data_3PSR
# 
_entry.id   3PSR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PSR         
WWPDB D_1000179118 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PSR 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brodersen, D.E.' 1 
'Nyborg, J.'      2 
'Kjeldgaard, M.'  3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
;
Biochemistry               38 1695 1704 1999 BICHAW US 0006-2960 0033 ? 10026247 10.1021/bi982483d 
1       'EF-Hands at Atomic Resolution: The Structure of Human Psoriasin (S100A7) Solved by MAD Phasing' Structure 6  477  ?    
1998 STRUE6 UK 0969-2126 2005 ? ?        ?                 
2       'Crystallization and Preliminary X-Ray Diffraction Studies of Psoriasin' 'Acta Crystallogr.,Sect.D' 53 119  ?    1997 
ABCRE6 DK 0907-4449 0766 ? ?        ?                 
3       
;Molecular Cloning, Occurrence, and Expression of a Novel Partially Secreted Protein "Psoriasin" that is Highly Up-Regulated in Psoriatic Skin
;
J.Invest.Dermatol.         97 701  ?    1991 JIDEAE US 0022-202X 2196 ? ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brodersen, D.E.'    1  
primary 'Nyborg, J.'         2  
primary 'Kjeldgaard, M.'     3  
1       'Brodersen, D.E.'    4  
1       'Etzerodt, M.'       5  
1       'Madsen, P.'         6  
1       'Celis, J.E.'        7  
1       'Thogersen, H.C.'    8  
1       'Nyborg, J.'         9  
1       'Kjeldgaard, M.'     10 
2       'Nolsoe, S.'         11 
2       'Thirup, S.'         12 
2       'Etzerodt, M.'       13 
2       'Thogersen, H.C.'    14 
2       'Nyborg, J.'         15 
3       'Madsen, P.'         16 
3       'Rasmussen, H.H.'    17 
3       'Leffers, H.'        18 
3       'Honore, B.'         19 
3       'Dejgaard, K.'       20 
3       'Olsen, E.'          21 
3       'Kiil, J.'           22 
3       'Walbum, E.'         23 
3       'Andersen, A.H.'     24 
3       'Basse, B.'          25 
3       'Lauridsen, J.B.'    26 
3       'Ratz, G.P.'         27 
3       'Celis, A.'          28 
3       'Vandekerckhove, J.' 29 
3       'Celis, J.E.'        30 
# 
_cell.entry_id           3PSR 
_cell.length_a           52.150 
_cell.length_b           56.670 
_cell.length_c           76.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3PSR 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man PSORIASIN     11343.784 2  ? ? ? 'CHAIN A IS CA2+ AND ZN2+ BOUND FORM, CHAIN B IS CA2+ BOUND FORM' 
2 non-polymer syn 'CALCIUM ION' 40.078    2  ? ? ? ?                                                                 
3 non-polymer syn 'ZINC ION'    65.409    1  ? ? ? ?                                                                 
4 water       nat water         18.015    70 ? ? ? ?                                                                 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        S100A7 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD
IATDYHKQSHGAAPCSGGSQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD
IATDYHKQSHGAAPCSGGSQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   THR n 
1 4   GLN n 
1 5   ALA n 
1 6   GLU n 
1 7   ARG n 
1 8   SER n 
1 9   ILE n 
1 10  ILE n 
1 11  GLY n 
1 12  MET n 
1 13  ILE n 
1 14  ASP n 
1 15  MET n 
1 16  PHE n 
1 17  HIS n 
1 18  LYS n 
1 19  TYR n 
1 20  THR n 
1 21  ARG n 
1 22  ARG n 
1 23  ASP n 
1 24  ASP n 
1 25  LYS n 
1 26  ILE n 
1 27  ASP n 
1 28  LYS n 
1 29  PRO n 
1 30  SER n 
1 31  LEU n 
1 32  LEU n 
1 33  THR n 
1 34  MET n 
1 35  MET n 
1 36  LYS n 
1 37  GLU n 
1 38  ASN n 
1 39  PHE n 
1 40  PRO n 
1 41  ASN n 
1 42  PHE n 
1 43  LEU n 
1 44  SER n 
1 45  ALA n 
1 46  CYS n 
1 47  ASP n 
1 48  LYS n 
1 49  LYS n 
1 50  GLY n 
1 51  THR n 
1 52  ASN n 
1 53  TYR n 
1 54  LEU n 
1 55  ALA n 
1 56  ASP n 
1 57  VAL n 
1 58  PHE n 
1 59  GLU n 
1 60  LYS n 
1 61  LYS n 
1 62  ASP n 
1 63  LYS n 
1 64  ASN n 
1 65  GLU n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  ILE n 
1 70  ASP n 
1 71  PHE n 
1 72  SER n 
1 73  GLU n 
1 74  PHE n 
1 75  LEU n 
1 76  SER n 
1 77  LEU n 
1 78  LEU n 
1 79  GLY n 
1 80  ASP n 
1 81  ILE n 
1 82  ALA n 
1 83  THR n 
1 84  ASP n 
1 85  TYR n 
1 86  HIS n 
1 87  LYS n 
1 88  GLN n 
1 89  SER n 
1 90  HIS n 
1 91  GLY n 
1 92  ALA n 
1 93  ALA n 
1 94  PRO n 
1 95  CYS n 
1 96  SER n 
1 97  GLY n 
1 98  GLY n 
1 99  SER n 
1 100 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 KERATINOCYTES 
_entity_src_gen.pdbx_gene_src_cellular_location    'CYTOPLASMIC, OR MAY BE SECRETED BY A NON-CLASSICAL SECRETORY PATHWAY' 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PT7H6FX-PS.4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A7_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P31151 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD
IATDYHKQSHGAAPCSGGSQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3PSR A 1 ? 100 ? P31151 1 ? 100 ? 1 100 
2 1 3PSR B 1 ? 100 ? P31151 1 ? 100 ? 1 100 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3PSR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3PSR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.3 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   8199 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.122 
_reflns.pdbx_netI_over_sigmaI        5.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.4 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.544 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3PSR 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     8172 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             100.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    52.0 
_refine.ls_R_factor_obs                          0.2199 
_refine.ls_R_factor_all                          0.223 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2953 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  415 
_refine.ls_number_parameters                     6450 
_refine.ls_number_restraints                     8061 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL. 91(1973) 201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1PSR 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3PSR 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      1610.3 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1538 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             70 
_refine_hist.number_atoms_total               1611 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        100.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.038 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.245 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.029 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.066 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    3PSR 
_pdbx_refine.R_factor_all_no_cutoff                      0.223 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2199 
_pdbx_refine.free_R_factor_no_cutoff                     0.2953 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.1 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            415 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1879 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1839 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2689 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.6 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          338 
_pdbx_refine.number_reflns_obs_4sig_cutoff               6343 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.159700 
_struct_ncs_oper.matrix[1][2]   0.931400 
_struct_ncs_oper.matrix[1][3]   0.327200 
_struct_ncs_oper.matrix[2][1]   0.926900 
_struct_ncs_oper.matrix[2][2]   -0.255600 
_struct_ncs_oper.matrix[2][3]   0.275000 
_struct_ncs_oper.matrix[3][1]   0.339700 
_struct_ncs_oper.matrix[3][2]   0.259300 
_struct_ncs_oper.matrix[3][3]   -0.904100 
_struct_ncs_oper.vector[1]      -17.58480 
_struct_ncs_oper.vector[2]      8.48140 
_struct_ncs_oper.vector[3]      38.33920 
# 
_struct.entry_id                  3PSR 
_struct.title                     'HUMAN PSORIASIN (S100A7) CA2+ BOUND FORM (CRYSTAL FORM I)' 
_struct.pdbx_descriptor           PSORIASIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PSR 
_struct_keywords.pdbx_keywords   'EF-HAND PROTEIN' 
_struct_keywords.text            'CA-BINDING, PSORIASIS, S100 PROTEIN FAMILY, EF-HAND PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A1    GLN A 4  ? LYS A 18 ? GLN A 4  LYS A 18 1 ? 15 
HELX_P HELX_P2  A2    LYS A 28 ? PHE A 39 ? LYS A 28 PHE A 39 1 ? 12 
HELX_P HELX_P3  "A2'" ASN A 41 ? LYS A 48 ? ASN A 41 LYS A 48 1 ? 8  
HELX_P HELX_P4  A3    TYR A 53 ? LYS A 61 ? TYR A 53 LYS A 61 1 ? 9  
HELX_P HELX_P5  A4    PHE A 71 ? HIS A 90 ? PHE A 71 HIS A 90 1 ? 20 
HELX_P HELX_P6  B1    GLN B 4  ? LYS B 18 ? GLN B 4  LYS B 18 1 ? 15 
HELX_P HELX_P7  B2    LYS B 28 ? PHE B 39 ? LYS B 28 PHE B 39 1 ? 12 
HELX_P HELX_P8  "B2'" ASN B 41 ? LYS B 48 ? ASN B 41 LYS B 48 1 ? 8  
HELX_P HELX_P9  B3    TYR B 53 ? LYS B 61 ? TYR B 53 LYS B 61 1 ? 9  
HELX_P HELX_P10 B4    PHE B 71 ? HIS B 90 ? PHE B 71 HIS B 90 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 95 SG  ? ? A CYS 46  A CYS 95  1_555 ? ? ? ? ? ? ? 1.885 ? 
disulf2  disulf ? ? B CYS 46 SG ? ? ? 1_555 B CYS 95 SG  ? ? B CYS 46  B CYS 95  1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc1  metalc ? ? C CA  .  CA ? ? ? 1_555 A ASP 62 OD1 ? ? A CA  102 A ASP 62  1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc2  metalc ? ? C CA  .  CA ? ? ? 1_555 A ASN 64 OD1 ? ? A CA  102 A ASN 64  1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc3  metalc ? ? C CA  .  CA ? ? ? 1_555 A ASP 66 OD1 ? ? A CA  102 A ASP 66  1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc4  metalc ? ? C CA  .  CA ? ? ? 1_555 A LYS 68 O   ? ? A CA  102 A LYS 68  1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc5  metalc ? ? C CA  .  CA ? ? ? 1_555 A GLU 73 OE1 ? ? A CA  102 A GLU 73  1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc6  metalc ? ? C CA  .  CA ? ? ? 1_555 A GLU 73 OE2 ? ? A CA  102 A GLU 73  1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc7  metalc ? ? C CA  .  CA ? ? ? 1_555 F HOH .  O   ? ? A CA  102 A HOH 269 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc8  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A HIS 17 NE2 ? ? A ZN  103 A HIS 17  1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc9  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A ASP 24 OD1 ? ? A ZN  103 A ASP 24  1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc10 metalc ? ? D ZN  .  ZN ? ? ? 1_555 A ASP 24 OD2 ? ? A ZN  103 A ASP 24  1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc11 metalc ? ? D ZN  .  ZN ? ? ? 1_555 B HIS 86 NE2 ? ? A ZN  103 B HIS 86  1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc12 metalc ? ? D ZN  .  ZN ? ? ? 1_555 B HIS 90 NE2 ? ? A ZN  103 B HIS 90  1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc13 metalc ? ? E CA  .  CA ? ? ? 1_555 B ASP 62 OD1 ? ? B CA  102 B ASP 62  1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc14 metalc ? ? E CA  .  CA ? ? ? 1_555 B ASN 64 OD1 ? ? B CA  102 B ASN 64  1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc15 metalc ? ? E CA  .  CA ? ? ? 1_555 B ASP 66 OD1 ? ? B CA  102 B ASP 66  1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc16 metalc ? ? E CA  .  CA ? ? ? 1_555 B LYS 68 O   ? ? B CA  102 B LYS 68  1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc17 metalc ? ? E CA  .  CA ? ? ? 1_555 B GLU 73 OE1 ? ? B CA  102 B GLU 73  1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc18 metalc ? ? E CA  .  CA ? ? ? 1_555 B GLU 73 OE2 ? ? B CA  102 B GLU 73  1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc19 metalc ? ? E CA  .  CA ? ? ? 1_555 G HOH .  O   ? ? B CA  102 B HOH 270 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc20 metalc ? ? C CA  .  CA ? ? ? 1_555 A ASP 66 OD2 ? ? A CA  102 A ASP 66  1_555 ? ? ? ? ? ? ? 3.304 ? 
metalc21 metalc ? ? E CA  .  CA ? ? ? 1_555 B ASP 66 OD2 ? ? B CA  102 B ASP 66  1_555 ? ? ? ? ? ? ? 3.281 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAA Unknown  ? ? ? ? 5 'REGULATORY CA2+ BINDING SITE'      
CAB Unknown  ? ? ? ? 5 'REGULATORY CA2+ BINDING SITE'      
ZNA Unknown  ? ? ? ? 4 'ZN2+ BINDING SITE'                 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 102' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 103' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  CAA 5 ASP A 62 ? ASP A 62  . ? 1_555 ? 
2  CAA 5 ASN A 64 ? ASN A 64  . ? 1_555 ? 
3  CAA 5 ASP A 66 ? ASP A 66  . ? 1_555 ? 
4  CAA 5 LYS A 68 ? LYS A 68  . ? 1_555 ? 
5  CAA 5 GLU A 73 ? GLU A 73  . ? 1_555 ? 
6  CAB 5 ASP B 62 ? ASP B 62  . ? 1_555 ? 
7  CAB 5 ASN B 64 ? ASN B 64  . ? 1_555 ? 
8  CAB 5 ASP B 66 ? ASP B 66  . ? 1_555 ? 
9  CAB 5 LYS A 68 ? LYS A 68  . ? 1_555 ? 
10 CAB 5 GLU B 73 ? GLU B 73  . ? 1_555 ? 
11 ZNA 4 HIS A 17 ? HIS A 17  . ? 1_555 ? 
12 ZNA 4 ASP A 24 ? ASP A 24  . ? 1_555 ? 
13 ZNA 4 HIS B 86 ? HIS B 86  . ? 1_555 ? 
14 ZNA 4 HIS B 90 ? HIS B 90  . ? 1_555 ? 
15 AC1 6 ASP A 62 ? ASP A 62  . ? 1_555 ? 
16 AC1 6 ASN A 64 ? ASN A 64  . ? 1_555 ? 
17 AC1 6 ASP A 66 ? ASP A 66  . ? 1_555 ? 
18 AC1 6 LYS A 68 ? LYS A 68  . ? 1_555 ? 
19 AC1 6 GLU A 73 ? GLU A 73  . ? 1_555 ? 
20 AC1 6 HOH F .  ? HOH A 269 . ? 1_555 ? 
21 AC2 4 HIS A 17 ? HIS A 17  . ? 1_555 ? 
22 AC2 4 ASP A 24 ? ASP A 24  . ? 1_555 ? 
23 AC2 4 HIS B 86 ? HIS B 86  . ? 1_555 ? 
24 AC2 4 HIS B 90 ? HIS B 90  . ? 1_555 ? 
25 AC3 6 ASP B 62 ? ASP B 62  . ? 1_555 ? 
26 AC3 6 ASN B 64 ? ASN B 64  . ? 1_555 ? 
27 AC3 6 ASP B 66 ? ASP B 66  . ? 1_555 ? 
28 AC3 6 LYS B 68 ? LYS B 68  . ? 1_555 ? 
29 AC3 6 GLU B 73 ? GLU B 73  . ? 1_555 ? 
30 AC3 6 HOH G .  ? HOH B 270 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3PSR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PSR 
_atom_sites.fract_transf_matrix[1][1]   0.019175 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017646 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013092 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1  ? 31.680 20.681 19.295 1.00 108.46 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1  ? 30.691 21.333 20.143 1.00 92.41  ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1  ? 29.289 21.201 19.548 1.00 83.71  ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1  ? 29.120 21.068 18.336 1.00 76.23  ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1  ? 31.029 22.810 20.349 1.00 95.96  ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1  ? 30.676 23.258 21.647 1.00 101.53 ? 1   SER A OG  1 
ATOM   7    N  N   . ASN A 1 2  ? 28.309 21.244 20.437 1.00 75.61  ? 2   ASN A N   1 
ATOM   8    C  CA  . ASN A 1 2  ? 26.896 21.173 20.123 1.00 68.67  ? 2   ASN A CA  1 
ATOM   9    C  C   . ASN A 1 2  ? 26.256 22.559 20.114 1.00 63.14  ? 2   ASN A C   1 
ATOM   10   O  O   . ASN A 1 2  ? 26.633 23.441 20.882 1.00 70.76  ? 2   ASN A O   1 
ATOM   11   C  CB  . ASN A 1 2  ? 26.185 20.273 21.140 1.00 68.74  ? 2   ASN A CB  1 
ATOM   12   C  CG  . ASN A 1 2  ? 25.936 18.870 20.621 1.00 72.78  ? 2   ASN A CG  1 
ATOM   13   O  OD1 . ASN A 1 2  ? 25.550 18.663 19.466 1.00 80.00  ? 2   ASN A OD1 1 
ATOM   14   N  ND2 . ASN A 1 2  ? 26.144 17.872 21.477 1.00 71.98  ? 2   ASN A ND2 1 
ATOM   15   N  N   . THR A 1 3  ? 25.278 22.723 19.233 1.00 56.06  ? 3   THR A N   1 
ATOM   16   C  CA  . THR A 1 3  ? 24.554 23.977 19.092 1.00 52.64  ? 3   THR A CA  1 
ATOM   17   C  C   . THR A 1 3  ? 23.813 24.337 20.371 1.00 48.33  ? 3   THR A C   1 
ATOM   18   O  O   . THR A 1 3  ? 23.692 23.510 21.278 1.00 49.77  ? 3   THR A O   1 
ATOM   19   C  CB  . THR A 1 3  ? 23.549 23.883 17.927 1.00 52.79  ? 3   THR A CB  1 
ATOM   20   O  OG1 . THR A 1 3  ? 22.462 23.026 18.300 1.00 50.86  ? 3   THR A OG1 1 
ATOM   21   C  CG2 . THR A 1 3  ? 24.200 23.248 16.704 1.00 41.44  ? 3   THR A CG2 1 
ATOM   22   N  N   . GLN A 1 4  ? 23.308 25.564 20.459 1.00 45.40  ? 4   GLN A N   1 
ATOM   23   C  CA  . GLN A 1 4  ? 22.506 25.905 21.634 1.00 49.34  ? 4   GLN A CA  1 
ATOM   24   C  C   . GLN A 1 4  ? 21.304 24.971 21.728 1.00 46.01  ? 4   GLN A C   1 
ATOM   25   O  O   . GLN A 1 4  ? 20.977 24.435 22.786 1.00 44.51  ? 4   GLN A O   1 
ATOM   26   C  CB  . GLN A 1 4  ? 22.048 27.359 21.580 1.00 63.99  ? 4   GLN A CB  1 
ATOM   27   C  CG  . GLN A 1 4  ? 22.191 28.115 22.888 1.00 85.68  ? 4   GLN A CG  1 
ATOM   28   C  CD  . GLN A 1 4  ? 20.901 28.186 23.685 1.00 104.52 ? 4   GLN A CD  1 
ATOM   29   O  OE1 . GLN A 1 4  ? 19.952 28.866 23.292 1.00 129.59 ? 4   GLN A OE1 1 
ATOM   30   N  NE2 . GLN A 1 4  ? 20.859 27.479 24.812 1.00 117.96 ? 4   GLN A NE2 1 
ATOM   31   N  N   . ALA A 1 5  ? 20.638 24.770 20.596 1.00 42.47  ? 5   ALA A N   1 
ATOM   32   C  CA  . ALA A 1 5  ? 19.445 23.932 20.530 1.00 40.17  ? 5   ALA A CA  1 
ATOM   33   C  C   . ALA A 1 5  ? 19.702 22.560 21.142 1.00 43.12  ? 5   ALA A C   1 
ATOM   34   O  O   . ALA A 1 5  ? 18.994 22.105 22.037 1.00 51.33  ? 5   ALA A O   1 
ATOM   35   C  CB  . ALA A 1 5  ? 18.968 23.786 19.090 1.00 36.14  ? 5   ALA A CB  1 
ATOM   36   N  N   . GLU A 1 6  ? 20.749 21.911 20.640 1.00 39.60  ? 6   GLU A N   1 
ATOM   37   C  CA  . GLU A 1 6  ? 21.167 20.627 21.188 1.00 43.36  ? 6   GLU A CA  1 
ATOM   38   C  C   . GLU A 1 6  ? 21.439 20.750 22.683 1.00 46.21  ? 6   GLU A C   1 
ATOM   39   O  O   . GLU A 1 6  ? 21.002 19.939 23.497 1.00 42.94  ? 6   GLU A O   1 
ATOM   40   C  CB  . GLU A 1 6  ? 22.405 20.128 20.441 1.00 44.45  ? 6   GLU A CB  1 
ATOM   41   C  CG  . GLU A 1 6  ? 22.101 19.591 19.046 1.00 48.91  ? 6   GLU A CG  1 
ATOM   42   C  CD  . GLU A 1 6  ? 23.306 19.672 18.128 1.00 53.89  ? 6   GLU A CD  1 
ATOM   43   O  OE1 . GLU A 1 6  ? 24.090 20.633 18.305 1.00 53.65  ? 6   GLU A OE1 1 
ATOM   44   O  OE2 . GLU A 1 6  ? 23.465 18.794 17.251 1.00 50.15  ? 6   GLU A OE2 1 
ATOM   45   N  N   . ARG A 1 7  ? 22.172 21.797 23.059 1.00 44.61  ? 7   ARG A N   1 
ATOM   46   C  CA  . ARG A 1 7  ? 22.459 22.004 24.474 1.00 47.67  ? 7   ARG A CA  1 
ATOM   47   C  C   . ARG A 1 7  ? 21.158 22.103 25.262 1.00 47.99  ? 7   ARG A C   1 
ATOM   48   O  O   . ARG A 1 7  ? 20.984 21.528 26.332 1.00 48.95  ? 7   ARG A O   1 
ATOM   49   C  CB  . ARG A 1 7  ? 23.301 23.264 24.673 1.00 51.66  ? 7   ARG A CB  1 
ATOM   50   C  CG  . ARG A 1 7  ? 24.763 23.098 24.297 1.00 63.32  ? 7   ARG A CG  1 
ATOM   51   C  CD  . ARG A 1 7  ? 25.575 24.340 24.636 1.00 77.41  ? 7   ARG A CD  1 
ATOM   52   N  NE  . ARG A 1 7  ? 25.752 25.203 23.471 1.00 89.07  ? 7   ARG A NE  1 
ATOM   53   C  CZ  . ARG A 1 7  ? 25.367 26.470 23.394 1.00 97.41  ? 7   ARG A CZ  1 
ATOM   54   N  NH1 . ARG A 1 7  ? 24.771 27.053 24.425 1.00 100.93 ? 7   ARG A NH1 1 
ATOM   55   N  NH2 . ARG A 1 7  ? 25.578 27.164 22.283 1.00 111.61 ? 7   ARG A NH2 1 
ATOM   56   N  N   . SER A 1 8  ? 20.232 22.868 24.685 1.00 45.68  ? 8   SER A N   1 
ATOM   57   C  CA  . SER A 1 8  ? 18.982 23.136 25.379 1.00 37.80  ? 8   SER A CA  1 
ATOM   58   C  C   . SER A 1 8  ? 18.224 21.856 25.680 1.00 41.13  ? 8   SER A C   1 
ATOM   59   O  O   . SER A 1 8  ? 17.645 21.686 26.749 1.00 51.99  ? 8   SER A O   1 
ATOM   60   C  CB  . SER A 1 8  ? 18.121 24.072 24.529 1.00 36.02  ? 8   SER A CB  1 
ATOM   61   O  OG  . SER A 1 8  ? 17.086 24.601 25.335 1.00 56.36  ? 8   SER A OG  1 
ATOM   62   N  N   . ILE A 1 9  ? 18.236 20.934 24.724 1.00 36.98  ? 9   ILE A N   1 
ATOM   63   C  CA  . ILE A 1 9  ? 17.541 19.665 24.862 1.00 36.07  ? 9   ILE A CA  1 
ATOM   64   C  C   . ILE A 1 9  ? 18.218 18.775 25.896 1.00 41.71  ? 9   ILE A C   1 
ATOM   65   O  O   . ILE A 1 9  ? 17.573 18.161 26.749 1.00 47.63  ? 9   ILE A O   1 
ATOM   66   C  CB  . ILE A 1 9  ? 17.491 18.915 23.520 1.00 42.11  ? 9   ILE A CB  1 
ATOM   67   C  CG1 . ILE A 1 9  ? 16.464 19.448 22.520 1.00 42.76  ? 9   ILE A CG1 1 
ATOM   68   C  CG2 . ILE A 1 9  ? 17.272 17.427 23.757 1.00 49.90  ? 9   ILE A CG2 1 
ATOM   69   C  CD1 . ILE A 1 9  ? 15.904 18.362 21.627 1.00 61.13  ? 9   ILE A CD1 1 
ATOM   70   N  N   . ILE A 1 10 ? 19.545 18.693 25.828 1.00 41.63  ? 10  ILE A N   1 
ATOM   71   C  CA  . ILE A 1 10 ? 20.294 17.941 26.832 1.00 47.76  ? 10  ILE A CA  1 
ATOM   72   C  C   . ILE A 1 10 ? 20.005 18.472 28.232 1.00 45.79  ? 10  ILE A C   1 
ATOM   73   O  O   . ILE A 1 10 ? 19.916 17.706 29.193 1.00 45.73  ? 10  ILE A O   1 
ATOM   74   C  CB  . ILE A 1 10 ? 21.808 17.999 26.558 1.00 51.18  ? 10  ILE A CB  1 
ATOM   75   C  CG1 . ILE A 1 10 ? 22.264 17.075 25.423 1.00 51.37  ? 10  ILE A CG1 1 
ATOM   76   C  CG2 . ILE A 1 10 ? 22.615 17.722 27.813 1.00 47.30  ? 10  ILE A CG2 1 
ATOM   77   C  CD1 . ILE A 1 10 ? 23.251 17.735 24.479 1.00 50.30  ? 10  ILE A CD1 1 
ATOM   78   N  N   . GLY A 1 11 ? 19.849 19.790 28.348 1.00 43.10  ? 11  GLY A N   1 
ATOM   79   C  CA  . GLY A 1 11 ? 19.515 20.399 29.624 1.00 41.77  ? 11  GLY A CA  1 
ATOM   80   C  C   . GLY A 1 11 ? 18.293 19.758 30.258 1.00 46.68  ? 11  GLY A C   1 
ATOM   81   O  O   . GLY A 1 11 ? 18.271 19.499 31.460 1.00 51.79  ? 11  GLY A O   1 
ATOM   82   N  N   . MET A 1 12 ? 17.266 19.499 29.449 1.00 46.89  ? 12  MET A N   1 
ATOM   83   C  CA  . MET A 1 12 ? 16.004 18.993 29.981 1.00 47.79  ? 12  MET A CA  1 
ATOM   84   C  C   . MET A 1 12 ? 16.204 17.586 30.530 1.00 45.34  ? 12  MET A C   1 
ATOM   85   O  O   . MET A 1 12 ? 15.644 17.216 31.557 1.00 51.58  ? 12  MET A O   1 
