data_3PT6
# 
_entry.id   3PT6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PT6         
NDB   NA0856       
RCSB  RCSB062785   
WWPDB D_1000062785 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3PT9 . unspecified 
PDB 3PTA . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PT6 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Song, J.'    1 
'Patel, D.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            331 
_citation.page_first                1036 
_citation.page_last                 1040 
_citation.year                      2011 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21163962 
_citation.pdbx_database_id_DOI      10.1126/science.1195380 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Song, J.'       1 
primary 'Rechkoblit, O.' 2 
primary 'Bestor, T.H.'   3 
primary 'Patel, D.J.'    4 
# 
_cell.entry_id           3PT6 
_cell.length_a           83.192 
_cell.length_b           213.507 
_cell.length_c           86.274 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PT6 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (cytosine-5)-methyltransferase 1'                                    108040.180 2  2.1.1.37 ? 
'UNP residues 650-1602' ? 
2 polymer     syn 
;DNA (5'-D(*TP*CP*CP*CP*GP*TP*GP*AP*GP*CP*CP*TP*CP*CP*GP*CP*AP*GP*G)-3')
;
5782.724   2  ?        ? ?                       ? 
3 polymer     syn 
;DNA (5'-D(*CP*CP*TP*GP*CP*GP*GP*AP*GP*GP*CP*TP*CP*AP*CP*GP*GP*GP*A)-3')
;
5871.786   2  ?        ? ?                       ? 
4 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                                                 384.411    2  ?        ? ? ? 
5 non-polymer syn 'ZINC ION'                                                                65.409     8  ?        ? ? ? 
6 water       nat water                                                                     18.015     24 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dnmt1, Met-1, DNA methyltransferase MmuI, DNA MTase MmuI, M.MmuI, MCMT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SAMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKKLHQGKKKK
QNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVL
GATSDPLELFLVGECENMQLSYIHSKVKVIYKAPSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQP
TEDNKHKFCLSCIRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPV
NETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWS
DEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVS
EPKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTN
SLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRSMVLKLTLR
CLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTI
TVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVR
LGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTT
VTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSA
;
;SAMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKKLHQGKKKK
QNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVL
GATSDPLELFLVGECENMQLSYIHSKVKVIYKAPSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQP
TEDNKHKFCLSCIRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPV
NETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWS
DEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVS
EPKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTN
SLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRSMVLKLTLR
CLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTI
TVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVR
LGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTT
VTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSA
;
A,B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DC)(DC)(DT)(DC)(DC)(DG)(DC)(DA)(DG)(DG)' TCCCGTGAGCCTCCGCAGG 
C,D ? 
3 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DC)(DG)(DG)(DA)(DG)(DG)(DC)(DT)(DC)(DA)(DC)(DG)(DG)(DG)(DA)' CCTGCGGAGGCTCACGGGA 
I,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   MET n 
1 4   LYS n 
1 5   ARG n 
1 6   ARG n 
1 7   ARG n 
1 8   CYS n 
1 9   GLY n 
1 10  VAL n 
1 11  CYS n 
1 12  GLU n 
1 13  VAL n 
1 14  CYS n 
1 15  GLN n 
1 16  GLN n 
1 17  PRO n 
1 18  GLU n 
1 19  CYS n 
1 20  GLY n 
1 21  LYS n 
1 22  CYS n 
1 23  LYS n 
1 24  ALA n 
1 25  CYS n 
1 26  LYS n 
1 27  ASP n 
1 28  MET n 
1 29  VAL n 
1 30  LYS n 
1 31  PHE n 
1 32  GLY n 
1 33  GLY n 
1 34  THR n 
1 35  GLY n 
1 36  ARG n 
1 37  SER n 
1 38  LYS n 
1 39  GLN n 
1 40  ALA n 
1 41  CYS n 
1 42  LEU n 
1 43  LYS n 
1 44  ARG n 
1 45  ARG n 
1 46  CYS n 
1 47  PRO n 
1 48  ASN n 
1 49  LEU n 
1 50  ALA n 
1 51  VAL n 
1 52  LYS n 
1 53  GLU n 
1 54  ALA n 
1 55  ASP n 
1 56  ASP n 
1 57  ASP n 
1 58  GLU n 
1 59  GLU n 
1 60  ALA n 
1 61  ASP n 
1 62  ASP n 
1 63  ASP n 
1 64  VAL n 
1 65  SER n 
1 66  GLU n 
1 67  MET n 
1 68  PRO n 
1 69  SER n 
1 70  PRO n 
1 71  LYS n 
1 72  LYS n 
1 73  LEU n 
1 74  HIS n 
1 75  GLN n 
1 76  GLY n 
1 77  LYS n 
1 78  LYS n 
1 79  LYS n 
1 80  LYS n 
1 81  GLN n 
1 82  ASN n 
1 83  LYS n 
1 84  ASP n 
1 85  ARG n 
1 86  ILE n 
1 87  SER n 
1 88  TRP n 
1 89  LEU n 
1 90  GLY n 
1 91  GLN n 
1 92  PRO n 
1 93  MET n 
1 94  LYS n 
1 95  ILE n 
1 96  GLU n 
1 97  GLU n 
1 98  ASN n 
1 99  ARG n 
1 100 THR n 
1 101 TYR n 
1 102 TYR n 
1 103 GLN n 
1 104 LYS n 
1 105 VAL n 
1 106 SER n 
1 107 ILE n 
1 108 ASP n 
1 109 GLU n 
1 110 GLU n 
1 111 MET n 
1 112 LEU n 
1 113 GLU n 
1 114 VAL n 
1 115 GLY n 
1 116 ASP n 
1 117 CYS n 
1 118 VAL n 
1 119 SER n 
1 120 VAL n 
1 121 ILE n 
1 122 PRO n 
1 123 ASP n 
1 124 ASP n 
1 125 SER n 
1 126 SER n 
1 127 LYS n 
1 128 PRO n 
1 129 LEU n 
1 130 TYR n 
1 131 LEU n 
1 132 ALA n 
1 133 ARG n 
1 134 VAL n 
1 135 THR n 
1 136 ALA n 
1 137 LEU n 
1 138 TRP n 
1 139 GLU n 
1 140 ASP n 
1 141 LYS n 
1 142 ASN n 
1 143 GLY n 
1 144 GLN n 
1 145 MET n 
1 146 MET n 
1 147 PHE n 
1 148 HIS n 
1 149 ALA n 
1 150 HIS n 
1 151 TRP n 
1 152 PHE n 
1 153 CYS n 
1 154 ALA n 
1 155 GLY n 
1 156 THR n 
1 157 ASP n 
1 158 THR n 
1 159 VAL n 
1 160 LEU n 
1 161 GLY n 
1 162 ALA n 
1 163 THR n 
1 164 SER n 
1 165 ASP n 
1 166 PRO n 
1 167 LEU n 
1 168 GLU n 
1 169 LEU n 
1 170 PHE n 
1 171 LEU n 
1 172 VAL n 
1 173 GLY n 
1 174 GLU n 
1 175 CYS n 
1 176 GLU n 
1 177 ASN n 
1 178 MET n 
1 179 GLN n 
1 180 LEU n 
1 181 SER n 
1 182 TYR n 
1 183 ILE n 
1 184 HIS n 
1 185 SER n 
1 186 LYS n 
1 187 VAL n 
1 188 LYS n 
1 189 VAL n 
1 190 ILE n 
1 191 TYR n 
1 192 LYS n 
1 193 ALA n 
1 194 PRO n 
1 195 SER n 
1 196 GLU n 
1 197 ASN n 
1 198 TRP n 
1 199 ALA n 
1 200 MET n 
1 201 GLU n 
1 202 GLY n 
1 203 GLY n 
1 204 THR n 
1 205 ASP n 
1 206 PRO n 
1 207 GLU n 
1 208 THR n 
1 209 THR n 
1 210 LEU n 
1 211 PRO n 
1 212 GLY n 
1 213 ALA n 
1 214 GLU n 
1 215 ASP n 
1 216 GLY n 
1 217 LYS n 
1 218 THR n 
1 219 TYR n 
1 220 PHE n 
1 221 PHE n 
1 222 GLN n 
1 223 LEU n 
1 224 TRP n 
1 225 TYR n 
1 226 ASN n 
1 227 GLN n 
1 228 GLU n 
1 229 TYR n 
1 230 ALA n 
1 231 ARG n 
1 232 PHE n 
1 233 GLU n 
1 234 SER n 
1 235 PRO n 
1 236 PRO n 
1 237 LYS n 
1 238 THR n 
1 239 GLN n 
1 240 PRO n 
1 241 THR n 
1 242 GLU n 
1 243 ASP n 
1 244 ASN n 
1 245 LYS n 
1 246 HIS n 
1 247 LYS n 
1 248 PHE n 
1 249 CYS n 
1 250 LEU n 
1 251 SER n 
1 252 CYS n 
1 253 ILE n 
1 254 ARG n 
1 255 LEU n 
1 256 ALA n 
1 257 GLU n 
1 258 LEU n 
1 259 ARG n 
1 260 GLN n 
1 261 LYS n 
1 262 GLU n 
1 263 MET n 
1 264 PRO n 
1 265 LYS n 
1 266 VAL n 
1 267 LEU n 
1 268 GLU n 
1 269 GLN n 
1 270 ILE n 
1 271 GLU n 
1 272 GLU n 
1 273 VAL n 
1 274 ASP n 
1 275 GLY n 
1 276 ARG n 
1 277 VAL n 
1 278 TYR n 
1 279 CYS n 
1 280 SER n 
1 281 SER n 
1 282 ILE n 
1 283 THR n 
1 284 LYS n 
1 285 ASN n 
1 286 GLY n 
1 287 VAL n 
1 288 VAL n 
1 289 TYR n 
1 290 ARG n 
1 291 LEU n 
1 292 GLY n 
1 293 ASP n 
1 294 SER n 
1 295 VAL n 
1 296 TYR n 
1 297 LEU n 
1 298 PRO n 
1 299 PRO n 
1 300 GLU n 
1 301 ALA n 
1 302 PHE n 
1 303 THR n 
1 304 PHE n 
1 305 ASN n 
1 306 ILE n 
1 307 LYS n 
1 308 VAL n 
1 309 ALA n 
1 310 SER n 
1 311 PRO n 
1 312 VAL n 
1 313 LYS n 
1 314 ARG n 
1 315 PRO n 
1 316 LYS n 
1 317 LYS n 
1 318 ASP n 
1 319 PRO n 
1 320 VAL n 
1 321 ASN n 
1 322 GLU n 
1 323 THR n 
1 324 LEU n 
1 325 TYR n 
1 326 PRO n 
1 327 GLU n 
1 328 HIS n 
1 329 TYR n 
1 330 ARG n 
1 331 LYS n 
1 332 TYR n 
1 333 SER n 
1 334 ASP n 
1 335 TYR n 
1 336 ILE n 
1 337 LYS n 
1 338 GLY n 
1 339 SER n 
1 340 ASN n 
1 341 LEU n 
1 342 ASP n 
1 343 ALA n 
1 344 PRO n 
1 345 GLU n 
1 346 PRO n 
1 347 TYR n 
1 348 ARG n 
1 349 ILE n 
1 350 GLY n 
1 351 ARG n 
1 352 ILE n 
1 353 LYS n 
1 354 GLU n 
1 355 ILE n 
1 356 HIS n 
1 357 CYS n 
1 358 GLY n 
1 359 LYS n 
1 360 LYS n 
1 361 LYS n 
1 362 GLY n 
1 363 LYS n 
1 364 VAL n 
1 365 ASN n 
1 366 GLU n 
1 367 ALA n 
1 368 ASP n 
1 369 ILE n 
1 370 LYS n 
1 371 LEU n 
1 372 ARG n 
1 373 LEU n 
1 374 TYR n 
1 375 LYS n 
1 376 PHE n 
1 377 TYR n 
1 378 ARG n 
1 379 PRO n 
1 380 GLU n 
1 381 ASN n 
1 382 THR n 
1 383 HIS n 
1 384 ARG n 
1 385 SER n 