ATOM   86   C  CB  . MET A 1 12 ? 14.883 19.003 28.944 1.00 50.68  ? 12  MET A CB  1 
ATOM   87   C  CG  . MET A 1 12 ? 14.798 20.204 28.026 1.00 56.77  ? 12  MET A CG  1 
ATOM   88   S  SD  . MET A 1 12 ? 13.500 21.390 28.424 1.00 157.91 ? 12  MET A SD  1 
ATOM   89   C  CE  . MET A 1 12 ? 14.158 22.110 29.930 1.00 61.37  ? 12  MET A CE  1 
ATOM   90   N  N   . ILE A 1 13 ? 17.020 16.815 29.825 1.00 43.91  ? 13  ILE A N   1 
ATOM   91   C  CA  . ILE A 1 13 ? 17.368 15.477 30.293 1.00 44.02  ? 13  ILE A CA  1 
ATOM   92   C  C   . ILE A 1 13 ? 18.182 15.569 31.576 1.00 46.73  ? 13  ILE A C   1 
ATOM   93   O  O   . ILE A 1 13 ? 18.007 14.781 32.506 1.00 52.70  ? 13  ILE A O   1 
ATOM   94   C  CB  . ILE A 1 13 ? 18.156 14.726 29.210 1.00 44.06  ? 13  ILE A CB  1 
ATOM   95   C  CG1 . ILE A 1 13 ? 17.271 14.323 28.021 1.00 41.69  ? 13  ILE A CG1 1 
ATOM   96   C  CG2 . ILE A 1 13 ? 18.895 13.511 29.741 1.00 42.92  ? 13  ILE A CG2 1 
ATOM   97   C  CD1 . ILE A 1 13 ? 18.113 13.907 26.842 1.00 55.60  ? 13  ILE A CD1 1 
ATOM   98   N  N   . ASP A 1 14 ? 19.077 16.558 31.617 1.00 42.42  ? 14  ASP A N   1 
ATOM   99   C  CA  . ASP A 1 14 ? 19.865 16.754 32.834 1.00 42.83  ? 14  ASP A CA  1 
ATOM   100  C  C   . ASP A 1 14 ? 18.940 17.150 33.974 1.00 41.88  ? 14  ASP A C   1 
ATOM   101  O  O   . ASP A 1 14 ? 19.037 16.616 35.077 1.00 44.40  ? 14  ASP A O   1 
ATOM   102  C  CB  . ASP A 1 14 ? 20.956 17.795 32.598 1.00 48.55  ? 14  ASP A CB  1 
ATOM   103  C  CG  . ASP A 1 14 ? 22.032 17.213 31.691 1.00 56.25  ? 14  ASP A CG  1 
ATOM   104  O  OD1 . ASP A 1 14 ? 22.046 15.972 31.561 1.00 50.89  ? 14  ASP A OD1 1 
ATOM   105  O  OD2 . ASP A 1 14 ? 22.831 17.979 31.123 1.00 70.59  ? 14  ASP A OD2 1 
ATOM   106  N  N   . MET A 1 15 ? 18.033 18.078 33.677 1.00 38.70  ? 15  MET A N   1 
ATOM   107  C  CA  . MET A 1 15 ? 17.033 18.466 34.667 1.00 39.66  ? 15  MET A CA  1 
ATOM   108  C  C   . MET A 1 15 ? 16.271 17.245 35.171 1.00 40.85  ? 15  MET A C   1 
ATOM   109  O  O   . MET A 1 15 ? 16.122 17.044 36.376 1.00 49.38  ? 15  MET A O   1 
ATOM   110  C  CB  . MET A 1 15 ? 16.058 19.478 34.077 1.00 39.90  ? 15  MET A CB  1 
ATOM   111  C  CG  . MET A 1 15 ? 15.018 19.960 35.079 1.00 42.05  ? 15  MET A CG  1 
ATOM   112  S  SD  . MET A 1 15 ? 14.048 21.339 34.436 1.00 53.23  ? 15  MET A SD  1 
ATOM   113  C  CE  . MET A 1 15 ? 12.862 20.434 33.434 1.00 49.22  ? 15  MET A CE  1 
ATOM   114  N  N   . PHE A 1 16 ? 15.797 16.432 34.234 1.00 38.08  ? 16  PHE A N   1 
ATOM   115  C  CA  . PHE A 1 16 ? 15.079 15.207 34.572 1.00 40.67  ? 16  PHE A CA  1 
ATOM   116  C  C   . PHE A 1 16 ? 15.857 14.371 35.587 1.00 42.93  ? 16  PHE A C   1 
ATOM   117  O  O   . PHE A 1 16 ? 15.334 13.996 36.638 1.00 42.99  ? 16  PHE A O   1 
ATOM   118  C  CB  . PHE A 1 16 ? 14.807 14.397 33.305 1.00 36.82  ? 16  PHE A CB  1 
ATOM   119  C  CG  . PHE A 1 16 ? 14.017 13.118 33.520 1.00 35.65  ? 16  PHE A CG  1 
ATOM   120  C  CD1 . PHE A 1 16 ? 12.670 13.155 33.833 1.00 33.06  ? 16  PHE A CD1 1 
ATOM   121  C  CD2 . PHE A 1 16 ? 14.627 11.880 33.400 1.00 34.82  ? 16  PHE A CD2 1 
ATOM   122  C  CE1 . PHE A 1 16 ? 11.941 11.997 34.022 1.00 30.07  ? 16  PHE A CE1 1 
ATOM   123  C  CE2 . PHE A 1 16 ? 13.910 10.713 33.598 1.00 31.66  ? 16  PHE A CE2 1 
ATOM   124  C  CZ  . PHE A 1 16 ? 12.566 10.769 33.915 1.00 31.43  ? 16  PHE A CZ  1 
ATOM   125  N  N   . HIS A 1 17 ? 17.110 14.096 35.240 1.00 42.65  ? 17  HIS A N   1 
ATOM   126  C  CA  . HIS A 1 17 ? 17.991 13.252 36.035 1.00 42.72  ? 17  HIS A CA  1 
ATOM   127  C  C   . HIS A 1 17 ? 18.375 13.888 37.361 1.00 42.91  ? 17  HIS A C   1 
ATOM   128  O  O   . HIS A 1 17 ? 18.994 13.254 38.214 1.00 51.59  ? 17  HIS A O   1 
ATOM   129  C  CB  . HIS A 1 17 ? 19.252 12.908 35.228 1.00 36.80  ? 17  HIS A CB  1 
ATOM   130  C  CG  . HIS A 1 17 ? 18.980 11.798 34.256 1.00 39.70  ? 17  HIS A CG  1 
ATOM   131  N  ND1 . HIS A 1 17 ? 19.708 11.606 33.109 1.00 42.99  ? 17  HIS A ND1 1 
ATOM   132  C  CD2 . HIS A 1 17 ? 18.043 10.823 34.271 1.00 44.48  ? 17  HIS A CD2 1 
ATOM   133  C  CE1 . HIS A 1 17 ? 19.238 10.559 32.457 1.00 47.72  ? 17  HIS A CE1 1 
ATOM   134  N  NE2 . HIS A 1 17 ? 18.223 10.064 33.144 1.00 47.38  ? 17  HIS A NE2 1 
ATOM   135  N  N   . LYS A 1 18 ? 18.005 15.152 37.547 1.00 40.69  ? 18  LYS A N   1 
ATOM   136  C  CA  . LYS A 1 18 ? 18.229 15.761 38.855 1.00 44.90  ? 18  LYS A CA  1 
ATOM   137  C  C   . LYS A 1 18 ? 17.149 15.286 39.816 1.00 45.18  ? 18  LYS A C   1 
ATOM   138  O  O   . LYS A 1 18 ? 17.315 15.292 41.035 1.00 51.28  ? 18  LYS A O   1 
ATOM   139  C  CB  . LYS A 1 18 ? 18.243 17.285 38.773 1.00 43.08  ? 18  LYS A CB  1 
ATOM   140  C  CG  . LYS A 1 18 ? 19.562 17.888 38.324 1.00 41.95  ? 18  LYS A CG  1 
ATOM   141  C  CD  . LYS A 1 18 ? 19.459 19.400 38.199 1.00 45.23  ? 18  LYS A CD  1 
ATOM   142  C  CE  . LYS A 1 18 ? 20.639 19.978 37.432 1.00 49.63  ? 18  LYS A CE  1 
ATOM   143  N  NZ  . LYS A 1 18 ? 20.628 21.467 37.405 1.00 53.10  ? 18  LYS A NZ  1 
ATOM   144  N  N   . TYR A 1 19 ? 15.993 14.858 39.304 1.00 40.41  ? 19  TYR A N   1 
ATOM   145  C  CA  . TYR A 1 19 ? 14.923 14.549 40.253 1.00 36.15  ? 19  TYR A CA  1 
ATOM   146  C  C   . TYR A 1 19 ? 14.482 13.100 40.197 1.00 44.16  ? 19  TYR A C   1 
ATOM   147  O  O   . TYR A 1 19 ? 13.517 12.701 40.856 1.00 50.68  ? 19  TYR A O   1 
ATOM   148  C  CB  . TYR A 1 19 ? 13.728 15.459 39.971 1.00 27.27  ? 19  TYR A CB  1 
ATOM   149  C  CG  . TYR A 1 19 ? 14.027 16.932 40.099 1.00 32.13  ? 19  TYR A CG  1 
ATOM   150  C  CD1 . TYR A 1 19 ? 14.528 17.655 39.022 1.00 30.22  ? 19  TYR A CD1 1 
ATOM   151  C  CD2 . TYR A 1 19 ? 13.802 17.598 41.300 1.00 31.09  ? 19  TYR A CD2 1 
ATOM   152  C  CE1 . TYR A 1 19 ? 14.795 19.005 39.157 1.00 30.39  ? 19  TYR A CE1 1 
ATOM   153  C  CE2 . TYR A 1 19 ? 14.063 18.948 41.443 1.00 24.65  ? 19  TYR A CE2 1 
ATOM   154  C  CZ  . TYR A 1 19 ? 14.560 19.638 40.360 1.00 30.81  ? 19  TYR A CZ  1 
ATOM   155  O  OH  . TYR A 1 19 ? 14.828 20.981 40.484 1.00 45.67  ? 19  TYR A OH  1 
ATOM   156  N  N   . THR A 1 20 ? 15.162 12.271 39.405 1.00 41.21  ? 20  THR A N   1 
ATOM   157  C  CA  . THR A 1 20 ? 14.682 10.892 39.332 1.00 43.55  ? 20  THR A CA  1 
ATOM   158  C  C   . THR A 1 20 ? 15.182 10.043 40.495 1.00 47.04  ? 20  THR A C   1 
ATOM   159  O  O   . THR A 1 20 ? 16.143 10.405 41.161 1.00 39.46  ? 20  THR A O   1 
ATOM   160  C  CB  . THR A 1 20 ? 15.113 10.222 38.014 1.00 42.44  ? 20  THR A CB  1 
ATOM   161  O  OG1 . THR A 1 20 ? 16.526 10.389 37.863 1.00 53.05  ? 20  THR A OG1 1 
ATOM   162  C  CG2 . THR A 1 20 ? 14.423 10.911 36.849 1.00 38.47  ? 20  THR A CG2 1 
ATOM   163  N  N   . ARG A 1 21 ? 14.508 8.923  40.712 1.00 50.67  ? 21  ARG A N   1 
ATOM   164  C  CA  . ARG A 1 21 ? 14.882 7.907  41.678 1.00 47.53  ? 21  ARG A CA  1 
ATOM   165  C  C   . ARG A 1 21 ? 15.739 6.856  40.975 1.00 51.49  ? 21  ARG A C   1 
ATOM   166  O  O   . ARG A 1 21 ? 16.103 7.039  39.812 1.00 47.96  ? 21  ARG A O   1 
ATOM   167  C  CB  . ARG A 1 21 ? 13.658 7.259  42.317 1.00 49.89  ? 21  ARG A CB  1 
ATOM   168  C  CG  . ARG A 1 21 ? 12.878 8.186  43.235 1.00 62.19  ? 21  ARG A CG  1 
ATOM   169  C  CD  . ARG A 1 21 ? 13.816 8.942  44.165 1.00 74.67  ? 21  ARG A CD  1 
ATOM   170  N  NE  . ARG A 1 21 ? 13.622 8.566  45.560 1.00 87.51  ? 21  ARG A NE  1 
ATOM   171  C  CZ  . ARG A 1 21 ? 13.013 9.306  46.477 1.00 94.27  ? 21  ARG A CZ  1 
ATOM   172  N  NH1 . ARG A 1 21 ? 12.515 10.499 46.174 1.00 77.81  ? 21  ARG A NH1 1 
ATOM   173  N  NH2 . ARG A 1 21 ? 12.900 8.846  47.719 1.00 109.67 ? 21  ARG A NH2 1 
ATOM   174  N  N   . ARG A 1 22 ? 16.051 5.777  41.682 1.00 53.28  ? 22  ARG A N   1 
ATOM   175  C  CA  . ARG A 1 22 ? 16.904 4.741  41.116 1.00 59.63  ? 22  ARG A CA  1 
ATOM   176  C  C   . ARG A 1 22 ? 16.339 4.251  39.790 1.00 54.42  ? 22  ARG A C   1 
ATOM   177  O  O   . ARG A 1 22 ? 17.076 3.903  38.873 1.00 56.53  ? 22  ARG A O   1 
ATOM   178  C  CB  . ARG A 1 22 ? 17.056 3.571  42.089 1.00 80.51  ? 22  ARG A CB  1 
ATOM   179  C  CG  . ARG A 1 22 ? 17.614 3.939  43.454 1.00 97.07  ? 22  ARG A CG  1 
ATOM   180  C  CD  . ARG A 1 22 ? 18.661 2.934  43.914 1.00 109.30 ? 22  ARG A CD  1 
ATOM   181  N  NE  . ARG A 1 22 ? 18.447 2.483  45.285 1.00 119.85 ? 22  ARG A NE  1 
ATOM   182  C  CZ  . ARG A 1 22 ? 17.791 1.383  45.632 1.00 125.85 ? 22  ARG A CZ  1 
ATOM   183  N  NH1 . ARG A 1 22 ? 17.266 0.594  44.703 1.00 130.02 ? 22  ARG A NH1 1 
ATOM   184  N  NH2 . ARG A 1 22 ? 17.656 1.063  46.915 1.00 133.77 ? 22  ARG A NH2 1 
ATOM   185  N  N   . ASP A 1 23 ? 15.014 4.226  39.696 1.00 52.05  ? 23  ASP A N   1 
ATOM   186  C  CA  . ASP A 1 23 ? 14.360 3.642  38.532 1.00 52.32  ? 23  ASP A CA  1 
ATOM   187  C  C   . ASP A 1 23 ? 14.282 4.566  37.327 1.00 47.32  ? 23  ASP A C   1 
ATOM   188  O  O   . ASP A 1 23 ? 13.614 4.232  36.343 1.00 48.13  ? 23  ASP A O   1 
ATOM   189  C  CB  . ASP A 1 23 ? 12.945 3.211  38.942 1.00 57.75  ? 23  ASP A CB  1 
ATOM   190  C  CG  . ASP A 1 23 ? 12.126 4.377  39.464 1.00 59.32  ? 23  ASP A CG  1 
ATOM   191  O  OD1 . ASP A 1 23 ? 12.631 5.518  39.456 1.00 53.13  ? 23  ASP A OD1 1 
ATOM   192  O  OD2 . ASP A 1 23 ? 10.974 4.133  39.876 1.00 72.63  ? 23  ASP A OD2 1 
ATOM   193  N  N   . ASP A 1 24 ? 14.936 5.719  37.363 1.00 44.84  ? 24  ASP A N   1 
ATOM   194  C  CA  . ASP A 1 24 ? 14.859 6.663  36.252 1.00 46.91  ? 24  ASP A CA  1 
ATOM   195  C  C   . ASP A 1 24 ? 13.457 7.257  36.122 1.00 54.06  ? 24  ASP A C   1 
ATOM   196  O  O   . ASP A 1 24 ? 13.064 7.732  35.055 1.00 53.99  ? 24  ASP A O   1 
ATOM   197  C  CB  . ASP A 1 24 ? 15.273 5.993  34.939 1.00 39.68  ? 24  ASP A CB  1 
ATOM   198  C  CG  . ASP A 1 24 ? 15.957 6.973  34.000 1.00 42.17  ? 24  ASP A CG  1 
ATOM   199  O  OD1 . ASP A 1 24 ? 16.479 7.989  34.519 1.00 45.20  ? 24  ASP A OD1 1 
ATOM   200  O  OD2 . ASP A 1 24 ? 15.615 6.965  32.795 1.00 40.16  ? 24  ASP A OD2 1 
ATOM   201  N  N   . LYS A 1 25 ? 12.702 7.232  37.216 1.00 52.41  ? 25  LYS A N   1 
ATOM   202  C  CA  . LYS A 1 25 ? 11.353 7.782  37.263 1.00 46.49  ? 25  LYS A CA  1 
ATOM   203  C  C   . LYS A 1 25 ? 11.241 8.789  38.403 1.00 45.62  ? 25  LYS A C   1 
ATOM   204  O  O   . LYS A 1 25 ? 11.993 8.685  39.374 1.00 50.82  ? 25  LYS A O   1 
ATOM   205  C  CB  . LYS A 1 25 ? 10.305 6.680  37.430 1.00 47.79  ? 25  LYS A CB  1 
ATOM   206  C  CG  . LYS A 1 25 ? 10.579 5.415  36.637 1.00 46.66  ? 25  LYS A CG  1 
ATOM   207  C  CD  . LYS A 1 25 ? 9.333  4.853  35.983 1.00 44.28  ? 25  LYS A CD  1 
ATOM   208  C  CE  . LYS A 1 25 ? 9.572  3.469  35.398 1.00 48.82  ? 25  LYS A CE  1 
ATOM   209  N  NZ  . LYS A 1 25 ? 9.385  2.385  36.405 1.00 62.50  ? 25  LYS A NZ  1 
ATOM   210  N  N   . ILE A 1 26 ? 10.327 9.745  38.298 1.00 43.86  ? 26  ILE A N   1 
ATOM   211  C  CA  . ILE A 1 26 ? 10.181 10.781 39.318 1.00 42.58  ? 26  ILE A CA  1 
ATOM   212  C  C   . ILE A 1 26 ? 8.943  10.562 40.171 1.00 45.53  ? 26  ILE A C   1 
ATOM   213  O  O   . ILE A 1 26 ? 7.838  10.428 39.643 1.00 48.69  ? 26  ILE A O   1 
ATOM   214  C  CB  . ILE A 1 26 ? 10.109 12.171 38.660 1.00 40.80  ? 26  ILE A CB  1 
ATOM   215  C  CG1 . ILE A 1 26 ? 11.360 12.533 37.855 1.00 41.57  ? 26  ILE A CG1 1 
ATOM   216  C  CG2 . ILE A 1 26 ? 9.801  13.252 39.682 1.00 33.24  ? 26  ILE A CG2 1 
ATOM   217  C  CD1 . ILE A 1 26 ? 11.203 13.784 37.022 1.00 32.19  ? 26  ILE A CD1 1 
ATOM   218  N  N   . ASP A 1 27 ? 9.098  10.525 41.494 1.00 44.01  ? 27  ASP A N   1 
ATOM   219  C  CA  . ASP A 1 27 ? 7.910  10.343 42.336 1.00 40.48  ? 27  ASP A CA  1 
ATOM   220  C  C   . ASP A 1 27 ? 7.178  11.670 42.508 1.00 38.49  ? 27  ASP A C   1 
ATOM   221  O  O   . ASP A 1 27 ? 7.669  12.733 42.119 1.00 36.78  ? 27  ASP A O   1 
ATOM   222  C  CB  . ASP A 1 27 ? 8.261  9.731  43.682 1.00 41.97  ? 27  ASP A CB  1 
ATOM   223  C  CG  . ASP A 1 27 ? 9.198  10.544 44.541 1.00 44.89  ? 27  ASP A CG  1 
ATOM   224  O  OD1 . ASP A 1 27 ? 9.171  11.790 44.497 1.00 43.81  ? 27  ASP A OD1 1 
ATOM   225  O  OD2 . ASP A 1 27 ? 9.990  9.926  45.285 1.00 58.68  ? 27  ASP A OD2 1 
ATOM   226  N  N   . LYS A 1 28 ? 5.977  11.611 43.082 1.00 42.22  ? 28  LYS A N   1 
ATOM   227  C  CA  . LYS A 1 28 ? 5.117  12.792 43.114 1.00 43.32  ? 28  LYS A CA  1 
ATOM   228  C  C   . LYS A 1 28 ? 5.717  13.965 43.875 1.00 41.52  ? 28  LYS A C   1 
ATOM   229  O  O   . LYS A 1 28 ? 5.799  15.078 43.337 1.00 51.20  ? 28  LYS A O   1 
ATOM   230  C  CB  . LYS A 1 28 ? 3.736  12.442 43.695 1.00 37.92  ? 28  LYS A CB  1 
ATOM   231  C  CG  . LYS A 1 28 ? 2.884  13.687 43.921 1.00 38.64  ? 28  LYS A CG  1 
ATOM   232  C  CD  . LYS A 1 28 ? 1.397  13.361 43.890 1.00 42.12  ? 28  LYS A CD  1 
ATOM   233  C  CE  . LYS A 1 28 ? 0.578  14.614 44.173 1.00 48.11  ? 28  LYS A CE  1 
ATOM   234  N  NZ  . LYS A 1 28 ? -0.824 14.312 44.564 1.00 45.57  ? 28  LYS A NZ  1 
ATOM   235  N  N   . PRO A 1 29 ? 6.137  13.793 45.120 1.00 36.85  ? 29  PRO A N   1 
ATOM   236  C  CA  . PRO A 1 29 ? 6.658  14.956 45.856 1.00 36.94  ? 29  PRO A CA  1 
ATOM   237  C  C   . PRO A 1 29 ? 7.879  15.549 45.165 1.00 38.68  ? 29  PRO A C   1 
ATOM   238  O  O   . PRO A 1 29 ? 8.106  16.760 45.211 1.00 39.55  ? 29  PRO A O   1 
ATOM   239  C  CB  . PRO A 1 29 ? 7.027  14.385 47.219 1.00 37.61  ? 29  PRO A CB  1 
ATOM   240  C  CG  . PRO A 1 29 ? 7.056  12.906 47.072 1.00 37.97  ? 29  PRO A CG  1 
ATOM   241  C  CD  . PRO A 1 29 ? 6.165  12.562 45.919 1.00 35.48  ? 29  PRO A CD  1 
ATOM   242  N  N   . SER A 1 30 ? 8.670  14.704 44.506 1.00 37.87  ? 30  SER A N   1 
ATOM   243  C  CA  . SER A 1 30 ? 9.812  15.220 43.754 1.00 38.75  ? 30  SER A CA  1 
ATOM   244  C  C   . SER A 1 30 ? 9.345  15.992 42.525 1.00 41.14  ? 30  SER A C   1 
ATOM   245  O  O   . SER A 1 30 ? 9.890  17.028 42.151 1.00 40.09  ? 30  SER A O   1 
ATOM   246  C  CB  . SER A 1 30 ? 10.747 14.095 43.320 1.00 39.07  ? 30  SER A CB  1 
ATOM   247  O  OG  . SER A 1 30 ? 11.320 13.425 44.425 1.00 45.15  ? 30  SER A OG  1 
ATOM   248  N  N   . LEU A 1 31 ? 8.306  15.469 41.871 1.00 41.26  ? 31  LEU A N   1 
ATOM   249  C  CA  . LEU A 1 31 ? 7.788  16.155 40.695 1.00 41.33  ? 31  LEU A CA  1 
ATOM   250  C  C   . LEU A 1 31 ? 7.279  17.550 41.043 1.00 43.23  ? 31  LEU A C   1 
ATOM   251  O  O   . LEU A 1 31 ? 7.473  18.491 40.276 1.00 45.91  ? 31  LEU A O   1 
ATOM   252  C  CB  . LEU A 1 31 ? 6.660  15.349 40.044 1.00 44.34  ? 31  LEU A CB  1 
ATOM   253  C  CG  . LEU A 1 31 ? 6.061  16.018 38.799 1.00 46.58  ? 31  LEU A CG  1 
ATOM   254  C  CD1 . LEU A 1 31 ? 6.996  15.833 37.615 1.00 40.05  ? 31  LEU A CD1 1 
ATOM   255  C  CD2 . LEU A 1 31 ? 4.677  15.466 38.512 1.00 50.27  ? 31  LEU A CD2 1 
ATOM   256  N  N   . LEU A 1 32 ? 6.629  17.658 42.199 1.00 45.58  ? 32  LEU A N   1 
ATOM   257  C  CA  . LEU A 1 32 ? 6.109  18.945 42.654 1.00 43.36  ? 32  LEU A CA  1 
ATOM   258  C  C   . LEU A 1 32 ? 7.263  19.892 42.965 1.00 40.63  ? 32  LEU A C   1 
ATOM   259  O  O   . LEU A 1 32 ? 7.214  21.073 42.625 1.00 46.84  ? 32  LEU A O   1 
ATOM   260  C  CB  . LEU A 1 32 ? 5.205  18.782 43.876 1.00 45.73  ? 32  LEU A CB  1 
ATOM   261  C  CG  . LEU A 1 32 ? 4.000  17.855 43.681 1.00 52.54  ? 32  LEU A CG  1 
ATOM   262  C  CD1 . LEU A 1 32 ? 3.205  17.699 44.968 1.00 47.31  ? 32  LEU A CD1 1 
ATOM   263  C  CD2 . LEU A 1 32 ? 3.112  18.373 42.560 1.00 51.89  ? 32  LEU A CD2 1 
ATOM   264  N  N   . THR A 1 33 ? 8.293  19.353 43.609 1.00 39.83  ? 33  THR A N   1 
ATOM   265  C  CA  . THR A 1 33 ? 9.507  20.098 43.921 1.00 41.52  ? 33  THR A CA  1 
ATOM   266  C  C   . THR A 1 33 ? 10.148 20.667 42.660 1.00 41.30  ? 33  THR A C   1 
ATOM   267  O  O   . THR A 1 33 ? 10.524 21.832 42.552 1.00 38.54  ? 33  THR A O   1 
ATOM   268  C  CB  . THR A 1 33 ? 10.514 19.179 44.641 1.00 40.73  ? 33  THR A CB  1 
ATOM   269  O  OG1 . THR A 1 33 ? 10.035 18.896 45.962 1.00 52.59  ? 33  THR A OG1 1 
ATOM   270  C  CG2 . THR A 1 33 ? 11.861 19.861 44.793 1.00 32.11  ? 33  THR A CG2 1 
ATOM   271  N  N   . MET A 1 34 ? 10.269 19.781 41.680 1.00 39.65  ? 34  MET A N   1 
ATOM   272  C  CA  . MET A 1 34 ? 10.813 20.111 40.373 1.00 41.12  ? 34  MET A CA  1 
ATOM   273  C  C   . MET A 1 34 ? 10.082 21.289 39.742 1.00 41.02  ? 34  MET A C   1 
ATOM   274  O  O   . MET A 1 34 ? 10.710 22.241 39.273 1.00 45.17  ? 34  MET A O   1 
ATOM   275  C  CB  . MET A 1 34 ? 10.720 18.866 39.495 1.00 39.42  ? 34  MET A CB  1 
ATOM   276  C  CG  . MET A 1 34 ? 11.573 18.898 38.242 1.00 41.16  ? 34  MET A CG  1 
ATOM   277  S  SD  . MET A 1 34 ? 10.607 18.404 36.799 1.00 74.90  ? 34  MET A SD  1 
ATOM   278  C  CE  . MET A 1 34 ? 9.627  19.893 36.591 1.00 46.77  ? 34  MET A CE  1 
ATOM   279  N  N   . MET A 1 35 ? 8.757  21.227 39.742 1.00 39.94  ? 35  MET A N   1 
ATOM   280  C  CA  . MET A 1 35 ? 7.885  22.277 39.239 1.00 44.68  ? 35  MET A CA  1 
ATOM   281  C  C   . MET A 1 35 ? 8.142  23.614 39.934 1.00 51.13  ? 35  MET A C   1 
ATOM   282  O  O   . MET A 1 35 ? 8.367  24.641 39.300 1.00 61.22  ? 35  MET A O   1 
ATOM   283  C  CB  . MET A 1 35 ? 6.409  21.907 39.432 1.00 40.04  ? 35  MET A CB  1 
ATOM   284  C  CG  . MET A 1 35 ? 5.825  20.950 38.411 1.00 39.53  ? 35  MET A CG  1 
ATOM   285  S  SD  . MET A 1 35 ? 6.123  21.489 36.717 1.00 59.01  ? 35  MET A SD  1 
ATOM   286  C  CE  . MET A 1 35 ? 4.912  22.792 36.533 1.00 34.94  ? 35  MET A CE  1 
ATOM   287  N  N   . LYS A 1 36 ? 8.096  23.587 41.260 1.00 52.77  ? 36  LYS A N   1 
ATOM   288  C  CA  . LYS A 1 36 ? 8.257  24.768 42.090 1.00 53.61  ? 36  LYS A CA  1 
ATOM   289  C  C   . LYS A 1 36 ? 9.608  25.441 41.857 1.00 46.70  ? 36  LYS A C   1 
ATOM   290  O  O   . LYS A 1 36 ? 9.675  26.666 41.773 1.00 40.71  ? 36  LYS A O   1 
ATOM   291  C  CB  . LYS A 1 36 ? 8.113  24.389 43.565 1.00 63.74  ? 36  LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 36 ? 6.773  24.753 44.178 1.00 73.46  ? 36  LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 36 ? 6.617  24.051 45.516 1.00 82.03  ? 36  LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 36 ? 5.371  23.185 45.546 1.00 89.76  ? 36  LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 36 ? 4.443  23.549 46.655 1.00 104.56 ? 36  LYS A NZ  1 
ATOM   296  N  N   . GLU A 1 37 ? 10.652 24.626 41.759 1.00 44.02  ? 37  GLU A N   1 
ATOM   297  C  CA  . GLU A 1 37 ? 12.017 25.101 41.601 1.00 45.87  ? 37  GLU A CA  1 
ATOM   298  C  C   . GLU A 1 37 ? 12.318 25.575 40.184 1.00 46.48  ? 37  GLU A C   1 
ATOM   299  O  O   . GLU A 1 37 ? 13.157 26.467 40.015 1.00 48.81  ? 37  GLU A O   1 
ATOM   300  C  CB  . GLU A 1 37 ? 13.030 24.010 41.981 1.00 45.87  ? 37  GLU A CB  1 
ATOM   301  C  CG  . GLU A 1 37 ? 13.000 23.589 43.437 1.00 51.29  ? 37  GLU A CG  1 
ATOM   302  C  CD  . GLU A 1 37 ? 14.120 22.648 43.829 1.00 58.32  ? 37  GLU A CD  1 
ATOM   303  O  OE1 . GLU A 1 37 ? 14.662 21.964 42.938 1.00 59.59  ? 37  GLU A OE1 1 
ATOM   304  O  OE2 . GLU A 1 37 ? 14.467 22.585 45.029 1.00 65.30  ? 37  GLU A OE2 1 
ATOM   305  N  N   . ASN A 1 38 ? 11.682 25.008 39.158 1.00 46.56  ? 38  ASN A N   1 
ATOM   306  C  CA  . ASN A 1 38 ? 12.113 25.345 37.799 1.00 48.04  ? 38  ASN A CA  1 
ATOM   307  C  C   . ASN A 1 38 ? 11.101 26.144 36.996 1.00 46.06  ? 38  ASN A C   1 
ATOM   308  O  O   . ASN A 1 38 ? 11.471 26.795 36.012 1.00 50.02  ? 38  ASN A O   1 
ATOM   309  C  CB  . ASN A 1 38 ? 12.478 24.057 37.040 1.00 47.53  ? 38  ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 38 ? 13.706 23.397 37.641 1.00 48.29  ? 38  ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 38 ? 14.837 23.688 37.256 1.00 46.12  ? 38  ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 38 ? 13.469 22.506 38.597 1.00 39.56  ? 38  ASN A ND2 1 
ATOM   313  N  N   . PHE A 1 39 ? 9.830  26.131 37.381 1.00 43.25  ? 39  PHE A N   1 
ATOM   314  C  CA  . PHE A 1 39 ? 8.861  26.942 36.641 1.00 43.12  ? 39  PHE A CA  1 
ATOM   315  C  C   . PHE A 1 39 ? 8.016  27.811 37.560 1.00 45.83  ? 39  PHE A C   1 
ATOM   316  O  O   . PHE A 1 39 ? 6.781  27.747 37.530 1.00 48.58  ? 39  PHE A O   1 
ATOM   317  C  CB  . PHE A 1 39 ? 7.955  26.036 35.804 1.00 39.98  ? 39  PHE A CB  1 
ATOM   318  C  CG  . PHE A 1 39 ? 8.708  25.115 34.859 1.00 39.28  ? 39  PHE A CG  1 
ATOM   319  C  CD1 . PHE A 1 39 ? 9.095  25.563 33.608 1.00 41.92  ? 39  PHE A CD1 1 
ATOM   320  C  CD2 . PHE A 1 39 ? 9.013  23.819 35.234 1.00 38.98  ? 39  PHE A CD2 1 
ATOM   321  C  CE1 . PHE A 1 39 ? 9.784  24.730 32.743 1.00 42.98  ? 39  PHE A CE1 1 
ATOM   322  C  CE2 . PHE A 1 39 ? 9.693  22.975 34.373 1.00 40.88  ? 39  PHE A CE2 1 
ATOM   323  C  CZ  . PHE A 1 39 ? 10.086 23.435 33.129 1.00 42.27  ? 39  PHE A CZ  1 
ATOM   324  N  N   . PRO A 1 40 ? 8.642  28.637 38.390 1.00 48.87  ? 40  PRO A N   1 
ATOM   325  C  CA  . PRO A 1 40 ? 7.873  29.419 39.366 1.00 48.28  ? 40  PRO A CA  1 
ATOM   326  C  C   . PRO A 1 40 ? 7.040  30.510 38.717 1.00 45.76  ? 40  PRO A C   1 
ATOM   327  O  O   . PRO A 1 40 ? 5.923  30.846 39.116 1.00 41.09  ? 40  PRO A O   1 
ATOM   328  C  CB  . PRO A 1 40 ? 8.970  30.048 40.231 1.00 50.01  ? 40  PRO A CB  1 
ATOM   329  C  CG  . PRO A 1 40 ? 10.145 30.154 39.312 1.00 47.75  ? 40  PRO A CG  1 
ATOM   330  C  CD  . PRO A 1 40 ? 10.086 28.908 38.475 1.00 46.21  ? 40  PRO A CD  1 
ATOM   331  N  N   . ASN A 1 41 ? 7.563  31.131 37.664 1.00 46.49  ? 41  ASN A N   1 
ATOM   332  C  CA  . ASN A 1 41 ? 6.769  32.193 37.036 1.00 46.74  ? 41  ASN A CA  1 
ATOM   333  C  C   . ASN A 1 41 ? 5.541  31.600 36.364 1.00 50.33  ? 41  ASN A C   1 
ATOM   334  O  O   . ASN A 1 41 ? 4.444  32.155 36.398 1.00 56.86  ? 41  ASN A O   1 
ATOM   335  C  CB  . ASN A 1 41 ? 7.654  32.971 36.062 1.00 47.19  ? 41  ASN A CB  1 
ATOM   336  C  CG  . ASN A 1 41 ? 8.955  33.397 36.721 1.00 47.79  ? 41  ASN A CG  1 
ATOM   337  O  OD1 . ASN A 1 41 ? 8.999  34.374 37.467 1.00 64.36  ? 41  ASN A OD1 1 
ATOM   338  N  ND2 . ASN A 1 41 ? 10.028 32.664 36.463 1.00 49.82  ? 41  ASN A ND2 1 
ATOM   339  N  N   . PHE A 1 42 ? 5.720  30.434 35.742 1.00 49.20  ? 42  PHE A N   1 
ATOM   340  C  CA  . PHE A 1 42 ? 4.595  29.760 35.102 1.00 43.96  ? 42  PHE A CA  1 
ATOM   341  C  C   . PHE A 1 42 ? 3.505  29.530 36.141 1.00 45.57  ? 42  PHE A C   1 
ATOM   342  O  O   . PHE A 1 42 ? 2.322  29.750 35.898 1.00 57.26  ? 42  PHE A O   1 
ATOM   343  C  CB  . PHE A 1 42 ? 5.033  28.446 34.462 1.00 46.85  ? 42  PHE A CB  1 
ATOM   344  C  CG  . PHE A 1 42 ? 3.914  27.515 34.024 1.00 55.08  ? 42  PHE A CG  1 
ATOM   345  C  CD1 . PHE A 1 42 ? 3.216  27.730 32.848 1.00 58.28  ? 42  PHE A CD1 1 
ATOM   346  C  CD2 . PHE A 1 42 ? 3.560  26.420 34.796 1.00 55.78  ? 42  PHE A CD2 1 
ATOM   347  C  CE1 . PHE A 1 42 ? 2.196  26.887 32.451 1.00 56.48  ? 42  PHE A CE1 1 
ATOM   348  C  CE2 . PHE A 1 42 ? 2.545  25.568 34.408 1.00 55.11  ? 42  PHE A CE2 1 
ATOM   349  C  CZ  . PHE A 1 42 ? 1.856  25.799 33.229 1.00 56.02  ? 42  PHE A CZ  1 
ATOM   350  N  N   . LEU A 1 43 ? 3.947  29.073 37.313 1.00 47.99  ? 43  LEU A N   1 
ATOM   351  C  CA  . LEU A 1 43 ? 2.988  28.709 38.355 1.00 51.15  ? 43  LEU A CA  1 
ATOM   352  C  C   . LEU A 1 43 ? 2.283  29.946 38.890 1.00 49.94  ? 43  LEU A C   1 
ATOM   353  O  O   . LEU A 1 43 ? 1.061  29.969 39.027 1.00 52.63  ? 43  LEU A O   1 
ATOM   354  C  CB  . LEU A 1 43 ? 3.684  27.941 39.477 1.00 48.83  ? 43  LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 43 ? 4.116  26.511 39.139 1.00 47.55  ? 43  LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 43 ? 4.872  25.888 40.300 1.00 35.82  ? 43  LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 43 ? 2.915  25.656 38.765 1.00 41.33  ? 43  LEU A CD2 1 
ATOM   358  N  N   . SER A 1 44 ? 3.066  30.977 39.185 1.00 47.38  ? 44  SER A N   1 
ATOM   359  C  CA  . SER A 1 44 ? 2.497  32.226 39.682 1.00 48.99  ? 44  SER A CA  1 
ATOM   360  C  C   . SER A 1 44 ? 1.409  32.732 38.741 1.00 49.81  ? 44  SER A C   1 
ATOM   361  O  O   . SER A 1 44 ? 0.430  33.332 39.184 1.00 57.78  ? 44  SER A O   1 
ATOM   362  C  CB  . SER A 1 44 ? 3.599  33.268 39.869 1.00 53.86  ? 44  SER A CB  1 
ATOM   363  O  OG  . SER A 1 44 ? 3.888  33.946 38.659 1.00 89.61  ? 44  SER A OG  1 
ATOM   364  N  N   . ALA A 1 45 ? 1.577  32.480 37.449 1.00 52.31  ? 45  ALA A N   1 
ATOM   365  C  CA  . ALA A 1 45 ? 0.585  32.881 36.459 1.00 53.43  ? 45  ALA A CA  1 
ATOM   366  C  C   . ALA A 1 45 ? -0.716 32.105 36.628 1.00 54.30  ? 45  ALA A C   1 
ATOM   367  O  O   . ALA A 1 45 ? -1.806 32.673 36.513 1.00 57.23  ? 45  ALA A O   1 
ATOM   368  C  CB  . ALA A 1 45 ? 1.124  32.687 35.051 1.00 53.12  ? 45  ALA A CB  1 
ATOM   369  N  N   . CYS A 1 46 ? -0.606 30.805 36.888 1.00 53.33  ? 46  CYS A N   1 
ATOM   370  C  CA  . CYS A 1 46 ? -1.813 29.999 37.062 1.00 59.35  ? 46  CYS A CA  1 
ATOM   371  C  C   . CYS A 1 46 ? -2.525 30.361 38.356 1.00 66.00  ? 46  CYS A C   1 
ATOM   372  O  O   . CYS A 1 46 ? -3.748 30.464 38.408 1.00 69.17  ? 46  CYS A O   1 
ATOM   373  C  CB  . CYS A 1 46 ? -1.471 28.511 37.032 1.00 60.19  ? 46  CYS A CB  1 
ATOM   374  S  SG  . CYS A 1 46 ? -0.883 27.929 35.423 1.00 63.19  ? 46  CYS A SG  1 
ATOM   375  N  N   . ASP A 1 47 ? -1.753 30.561 39.420 1.00 71.17  ? 47  ASP A N   1 
ATOM   376  C  CA  . ASP A 1 47 ? -2.366 30.935 40.691 1.00 78.08  ? 47  ASP A CA  1 
ATOM   377  C  C   . ASP A 1 47 ? -3.000 32.311 40.598 1.00 76.38  ? 47  ASP A C   1 
ATOM   378  O  O   . ASP A 1 47 ? -4.050 32.559 41.184 1.00 80.03  ? 47  ASP A O   1 
ATOM   379  C  CB  . ASP A 1 47 ? -1.321 30.890 41.809 1.00 90.75  ? 47  ASP A CB  1 
ATOM   380  C  CG  . ASP A 1 47 ? -0.952 29.453 42.139 1.00 105.07 ? 47  ASP A CG  1 
ATOM   381  O  OD1 . ASP A 1 47 ? -0.944 28.610 41.216 1.00 127.26 ? 47  ASP A OD1 1 
ATOM   382  O  OD2 . ASP A 1 47 ? -0.676 29.172 43.326 1.00 118.97 ? 47  ASP A OD2 1 
ATOM   383  N  N   . LYS A 1 48 ? -2.367 33.216 39.859 1.00 75.63  ? 48  LYS A N   1 
ATOM   384  C  CA  . LYS A 1 48 ? -2.978 34.532 39.682 1.00 76.36  ? 48  LYS A CA  1 
ATOM   385  C  C   . LYS A 1 48 ? -4.269 34.412 38.880 1.00 76.16  ? 48  LYS A C   1 
ATOM   386  O  O   . LYS A 1 48 ? -5.193 35.199 39.072 1.00 93.03  ? 48  LYS A O   1 
ATOM   387  C  CB  . LYS A 1 48 ? -2.017 35.492 38.990 1.00 81.72  ? 48  LYS A CB  1 
ATOM   388  C  CG  . LYS A 1 48 ? -1.575 36.649 39.874 1.00 87.49  ? 48  LYS A CG  1 
ATOM   389  C  CD  . LYS A 1 48 ? -1.006 37.785 39.035 1.00 94.73  ? 48  LYS A CD  1 
ATOM   390  C  CE  . LYS A 1 48 ? 0.156  37.308 38.176 1.00 100.44 ? 48  LYS A CE  1 
ATOM   391  N  NZ  . LYS A 1 48 ? 1.478  37.624 38.788 1.00 113.29 ? 48  LYS A NZ  1 
ATOM   392  N  N   . LYS A 1 49 ? -4.323 33.434 37.987 1.00 75.20  ? 49  LYS A N   1 
ATOM   393  C  CA  . LYS A 1 49 ? -5.525 33.156 37.206 1.00 76.78  ? 49  LYS A CA  1 
ATOM   394  C  C   . LYS A 1 49 ? -6.533 32.385 38.051 1.00 79.80  ? 49  LYS A C   1 
ATOM   395  O  O   . LYS A 1 49 ? -7.644 32.053 37.636 1.00 74.11  ? 49  LYS A O   1 
ATOM   396  C  CB  . LYS A 1 49 ? -5.148 32.377 35.947 1.00 79.08  ? 49  LYS A CB  1 
ATOM   397  C  CG  . LYS A 1 49 ? -6.268 31.651 35.235 1.00 84.11  ? 49  LYS A CG  1 
ATOM   398  C  CD  . LYS A 1 49 ? -5.972 30.169 35.052 1.00 89.81  ? 49  LYS A CD  1 
ATOM   399  C  CE  . LYS A 1 49 ? -7.193 29.440 34.512 1.00 94.96  ? 49  LYS A CE  1 
ATOM   400  N  NZ  . LYS A 1 49 ? -6.811 28.267 33.675 1.00 99.13  ? 49  LYS A NZ  1 
ATOM   401  N  N   . GLY A 1 50 ? -6.128 32.094 39.285 1.00 83.05  ? 50  GLY A N   1 
ATOM   402  C  CA  . GLY A 1 50 ? -6.957 31.393 40.249 1.00 85.22  ? 50  GLY A CA  1 
ATOM   403  C  C   . GLY A 1 50 ? -6.831 29.888 40.124 1.00 85.52  ? 50  GLY A C   1 
ATOM   404  O  O   . GLY A 1 50 ? -7.673 29.129 40.600 1.00 103.37 ? 50  GLY A O   1 
ATOM   405  N  N   . THR A 1 51 ? -5.764 29.444 39.469 1.00 78.03  ? 51  THR A N   1 
ATOM   406  C  CA  . THR A 1 51 ? -5.594 28.026 39.188 1.00 69.54  ? 51  THR A CA  1 
ATOM   407  C  C   . THR A 1 51 ? -4.367 27.459 39.882 1.00 65.18  ? 51  THR A C   1 
ATOM   408  O  O   . THR A 1 51 ? -3.258 27.953 39.682 1.00 74.46  ? 51  THR A O   1 
ATOM   409  C  CB  . THR A 1 51 ? -5.476 27.789 37.669 1.00 68.81  ? 51  THR A CB  1 
ATOM   410  O  OG1 . THR A 1 51 ? -6.628 28.342 37.022 1.00 75.25  ? 51  THR A OG1 1 
ATOM   411  C  CG2 . THR A 1 51 ? -5.460 26.303 37.357 1.00 64.91  ? 51  THR A CG2 1 
ATOM   412  N  N   . ASN A 1 52 ? -4.577 26.418 40.689 1.00 60.69  ? 52  ASN A N   1 
ATOM   413  C  CA  . ASN A 1 52 ? -3.433 25.760 41.304 1.00 62.22  ? 52  ASN A CA  1 
ATOM   414  C  C   . ASN A 1 52 ? -3.089 24.489 40.523 1.00 58.22  ? 52  ASN A C   1 
ATOM   415  O  O   . ASN A 1 52 ? -3.616 23.414 40.780 1.00 54.21  ? 52  ASN A O   1 
ATOM   416  C  CB  . ASN A 1 52 ? -3.647 25.424 42.778 1.00 69.48  ? 52  ASN A CB  1 
ATOM   417  C  CG  . ASN A 1 52 ? -2.496 24.571 43.292 1.00 79.84  ? 52  ASN A CG  1 
ATOM   418  O  OD1 . ASN A 1 52 ? -1.434 25.046 43.693 1.00 91.35  ? 52  ASN A OD1 1 
ATOM   419  N  ND2 . ASN A 1 52 ? -2.712 23.263 43.278 1.00 92.17  ? 52  ASN A ND2 1 
ATOM   420  N  N   . TYR A 1 53 ? -2.195 24.681 39.570 1.00 52.86  ? 53  TYR A N   1 
ATOM   421  C  CA  . TYR A 1 53 ? -1.675 23.671 38.674 1.00 46.46  ? 53  TYR A CA  1 
ATOM   422  C  C   . TYR A 1 53 ? -1.165 22.445 39.414 1.00 42.73  ? 53  TYR A C   1 
ATOM   423  O  O   . TYR A 1 53 ? -1.325 21.329 38.919 1.00 51.60  ? 53  TYR A O   1 
ATOM   424  C  CB  . TYR A 1 53 ? -0.533 24.278 37.852 1.00 51.75  ? 53  TYR A CB  1 
ATOM   425  C  CG  . TYR A 1 53 ? -0.262 23.638 36.515 1.00 51.21  ? 53  TYR A CG  1 
ATOM   426  C  CD1 . TYR A 1 53 ? -1.088 23.885 35.428 1.00 50.64  ? 53  TYR A CD1 1 
ATOM   427  C  CD2 . TYR A 1 53 ? 0.825  22.791 36.332 1.00 46.47  ? 53  TYR A CD2 1 
ATOM   428  C  CE1 . TYR A 1 53 ? -0.840 23.301 34.203 1.00 50.37  ? 53  TYR A CE1 1 
ATOM   429  C  CE2 . TYR A 1 53 ? 1.077  22.204 35.109 1.00 43.34  ? 53  TYR A CE2 1 
ATOM   430  C  CZ  . TYR A 1 53 ? 0.242  22.463 34.048 1.00 46.43  ? 53  TYR A CZ  1 
ATOM   431  O  OH  . TYR A 1 53 ? 0.482  21.886 32.823 1.00 70.27  ? 53  TYR A OH  1 
ATOM   432  N  N   . LEU A 1 54 ? -0.545 22.636 40.576 1.00 42.99  ? 54  LEU A N   1 
ATOM   433  C  CA  . LEU A 1 54 ? 0.112  21.517 41.249 1.00 43.58  ? 54  LEU A CA  1 
ATOM   434  C  C   . LEU A 1 54 ? -0.873 20.517 41.838 1.00 43.39  ? 54  LEU A C   1 
ATOM   435  O  O   . LEU A 1 54 ? -0.520 19.365 42.099 1.00 51.21  ? 54  LEU A O   1 
ATOM   436  C  CB  . LEU A 1 54 ? 1.048  22.036 42.345 1.00 45.60  ? 54  LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 54 ? 2.291  22.785 41.851 1.00 47.70  ? 54  LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 54 ? 3.336  22.895 42.948 1.00 45.86  ? 54  LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 54 ? 2.876  22.103 40.622 1.00 43.82  ? 54  LEU A CD2 1 
ATOM   440  N  N   . ALA A 1 55 ? -2.110 20.938 42.058 1.00 40.50  ? 55  ALA A N   1 
ATOM   441  C  CA  . ALA A 1 55 ? -3.085 20.078 42.716 1.00 45.75  ? 55  ALA A CA  1 
ATOM   442  C  C   . ALA A 1 55 ? -3.300 18.768 41.976 1.00 51.29  ? 55  ALA A C   1 
ATOM   443  O  O   . ALA A 1 55 ? -3.535 17.718 42.578 1.00 56.21  ? 55  ALA A O   1 
ATOM   444  C  CB  . ALA A 1 55 ? -4.408 20.824 42.867 1.00 51.27  ? 55  ALA A CB  1 
ATOM   445  N  N   . ASP A 1 56 ? -3.234 18.798 40.642 1.00 51.90  ? 56  ASP A N   1 
ATOM   446  C  CA  . ASP A 1 56 ? -3.623 17.598 39.915 1.00 55.45  ? 56  ASP A CA  1 
ATOM   447  C  C   . ASP A 1 56 ? -2.647 17.188 38.820 1.00 50.27  ? 56  ASP A C   1 
ATOM   448  O  O   . ASP A 1 56 ? -2.868 16.118 38.250 1.00 45.89  ? 56  ASP A O   1 
ATOM   449  C  CB  . ASP A 1 56 ? -5.003 17.832 39.284 1.00 63.33  ? 56  ASP A CB  1 
ATOM   450  C  CG  . ASP A 1 56 ? -4.955 18.926 38.231 1.00 68.34  ? 56  ASP A CG  1 
ATOM   451  O  OD1 . ASP A 1 56 ? -4.091 19.821 38.334 1.00 71.03  ? 56  ASP A OD1 1 
ATOM   452  O  OD2 . ASP A 1 56 ? -5.784 18.880 37.299 1.00 79.46  ? 56  ASP A OD2 1 
ATOM   453  N  N   . VAL A 1 57 ? -1.655 18.026 38.562 1.00 42.75  ? 57  VAL A N   1 
ATOM   454  C  CA  . VAL A 1 57 ? -0.721 17.806 37.469 1.00 43.45  ? 57  VAL A CA  1 
ATOM   455  C  C   . VAL A 1 57 ? -0.202 16.372 37.470 1.00 41.25  ? 57  VAL A C   1 
ATOM   456  O  O   . VAL A 1 57 ? -0.199 15.699 36.441 1.00 51.40  ? 57  VAL A O   1 
ATOM   457  C  CB  . VAL A 1 57 ? 0.488  18.758 37.528 1.00 46.22  ? 57  VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 57 ? 1.087  18.786 38.924 1.00 44.57  ? 57  VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 57 ? 1.541  18.347 36.509 1.00 40.32  ? 57  VAL A CG2 1 
ATOM   460  N  N   . PHE A 1 58 ? 0.218  15.927 38.653 1.00 37.04  ? 58  PHE A N   1 
ATOM   461  C  CA  . PHE A 1 58 ? 0.751  14.577 38.762 1.00 38.34  ? 58  PHE A CA  1 
ATOM   462  C  C   . PHE A 1 58 ? -0.284 13.573 38.255 1.00 42.71  ? 58  PHE A C   1 
ATOM   463  O  O   . PHE A 1 58 ? 0.039  12.692 37.464 1.00 44.43  ? 58  PHE A O   1 
ATOM   464  C  CB  . PHE A 1 58 ? 1.161  14.243 40.201 1.00 37.24  ? 58  PHE A CB  1 
ATOM   465  C  CG  . PHE A 1 58 ? 1.932  12.928 40.269 1.00 39.34  ? 58  PHE A CG  1 
ATOM   466  C  CD1 . PHE A 1 58 ? 3.295  12.896 40.037 1.00 43.25  ? 58  PHE A CD1 1 
ATOM   467  C  CD2 . PHE A 1 58 ? 1.283  11.741 40.555 1.00 37.74  ? 58  PHE A CD2 1 
ATOM   468  C  CE1 . PHE A 1 58 ? 3.999  11.707 40.085 1.00 41.90  ? 58  PHE A CE1 1 
ATOM   469  C  CE2 . PHE A 1 58 ? 1.980  10.549 40.602 1.00 41.13  ? 58  PHE A CE2 1 
ATOM   470  C  CZ  . PHE A 1 58 ? 3.343  10.524 40.364 1.00 40.57  ? 58  PHE A CZ  1 
ATOM   471  N  N   . GLU A 1 59 ? -1.510 13.744 38.728 1.00 46.73  ? 59  GLU A N   1 
ATOM   472  C  CA  . GLU A 1 59 ? -2.607 12.843 38.404 1.00 48.68  ? 59  GLU A CA  1 
ATOM   473  C  C   . GLU A 1 59 ? -2.923 12.860 36.914 1.00 44.68  ? 59  GLU A C   1 
ATOM   474  O  O   . GLU A 1 59 ? -3.316 11.846 36.347 1.00 48.25  ? 59  GLU A O   1 
ATOM   475  C  CB  . GLU A 1 59 ? -3.864 13.214 39.199 1.00 46.56  ? 59  GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 59 ? -3.808 12.786 40.656 1.00 40.48  ? 59  GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 59 ? -2.771 13.566 41.440 1.00 44.14  ? 59  GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 59 ? -2.687 14.802 41.295 1.00 47.46  ? 59  GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 59 ? -2.034 12.906 42.198 1.00 49.80  ? 59  GLU A OE2 1 
ATOM   480  N  N   . LYS A 1 60 ? -2.750 14.030 36.308 1.00 45.48  ? 60  LYS A N   1 
ATOM   481  C  CA  . LYS A 1 60 ? -3.011 14.142 34.878 1.00 48.99  ? 60  LYS A CA  1 
ATOM   482  C  C   . LYS A 1 60 ? -1.844 13.631 34.051 1.00 48.67  ? 60  LYS A C   1 
ATOM   483  O  O   . LYS A 1 60 ? -2.053 13.124 32.941 1.00 61.51  ? 60  LYS A O   1 
ATOM   484  C  CB  . LYS A 1 60 ? -3.347 15.583 34.478 1.00 46.73  ? 60  LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 60 ? -4.575 16.164 35.137 1.00 52.52  ? 60  LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 60 ? -5.870 15.843 34.411 1.00 57.36  ? 60  LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 60 ? -6.972 16.780 34.857 1.00 58.43  ? 60  LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 60 ? -7.135 16.796 36.334 1.00 62.88  ? 60  LYS A NZ  1 
ATOM   489  N  N   . LYS A 1 61 ? -0.611 13.738 34.543 1.00 40.41  ? 61  LYS A N   1 
ATOM   490  C  CA  . LYS A 1 61 ? 0.507  13.304 33.700 1.00 42.00  ? 61  LYS A CA  1 
ATOM   491  C  C   . LYS A 1 61 ? 0.907  11.856 33.921 1.00 41.72  ? 61  LYS A C   1 
ATOM   492  O  O   . LYS A 1 61 ? 1.589  11.282 33.073 1.00 47.67  ? 61  LYS A O   1 
ATOM   493  C  CB  . LYS A 1 61 ? 1.707  14.229 33.916 1.00 48.19  ? 61  LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 61 ? 1.460  15.650 33.429 1.00 55.00  ? 61  LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 61 ? 0.498  15.701 32.256 1.00 57.87  ? 61  LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 61 ? 1.182  16.226 31.004 1.00 59.19  ? 61  LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 61 ? 0.281  16.260 29.818 1.00 62.03  ? 61  LYS A NZ  1 
ATOM   498  N  N   . ASP A 1 62 ? 0.501  11.237 35.020 1.00 45.53  ? 62  ASP A N   1 
ATOM   499  C  CA  . ASP A 1 62 ? 0.783  9.816  35.206 1.00 47.63  ? 62  ASP A CA  1 
ATOM   500  C  C   . ASP A 1 62 ? -0.226 8.984  34.420 1.00 53.64  ? 62  ASP A C   1 
ATOM   501  O  O   . ASP A 1 62 ? -1.102 8.342  34.992 1.00 46.67  ? 62  ASP A O   1 
ATOM   502  C  CB  . ASP A 1 62 ? 0.752  9.429  36.683 1.00 43.38  ? 62  ASP A CB  1 
ATOM   503  C  CG  . ASP A 1 62 ? 1.223  8.002  36.898 1.00 46.06  ? 62  ASP A CG  1 
ATOM   504  O  OD1 . ASP A 1 62 ? 1.815  7.423  35.962 1.00 46.97  ? 62  ASP A OD1 1 
ATOM   505  O  OD2 . ASP A 1 62 ? 0.793  7.391  37.900 1.00 42.77  ? 62  ASP A OD2 1 
ATOM   506  N  N   . LYS A 1 63 ? -0.094 9.022  33.102 1.00 60.65  ? 63  LYS A N   1 
ATOM   507  C  CA  . LYS A 1 63 ? -1.032 8.409  32.176 1.00 63.82  ? 63  LYS A CA  1 
ATOM   508  C  C   . LYS A 1 63 ? -1.211 6.919  32.412 1.00 55.26  ? 63  LYS A C   1 
ATOM   509  O  O   . LYS A 1 63 ? -2.287 6.369  32.167 1.00 55.03  ? 63  LYS A O   1 
ATOM   510  C  CB  . LYS A 1 63 ? -0.572 8.650  30.731 1.00 76.22  ? 63  LYS A CB  1 
ATOM   511  C  CG  . LYS A 1 63 ? -1.648 9.266  29.849 1.00 91.12  ? 63  LYS A CG  1 
ATOM   512  C  CD  . LYS A 1 63 ? -1.056 9.867  28.583 1.00 102.70 ? 63  LYS A CD  1 
ATOM   513  C  CE  . LYS A 1 63 ? -1.532 11.296 28.375 1.00 108.73 ? 63  LYS A CE  1 
ATOM   514  N  NZ  . LYS A 1 63 ? -2.432 11.417 27.193 1.00 110.12 ? 63  LYS A NZ  1 
ATOM   515  N  N   . ASN A 1 64 ? -0.170 6.236  32.879 1.00 50.99  ? 64  ASN A N   1 
ATOM   516  C  CA  . ASN A 1 64 ? -0.306 4.796  33.086 1.00 50.07  ? 64  ASN A CA  1 
ATOM   517  C  C   . ASN A 1 64 ? -0.522 4.440  34.553 1.00 55.38  ? 64  ASN A C   1 
ATOM   518  O  O   . ASN A 1 64 ? -0.456 3.262  34.914 1.00 55.64  ? 64  ASN A O   1 
ATOM   519  C  CB  . ASN A 1 64 ? 0.926  4.079  32.530 1.00 48.73  ? 64  ASN A CB  1 
ATOM   520  C  CG  . ASN A 1 64 ? 2.169  4.337  33.359 1.00 49.49  ? 64  ASN A CG  1 
ATOM   521  O  OD1 . ASN A 1 64 ? 2.247  5.290  34.130 1.00 51.13  ? 64  ASN A OD1 1 
ATOM   522  N  ND2 . ASN A 1 64 ? 3.147  3.459  33.188 1.00 45.57  ? 64  ASN A ND2 1 
ATOM   523  N  N   . GLU A 1 65 ? -0.783 5.428  35.393 1.00 60.09  ? 65  GLU A N   1 
ATOM   524  C  CA  . GLU A 1 65 ? -1.121 5.256  36.799 1.00 64.59  ? 65  GLU A CA  1 
ATOM   525  C  C   . GLU A 1 65 ? -0.160 4.336  37.542 1.00 59.83  ? 65  GLU A C   1 
ATOM   526  O  O   . GLU A 1 65 ? -0.556 3.476  38.333 1.00 61.32  ? 65  GLU A O   1 
ATOM   527  C  CB  . GLU A 1 65 ? -2.555 4.723  36.956 1.00 69.85  ? 65  GLU A CB  1 
ATOM   528  C  CG  . GLU A 1 65 ? -3.531 5.202  35.900 1.00 77.51  ? 65  GLU A CG  1 
ATOM   529  C  CD  . GLU A 1 65 ? -4.953 5.388  36.378 1.00 80.14  ? 65  GLU A CD  1 
ATOM   530  O  OE1 . GLU A 1 65 ? -5.291 4.984  37.509 1.00 79.75  ? 65  GLU A OE1 1 
ATOM   531  O  OE2 . GLU A 1 65 ? -5.766 5.952  35.611 1.00 89.38  ? 65  GLU A OE2 1 
ATOM   532  N  N   . ASP A 1 66 ? 1.142  4.497  37.318 1.00 55.01  ? 66  ASP A N   1 
ATOM   533  C  CA  . ASP A 1 66 ? 2.090  3.666  38.063 1.00 52.71  ? 66  ASP A CA  1 
ATOM   534  C  C   . ASP A 1 66 ? 2.680  4.451  39.231 1.00 56.53  ? 66  ASP A C   1 
ATOM   535  O  O   . ASP A 1 66 ? 3.657  4.037  39.850 1.00 60.00  ? 66  ASP A O   1 
ATOM   536  C  CB  . ASP A 1 66 ? 3.192  3.162  37.134 1.00 50.19  ? 66  ASP A CB  1 
ATOM   537  C  CG  . ASP A 1 66 ? 4.041  4.296  36.595 1.00 53.56  ? 66  ASP A CG  1 
ATOM   538  O  OD1 . ASP A 1 66 ? 3.633  5.465  36.753 1.00 54.09  ? 66  ASP A OD1 1 
ATOM   539  O  OD2 . ASP A 1 66 ? 5.044  4.002  35.916 1.00 53.46  ? 66  ASP A OD2 1 
ATOM   540  N  N   . LYS A 1 67 ? 2.078  5.587  39.529 1.00 59.29  ? 67  LYS A N   1 
ATOM   541  C  CA  . LYS A 1 67 ? 2.439  6.509  40.585 1.00 64.18  ? 67  LYS A CA  1 
ATOM   542  C  C   . LYS A 1 67 ? 3.855  7.054  40.380 1.00 61.06  ? 67  LYS A C   1 
ATOM   543  O  O   . LYS A 1 67 ? 4.443  7.552  41.341 1.00 53.32  ? 67  LYS A O   1 
ATOM   544  C  CB  . LYS A 1 67 ? 2.333  5.892  41.980 1.00 73.79  ? 67  LYS A CB  1 
ATOM   545  C  CG  . LYS A 1 67 ? 0.916  5.489  42.370 1.00 85.26  ? 67  LYS A CG  1 
ATOM   546  C  CD  . LYS A 1 67 ? 0.647  4.074  41.869 1.00 95.47  ? 67  LYS A CD  1 
ATOM   547  C  CE  . LYS A 1 67 ? 0.998  3.031  42.924 1.00 100.37 ? 67  LYS A CE  1 
ATOM   548  N  NZ  . LYS A 1 67 ? 1.480  1.754  42.327 1.00 100.26 ? 67  LYS A NZ  1 
ATOM   549  N  N   . LYS A 1 68 ? 4.341  6.965  39.150 1.00 58.56  ? 68  LYS A N   1 
ATOM   550  C  CA  . LYS A 1 68 ? 5.643  7.501  38.780 1.00 54.47  ? 68  LYS A CA  1 
ATOM   551  C  C   . LYS A 1 68 ? 5.536  8.291  37.474 1.00 52.94  ? 68  LYS A C   1 
ATOM   552  O  O   . LYS A 1 68 ? 4.681  8.009  36.635 1.00 58.45  ? 68  LYS A O   1 
ATOM   553  C  CB  . LYS A 1 68 ? 6.690  6.406  38.622 1.00 54.98  ? 68  LYS A CB  1 
ATOM   554  C  CG  . LYS A 1 68 ? 6.982  5.523  39.810 1.00 60.96  ? 68  LYS A CG  1 
ATOM   555  C  CD  . LYS A 1 68 ? 7.979  6.146  40.768 1.00 73.08  ? 68  LYS A CD  1 
ATOM   556  C  CE  . LYS A 1 68 ? 8.597  5.089  41.676 1.00 81.14  ? 68  LYS A CE  1 
ATOM   557  N  NZ  . LYS A 1 68 ? 9.793  5.623  42.394 1.00 91.05  ? 68  LYS A NZ  1 
ATOM   558  N  N   . ILE A 1 69 ? 6.411  9.268  37.322 1.00 47.88  ? 69  ILE A N   1 
ATOM   559  C  CA  . ILE A 1 69 ? 6.538  10.029 36.085 1.00 41.77  ? 69  ILE A CA  1 
ATOM   560  C  C   . ILE A 1 69 ? 7.792  9.603  35.326 1.00 40.01  ? 69  ILE A C   1 
ATOM   561  O  O   . ILE A 1 69 ? 8.907  9.881  35.769 1.00 36.22  ? 69  ILE A O   1 
ATOM   562  C  CB  . ILE A 1 69 ? 6.570  11.531 36.401 1.00 38.82  ? 69  ILE A CB  1 
ATOM   563  C  CG1 . ILE A 1 69 ? 5.248  12.048 36.983 1.00 36.80  ? 69  ILE A CG1 1 
ATOM   564  C  CG2 . ILE A 1 69 ? 6.986  12.351 35.195 1.00 31.67  ? 69  ILE A CG2 1 
ATOM   565  C  CD1 . ILE A 1 69 ? 4.041  11.675 36.153 1.00 45.52  ? 69  ILE A CD1 1 
ATOM   566  N  N   . ASP A 1 70 ? 7.626  8.914  34.200 1.00 35.16  ? 70  ASP A N   1 
ATOM   567  C  CA  . ASP A 1 70 ? 8.753  8.498  33.369 1.00 38.25  ? 70  ASP A CA  1 
ATOM   568  C  C   . ASP A 1 70 ? 9.136  9.607  32.395 1.00 41.50  ? 70  ASP A C   1 
ATOM   569  O  O   . ASP A 1 70 ? 8.508  10.667 32.381 1.00 37.41  ? 70  ASP A O   1 
ATOM   570  C  CB  . ASP A 1 70 ? 8.437  7.208  32.621 1.00 46.21  ? 70  ASP A CB  1 
ATOM   571  C  CG  . ASP A 1 70 ? 7.201  7.242  31.747 1.00 51.08  ? 70  ASP A CG  1 
ATOM   572  O  OD1 . ASP A 1 70 ? 6.894  8.314  31.177 1.00 51.66  ? 70  ASP A OD1 1 
ATOM   573  O  OD2 . ASP A 1 70 ? 6.527  6.191  31.611 1.00 49.12  ? 70  ASP A OD2 1 
ATOM   574  N  N   . PHE A 1 71 ? 10.160 9.393  31.574 1.00 42.58  ? 71  PHE A N   1 
ATOM   575  C  CA  . PHE A 1 71 ? 10.628 10.444 30.675 1.00 41.90  ? 71  PHE A CA  1 
ATOM   576  C  C   . PHE A 1 71 ? 9.575  10.875 29.663 1.00 43.84  ? 71  PHE A C   1 