1 386 TYR n 
1 387 ASN n 
1 388 GLY n 
1 389 SER n 
1 390 TYR n 
1 391 HIS n 
1 392 THR n 
1 393 ASP n 
1 394 ILE n 
1 395 ASN n 
1 396 MET n 
1 397 LEU n 
1 398 TYR n 
1 399 TRP n 
1 400 SER n 
1 401 ASP n 
1 402 GLU n 
1 403 GLU n 
1 404 ALA n 
1 405 VAL n 
1 406 VAL n 
1 407 ASN n 
1 408 PHE n 
1 409 SER n 
1 410 ASP n 
1 411 VAL n 
1 412 GLN n 
1 413 GLY n 
1 414 ARG n 
1 415 CYS n 
1 416 THR n 
1 417 VAL n 
1 418 GLU n 
1 419 TYR n 
1 420 GLY n 
1 421 GLU n 
1 422 ASP n 
1 423 LEU n 
1 424 LEU n 
1 425 GLU n 
1 426 SER n 
1 427 ILE n 
1 428 GLN n 
1 429 ASP n 
1 430 TYR n 
1 431 SER n 
1 432 GLN n 
1 433 GLY n 
1 434 GLY n 
1 435 PRO n 
1 436 ASP n 
1 437 ARG n 
1 438 PHE n 
1 439 TYR n 
1 440 PHE n 
1 441 LEU n 
1 442 GLU n 
1 443 ALA n 
1 444 TYR n 
1 445 ASN n 
1 446 SER n 
1 447 LYS n 
1 448 THR n 
1 449 LYS n 
1 450 ASN n 
1 451 PHE n 
1 452 GLU n 
1 453 ASP n 
1 454 PRO n 
1 455 PRO n 
1 456 ASN n 
1 457 HIS n 
1 458 ALA n 
1 459 ARG n 
1 460 SER n 
1 461 PRO n 
1 462 GLY n 
1 463 ASN n 
1 464 LYS n 
1 465 GLY n 
1 466 LYS n 
1 467 GLY n 
1 468 LYS n 
1 469 GLY n 
1 470 LYS n 
1 471 GLY n 
1 472 LYS n 
1 473 GLY n 
1 474 LYS n 
1 475 GLY n 
1 476 LYS n 
1 477 HIS n 
1 478 GLN n 
1 479 VAL n 
1 480 SER n 
1 481 GLU n 
1 482 PRO n 
1 483 LYS n 
1 484 GLU n 
1 485 PRO n 
1 486 GLU n 
1 487 ALA n 
1 488 ALA n 
1 489 ILE n 
1 490 LYS n 
1 491 LEU n 
1 492 PRO n 
1 493 LYS n 
1 494 LEU n 
1 495 ARG n 
1 496 THR n 
1 497 LEU n 
1 498 ASP n 
1 499 VAL n 
1 500 PHE n 
1 501 SER n 
1 502 GLY n 
1 503 CYS n 
1 504 GLY n 
1 505 GLY n 
1 506 LEU n 
1 507 SER n 
1 508 GLU n 
1 509 GLY n 
1 510 PHE n 
1 511 HIS n 
1 512 GLN n 
1 513 ALA n 
1 514 GLY n 
1 515 ILE n 
1 516 SER n 
1 517 GLU n 
1 518 THR n 
1 519 LEU n 
1 520 TRP n 
1 521 ALA n 
1 522 ILE n 
1 523 GLU n 
1 524 MET n 
1 525 TRP n 
1 526 ASP n 
1 527 PRO n 
1 528 ALA n 
1 529 ALA n 
1 530 GLN n 
1 531 ALA n 
1 532 PHE n 
1 533 ARG n 
1 534 LEU n 
1 535 ASN n 
1 536 ASN n 
1 537 PRO n 
1 538 GLY n 
1 539 THR n 
1 540 THR n 
1 541 VAL n 
1 542 PHE n 
1 543 THR n 
1 544 GLU n 
1 545 ASP n 
1 546 CYS n 
1 547 ASN n 
1 548 VAL n 
1 549 LEU n 
1 550 LEU n 
1 551 LYS n 
1 552 LEU n 
1 553 VAL n 
1 554 MET n 
1 555 ALA n 
1 556 GLY n 
1 557 GLU n 
1 558 VAL n 
1 559 THR n 
1 560 ASN n 
1 561 SER n 
1 562 LEU n 
1 563 GLY n 
1 564 GLN n 
1 565 ARG n 
1 566 LEU n 
1 567 PRO n 
1 568 GLN n 
1 569 LYS n 
1 570 GLY n 
1 571 ASP n 
1 572 VAL n 
1 573 GLU n 
1 574 MET n 
1 575 LEU n 
1 576 CYS n 
1 577 GLY n 
1 578 GLY n 
1 579 PRO n 
1 580 PRO n 
1 581 CYS n 
1 582 GLN n 
1 583 GLY n 
1 584 PHE n 
1 585 SER n 
1 586 GLY n 
1 587 MET n 
1 588 ASN n 
1 589 ARG n 
1 590 PHE n 
1 591 ASN n 
1 592 SER n 
1 593 ARG n 
1 594 THR n 
1 595 TYR n 
1 596 SER n 
1 597 LYS n 
1 598 PHE n 
1 599 LYS n 
1 600 ASN n 
1 601 SER n 
1 602 LEU n 
1 603 VAL n 
1 604 VAL n 
1 605 SER n 
1 606 PHE n 
1 607 LEU n 
1 608 SER n 
1 609 TYR n 
1 610 CYS n 
1 611 ASP n 
1 612 TYR n 
1 613 TYR n 
1 614 ARG n 
1 615 PRO n 
1 616 ARG n 
1 617 PHE n 
1 618 PHE n 
1 619 LEU n 
1 620 LEU n 
1 621 GLU n 
1 622 ASN n 
1 623 VAL n 
1 624 ARG n 
1 625 ASN n 
1 626 PHE n 
1 627 VAL n 
1 628 SER n 
1 629 TYR n 
1 630 ARG n 
1 631 ARG n 
1 632 SER n 
1 633 MET n 
1 634 VAL n 
1 635 LEU n 
1 636 LYS n 
1 637 LEU n 
1 638 THR n 
1 639 LEU n 
1 640 ARG n 
1 641 CYS n 
1 642 LEU n 
1 643 VAL n 
1 644 ARG n 
1 645 MET n 
1 646 GLY n 
1 647 TYR n 
1 648 GLN n 
1 649 CYS n 
1 650 THR n 
1 651 PHE n 
1 652 GLY n 
1 653 VAL n 
1 654 LEU n 
1 655 GLN n 
1 656 ALA n 
1 657 GLY n 
1 658 GLN n 
1 659 TYR n 
1 660 GLY n 
1 661 VAL n 
1 662 ALA n 
1 663 GLN n 
1 664 THR n 
1 665 ARG n 
1 666 ARG n 
1 667 ARG n 
1 668 ALA n 
1 669 ILE n 
1 670 ILE n 
1 671 LEU n 
1 672 ALA n 
1 673 ALA n 
1 674 ALA n 
1 675 PRO n 
1 676 GLY n 
1 677 GLU n 
1 678 LYS n 
1 679 LEU n 
1 680 PRO n 
1 681 LEU n 
1 682 PHE n 
1 683 PRO n 
1 684 GLU n 
1 685 PRO n 
1 686 LEU n 
1 687 HIS n 
1 688 VAL n 
1 689 PHE n 
1 690 ALA n 
1 691 PRO n 
1 692 ARG n 
1 693 ALA n 
1 694 CYS n 
1 695 GLN n 
1 696 LEU n 
1 697 SER n 
1 698 VAL n 
1 699 VAL n 
1 700 VAL n 
1 701 ASP n 
1 702 ASP n 
1 703 LYS n 
1 704 LYS n 
1 705 PHE n 
1 706 VAL n 
1 707 SER n 
1 708 ASN n 
1 709 ILE n 
1 710 THR n 
1 711 ARG n 
1 712 LEU n 
1 713 SER n 
1 714 SER n 
1 715 GLY n 
1 716 PRO n 
1 717 PHE n 
1 718 ARG n 
1 719 THR n 
1 720 ILE n 
1 721 THR n 
1 722 VAL n 
1 723 ARG n 
1 724 ASP n 
1 725 THR n 
1 726 MET n 
1 727 SER n 
1 728 ASP n 
1 729 LEU n 
1 730 PRO n 
1 731 GLU n 
1 732 ILE n 
1 733 GLN n 
1 734 ASN n 
1 735 GLY n 
1 736 ALA n 
1 737 SER n 
1 738 ASN n 
1 739 SER n 
1 740 GLU n 
1 741 ILE n 
1 742 PRO n 
1 743 TYR n 
1 744 ASN n 
1 745 GLY n 
1 746 GLU n 
1 747 PRO n 
1 748 LEU n 
1 749 SER n 
1 750 TRP n 
1 751 PHE n 
1 752 GLN n 
1 753 ARG n 
1 754 GLN n 
1 755 LEU n 
1 756 ARG n 
1 757 GLY n 
1 758 SER n 
1 759 HIS n 
1 760 TYR n 
1 761 GLN n 
1 762 PRO n 
1 763 ILE n 
1 764 LEU n 
1 765 ARG n 
1 766 ASP n 
1 767 HIS n 
1 768 ILE n 
1 769 CYS n 
1 770 LYS n 
1 771 ASP n 
1 772 MET n 
1 773 SER n 
1 774 PRO n 
1 775 LEU n 
1 776 VAL n 
1 777 ALA n 
1 778 ALA n 
1 779 ARG n 
1 780 MET n 
1 781 ARG n 
1 782 HIS n 
1 783 ILE n 
1 784 PRO n 
1 785 LEU n 
1 786 PHE n 
1 787 PRO n 
1 788 GLY n 
1 789 SER n 
1 790 ASP n 
1 791 TRP n 
1 792 ARG n 
1 793 ASP n 
1 794 LEU n 
1 795 PRO n 
1 796 ASN n 
1 797 ILE n 
1 798 GLN n 
1 799 VAL n 
1 800 ARG n 
1 801 LEU n 
1 802 GLY n 
1 803 ASP n 
1 804 GLY n 
1 805 VAL n 
1 806 ILE n 
1 807 ALA n 
1 808 HIS n 
1 809 LYS n 
1 810 LEU n 
1 811 GLN n 
1 812 TYR n 
1 813 THR n 
1 814 PHE n 
1 815 HIS n 
1 816 ASP n 
1 817 VAL n 
1 818 LYS n 
1 819 ASN n 
1 820 GLY n 
1 821 TYR n 
1 822 SER n 
1 823 SER n 
1 824 THR n 
1 825 GLY n 
1 826 ALA n 
1 827 LEU n 
1 828 ARG n 
1 829 GLY n 
1 830 VAL n 
1 831 CYS n 
1 832 SER n 
1 833 CYS n 
1 834 ALA n 
1 835 GLU n 
1 836 GLY n 
1 837 LYS n 
1 838 ALA n 
1 839 CYS n 
1 840 ASP n 
1 841 PRO n 
1 842 GLU n 
1 843 SER n 
1 844 ARG n 
1 845 GLN n 
1 846 PHE n 
1 847 SER n 
1 848 THR n 
1 849 LEU n 
1 850 ILE n 
1 851 PRO n 
1 852 TRP n 
1 853 CYS n 
1 854 LEU n 
1 855 PRO n 
1 856 HIS n 
1 857 THR n 
1 858 GLY n 
1 859 ASN n 
1 860 ARG n 
1 861 HIS n 
1 862 ASN n 
1 863 HIS n 
1 864 TRP n 
1 865 ALA n 
1 866 GLY n 
1 867 LEU n 
1 868 TYR n 
1 869 GLY n 
1 870 ARG n 
1 871 LEU n 
1 872 GLU n 
1 873 TRP n 
1 874 ASP n 
1 875 GLY n 
1 876 PHE n 
1 877 PHE n 
1 878 SER n 
1 879 THR n 
1 880 THR n 
1 881 VAL n 
1 882 THR n 
1 883 ASN n 
1 884 PRO n 
1 885 GLU n 
1 886 PRO n 
1 887 MET n 
1 888 GLY n 
1 889 LYS n 
1 890 GLN n 
1 891 GLY n 
1 892 ARG n 
1 893 VAL n 
1 894 LEU n 
1 895 HIS n 
1 896 PRO n 
1 897 GLU n 
1 898 GLN n 
1 899 HIS n 
1 900 ARG n 
1 901 VAL n 
1 902 VAL n 
1 903 SER n 
1 904 VAL n 
1 905 ARG n 
1 906 GLU n 
1 907 CYS n 
1 908 ALA n 
1 909 ARG n 
1 910 SER n 
1 911 GLN n 
1 912 GLY n 
1 913 PHE n 
1 914 PRO n 
1 915 ASP n 
1 916 SER n 
1 917 TYR n 
1 918 ARG n 
1 919 PHE n 
1 920 PHE n 
1 921 GLY n 
1 922 ASN n 
1 923 ILE n 
1 924 LEU n 
1 925 ASP n 
1 926 ARG n 
1 927 HIS n 
1 928 ARG n 
1 929 GLN n 
1 930 VAL n 
1 931 GLY n 
1 932 ASN n 
1 933 ALA n 
1 934 VAL n 
1 935 PRO n 
1 936 PRO n 
1 937 PRO n 
1 938 LEU n 
1 939 ALA n 
1 940 LYS n 
1 941 ALA n 
1 942 ILE n 
1 943 GLY n 
1 944 LEU n 
1 945 GLU n 
1 946 ILE n 
1 947 LYS n 
1 948 LEU n 
1 949 CYS n 
1 950 LEU n 
1 951 LEU n 
1 952 SER n 
1 953 SER n 
1 954 ALA n 
2 1   DT  n 
2 2   DC  n 
2 3   DC  n 
2 4   DC  n 
2 5   DG  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DC  n 
2 12  DT  n 
2 13  DC  n 
2 14  DC  n 
2 15  DG  n 
2 16  DC  n 
2 17  DA  n 
2 18  DG  n 
2 19  DG  n 
3 1   DC  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DC  n 
3 6   DG  n 
3 7   DG  n 
3 8   DA  n 
3 9   DG  n 
3 10  DG  n 
3 11  DC  n 
3 12  DT  n 
3 13  DC  n 
3 14  DA  n 
3 15  DC  n 
3 16  DG  n 
3 17  DG  n 
3 18  DG  n 
3 19  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Dnmt1, Dnmt, Met1, Uim' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-RIL (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DNMT1_MOUSE P13864 1 
;AMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKKLHQGKKKKQ
NKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVLG
ATSDPLELFLVGECENMQLSYIHSKVKVIYKAPSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQPT
EDNKHKFCLSCIRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVN
ETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWSD
EEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVSE
PKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTNS
LGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRSMVLKLTLRC
LVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTIT
VRDTMSDLPEIQNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVRL
GDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTV
TNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSA
;
650 ? 