ATOM   577  O  O   . PHE A 1 71 ? 9.426  12.059 29.348 1.00 46.15  ? 71  PHE A O   1 
ATOM   578  C  CB  . PHE A 1 71 ? 11.889 9.988  29.931 1.00 42.55  ? 71  PHE A CB  1 
ATOM   579  C  CG  . PHE A 1 71 ? 12.494 11.111 29.097 1.00 45.87  ? 71  PHE A CG  1 
ATOM   580  C  CD1 . PHE A 1 71 ? 13.116 12.185 29.710 1.00 44.55  ? 71  PHE A CD1 1 
ATOM   581  C  CD2 . PHE A 1 71 ? 12.421 11.074 27.717 1.00 45.85  ? 71  PHE A CD2 1 
ATOM   582  C  CE1 . PHE A 1 71 ? 13.655 13.211 28.959 1.00 45.94  ? 71  PHE A CE1 1 
ATOM   583  C  CE2 . PHE A 1 71 ? 12.962 12.092 26.956 1.00 48.29  ? 71  PHE A CE2 1 
ATOM   584  C  CZ  . PHE A 1 71 ? 13.579 13.161 27.579 1.00 48.90  ? 71  PHE A CZ  1 
ATOM   585  N  N   . SER A 1 72 ? 8.832  9.912  29.126 1.00 42.99  ? 72  SER A N   1 
ATOM   586  C  CA  . SER A 1 72 ? 7.797  10.237 28.149 1.00 43.17  ? 72  SER A CA  1 
ATOM   587  C  C   . SER A 1 72 ? 6.684  11.053 28.796 1.00 42.01  ? 72  SER A C   1 
ATOM   588  O  O   . SER A 1 72 ? 6.251  12.074 28.253 1.00 46.61  ? 72  SER A O   1 
ATOM   589  C  CB  . SER A 1 72 ? 7.240  8.961  27.522 1.00 49.20  ? 72  SER A CB  1 
ATOM   590  O  OG  . SER A 1 72 ? 6.409  8.266  28.439 1.00 79.92  ? 72  SER A OG  1 
ATOM   591  N  N   . GLU A 1 73 ? 6.217  10.617 29.969 1.00 37.61  ? 73  GLU A N   1 
ATOM   592  C  CA  . GLU A 1 73 ? 5.197  11.416 30.653 1.00 34.84  ? 73  GLU A CA  1 
ATOM   593  C  C   . GLU A 1 73 ? 5.767  12.799 30.950 1.00 38.94  ? 73  GLU A C   1 
ATOM   594  O  O   . GLU A 1 73 ? 5.079  13.806 30.811 1.00 45.62  ? 73  GLU A O   1 
ATOM   595  C  CB  . GLU A 1 73 ? 4.713  10.717 31.912 1.00 34.84  ? 73  GLU A CB  1 
ATOM   596  C  CG  . GLU A 1 73 ? 4.113  9.345  31.655 1.00 36.48  ? 73  GLU A CG  1 
ATOM   597  C  CD  . GLU A 1 73 ? 3.833  8.576  32.931 1.00 44.60  ? 73  GLU A CD  1 
ATOM   598  O  OE1 . GLU A 1 73 ? 4.731  8.542  33.799 1.00 49.78  ? 73  GLU A OE1 1 
ATOM   599  O  OE2 . GLU A 1 73 ? 2.870  7.777  32.947 1.00 46.97  ? 73  GLU A OE2 1 
ATOM   600  N  N   . PHE A 1 74 ? 7.037  12.829 31.326 1.00 44.77  ? 74  PHE A N   1 
ATOM   601  C  CA  . PHE A 1 74 ? 7.806  14.044 31.548 1.00 44.54  ? 74  PHE A CA  1 
ATOM   602  C  C   . PHE A 1 74 ? 7.810  14.920 30.299 1.00 42.28  ? 74  PHE A C   1 
ATOM   603  O  O   . PHE A 1 74 ? 7.548  16.123 30.393 1.00 40.51  ? 74  PHE A O   1 
ATOM   604  C  CB  . PHE A 1 74 ? 9.239  13.695 31.967 1.00 45.84  ? 74  PHE A CB  1 
ATOM   605  C  CG  . PHE A 1 74 ? 10.178 14.884 32.099 1.00 46.16  ? 74  PHE A CG  1 
ATOM   606  C  CD1 . PHE A 1 74 ? 10.068 15.766 33.161 1.00 44.16  ? 74  PHE A CD1 1 
ATOM   607  C  CD2 . PHE A 1 74 ? 11.174 15.116 31.162 1.00 46.93  ? 74  PHE A CD2 1 
ATOM   608  C  CE1 . PHE A 1 74 ? 10.922 16.847 33.277 1.00 46.07  ? 74  PHE A CE1 1 
ATOM   609  C  CE2 . PHE A 1 74 ? 12.031 16.195 31.268 1.00 45.88  ? 74  PHE A CE2 1 
ATOM   610  C  CZ  . PHE A 1 74 ? 11.910 17.068 32.335 1.00 46.26  ? 74  PHE A CZ  1 
ATOM   611  N  N   . LEU A 1 75 ? 8.109  14.327 29.143 1.00 39.22  ? 75  LEU A N   1 
ATOM   612  C  CA  . LEU A 1 75 ? 8.104  15.089 27.898 1.00 40.21  ? 75  LEU A CA  1 
ATOM   613  C  C   . LEU A 1 75 ? 6.753  15.765 27.688 1.00 44.10  ? 75  LEU A C   1 
ATOM   614  O  O   . LEU A 1 75 ? 6.675  16.929 27.294 1.00 46.01  ? 75  LEU A O   1 
ATOM   615  C  CB  . LEU A 1 75 ? 8.419  14.198 26.701 1.00 41.37  ? 75  LEU A CB  1 
ATOM   616  C  CG  . LEU A 1 75 ? 9.878  13.837 26.443 1.00 44.02  ? 75  LEU A CG  1 
ATOM   617  C  CD1 . LEU A 1 75 ? 10.022 13.061 25.139 1.00 36.18  ? 75  LEU A CD1 1 
ATOM   618  C  CD2 . LEU A 1 75 ? 10.752 15.081 26.415 1.00 42.95  ? 75  LEU A CD2 1 
ATOM   619  N  N   . SER A 1 76 ? 5.666  15.038 27.956 1.00 41.41  ? 76  SER A N   1 
ATOM   620  C  CA  . SER A 1 76 ? 4.345  15.632 27.751 1.00 41.21  ? 76  SER A CA  1 
ATOM   621  C  C   . SER A 1 76 ? 4.118  16.843 28.648 1.00 40.40  ? 76  SER A C   1 
ATOM   622  O  O   . SER A 1 76 ? 3.622  17.883 28.215 1.00 34.77  ? 76  SER A O   1 
ATOM   623  C  CB  . SER A 1 76 ? 3.257  14.582 27.989 1.00 43.84  ? 76  SER A CB  1 
ATOM   624  O  OG  . SER A 1 76 ? 1.983  15.206 28.005 1.00 70.74  ? 76  SER A OG  1 
ATOM   625  N  N   . LEU A 1 77 ? 4.493  16.711 29.917 1.00 38.34  ? 77  LEU A N   1 
ATOM   626  C  CA  . LEU A 1 77 ? 4.370  17.810 30.864 1.00 34.97  ? 77  LEU A CA  1 
ATOM   627  C  C   . LEU A 1 77 ? 5.046  19.058 30.321 1.00 32.80  ? 77  LEU A C   1 
ATOM   628  O  O   . LEU A 1 77 ? 4.472  20.144 30.297 1.00 41.06  ? 77  LEU A O   1 
ATOM   629  C  CB  . LEU A 1 77 ? 4.975  17.425 32.215 1.00 37.50  ? 77  LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 77 ? 5.076  18.558 33.244 1.00 40.66  ? 77  LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 77 ? 3.722  19.211 33.467 1.00 35.19  ? 77  LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 77 ? 5.653  18.044 34.549 1.00 42.22  ? 77  LEU A CD2 1 
ATOM   633  N  N   . LEU A 1 78 ? 6.294  18.907 29.878 1.00 36.52  ? 78  LEU A N   1 
ATOM   634  C  CA  . LEU A 1 78 ? 6.992  20.081 29.335 1.00 36.77  ? 78  LEU A CA  1 
ATOM   635  C  C   . LEU A 1 78 ? 6.243  20.595 28.110 1.00 39.96  ? 78  LEU A C   1 
ATOM   636  O  O   . LEU A 1 78 ? 6.202  21.794 27.838 1.00 43.11  ? 78  LEU A O   1 
ATOM   637  C  CB  . LEU A 1 78 ? 8.442  19.735 29.018 1.00 33.66  ? 78  LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 78 ? 9.338  19.516 30.245 1.00 41.06  ? 78  LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 78 ? 10.767 19.195 29.843 1.00 45.10  ? 78  LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 78 ? 9.311  20.747 31.137 1.00 46.78  ? 78  LEU A CD2 1 
ATOM   641  N  N   . GLY A 1 79 ? 5.639  19.656 27.382 1.00 37.39  ? 79  GLY A N   1 
ATOM   642  C  CA  . GLY A 1 79 ? 4.887  19.983 26.184 1.00 34.70  ? 79  GLY A CA  1 
ATOM   643  C  C   . GLY A 1 79 ? 3.751  20.936 26.491 1.00 38.26  ? 79  GLY A C   1 
ATOM   644  O  O   . GLY A 1 79 ? 3.511  21.899 25.767 1.00 40.63  ? 79  GLY A O   1 
ATOM   645  N  N   . ASP A 1 80 ? 3.048  20.660 27.588 1.00 37.17  ? 80  ASP A N   1 
ATOM   646  C  CA  . ASP A 1 80 ? 1.929  21.527 27.947 1.00 42.70  ? 80  ASP A CA  1 
ATOM   647  C  C   . ASP A 1 80 ? 2.436  22.917 28.303 1.00 42.91  ? 80  ASP A C   1 
ATOM   648  O  O   . ASP A 1 80 ? 1.795  23.934 28.025 1.00 46.25  ? 80  ASP A O   1 
ATOM   649  C  CB  . ASP A 1 80 ? 1.123  20.941 29.102 1.00 45.35  ? 80  ASP A CB  1 
ATOM   650  C  CG  . ASP A 1 80 ? 0.673  19.512 28.879 1.00 49.24  ? 80  ASP A CG  1 
ATOM   651  O  OD1 . ASP A 1 80 ? 0.293  19.140 27.749 1.00 54.43  ? 80  ASP A OD1 1 
ATOM   652  O  OD2 . ASP A 1 80 ? 0.697  18.729 29.854 1.00 66.63  ? 80  ASP A OD2 1 
ATOM   653  N  N   . ILE A 1 81 ? 3.607  22.953 28.936 1.00 41.57  ? 81  ILE A N   1 
ATOM   654  C  CA  . ILE A 1 81 ? 4.117  24.251 29.377 1.00 43.88  ? 81  ILE A CA  1 
ATOM   655  C  C   . ILE A 1 81 ? 4.568  25.092 28.191 1.00 42.84  ? 81  ILE A C   1 
ATOM   656  O  O   . ILE A 1 81 ? 4.185  26.260 28.089 1.00 44.22  ? 81  ILE A O   1 
ATOM   657  C  CB  . ILE A 1 81 ? 5.262  24.063 30.387 1.00 45.81  ? 81  ILE A CB  1 
ATOM   658  C  CG1 . ILE A 1 81 ? 4.813  23.284 31.625 1.00 49.16  ? 81  ILE A CG1 1 
ATOM   659  C  CG2 . ILE A 1 81 ? 5.881  25.395 30.761 1.00 39.44  ? 81  ILE A CG2 1 
ATOM   660  C  CD1 . ILE A 1 81 ? 5.840  23.155 32.720 1.00 49.36  ? 81  ILE A CD1 1 
ATOM   661  N  N   . ALA A 1 82 ? 5.368  24.476 27.328 1.00 43.07  ? 82  ALA A N   1 
ATOM   662  C  CA  . ALA A 1 82 ? 5.834  25.136 26.110 1.00 42.19  ? 82  ALA A CA  1 
ATOM   663  C  C   . ALA A 1 82 ? 4.634  25.737 25.382 1.00 41.17  ? 82  ALA A C   1 
ATOM   664  O  O   . ALA A 1 82 ? 4.568  26.902 25.012 1.00 38.29  ? 82  ALA A O   1 
ATOM   665  C  CB  . ALA A 1 82 ? 6.576  24.161 25.214 1.00 36.04  ? 82  ALA A CB  1 
ATOM   666  N  N   . THR A 1 83 ? 3.648  24.863 25.219 1.00 37.11  ? 83  THR A N   1 
ATOM   667  C  CA  . THR A 1 83 ? 2.409  25.204 24.552 1.00 36.46  ? 83  THR A CA  1 
ATOM   668  C  C   . THR A 1 83 ? 1.759  26.438 25.152 1.00 43.27  ? 83  THR A C   1 
ATOM   669  O  O   . THR A 1 83 ? 1.259  27.322 24.452 1.00 44.90  ? 83  THR A O   1 
ATOM   670  C  CB  . THR A 1 83 ? 1.420  24.023 24.648 1.00 43.56  ? 83  THR A CB  1 
ATOM   671  O  OG1 . THR A 1 83 ? 1.928  22.907 23.913 1.00 54.15  ? 83  THR A OG1 1 
ATOM   672  C  CG2 . THR A 1 83 ? 0.086  24.425 24.034 1.00 48.87  ? 83  THR A CG2 1 
ATOM   673  N  N   . ASP A 1 84 ? 1.741  26.530 26.486 1.00 46.38  ? 84  ASP A N   1 
ATOM   674  C  CA  . ASP A 1 84 ? 1.077  27.708 27.047 1.00 45.76  ? 84  ASP A CA  1 
ATOM   675  C  C   . ASP A 1 84 ? 1.836  28.963 26.647 1.00 47.55  ? 84  ASP A C   1 
ATOM   676  O  O   . ASP A 1 84 ? 1.278  29.993 26.278 1.00 46.78  ? 84  ASP A O   1 
ATOM   677  C  CB  . ASP A 1 84 ? 0.974  27.631 28.568 1.00 49.82  ? 84  ASP A CB  1 
ATOM   678  C  CG  . ASP A 1 84 ? 0.232  28.832 29.129 1.00 53.13  ? 84  ASP A CG  1 
ATOM   679  O  OD1 . ASP A 1 84 ? 0.853  29.896 29.327 1.00 63.50  ? 84  ASP A OD1 1 
ATOM   680  O  OD2 . ASP A 1 84 ? -0.986 28.709 29.369 1.00 59.88  ? 84  ASP A OD2 1 
ATOM   681  N  N   . TYR A 1 85 ? 3.166  28.865 26.732 1.00 48.55  ? 85  TYR A N   1 
ATOM   682  C  CA  . TYR A 1 85 ? 3.958  30.031 26.350 1.00 50.43  ? 85  TYR A CA  1 
ATOM   683  C  C   . TYR A 1 85 ? 3.712  30.411 24.894 1.00 49.65  ? 85  TYR A C   1 
ATOM   684  O  O   . TYR A 1 85 ? 3.708  31.587 24.533 1.00 48.06  ? 85  TYR A O   1 
ATOM   685  C  CB  . TYR A 1 85 ? 5.442  29.753 26.560 1.00 55.10  ? 85  TYR A CB  1 
ATOM   686  C  CG  . TYR A 1 85 ? 5.914  29.885 27.984 1.00 61.29  ? 85  TYR A CG  1 
ATOM   687  C  CD1 . TYR A 1 85 ? 6.233  31.127 28.517 1.00 62.82  ? 85  TYR A CD1 1 
ATOM   688  C  CD2 . TYR A 1 85 ? 6.040  28.758 28.786 1.00 64.81  ? 85  TYR A CD2 1 
ATOM   689  C  CE1 . TYR A 1 85 ? 6.667  31.249 29.823 1.00 64.90  ? 85  TYR A CE1 1 
ATOM   690  C  CE2 . TYR A 1 85 ? 6.475  28.880 30.094 1.00 68.46  ? 85  TYR A CE2 1 
ATOM   691  C  CZ  . TYR A 1 85 ? 6.786  30.122 30.606 1.00 66.81  ? 85  TYR A CZ  1 
ATOM   692  O  OH  . TYR A 1 85 ? 7.220  30.242 31.909 1.00 61.13  ? 85  TYR A OH  1 
ATOM   693  N  N   . HIS A 1 86 ? 3.519  29.393 24.053 1.00 45.66  ? 86  HIS A N   1 
ATOM   694  C  CA  . HIS A 1 86 ? 3.329  29.667 22.634 1.00 44.44  ? 86  HIS A CA  1 
ATOM   695  C  C   . HIS A 1 86 ? 2.081  30.520 22.450 1.00 44.66  ? 86  HIS A C   1 
ATOM   696  O  O   . HIS A 1 86 ? 2.116  31.579 21.830 1.00 43.13  ? 86  HIS A O   1 
ATOM   697  C  CB  . HIS A 1 86 ? 3.207  28.383 21.820 1.00 46.38  ? 86  HIS A CB  1 
ATOM   698  C  CG  . HIS A 1 86 ? 2.977  28.619 20.360 1.00 49.47  ? 86  HIS A CG  1 
ATOM   699  N  ND1 . HIS A 1 86 ? 2.177  27.793 19.604 1.00 53.40  ? 86  HIS A ND1 1 
ATOM   700  C  CD2 . HIS A 1 86 ? 3.432  29.571 19.510 1.00 48.35  ? 86  HIS A CD2 1 
ATOM   701  C  CE1 . HIS A 1 86 ? 2.145  28.226 18.353 1.00 50.53  ? 86  HIS A CE1 1 
ATOM   702  N  NE2 . HIS A 1 86 ? 2.902  29.310 18.269 1.00 48.57  ? 86  HIS A NE2 1 
ATOM   703  N  N   . LYS A 1 87 ? 0.978  30.027 23.011 1.00 47.98  ? 87  LYS A N   1 
ATOM   704  C  CA  . LYS A 1 87 ? -0.282 30.763 22.901 1.00 53.76  ? 87  LYS A CA  1 
ATOM   705  C  C   . LYS A 1 87 ? -0.102 32.183 23.421 1.00 54.75  ? 87  LYS A C   1 
ATOM   706  O  O   . LYS A 1 87 ? -0.678 33.133 22.899 1.00 56.64  ? 87  LYS A O   1 
ATOM   707  C  CB  . LYS A 1 87 ? -1.393 30.035 23.654 1.00 59.95  ? 87  LYS A CB  1 
ATOM   708  C  CG  . LYS A 1 87 ? -1.636 28.613 23.163 1.00 67.91  ? 87  LYS A CG  1 
ATOM   709  C  CD  . LYS A 1 87 ? -2.934 28.064 23.734 1.00 77.76  ? 87  LYS A CD  1 
ATOM   710  C  CE  . LYS A 1 87 ? -3.646 27.166 22.733 1.00 85.62  ? 87  LYS A CE  1 
ATOM   711  N  NZ  . LYS A 1 87 ? -4.478 26.136 23.421 1.00 97.10  ? 87  LYS A NZ  1 
ATOM   712  N  N   . GLN A 1 88 ? 0.728  32.317 24.453 1.00 58.57  ? 88  GLN A N   1 
ATOM   713  C  CA  . GLN A 1 88 ? 1.002  33.631 25.018 1.00 60.33  ? 88  GLN A CA  1 
ATOM   714  C  C   . GLN A 1 88 ? 1.591  34.562 23.961 1.00 58.42  ? 88  GLN A C   1 
ATOM   715  O  O   . GLN A 1 88 ? 1.189  35.720 23.859 1.00 64.03  ? 88  GLN A O   1 
ATOM   716  C  CB  . GLN A 1 88 ? 1.969  33.537 26.198 1.00 61.52  ? 88  GLN A CB  1 
ATOM   717  C  CG  . GLN A 1 88 ? 1.324  33.141 27.517 1.00 65.28  ? 88  GLN A CG  1 
ATOM   718  C  CD  . GLN A 1 88 ? 2.295  33.302 28.674 1.00 69.88  ? 88  GLN A CD  1 
ATOM   719  O  OE1 . GLN A 1 88 ? 2.716  34.420 28.975 1.00 79.40  ? 88  GLN A OE1 1 
ATOM   720  N  NE2 . GLN A 1 88 ? 2.645  32.187 29.307 1.00 69.32  ? 88  GLN A NE2 1 
ATOM   721  N  N   . SER A 1 89 ? 2.535  34.035 23.192 1.00 57.19  ? 89  SER A N   1 
ATOM   722  C  CA  . SER A 1 89 ? 3.289  34.799 22.204 1.00 60.06  ? 89  SER A CA  1 
ATOM   723  C  C   . SER A 1 89 ? 2.405  35.250 21.048 1.00 63.91  ? 89  SER A C   1 
ATOM   724  O  O   . SER A 1 89 ? 2.805  36.058 20.207 1.00 71.59  ? 89  SER A O   1 
ATOM   725  C  CB  . SER A 1 89 ? 4.469  33.981 21.677 1.00 61.38  ? 89  SER A CB  1 
ATOM   726  O  OG  . SER A 1 89 ? 4.048  32.992 20.752 1.00 57.76  ? 89  SER A OG  1 
ATOM   727  N  N   . HIS A 1 90 ? 1.185  34.725 21.000 1.00 64.42  ? 90  HIS A N   1 
ATOM   728  C  CA  . HIS A 1 90 ? 0.216  35.189 20.010 1.00 67.19  ? 90  HIS A CA  1 
ATOM   729  C  C   . HIS A 1 90 ? -0.886 35.972 20.716 1.00 75.81  ? 90  HIS A C   1 
ATOM   730  O  O   . HIS A 1 90 ? -2.012 36.065 20.226 1.00 88.33  ? 90  HIS A O   1 
ATOM   731  C  CB  . HIS A 1 90 ? -0.351 34.022 19.211 1.00 62.96  ? 90  HIS A CB  1 
ATOM   732  C  CG  . HIS A 1 90 ? 0.688  33.336 18.374 1.00 64.26  ? 90  HIS A CG  1 
ATOM   733  N  ND1 . HIS A 1 90 ? 0.351  32.644 17.236 1.00 65.01  ? 90  HIS A ND1 1 
ATOM   734  C  CD2 . HIS A 1 90 ? 2.033  33.227 18.491 1.00 63.02  ? 90  HIS A CD2 1 
ATOM   735  C  CE1 . HIS A 1 90 ? 1.447  32.138 16.691 1.00 65.97  ? 90  HIS A CE1 1 
ATOM   736  N  NE2 . HIS A 1 90 ? 2.488  32.476 17.434 1.00 62.51  ? 90  HIS A NE2 1 
ATOM   737  N  N   . GLY A 1 91 ? -0.535 36.527 21.877 1.00 77.25  ? 91  GLY A N   1 
ATOM   738  C  CA  . GLY A 1 91 ? -1.438 37.358 22.637 1.00 78.92  ? 91  GLY A CA  1 
ATOM   739  C  C   . GLY A 1 91 ? -2.078 36.701 23.842 1.00 81.63  ? 91  GLY A C   1 
ATOM   740  O  O   . GLY A 1 91 ? -2.106 37.340 24.898 1.00 109.20 ? 91  GLY A O   1 
ATOM   741  N  N   . ALA A 1 92 ? -2.575 35.487 23.689 1.00 78.01  ? 92  ALA A N   1 
ATOM   742  C  CA  . ALA A 1 92 ? -3.304 34.723 24.686 1.00 77.92  ? 92  ALA A CA  1 
ATOM   743  C  C   . ALA A 1 92 ? -2.752 34.897 26.098 1.00 81.62  ? 92  ALA A C   1 
ATOM   744  O  O   . ALA A 1 92 ? -1.595 35.258 26.317 1.00 79.46  ? 92  ALA A O   1 
ATOM   745  C  CB  . ALA A 1 92 ? -3.311 33.243 24.317 1.00 64.16  ? 92  ALA A CB  1 
ATOM   746  N  N   . ALA A 1 93 ? -3.615 34.629 27.079 1.00 82.83  ? 93  ALA A N   1 
ATOM   747  C  CA  . ALA A 1 93 ? -3.221 34.797 28.474 1.00 82.07  ? 93  ALA A CA  1 
ATOM   748  C  C   . ALA A 1 93 ? -2.513 33.563 29.014 1.00 77.49  ? 93  ALA A C   1 
ATOM   749  O  O   . ALA A 1 93 ? -2.845 32.426 28.676 1.00 79.84  ? 93  ALA A O   1 
ATOM   750  C  CB  . ALA A 1 93 ? -4.438 35.123 29.327 1.00 88.30  ? 93  ALA A CB  1 
ATOM   751  N  N   . PRO A 1 94 ? -1.526 33.800 29.870 1.00 72.73  ? 94  PRO A N   1 
ATOM   752  C  CA  . PRO A 1 94 ? -0.837 32.680 30.523 1.00 72.30  ? 94  PRO A CA  1 
ATOM   753  C  C   . PRO A 1 94 ? -1.869 31.786 31.205 1.00 70.41  ? 94  PRO A C   1 
ATOM   754  O  O   . PRO A 1 94 ? -2.932 32.280 31.587 1.00 71.01  ? 94  PRO A O   1 
ATOM   755  C  CB  . PRO A 1 94 ? 0.064  33.362 31.548 1.00 71.95  ? 94  PRO A CB  1 
ATOM   756  C  CG  . PRO A 1 94 ? 0.278  34.737 31.007 1.00 71.16  ? 94  PRO A CG  1 
ATOM   757  C  CD  . PRO A 1 94 ? -0.993 35.102 30.286 1.00 70.35  ? 94  PRO A CD  1 
ATOM   758  N  N   . CYS A 1 95 ? -1.559 30.505 31.334 1.00 69.90  ? 95  CYS A N   1 
ATOM   759  C  CA  . CYS A 1 95 ? -2.496 29.544 31.919 1.00 71.81  ? 95  CYS A CA  1 
ATOM   760  C  C   . CYS A 1 95 ? -3.863 29.663 31.251 1.00 77.99  ? 95  CYS A C   1 
ATOM   761  O  O   . CYS A 1 95 ? -4.781 30.297 31.773 1.00 79.92  ? 95  CYS A O   1 
ATOM   762  C  CB  . CYS A 1 95 ? -2.603 29.737 33.432 1.00 65.71  ? 95  CYS A CB  1 
ATOM   763  S  SG  . CYS A 1 95 ? -2.429 28.206 34.381 1.00 73.64  ? 95  CYS A SG  1 
ATOM   764  N  N   . SER A 1 96 ? -3.994 29.069 30.068 1.00 84.37  ? 96  SER A N   1 
ATOM   765  C  CA  . SER A 1 96 ? -5.169 29.255 29.229 1.00 90.79  ? 96  SER A CA  1 
ATOM   766  C  C   . SER A 1 96 ? -5.409 28.062 28.316 1.00 91.71  ? 96  SER A C   1 
ATOM   767  O  O   . SER A 1 96 ? -5.860 27.011 28.762 1.00 95.33  ? 96  SER A O   1 
ATOM   768  C  CB  . SER A 1 96 ? -4.998 30.521 28.380 1.00 98.08  ? 96  SER A CB  1 
ATOM   769  O  OG  . SER A 1 96 ? -3.726 30.518 27.745 1.00 112.74 ? 96  SER A OG  1 
ATOM   770  N  N   . SER B 1 1  ? 11.802 37.152 37.541 1.00 107.95 ? 1   SER B N   1 
ATOM   771  C  CA  . SER B 1 1  ? 12.943 36.615 36.805 1.00 92.65  ? 1   SER B CA  1 
ATOM   772  C  C   . SER B 1 1  ? 12.678 35.181 36.345 1.00 83.56  ? 1   SER B C   1 
ATOM   773  O  O   . SER B 1 1  ? 11.837 34.483 36.910 1.00 75.10  ? 1   SER B O   1 
ATOM   774  C  CB  . SER B 1 1  ? 14.217 36.671 37.647 1.00 95.70  ? 1   SER B CB  1 
ATOM   775  O  OG  . SER B 1 1  ? 15.355 36.954 36.847 1.00 101.20 ? 1   SER B OG  1 
ATOM   776  N  N   . ASN B 1 2  ? 13.409 34.778 35.312 1.00 75.34  ? 2   ASN B N   1 
ATOM   777  C  CA  . ASN B 1 2  ? 13.205 33.503 34.643 1.00 68.14  ? 2   ASN B CA  1 
ATOM   778  C  C   . ASN B 1 2  ? 14.293 32.496 34.997 1.00 62.57  ? 2   ASN B C   1 
ATOM   779  O  O   . ASN B 1 2  ? 15.483 32.809 35.003 1.00 70.46  ? 2   ASN B O   1 
ATOM   780  C  CB  . ASN B 1 2  ? 13.174 33.677 33.124 1.00 68.14  ? 2   ASN B CB  1 
ATOM   781  C  CG  . ASN B 1 2  ? 11.864 34.198 32.578 1.00 71.66  ? 2   ASN B CG  1 
ATOM   782  O  OD1 . ASN B 1 2  ? 10.785 33.886 33.080 1.00 79.37  ? 2   ASN B OD1 1 
ATOM   783  N  ND2 . ASN B 1 2  ? 11.966 35.013 31.533 1.00 72.04  ? 2   ASN B ND2 1 
ATOM   784  N  N   . THR B 1 3  ? 13.873 31.271 35.295 1.00 56.17  ? 3   THR B N   1 
ATOM   785  C  CA  . THR B 1 3  ? 14.817 30.199 35.577 1.00 52.00  ? 3   THR B CA  1 
ATOM   786  C  C   . THR B 1 3  ? 15.501 29.748 34.294 1.00 47.93  ? 3   THR B C   1 
ATOM   787  O  O   . THR B 1 3  ? 15.019 30.030 33.199 1.00 48.55  ? 3   THR B O   1 
ATOM   788  C  CB  . THR B 1 3  ? 14.119 28.985 36.221 1.00 52.19  ? 3   THR B CB  1 
ATOM   789  O  OG1 . THR B 1 3  ? 13.259 28.358 35.262 1.00 49.50  ? 3   THR B OG1 1 
ATOM   790  C  CG2 . THR B 1 3  ? 13.241 29.437 37.376 1.00 41.76  ? 3   THR B CG2 1 
ATOM   791  N  N   . GLN B 1 4  ? 16.612 29.035 34.433 1.00 44.72  ? 4   GLN B N   1 
ATOM   792  C  CA  . GLN B 1 4  ? 17.231 28.381 33.290 1.00 48.76  ? 4   GLN B CA  1 
ATOM   793  C  C   . GLN B 1 4  ? 16.186 27.586 32.505 1.00 46.32  ? 4   GLN B C   1 
ATOM   794  O  O   . GLN B 1 4  ? 16.146 27.600 31.277 1.00 44.23  ? 4   GLN B O   1 
ATOM   795  C  CB  . GLN B 1 4  ? 18.342 27.444 33.756 1.00 64.25  ? 4   GLN B CB  1 
ATOM   796  C  CG  . GLN B 1 4  ? 19.585 27.427 32.884 1.00 86.28  ? 4   GLN B CG  1 
ATOM   797  C  CD  . GLN B 1 4  ? 20.764 28.125 33.537 1.00 104.55 ? 4   GLN B CD  1 
ATOM   798  O  OE1 . GLN B 1 4  ? 20.791 29.353 33.650 1.00 129.21 ? 4   GLN B OE1 1 
ATOM   799  N  NE2 . GLN B 1 4  ? 21.754 27.348 33.971 1.00 117.77 ? 4   GLN B NE2 1 
ATOM   800  N  N   . ALA B 1 5  ? 15.333 26.885 33.247 1.00 42.60  ? 5   ALA B N   1 
ATOM   801  C  CA  . ALA B 1 5  ? 14.321 26.024 32.651 1.00 39.44  ? 5   ALA B CA  1 
ATOM   802  C  C   . ALA B 1 5  ? 13.346 26.823 31.799 1.00 42.67  ? 5   ALA B C   1 
ATOM   803  O  O   . ALA B 1 5  ? 13.074 26.492 30.642 1.00 51.42  ? 5   ALA B O   1 
ATOM   804  C  CB  . ALA B 1 5  ? 13.589 25.264 33.746 1.00 35.84  ? 5   ALA B CB  1 
ATOM   805  N  N   . GLU B 1 6  ? 12.803 27.895 32.373 1.00 39.23  ? 6   GLU B N   1 
ATOM   806  C  CA  . GLU B 1 6  ? 11.807 28.668 31.630 1.00 43.48  ? 6   GLU B CA  1 
ATOM   807  C  C   . GLU B 1 6  ? 12.413 29.275 30.371 1.00 46.39  ? 6   GLU B C   1 
ATOM   808  O  O   . GLU B 1 6  ? 11.853 29.182 29.276 1.00 43.10  ? 6   GLU B O   1 
ATOM   809  C  CB  . GLU B 1 6  ? 11.203 29.743 32.534 1.00 45.11  ? 6   GLU B CB  1 
ATOM   810  C  CG  . GLU B 1 6  ? 10.170 29.203 33.514 1.00 48.99  ? 6   GLU B CG  1 
ATOM   811  C  CD  . GLU B 1 6  ? 10.026 30.081 34.743 1.00 52.78  ? 6   GLU B CD  1 
ATOM   812  O  OE1 . GLU B 1 6  ? 10.963 30.861 35.014 1.00 51.81  ? 6   GLU B OE1 1 
ATOM   813  O  OE2 . GLU B 1 6  ? 8.984  29.984 35.424 1.00 48.71  ? 6   GLU B OE2 1 
ATOM   814  N  N   . ARG B 1 7  ? 13.572 29.911 30.522 1.00 44.10  ? 7   ARG B N   1 
ATOM   815  C  CA  . ARG B 1 7  ? 14.215 30.545 29.375 1.00 46.40  ? 7   ARG B CA  1 
ATOM   816  C  C   . ARG B 1 7  ? 14.447 29.518 28.275 1.00 47.26  ? 7   ARG B C   1 
ATOM   817  O  O   . ARG B 1 7  ? 14.244 29.755 27.089 1.00 49.08  ? 7   ARG B O   1 
ATOM   818  C  CB  . ARG B 1 7  ? 15.534 31.186 29.789 1.00 51.18  ? 7   ARG B CB  1 
ATOM   819  C  CG  . ARG B 1 7  ? 15.411 32.422 30.660 1.00 63.44  ? 7   ARG B CG  1 
ATOM   820  C  CD  . ARG B 1 7  ? 16.777 32.907 31.125 1.00 77.96  ? 7   ARG B CD  1 
ATOM   821  N  NE  . ARG B 1 7  ? 17.070 32.507 32.497 1.00 89.75  ? 7   ARG B NE  1 
ATOM   822  C  CZ  . ARG B 1 7  ? 18.151 31.848 32.896 1.00 97.92  ? 7   ARG B CZ  1 
ATOM   823  N  NH1 . ARG B 1 7  ? 19.092 31.489 32.029 1.00 101.27 ? 7   ARG B NH1 1 
ATOM   824  N  NH2 . ARG B 1 7  ? 18.302 31.540 34.181 1.00 111.53 ? 7   ARG B NH2 1 
ATOM   825  N  N   . SER B 1 8  ? 14.885 28.330 28.683 1.00 45.48  ? 8   SER B N   1 
ATOM   826  C  CA  . SER B 1 8  ? 15.152 27.269 27.719 1.00 37.57  ? 8   SER B CA  1 
ATOM   827  C  C   . SER B 1 8  ? 13.901 26.958 26.904 1.00 42.60  ? 8   SER B C   1 
ATOM   828  O  O   . SER B 1 8  ? 13.986 26.696 25.704 1.00 52.40  ? 8   SER B O   1 
ATOM   829  C  CB  . SER B 1 8  ? 15.651 26.030 28.451 1.00 35.05  ? 8   SER B CB  1 
ATOM   830  O  OG  . SER B 1 8  ? 15.585 24.872 27.640 1.00 56.56  ? 8   SER B OG  1 
ATOM   831  N  N   . ILE B 1 9  ? 12.748 26.980 27.571 1.00 38.49  ? 9   ILE B N   1 
ATOM   832  C  CA  . ILE B 1 9  ? 11.488 26.724 26.879 1.00 37.52  ? 9   ILE B CA  1 
ATOM   833  C  C   . ILE B 1 9  ? 11.151 27.866 25.931 1.00 41.10  ? 9   ILE B C   1 
ATOM   834  O  O   . ILE B 1 9  ? 10.800 27.663 24.770 1.00 46.68  ? 9   ILE B O   1 
ATOM   835  C  CB  . ILE B 1 9  ? 10.348 26.517 27.892 1.00 43.12  ? 9   ILE B CB  1 
ATOM   836  C  CG1 . ILE B 1 9  ? 10.251 25.069 28.391 1.00 43.20  ? 9   ILE B CG1 1 
ATOM   837  C  CG2 . ILE B 1 9  ? 9.014  26.996 27.344 1.00 49.81  ? 9   ILE B CG2 1 
ATOM   838  C  CD1 . ILE B 1 9  ? 8.834  24.637 28.691 1.00 60.99  ? 9   ILE B CD1 1 
ATOM   839  N  N   . ILE B 1 10 ? 11.263 29.092 26.433 1.00 40.66  ? 10  ILE B N   1 
ATOM   840  C  CA  . ILE B 1 10 ? 10.992 30.251 25.588 1.00 46.43  ? 10  ILE B CA  1 
ATOM   841  C  C   . ILE B 1 10 ? 11.879 30.207 24.349 1.00 45.53  ? 10  ILE B C   1 
ATOM   842  O  O   . ILE B 1 10 ? 11.464 30.512 23.234 1.00 46.62  ? 10  ILE B O   1 
ATOM   843  C  CB  . ILE B 1 10 ? 11.218 31.568 26.345 1.00 51.12  ? 10  ILE B CB  1 
ATOM   844  C  CG1 . ILE B 1 10 ? 10.149 31.888 27.395 1.00 51.26  ? 10  ILE B CG1 1 
ATOM   845  C  CG2 . ILE B 1 10 ? 11.364 32.719 25.360 1.00 48.86  ? 10  ILE B CG2 1 
ATOM   846  C  CD1 . ILE B 1 10 ? 10.718 32.532 28.646 1.00 50.54  ? 10  ILE B CD1 1 
ATOM   847  N  N   . GLY B 1 11 ? 13.130 29.801 24.551 1.00 44.28  ? 11  GLY B N   1 
ATOM   848  C  CA  . GLY B 1 11 ? 14.065 29.672 23.446 1.00 42.72  ? 11  GLY B CA  1 
ATOM   849  C  C   . GLY B 1 11 ? 13.531 28.735 22.380 1.00 47.32  ? 11  GLY B C   1 
ATOM   850  O  O   . GLY B 1 11 ? 13.657 29.024 21.190 1.00 52.64  ? 11  GLY B O   1 
ATOM   851  N  N   . MET B 1 12 ? 12.934 27.610 22.787 1.00 46.60  ? 12  MET B N   1 
ATOM   852  C  CA  . MET B 1 12 ? 12.418 26.673 21.796 1.00 47.63  ? 12  MET B CA  1 
ATOM   853  C  C   . MET B 1 12 ? 11.375 27.372 20.925 1.00 45.94  ? 12  MET B C   1 
ATOM   854  O  O   . MET B 1 12 ? 11.290 27.145 19.722 1.00 51.68  ? 12  MET B O   1 
ATOM   855  C  CB  . MET B 1 12 ? 11.792 25.433 22.425 1.00 51.45  ? 12  MET B CB  1 
ATOM   856  C  CG  . MET B 1 12 ? 12.776 24.597 23.230 1.00 57.02  ? 12  MET B CG  1 
ATOM   857  S  SD  . MET B 1 12 ? 12.046 24.061 24.790 1.00 157.91 ? 12  MET B SD  1 
ATOM   858  C  CE  . MET B 1 12 ? 10.916 22.798 24.205 1.00 62.11  ? 12  MET B CE  1 
ATOM   859  N  N   . ILE B 1 13 ? 10.596 28.223 21.588 1.00 44.87  ? 13  ILE B N   1 
ATOM   860  C  CA  . ILE B 1 13 ? 9.519  28.920 20.885 1.00 43.32  ? 13  ILE B CA  1 
ATOM   861  C  C   . ILE B 1 13 ? 10.120 29.940 19.933 1.00 46.45  ? 13  ILE B C   1 
ATOM   862  O  O   . ILE B 1 13 ? 9.644  30.139 18.818 1.00 52.11  ? 13  ILE B O   1 
ATOM   863  C  CB  . ILE B 1 13 ? 8.553  29.584 21.877 1.00 43.03  ? 13  ILE B CB  1 
ATOM   864  C  CG1 . ILE B 1 13 ? 7.734  28.555 22.662 1.00 41.56  ? 13  ILE B CG1 1 
ATOM   865  C  CG2 . ILE B 1 13 ? 7.673  30.598 21.166 1.00 43.82  ? 13  ILE B CG2 1 
ATOM   866  C  CD1 . ILE B 1 13 ? 6.564  29.107 23.435 1.00 56.06  ? 13  ILE B CD1 1 
ATOM   867  N  N   . ASP B 1 14 ? 11.200 30.570 20.398 1.00 42.77  ? 14  ASP B N   1 
ATOM   868  C  CA  . ASP B 1 14 ? 11.883 31.538 19.546 1.00 43.35  ? 14  ASP B CA  1 
ATOM   869  C  C   . ASP B 1 14 ? 12.450 30.841 18.316 1.00 42.43  ? 14  ASP B C   1 
ATOM   870  O  O   . ASP B 1 14 ? 12.265 31.291 17.186 1.00 45.83  ? 14  ASP B O   1 
ATOM   871  C  CB  . ASP B 1 14 ? 12.986 32.252 20.328 1.00 49.50  ? 14  ASP B CB  1 
ATOM   872  C  CG  . ASP B 1 14 ? 12.386 33.229 21.328 1.00 58.30  ? 14  ASP B CG  1 
ATOM   873  O  OD1 . ASP B 1 14 ? 11.139 33.304 21.395 1.00 53.39  ? 14  ASP B OD1 1 
ATOM   874  O  OD2 . ASP B 1 14 ? 13.154 33.915 22.037 1.00 72.45  ? 14  ASP B OD2 1 
ATOM   875  N  N   . MET B 1 15 ? 13.137 29.731 18.565 1.00 39.05  ? 15  MET B N   1 
ATOM   876  C  CA  . MET B 1 15 ? 13.688 28.941 17.476 1.00 40.37  ? 15  MET B CA  1 
ATOM   877  C  C   . MET B 1 15 ? 12.591 28.592 16.475 1.00 42.49  ? 15  MET B C   1 
ATOM   878  O  O   . MET B 1 15 ? 12.759 28.718 15.265 1.00 51.47  ? 15  MET B O   1 
ATOM   879  C  CB  . MET B 1 15 ? 14.341 27.661 18.003 1.00 39.83  ? 15  MET B CB  1 
ATOM   880  C  CG  . MET B 1 15 ? 15.057 26.891 16.900 1.00 41.35  ? 15  MET B CG  1 
ATOM   881  S  SD  . MET B 1 15 ? 15.462 25.213 17.405 1.00 51.63  ? 15  MET B SD  1 
ATOM   882  C  CE  . MET B 1 15 ? 13.891 24.403 17.117 1.00 49.80  ? 15  MET B CE  1 
ATOM   883  N  N   . PHE B 1 16 ? 11.450 28.158 16.996 1.00 39.37  ? 16  PHE B N   1 
ATOM   884  C  CA  . PHE B 1 16 ? 10.318 27.796 16.157 1.00 41.22  ? 16  PHE B CA  1 
ATOM   885  C  C   . PHE B 1 16 ? 9.968  28.902 15.169 1.00 43.58  ? 16  PHE B C   1 
ATOM   886  O  O   . PHE B 1 16 ? 9.964  28.709 13.955 1.00 44.81  ? 16  PHE B O   1 
ATOM   887  C  CB  . PHE B 1 16 ? 9.099  27.479 17.035 1.00 36.65  ? 16  PHE B CB  1 
ATOM   888  C  CG  . PHE B 1 16 ? 7.866  27.091 16.235 1.00 36.15  ? 16  PHE B CG  1 
ATOM   889  C  CD1 . PHE B 1 16 ? 7.783  25.840 15.648 1.00 33.72  ? 16  PHE B CD1 1 
ATOM   890  C  CD2 . PHE B 1 16 ? 6.816  27.983 16.080 1.00 34.97  ? 16  PHE B CD2 1 
ATOM   891  C  CE1 . PHE B 1 16 ? 6.666  25.477 14.913 1.00 31.66  ? 16  PHE B CE1 1 
ATOM   892  C  CE2 . PHE B 1 16 ? 5.694  27.630 15.354 1.00 31.62  ? 16  PHE B CE2 1 
ATOM   893  C  CZ  . PHE B 1 16 ? 5.618  26.373 14.771 1.00 33.35  ? 16  PHE B CZ  1 
ATOM   894  N  N   . HIS B 1 17 ? 9.657  30.080 15.694 1.00 42.94  ? 17  HIS B N   1 
ATOM   895  C  CA  . HIS B 1 17 ? 9.180  31.189 14.882 1.00 42.00  ? 17  HIS B CA  1 
ATOM   896  C  C   . HIS B 1 17 ? 10.221 31.674 13.889 1.00 43.59  ? 17  HIS B C   1 
ATOM   897  O  O   . HIS B 1 17 ? 9.914  32.430 12.969 1.00 54.25  ? 17  HIS B O   1 
ATOM   898  C  CB  . HIS B 1 17 ? 8.749  32.340 15.805 1.00 38.17  ? 17  HIS B CB  1 
ATOM   899  C  CG  . HIS B 1 17 ? 7.358  32.131 16.322 1.00 41.23  ? 17  HIS B CG  1 
ATOM   900  N  ND1 . HIS B 1 17 ? 6.947  32.499 17.579 1.00 44.13  ? 17  HIS B ND1 1 
ATOM   901  C  CD2 . HIS B 1 17 ? 6.278  31.576 15.721 1.00 46.81  ? 17  HIS B CD2 1 
ATOM   902  C  CE1 . HIS B 1 17 ? 5.669  32.182 17.732 1.00 48.77  ? 17  HIS B CE1 1 
ATOM   903  N  NE2 . HIS B 1 17 ? 5.232  31.617 16.619 1.00 49.21  ? 17  HIS B NE2 1 
ATOM   904  N  N   . LYS B 1 18 ? 11.467 31.250 14.054 1.00 41.40  ? 18  LYS B N   1 
ATOM   905  C  CA  . LYS B 1 18 ? 12.533 31.686 13.156 1.00 45.59  ? 18  LYS B CA  1 
ATOM   906  C  C   . LYS B 1 18 ? 12.296 31.159 11.747 1.00 45.00  ? 18  LYS B C   1 
ATOM   907  O  O   . LYS B 1 18 ? 12.746 31.714 10.747 1.00 49.79  ? 18  LYS B O   1 
ATOM   908  C  CB  . LYS B 1 18 ? 13.876 31.201 13.698 1.00 58.08  ? 18  LYS B CB  1 
ATOM   909  C  CG  . LYS B 1 18 ? 15.116 31.871 13.140 1.00 75.09  ? 18  LYS B CG  1 
ATOM   910  C  CD  . LYS B 1 18 ? 16.350 31.522 13.961 1.00 89.79  ? 18  LYS B CD  1 
ATOM   911  C  CE  . LYS B 1 18 ? 17.578 31.288 13.086 1.00 97.46  ? 18  LYS B CE  1 
ATOM   912  N  NZ  . LYS B 1 18 ? 18.734 30.773 13.874 1.00 103.45 ? 18  LYS B NZ  1 
ATOM   913  N  N   . TYR B 1 19 ? 11.562 30.049 11.694 1.00 40.08  ? 19  TYR B N   1 
ATOM   914  C  CA  . TYR B 1 19 ? 11.346 29.361 10.427 1.00 44.13  ? 19  TYR B CA  1 
ATOM   915  C  C   . TYR B 1 19 ? 9.915  29.445 9.941  1.00 44.47  ? 19  TYR B C   1 
ATOM   916  O  O   . TYR B 1 19 ? 9.502  28.710 9.040  1.00 61.98  ? 19  TYR B O   1 
ATOM   917  C  CB  . TYR B 1 19 ? 11.788 27.897 10.618 1.00 46.96  ? 19  TYR B CB  1 
ATOM   918  C  CG  . TYR B 1 19 ? 13.254 27.870 11.008 1.00 58.82  ? 19  TYR B CG  1 
ATOM   919  C  CD1 . TYR B 1 19 ? 13.628 27.938 12.343 1.00 65.92  ? 19  TYR B CD1 1 
ATOM   920  C  CD2 . TYR B 1 19 ? 14.253 27.793 10.047 1.00 63.04  ? 19  TYR B CD2 1 
ATOM   921  C  CE1 . TYR B 1 19 ? 14.962 27.920 12.711 1.00 65.39  ? 19  TYR B CE1 1 
ATOM   922  C  CE2 . TYR B 1 19 ? 15.590 27.773 10.407 1.00 65.55  ? 19  TYR B CE2 1 
ATOM   923  C  CZ  . TYR B 1 19 ? 15.937 27.837 11.740 1.00 63.48  ? 19  TYR B CZ  1 
ATOM   924  O  OH  . TYR B 1 19 ? 17.260 27.817 12.111 1.00 49.72  ? 19  TYR B OH  1 
ATOM   925  N  N   . THR B 1 20 ? 9.123  30.343 10.527 1.00 39.56  ? 20  THR B N   1 
ATOM   926  C  CA  . THR B 1 20 ? 7.720  30.397 10.131 1.00 48.01  ? 20  THR B CA  1 
ATOM   927  C  C   . THR B 1 20 ? 7.471  31.433 9.044  1.00 55.06  ? 20  THR B C   1 
ATOM   928  O  O   . THR B 1 20 ? 6.336  31.583 8.587  1.00 57.26  ? 20  THR B O   1 
ATOM   929  C  CB  . THR B 1 20 ? 6.793  30.743 11.315 1.00 43.91  ? 20  THR B CB  1 
ATOM   930  O  OG1 . THR B 1 20 ? 7.426  31.739 12.125 1.00 46.09  ? 20  THR B OG1 1 
ATOM   931  C  CG2 . THR B 1 20 ? 6.552  29.522 12.185 1.00 28.52  ? 20  THR B CG2 1 
ATOM   932  N  N   . ARG B 1 21 ? 8.518  32.148 8.644  1.00 59.81  ? 21  ARG B N   1 
ATOM   933  C  CA  . ARG B 1 21 ? 8.271  33.290 7.758  1.00 60.91  ? 21  ARG B CA  1 
ATOM   934  C  C   . ARG B 1 21 ? 7.289  34.210 8.479  1.00 59.17  ? 21  ARG B C   1 
ATOM   935  O  O   . ARG B 1 21 ? 7.427  34.398 9.691  1.00 80.32  ? 21  ARG B O   1 
ATOM   936  C  CB  . ARG B 1 21 ? 7.747  32.855 6.401  1.00 61.49  ? 21  ARG B CB  1 
ATOM   937  C  CG  . ARG B 1 21 ? 8.775  32.171 5.506  1.00 64.06  ? 21  ARG B CG  1 
ATOM   938  C  CD  . ARG B 1 21 ? 8.094  31.484 4.338  1.00 66.32  ? 21  ARG B CD  1 
ATOM   939  N  NE  . ARG B 1 21 ? 8.341  32.041 3.033  1.00 67.44  ? 21  ARG B NE  1 
ATOM   940  C  CZ  . ARG B 1 21 ? 8.617  33.255 2.607  1.00 74.19  ? 21  ARG B CZ  1 
ATOM   941  N  NH1 . ARG B 1 21 ? 8.730  34.307 3.409  1.00 80.39  ? 21  ARG B NH1 1 
ATOM   942  N  NH2 . ARG B 1 21 ? 8.795  33.455 1.300  1.00 82.06  ? 21  ARG B NH2 1 
ATOM   943  N  N   . ARG B 1 22 ? 6.307  34.760 7.779  1.00 56.53  ? 22  ARG B N   1 
ATOM   944  C  CA  . ARG B 1 22 ? 5.374  35.669 8.442  1.00 57.39  ? 22  ARG B CA  1 
ATOM   945  C  C   . ARG B 1 22 ? 4.166  34.947 9.007  1.00 52.66  ? 22  ARG B C   1 
ATOM   946  O  O   . ARG B 1 22 ? 3.298  35.565 9.634  1.00 45.56  ? 22  ARG B O   1 
ATOM   947  C  CB  . ARG B 1 22 ? 4.927  36.760 7.463  1.00 66.97  ? 22  ARG B CB  1 
ATOM   948  C  CG  . ARG B 1 22 ? 6.023  37.760 7.129  1.00 82.36  ? 22  ARG B CG  1 
ATOM   949  C  CD  . ARG B 1 22 ? 6.090  38.862 8.175  1.00 100.35 ? 22  ARG B CD  1 
ATOM   950  N  NE  . ARG B 1 22 ? 6.044  40.196 7.580  1.00 111.58 ? 22  ARG B NE  1 
ATOM   951  C  CZ  . ARG B 1 22 ? 5.779  41.318 8.239  1.00 113.95 ? 22  ARG B CZ  1 
ATOM   952  N  NH1 . ARG B 1 22 ? 5.528  41.294 9.542  1.00 113.92 ? 22  ARG B NH1 1 
ATOM   953  N  NH2 . ARG B 1 22 ? 5.765  42.476 7.587  1.00 111.45 ? 22  ARG B NH2 1 
ATOM   954  N  N   . ASP B 1 23 ? 4.037  33.627 8.821  1.00 49.04  ? 23  ASP B N   1 
ATOM   955  C  CA  . ASP B 1 23 ? 2.825  33.057 9.447  1.00 58.42  ? 23  ASP B CA  1 
ATOM   956  C  C   . ASP B 1 23 ? 3.223  32.147 10.602 1.00 58.44  ? 23  ASP B C   1 
ATOM   957  O  O   . ASP B 1 23 ? 4.313  32.302 11.160 1.00 72.96  ? 23  ASP B O   1 
ATOM   958  C  CB  . ASP B 1 23 ? 1.938  32.406 8.405  1.00 63.63  ? 23  ASP B CB  1 
ATOM   959  C  CG  . ASP B 1 23 ? 2.224  30.976 8.031  1.00 68.55  ? 23  ASP B CG  1 
ATOM   960  O  OD1 . ASP B 1 23 ? 3.414  30.618 7.909  1.00 89.86  ? 23  ASP B OD1 1 
ATOM   961  O  OD2 . ASP B 1 23 ? 1.248  30.208 7.866  1.00 53.58  ? 23  ASP B OD2 1 
ATOM   962  N  N   . ASP B 1 24 ? 2.363  31.228 11.008 1.00 55.33  ? 24  ASP B N   1 
ATOM   963  C  CA  . ASP B 1 24 ? 2.548  30.461 12.225 1.00 61.31  ? 24  ASP B CA  1 
ATOM   964  C  C   . ASP B 1 24 ? 2.872  29.002 11.969 1.00 60.42  ? 24  ASP B C   1 
ATOM   965  O  O   . ASP B 1 24 ? 2.616  28.159 12.832 1.00 73.37  ? 24  ASP B O   1 
ATOM   966  C  CB  . ASP B 1 24 ? 1.257  30.532 13.058 1.00 71.40  ? 24  ASP B CB  1 
ATOM   967  C  CG  . ASP B 1 24 ? 0.045  30.179 12.214 1.00 82.85  ? 24  ASP B CG  1 
ATOM   968  O  OD1 . ASP B 1 24 ? 0.165  29.305 11.328 1.00 91.57  ? 24  ASP B OD1 1 
ATOM   969  O  OD2 . ASP B 1 24 ? -1.031 30.777 12.433 1.00 104.13 ? 24  ASP B OD2 1 
ATOM   970  N  N   . LYS B 1 25 ? 3.419  28.687 10.799 1.00 53.28  ? 25  LYS B N   1 
ATOM   971  C  CA  . LYS B 1 25 ? 3.676  27.274 10.515 1.00 50.82  ? 25  LYS B CA  1 
ATOM   972  C  C   . LYS B 1 25 ? 4.932  27.106 9.676  1.00 46.27  ? 25  LYS B C   1 
ATOM   973  O  O   . LYS B 1 25 ? 5.354  28.056 9.017  1.00 54.23  ? 25  LYS B O   1 
ATOM   974  C  CB  . LYS B 1 25 ? 2.465  26.661 9.808  1.00 52.87  ? 25  LYS B CB  1 
ATOM   975  C  CG  . LYS B 1 25 ? 1.520  25.931 10.747 1.00 59.03  ? 25  LYS B CG  1 
ATOM   976  C  CD  . LYS B 1 25 ? 0.142  26.569 10.734 1.00 76.26  ? 25  LYS B CD  1 
ATOM   977  C  CE  . LYS B 1 25 ? -0.893 25.653 11.370 1.00 89.66  ? 25  LYS B CE  1 
ATOM   978  N  NZ  . LYS B 1 25 ? -1.549 24.769 10.364 1.00 115.47 ? 25  LYS B NZ  1 
ATOM   979  N  N   . ILE B 1 26 ? 5.522  25.913 9.696  1.00 43.33  ? 26  ILE B N   1 
ATOM   980  C  CA  . ILE B 1 26 ? 6.770  25.703 8.970  1.00 43.13  ? 26  ILE B CA  1 
ATOM   981  C  C   . ILE B 1 26 ? 6.589  24.820 7.744  1.00 46.60  ? 26  ILE B C   1 
ATOM   982  O  O   . ILE B 1 26 ? 6.044  23.718 7.807  1.00 49.31  ? 26  ILE B O   1 
ATOM   983  C  CB  . ILE B 1 26 ? 7.839  25.078 9.891  1.00 41.73  ? 26  ILE B CB  1 
ATOM   984  C  CG1 . ILE B 1 26 ? 8.169  25.942 11.109 1.00 41.91  ? 26  ILE B CG1 1 
ATOM   985  C  CG2 . ILE B 1 26 ? 9.096  24.738 9.103  1.00 33.23  ? 26  ILE B CG2 1 
ATOM   986  C  CD1 . ILE B 1 26 ? 9.076  25.292 12.128 1.00 32.83  ? 26  ILE B CD1 1 
ATOM   987  N  N   . ASP B 1 27 ? 7.068  25.308 6.597  1.00 45.49  ? 27  ASP B N   1 
ATOM   988  C  CA  . ASP B 1 27 ? 7.015  24.491 5.386  1.00 40.87  ? 27  ASP B CA  1 
ATOM   989  C  C   . ASP B 1 27 ? 8.135  23.459 5.406  1.00 38.54  ? 27  ASP B C   1 
ATOM   990  O  O   . ASP B 1 27 ? 9.048  23.533 6.229  1.00 39.02  ? 27  ASP B O   1 
ATOM   991  C  CB  . ASP B 1 27 ? 7.093  25.355 4.132  1.00 43.11  ? 27  ASP B CB  1 
ATOM   992  C  CG  . ASP B 1 27 ? 8.388  26.100 3.910  1.00 45.77  ? 27  ASP B CG  1 
ATOM   993  O  OD1 . ASP B 1 27 ? 9.488  25.577 4.192  1.00 44.80  ? 27  ASP B OD1 1 
ATOM   994  O  OD2 . ASP B 1 27 ? 8.311  27.252 3.420  1.00 58.58  ? 27  ASP B OD2 1 
ATOM   995  N  N   . LYS B 1 28 ? 8.084  22.507 4.487  1.00 41.64  ? 28  LYS B N   1 
ATOM   996  C  CA  . LYS B 1 28 ? 9.105  21.468 4.421  1.00 42.32  ? 28  LYS B CA  1 
ATOM   997  C  C   . LYS B 1 28 ? 10.513 22.014 4.263  1.00 41.43  ? 28  LYS B C   1 
ATOM   998  O  O   . LYS B 1 28 ? 11.406 21.671 5.050  1.00 52.27  ? 28  LYS B O   1 
ATOM   999  C  CB  . LYS B 1 28 ? 8.782  20.504 3.273  1.00 37.26  ? 28  LYS B CB  1 
ATOM   1000 C  CG  . LYS B 1 28 ? 9.877  19.477 3.030  1.00 38.96  ? 28  LYS B CG  1 
ATOM   1001 C  CD  . LYS B 1 28 ? 9.302  18.212 2.419  1.00 42.02  ? 28  LYS B CD  1 
ATOM   1002 C  CE  . LYS B 1 28 ? 10.385 17.201 2.086  1.00 48.45  ? 28  LYS B CE  1 
ATOM   1003 N  NZ  . LYS B 1 28 ? 9.799  15.979 1.455  1.00 48.29  ? 28  LYS B NZ  1 
ATOM   1004 N  N   . PRO B 1 29 ? 10.786 22.855 3.276  1.00 37.40  ? 29  PRO B N   1 
ATOM   1005 C  CA  . PRO B 1 29 ? 12.185 23.286 3.101  1.00 37.98  ? 29  PRO B CA  1 
ATOM   1006 C  C   . PRO B 1 29 ? 12.672 24.070 4.316  1.00 40.14  ? 29  PRO B C   1 
ATOM   1007 O  O   . PRO B 1 29 ? 13.838 23.991 4.710  1.00 40.82  ? 29  PRO B O   1 
ATOM   1008 C  CB  . PRO B 1 29 ? 12.142 24.165 1.856  1.00 37.19  ? 29  PRO B CB  1 
ATOM   1009 C  CG  . PRO B 1 29 ? 10.713 24.534 1.661  1.00 38.21  ? 29  PRO B CG  1 
ATOM   1010 C  CD  . PRO B 1 29 ? 9.884  23.456 2.291  1.00 35.58  ? 29  PRO B CD  1 
ATOM   1011 N  N   . SER B 1 30 ? 11.762 24.836 4.922  1.00 38.60  ? 30  SER B N   1 
ATOM   1012 C  CA  . SER B 1 30 ? 12.132 25.585 6.119  1.00 38.55  ? 30  SER B CA  1 
ATOM   1013 C  C   . SER B 1 30 ? 12.465 24.646 7.273  1.00 42.22  ? 30  SER B C   1 
ATOM   1014 O  O   . SER B 1 30 ? 13.376 24.912 8.064  1.00 42.09  ? 30  SER B O   1 
ATOM   1015 C  CB  . SER B 1 30 ? 11.004 26.538 6.508  1.00 38.26  ? 30  SER B CB  1 
ATOM   1016 O  OG  . SER B 1 30 ? 10.959 27.641 5.616  1.00 43.79  ? 30  SER B OG  1 
ATOM   1017 N  N   . LEU B 1 31 ? 11.726 23.538 7.369  1.00 42.26  ? 31  LEU B N   1 
ATOM   1018 C  CA  . LEU B 1 31 ? 11.980 22.601 8.458  1.00 42.06  ? 31  LEU B CA  1 
ATOM   1019 C  C   . LEU B 1 31 ? 13.343 21.932 8.298  1.00 44.88  ? 31  LEU B C   1 
ATOM   1020 O  O   . LEU B 1 31 ? 14.107 21.797 9.256  1.00 47.98  ? 31  LEU B O   1 
ATOM   1021 C  CB  . LEU B 1 31 ? 10.902 21.517 8.554  1.00 44.50  ? 31  LEU B CB  1 
ATOM   1022 C  CG  . LEU B 1 31 ? 11.217 20.443 9.612  1.00 47.66  ? 31  LEU B CG  1 
ATOM   1023 C  CD1 . LEU B 1 31 ? 10.859 20.967 10.996 1.00 41.23  ? 31  LEU B CD1 1 
ATOM   1024 C  CD2 . LEU B 1 31 ? 10.509 19.136 9.305  1.00 50.96  ? 31  LEU B CD2 1 
ATOM   1025 N  N   . LEU B 1 32 ? 13.631 21.510 7.070  1.00 46.23  ? 32  LEU B N   1 
ATOM   1026 C  CA  . LEU B 1 32 ? 14.908 20.863 6.784  1.00 43.04  ? 32  LEU B CA  1 
ATOM   1027 C  C   . LEU B 1 32 ? 16.053 21.799 7.142  1.00 40.10  ? 32  LEU B C   1 
ATOM   1028 O  O   . LEU B 1 32 ? 17.066 21.373 7.689  1.00 48.31  ? 32  LEU B O   1 
ATOM   1029 C  CB  . LEU B 1 32 ? 14.974 20.452 5.313  1.00 45.80  ? 32  LEU B CB  1 
ATOM   1030 C  CG  . LEU B 1 32 ? 13.850 19.512 4.860  1.00 52.22  ? 32  LEU B CG  1 
ATOM   1031 C  CD1 . LEU B 1 32 ? 13.959 19.218 3.374  1.00 48.52  ? 32  LEU B CD1 1 
ATOM   1032 C  CD2 . LEU B 1 32 ? 13.869 18.227 5.676  1.00 52.12  ? 32  LEU B CD2 1 
ATOM   1033 N  N   . THR B 1 33 ? 15.853 23.074 6.828  1.00 38.91  ? 33  THR B N   1 
ATOM   1034 C  CA  . THR B 1 33 ? 16.844 24.095 7.146  1.00 41.32  ? 33  THR B CA  1 
ATOM   1035 C  C   . THR B 1 33 ? 17.036 24.203 8.654  1.00 42.25  ? 33  THR B C   1 
ATOM   1036 O  O   . THR B 1 33 ? 18.139 24.176 9.196  1.00 40.76  ? 33  THR B O   1 
ATOM   1037 C  CB  . THR B 1 33 ? 16.430 25.472 6.603  1.00 40.05  ? 33  THR B CB  1 
ATOM   1038 O  OG1 . THR B 1 33 ? 16.373 25.435 5.175  1.00 52.44  ? 33  THR B OG1 1 
ATOM   1039 C  CG2 . THR B 1 33 ? 17.479 26.498 6.996  1.00 32.60  ? 33  THR B CG2 1 
ATOM   1040 N  N   . MET B 1 34 ? 15.904 24.323 9.341  1.00 40.21  ? 34  MET B N   1 
ATOM   1041 C  CA  . MET B 1 34 ? 15.901 24.372 10.797 1.00 41.76  ? 34  MET B CA  1 
ATOM   1042 C  C   . MET B 1 34 ? 16.697 23.217 11.396 1.00 42.01  ? 34  MET B C   1 
ATOM   1043 O  O   . MET B 1 34 ? 17.492 23.394 12.317 1.00 45.84  ? 34  MET B O   1 
ATOM   1044 C  CB  . MET B 1 34 ? 14.451 24.350 11.277 1.00 40.23  ? 34  MET B CB  1 
ATOM   1045 C  CG  . MET B 1 34 ? 14.286 24.692 12.753 1.00 40.36  ? 34  MET B CG  1 
ATOM   1046 S  SD  . MET B 1 34 ? 13.133 23.550 13.535 1.00 75.77  ? 34  MET B SD  1 
ATOM   1047 C  CE  . MET B 1 34 ? 14.050 22.014 13.404 1.00 47.38  ? 34  MET B CE  1 
ATOM   1048 N  N   . MET B 1 35 ? 16.471 22.028 10.852 1.00 40.40  ? 35  MET B N   1 
ATOM   1049 C  CA  . MET B 1 35 ? 17.137 20.811 11.282 1.00 43.89  ? 35  MET B CA  1 
ATOM   1050 C  C   . MET B 1 35 ? 18.646 20.889 11.090 1.00 52.01  ? 35  MET B C   1 
ATOM   1051 O  O   . MET B 1 35 ? 19.436 20.528 11.962 1.00 62.61  ? 35  MET B O   1 
ATOM   1052 C  CB  . MET B 1 35 ? 16.590 19.611 10.502 1.00 40.29  ? 35  MET B CB  1 
ATOM   1053 C  CG  . MET B 1 35 ? 15.258 19.095 11.034 1.00 40.78  ? 35  MET B CG  1 
ATOM   1054 S  SD  . MET B 1 35 ? 15.314 18.671 12.784 1.00 57.67  ? 35  MET B SD  1 
ATOM   1055 C  CE  . MET B 1 35 ? 16.219 17.125 12.736 1.00 34.43  ? 35  MET B CE  1 
ATOM   1056 N  N   . LYS B 1 36 ? 19.054 21.360 9.916  1.00 53.45  ? 36  LYS B N   1 
ATOM   1057 C  CA  . LYS B 1 36 ? 20.475 21.397 9.584  1.00 53.79  ? 36  LYS B CA  1 
ATOM   1058 C  C   . LYS B 1 36 ? 21.221 22.405 10.445 1.00 48.05  ? 36  LYS B C   1 
ATOM   1059 O  O   . LYS B 1 36 ? 22.330 22.111 10.900 1.00 42.84  ? 36  LYS B O   1 
ATOM   1060 C  CB  . LYS B 1 36 ? 20.646 21.705 8.092  1.00 63.95  ? 36  LYS B CB  1 
ATOM   1061 C  CG  . LYS B 1 36 ? 20.964 20.487 7.237  1.00 73.74  ? 36  LYS B CG  1 
ATOM   1062 C  CD  . LYS B 1 36 ? 20.017 20.300 6.066  1.00 82.41  ? 36  LYS B CD  1 
ATOM   1063 C  CE  . LYS B 1 36 ? 20.683 20.610 4.734  1.00 89.72  ? 36  LYS B CE  1 
ATOM   1064 N  NZ  . LYS B 1 36 ? 19.884 21.595 3.946  1.00 104.17 ? 36  LYS B NZ  1 
ATOM   1065 N  N   . GLU B 1 37 ? 20.627 23.572 10.666 1.00 45.20  ? 37  GLU B N   1 
ATOM   1066 C  CA  . GLU B 1 37 ? 21.234 24.636 11.448 1.00 45.51  ? 37  GLU B CA  1 
ATOM   1067 C  C   . GLU B 1 37 ? 21.275 24.343 12.946 1.00 46.68  ? 37  GLU B C   1 
ATOM   1068 O  O   . GLU B 1 37 ? 22.155 24.821 13.661 1.00 48.93  ? 37  GLU B O   1 
ATOM   1069 C  CB  . GLU B 1 37 ? 20.461 25.944 11.273 1.00 46.60  ? 37  GLU B CB  1 
ATOM   1070 C  CG  . GLU B 1 37 ? 20.516 26.624 9.926  1.00 52.94  ? 37  GLU B CG  1 