2 PDB 3PT6        3PT6   2 TCCCGTGAGCCTCCGCAGG ?   ? 
3 PDB 3PT6        3PT6   3 CCTGCGGAGGCTCACGGGA ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3PT6 A 2 ? 954 ? P13864 650 ? 1602 ? 650 1602 
2 1 3PT6 B 2 ? 954 ? P13864 650 ? 1602 ? 650 1602 
3 2 3PT6 C 1 ? 19  ? 3PT6   1   ? 19   ? 1   19   
4 2 3PT6 D 1 ? 19  ? 3PT6   1   ? 19   ? 1   19   
5 3 3PT6 I 1 ? 19  ? 3PT6   20  ? 38   ? 20  38   
6 3 3PT6 J 1 ? 19  ? 3PT6   20  ? 38   ? 20  38   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3PT6 SER A 1 ? UNP P13864 ? ? 'EXPRESSION TAG' 649 1 
2 3PT6 SER B 1 ? UNP P13864 ? ? 'EXPRESSION TAG' 649 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE            ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          3PT6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '6% PEG20,000, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-11-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.2827 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2827 
# 
_reflns.entry_id                     3PT6 
_reflns.observed_criterion_sigma_I   -1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   58596 
_reflns.number_all                   58980 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.512 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5839 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3PT6 
_refine.ls_number_reflns_obs                     57011 
_refine.ls_number_reflns_all                     58596 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.819 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    96.55 
_refine.ls_R_factor_obs                          0.2130 
_refine.ls_R_factor_R_work                       0.2111 
_refine.ls_R_factor_R_free                       0.2659 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.39 
_refine.ls_number_reflns_R_free                  1930 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            9.8450 
_refine.aniso_B[2][2]                            -13.8660 
_refine.aniso_B[3][3]                            4.0210 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            8.5073 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.271 
_refine.solvent_model_param_bsol                 24.470 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13963 
_refine_hist.pdbx_number_atoms_nucleic_acid   1546 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               15593 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        29.819 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 16138 'X-RAY DIFFRACTION' ? 
f_angle_d          0.970  ? ? 22246 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.667 ? ? 5928  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.060  ? ? 2373  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 2670  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.00   3.1092  5074 0.3228 89.00 0.3539 . . 174 . . . . 'X-RAY DIFFRACTION' 
. 3.1092 3.2336  5250 0.2923 93.00 0.3675 . . 187 . . . . 'X-RAY DIFFRACTION' 
. 3.2336 3.3805  5395 0.2614 95.00 0.3178 . . 182 . . . . 'X-RAY DIFFRACTION' 
. 3.3805 3.5585  5490 0.2400 96.00 0.3076 . . 197 . . . . 'X-RAY DIFFRACTION' 
. 3.5585 3.7810  5573 0.2217 98.00 0.3037 . . 196 . . . . 'X-RAY DIFFRACTION' 
. 3.7810 4.0723  5566 0.2018 98.00 0.2569 . . 192 . . . . 'X-RAY DIFFRACTION' 
. 4.0723 4.4809  5645 0.1775 99.00 0.2472 . . 198 . . . . 'X-RAY DIFFRACTION' 
. 4.4809 5.1264  5686 0.1696 99.00 0.2052 . . 202 . . . . 'X-RAY DIFFRACTION' 
. 5.1264 6.4480  5696 0.2093 99.00 0.2477 . . 199 . . . . 'X-RAY DIFFRACTION' 
. 6.4480 29.8207 5706 0.1868 99.00 0.2434 . . 203 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3PT6 
_struct.title                     'Crystal structure of mouse DNMT1(650-1602) in complex with DNA' 
_struct.pdbx_descriptor           'DNA (cytosine-5)-methyltransferase 1 (E.C.2.1.1.37)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PT6 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            'Maintenance DNA methylation, Transferase-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 3 ? 
F N N 1 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 11  ? GLN A 16  ? CYS A 659  GLN A 664  1 ? 6  
HELX_P HELX_P2  2  CYS A 41  ? ARG A 45  ? CYS A 689  ARG A 693  5 ? 5  
HELX_P HELX_P3  3  ALA A 154 ? THR A 158 ? ALA A 802  THR A 806  5 ? 5  
HELX_P HELX_P4  4  LEU A 160 ? SER A 164 ? LEU A 808  SER A 812  5 ? 5  
HELX_P HELX_P5  5  ASN A 244 ? PHE A 248 ? ASN A 892  PHE A 896  5 ? 5  
HELX_P HELX_P6  6  CYS A 249 ? MET A 263 ? CYS A 897  MET A 911  1 ? 15 
HELX_P HELX_P7  7  PRO A 298 ? PHE A 302 ? PRO A 946  PHE A 950  5 ? 5  
HELX_P HELX_P8  8  TYR A 325 ? TYR A 329 ? TYR A 973  TYR A 977  5 ? 5  
HELX_P HELX_P9  9  ARG A 378 ? THR A 382 ? ARG A 1026 THR A 1030 5 ? 5  
HELX_P HELX_P10 10 SER A 385 ? SER A 389 ? SER A 1033 SER A 1037 5 ? 5  
HELX_P HELX_P11 11 SER A 409 ? VAL A 411 ? SER A 1057 VAL A 1059 5 ? 3  
HELX_P HELX_P12 12 SER A 426 ? GLY A 434 ? SER A 1074 GLY A 1082 1 ? 9  
HELX_P HELX_P13 13 GLY A 504 ? GLY A 514 ? GLY A 1152 GLY A 1162 1 ? 11 
HELX_P HELX_P14 14 TRP A 525 ? ASN A 536 ? TRP A 1173 ASN A 1184 1 ? 12 
HELX_P HELX_P15 15 ASP A 545 ? ALA A 555 ? ASP A 1193 ALA A 1203 1 ? 11 
HELX_P HELX_P16 16 CYS A 581 ? SER A 585 ? CYS A 1229 SER A 1233 5 ? 5  
HELX_P HELX_P17 17 TYR A 595 ? ASN A 600 ? TYR A 1243 ASN A 1248 1 ? 6  
HELX_P HELX_P18 18 SER A 601 ? ARG A 614 ? SER A 1249 ARG A 1262 1 ? 14 
HELX_P HELX_P19 19 ASN A 625 ? SER A 628 ? ASN A 1273 SER A 1276 5 ? 4  
HELX_P HELX_P20 20 SER A 632 ? GLY A 646 ? SER A 1280 GLY A 1294 1 ? 15 
HELX_P HELX_P21 21 GLY A 657 ? GLY A 660 ? GLY A 1305 GLY A 1308 5 ? 4  
HELX_P HELX_P22 22 ALA A 690 ? GLN A 695 ? ALA A 1338 GLN A 1343 5 ? 6  
HELX_P HELX_P23 23 THR A 721 ? SER A 727 ? THR A 1369 SER A 1375 1 ? 7  
HELX_P HELX_P24 24 SER A 749 ? ARG A 756 ? SER A 1397 ARG A 1404 1 ? 8  
HELX_P HELX_P25 25 SER A 773 ? HIS A 782 ? SER A 1421 HIS A 1430 1 ? 10 
HELX_P HELX_P26 26 ASP A 790 ? LEU A 794 ? ASP A 1438 LEU A 1442 5 ? 5  
HELX_P HELX_P27 27 CYS A 831 ? GLY A 836 ? CYS A 1479 GLY A 1484 5 ? 6  
HELX_P HELX_P28 28 ASP A 840 ? ARG A 844 ? ASP A 1488 ARG A 1492 5 ? 5  
HELX_P HELX_P29 29 TRP A 852 ? GLY A 858 ? TRP A 1500 GLY A 1506 1 ? 7  
HELX_P HELX_P30 30 ASN A 859 ? ALA A 865 ? ASN A 1507 ALA A 1513 5 ? 7  
HELX_P HELX_P31 31 SER A 903 ? GLN A 911 ? SER A 1551 GLN A 1559 1 ? 9  
HELX_P HELX_P32 32 ASN A 922 ? ALA A 933 ? ASN A 1570 ALA A 1581 1 ? 12 
HELX_P HELX_P33 33 PRO A 935 ? LEU A 948 ? PRO A 1583 LEU A 1596 1 ? 14 
HELX_P HELX_P34 34 CYS F 11  ? GLN F 16  ? CYS B 659  GLN B 664  1 ? 6  
HELX_P HELX_P35 35 CYS F 22  ? ASP F 27  ? CYS B 670  ASP B 675  1 ? 6  
HELX_P HELX_P36 36 MET F 28  ? GLY F 32  ? MET B 676  GLY B 680  5 ? 5  
HELX_P HELX_P37 37 CYS F 41  ? ARG F 45  ? CYS B 689  ARG B 693  5 ? 5  
HELX_P HELX_P38 38 THR F 156 ? THR F 158 ? THR B 804  THR B 806  5 ? 3  
HELX_P HELX_P39 39 LEU F 160 ? SER F 164 ? LEU B 808  SER B 812  5 ? 5  
HELX_P HELX_P40 40 CYS F 249 ? MET F 263 ? CYS B 897  MET B 911  1 ? 15 
HELX_P HELX_P41 41 TYR F 325 ? LYS F 331 ? TYR B 973  LYS B 979  5 ? 7  
HELX_P HELX_P42 42 SER F 339 ? ALA F 343 ? SER B 987  ALA B 991  5 ? 5  
HELX_P HELX_P43 43 ARG F 378 ? THR F 382 ? ARG B 1026 THR B 1030 5 ? 5  
HELX_P HELX_P44 44 SER F 409 ? VAL F 411 ? SER B 1057 VAL B 1059 5 ? 3  
HELX_P HELX_P45 45 SER F 426 ? GLY F 434 ? SER B 1074 GLY B 1082 1 ? 9  
HELX_P HELX_P46 46 PRO F 455 ? ARG F 459 ? PRO B 1103 ARG B 1107 5 ? 5  
HELX_P HELX_P47 47 GLY F 504 ? GLY F 514 ? GLY B 1152 GLY B 1162 1 ? 11 
HELX_P HELX_P48 48 TRP F 525 ? ASN F 536 ? TRP B 1173 ASN B 1184 1 ? 12 
HELX_P HELX_P49 49 ASP F 545 ? ALA F 555 ? ASP B 1193 ALA B 1203 1 ? 11 
HELX_P HELX_P50 50 ASN F 591 ? ASN F 600 ? ASN B 1239 ASN B 1248 1 ? 10 
HELX_P HELX_P51 51 SER F 601 ? ARG F 614 ? SER B 1249 ARG B 1262 1 ? 14 
HELX_P HELX_P52 52 ARG F 624 ? VAL F 627 ? ARG B 1272 VAL B 1275 5 ? 4  
HELX_P HELX_P53 53 SER F 628 ? MET F 645 ? SER B 1276 MET B 1293 1 ? 18 
HELX_P HELX_P54 54 GLY F 657 ? GLY F 660 ? GLY B 1305 GLY B 1308 5 ? 4  
HELX_P HELX_P55 55 ALA F 690 ? CYS F 694 ? ALA B 1338 CYS B 1342 5 ? 5  
HELX_P HELX_P56 56 THR F 721 ? SER F 727 ? THR B 1369 SER B 1375 1 ? 7  
HELX_P HELX_P57 57 SER F 749 ? GLY F 757 ? SER B 1397 GLY B 1405 1 ? 9  
HELX_P HELX_P58 58 SER F 773 ? HIS F 782 ? SER B 1421 HIS B 1430 1 ? 10 
HELX_P HELX_P59 59 ASP F 790 ? LEU F 794 ? ASP B 1438 LEU B 1442 5 ? 5  
HELX_P HELX_P60 60 CYS F 831 ? GLU F 835 ? CYS B 1479 GLU B 1483 5 ? 5  
HELX_P HELX_P61 61 TRP F 852 ? GLY F 858 ? TRP B 1500 GLY B 1506 1 ? 7  
HELX_P HELX_P62 62 ASN F 859 ? ALA F 865 ? ASN B 1507 ALA B 1513 5 ? 7  
HELX_P HELX_P63 63 SER F 903 ? GLN F 911 ? SER B 1551 GLN B 1559 1 ? 9  
HELX_P HELX_P64 64 ASN F 922 ? ALA F 933 ? ASN B 1570 ALA B 1581 1 ? 12 
HELX_P HELX_P65 65 PRO F 935 ? LEU F 951 ? PRO B 1583 LEU B 1599 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A HIS 148 NE2 ? ? ? 1_555 J ZN .  ZN ? ? A HIS 796  A ZN 3  1_555 ? ? ? ? ? ? ?               2.004 ? 
metalc2   metalc ? ? F HIS 148 NE2 ? ? ? 1_555 L ZN .  ZN ? ? B HIS 796  B ZN 1  1_555 ? ? ? ? ? ? ?               2.029 ? 
metalc3   metalc ? ? A HIS 856 NE2 ? ? ? 1_555 H ZN .  ZN ? ? A HIS 1504 A ZN 1  1_555 ? ? ? ? ? ? ?               2.139 ? 
metalc4   metalc ? ? F HIS 856 NE2 ? ? ? 1_555 P ZN .  ZN ? ? B HIS 1504 B ZN 3  1_555 ? ? ? ? ? ? ?               2.182 ? 
metalc5   metalc ? ? A CYS 252 SG  ? ? ? 1_555 J ZN .  ZN ? ? A CYS 900  A ZN 3  1_555 ? ? ? ? ? ? ?               2.270 ? 
metalc6   metalc ? ? F CYS 839 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1487 B ZN 3  1_555 ? ? ? ? ? ? ?               2.273 ? 
metalc7   metalc ? ? A CYS 14  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 662  A ZN 2  1_555 ? ? ? ? ? ? ?               2.282 ? 
metalc8   metalc ? ? A CYS 11  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 659  A ZN 2  1_555 ? ? ? ? ? ? ?               2.295 ? 
metalc9   metalc ? ? A CYS 175 SG  ? ? ? 1_555 J ZN .  ZN ? ? A CYS 823  A ZN 3  1_555 ? ? ? ? ? ? ?               2.296 ? 