ATOM   1071 C  CD  . GLU B 1 37 ? 19.807 27.972 9.932  1.00 60.41  ? 37  GLU B CD  1 
ATOM   1072 O  OE1 . GLU B 1 37 ? 19.166 28.338 10.942 1.00 61.01  ? 37  GLU B OE1 1 
ATOM   1073 O  OE2 . GLU B 1 37 ? 19.882 28.693 8.911  1.00 67.61  ? 37  GLU B OE2 1 
ATOM   1074 N  N   . ASN B 1 38 ? 20.303 23.587 13.449 1.00 47.28  ? 38  ASN B N   1 
ATOM   1075 C  CA  . ASN B 1 38 ? 20.145 23.467 14.893 1.00 47.43  ? 38  ASN B CA  1 
ATOM   1076 C  C   . ASN B 1 38 ? 20.414 22.066 15.404 1.00 46.75  ? 38  ASN B C   1 
ATOM   1077 O  O   . ASN B 1 38 ? 20.669 21.890 16.600 1.00 52.71  ? 38  ASN B O   1 
ATOM   1078 C  CB  . ASN B 1 38 ? 18.727 23.886 15.303 1.00 47.33  ? 38  ASN B CB  1 
ATOM   1079 C  CG  . ASN B 1 38 ? 18.483 25.363 15.056 1.00 48.95  ? 38  ASN B CG  1 
ATOM   1080 O  OD1 . ASN B 1 38 ? 18.757 26.206 15.912 1.00 47.30  ? 38  ASN B OD1 1 
ATOM   1081 N  ND2 . ASN B 1 38 ? 17.963 25.652 13.867 1.00 39.61  ? 38  ASN B ND2 1 
ATOM   1082 N  N   . PHE B 1 39 ? 20.379 21.052 14.543 1.00 44.41  ? 39  PHE B N   1 
ATOM   1083 C  CA  . PHE B 1 39 ? 20.698 19.705 15.026 1.00 43.81  ? 39  PHE B CA  1 
ATOM   1084 C  C   . PHE B 1 39 ? 21.735 19.008 14.164 1.00 46.27  ? 39  PHE B C   1 
ATOM   1085 O  O   . PHE B 1 39 ? 21.519 17.884 13.699 1.00 48.73  ? 39  PHE B O   1 
ATOM   1086 C  CB  . PHE B 1 39 ? 19.399 18.884 15.116 1.00 38.62  ? 39  PHE B CB  1 
ATOM   1087 C  CG  . PHE B 1 39 ? 18.469 19.470 16.172 1.00 39.83  ? 39  PHE B CG  1 
ATOM   1088 C  CD1 . PHE B 1 39 ? 18.626 19.134 17.508 1.00 42.80  ? 39  PHE B CD1 1 
ATOM   1089 C  CD2 . PHE B 1 39 ? 17.458 20.349 15.818 1.00 40.65  ? 39  PHE B CD2 1 
ATOM   1090 C  CE1 . PHE B 1 39 ? 17.794 19.665 18.479 1.00 43.16  ? 39  PHE B CE1 1 
ATOM   1091 C  CE2 . PHE B 1 39 ? 16.619 20.882 16.785 1.00 42.02  ? 39  PHE B CE2 1 
ATOM   1092 C  CZ  . PHE B 1 39 ? 16.792 20.546 18.116 1.00 42.55  ? 39  PHE B CZ  1 
ATOM   1093 N  N   . PRO B 1 40 ? 22.882 19.643 13.946 1.00 49.72  ? 40  PRO B N   1 
ATOM   1094 C  CA  . PRO B 1 40 ? 23.860 19.085 13.001 1.00 49.34  ? 40  PRO B CA  1 
ATOM   1095 C  C   . PRO B 1 40 ? 24.507 17.815 13.535 1.00 46.90  ? 40  PRO B C   1 
ATOM   1096 O  O   . PRO B 1 40 ? 24.768 16.851 12.819 1.00 41.99  ? 40  PRO B O   1 
ATOM   1097 C  CB  . PRO B 1 40 ? 24.895 20.208 12.900 1.00 50.45  ? 40  PRO B CB  1 
ATOM   1098 C  CG  . PRO B 1 40 ? 24.833 20.884 14.234 1.00 46.96  ? 40  PRO B CG  1 
ATOM   1099 C  CD  . PRO B 1 40 ? 23.371 20.886 14.567 1.00 47.19  ? 40  PRO B CD  1 
ATOM   1100 N  N   . ASN B 1 41 ? 24.776 17.812 14.843 1.00 46.83  ? 41  ASN B N   1 
ATOM   1101 C  CA  . ASN B 1 41 ? 25.430 16.626 15.397 1.00 47.30  ? 41  ASN B CA  1 
ATOM   1102 C  C   . ASN B 1 41 ? 24.473 15.446 15.410 1.00 50.58  ? 41  ASN B C   1 
ATOM   1103 O  O   . ASN B 1 41 ? 24.858 14.326 15.057 1.00 58.10  ? 41  ASN B O   1 
ATOM   1104 C  CB  . ASN B 1 41 ? 25.967 16.960 16.792 1.00 47.28  ? 41  ASN B CB  1 
ATOM   1105 C  CG  . ASN B 1 41 ? 26.919 18.142 16.729 1.00 47.17  ? 41  ASN B CG  1 
ATOM   1106 O  OD1 . ASN B 1 41 ? 28.108 17.961 16.479 1.00 63.36  ? 41  ASN B OD1 1 
ATOM   1107 N  ND2 . ASN B 1 41 ? 26.406 19.345 16.949 1.00 50.05  ? 41  ASN B ND2 1 
ATOM   1108 N  N   . PHE B 1 42 ? 23.225 15.688 15.814 1.00 49.03  ? 42  PHE B N   1 
ATOM   1109 C  CA  . PHE B 1 42 ? 22.249 14.598 15.800 1.00 44.04  ? 42  PHE B CA  1 
ATOM   1110 C  C   . PHE B 1 42 ? 22.165 14.060 14.375 1.00 44.83  ? 42  PHE B C   1 
ATOM   1111 O  O   . PHE B 1 42 ? 22.035 12.867 14.137 1.00 57.51  ? 42  PHE B O   1 
ATOM   1112 C  CB  . PHE B 1 42 ? 20.883 15.055 16.297 1.00 46.43  ? 42  PHE B CB  1 
ATOM   1113 C  CG  . PHE B 1 42 ? 19.740 14.096 15.997 1.00 55.53  ? 42  PHE B CG  1 
ATOM   1114 C  CD1 . PHE B 1 42 ? 19.494 13.016 16.826 1.00 58.52  ? 42  PHE B CD1 1 
ATOM   1115 C  CD2 . PHE B 1 42 ? 18.917 14.275 14.893 1.00 56.28  ? 42  PHE B CD2 1 
ATOM   1116 C  CE1 . PHE B 1 42 ? 18.458 12.140 16.552 1.00 57.09  ? 42  PHE B CE1 1 
ATOM   1117 C  CE2 . PHE B 1 42 ? 17.885 13.404 14.607 1.00 54.54  ? 42  PHE B CE2 1 
ATOM   1118 C  CZ  . PHE B 1 42 ? 17.654 12.327 15.442 1.00 55.91  ? 42  PHE B CZ  1 
ATOM   1119 N  N   . LEU B 1 43 ? 22.262 14.998 13.435 1.00 47.20  ? 43  LEU B N   1 
ATOM   1120 C  CA  . LEU B 1 43 ? 22.197 14.622 12.028 1.00 51.64  ? 43  LEU B CA  1 
ATOM   1121 C  C   . LEU B 1 43 ? 23.402 13.767 11.648 1.00 50.61  ? 43  LEU B C   1 
ATOM   1122 O  O   . LEU B 1 43 ? 23.240 12.659 11.130 1.00 53.10  ? 43  LEU B O   1 
ATOM   1123 C  CB  . LEU B 1 43 ? 22.111 15.862 11.139 1.00 49.57  ? 43  LEU B CB  1 
ATOM   1124 C  CG  . LEU B 1 43 ? 20.795 16.638 11.166 1.00 48.49  ? 43  LEU B CG  1 
ATOM   1125 C  CD1 . LEU B 1 43 ? 20.930 17.925 10.362 1.00 37.65  ? 43  LEU B CD1 1 
ATOM   1126 C  CD2 . LEU B 1 43 ? 19.640 15.790 10.653 1.00 41.53  ? 43  LEU B CD2 1 
ATOM   1127 N  N   . SER B 1 44 ? 24.601 14.281 11.908 1.00 47.97  ? 44  SER B N   1 
ATOM   1128 C  CA  . SER B 1 44 ? 25.803 13.535 11.537 1.00 48.89  ? 44  SER B CA  1 
ATOM   1129 C  C   . SER B 1 44 ? 25.782 12.154 12.181 1.00 50.16  ? 44  SER B C   1 
ATOM   1130 O  O   . SER B 1 44 ? 26.079 11.148 11.539 1.00 57.40  ? 44  SER B O   1 
ATOM   1131 C  CB  . SER B 1 44 ? 27.060 14.302 11.936 1.00 54.38  ? 44  SER B CB  1 
ATOM   1132 O  OG  . SER B 1 44 ? 27.414 14.041 13.283 1.00 89.31  ? 44  SER B OG  1 
ATOM   1133 N  N   . ALA B 1 45 ? 25.407 12.119 13.458 1.00 52.21  ? 45  ALA B N   1 
ATOM   1134 C  CA  . ALA B 1 45 ? 25.298 10.862 14.189 1.00 53.05  ? 45  ALA B CA  1 
ATOM   1135 C  C   . ALA B 1 45 ? 24.427 9.872  13.427 1.00 53.89  ? 45  ALA B C   1 
ATOM   1136 O  O   . ALA B 1 45 ? 24.709 8.686  13.314 1.00 57.47  ? 45  ALA B O   1 
ATOM   1137 C  CB  . ALA B 1 45 ? 24.728 11.106 15.574 1.00 53.27  ? 45  ALA B CB  1 
ATOM   1138 N  N   . CYS B 1 46 ? 23.338 10.410 12.888 1.00 54.03  ? 46  CYS B N   1 
ATOM   1139 C  CA  . CYS B 1 46 ? 22.432 9.610  12.079 1.00 60.27  ? 46  CYS B CA  1 
ATOM   1140 C  C   . CYS B 1 46 ? 23.129 9.134  10.815 1.00 66.66  ? 46  CYS B C   1 
ATOM   1141 O  O   . CYS B 1 46 ? 23.071 7.970  10.426 1.00 70.16  ? 46  CYS B O   1 
ATOM   1142 C  CB  . CYS B 1 46 ? 21.187 10.440 11.738 1.00 61.25  ? 46  CYS B CB  1 
ATOM   1143 S  SG  . CYS B 1 46 ? 20.107 10.660 13.185 1.00 66.98  ? 46  CYS B SG  1 
ATOM   1144 N  N   . ASP B 1 47 ? 23.815 10.059 10.141 1.00 70.63  ? 47  ASP B N   1 
ATOM   1145 C  CA  . ASP B 1 47 ? 24.405 9.662  8.860  1.00 77.72  ? 47  ASP B CA  1 
ATOM   1146 C  C   . ASP B 1 47 ? 25.459 8.595  9.104  1.00 76.84  ? 47  ASP B C   1 
ATOM   1147 O  O   . ASP B 1 47 ? 25.570 7.623  8.362  1.00 79.71  ? 47  ASP B O   1 
ATOM   1148 C  CB  . ASP B 1 47 ? 24.981 10.873 8.133  1.00 90.34  ? 47  ASP B CB  1 
ATOM   1149 C  CG  . ASP B 1 47 ? 23.927 11.956 7.959  1.00 104.62 ? 47  ASP B CG  1 
ATOM   1150 O  OD1 . ASP B 1 47 ? 22.765 11.589 7.675  1.00 126.68 ? 47  ASP B OD1 1 
ATOM   1151 O  OD2 . ASP B 1 47 ? 24.262 13.146 8.121  1.00 118.94 ? 47  ASP B OD2 1 
ATOM   1152 N  N   . LYS B 1 48 ? 26.227 8.784  10.177 1.00 75.98  ? 48  LYS B N   1 
ATOM   1153 C  CA  . LYS B 1 48 ? 27.297 7.836  10.467 1.00 76.52  ? 48  LYS B CA  1 
ATOM   1154 C  C   . LYS B 1 48 ? 26.739 6.425  10.604 1.00 75.88  ? 48  LYS B C   1 
ATOM   1155 O  O   . LYS B 1 48 ? 27.375 5.458  10.188 1.00 93.19  ? 48  LYS B O   1 
ATOM   1156 C  CB  . LYS B 1 48 ? 28.054 8.233  11.733 1.00 81.42  ? 48  LYS B CB  1 
ATOM   1157 C  CG  . LYS B 1 48 ? 29.457 8.760  11.472 1.00 87.05  ? 48  LYS B CG  1 
ATOM   1158 C  CD  . LYS B 1 48 ? 30.259 8.827  12.762 1.00 94.33  ? 48  LYS B CD  1 
ATOM   1159 C  CE  . LYS B 1 48 ? 30.381 7.445  13.392 1.00 100.42 ? 48  LYS B CE  1 
ATOM   1160 N  NZ  . LYS B 1 48 ? 31.712 6.826  13.130 1.00 112.81 ? 48  LYS B NZ  1 
ATOM   1161 N  N   . LYS B 1 49 ? 25.549 6.320  11.182 1.00 74.75  ? 49  LYS B N   1 
ATOM   1162 C  CA  . LYS B 1 49 ? 24.916 5.013  11.366 1.00 76.84  ? 49  LYS B CA  1 
ATOM   1163 C  C   . LYS B 1 49 ? 24.326 4.533  10.043 1.00 79.65  ? 49  LYS B C   1 
ATOM   1164 O  O   . LYS B 1 49 ? 23.844 3.408  9.919  1.00 73.94  ? 49  LYS B O   1 
ATOM   1165 C  CB  . LYS B 1 49 ? 23.861 5.096  12.462 1.00 79.11  ? 49  LYS B CB  1 
ATOM   1166 C  CG  . LYS B 1 49 ? 22.952 3.880  12.549 1.00 84.15  ? 49  LYS B CG  1 
ATOM   1167 C  CD  . LYS B 1 49 ? 21.750 4.182  13.426 1.00 89.54  ? 49  LYS B CD  1 
ATOM   1168 C  CE  . LYS B 1 49 ? 20.529 3.366  13.029 1.00 94.21  ? 49  LYS B CE  1 
ATOM   1169 N  NZ  . LYS B 1 49 ? 19.263 4.129  13.230 1.00 98.59  ? 49  LYS B NZ  1 
ATOM   1170 N  N   . GLY B 1 50 ? 24.381 5.417  9.049  1.00 82.61  ? 50  GLY B N   1 
ATOM   1171 C  CA  . GLY B 1 50 ? 23.873 5.127  7.722  1.00 85.23  ? 50  GLY B CA  1 
ATOM   1172 C  C   . GLY B 1 50 ? 22.417 5.516  7.557  1.00 86.31  ? 50  GLY B C   1 
ATOM   1173 O  O   . GLY B 1 50 ? 21.729 5.036  6.653  1.00 103.78 ? 50  GLY B O   1 
ATOM   1174 N  N   . THR B 1 51 ? 21.930 6.396  8.429  1.00 78.83  ? 51  THR B N   1 
ATOM   1175 C  CA  . THR B 1 51 ? 20.539 6.831  8.367  1.00 69.82  ? 51  THR B CA  1 
ATOM   1176 C  C   . THR B 1 51 ? 20.435 8.313  8.038  1.00 65.87  ? 51  THR B C   1 
ATOM   1177 O  O   . THR B 1 51 ? 20.996 9.158  8.739  1.00 74.89  ? 51  THR B O   1 
ATOM   1178 C  CB  . THR B 1 51 ? 19.821 6.553  9.702  1.00 69.01  ? 51  THR B CB  1 
ATOM   1179 O  OG1 . THR B 1 51 ? 19.901 5.155  10.006 1.00 75.49  ? 51  THR B OG1 1 
ATOM   1180 C  CG2 . THR B 1 51 ? 18.341 6.888  9.607  1.00 65.13  ? 51  THR B CG2 1 
ATOM   1181 N  N   . ASN B 1 52 ? 19.711 8.645  6.970  1.00 61.45  ? 52  ASN B N   1 
ATOM   1182 C  CA  . ASN B 1 52 ? 19.468 10.055 6.678  1.00 62.85  ? 52  ASN B CA  1 
ATOM   1183 C  C   . ASN B 1 52 ? 18.080 10.444 7.199  1.00 59.06  ? 52  ASN B C   1 
ATOM   1184 O  O   . ASN B 1 52 ? 17.059 10.236 6.546  1.00 55.05  ? 52  ASN B O   1 
ATOM   1185 C  CB  . ASN B 1 52 ? 19.591 10.390 5.195  1.00 69.82  ? 52  ASN B CB  1 
ATOM   1186 C  CG  . ASN B 1 52 ? 18.853 11.676 4.852  1.00 79.98  ? 52  ASN B CG  1 
ATOM   1187 O  OD1 . ASN B 1 52 ? 17.728 11.620 4.356  1.00 91.46  ? 52  ASN B OD1 1 
ATOM   1188 N  ND2 . ASN B 1 52 ? 19.462 12.825 5.123  1.00 92.38  ? 52  ASN B ND2 1 
ATOM   1189 N  N   . TYR B 1 53 ? 18.097 11.014 8.396  1.00 53.92  ? 53  TYR B N   1 
ATOM   1190 C  CA  . TYR B 1 53 ? 16.897 11.441 9.100  1.00 47.46  ? 53  TYR B CA  1 
ATOM   1191 C  C   . TYR B 1 53 ? 16.019 12.338 8.241  1.00 43.79  ? 53  TYR B C   1 
ATOM   1192 O  O   . TYR B 1 53 ? 14.794 12.237 8.281  1.00 51.10  ? 53  TYR B O   1 
ATOM   1193 C  CB  . TYR B 1 53 ? 17.324 12.171 10.374 1.00 51.26  ? 53  TYR B CB  1 
ATOM   1194 C  CG  . TYR B 1 53 ? 16.326 12.192 11.498 1.00 51.89  ? 53  TYR B CG  1 
ATOM   1195 C  CD1 . TYR B 1 53 ? 16.104 11.068 12.284 1.00 52.26  ? 53  TYR B CD1 1 
ATOM   1196 C  CD2 . TYR B 1 53 ? 15.602 13.343 11.787 1.00 47.68  ? 53  TYR B CD2 1 
ATOM   1197 C  CE1 . TYR B 1 53 ? 15.185 11.099 13.318 1.00 51.31  ? 53  TYR B CE1 1 
ATOM   1198 C  CE2 . TYR B 1 53 ? 14.685 13.380 12.819 1.00 43.91  ? 53  TYR B CE2 1 
ATOM   1199 C  CZ  . TYR B 1 53 ? 14.482 12.252 13.582 1.00 46.86  ? 53  TYR B CZ  1 
ATOM   1200 O  OH  . TYR B 1 53 ? 13.570 12.275 14.610 1.00 70.46  ? 53  TYR B OH  1 
ATOM   1201 N  N   . LEU B 1 54 ? 16.649 13.226 7.471  1.00 44.75  ? 54  LEU B N   1 
ATOM   1202 C  CA  . LEU B 1 54 ? 15.920 14.260 6.743  1.00 44.24  ? 54  LEU B CA  1 
ATOM   1203 C  C   . LEU B 1 54 ? 14.990 13.683 5.685  1.00 43.40  ? 54  LEU B C   1 
ATOM   1204 O  O   . LEU B 1 54 ? 14.025 14.321 5.269  1.00 52.53  ? 54  LEU B O   1 
ATOM   1205 C  CB  . LEU B 1 54 ? 16.888 15.233 6.069  1.00 45.77  ? 54  LEU B CB  1 
ATOM   1206 C  CG  . LEU B 1 54 ? 17.764 16.103 6.966  1.00 47.60  ? 54  LEU B CG  1 
ATOM   1207 C  CD1 . LEU B 1 54 ? 18.272 17.316 6.198  1.00 46.33  ? 54  LEU B CD1 1 
ATOM   1208 C  CD2 . LEU B 1 54 ? 17.010 16.533 8.214  1.00 43.98  ? 54  LEU B CD2 1 
ATOM   1209 N  N   . ALA B 1 55 ? 15.292 12.470 5.248  1.00 41.83  ? 55  ALA B N   1 
ATOM   1210 C  CA  . ALA B 1 55 ? 14.567 11.833 4.162  1.00 45.50  ? 55  ALA B CA  1 
ATOM   1211 C  C   . ALA B 1 55 ? 13.063 11.858 4.358  1.00 52.27  ? 55  ALA B C   1 
ATOM   1212 O  O   . ALA B 1 55 ? 12.319 12.049 3.388  1.00 59.86  ? 55  ALA B O   1 
ATOM   1213 C  CB  . ALA B 1 55 ? 15.052 10.393 4.007  1.00 51.80  ? 55  ALA B CB  1 
ATOM   1214 N  N   . ASP B 1 56 ? 12.557 11.660 5.577  1.00 52.44  ? 56  ASP B N   1 
ATOM   1215 C  CA  . ASP B 1 56 ? 11.097 11.556 5.684  1.00 55.79  ? 56  ASP B CA  1 
ATOM   1216 C  C   . ASP B 1 56 ? 10.552 12.208 6.947  1.00 51.58  ? 56  ASP B C   1 
ATOM   1217 O  O   . ASP B 1 56 ? 9.362  12.078 7.259  1.00 47.94  ? 56  ASP B O   1 
ATOM   1218 C  CB  . ASP B 1 56 ? 10.658 10.088 5.660  1.00 64.10  ? 56  ASP B CB  1 
ATOM   1219 C  CG  . ASP B 1 56 ? 11.289 9.294  6.790  1.00 69.84  ? 56  ASP B CG  1 
ATOM   1220 O  OD1 . ASP B 1 56 ? 12.377 9.700  7.258  1.00 72.82  ? 56  ASP B OD1 1 
ATOM   1221 O  OD2 . ASP B 1 56 ? 10.693 8.270  7.193  1.00 80.80  ? 56  ASP B OD2 1 
ATOM   1222 N  N   . VAL B 1 57 ? 11.452 12.895 7.638  1.00 44.18  ? 57  VAL B N   1 
ATOM   1223 C  CA  . VAL B 1 57 ? 11.103 13.614 8.853  1.00 43.75  ? 57  VAL B CA  1 
ATOM   1224 C  C   . VAL B 1 57 ? 9.851  14.460 8.638  1.00 41.71  ? 57  VAL B C   1 
ATOM   1225 O  O   . VAL B 1 57 ? 8.906  14.366 9.420  1.00 52.70  ? 57  VAL B O   1 
ATOM   1226 C  CB  . VAL B 1 57 ? 12.242 14.532 9.328  1.00 46.49  ? 57  VAL B CB  1 
ATOM   1227 C  CG1 . VAL B 1 57 ? 12.804 15.340 8.169  1.00 45.56  ? 57  VAL B CG1 1 
ATOM   1228 C  CG2 . VAL B 1 57 ? 11.746 15.452 10.436 1.00 42.11  ? 57  VAL B CG2 1 
ATOM   1229 N  N   . PHE B 1 58 ? 9.863  15.268 7.581  1.00 37.87  ? 58  PHE B N   1 
ATOM   1230 C  CA  . PHE B 1 58 ? 8.727  16.144 7.331  1.00 37.95  ? 58  PHE B CA  1 
ATOM   1231 C  C   . PHE B 1 58 ? 7.465  15.295 7.211  1.00 43.50  ? 58  PHE B C   1 
ATOM   1232 O  O   . PHE B 1 58 ? 6.441  15.555 7.841  1.00 45.99  ? 58  PHE B O   1 
ATOM   1233 C  CB  . PHE B 1 58 ? 8.908  17.003 6.074  1.00 37.26  ? 58  PHE B CB  1 
ATOM   1234 C  CG  . PHE B 1 58 ? 7.829  18.077 5.985  1.00 40.18  ? 58  PHE B CG  1 
ATOM   1235 C  CD1 . PHE B 1 58 ? 7.955  19.272 6.668  1.00 43.97  ? 58  PHE B CD1 1 
ATOM   1236 C  CD2 . PHE B 1 58 ? 6.691  17.870 5.226  1.00 38.98  ? 58  PHE B CD2 1 
ATOM   1237 C  CE1 . PHE B 1 58 ? 6.965  20.239 6.605  1.00 42.99  ? 58  PHE B CE1 1 
ATOM   1238 C  CE2 . PHE B 1 58 ? 5.703  18.834 5.151  1.00 41.85  ? 58  PHE B CE2 1 
ATOM   1239 C  CZ  . PHE B 1 58 ? 5.834  20.025 5.842  1.00 41.35  ? 58  PHE B CZ  1 
ATOM   1240 N  N   . GLU B 1 59 ? 7.593  14.257 6.387  1.00 47.93  ? 59  GLU B N   1 
ATOM   1241 C  CA  . GLU B 1 59 ? 6.442  13.398 6.115  1.00 48.97  ? 59  GLU B CA  1 
ATOM   1242 C  C   . GLU B 1 59 ? 5.994  12.699 7.388  1.00 46.39  ? 59  GLU B C   1 
ATOM   1243 O  O   . GLU B 1 59 ? 4.796  12.643 7.666  1.00 51.87  ? 59  GLU B O   1 
ATOM   1244 C  CB  . GLU B 1 59 ? 6.770  12.390 5.012  1.00 47.11  ? 59  GLU B CB  1 
ATOM   1245 C  CG  . GLU B 1 59 ? 6.717  13.025 3.623  1.00 41.18  ? 59  GLU B CG  1 
ATOM   1246 C  CD  . GLU B 1 59 ? 7.908  13.931 3.374  1.00 46.20  ? 59  GLU B CD  1 
ATOM   1247 O  OE1 . GLU B 1 59 ? 9.052  13.446 3.537  1.00 51.11  ? 59  GLU B OE1 1 
ATOM   1248 O  OE2 . GLU B 1 59 ? 7.715  15.115 3.023  1.00 51.35  ? 59  GLU B OE2 1 
ATOM   1249 N  N   . LYS B 1 60 ? 6.939  12.182 8.166  1.00 46.66  ? 60  LYS B N   1 
ATOM   1250 C  CA  . LYS B 1 60 ? 6.604  11.540 9.430  1.00 48.63  ? 60  LYS B CA  1 
ATOM   1251 C  C   . LYS B 1 60 ? 5.856  12.469 10.381 1.00 48.86  ? 60  LYS B C   1 
ATOM   1252 O  O   . LYS B 1 60 ? 5.000  12.023 11.144 1.00 62.21  ? 60  LYS B O   1 
ATOM   1253 C  CB  . LYS B 1 60 ? 7.887  11.082 10.121 1.00 46.64  ? 60  LYS B CB  1 
ATOM   1254 C  CG  . LYS B 1 60 ? 8.472  9.826  9.492  1.00 53.11  ? 60  LYS B CG  1 
ATOM   1255 C  CD  . LYS B 1 60 ? 8.627  8.761  10.566 1.00 58.57  ? 60  LYS B CD  1 
ATOM   1256 C  CE  . LYS B 1 60 ? 10.059 8.231  10.633 1.00 61.06  ? 60  LYS B CE  1 
ATOM   1257 N  NZ  . LYS B 1 60 ? 11.048 9.351  10.704 1.00 64.57  ? 60  LYS B NZ  1 
ATOM   1258 N  N   . LYS B 1 61 ? 6.189  13.760 10.359 1.00 40.94  ? 61  LYS B N   1 
ATOM   1259 C  CA  . LYS B 1 61 ? 5.695  14.630 11.422 1.00 42.69  ? 61  LYS B CA  1 
ATOM   1260 C  C   . LYS B 1 61 ? 4.497  15.460 11.003 1.00 43.45  ? 61  LYS B C   1 
ATOM   1261 O  O   . LYS B 1 61 ? 3.804  16.028 11.857 1.00 49.36  ? 61  LYS B O   1 
ATOM   1262 C  CB  . LYS B 1 61 ? 6.818  15.555 11.906 1.00 48.86  ? 61  LYS B CB  1 
ATOM   1263 C  CG  . LYS B 1 61 ? 7.997  14.830 12.534 1.00 55.36  ? 61  LYS B CG  1 
ATOM   1264 C  CD  . LYS B 1 61 ? 7.600  13.482 13.102 1.00 57.92  ? 61  LYS B CD  1 
ATOM   1265 C  CE  . LYS B 1 61 ? 7.735  13.430 14.616 1.00 58.09  ? 61  LYS B CE  1 
ATOM   1266 N  NZ  . LYS B 1 61 ? 7.646  12.027 15.110 1.00 61.84  ? 61  LYS B NZ  1 
ATOM   1267 N  N   . ASP B 1 62 ? 4.226  15.556 9.702  1.00 46.66  ? 62  ASP B N   1 
ATOM   1268 C  CA  . ASP B 1 62 ? 3.041  16.326 9.309  1.00 49.38  ? 62  ASP B CA  1 
ATOM   1269 C  C   . ASP B 1 62 ? 1.784  15.474 9.466  1.00 55.47  ? 62  ASP B C   1 
ATOM   1270 O  O   . ASP B 1 62 ? 1.123  15.110 8.493  1.00 48.88  ? 62  ASP B O   1 
ATOM   1271 C  CB  . ASP B 1 62 ? 3.192  16.843 7.882  1.00 44.73  ? 62  ASP B CB  1 
ATOM   1272 C  CG  . ASP B 1 62 ? 1.982  17.668 7.470  1.00 47.61  ? 62  ASP B CG  1 
ATOM   1273 O  OD1 . ASP B 1 62 ? 1.220  18.078 8.378  1.00 47.45  ? 62  ASP B OD1 1 
ATOM   1274 O  OD2 . ASP B 1 62 ? 1.704  17.722 6.253  1.00 45.75  ? 62  ASP B OD2 1 
ATOM   1275 N  N   . LYS B 1 63 ? 1.473  15.155 10.716 1.00 61.61  ? 63  LYS B N   1 
ATOM   1276 C  CA  . LYS B 1 63 ? 0.418  14.223 11.079 1.00 64.66  ? 63  LYS B CA  1 
ATOM   1277 C  C   . LYS B 1 63 ? -0.883 14.506 10.345 1.00 55.43  ? 63  LYS B C   1 
ATOM   1278 O  O   . LYS B 1 63 ? -1.578 13.579 9.938  1.00 57.20  ? 63  LYS B O   1 
ATOM   1279 C  CB  . LYS B 1 63 ? 0.166  14.254 12.592 1.00 76.84  ? 63  LYS B CB  1 
ATOM   1280 C  CG  . LYS B 1 63 ? 0.261  12.890 13.260 1.00 91.01  ? 63  LYS B CG  1 
ATOM   1281 C  CD  . LYS B 1 63 ? -0.374 12.901 14.642 1.00 102.59 ? 63  LYS B CD  1 
ATOM   1282 C  CE  . LYS B 1 63 ? -1.527 11.913 14.746 1.00 108.74 ? 63  LYS B CE  1 
ATOM   1283 N  NZ  . LYS B 1 63 ? -1.218 10.751 15.628 1.00 110.14 ? 63  LYS B NZ  1 
ATOM   1284 N  N   . ASN B 1 64 ? -1.225 15.777 10.161 1.00 50.60  ? 64  ASN B N   1 
ATOM   1285 C  CA  . ASN B 1 64 ? -2.515 16.065 9.536  1.00 50.77  ? 64  ASN B CA  1 
ATOM   1286 C  C   . ASN B 1 64 ? -2.358 16.350 8.046  1.00 56.58  ? 64  ASN B C   1 
ATOM   1287 O  O   . ASN B 1 64 ? -3.281 16.850 7.400  1.00 57.46  ? 64  ASN B O   1 
ATOM   1288 C  CB  . ASN B 1 64 ? -3.191 17.247 10.232 1.00 48.70  ? 64  ASN B CB  1 
ATOM   1289 C  CG  . ASN B 1 64 ? -2.432 18.541 9.998  1.00 50.16  ? 64  ASN B CG  1 
ATOM   1290 O  OD1 . ASN B 1 64 ? -1.274 18.525 9.565  1.00 51.75  ? 64  ASN B OD1 1 
ATOM   1291 N  ND2 . ASN B 1 64 ? -3.124 19.664 10.151 1.00 45.71  ? 64  ASN B ND2 1 
ATOM   1292 N  N   . GLU B 1 65 ? -1.188 16.024 7.514  1.00 61.22  ? 65  GLU B N   1 
ATOM   1293 C  CA  . GLU B 1 65 ? -0.878 16.149 6.097  1.00 65.48  ? 65  GLU B CA  1 
ATOM   1294 C  C   . GLU B 1 65 ? -1.262 17.500 5.513  1.00 60.34  ? 65  GLU B C   1 
ATOM   1295 O  O   . GLU B 1 65 ? -1.626 17.593 4.336  1.00 62.60  ? 65  GLU B O   1 
ATOM   1296 C  CB  . GLU B 1 65 ? -1.577 15.038 5.297  1.00 69.89  ? 65  GLU B CB  1 
ATOM   1297 C  CG  . GLU B 1 65 ? -1.701 13.719 6.037  1.00 77.62  ? 65  GLU B CG  1 
ATOM   1298 C  CD  . GLU B 1 65 ? -1.541 12.502 5.150  1.00 80.84  ? 65  GLU B CD  1 
ATOM   1299 O  OE1 . GLU B 1 65 ? -1.139 12.666 3.977  1.00 79.97  ? 65  GLU B OE1 1 
ATOM   1300 O  OE2 . GLU B 1 65 ? -1.818 11.379 5.630  1.00 89.74  ? 65  GLU B OE2 1 
ATOM   1301 N  N   . ASP B 1 66 ? -1.188 18.589 6.277  1.00 53.92  ? 66  ASP B N   1 
ATOM   1302 C  CA  . ASP B 1 66 ? -1.512 19.870 5.646  1.00 52.45  ? 66  ASP B CA  1 
ATOM   1303 C  C   . ASP B 1 66 ? -0.267 20.458 4.981  1.00 57.67  ? 66  ASP B C   1 
ATOM   1304 O  O   . ASP B 1 66 ? -0.261 21.603 4.531  1.00 61.05  ? 66  ASP B O   1 
ATOM   1305 C  CB  . ASP B 1 66 ? -2.091 20.834 6.674  1.00 50.58  ? 66  ASP B CB  1 
ATOM   1306 C  CG  . ASP B 1 66 ? -1.069 21.176 7.749  1.00 54.89  ? 66  ASP B CG  1 
ATOM   1307 O  OD1 . ASP B 1 66 ? 0.003  20.531 7.766  1.00 54.84  ? 66  ASP B OD1 1 
ATOM   1308 O  OD2 . ASP B 1 66 ? -1.418 21.974 8.646  1.00 55.07  ? 66  ASP B OD2 1 
ATOM   1309 N  N   . LYS B 1 67 ? 0.767  19.631 4.945  1.00 59.87  ? 67  LYS B N   1 
ATOM   1310 C  CA  . LYS B 1 67 ? 2.066  19.907 4.354  1.00 64.70  ? 67  LYS B CA  1 
ATOM   1311 C  C   . LYS B 1 67 ? 2.674  21.178 4.943  1.00 61.48  ? 67  LYS B C   1 
ATOM   1312 O  O   . LYS B 1 67 ? 3.281  22.003 4.268  1.00 55.17  ? 67  LYS B O   1 
ATOM   1313 C  CB  . LYS B 1 67 ? 1.985  20.007 2.832  1.00 73.28  ? 67  LYS B CB  1 
ATOM   1314 C  CG  . LYS B 1 67 ? 1.545  18.739 2.125  1.00 85.44  ? 67  LYS B CG  1 
ATOM   1315 C  CD  . LYS B 1 67 ? 2.445  17.542 2.369  1.00 95.21  ? 67  LYS B CD  1 
ATOM   1316 C  CE  . LYS B 1 67 ? 3.623  17.521 1.405  1.00 100.44 ? 67  LYS B CE  1 
ATOM   1317 N  NZ  . LYS B 1 67 ? 4.519  16.359 1.654  1.00 100.30 ? 67  LYS B NZ  1 
ATOM   1318 N  N   . LYS B 1 68 ? 2.471  21.288 6.244  1.00 57.85  ? 68  LYS B N   1 
ATOM   1319 C  CA  . LYS B 1 68 ? 3.062  22.287 7.108  1.00 54.86  ? 68  LYS B CA  1 
ATOM   1320 C  C   . LYS B 1 68 ? 3.209  21.689 8.505  1.00 54.68  ? 68  LYS B C   1 
ATOM   1321 O  O   . LYS B 1 68 ? 2.444  20.802 8.884  1.00 59.11  ? 68  LYS B O   1 
ATOM   1322 C  CB  . LYS B 1 68 ? 2.234  23.569 7.167  1.00 55.28  ? 68  LYS B CB  1 
ATOM   1323 C  CG  . LYS B 1 68 ? 2.515  24.501 5.994  1.00 60.68  ? 68  LYS B CG  1 
ATOM   1324 C  CD  . LYS B 1 68 ? 3.582  25.521 6.369  1.00 72.78  ? 68  LYS B CD  1 
ATOM   1325 C  CE  . LYS B 1 68 ? 3.356  26.853 5.671  1.00 81.09  ? 68  LYS B CE  1 
ATOM   1326 N  NZ  . LYS B 1 68 ? 3.831  28.010 6.482  1.00 90.64  ? 68  LYS B NZ  1 
ATOM   1327 N  N   . ILE B 1 69 ? 4.188  22.178 9.254  1.00 50.51  ? 69  ILE B N   1 
ATOM   1328 C  CA  . ILE B 1 69 ? 4.399  21.729 10.630 1.00 42.40  ? 69  ILE B CA  1 
ATOM   1329 C  C   . ILE B 1 69 ? 3.976  22.817 11.606 1.00 39.98  ? 69  ILE B C   1 
ATOM   1330 O  O   . ILE B 1 69 ? 4.648  23.848 11.720 1.00 39.52  ? 69  ILE B O   1 
ATOM   1331 C  CB  . ILE B 1 69 ? 5.872  21.343 10.844 1.00 39.65  ? 69  ILE B CB  1 
ATOM   1332 C  CG1 . ILE B 1 69 ? 6.306  20.146 9.989  1.00 37.57  ? 69  ILE B CG1 1 
ATOM   1333 C  CG2 . ILE B 1 69 ? 6.175  21.105 12.314 1.00 33.49  ? 69  ILE B CG2 1 
ATOM   1334 C  CD1 . ILE B 1 69 ? 5.373  18.958 10.095 1.00 45.98  ? 69  ILE B CD1 1 
ATOM   1335 N  N   . ASP B 1 70 ? 2.863  22.616 12.305 1.00 35.37  ? 70  ASP B N   1 
ATOM   1336 C  CA  . ASP B 1 70 ? 2.430  23.588 13.310 1.00 38.90  ? 70  ASP B CA  1 
ATOM   1337 C  C   . ASP B 1 70 ? 3.168  23.330 14.624 1.00 42.30  ? 70  ASP B C   1 
ATOM   1338 O  O   . ASP B 1 70 ? 3.876  22.323 14.750 1.00 38.14  ? 70  ASP B O   1 
ATOM   1339 C  CB  . ASP B 1 70 ? 0.927  23.540 13.548 1.00 46.46  ? 70  ASP B CB  1 
ATOM   1340 C  CG  . ASP B 1 70 ? 0.391  22.147 13.813 1.00 50.36  ? 70  ASP B CG  1 
ATOM   1341 O  OD1 . ASP B 1 70 ? 1.170  21.250 14.196 1.00 51.27  ? 70  ASP B OD1 1 
ATOM   1342 O  OD2 . ASP B 1 70 ? -0.828 21.942 13.626 1.00 50.93  ? 70  ASP B OD2 1 
ATOM   1343 N  N   . PHE B 1 71 ? 3.009  24.227 15.591 1.00 41.87  ? 71  PHE B N   1 
ATOM   1344 C  CA  . PHE B 1 71 ? 3.761  24.128 16.830 1.00 41.51  ? 71  PHE B CA  1 
ATOM   1345 C  C   . PHE B 1 71 ? 3.651  22.767 17.506 1.00 44.15  ? 71  PHE B C   1 
ATOM   1346 O  O   . PHE B 1 71 ? 4.606  22.264 18.096 1.00 47.60  ? 71  PHE B O   1 
ATOM   1347 C  CB  . PHE B 1 71 ? 3.306  25.181 17.852 1.00 42.70  ? 71  PHE B CB  1 
ATOM   1348 C  CG  . PHE B 1 71 ? 4.265  25.214 19.041 1.00 46.23  ? 71  PHE B CG  1 
ATOM   1349 C  CD1 . PHE B 1 71 ? 5.500  25.827 18.911 1.00 44.64  ? 71  PHE B CD1 1 
ATOM   1350 C  CD2 . PHE B 1 71 ? 3.919  24.635 20.248 1.00 47.33  ? 71  PHE B CD2 1 
ATOM   1351 C  CE1 . PHE B 1 71 ? 6.376  25.863 19.978 1.00 46.81  ? 71  PHE B CE1 1 
ATOM   1352 C  CE2 . PHE B 1 71 ? 4.789  24.671 21.323 1.00 49.27  ? 71  PHE B CE2 1 
ATOM   1353 C  CZ  . PHE B 1 71 ? 6.018  25.288 21.184 1.00 49.25  ? 71  PHE B CZ  1 
ATOM   1354 N  N   . SER B 1 72 ? 2.471  22.166 17.430 1.00 43.38  ? 72  SER B N   1 
ATOM   1355 C  CA  . SER B 1 72 ? 2.289  20.868 18.073 1.00 43.33  ? 72  SER B CA  1 
ATOM   1356 C  C   . SER B 1 72 ? 3.102  19.796 17.366 1.00 41.61  ? 72  SER B C   1 
ATOM   1357 O  O   . SER B 1 72 ? 3.744  18.963 18.008 1.00 46.33  ? 72  SER B O   1 
ATOM   1358 C  CB  . SER B 1 72 ? 0.802  20.506 18.096 1.00 50.67  ? 72  SER B CB  1 
ATOM   1359 O  OG  . SER B 1 72 ? 0.357  20.102 16.810 1.00 80.92  ? 72  SER B OG  1 
ATOM   1360 N  N   . GLU B 1 73 ? 3.073  19.805 16.032 1.00 39.69  ? 73  GLU B N   1 
ATOM   1361 C  CA  . GLU B 1 73 ? 3.847  18.794 15.300 1.00 37.07  ? 73  GLU B CA  1 
ATOM   1362 C  C   . GLU B 1 73 ? 5.330  18.960 15.613 1.00 40.09  ? 73  GLU B C   1 
ATOM   1363 O  O   . GLU B 1 73 ? 6.059  17.979 15.754 1.00 46.32  ? 73  GLU B O   1 
ATOM   1364 C  CB  . GLU B 1 73 ? 3.552  18.890 13.803 1.00 37.39  ? 73  GLU B CB  1 
ATOM   1365 C  CG  . GLU B 1 73 ? 2.102  18.531 13.497 1.00 39.09  ? 73  GLU B CG  1 
ATOM   1366 C  CD  . GLU B 1 73 ? 1.643  18.906 12.104 1.00 45.84  ? 73  GLU B CD  1 
ATOM   1367 O  OE1 . GLU B 1 73 ? 2.005  20.008 11.635 1.00 49.51  ? 73  GLU B OE1 1 
ATOM   1368 O  OE2 . GLU B 1 73 ? 0.778  18.188 11.551 1.00 48.40  ? 73  GLU B OE2 1 
ATOM   1369 N  N   . PHE B 1 74 ? 5.744  20.212 15.741 1.00 44.51  ? 74  PHE B N   1 
ATOM   1370 C  CA  . PHE B 1 74 ? 7.102  20.605 16.111 1.00 45.97  ? 74  PHE B CA  1 
ATOM   1371 C  C   . PHE B 1 74 ? 7.510  19.995 17.448 1.00 43.78  ? 74  PHE B C   1 
ATOM   1372 O  O   . PHE B 1 74 ? 8.531  19.308 17.548 1.00 41.04  ? 74  PHE B O   1 
ATOM   1373 C  CB  . PHE B 1 74 ? 7.173  22.126 16.125 1.00 46.26  ? 74  PHE B CB  1 
ATOM   1374 C  CG  . PHE B 1 74 ? 8.404  22.779 16.708 1.00 46.11  ? 74  PHE B CG  1 
ATOM   1375 C  CD1 . PHE B 1 74 ? 9.637  22.675 16.088 1.00 44.65  ? 74  PHE B CD1 1 
ATOM   1376 C  CD2 . PHE B 1 74 ? 8.311  23.508 17.883 1.00 47.00  ? 74  PHE B CD2 1 
ATOM   1377 C  CE1 . PHE B 1 74 ? 10.754 23.284 16.629 1.00 46.87  ? 74  PHE B CE1 1 
ATOM   1378 C  CE2 . PHE B 1 74 ? 9.421  24.118 18.433 1.00 46.76  ? 74  PHE B CE2 1 
ATOM   1379 C  CZ  . PHE B 1 74 ? 10.650 24.008 17.804 1.00 47.20  ? 74  PHE B CZ  1 
ATOM   1380 N  N   . LEU B 1 75 ? 6.720  20.215 18.493 1.00 40.25  ? 75  LEU B N   1 
ATOM   1381 C  CA  . LEU B 1 75 ? 6.995  19.635 19.805 1.00 40.11  ? 75  LEU B CA  1 
ATOM   1382 C  C   . LEU B 1 75 ? 7.168  18.125 19.689 1.00 43.93  ? 75  LEU B C   1 
ATOM   1383 O  O   . LEU B 1 75 ? 8.004  17.521 20.369 1.00 46.79  ? 75  LEU B O   1 
ATOM   1384 C  CB  . LEU B 1 75 ? 5.893  19.961 20.809 1.00 41.31  ? 75  LEU B CB  1 
ATOM   1385 C  CG  . LEU B 1 75 ? 5.735  21.418 21.249 1.00 44.33  ? 75  LEU B CG  1 
ATOM   1386 C  CD1 . LEU B 1 75 ? 4.697  21.540 22.357 1.00 37.58  ? 75  LEU B CD1 1 
ATOM   1387 C  CD2 . LEU B 1 75 ? 7.057  22.009 21.709 1.00 42.99  ? 75  LEU B CD2 1 
ATOM   1388 N  N   . SER B 1 76 ? 6.393  17.474 18.818 1.00 40.44  ? 76  SER B N   1 
ATOM   1389 C  CA  . SER B 1 76 ? 6.597  16.031 18.672 1.00 41.49  ? 76  SER B CA  1 
ATOM   1390 C  C   . SER B 1 76 ? 7.977  15.711 18.101 1.00 41.13  ? 76  SER B C   1 
ATOM   1391 O  O   . SER B 1 76 ? 8.669  14.791 18.543 1.00 35.56  ? 76  SER B O   1 
ATOM   1392 C  CB  . SER B 1 76 ? 5.524  15.405 17.782 1.00 44.60  ? 76  SER B CB  1 
ATOM   1393 O  OG  . SER B 1 76 ? 5.944  14.113 17.355 1.00 70.78  ? 76  SER B OG  1 
ATOM   1394 N  N   . LEU B 1 77 ? 8.369  16.487 17.093 1.00 38.81  ? 77  LEU B N   1 
ATOM   1395 C  CA  . LEU B 1 77 ? 9.695  16.317 16.506 1.00 36.09  ? 77  LEU B CA  1 
ATOM   1396 C  C   . LEU B 1 77 ? 10.754 16.397 17.598 1.00 34.11  ? 77  LEU B C   1 
ATOM   1397 O  O   . LEU B 1 77 ? 11.561 15.487 17.775 1.00 41.27  ? 77  LEU B O   1 
ATOM   1398 C  CB  . LEU B 1 77 ? 9.938  17.376 15.435 1.00 38.19  ? 77  LEU B CB  1 
ATOM   1399 C  CG  . LEU B 1 77 ? 11.344 17.456 14.844 1.00 40.16  ? 77  LEU B CG  1 
ATOM   1400 C  CD1 . LEU B 1 77 ? 11.813 16.090 14.374 1.00 34.92  ? 77  LEU B CD1 1 
ATOM   1401 C  CD2 . LEU B 1 77 ? 11.369 18.459 13.700 1.00 42.72  ? 77  LEU B CD2 1 
ATOM   1402 N  N   . LEU B 1 78 ? 10.722 17.494 18.350 1.00 35.08  ? 78  LEU B N   1 
ATOM   1403 C  CA  . LEU B 1 78 ? 11.701 17.672 19.419 1.00 36.96  ? 78  LEU B CA  1 
ATOM   1404 C  C   . LEU B 1 78 ? 11.601 16.556 20.449 1.00 40.30  ? 78  LEU B C   1 
ATOM   1405 O  O   . LEU B 1 78 ? 12.576 16.197 21.117 1.00 44.01  ? 78  LEU B O   1 
ATOM   1406 C  CB  . LEU B 1 78 ? 11.519 19.042 20.069 1.00 34.82  ? 78  LEU B CB  1 
ATOM   1407 C  CG  . LEU B 1 78 ? 11.712 20.271 19.177 1.00 41.47  ? 78  LEU B CG  1 
ATOM   1408 C  CD1 . LEU B 1 78 ? 12.096 21.480 20.016 1.00 45.01  ? 78  LEU B CD1 1 
ATOM   1409 C  CD2 . LEU B 1 78 ? 12.752 20.026 18.091 1.00 46.96  ? 78  LEU B CD2 1 
ATOM   1410 N  N   . GLY B 1 79 ? 10.406 15.974 20.580 1.00 38.12  ? 79  GLY B N   1 
ATOM   1411 C  CA  . GLY B 1 79 ? 10.277 14.833 21.484 1.00 34.44  ? 79  GLY B CA  1 
ATOM   1412 C  C   . GLY B 1 79 ? 11.154 13.691 20.992 1.00 38.92  ? 79  GLY B C   1 
ATOM   1413 O  O   . GLY B 1 79 ? 11.921 13.113 21.765 1.00 42.21  ? 79  GLY B O   1 
ATOM   1414 N  N   . ASP B 1 80 ? 11.049 13.366 19.700 1.00 38.11  ? 80  ASP B N   1 
ATOM   1415 C  CA  . ASP B 1 80 ? 11.840 12.260 19.166 1.00 42.59  ? 80  ASP B CA  1 
ATOM   1416 C  C   . ASP B 1 80 ? 13.328 12.471 19.432 1.00 42.17  ? 80  ASP B C   1 
ATOM   1417 O  O   . ASP B 1 80 ? 14.087 11.557 19.730 1.00 45.42  ? 80  ASP B O   1 
ATOM   1418 C  CB  . ASP B 1 80 ? 11.632 12.088 17.666 1.00 45.44  ? 80  ASP B CB  1 
ATOM   1419 C  CG  . ASP B 1 80 ? 10.196 11.925 17.229 1.00 49.18  ? 80  ASP B CG  1 
ATOM   1420 O  OD1 . ASP B 1 80 ? 9.405  11.267 17.931 1.00 53.64  ? 80  ASP B OD1 1 
ATOM   1421 O  OD2 . ASP B 1 80 ? 9.872  12.467 16.148 1.00 66.59  ? 80  ASP B OD2 1 
ATOM   1422 N  N   . ILE B 1 81 ? 13.743 13.730 19.319 1.00 41.90  ? 81  ILE B N   1 
ATOM   1423 C  CA  . ILE B 1 81 ? 15.151 14.037 19.547 1.00 44.24  ? 81  ILE B CA  1 
ATOM   1424 C  C   . ILE B 1 81 ? 15.497 13.883 21.023 1.00 42.57  ? 81  ILE B C   1 
ATOM   1425 O  O   . ILE B 1 81 ? 16.419 13.133 21.343 1.00 44.97  ? 81  ILE B O   1 
ATOM   1426 C  CB  . ILE B 1 81 ? 15.483 15.455 19.057 1.00 46.14  ? 81  ILE B CB  1 
ATOM   1427 C  CG1 . ILE B 1 81 ? 15.142 15.661 17.577 1.00 48.90  ? 81  ILE B CG1 1 
ATOM   1428 C  CG2 . ILE B 1 81 ? 16.932 15.806 19.337 1.00 40.32  ? 81  ILE B CG2 1 
ATOM   1429 C  CD1 . ILE B 1 81 ? 15.429 17.063 17.084 1.00 50.46  ? 81  ILE B CD1 1 
ATOM   1430 N  N   . ALA B 1 82 ? 14.751 14.582 21.866 1.00 41.37  ? 82  ALA B N   1 
ATOM   1431 C  CA  . ALA B 1 82 ? 14.928 14.509 23.309 1.00 41.34  ? 82  ALA B CA  1 
ATOM   1432 C  C   . ALA B 1 82 ? 15.019 13.056 23.757 1.00 40.55  ? 82  ALA B C   1 
ATOM   1433 O  O   . ALA B 1 82 ? 15.866 12.619 24.529 1.00 37.48  ? 82  ALA B O   1 
ATOM   1434 C  CB  . ALA B 1 82 ? 13.776 15.210 24.004 1.00 35.60  ? 82  ALA B CB  1 
ATOM   1435 N  N   . THR B 1 83 ? 14.094 12.276 23.208 1.00 35.74  ? 83  THR B N   1 
ATOM   1436 C  CA  . THR B 1 83 ? 14.071 10.851 23.514 1.00 36.48  ? 83  THR B CA  1 
ATOM   1437 C  C   . THR B 1 83 ? 15.355 10.170 23.086 1.00 42.98  ? 83  THR B C   1 
ATOM   1438 O  O   . THR B 1 83 ? 15.879 9.275  23.754 1.00 43.63  ? 83  THR B O   1 
ATOM   1439 C  CB  . THR B 1 83 ? 12.854 10.208 22.826 1.00 43.26  ? 83  THR B CB  1 
ATOM   1440 O  OG1 . THR B 1 83 ? 11.682 10.551 23.587 1.00 54.42  ? 83  THR B OG1 1 
ATOM   1441 C  CG2 . THR B 1 83 ? 12.963 8.696  22.812 1.00 48.20  ? 83  THR B CG2 1 
ATOM   1442 N  N   . ASP B 1 84 ? 15.906 10.577 21.938 1.00 45.91  ? 84  ASP B N   1 
ATOM   1443 C  CA  . ASP B 1 84 ? 17.145 9.903  21.541 1.00 45.44  ? 84  ASP B CA  1 
ATOM   1444 C  C   . ASP B 1 84 ? 18.247 10.241 22.532 1.00 47.01  ? 84  ASP B C   1 
ATOM   1445 O  O   . ASP B 1 84 ? 19.010 9.402  23.002 1.00 45.91  ? 84  ASP B O   1 
ATOM   1446 C  CB  . ASP B 1 84 ? 17.566 10.291 20.130 1.00 49.76  ? 84  ASP B CB  1 
ATOM   1447 C  CG  . ASP B 1 84 ? 18.863 9.630  19.702 1.00 53.07  ? 84  ASP B CG  1 
ATOM   1448 O  OD1 . ASP B 1 84 ? 18.822 8.504  19.165 1.00 59.31  ? 84  ASP B OD1 1 
ATOM   1449 O  OD2 . ASP B 1 84 ? 19.925 10.251 19.913 1.00 63.43  ? 84  ASP B OD2 1 
ATOM   1450 N  N   . TYR B 1 85 ? 18.335 11.528 22.859 1.00 47.78  ? 85  TYR B N   1 
ATOM   1451 C  CA  . TYR B 1 85 ? 19.403 11.914 23.782 1.00 50.61  ? 85  TYR B CA  1 
ATOM   1452 C  C   . TYR B 1 85 ? 19.202 11.297 25.154 1.00 48.36  ? 85  TYR B C   1 
ATOM   1453 O  O   . TYR B 1 85 ? 20.162 11.058 25.887 1.00 46.97  ? 85  TYR B O   1 
ATOM   1454 C  CB  . TYR B 1 85 ? 19.461 13.435 23.874 1.00 54.78  ? 85  TYR B CB  1 
ATOM   1455 C  CG  . TYR B 1 85 ? 20.199 14.094 22.737 1.00 60.64  ? 85  TYR B CG  1 
ATOM   1456 C  CD1 . TYR B 1 85 ? 19.554 14.462 21.564 1.00 64.02  ? 85  TYR B CD1 1 
ATOM   1457 C  CD2 . TYR B 1 85 ? 21.560 14.343 22.855 1.00 62.52  ? 85  TYR B CD2 1 
ATOM   1458 C  CE1 . TYR B 1 85 ? 20.252 15.064 20.535 1.00 67.77  ? 85  TYR B CE1 1 
ATOM   1459 C  CE2 . TYR B 1 85 ? 22.260 14.946 21.830 1.00 64.81  ? 85  TYR B CE2 1 
ATOM   1460 C  CZ  . TYR B 1 85 ? 21.602 15.303 20.674 1.00 66.67  ? 85  TYR B CZ  1 
ATOM   1461 O  OH  . TYR B 1 85 ? 22.309 15.905 19.656 1.00 61.23  ? 85  TYR B OH  1 
ATOM   1462 N  N   . HIS B 1 86 ? 17.949 11.048 25.538 1.00 44.70  ? 86  HIS B N   1 
ATOM   1463 C  CA  . HIS B 1 86 ? 17.739 10.435 26.848 1.00 44.03  ? 86  HIS B CA  1 
ATOM   1464 C  C   . HIS B 1 86 ? 18.456 9.087  26.896 1.00 43.88  ? 86  HIS B C   1 
ATOM   1465 O  O   . HIS B 1 86 ? 19.232 8.792  27.795 1.00 42.41  ? 86  HIS B O   1 
ATOM   1466 C  CB  . HIS B 1 86 ? 16.260 10.233 27.168 1.00 45.89  ? 86  HIS B CB  1 
ATOM   1467 C  CG  . HIS B 1 86 ? 16.030 9.509  28.463 1.00 48.84  ? 86  HIS B CG  1 
ATOM   1468 N  ND1 . HIS B 1 86 ? 15.297 8.351  28.582 1.00 52.97  ? 86  HIS B ND1 1 
ATOM   1469 C  CD2 . HIS B 1 86 ? 16.459 9.790  29.714 1.00 47.38  ? 86  HIS B CD2 1 
ATOM   1470 C  CE1 . HIS B 1 86 ? 15.283 7.957  29.844 1.00 49.53  ? 86  HIS B CE1 1 
ATOM   1471 N  NE2 . HIS B 1 86 ? 15.982 8.816  30.557 1.00 45.91  ? 86  HIS B NE2 1 
ATOM   1472 N  N   . LYS B 1 87 ? 18.161 8.290  25.878 1.00 46.90  ? 87  LYS B N   1 
ATOM   1473 C  CA  . LYS B 1 87 ? 18.735 6.955  25.779 1.00 53.67  ? 87  LYS B CA  1 
ATOM   1474 C  C   . LYS B 1 87 ? 20.254 7.012  25.749 1.00 53.86  ? 87  LYS B C   1 
ATOM   1475 O  O   . LYS B 1 87 ? 20.925 6.165  26.340 1.00 55.13  ? 87  LYS B O   1 
ATOM   1476 C  CB  . LYS B 1 87 ? 18.185 6.244  24.539 1.00 59.69  ? 87  LYS B CB  1 
ATOM   1477 C  CG  . LYS B 1 87 ? 16.665 6.227  24.466 1.00 68.39  ? 87  LYS B CG  1 
ATOM   1478 C  CD  . LYS B 1 87 ? 16.157 5.112  23.568 1.00 77.95  ? 87  LYS B CD  1 
ATOM   1479 C  CE  . LYS B 1 87 ? 14.867 4.504  24.097 1.00 85.56  ? 87  LYS B CE  1 
ATOM   1480 N  NZ  . LYS B 1 87 ? 13.995 4.025  22.984 1.00 97.17  ? 87  LYS B NZ  1 
ATOM   1481 N  N   . GLN B 1 88 ? 20.814 8.005  25.064 1.00 57.89  ? 88  GLN B N   1 
ATOM   1482 C  CA  . GLN B 1 88 ? 22.271 8.117  24.999 1.00 59.90  ? 88  GLN B CA  1 
ATOM   1483 C  C   . GLN B 1 88 ? 22.863 8.225  26.404 1.00 57.90  ? 88  GLN B C   1 
ATOM   1484 O  O   . GLN B 1 88 ? 23.929 7.670  26.667 1.00 62.04  ? 88  GLN B O   1 
ATOM   1485 C  CB  . GLN B 1 88 ? 22.688 9.317  24.153 1.00 60.65  ? 88  GLN B CB  1 
ATOM   1486 C  CG  . GLN B 1 88 ? 22.824 9.019  22.669 1.00 64.20  ? 88  GLN B CG  1 
ATOM   1487 C  CD  . GLN B 1 88 ? 23.086 10.272 21.855 1.00 69.26  ? 88  GLN B CD  1 
ATOM   1488 O  OE1 . GLN B 1 88 ? 24.087 10.964 22.055 1.00 79.17  ? 88  GLN B OE1 1 
ATOM   1489 N  NE2 . GLN B 1 88 ? 22.182 10.575 20.931 1.00 68.22  ? 88  GLN B NE2 1 
ATOM   1490 N  N   . SER B 1 89 ? 22.149 8.937  27.265 1.00 55.74  ? 89  SER B N   1 
ATOM   1491 C  CA  . SER B 1 89 ? 22.519 9.126  28.659 1.00 59.10  ? 89  SER B CA  1 
ATOM   1492 C  C   . SER B 1 89 ? 22.512 7.803  29.416 1.00 62.19  ? 89  SER B C   1 
ATOM   1493 O  O   . SER B 1 89 ? 23.091 7.694  30.495 1.00 69.50  ? 89  SER B O   1 
ATOM   1494 C  CB  . SER B 1 89 ? 21.582 10.121 29.346 1.00 61.42  ? 89  SER B CB  1 
ATOM   1495 O  OG  . SER B 1 89 ? 20.327 9.551  29.667 1.00 56.47  ? 89  SER B OG  1 
ATOM   1496 N  N   . HIS B 1 90 ? 21.857 6.796  28.843 1.00 63.65  ? 90  HIS B N   1 
ATOM   1497 C  CA  . HIS B 1 90 ? 21.874 5.474  29.459 1.00 66.92  ? 90  HIS B CA  1 
ATOM   1498 C  C   . HIS B 1 90 ? 22.814 4.542  28.698 1.00 75.09  ? 90  HIS B C   1 
ATOM   1499 O  O   . HIS B 1 90 ? 22.703 3.323  28.787 1.00 87.62  ? 90  HIS B O   1 
ATOM   1500 C  CB  . HIS B 1 90 ? 20.465 4.882  29.541 1.00 62.82  ? 90  HIS B CB  1 
ATOM   1501 C  CG  . HIS B 1 90 ? 19.624 5.570  30.576 1.00 63.77  ? 90  HIS B CG  1 
ATOM   1502 N  ND1 . HIS B 1 90 ? 19.142 4.971  31.719 1.00 64.51  ? 90  HIS B ND1 1 
ATOM   1503 C  CD2 . HIS B 1 90 ? 19.193 6.850  30.618 1.00 62.17  ? 90  HIS B CD2 1 
ATOM   1504 C  CE1 . HIS B 1 90 ? 18.446 5.846  32.418 1.00 64.26  ? 90  HIS B CE1 1 
ATOM   1505 N  NE2 . HIS B 1 90 ? 18.460 6.996  31.771 1.00 61.38  ? 90  HIS B NE2 1 
ATOM   1506 N  N   . GLY B 1 91 ? 23.736 5.149  27.959 1.00 77.23  ? 91  GLY B N   1 
ATOM   1507 C  CA  . GLY B 1 91 ? 24.756 4.438  27.224 1.00 78.60  ? 91  GLY B CA  1 
ATOM   1508 C  C   . GLY B 1 91 ? 24.559 4.454  25.719 1.00 81.70  ? 91  GLY B C   1 
ATOM   1509 O  O   . GLY B 1 91 ? 25.410 4.993  25.005 1.00 109.46 ? 91  GLY B O   1 
ATOM   1510 N  N   . ALA B 1 92 ? 23.462 3.869  25.272 1.00 77.88  ? 92  ALA B N   1 
ATOM   1511 C  CA  . ALA B 1 92 ? 23.061 3.648  23.897 1.00 77.65  ? 92  ALA B CA  1 
ATOM   1512 C  C   . ALA B 1 92 ? 23.580 4.693  22.913 1.00 80.87  ? 92  ALA B C   1 
ATOM   1513 O  O   . ALA B 1 92 ? 23.956 5.808  23.268 1.00 78.79  ? 92  ALA B O   1 
ATOM   1514 C  CB  . ALA B 1 92 ? 21.538 3.576  23.809 1.00 64.32  ? 92  ALA B CB  1 
ATOM   1515 N  N   . ALA B 1 93 ? 23.606 4.303  21.641 1.00 82.62  ? 93  ALA B N   1 
ATOM   1516 C  CA  . ALA B 1 93 ? 24.193 5.112  20.585 1.00 81.91  ? 93  ALA B CA  1 
ATOM   1517 C  C   . ALA B 1 93 ? 23.210 6.105  19.979 1.00 77.33  ? 93  ALA B C   1 
ATOM   1518 O  O   . ALA B 1 93 ? 22.005 5.868  19.914 1.00 79.73  ? 93  ALA B O   1 
ATOM   1519 C  CB  . ALA B 1 93 ? 24.747 4.204  19.490 1.00 88.00  ? 93  ALA B CB  1 
ATOM   1520 N  N   . PRO B 1 94 ? 23.754 7.231  19.527 1.00 72.20  ? 94  PRO B N   1 
ATOM   1521 C  CA  . PRO B 1 94 ? 22.930 8.269  18.905 1.00 71.69  ? 94  PRO B CA  1 
ATOM   1522 C  C   . PRO B 1 94 ? 22.160 7.701  17.715 1.00 70.62  ? 94  PRO B C   1 
ATOM   1523 O  O   . PRO B 1 94 ? 22.605 6.729  17.105 1.00 71.49  ? 94  PRO B O   1 
ATOM   1524 C  CB  . PRO B 1 94 ? 23.952 9.300  18.434 1.00 71.26  ? 94  PRO B CB  1 
ATOM   1525 C  CG  . PRO B 1 94 ? 25.174 9.051  19.247 1.00 70.87  ? 94  PRO B CG  1 
ATOM   1526 C  CD  . PRO B 1 94 ? 25.180 7.587  19.579 1.00 69.76  ? 94  PRO B CD  1 
ATOM   1527 N  N   . CYS B 1 95 ? 21.026 8.306  17.395 1.00 70.10  ? 95  CYS B N   1 
ATOM   1528 C  CA  . CYS B 1 95 ? 20.199 7.883  16.278 1.00 71.32  ? 95  CYS B CA  1 
ATOM   1529 C  C   . CYS B 1 95 ? 19.957 6.377  16.279 1.00 77.27  ? 95  CYS B C   1 
ATOM   1530 O  O   . CYS B 1 95 ? 20.561 5.649  15.496 1.00 79.81  ? 95  CYS B O   1 
ATOM   1531 C  CB  . CYS B 1 95 ? 20.847 8.311  14.957 1.00 65.54  ? 95  CYS B CB  1 
ATOM   1532 S  SG  . CYS B 1 95 ? 19.641 8.747  13.680 1.00 71.53  ? 95  CYS B SG  1 
ATOM   1533 N  N   . SER B 1 96 ? 19.065 5.926  17.150 1.00 83.66  ? 96  SER B N   1 
ATOM   1534 C  CA  . SER B 1 96 ? 18.711 4.513  17.224 1.00 90.29  ? 96  SER B CA  1 
ATOM   1535 C  C   . SER B 1 96 ? 17.211 4.309  17.394 1.00 91.96  ? 96  SER B C   1 
ATOM   1536 O  O   . SER B 1 96 ? 16.395 4.737  16.577 1.00 95.82  ? 96  SER B O   1 
ATOM   1537 C  CB  . SER B 1 96 ? 19.465 3.857  18.385 1.00 96.25  ? 96  SER B CB  1 
ATOM   1538 O  OG  . SER B 1 96 ? 20.025 4.852  19.237 1.00 114.98 ? 96  SER B OG  1 
HETATM 1539 CA CA  . CA  C 2 .  ? 3.528  6.831  35.132 0.77 33.51  ? 102 CA  A CA  1 
HETATM 1540 ZN ZN  . ZN  D 3 .  ? 17.070 8.514  32.638 0.54 38.05  ? 103 ZN  A ZN  1 
HETATM 1541 CA CA  . CA  E 2 .  ? 0.643  19.547 9.438  1.00 63.70  ? 102 CA  B CA  1 
HETATM 1542 O  O   . HOH F 4 .  ? -2.399 20.714 36.327 1.00 43.22  ? 201 HOH A O   1 
HETATM 1543 O  O   . HOH F 4 .  ? -0.945 12.743 46.840 1.00 52.74  ? 202 HOH A O   1 
HETATM 1544 O  O   . HOH F 4 .  ? 11.772 10.885 42.134 1.00 50.82  ? 203 HOH A O   1 
HETATM 1545 O  O   . HOH F 4 .  ? 16.001 25.738 36.032 1.00 39.29  ? 205 HOH A O   1 
HETATM 1546 O  O   . HOH F 4 .  ? 17.662 20.532 43.132 1.00 56.02  ? 206 HOH A O   1 
HETATM 1547 O  O   . HOH F 4 .  ? -6.885 23.405 40.215 1.00 64.62  ? 208 HOH A O   1 
HETATM 1548 O  O   . HOH F 4 .  ? 19.732 20.778 33.319 1.00 72.30  ? 209 HOH A O   1 
HETATM 1549 O  O   . HOH F 4 .  ? 6.989  17.151 23.807 1.00 63.62  ? 210 HOH A O   1 
HETATM 1550 O  O   . HOH F 4 .  ? 4.180  9.175  43.671 1.00 40.79  ? 213 HOH A O   1 
HETATM 1551 O  O   . HOH F 4 .  ? 2.849  12.153 29.319 1.00 79.61  ? 218 HOH A O   1 
HETATM 1552 O  O   . HOH F 4 .  ? -2.087 16.624 44.969 1.00 48.67  ? 219 HOH A O   1 
HETATM 1553 O  O   . HOH F 4 .  ? 11.713 7.257  32.374 1.00 71.52  ? 220 HOH A O   1 
HETATM 1554 O  O   . HOH F 4 .  ? -3.341 9.536  37.030 1.00 60.91  ? 221 HOH A O   1 
HETATM 1555 O  O   . HOH F 4 .  ? 5.880  32.020 42.753 1.00 99.64  ? 224 HOH A O   1 
HETATM 1556 O  O   . HOH F 4 .  ? -5.009 5.606  32.744 1.00 51.89  ? 225 HOH A O   1 
HETATM 1557 O  O   . HOH F 4 .  ? 17.597 22.577 36.152 1.00 78.87  ? 226 HOH A O   1 
HETATM 1558 O  O   . HOH F 4 .  ? -1.356 8.401  39.144 1.00 46.60  ? 227 HOH A O   1 
HETATM 1559 O  O   . HOH F 4 .  ? -0.526 16.612 41.375 1.00 33.53  ? 228 HOH A O   1 
HETATM 1560 O  O   . HOH F 4 .  ? 15.067 4.909  31.918 1.00 78.98  ? 229 HOH A O   1 
HETATM 1561 O  O   . HOH F 4 .  ? 16.849 5.986  45.334 1.00 97.14  ? 231 HOH A O   1 
HETATM 1562 O  O   . HOH F 4 .  ? -2.777 7.666  45.436 1.00 80.23  ? 233 HOH A O   1 
HETATM 1563 O  O   . HOH F 4 .  ? 7.304  18.057 47.534 1.00 88.41  ? 234 HOH A O   1 
HETATM 1564 O  O   . HOH F 4 .  ? -7.230 30.980 30.005 1.00 80.16  ? 240 HOH A O   1 
HETATM 1565 O  O   . HOH F 4 .  ? 5.222  10.922 24.912 1.00 92.05  ? 243 HOH A O   1 
HETATM 1566 O  O   . HOH F 4 .  ? -1.998 9.273  42.145 1.00 75.03  ? 245 HOH A O   1 