metalc10  metalc ? ? A CYS 839 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 1487 A ZN 1  1_555 ? ? ? ? ? ? ?               2.299 ? 
metalc11  metalc ? ? A CYS 22  SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 670  A ZN 4  1_555 ? ? ? ? ? ? ?               2.302 ? 
metalc12  metalc ? ? F CYS 25  SG  ? ? ? 1_555 O ZN .  ZN ? ? B CYS 673  B ZN 4  1_555 ? ? ? ? ? ? ?               2.307 ? 
metalc13  metalc ? ? A CYS 831 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 1479 A ZN 1  1_555 ? ? ? ? ? ? ?               2.307 ? 
metalc14  metalc ? ? A CYS 46  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 694  A ZN 2  1_555 ? ? ? ? ? ? ?               2.309 ? 
metalc15  metalc ? ? F CYS 8   SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 656  B ZN 2  1_555 ? ? ? ? ? ? ?               2.313 ? 
metalc16  metalc ? ? F CYS 175 SG  ? ? ? 1_555 L ZN .  ZN ? ? B CYS 823  B ZN 1  1_555 ? ? ? ? ? ? ?               2.313 ? 
metalc17  metalc ? ? F CYS 41  SG  ? ? ? 1_555 O ZN .  ZN ? ? B CYS 689  B ZN 4  1_555 ? ? ? ? ? ? ?               2.316 ? 
metalc18  metalc ? ? F CYS 14  SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 662  B ZN 2  1_555 ? ? ? ? ? ? ?               2.317 ? 
metalc19  metalc ? ? F CYS 252 SG  ? ? ? 1_555 L ZN .  ZN ? ? B CYS 900  B ZN 1  1_555 ? ? ? ? ? ? ?               2.320 ? 
metalc20  metalc ? ? F CYS 11  SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 659  B ZN 2  1_555 ? ? ? ? ? ? ?               2.322 ? 
metalc21  metalc ? ? A CYS 25  SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 673  A ZN 4  1_555 ? ? ? ? ? ? ?               2.323 ? 
metalc22  metalc ? ? A CYS 249 SG  ? ? ? 1_555 J ZN .  ZN ? ? A CYS 897  A ZN 3  1_555 ? ? ? ? ? ? ?               2.323 ? 
metalc23  metalc ? ? F CYS 22  SG  ? ? ? 1_555 O ZN .  ZN ? ? B CYS 670  B ZN 4  1_555 ? ? ? ? ? ? ?               2.325 ? 
metalc24  metalc ? ? F CYS 249 SG  ? ? ? 1_555 L ZN .  ZN ? ? B CYS 897  B ZN 1  1_555 ? ? ? ? ? ? ?               2.331 ? 
metalc25  metalc ? ? F CYS 46  SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 694  B ZN 2  1_555 ? ? ? ? ? ? ?               2.337 ? 
metalc26  metalc ? ? A CYS 8   SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 656  A ZN 2  1_555 ? ? ? ? ? ? ?               2.338 ? 
metalc27  metalc ? ? A CYS 833 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 1481 A ZN 1  1_555 ? ? ? ? ? ? ?               2.342 ? 
metalc28  metalc ? ? F CYS 831 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1479 B ZN 3  1_555 ? ? ? ? ? ? ?               2.352 ? 
metalc29  metalc ? ? F CYS 19  SG  ? ? ? 1_555 O ZN .  ZN ? ? B CYS 667  B ZN 4  1_555 ? ? ? ? ? ? ?               2.352 ? 
metalc30  metalc ? ? A CYS 19  SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 667  A ZN 4  1_555 ? ? ? ? ? ? ?               2.355 ? 
metalc31  metalc ? ? F CYS 833 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1481 B ZN 3  1_555 ? ? ? ? ? ? ?               2.356 ? 
metalc32  metalc ? ? A CYS 41  SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 689  A ZN 4  1_555 ? ? ? ? ? ? ?               2.368 ? 
hydrog1   hydrog ? ? B DT  1   N3  ? ? ? 1_555 C DA 19 N1 ? ? C DT  1    I DA 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? B DT  1   O4  ? ? ? 1_555 C DA 19 N6 ? ? C DT  1    I DA 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? B DC  2   N3  ? ? ? 1_555 C DG 18 N1 ? ? C DC  2    I DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? B DC  2   N4  ? ? ? 1_555 C DG 18 O6 ? ? C DC  2    I DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? B DC  2   O2  ? ? ? 1_555 C DG 18 N2 ? ? C DC  2    I DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG 17 O6 ? ? C DC  3    I DG 36 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog7   hydrog ? ? B DC  4   N3  ? ? ? 1_555 C DG 16 N1 ? ? C DC  4    I DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? B DC  4   N4  ? ? ? 1_555 C DG 16 O6 ? ? C DC  4    I DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? B DC  4   O2  ? ? ? 1_555 C DG 16 N2 ? ? C DC  4    I DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? B DG  5   N1  ? ? ? 1_555 C DC 15 N3 ? ? C DG  5    I DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? B DG  5   N2  ? ? ? 1_555 C DC 15 O2 ? ? C DG  5    I DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? B DG  5   O6  ? ? ? 1_555 C DC 15 N4 ? ? C DG  5    I DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DC 13 N4 ? ? C DT  6    I DC 32 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog14  hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA 14 N1 ? ? C DT  6    I DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA 14 N6 ? ? C DT  6    I DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC 13 N3 ? ? C DG  7    I DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC 13 O2 ? ? C DG  7    I DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC 13 N4 ? ? C DG  7    I DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT 12 N3 ? ? C DA  8    I DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT 12 O4 ? ? C DA  8    I DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC 11 N3 ? ? C DG  9    I DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC 11 O2 ? ? C DG  9    I DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC 11 N4 ? ? C DG  9    I DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? B DC  10  N3  ? ? ? 1_555 C DG 10 N1 ? ? C DC  10   I DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? B DC  10  N4  ? ? ? 1_555 C DG 10 O6 ? ? C DC  10   I DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? B DC  10  O2  ? ? ? 1_555 C DG 10 N2 ? ? C DC  10   I DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? B DC  11  N3  ? ? ? 1_555 C DG 9  N1 ? ? C DC  11   I DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? B DC  11  N4  ? ? ? 1_555 C DG 9  O6 ? ? C DC  11   I DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? B DC  11  O2  ? ? ? 1_555 C DG 9  N2 ? ? C DC  11   I DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? B DT  12  N3  ? ? ? 1_555 C DA 8  N1 ? ? C DT  12   I DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? B DT  12  O4  ? ? ? 1_555 C DA 8  N6 ? ? C DT  12   I DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? B DC  13  N3  ? ? ? 1_555 C DG 7  N1 ? ? C DC  13   I DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? B DC  13  N4  ? ? ? 1_555 C DG 7  O6 ? ? C DC  13   I DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? B DC  13  O2  ? ? ? 1_555 C DG 7  N2 ? ? C DC  13   I DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? B DC  14  N3  ? ? ? 1_555 C DG 6  N1 ? ? C DC  14   I DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? B DC  14  N4  ? ? ? 1_555 C DG 6  O6 ? ? C DC  14   I DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? B DC  14  O2  ? ? ? 1_555 C DG 6  N2 ? ? C DC  14   I DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? B DG  15  N1  ? ? ? 1_555 C DC 5  N3 ? ? C DG  15   I DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? B DG  15  N2  ? ? ? 1_555 C DC 5  O2 ? ? C DG  15   I DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? B DG  15  O6  ? ? ? 1_555 C DC 5  N4 ? ? C DG  15   I DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? B DC  16  N3  ? ? ? 1_555 C DG 4  N1 ? ? C DC  16   I DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? B DC  16  N4  ? ? ? 1_555 C DG 4  O6 ? ? C DC  16   I DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? B DC  16  O2  ? ? ? 1_555 C DG 4  N2 ? ? C DC  16   I DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? B DA  17  N1  ? ? ? 1_555 C DT 3  N3 ? ? C DA  17   I DT 22 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog45  hydrog ? ? B DG  18  N1  ? ? ? 1_555 C DC 2  N3 ? ? C DG  18   I DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? B DG  18  N2  ? ? ? 1_555 C DC 2  O2 ? ? C DG  18   I DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? B DG  18  O6  ? ? ? 1_555 C DC 2  N4 ? ? C DG  18   I DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? B DG  19  N1  ? ? ? 1_555 C DC 1  N3 ? ? C DG  19   I DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? B DG  19  N2  ? ? ? 1_555 C DC 1  O2 ? ? C DG  19   I DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? B DG  19  O6  ? ? ? 1_555 C DC 1  N4 ? ? C DG  19   I DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? D DC  2   N3  ? ? ? 1_555 E DG 18 N1 ? ? D DC  2    J DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? D DC  2   N4  ? ? ? 1_555 E DG 18 O6 ? ? D DC  2    J DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? D DC  2   O2  ? ? ? 1_555 E DG 18 N2 ? ? D DC  2    J DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? D DC  3   N3  ? ? ? 1_555 E DG 17 N1 ? ? D DC  3    J DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? D DC  3   N4  ? ? ? 1_555 E DG 17 O6 ? ? D DC  3    J DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? D DC  3   O2  ? ? ? 1_555 E DG 17 N2 ? ? D DC  3    J DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? D DC  4   N3  ? ? ? 1_555 E DG 16 N1 ? ? D DC  4    J DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? D DC  4   N4  ? ? ? 1_555 E DG 16 O6 ? ? D DC  4    J DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? D DC  4   O2  ? ? ? 1_555 E DG 16 N2 ? ? D DC  4    J DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? D DG  5   N1  ? ? ? 1_555 E DC 15 N3 ? ? D DG  5    J DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? D DG  5   N2  ? ? ? 1_555 E DC 15 O2 ? ? D DG  5    J DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? D DG  5   O6  ? ? ? 1_555 E DC 15 N4 ? ? D DG  5    J DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? D DT  6   N3  ? ? ? 1_555 E DA 14 N1 ? ? D DT  6    J DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? D DT  6   O4  ? ? ? 1_555 E DA 14 N6 ? ? D DT  6    J DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? D DG  7   N1  ? ? ? 1_555 E DC 13 N3 ? ? D DG  7    J DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? D DG  7   N2  ? ? ? 1_555 E DC 13 O2 ? ? D DG  7    J DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? D DG  7   O6  ? ? ? 1_555 E DC 13 N4 ? ? D DG  7    J DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? D DA  8   N1  ? ? ? 1_555 E DT 12 N3 ? ? D DA  8    J DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? D DA  8   N6  ? ? ? 1_555 E DT 12 O4 ? ? D DA  8    J DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? D DG  9   N1  ? ? ? 1_555 E DC 11 N3 ? ? D DG  9    J DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? D DG  9   N2  ? ? ? 1_555 E DC 11 O2 ? ? D DG  9    J DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? D DG  9   O6  ? ? ? 1_555 E DC 11 N4 ? ? D DG  9    J DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? D DC  10  N3  ? ? ? 1_555 E DG 10 N1 ? ? D DC  10   J DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? D DC  10  N4  ? ? ? 1_555 E DG 10 O6 ? ? D DC  10   J DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? D DC  10  O2  ? ? ? 1_555 E DG 10 N2 ? ? D DC  10   J DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? D DC  11  N3  ? ? ? 1_555 E DG 9  N1 ? ? D DC  11   J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? D DC  11  N4  ? ? ? 1_555 E DG 9  O6 ? ? D DC  11   J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? D DC  11  O2  ? ? ? 1_555 E DG 9  N2 ? ? D DC  11   J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? D DT  12  N3  ? ? ? 1_555 E DA 8  N1 ? ? D DT  12   J DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? D DT  12  O4  ? ? ? 1_555 E DA 8  N6 ? ? D DT  12   J DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? D DC  13  N3  ? ? ? 1_555 E DG 7  N1 ? ? D DC  13   J DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? D DC  13  N4  ? ? ? 1_555 E DG 7  O6 ? ? D DC  13   J DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? D DC  13  O2  ? ? ? 1_555 E DG 7  N2 ? ? D DC  13   J DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? D DC  14  N3  ? ? ? 1_555 E DG 6  N1 ? ? D DC  14   J DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? D DC  14  N4  ? ? ? 1_555 E DG 6  O6 ? ? D DC  14   J DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? D DC  14  O2  ? ? ? 1_555 E DG 6  N2 ? ? D DC  14   J DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? D DG  15  N1  ? ? ? 1_555 E DC 5  N3 ? ? D DG  15   J DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? D DG  15  N2  ? ? ? 1_555 E DC 5  O2 ? ? D DG  15   J DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? D DG  15  O6  ? ? ? 1_555 E DC 5  N4 ? ? D DG  15   J DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? D DC  16  N3  ? ? ? 1_555 E DG 4  N1 ? ? D DC  16   J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? D DC  16  N4  ? ? ? 1_555 E DG 4  O6 ? ? D DC  16   J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? D DC  16  O2  ? ? ? 1_555 E DG 4  N2 ? ? D DC  16   J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? D DA  17  N1  ? ? ? 1_555 E DT 3  N3 ? ? D DA  17   J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? D DA  17  N6  ? ? ? 1_555 E DT 3  O4 ? ? D DA  17   J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? D DG  18  N1  ? ? ? 1_555 E DC 2  N3 ? ? D DG  18   J DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? D DG  18  N2  ? ? ? 1_555 E DC 2  O2 ? ? D DG  18   J DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? D DG  18  O6  ? ? ? 1_555 E DC 2  N4 ? ? D DG  18   J DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? D DG  19  N1  ? ? ? 1_555 E DC 1  N3 ? ? D DG  19   J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? D DG  19  N2  ? ? ? 1_555 E DC 1  O2 ? ? D DG  19   J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? D DG  19  O6  ? ? ? 1_555 E DC 1  N4 ? ? D DG  19   J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 4 ? 