HETATM 1567 O  O   . HOH F 4 .  ? 16.651 10.367 44.443 1.00 62.56  ? 247 HOH A O   1 
HETATM 1568 O  O   . HOH F 4 .  ? 17.960 3.408  47.884 1.00 78.97  ? 249 HOH A O   1 
HETATM 1569 O  O   . HOH F 4 .  ? 21.577 13.370 32.850 1.00 34.89  ? 253 HOH A O   1 
HETATM 1570 O  O   . HOH F 4 .  ? 3.296  5.959  30.731 1.00 69.90  ? 255 HOH A O   1 
HETATM 1571 O  O   . HOH F 4 .  ? 0.093  25.185 19.877 1.00 70.56  ? 256 HOH A O   1 
HETATM 1572 O  O   . HOH F 4 .  ? -4.365 24.401 20.479 1.00 87.38  ? 258 HOH A O   1 
HETATM 1573 O  O   . HOH F 4 .  ? 15.194 14.580 44.065 1.00 101.54 ? 262 HOH A O   1 
HETATM 1574 O  O   . HOH F 4 .  ? 17.990 8.092  36.925 1.00 56.94  ? 263 HOH A O   1 
HETATM 1575 O  O   . HOH F 4 .  ? 13.876 28.945 41.251 1.00 83.91  ? 264 HOH A O   1 
HETATM 1576 O  O   . HOH F 4 .  ? 15.908 8.460  46.890 1.00 102.18 ? 266 HOH A O   1 
HETATM 1577 O  O   . HOH F 4 .  ? -0.445 19.666 32.551 1.00 64.83  ? 267 HOH A O   1 
HETATM 1578 O  O   . HOH F 4 .  ? 5.372  5.862  34.127 1.00 44.63  ? 269 HOH A O   1 
HETATM 1579 O  O   . HOH G 4 .  ? 11.207 31.980 8.398  1.00 33.96  ? 204 HOH B O   1 
HETATM 1580 O  O   . HOH G 4 .  ? 2.245  17.338 20.501 1.00 60.22  ? 207 HOH B O   1 
HETATM 1581 O  O   . HOH G 4 .  ? 11.238 11.997 14.054 1.00 56.94  ? 211 HOH B O   1 
HETATM 1582 O  O   . HOH G 4 .  ? 13.734 10.839 10.333 1.00 61.81  ? 212 HOH B O   1 
HETATM 1583 O  O   . HOH G 4 .  ? 17.239 23.177 29.019 1.00 44.66  ? 214 HOH B O   1 
HETATM 1584 O  O   . HOH G 4 .  ? 5.551  22.357 4.321  1.00 119.00 ? 215 HOH B O   1 
HETATM 1585 O  O   . HOH G 4 .  ? 16.064 28.963 20.473 1.00 86.41  ? 216 HOH B O   1 
HETATM 1586 O  O   . HOH G 4 .  ? 10.888 15.279 5.104  1.00 49.94  ? 217 HOH B O   1 
HETATM 1587 O  O   . HOH G 4 .  ? 16.072 15.778 1.873  1.00 82.56  ? 222 HOH B O   1 
HETATM 1588 O  O   . HOH G 4 .  ? -0.173 24.291 16.779 1.00 75.75  ? 223 HOH B O   1 
HETATM 1589 O  O   . HOH G 4 .  ? -0.771 31.833 8.806  1.00 81.79  ? 230 HOH B O   1 
HETATM 1590 O  O   . HOH G 4 .  ? 1.586  34.832 11.381 1.00 87.88  ? 232 HOH B O   1 
HETATM 1591 O  O   . HOH G 4 .  ? 3.734  25.165 -0.439 1.00 83.72  ? 235 HOH B O   1 
HETATM 1592 O  O   . HOH G 4 .  ? 6.741  25.520 -0.715 1.00 81.74  ? 236 HOH B O   1 
HETATM 1593 O  O   . HOH G 4 .  ? -4.727 18.996 4.948  1.00 61.45  ? 237 HOH B O   1 
HETATM 1594 O  O   . HOH G 4 .  ? -0.956 16.813 12.421 1.00 101.06 ? 238 HOH B O   1 
HETATM 1595 O  O   . HOH G 4 .  ? 21.585 11.157 16.936 1.00 76.33  ? 239 HOH B O   1 
HETATM 1596 O  O   . HOH G 4 .  ? 8.434  8.134  20.383 1.00 109.29 ? 241 HOH B O   1 
HETATM 1597 O  O   . HOH G 4 .  ? 10.268 38.280 8.082  1.00 101.14 ? 242 HOH B O   1 
HETATM 1598 O  O   . HOH G 4 .  ? 2.304  15.988 15.913 1.00 124.18 ? 244 HOH B O   1 
HETATM 1599 O  O   . HOH G 4 .  ? 22.127 1.860  21.294 1.00 71.77  ? 246 HOH B O   1 
HETATM 1600 O  O   . HOH G 4 .  ? 15.942 3.422  10.683 1.00 104.00 ? 248 HOH B O   1 
HETATM 1601 O  O   . HOH G 4 .  ? 18.537 28.597 15.481 1.00 67.81  ? 250 HOH B O   1 
HETATM 1602 O  O   . HOH G 4 .  ? 24.436 0.907  23.620 1.00 157.91 ? 251 HOH B O   1 
HETATM 1603 O  O   . HOH G 4 .  ? 23.837 24.615 35.484 1.00 67.56  ? 252 HOH B O   1 
HETATM 1604 O  O   . HOH G 4 .  ? 12.110 29.726 6.610  1.00 39.66  ? 254 HOH B O   1 
HETATM 1605 O  O   . HOH G 4 .  ? 8.930  41.509 9.903  1.00 80.67  ? 257 HOH B O   1 
HETATM 1606 O  O   . HOH G 4 .  ? 3.956  30.326 4.132  1.00 70.36  ? 259 HOH B O   1 
HETATM 1607 O  O   . HOH G 4 .  ? 9.387  38.056 11.038 1.00 90.66  ? 260 HOH B O   1 
HETATM 1608 O  O   . HOH G 4 .  ? 12.232 14.639 1.807  1.00 76.68  ? 261 HOH B O   1 
HETATM 1609 O  O   . HOH G 4 .  ? 16.237 22.768 2.595  1.00 99.53  ? 265 HOH B O   1 
HETATM 1610 O  O   . HOH G 4 .  ? 20.695 17.357 2.492  1.00 157.91 ? 268 HOH B O   1 
HETATM 1611 O  O   . HOH G 4 .  ? -0.165 21.008 10.566 1.00 53.99  ? 270 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1  SER SER A . n 
A 1 2   ASN 2   2   2  ASN ASN A . n 
A 1 3   THR 3   3   3  THR THR A . n 
A 1 4   GLN 4   4   4  GLN GLN A . n 
A 1 5   ALA 5   5   5  ALA ALA A . n 
A 1 6   GLU 6   6   6  GLU GLU A . n 
A 1 7   ARG 7   7   7  ARG ARG A . n 
A 1 8   SER 8   8   8  SER SER A . n 
A 1 9   ILE 9   9   9  ILE ILE A . n 
A 1 10  ILE 10  10  10 ILE ILE A . n 
A 1 11  GLY 11  11  11 GLY GLY A . n 
A 1 12  MET 12  12  12 MET MET A . n 
A 1 13  ILE 13  13  13 ILE ILE A . n 
A 1 14  ASP 14  14  14 ASP ASP A . n 
A 1 15  MET 15  15  15 MET MET A . n 
A 1 16  PHE 16  16  16 PHE PHE A . n 
A 1 17  HIS 17  17  17 HIS HIS A . n 
A 1 18  LYS 18  18  18 LYS LYS A . n 
A 1 19  TYR 19  19  19 TYR TYR A . n 
A 1 20  THR 20  20  20 THR THR A . n 
A 1 21  ARG 21  21  21 ARG ARG A . n 
A 1 22  ARG 22  22  22 ARG ARG A . n 
A 1 23  ASP 23  23  23 ASP ASP A . n 
A 1 24  ASP 24  24  24 ASP ASP A . n 
A 1 25  LYS 25  25  25 LYS LYS A . n 
A 1 26  ILE 26  26  26 ILE ILE A . n 
A 1 27  ASP 27  27  27 ASP ASP A . n 
A 1 28  LYS 28  28  28 LYS LYS A . n 
A 1 29  PRO 29  29  29 PRO PRO A . n 
A 1 30  SER 30  30  30 SER SER A . n 
A 1 31  LEU 31  31  31 LEU LEU A . n 
A 1 32  LEU 32  32  32 LEU LEU A . n 
A 1 33  THR 33  33  33 THR THR A . n 
A 1 34  MET 34  34  34 MET MET A . n 
A 1 35  MET 35  35  35 MET MET A . n 
A 1 36  LYS 36  36  36 LYS LYS A . n 
A 1 37  GLU 37  37  37 GLU GLU A . n 
A 1 38  ASN 38  38  38 ASN ASN A . n 
A 1 39  PHE 39  39  39 PHE PHE A . n 
A 1 40  PRO 40  40  40 PRO PRO A . n 
A 1 41  ASN 41  41  41 ASN ASN A . n 
A 1 42  PHE 42  42  42 PHE PHE A . n 
A 1 43  LEU 43  43  43 LEU LEU A . n 
A 1 44  SER 44  44  44 SER SER A . n 
A 1 45  ALA 45  45  45 ALA ALA A . n 
A 1 46  CYS 46  46  46 CYS CYS A . n 
A 1 47  ASP 47  47  47 ASP ASP A . n 
A 1 48  LYS 48  48  48 LYS LYS A . n 
A 1 49  LYS 49  49  49 LYS LYS A . n 
A 1 50  GLY 50  50  50 GLY GLY A . n 
A 1 51  THR 51  51  51 THR THR A . n 
A 1 52  ASN 52  52  52 ASN ASN A . n 
A 1 53  TYR 53  53  53 TYR TYR A . n 
A 1 54  LEU 54  54  54 LEU LEU A . n 
A 1 55  ALA 55  55  55 ALA ALA A . n 
A 1 56  ASP 56  56  56 ASP ASP A . n 
A 1 57  VAL 57  57  57 VAL VAL A . n 
A 1 58  PHE 58  58  58 PHE PHE A . n 
A 1 59  GLU 59  59  59 GLU GLU A . n 
A 1 60  LYS 60  60  60 LYS LYS A . n 
A 1 61  LYS 61  61  61 LYS LYS A . n 
A 1 62  ASP 62  62  62 ASP ASP A . n 
A 1 63  LYS 63  63  63 LYS LYS A . n 
A 1 64  ASN 64  64  64 ASN ASN A . n 
A 1 65  GLU 65  65  65 GLU GLU A . n 
A 1 66  ASP 66  66  66 ASP ASP A . n 
A 1 67  LYS 67  67  67 LYS LYS A . n 
A 1 68  LYS 68  68  68 LYS LYS A . n 
A 1 69  ILE 69  69  69 ILE ILE A . n 
A 1 70  ASP 70  70  70 ASP ASP A . n 
A 1 71  PHE 71  71  71 PHE PHE A . n 
A 1 72  SER 72  72  72 SER SER A . n 
A 1 73  GLU 73  73  73 GLU GLU A . n 
A 1 74  PHE 74  74  74 PHE PHE A . n 
A 1 75  LEU 75  75  75 LEU LEU A . n 
A 1 76  SER 76  76  76 SER SER A . n 
A 1 77  LEU 77  77  77 LEU LEU A . n 
A 1 78  LEU 78  78  78 LEU LEU A . n 
A 1 79  GLY 79  79  79 GLY GLY A . n 
A 1 80  ASP 80  80  80 ASP ASP A . n 
A 1 81  ILE 81  81  81 ILE ILE A . n 
A 1 82  ALA 82  82  82 ALA ALA A . n 
A 1 83  THR 83  83  83 THR THR A . n 
A 1 84  ASP 84  84  84 ASP ASP A . n 
A 1 85  TYR 85  85  85 TYR TYR A . n 
A 1 86  HIS 86  86  86 HIS HIS A . n 
A 1 87  LYS 87  87  87 LYS LYS A . n 
A 1 88  GLN 88  88  88 GLN GLN A . n 
A 1 89  SER 89  89  89 SER SER A . n 
A 1 90  HIS 90  90  90 HIS HIS A . n 
A 1 91  GLY 91  91  91 GLY GLY A . n 
A 1 92  ALA 92  92  92 ALA ALA A . n 
A 1 93  ALA 93  93  93 ALA ALA A . n 
A 1 94  PRO 94  94  94 PRO PRO A . n 
A 1 95  CYS 95  95  95 CYS CYS A . n 
A 1 96  SER 96  96  96 SER SER A . n 
A 1 97  GLY 97  97  ?  ?   ?   A . n 
A 1 98  GLY 98  98  ?  ?   ?   A . n 
A 1 99  SER 99  99  ?  ?   ?   A . n 
A 1 100 GLN 100 100 ?  ?   ?   A . n 
B 1 1   SER 1   1   1  SER SER B . n 
B 1 2   ASN 2   2   2  ASN ASN B . n 
B 1 3   THR 3   3   3  THR THR B . n 
B 1 4   GLN 4   4   4  GLN GLN B . n 
B 1 5   ALA 5   5   5  ALA ALA B . n 
B 1 6   GLU 6   6   6  GLU GLU B . n 
B 1 7   ARG 7   7   7  ARG ARG B . n 
B 1 8   SER 8   8   8  SER SER B . n 
B 1 9   ILE 9   9   9  ILE ILE B . n 
B 1 10  ILE 10  10  10 ILE ILE B . n 
B 1 11  GLY 11  11  11 GLY GLY B . n 
B 1 12  MET 12  12  12 MET MET B . n 
B 1 13  ILE 13  13  13 ILE ILE B . n 
B 1 14  ASP 14  14  14 ASP ASP B . n 
B 1 15  MET 15  15  15 MET MET B . n 
B 1 16  PHE 16  16  16 PHE PHE B . n 
B 1 17  HIS 17  17  17 HIS HIS B . n 
B 1 18  LYS 18  18  18 LYS LYS B . n 
B 1 19  TYR 19  19  19 TYR TYR B . n 
B 1 20  THR 20  20  20 THR THR B . n 
B 1 21  ARG 21  21  21 ARG ARG B . n 
B 1 22  ARG 22  22  22 ARG ARG B . n 
B 1 23  ASP 23  23  23 ASP ASP B . n 
B 1 24  ASP 24  24  24 ASP ASP B . n 
B 1 25  LYS 25  25  25 LYS LYS B . n 
B 1 26  ILE 26  26  26 ILE ILE B . n 
B 1 27  ASP 27  27  27 ASP ASP B . n 
B 1 28  LYS 28  28  28 LYS LYS B . n 
B 1 29  PRO 29  29  29 PRO PRO B . n 
B 1 30  SER 30  30  30 SER SER B . n 
B 1 31  LEU 31  31  31 LEU LEU B . n 
B 1 32  LEU 32  32  32 LEU LEU B . n 
B 1 33  THR 33  33  33 THR THR B . n 
B 1 34  MET 34  34  34 MET MET B . n 
B 1 35  MET 35  35  35 MET MET B . n 
B 1 36  LYS 36  36  36 LYS LYS B . n 
B 1 37  GLU 37  37  37 GLU GLU B . n 
B 1 38  ASN 38  38  38 ASN ASN B . n 
B 1 39  PHE 39  39  39 PHE PHE B . n 
B 1 40  PRO 40  40  40 PRO PRO B . n 
B 1 41  ASN 41  41  41 ASN ASN B . n 
B 1 42  PHE 42  42  42 PHE PHE B . n 
B 1 43  LEU 43  43  43 LEU LEU B . n 
B 1 44  SER 44  44  44 SER SER B . n 
B 1 45  ALA 45  45  45 ALA ALA B . n 
B 1 46  CYS 46  46  46 CYS CYS B . n 
B 1 47  ASP 47  47  47 ASP ASP B . n 
B 1 48  LYS 48  48  48 LYS LYS B . n 
B 1 49  LYS 49  49  49 LYS LYS B . n 
B 1 50  GLY 50  50  50 GLY GLY B . n 
B 1 51  THR 51  51  51 THR THR B . n 
B 1 52  ASN 52  52  52 ASN ASN B . n 
B 1 53  TYR 53  53  53 TYR TYR B . n 
B 1 54  LEU 54  54  54 LEU LEU B . n 
B 1 55  ALA 55  55  55 ALA ALA B . n 
B 1 56  ASP 56  56  56 ASP ASP B . n 
B 1 57  VAL 57  57  57 VAL VAL B . n 
B 1 58  PHE 58  58  58 PHE PHE B . n 
B 1 59  GLU 59  59  59 GLU GLU B . n 
B 1 60  LYS 60  60  60 LYS LYS B . n 
B 1 61  LYS 61  61  61 LYS LYS B . n 
B 1 62  ASP 62  62  62 ASP ASP B . n 
B 1 63  LYS 63  63  63 LYS LYS B . n 
B 1 64  ASN 64  64  64 ASN ASN B . n 
B 1 65  GLU 65  65  65 GLU GLU B . n 
B 1 66  ASP 66  66  66 ASP ASP B . n 
B 1 67  LYS 67  67  67 LYS LYS B . n 
B 1 68  LYS 68  68  68 LYS LYS B . n 
B 1 69  ILE 69  69  69 ILE ILE B . n 
B 1 70  ASP 70  70  70 ASP ASP B . n 
B 1 71  PHE 71  71  71 PHE PHE B . n 
B 1 72  SER 72  72  72 SER SER B . n 
B 1 73  GLU 73  73  73 GLU GLU B . n 
B 1 74  PHE 74  74  74 PHE PHE B . n 
B 1 75  LEU 75  75  75 LEU LEU B . n 
B 1 76  SER 76  76  76 SER SER B . n 
B 1 77  LEU 77  77  77 LEU LEU B . n 
B 1 78  LEU 78  78  78 LEU LEU B . n 
B 1 79  GLY 79  79  79 GLY GLY B . n 
B 1 80  ASP 80  80  80 ASP ASP B . n 
B 1 81  ILE 81  81  81 ILE ILE B . n 
B 1 82  ALA 82  82  82 ALA ALA B . n 
B 1 83  THR 83  83  83 THR THR B . n 
B 1 84  ASP 84  84  84 ASP ASP B . n 
B 1 85  TYR 85  85  85 TYR TYR B . n 
B 1 86  HIS 86  86  86 HIS HIS B . n 
B 1 87  LYS 87  87  87 LYS LYS B . n 
B 1 88  GLN 88  88  88 GLN GLN B . n 
B 1 89  SER 89  89  89 SER SER B . n 
B 1 90  HIS 90  90  90 HIS HIS B . n 
B 1 91  GLY 91  91  91 GLY GLY B . n 
B 1 92  ALA 92  92  92 ALA ALA B . n 
B 1 93  ALA 93  93  93 ALA ALA B . n 
B 1 94  PRO 94  94  94 PRO PRO B . n 
B 1 95  CYS 95  95  95 CYS CYS B . n 
B 1 96  SER 96  96  96 SER SER B . n 
B 1 97  GLY 97  97  ?  ?   ?   B . n 
B 1 98  GLY 98  98  ?  ?   ?   B . n 
B 1 99  SER 99  99  ?  ?   ?   B . n 
B 1 100 GLN 100 100 ?  ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2480  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  10210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 64 ? A ASN 64  ? 1_555 84.2  ? 
2  OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66  ? 1_555 85.2  ? 
3  OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66  ? 1_555 85.8  ? 
4  OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? A LYS 68 ? A LYS 68  ? 1_555 90.4  ? 
5  OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? A LYS 68 ? A LYS 68  ? 1_555 163.8 ? 
6  OD1 ? A ASP 66 ? A ASP 66  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? A LYS 68 ? A LYS 68  ? 1_555 78.4  ? 
7  OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 115.8 ? 
8  OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 120.8 ? 
9  OD1 ? A ASP 66 ? A ASP 66  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 146.1 ? 
10 O   ? A LYS 68 ? A LYS 68  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 75.4  ? 
11 OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 91.5  ? 
12 OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 73.5  ? 
13 OD1 ? A ASP 66 ? A ASP 66  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 159.3 ? 
14 O   ? A LYS 68 ? A LYS 68  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 122.1 ? 
15 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 52.4  ? 
16 OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 172.1 ? 
17 OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 88.5  ? 
18 OD1 ? A ASP 66 ? A ASP 66  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 91.3  ? 
19 O   ? A LYS 68 ? A LYS 68  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 95.9  ? 
20 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 70.7  ? 
21 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O   ? F HOH .  ? A HOH 269 ? 1_555 89.3  ? 
22 OD1 ? A ASP 62 ? A ASP 62  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 123.4 ? 
23 OD1 ? A ASN 64 ? A ASN 64  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 77.3  ? 
24 OD1 ? A ASP 66 ? A ASP 66  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 41.0  ? 
25 O   ? A LYS 68 ? A LYS 68  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 93.2  ? 
26 OE1 ? A GLU 73 ? A GLU 73  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 119.7 ? 
27 OE2 ? A GLU 73 ? A GLU 73  ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 131.3 ? 
28 O   ? F HOH .  ? A HOH 269 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 51.6  ? 
29 NE2 ? A HIS 17 ? A HIS 17  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OD1 ? A ASP 24 ? A ASP 24  ? 1_555 97.7  ? 
30 NE2 ? A HIS 17 ? A HIS 17  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OD2 ? A ASP 24 ? A ASP 24  ? 1_555 160.0 ? 
31 OD1 ? A ASP 24 ? A ASP 24  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OD2 ? A ASP 24 ? A ASP 24  ? 1_555 63.1  ? 
32 NE2 ? A HIS 17 ? A HIS 17  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 86 ? B HIS 86  ? 1_555 112.9 ? 
33 OD1 ? A ASP 24 ? A ASP 24  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 86 ? B HIS 86  ? 1_555 135.2 ? 
34 OD2 ? A ASP 24 ? A ASP 24  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 86 ? B HIS 86  ? 1_555 81.0  ? 
35 NE2 ? A HIS 17 ? A HIS 17  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 90 ? B HIS 90  ? 1_555 105.5 ? 
36 OD1 ? A ASP 24 ? A ASP 24  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 90 ? B HIS 90  ? 1_555 111.3 ? 
37 OD2 ? A ASP 24 ? A ASP 24  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 90 ? B HIS 90  ? 1_555 87.7  ? 
38 NE2 ? B HIS 86 ? B HIS 86  ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? B HIS 90 ? B HIS 90  ? 1_555 91.8  ? 
39 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 86.4  ? 
40 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 90.6  ? 
41 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 89.9  ? 
42 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? B LYS 68 ? B LYS 68  ? 1_555 92.9  ? 
43 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? B LYS 68 ? B LYS 68  ? 1_555 167.3 ? 
44 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? B LYS 68 ? B LYS 68  ? 1_555 77.4  ? 
45 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 116.4 ? 
46 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 119.4 ? 
47 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 139.7 ? 
48 O   ? B LYS 68 ? B LYS 68  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 72.2  ? 
49 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 92.0  ? 
50 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 75.2  ? 
51 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 164.7 ? 
52 O   ? B LYS 68 ? B LYS 68  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 117.5 ? 
53 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 50.5  ? 
54 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 173.8 ? 
55 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 87.4  ? 
56 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 89.0  ? 
57 O   ? B LYS 68 ? B LYS 68  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 93.1  ? 
58 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 67.2  ? 
59 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 O   ? G HOH .  ? B HOH 270 ? 1_555 86.7  ? 
60 OD1 ? B ASP 62 ? B ASP 62  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 128.9 ? 
61 OD1 ? B ASN 64 ? B ASN 64  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 78.9  ? 
62 OD1 ? B ASP 66 ? B ASP 66  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 41.4  ? 
63 O   ? B LYS 68 ? B LYS 68  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 91.8  ? 
64 OE1 ? B GLU 73 ? B GLU 73  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 113.4 ? 
65 OE2 ? B GLU 73 ? B GLU 73  ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 129.5 ? 
66 O   ? G HOH .  ? B HOH 270 ? 1_555 CA ? E CA . ? B CA 102 ? 1_555 OD2 ? B ASP 66 ? B ASP 66  ? 1_555 49.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-15 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .         ? 1 
SCALA     'data scaling'   .         ? 2 
SHELXL-97 'model building' .         ? 3 
SHELXL-97 refinement       .         ? 4 
CCP4      'data scaling'   '(SCALA)' ? 5 
SHELXL-97 phasing          .         ? 6 
# 
_pdbx_entry_details.entry_id             3PSR 
_pdbx_entry_details.compound_details     
;FOR THIS STRUCTURE, ONLY ONE OF THE TWO ZINC BINDING SITES
ACTUALLY BINDS ZINC (MONOMER A), WHEREAS THE OTHER
(MONOMER B) DOES NOT.  ONLY ONE ZINC SITE IS LISTED ON
SITE RECORDS BELOW.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CD B ARG 21 ? ? NE B ARG 21 ? ? CZ  B ARG 21 ? ? 133.32 123.60 9.72 1.40 N 
2 1 NE B ARG 21 ? ? CZ B ARG 21 ? ? NH1 B ARG 21 ? ? 123.60 120.30 3.30 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 92 ? ? -38.22  157.38  
2 1 CYS A 95 ? ? 50.35   79.52   
3 1 ARG B 21 ? ? 56.91   -138.31 
4 1 ASP B 23 ? ? -112.01 -158.59 
5 1 ALA B 92 ? ? -29.52  159.21  
6 1 CYS B 95 ? ? 48.24   76.75   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 97  ? A GLY 97  
2 1 Y 1 A GLY 98  ? A GLY 98  
3 1 Y 1 A SER 99  ? A SER 99  
4 1 Y 1 A GLN 100 ? A GLN 100 
5 1 Y 1 B GLY 97  ? B GLY 97  
6 1 Y 1 B GLY 98  ? B GLY 98  
7 1 Y 1 B SER 99  ? B SER 99  
8 1 Y 1 B GLN 100 ? B GLN 100 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 'ZINC ION'    ZN  
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1  102 102 CA  CA  A . 
D 3 ZN  1  103 103 ZN  ZN  A . 
E 2 CA  1  102 102 CA  CA  B . 
F 4 HOH 1  201 201 HOH HOH A . 
F 4 HOH 2  202 202 HOH HOH A . 
F 4 HOH 3  203 203 HOH HOH A . 
F 4 HOH 4  205 205 HOH HOH A . 
F 4 HOH 5  206 206 HOH HOH A . 
F 4 HOH 6  208 208 HOH HOH A . 
F 4 HOH 7  209 209 HOH HOH A . 
F 4 HOH 8  210 210 HOH HOH A . 
F 4 HOH 9  213 213 HOH HOH A . 
F 4 HOH 10 218 218 HOH HOH A . 
F 4 HOH 11 219 219 HOH HOH A . 
F 4 HOH 12 220 220 HOH HOH A . 
F 4 HOH 13 221 221 HOH HOH A . 
F 4 HOH 14 224 224 HOH HOH A . 
F 4 HOH 15 225 225 HOH HOH A . 
F 4 HOH 16 226 226 HOH HOH A . 
F 4 HOH 17 227 227 HOH HOH A . 
F 4 HOH 18 228 228 HOH HOH A . 
F 4 HOH 19 229 229 HOH HOH A . 
F 4 HOH 20 231 231 HOH HOH A . 
F 4 HOH 21 233 233 HOH HOH A . 
F 4 HOH 22 234 234 HOH HOH A . 
F 4 HOH 23 240 240 HOH HOH A . 
F 4 HOH 24 243 243 HOH HOH A . 
F 4 HOH 25 245 245 HOH HOH A . 
F 4 HOH 26 247 247 HOH HOH A . 
F 4 HOH 27 249 249 HOH HOH A . 
F 4 HOH 28 253 253 HOH HOH A . 
F 4 HOH 29 255 255 HOH HOH A . 
F 4 HOH 30 256 256 HOH HOH A . 
F 4 HOH 31 258 258 HOH HOH A . 
F 4 HOH 32 262 262 HOH HOH A . 
F 4 HOH 33 263 263 HOH HOH A . 
F 4 HOH 34 264 264 HOH HOH A . 
F 4 HOH 35 266 266 HOH HOH A . 
F 4 HOH 36 267 267 HOH HOH A . 
F 4 HOH 37 269 269 HOH HOH A . 
G 4 HOH 1  204 204 HOH HOH B . 
G 4 HOH 2  207 207 HOH HOH B . 
G 4 HOH 3  211 211 HOH HOH B . 
G 4 HOH 4  212 212 HOH HOH B . 
G 4 HOH 5  214 214 HOH HOH B . 
G 4 HOH 6  215 215 HOH HOH B . 
G 4 HOH 7  216 216 HOH HOH B . 
G 4 HOH 8  217 217 HOH HOH B . 
G 4 HOH 9  222 222 HOH HOH B . 
G 4 HOH 10 223 223 HOH HOH B . 
G 4 HOH 11 230 230 HOH HOH B . 
G 4 HOH 12 232 232 HOH HOH B . 
G 4 HOH 13 235 235 HOH HOH B . 
G 4 HOH 14 236 236 HOH HOH B . 
G 4 HOH 15 237 237 HOH HOH B . 
G 4 HOH 16 238 238 HOH HOH B . 
G 4 HOH 17 239 239 HOH HOH B . 
G 4 HOH 18 241 241 HOH HOH B . 
G 4 HOH 19 242 242 HOH HOH B . 
G 4 HOH 20 244 244 HOH HOH B . 
G 4 HOH 21 246 246 HOH HOH B . 
G 4 HOH 22 248 248 HOH HOH B . 
G 4 HOH 23 250 250 HOH HOH B . 
G 4 HOH 24 251 251 HOH HOH B . 
G 4 HOH 25 252 252 HOH HOH B . 
G 4 HOH 26 254 254 HOH HOH B . 
G 4 HOH 27 257 257 HOH HOH B . 
G 4 HOH 28 259 259 HOH HOH B . 
G 4 HOH 29 260 260 HOH HOH B . 
G 4 HOH 30 261 261 HOH HOH B . 
G 4 HOH 31 265 265 HOH HOH B . 
G 4 HOH 32 268 268 HOH HOH B . 
G 4 HOH 33 270 270 HOH HOH B . 
#