G ? 9 ? 
H ? 7 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 3 ? 
M ? 7 ? 
N ? 7 ? 
O ? 7 ? 
P ? 3 ? 
Q ? 7 ? 
R ? 7 ? 
S ? 2 ? 
T ? 2 ? 
U ? 2 ? 
V ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? anti-parallel 
G 7 8 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? parallel      
M 6 7 ? parallel      
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? parallel      
N 6 7 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? parallel      
O 6 7 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
Q 5 6 ? parallel      
Q 6 7 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? parallel      
R 3 4 ? parallel      
R 4 5 ? parallel      
R 5 6 ? anti-parallel 
R 6 7 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 78  ? LYS A 79  ? LYS A 726  LYS A 727  
A 2 CYS A 117 ? PRO A 122 ? CYS A 765  PRO A 770  
A 3 TYR A 130 ? ASP A 140 ? TYR A 778  ASP A 788  
A 4 MET A 145 ? TRP A 151 ? MET A 793  TRP A 799  
A 5 CYS A 175 ? GLN A 179 ? CYS A 823  GLN A 827  
B 1 LYS A 94  ? ILE A 95  ? LYS A 742  ILE A 743  
B 2 ARG A 99  ? TYR A 102 ? ARG A 747  TYR A 750  
B 3 TYR A 130 ? ASP A 140 ? TYR A 778  ASP A 788  
B 4 CYS A 117 ? PRO A 122 ? CYS A 765  PRO A 770  
B 5 ILE A 183 ? LYS A 186 ? ILE A 831  LYS A 834  
C 1 ILE A 86  ? LEU A 89  ? ILE A 734  LEU A 737  
C 2 LYS A 104 ? ILE A 107 ? LYS A 752  ILE A 755  
C 3 GLU A 110 ? GLU A 113 ? GLU A 758  GLU A 761  
D 1 GLU A 168 ? LEU A 171 ? GLU A 816  LEU A 819  
D 2 TYR A 219 ? ASN A 226 ? TYR A 867  ASN A 874  
D 3 VAL A 189 ? TYR A 191 ? VAL A 837  TYR A 839  
E 1 GLU A 168 ? LEU A 171 ? GLU A 816  LEU A 819  
E 2 TYR A 219 ? ASN A 226 ? TYR A 867  ASN A 874  
E 3 ARG A 231 ? GLU A 233 ? ARG A 879  GLU A 881  
F 1 LYS A 265 ? VAL A 273 ? LYS A 913  VAL A 921  
F 2 ARG A 276 ? LYS A 284 ? ARG A 924  LYS A 932  
F 3 ARG A 348 ? LYS A 360 ? ARG A 996  LYS A 1008 
F 4 VAL A 287 ? ARG A 290 ? VAL A 935  ARG A 938  
G 1 LYS A 265 ? VAL A 273 ? LYS A 913  VAL A 921  
G 2 ARG A 276 ? LYS A 284 ? ARG A 924  LYS A 932  
G 3 LYS A 363 ? TYR A 377 ? LYS A 1011 TYR A 1025 
G 4 MET A 396 ? ASN A 407 ? MET A 1044 ASN A 1055 
G 5 ARG A 437 ? ALA A 443 ? ARG A 1085 ALA A 1091 
G 6 GLY A 413 ? TYR A 419 ? GLY A 1061 TYR A 1067 
G 7 SER A 294 ? LEU A 297 ? SER A 942  LEU A 945  
G 8 ARG A 348 ? LYS A 360 ? ARG A 996  LYS A 1008 
G 9 VAL A 287 ? ARG A 290 ? VAL A 935  ARG A 938  
H 1 THR A 540 ? PHE A 542 ? THR A 1188 PHE A 1190 
H 2 SER A 516 ? ILE A 522 ? SER A 1164 ILE A 1170 
H 3 LEU A 494 ? VAL A 499 ? LEU A 1142 VAL A 1147 
H 4 MET A 574 ? GLY A 577 ? MET A 1222 GLY A 1225 
H 5 PHE A 617 ? VAL A 623 ? PHE A 1265 VAL A 1271 
H 6 ARG A 666 ? ALA A 673 ? ARG A 1314 ALA A 1321 
H 7 GLN A 648 ? GLN A 655 ? GLN A 1296 GLN A 1303 
I 1 VAL A 698 ? VAL A 700 ? VAL A 1346 VAL A 1348 
I 2 LYS A 703 ? PHE A 705 ? LYS A 1351 PHE A 1353 
J 1 GLU A 740 ? PRO A 742 ? GLU A 1388 PRO A 1390 
J 2 ILE A 763 ? ARG A 765 ? ILE A 1411 ARG A 1413 
K 1 VAL A 799 ? ARG A 800 ? VAL A 1447 ARG A 1448 
K 2 ILE A 806 ? ALA A 807 ? ILE A 1454 ALA A 1455 
L 1 ILE F 86  ? LEU F 89  ? ILE B 734  LEU B 737  
L 2 LYS F 104 ? ILE F 107 ? LYS B 752  ILE B 755  
L 3 GLU F 110 ? GLU F 113 ? GLU B 758  GLU B 761  
M 1 LYS F 94  ? ILE F 95  ? LYS B 742  ILE B 743  
M 2 ARG F 99  ? TYR F 102 ? ARG B 747  TYR B 750  
M 3 TYR F 130 ? ASP F 140 ? TYR B 778  ASP B 788  
M 4 MET F 145 ? ALA F 154 ? MET B 793  ALA B 802  
M 5 GLU F 168 ? GLN F 179 ? GLU B 816  GLN B 827  
M 6 TYR F 219 ? ASN F 226 ? TYR B 867  ASN B 874  
M 7 VAL F 189 ? TYR F 191 ? VAL B 837  TYR B 839  
N 1 ILE F 183 ? VAL F 187 ? ILE B 831  VAL B 835  
N 2 CYS F 117 ? VAL F 120 ? CYS B 765  VAL B 768  
N 3 TYR F 130 ? ASP F 140 ? TYR B 778  ASP B 788  
N 4 MET F 145 ? ALA F 154 ? MET B 793  ALA B 802  
N 5 GLU F 168 ? GLN F 179 ? GLU B 816  GLN B 827  
N 6 TYR F 219 ? ASN F 226 ? TYR B 867  ASN B 874  
N 7 ARG F 231 ? GLU F 233 ? ARG B 879  GLU B 881  
O 1 LYS F 265 ? VAL F 273 ? LYS B 913  VAL B 921  
O 2 ARG F 276 ? LYS F 284 ? ARG B 924  LYS B 932  
O 3 ARG F 348 ? LYS F 360 ? ARG B 996  LYS B 1008 
O 4 LYS F 363 ? TYR F 377 ? LYS B 1011 TYR B 1025 
O 5 MET F 396 ? ASN F 407 ? MET B 1044 ASN B 1055 
O 6 ARG F 437 ? ASN F 445 ? ARG B 1085 ASN B 1093 
O 7 ASN F 450 ? GLU F 452 ? ASN B 1098 GLU B 1100 
P 1 LYS F 265 ? VAL F 273 ? LYS B 913  VAL B 921  
P 2 ARG F 276 ? LYS F 284 ? ARG B 924  LYS B 932  
P 3 VAL F 287 ? ARG F 290 ? VAL B 935  ARG B 938  
Q 1 LYS F 265 ? VAL F 273 ? LYS B 913  VAL B 921  
Q 2 ARG F 276 ? LYS F 284 ? ARG B 924  LYS B 932  
Q 3 ARG F 348 ? LYS F 360 ? ARG B 996  LYS B 1008 
Q 4 SER F 294 ? LEU F 297 ? SER B 942  LEU B 945  
Q 5 GLY F 413 ? TYR F 419 ? GLY B 1061 TYR B 1067 
Q 6 ARG F 437 ? ASN F 445 ? ARG B 1085 ASN B 1093 
Q 7 ASN F 450 ? GLU F 452 ? ASN B 1098 GLU B 1100 
R 1 THR F 540 ? PHE F 542 ? THR B 1188 PHE B 1190 
R 2 SER F 516 ? ILE F 522 ? SER B 1164 ILE B 1170 
R 3 LEU F 494 ? VAL F 499 ? LEU B 1142 VAL B 1147 
R 4 MET F 574 ? GLY F 577 ? MET B 1222 GLY B 1225 
R 5 PHE F 617 ? ASN F 622 ? PHE B 1265 ASN B 1270 
R 6 ARG F 666 ? ALA F 673 ? ARG B 1314 ALA B 1321 
R 7 GLN F 648 ? GLN F 655 ? GLN B 1296 GLN B 1303 
S 1 VAL F 698 ? VAL F 699 ? VAL B 1346 VAL B 1347 
S 2 LYS F 704 ? PHE F 705 ? LYS B 1352 PHE B 1353 
T 1 GLU F 740 ? PRO F 742 ? GLU B 1388 PRO B 1390 
T 2 ILE F 763 ? ARG F 765 ? ILE B 1411 ARG B 1413 
U 1 VAL F 799 ? ARG F 800 ? VAL B 1447 ARG B 1448 
U 2 ILE F 806 ? ALA F 807 ? ILE B 1454 ALA B 1455 
V 1 GLY F 869 ? ARG F 870 ? GLY B 1517 ARG B 1518 
V 2 ARG F 892 ? LEU F 894 ? ARG B 1540 LEU B 1542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 79  ? N LYS A 727  O ILE A 121 ? O ILE A 769  
A 2 3 N VAL A 118 ? N VAL A 766  O ALA A 132 ? O ALA A 780  
A 3 4 N TRP A 138 ? N TRP A 786  O MET A 146 ? O MET A 794  
A 4 5 N ALA A 149 ? N ALA A 797  O GLU A 176 ? O GLU A 824  
B 1 2 N LYS A 94  ? N LYS A 742  O TYR A 101 ? O TYR A 749  
B 2 3 N THR A 100 ? N THR A 748  O GLU A 139 ? O GLU A 787  
B 3 4 O ALA A 132 ? O ALA A 780  N VAL A 118 ? N VAL A 766  
B 4 5 N SER A 119 ? N SER A 767  O SER A 185 ? O SER A 833  
C 1 2 N SER A 87  ? N SER A 735  O SER A 106 ? O SER A 754  
C 2 3 N ILE A 107 ? N ILE A 755  O GLU A 110 ? O GLU A 758  
D 1 2 N LEU A 171 ? N LEU A 819  O TYR A 225 ? O TYR A 873  
D 2 3 O TYR A 219 ? O TYR A 867  N ILE A 190 ? N ILE A 838  
E 1 2 N LEU A 171 ? N LEU A 819  O TYR A 225 ? O TYR A 873  
E 2 3 N TRP A 224 ? N TRP A 872  O GLU A 233 ? O GLU A 881  
F 1 2 N GLU A 271 ? N GLU A 919  O TYR A 278 ? O TYR A 926  
F 2 3 N CYS A 279 ? N CYS A 927  O ILE A 355 ? O ILE A 1003 
G 1 2 N GLU A 271 ? N GLU A 919  O TYR A 278 ? O TYR A 926  
G 3 4 N LYS A 375 ? N LYS A 1023 O GLU A 402 ? O GLU A 1050 
G 4 5 N LEU A 397 ? N LEU A 1045 O TYR A 439 ? O TYR A 1087 
G 5 6 O PHE A 438 ? O PHE A 1086 N THR A 416 ? N THR A 1064 
G 6 7 O GLY A 413 ? O GLY A 1061 N TYR A 296 ? N TYR A 944  
G 7 8 N LEU A 297 ? N LEU A 945  O ARG A 348 ? O ARG A 996  
H 1 2 O PHE A 542 ? O PHE A 1190 N ALA A 521 ? N ALA A 1169 
H 2 3 O ILE A 522 ? O ILE A 1170 N ASP A 498 ? N ASP A 1146 
H 3 4 N LEU A 497 ? N LEU A 1145 O MET A 574 ? O MET A 1222 
H 4 5 N LEU A 575 ? N LEU A 1223 O LEU A 619 ? O LEU A 1267 
H 5 6 N LEU A 620 ? N LEU A 1268 O ILE A 670 ? O ILE A 1318 
H 6 7 O LEU A 671 ? O LEU A 1319 N THR A 650 ? N THR A 1298 
I 1 2 N VAL A 698 ? N VAL A 1346 O PHE A 705 ? O PHE A 1353 
J 1 2 N ILE A 741 ? N ILE A 1389 O LEU A 764 ? O LEU A 1412 
K 1 2 N VAL A 799 ? N VAL A 1447 O ALA A 807 ? O ALA A 1455 
L 1 2 N SER F 87  ? N SER B 735  O SER F 106 ? O SER B 754  
L 2 3 N VAL F 105 ? N VAL B 753  O LEU F 112 ? O LEU B 760  
M 1 2 N LYS F 94  ? N LYS B 742  O TYR F 101 ? O TYR B 749  
M 2 3 N TYR F 102 ? N TYR B 750  O LEU F 137 ? O LEU B 785  
M 3 4 N LEU F 131 ? N LEU B 779  O PHE F 152 ? O PHE B 800  
M 4 5 N ALA F 149 ? N ALA B 797  O GLU F 176 ? O GLU B 824  
M 5 6 N LEU F 169 ? N LEU B 817  O PHE F 220 ? O PHE B 868  
M 6 7 O TYR F 219 ? O TYR B 867  N ILE F 190 ? N ILE B 838  
N 1 2 O VAL F 187 ? O VAL B 835  N CYS F 117 ? N CYS B 765  
N 2 3 N VAL F 118 ? N VAL B 766  O ALA F 132 ? O ALA B 780  
N 3 4 N LEU F 131 ? N LEU B 779  O PHE F 152 ? O PHE B 800  
N 4 5 N ALA F 149 ? N ALA B 797  O GLU F 176 ? O GLU B 824  
N 5 6 N LEU F 169 ? N LEU B 817  O PHE F 220 ? O PHE B 868  
N 6 7 N TRP F 224 ? N TRP B 872  O GLU F 233 ? O GLU B 881  
O 1 2 N ILE F 270 ? N ILE B 918  O TYR F 278 ? O TYR B 926  
O 2 3 N VAL F 277 ? N VAL B 925  O CYS F 357 ? O CYS B 1005 
O 3 4 N LYS F 353 ? N LYS B 1001 O ARG F 372 ? O ARG B 1020 
O 4 5 N TYR F 377 ? N TYR B 1025 O TYR F 398 ? O TYR B 1046 
O 5 6 N TRP F 399 ? N TRP B 1047 O TYR F 444 ? O TYR B 1092 
O 6 7 N ALA F 443 ? N ALA B 1091 O GLU F 452 ? O GLU B 1100 
P 1 2 N ILE F 270 ? N ILE B 918  O TYR F 278 ? O TYR B 926  
P 2 3 N ILE F 282 ? N ILE B 930  O TYR F 289 ? O TYR B 937  
Q 1 2 N ILE F 270 ? N ILE B 918  O TYR F 278 ? O TYR B 926  
Q 2 3 N VAL F 277 ? N VAL B 925  O CYS F 357 ? O CYS B 1005 
Q 3 4 O ARG F 348 ? O ARG B 996  N LEU F 297 ? N LEU B 945  
Q 4 5 N TYR F 296 ? N TYR B 944  O GLY F 413 ? O GLY B 1061 
Q 5 6 N THR F 416 ? N THR B 1064 O PHE F 438 ? O PHE B 1086 
Q 6 7 N ALA F 443 ? N ALA B 1091 O GLU F 452 ? O GLU B 1100 
R 1 2 O PHE F 542 ? O PHE B 1190 N ALA F 521 ? N ALA B 1169 
R 2 3 O GLU F 517 ? O GLU B 1165 N LEU F 494 ? N LEU B 1142 
R 3 4 N LEU F 497 ? N LEU B 1145 O MET F 574 ? O MET B 1222 
R 4 5 N GLY F 577 ? N GLY B 1225 O GLU F 621 ? O GLU B 1269 
R 5 6 N ASN F 622 ? N ASN B 1270 O ALA F 668 ? O ALA B 1316 
R 6 7 O ARG F 667 ? O ARG B 1315 N LEU F 654 ? N LEU B 1302 
S 1 2 N VAL F 698 ? N VAL B 1346 O PHE F 705 ? O PHE B 1353 
T 1 2 N ILE F 741 ? N ILE B 1389 O LEU F 764 ? O LEU B 1412 
U 1 2 N VAL F 799 ? N VAL B 1447 O ALA F 807 ? O ALA B 1455 
V 1 2 N GLY F 869 ? N GLY B 1517 O LEU F 894 ? O LEU B 1542 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1'     
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2'     
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 3'     
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 4'     
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1'     
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 2'     
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 3'     
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 4'     
AC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE SAH A 1603' 
BC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE SAH B 1603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 831 ? CYS A 1479 . ? 1_555 ? 
2  AC1 4  CYS A 833 ? CYS A 1481 . ? 1_555 ? 
3  AC1 4  CYS A 839 ? CYS A 1487 . ? 1_555 ? 
4  AC1 4  HIS A 856 ? HIS A 1504 . ? 1_555 ? 
5  AC2 4  CYS A 8   ? CYS A 656  . ? 1_555 ? 
6  AC2 4  CYS A 11  ? CYS A 659  . ? 1_555 ? 
7  AC2 4  CYS A 14  ? CYS A 662  . ? 1_555 ? 
8  AC2 4  CYS A 46  ? CYS A 694  . ? 1_555 ? 
9  AC3 4  HIS A 148 ? HIS A 796  . ? 1_555 ? 
10 AC3 4  CYS A 175 ? CYS A 823  . ? 1_555 ? 
11 AC3 4  CYS A 249 ? CYS A 897  . ? 1_555 ? 
12 AC3 4  CYS A 252 ? CYS A 900  . ? 1_555 ? 
13 AC4 4  CYS A 19  ? CYS A 667  . ? 1_555 ? 
14 AC4 4  CYS A 22  ? CYS A 670  . ? 1_555 ? 
15 AC4 4  CYS A 25  ? CYS A 673  . ? 1_555 ? 
16 AC4 4  CYS A 41  ? CYS A 689  . ? 1_555 ? 
17 AC5 4  HIS F 148 ? HIS B 796  . ? 1_555 ? 
18 AC5 4  CYS F 175 ? CYS B 823  . ? 1_555 ? 
19 AC5 4  CYS F 249 ? CYS B 897  . ? 1_555 ? 
20 AC5 4  CYS F 252 ? CYS B 900  . ? 1_555 ? 
21 AC6 4  CYS F 8   ? CYS B 656  . ? 1_555 ? 
22 AC6 4  CYS F 11  ? CYS B 659  . ? 1_555 ? 
23 AC6 4  CYS F 14  ? CYS B 662  . ? 1_555 ? 
24 AC6 4  CYS F 46  ? CYS B 694  . ? 1_555 ? 
25 AC7 4  CYS F 831 ? CYS B 1479 . ? 1_555 ? 
26 AC7 4  CYS F 833 ? CYS B 1481 . ? 1_555 ? 
27 AC7 4  CYS F 839 ? CYS B 1487 . ? 1_555 ? 
28 AC7 4  HIS F 856 ? HIS B 1504 . ? 1_555 ? 
29 AC8 4  CYS F 19  ? CYS B 667  . ? 1_555 ? 
30 AC8 4  CYS F 22  ? CYS B 670  . ? 1_555 ? 
31 AC8 4  CYS F 25  ? CYS B 673  . ? 1_555 ? 
32 AC8 4  CYS F 41  ? CYS B 689  . ? 1_555 ? 
33 AC9 16 HOH Q .   ? HOH A 5    . ? 1_555 ? 
34 AC9 16 HOH Q .   ? HOH A 13   . ? 1_555 ? 
35 AC9 16 PHE A 500 ? PHE A 1148 . ? 1_555 ? 
36 AC9 16 SER A 501 ? SER A 1149 . ? 1_555 ? 
37 AC9 16 GLY A 504 ? GLY A 1152 . ? 1_555 ? 
38 AC9 16 GLY A 505 ? GLY A 1153 . ? 1_555 ? 
39 AC9 16 LEU A 506 ? LEU A 1154 . ? 1_555 ? 
40 AC9 16 GLU A 523 ? GLU A 1171 . ? 1_555 ? 
41 AC9 16 MET A 524 ? MET A 1172 . ? 1_555 ? 
42 AC9 16 TRP A 525 ? TRP A 1173 . ? 1_555 ? 
43 AC9 16 GLU A 544 ? GLU A 1192 . ? 1_555 ? 
44 AC9 16 ASP A 545 ? ASP A 1193 . ? 1_555 ? 
45 AC9 16 GLY A 578 ? GLY A 1226 . ? 1_555 ? 
46 AC9 16 ASN A 932 ? ASN A 1580 . ? 1_555 ? 
47 AC9 16 ALA A 933 ? ALA A 1581 . ? 1_555 ? 
48 AC9 16 VAL A 934 ? VAL A 1582 . ? 1_555 ? 
49 BC1 15 HOH R .   ? HOH B 5    . ? 1_555 ? 
50 BC1 15 PHE F 500 ? PHE B 1148 . ? 1_555 ? 
51 BC1 15 SER F 501 ? SER B 1149 . ? 1_555 ? 
52 BC1 15 GLY F 502 ? GLY B 1150 . ? 1_555 ? 
53 BC1 15 GLY F 504 ? GLY B 1152 . ? 1_555 ? 
54 BC1 15 GLY F 505 ? GLY B 1153 . ? 1_555 ? 
55 BC1 15 LEU F 506 ? LEU B 1154 . ? 1_555 ? 
56 BC1 15 GLU F 523 ? GLU B 1171 . ? 1_555 ? 
57 BC1 15 MET F 524 ? MET B 1172 . ? 1_555 ? 
58 BC1 15 TRP F 525 ? TRP B 1173 . ? 1_555 ? 
59 BC1 15 ASP F 545 ? ASP B 1193 . ? 1_555 ? 
60 BC1 15 CYS F 546 ? CYS B 1194 . ? 1_555 ? 
61 BC1 15 GLY F 578 ? GLY B 1226 . ? 1_555 ? 
62 BC1 15 ALA F 933 ? ALA B 1581 . ? 1_555 ? 
63 BC1 15 VAL F 934 ? VAL B 1582 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3PT6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PT6 
_atom_sites.fract_transf_matrix[1][1]   0.012020 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002042 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004684 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011757 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1 3   ? -26.570 6.172   -35.199 1.00 83.40  ? 651  MET A N     1 
ATOM   2     C  CA    . MET A 1 3   ? -25.968 7.490   -35.010 1.00 85.44  ? 651  MET A CA    1 
ATOM   3     C  C     . MET A 1 3   ? -24.438 7.438   -35.024 1.00 86.91  ? 651  MET A C     1 
ATOM   4     O  O     . MET A 1 3   ? -23.820 6.690   -34.261 1.00 83.42  ? 651  MET A O     1 
ATOM   5     C  CB    . MET A 1 3   ? -26.487 8.144   -33.724 1.00 89.34  ? 651  MET A CB    1 
ATOM   6     C  CG    . MET A 1 3   ? -26.535 7.213   -32.509 1.00 86.86  ? 651  MET A CG    1 
ATOM   7     S  SD    . MET A 1 3   ? -27.583 7.849   -31.174 1.00 77.44  ? 651  MET A SD    1 
ATOM   8     C  CE    . MET A 1 3   ? -26.740 9.386   -30.766 1.00 77.73  ? 651  MET A CE    1 
ATOM   9     N  N     . LYS A 1 4   ? -23.838 8.246   -35.896 1.00 90.23  ? 652  LYS A N     1 
ATOM   10    C  CA    . LYS A 1 4   ? -22.391 8.227   -36.112 1.00 85.50  ? 652  LYS A CA    1 
ATOM   11    C  C     . LYS A 1 4   ? -21.595 8.980   -35.039 1.00 84.64  ? 652  LYS A C     1 
ATOM   12    O  O     . LYS A 1 4   ? -21.906 10.124  -34.680 1.00 79.47  ? 652  LYS A O     1 
ATOM   13    C  CB    . LYS A 1 4   ? -22.042 8.758   -37.508 1.00 82.78  ? 652  LYS A CB    1 
ATOM   14    N  N     . ARG A 1 5   ? -20.560 8.310   -34.544 1.00 82.27  ? 653  ARG A N     1 
ATOM   15    C  CA    . ARG A 1 5   ? -19.689 8.844   -33.512 1.00 79.04  ? 653  ARG A CA    1 
ATOM   16    C  C     . ARG A 1 5   ? -18.589 9.657   -34.161 1.00 72.15  ? 653  ARG A C     1 
ATOM   17    O  O     . ARG A 1 5   ? -18.576 9.822   -35.375 1.00 73.03  ? 653  ARG A O     1 
ATOM   18    C  CB    . ARG A 1 5   ? -19.078 7.691   -32.718 1.00 78.25  ? 653  ARG A CB    1 
ATOM   19    C  CG    . ARG A 1 5   ? -20.019 6.509   -32.555 1.00 77.61  ? 653  ARG A CG    1 
ATOM   20    C  CD    . ARG A 1 5   ? -19.541 5.598   -31.445 1.00 80.13  ? 653  ARG A CD    1 
ATOM   21    N  NE    . ARG A 1 5   ? -18.123 5.265   -31.573 1.00 77.99  ? 653  ARG A NE    1 
ATOM   22    C  CZ    . ARG A 1 5   ? -17.670 4.103   -32.030 1.00 71.60  ? 653  ARG A CZ    1 
ATOM   23    N  NH1   . ARG A 1 5   ? -18.528 3.164   -32.403 1.00 69.40  ? 653  ARG A NH1   1 
ATOM   24    N  NH2   . ARG A 1 5   ? -16.363 3.879   -32.108 1.00 67.99  ? 653  ARG A NH2   1 
ATOM   25    N  N     . ARG A 1 6   ? -17.664 10.160  -33.352 1.00 73.84  ? 654  ARG A N     1 
ATOM   26    C  CA    . ARG A 1 6   ? -16.511 10.887  -33.874 1.00 76.89  ? 654  ARG A CA    1 
ATOM   27    C  C     . ARG A 1 6   ? -15.395 11.056  -32.852 1.00 74.70  ? 654  ARG A C     1 
ATOM   28    O  O     . ARG A 1 6   ? -15.418 10.451  -31.788 1.00 77.58  ? 654  ARG A O     1 
ATOM   29    C  CB    . ARG A 1 6   ? -16.931 12.257  -34.412 1.00 81.64  ? 654  ARG A CB    1 
ATOM   30    N  N     . ARG A 1 7   ? -14.426 11.899  -33.181 1.00 73.46  ? 655  ARG A N     1 
ATOM   31    C  CA    . ARG A 1 7   ? -13.216 12.011  -32.392 1.00 75.26  ? 655  ARG A CA    1 
ATOM   32    C  C     . ARG A 1 7   ? -13.273 13.195  -31.435 1.00 82.21  ? 655  ARG A C     1 
ATOM   33    O  O     . ARG A 1 7   ? -13.867 14.226  -31.751 1.00 83.08  ? 655  ARG A O     1 
ATOM   34    C  CB    . ARG A 1 7   ? -12.030 12.160  -33.331 1.00 76.33  ? 655  ARG A CB    1 
ATOM   35    C  CG    . ARG A 1 7   ? -10.846 12.826  -32.705 1.00 79.65  ? 655  ARG A CG    1 
ATOM   36    C  CD    . ARG A 1 7   ? -10.049 13.567  -33.746 1.00 79.43  ? 655  ARG A CD    1 
ATOM   37    N  NE    . ARG A 1 7   ? -8.974  12.752  -34.293 1.00 77.40  ? 655  ARG A NE    1 
ATOM   38    C  CZ    . ARG A 1 7   ? -8.267  13.087  -35.365 1.00 80.12  ? 655  ARG A CZ    1 
ATOM   39    N  NH1   . ARG A 1 7   ? -8.539  14.214  -36.009 1.00 82.79  ? 655  ARG A NH1   1 
ATOM   40    N  NH2   . ARG A 1 7   ? -7.297  12.293  -35.797 1.00 81.97  ? 655  ARG A NH2   1 
ATOM   41    N  N     . CYS A 1 8   ? -12.664 13.039  -30.261 1.00 85.06  ? 656  CYS A N     1 
ATOM   42    C  CA    . CYS A 1 8   ? -12.528 14.145  -29.313 1.00 85.32  ? 656  CYS A CA    1 
ATOM   43    C  C     . CYS A 1 8   ? -11.369 15.036  -29.738 1.00 84.50  ? 656  CYS A C     1 
ATOM   44    O  O     . CYS A 1 8   ? -10.486 14.606  -30.478 1.00 84.01  ? 656  CYS A O     1 
ATOM   45    C  CB    . CYS A 1 8   ? -12.277 13.625  -27.893 1.00 84.18  ? 656  CYS A CB    1 
ATOM   46    S  SG    . CYS A 1 8   ? -10.576 13.051  -27.560 1.00 86.61  ? 656  CYS A SG    1 
ATOM   47    N  N     . GLY A 1 9   ? -11.361 16.274  -29.265 1.00 83.50  ? 657  GLY A N     1 
ATOM   48    C  CA    . GLY A 1 9   ? -10.289 17.187  -29.618 1.00 86.06  ? 657  GLY A CA    1 
ATOM   49    C  C     . GLY A 1 9   ? -9.141  17.195  -28.629 1.00 85.92  ? 657  GLY A C     1 
ATOM   50    O  O     . GLY A 1 9   ? -8.057  17.693  -28.925 1.00 86.82  ? 657  GLY A O     1 
ATOM   51    N  N     . VAL A 1 10  ? -9.375  16.614  -27.458 1.00 85.52  ? 658  VAL A N     1 
ATOM   52    C  CA    . VAL A 1 10  ? -8.483  16.796  -26.314 1.00 77.87  ? 658  VAL A CA    1 
ATOM   53    C  C     . VAL A 1 10  ? -7.317  15.800  -26.186 1.00 77.67  ? 658  VAL A C     1 
ATOM   54    O  O     . VAL A 1 10  ? -6.169  16.211  -25.989 1.00 74.32  ? 658  VAL A O     1 
ATOM   55    C  CB    . VAL A 1 10  ? -9.289  16.795  -25.000 1.00 68.09  ? 658  VAL A CB    1 
ATOM   56    N  N     . CYS A 1 11  ? -7.608  14.506  -26.302 1.00 79.95  ? 659  CYS A N     1 
ATOM   57    C  CA    . CYS A 1 11  ? -6.648  13.464  -25.915 1.00 80.29  ? 659  CYS A CA    1 
ATOM   58    C  C     . CYS A 1 11  ? -5.279  13.547  -26.612 1.00 84.12  ? 659  CYS A C     1 
ATOM   59    O  O     . CYS A 1 11  ? -5.130  14.191  -27.651 1.00 84.53  ? 659  CYS A O     1 
ATOM   60    C  CB    . CYS A 1 11  ? -7.257  12.063  -26.063 1.00 78.17  ? 659  CYS A CB    1 
ATOM   61    S  SG    . CYS A 1 11  ? -7.102  11.319  -27.701 1.00 88.59  ? 659  CYS A SG    1 
ATOM   62    N  N     . GLU A 1 12  ? -4.286  12.890  -26.014 1.00 84.18  ? 660  GLU A N     1 
ATOM   63    C  CA    . GLU A 1 12  ? -2.910  12.919  -26.505 1.00 84.61  ? 660  GLU A CA    1 
ATOM   64    C  C     . GLU A 1 12  ? -2.820  12.347  -27.914 1.00 85.71  ? 660  GLU A C     1 
ATOM   65    O  O     . GLU A 1 12  ? -1.931  12.709  -28.687 1.00 85.81  ? 660  GLU A O     1 
ATOM   66    C  CB    . GLU A 1 12  ? -1.990  12.139  -25.563 1.00 78.36  ? 660  GLU A CB    1 
ATOM   67    N  N     . VAL A 1 13  ? -3.749  11.453  -28.237 1.00 83.01  ? 661  VAL A N     1 
ATOM   68    C  CA    . VAL A 1 13  ? -3.788  10.821  -29.548 1.00 84.00  ? 661  VAL A CA    1 
ATOM   69    C  C     . VAL A 1 13  ? -4.138  11.832  -30.631 1.00 87.06  ? 661  VAL A C     1 
ATOM   70    O  O     . VAL A 1 13  ? -3.404  11.988  -31.612 1.00 89.87  ? 661  VAL A O     1 
ATOM   71    C  CB    . VAL A 1 13  ? -4.794  9.660   -29.580 1.00 83.54  ? 661  VAL A CB    1 
ATOM   72    C  CG1   . VAL A 1 13  ? -4.930  9.114   -30.987 1.00 83.31  ? 661  VAL A CG1   1 
ATOM   73    C  CG2   . VAL A 1 13  ? -4.358  8.565   -28.624 1.00 83.71  ? 661  VAL A CG2   1 
ATOM   74    N  N     . CYS A 1 14  ? -5.256  12.523  -30.444 1.00 83.70  ? 662  CYS A N     1 
ATOM   75    C  CA    . CYS A 1 14  ? -5.701  13.533  -31.398 1.00 85.45  ? 662  CYS A CA    1 
ATOM   76    C  C     . CYS A 1 14  ? -4.663  14.619  -31.633 1.00 88.96  ? 662  CYS A C     1 
ATOM   77    O  O     . CYS A 1 14  ? -4.322  14.919  -32.775 1.00 91.13  ? 662  CYS A O     1 
ATOM   78    C  CB    . CYS A 1 14  ? -7.002  14.169  -30.925 1.00 86.84  ? 662  CYS A CB    1 
ATOM   79    S  SG    . CYS A 1 14  ? -8.304  12.966  -30.671 1.00 91.72  ? 662  CYS A SG    1 
ATOM   80    N  N     . GLN A 1 15  ? -4.163  15.209  -30.552 1.00 90.31  ? 663  GLN A N     1 
ATOM   81    C  CA    . GLN A 1 15  ? -3.231  16.331  -30.656 1.00 92.41  ? 663  GLN A CA    1 
ATOM   82    C  C     . GLN A 1 15  ? -2.007  16.041  -31.535 1.00 90.95  ? 663  GLN A C     1 
ATOM   83    O  O     . GLN A 1 15  ? -1.534  16.924  -32.248 1.00 89.47  ? 663  GLN A O     1 
ATOM   84    C  CB    . GLN A 1 15  ? -2.808  16.812  -29.267 1.00 88.47  ? 663  GLN A CB    1 
ATOM   85    C  CG    . GLN A 1 15  ? -3.978  17.250  -28.406 1.00 86.61  ? 663  GLN A CG    1 
ATOM   86    C  CD    . GLN A 1 15  ? -3.543  17.797  -27.060 1.00 85.48  ? 663  GLN A CD    1 
ATOM   87    O  OE1   . GLN A 1 15  ? -2.913  17.098  -26.264 1.00 84.15  ? 663  GLN A OE1   1 
ATOM   88    N  NE2   . GLN A 1 15  ? -3.879  19.058  -26.799 1.00 82.11  ? 663  GLN A NE2   1 
ATOM   89    N  N     . GLN A 1 16  ? -1.503  14.812  -31.487 1.00 89.30  ? 664  GLN A N     1 
ATOM   90    C  CA    . GLN A 1 16  ? -0.394  14.419  -32.350 1.00 90.31  ? 664  GLN A CA    1 
ATOM   91    C  C     . GLN A 1 16  ? -0.722  14.763  -33.798 1.00 90.70  ? 664  GLN A C     1 
ATOM   92    O  O     . GLN A 1 16  ? -1.782  14.389  -34.295 1.00 91.55  ? 664  GLN A O     1 
ATOM   93    C  CB    . GLN A 1 16  ? -0.113  12.923  -32.215 1.00 90.47  ? 664  GLN A CB    1 
ATOM   94    C  CG    . GLN A 1 16  ? 0.277   12.494  -30.812 1.00 89.67  ? 664  GLN A CG    1 
ATOM   95    C  CD    . GLN A 1 16  ? 0.438   10.992  -30.688 1.00 93.73  ? 664  GLN A CD    1 
ATOM   96    O  OE1   . GLN A 1 16  ? 0.024   10.235  -31.568 1.00 95.54  ? 664  GLN A OE1   1 
ATOM   97    N  NE2   . GLN A 1 16  ? 1.044   10.551  -29.590 1.00 93.03  ? 664  GLN A NE2   1 
ATOM   98    N  N     . PRO A 1 17  ? 0.179   15.501  -34.471 1.00 92.00  ? 665  PRO A N     1 
ATOM   99    C  CA    . PRO A 1 17  ? 0.014   15.942  -35.865 1.00 91.47  ? 665  PRO A CA    1 
ATOM   100   C  C     . PRO A 1 17  ? 0.380   14.864  -36.878 1.00 90.81  ? 665  PRO A C     1 
ATOM   101   O  O     . PRO A 1 17  ? 0.917   13.822  -36.499 1.00 91.19  ? 665  PRO A O     1 
ATOM   102   C  CB    . PRO A 1 17  ? 0.999   17.115  -35.989 1.00 90.07  ? 665  PRO A CB    1 
ATOM   103   C  CG    . PRO A 1 17  ? 1.426   17.441  -34.582 1.00 87.58  ? 665  PRO A CG    1 
ATOM   104   C  CD    . PRO A 1 17  ? 1.332   16.151  -33.831 1.00 89.51  ? 665  PRO A CD    1 
ATOM   105   N  N     . GLU A 1 18  ? 0.109   15.132  -38.153 1.00 93.41  ? 666  GLU A N     1 
ATOM   106   C  CA    . GLU A 1 18  ? 0.285   14.141  -39.218 1.00 97.14  ? 666  GLU A CA    1 
ATOM   107   C  C     . GLU A 1 18  ? 1.748   13.901  -39.601 1.00 95.59  ? 666  GLU A C     1 
ATOM   108   O  O     . GLU A 1 18  ? 2.567   14.817  -39.568 1.00 94.48  ? 666  GLU A O     1 
ATOM   109   C  CB    . GLU A 1 18  ? -0.560  14.509  -40.447 1.00 95.58  ? 666  GLU A CB    1 
ATOM   110   C  CG    . GLU A 1 18  ? -2.061  14.274  -40.243 1.00 96.95  ? 666  GLU A CG    1 
ATOM   111   C  CD    . GLU A 1 18  ? -2.921  14.883  -41.338 1.00 96.33  ? 666  GLU A CD    1 
ATOM   112   O  OE1   . GLU A 1 18  ? -2.369  15.612  -42.188 1.00 99.84  ? 666  GLU A OE1   1 
ATOM   113   O  OE2   . GLU A 1 18  ? -4.148  14.635  -41.344 1.00 93.24  ? 666  GLU A OE2   1 
ATOM   114   N  N     . CYS A 1 19  ? 2.060   12.658  -39.959 1.00 97.85  ? 667  CYS A N     1 
ATOM   115   C  CA    . CYS A 1 19  ? 3.439   12.246  -40.208 1.00 101.85 ? 667  CYS A CA    1 
ATOM   116   C  C     . CYS A 1 19  ? 3.783   12.189  -41.699 1.00 104.09 ? 667  CYS A C     1 
ATOM   117   O  O     . CYS A 1 19  ? 4.790   12.754  -42.131 1.00 106.85 ? 667  CYS A O     1 
ATOM   118   C  CB    . CYS A 1 19  ? 3.738   10.897  -39.526 1.00 105.49 ? 667  CYS A CB    1 
ATOM   119   S  SG    . CYS A 1 19  ? 2.754   9.450   -40.091 1.00 108.51 ? 667  CYS A SG    1 
ATOM   120   N  N     . GLY A 1 20  ? 2.947   11.516  -42.484 1.00 100.20 ? 668  GLY A N     1 
ATOM   121   C  CA    . GLY A 1 20  ? 3.205   11.375  -43.904 1.00 100.71 ? 668  GLY A CA    1 
ATOM   122   C  C     . GLY A 1 20  ? 3.931   10.085  -44.223 1.00 103.78 ? 668  GLY A C     1 
ATOM   123   O  O     . GLY A 1 20  ? 4.410   9.886   -45.342 1.00 105.07 ? 668  GLY A O     1 
ATOM   124   N  N     . LYS A 1 21  ? 4.011   9.202   -43.232 1.00 105.66 ? 669  LYS A N     1 
ATOM   125   C  CA    . LYS A 1 21  ? 4.645   7.898   -43.411 1.00 106.61 ? 669  LYS A CA    1 
ATOM   126   C  C     . LYS A 1 21  ? 3.616   6.788   -43.658 1.00 106.23 ? 669  LYS A C     1 
ATOM   127   O  O     . LYS A 1 21  ? 3.963   5.714   -44.158 1.00 105.53 ? 669  LYS A O     1 
ATOM   128   C  CB    . LYS A 1 21  ? 5.522   7.550   -42.205 1.00 103.57 ? 669  LYS A CB    1 
ATOM   129   N  N     . CYS A 1 22  ? 2.356   7.053   -43.316 1.00 105.65 ? 670  CYS A N     1 
ATOM   130   C  CA    . CYS A 1 22  ? 1.289   6.062   -43.465 1.00 106.70 ? 670  CYS A CA    1 
ATOM   131   C  C     . CYS A 1 22  ? 1.011   5.725   -44.925 1.00 106.37 ? 670  CYS A C     1 
ATOM   132   O  O     . CYS A 1 22  ? 1.400   6.459   -45.832 1.00 104.96 ? 670  CYS A O     1 
ATOM   133   C  CB    . CYS A 1 22  ? -0.017  6.559   -42.834 1.00 105.87 ? 670  CYS A CB    1 
ATOM   134   S  SG    . CYS A 1 22  ? 0.070   7.001   -41.097 1.00 109.78 ? 670  CYS A SG    1 
ATOM   135   N  N     . LYS A 1 23  ? 0.325   4.605   -45.141 1.00 104.67 ? 671  LYS A N     1 
ATOM   136   C  CA    . LYS A 1 23  ? -0.231  4.294   -46.453 1.00 105.03 ? 671  LYS A CA    1 
ATOM   137   C  C     . LYS A 1 23  ? -1.291  5.350   -46.753 1.00 101.66 ? 671  LYS A C     1 
ATOM   138   O  O     . LYS A 1 23  ? -1.478  5.768   -47.900 1.00 97.30  ? 671  LYS A O     1 
ATOM   139   C  CB    . LYS A 1 23  ? -0.846  2.893   -46.460 1.00 98.06  ? 671  LYS A CB    1 
ATOM   140   N  N     . ALA A 1 24  ? -1.966  5.785   -45.691 1.00 101.21 ? 672  ALA A N     1 
ATOM   141   C  CA    . ALA A 1 24  ? -2.982  6.826   -45.770 1.00 101.31 ? 672  ALA A CA    1 
ATOM   142   C  C     . ALA A 1 24  ? -2.350  8.220   -45.777 1.00 102.83 ? 672  ALA A C     1 
ATOM   143   O  O     . ALA A 1 24  ? -2.673  9.045   -46.632 1.00 102.21 ? 672  ALA A O     1 
ATOM   144   C  CB    . ALA A 1 24  ? -3.975  6.688   -44.618 1.00 96.19  ? 672  ALA A CB    1 
ATOM   145   N  N     . CYS A 1 25  ? -1.451  8.480   -44.829 1.00 103.42 ? 673  CYS A N     1 
ATOM   146   C  CA    . CYS A 1 25  ? -0.751  9.763   -44.786 1.00 102.80 ? 673  CYS A CA    1 
ATOM   147   C  C     . CYS A 1 25  ? -0.050  10.039  -46.116 1.00 103.22 ? 673  CYS A C     1 
ATOM   148   O  O     . CYS A 1 25  ? 0.109   11.193  -46.518 1.00 101.07 ? 673  CYS A O     1 
ATOM   149   C  CB    . CYS A 1 25  ? 0.246   9.816   -43.622 1.00 100.97 ? 673  CYS A CB    1 
ATOM   150   S  SG    . CYS A 1 25  ? -0.368  10.642  -42.122 1.00 92.71  ? 673  CYS A SG    1 
ATOM   151   N  N     . LYS A 1 26  ? 0.352   8.969   -46.798 1.00 106.10 ? 674  LYS A N     1 
ATOM   152   C  CA    . LYS A 1 26  ? 0.974   9.079   -48.117 1.00 107.56 ? 674  LYS A CA    1 
ATOM   153   C  C     . LYS A 1 26  ? -0.062  9.247   -49.233 1.00 105.19 ? 674  LYS A C     1 
ATOM   154   O  O     . LYS A 1 26  ? 0.241   9.801   -50.296 1.00 105.89 ? 674  LYS A O     1 
ATOM   155   C  CB    . LYS A 1 26  ? 1.872   7.867   -48.399 1.00 105.81 ? 674  LYS A CB    1 
ATOM   156   C  CG    . LYS A 1 26  ? 3.225   7.915   -47.697 1.00 105.90 ? 674  LYS A CG    1 
ATOM   157   C  CD    . LYS A 1 26  ? 4.171   6.854   -48.245 1.00 108.67 ? 674  LYS A CD    1 
ATOM   158   C  CE    . LYS A 1 26  ? 5.590   7.051   -47.724 1.00 110.81 ? 674  LYS A CE    1 
ATOM   159   N  NZ    . LYS A 1 26  ? 6.572   6.123   -48.365 1.00 110.18 ? 674  LYS A NZ    1 
ATOM   160   N  N     . ASP A 1 27  ? -1.282  8.777   -48.987 1.00 101.06 ? 675  ASP A N     1 
ATOM   161   C  CA    . ASP A 1 27  ? -2.339  8.852   -49.989 1.00 101.10 ? 675  ASP A CA    1 
ATOM   162   C  C     . ASP A 1 27  ? -3.227  10.085  -49.826 1.00 101.32 ? 675  ASP A C     1 
ATOM   163   O  O     . ASP A 1 27  ? -4.151  10.304  -50.610 1.00 99.87  ? 675  ASP A O     1 
ATOM   164   C  CB    . ASP A 1 27  ? -3.198  7.587   -49.970 1.00 100.34 ? 675  ASP A CB    1 
ATOM   165   C  CG    . ASP A 1 27  ? -4.257  7.593   -51.057 1.00 102.16 ? 675  ASP A CG    1 
ATOM   166   O  OD1   . ASP A 1 27  ? -5.413  7.979   -50.767 1.00 97.54  ? 675  ASP A OD1   1 
ATOM   167   O  OD2   . ASP A 1 27  ? -3.925  7.229   -52.207 1.00 105.10 ? 675  ASP A OD2   1 
ATOM   168   N  N     . MET A 1 28  ? -2.951  10.889  -48.807 1.00 100.98 ? 676  MET A N     1 
ATOM   169   C  CA    . MET A 1 28  ? -3.751  12.082  -48.573 1.00 101.79 ? 676  MET A CA    1 
ATOM   170   C  C     . MET A 1 28  ? -3.638  13.040  -49.756 1.00 103.19 ? 676  MET A C     1 
ATOM   171   O  O     . MET A 1 28  ? -2.593  13.115  -50.406 1.00 101.76 ? 676  MET A O     1 
ATOM   172   C  CB    . MET A 1 28  ? -3.338  12.761  -47.267 1.00 99.91  ? 676  MET A CB    1 
ATOM   173   C  CG    . MET A 1 28  ? -3.480  11.860  -46.051 1.00 98.07  ? 676  MET A CG    1 
ATOM   174   S  SD    . MET A 1 28  ? -3.292  12.716  -44.477 1.00 95.91  ? 676  MET A SD    1 
ATOM   175   C  CE    . MET A 1 28  ? -4.605  13.932  -44.591 1.00 94.29  ? 676  MET A CE    1 
ATOM   176   N  N     . VAL A 1 29  ? -4.725  13.754  -50.039 1.00 101.97 ? 677  VAL A N     1 
ATOM   177   C  CA    . VAL A 1 29  ? -4.760  14.702  -51.151 1.00 103.32 ? 677  VAL A CA    1 
ATOM   178   C  C     . VAL A 1 29  ? -3.633  15.731  -51.060 1.00 101.81 ? 677  VAL A C     1 
ATOM   179   O  O     . VAL A 1 29  ? -2.902  15.952  -52.027 1.00 97.45  ? 677  VAL A O     1 
ATOM   180   C  CB    . VAL A 1 29  ? -6.125  15.425  -51.231 1.00 104.19 ? 677  VAL A CB    1 
ATOM   181   C  CG1   . VAL A 1 29  ? -6.603  15.830  -49.838 1.00 102.17 ? 677  VAL A CG1   1 
ATOM   182   C  CG2   . VAL A 1 29  ? -6.043  16.631  -52.163 1.00 98.79  ? 677  VAL A CG2   1 
ATOM   183   N  N     . LYS A 1 30  ? -3.503  16.351  -49.888 1.00 103.08 ? 678  LYS A N     1 
ATOM   184   C  CA    . LYS A 1 30  ? -2.467  17.348  -49.632 1.00 101.25 ? 678  LYS A CA    1 
ATOM   185   C  C     . LYS A 1 30  ? -1.064  16.770  -49.814 1.00 102.52 ? 678  LYS A C     1 
ATOM   186   O  O     . LYS A 1 30  ? -0.138  17.483  -50.198 1.00 104.15 ? 678  LYS A O     1 
ATOM   187   C  CB    . LYS A 1 30  ? -2.618  17.923  -48.221 1.00 98.36  ? 678  LYS A CB    1 
ATOM   188   C  CG    . LYS A 1 30  ? -2.745  16.862  -47.134 1.00 99.87  ? 678  LYS A CG    1 
ATOM   189   C  CD    . LYS A 1 30  ? -2.736  17.471  -45.739 1.00 98.51  ? 678  LYS A CD    1 
ATOM   190   C  CE    . LYS A 1 30  ? -3.944  18.372  -45.504 1.00 97.51  ? 678  LYS A CE    1 
ATOM   191   N  NZ    . LYS A 1 30  ? -3.960  18.932  -44.120 1.00 94.60  ? 678  LYS A NZ    1 
ATOM   192   N  N     . PHE A 1 31  ? -0.912  15.479  -49.526 1.00 103.29 ? 679  PHE A N     1 
ATOM   193   C  CA    . PHE A 1 31  ? 0.359   14.784  -49.737 1.00 104.84 ? 679  PHE A CA    1 
ATOM   194   C  C     . PHE A 1 31  ? 0.439   14.223  -51.156 1.00 106.03 ? 679  PHE A C     1 
ATOM   195   O  O     . PHE A 1 31  ? 1.206   13.294  -51.432 1.00 102.94 ? 679  PHE A O     1 
ATOM   196   C  CB    . PHE A 1 31  ? 0.544   13.650  -48.723 1.00 104.60 ? 679  PHE A CB    1 
ATOM   197   C  CG    . PHE A 1 31  ? 0.916   14.115  -47.338 1.00 103.71 ? 679  PHE A CG    1 
ATOM   198   C  CD1   . PHE A 1 31  ? 2.102   13.699  -46.748 1.00 101.68 ? 679  PHE A CD1   1 
ATOM   199   C  CD2   . PHE A 1 31  ? 0.075   14.956  -46.621 1.00 101.17 ? 679  PHE A CD2   1 
ATOM   200   C  CE1   . PHE A 1 31  ? 2.444   14.117  -45.468 1.00 101.54 ? 679  PHE A CE1   1 
ATOM   201   C  CE2   . PHE A 1 31  ? 0.411   15.376  -45.340 1.00 98.13  ? 679  PHE A CE2   1 
ATOM   202   C  CZ    . PHE A 1 31  ? 1.597   14.955  -44.763 1.00 97.16  ? 679  PHE A CZ    1 
ATOM   203   N  N     . GLY A 1 32  ? -0.373  14.784  -52.048 1.00 106.60 ? 680  GLY A N     1 
ATOM   204   C  CA    . GLY A 1 32  ? -0.331  14.423  -53.453 1.00 109.09 ? 680  GLY A CA    1 
ATOM   205   C  C     . GLY A 1 32  ? -1.095  13.163  -53.826 1.00 110.19 ? 680  GLY A C     1 
ATOM   206   O  O     . GLY A 1 32  ? -1.358  12.926  -55.009 1.00 109.27 ? 680  GLY A O     1 
ATOM   207   N  N     . GLY A 1 33  ? -1.444  12.352  -52.829 1.00 106.46 ? 681  GLY A N     1 
ATOM   208   C  CA    . GLY A 1 33  ? -2.220  11.151  -53.067 1.00 101.69 ? 681  GLY A CA    1 
ATOM   209   C  C     . GLY A 1 33  ? -3.558  11.457  -53.715 1.00 103.00 ? 681  GLY A C     1 
ATOM   210   O  O     . GLY A 1 33  ? -4.022  12.603  -53.716 1.00 100.69 ? 681  GLY A O     1 
ATOM   211   N  N     . THR A 1 34  ? -4.182  10.424  -54.272 1.00 102.38 ? 682  THR A N     1 
ATOM   212   C  CA    . THR A 1 34  ? -5.495  10.563  -54.905 1.00 101.95 ? 682  THR A CA    1 
ATOM   213   C  C     . THR A 1 34  ? -6.590  10.865  -53.873 1.00 101.17 ? 682  THR A C     1 
ATOM   214   O  O     . THR A 1 34  ? -7.632  11.450  -54.197 1.00 98.47  ? 682  THR A O     1 
ATOM   215   C  CB    . THR A 1 34  ? -5.862  9.296   -55.704 1.00 97.47  ? 682  THR A CB    1 
ATOM   216   N  N     . GLY A 1 35  ? -6.341  10.461  -52.630 1.00 100.15 ? 683  GLY A N     1 
ATOM   217   C  CA    . GLY A 1 35  ? -7.230  10.775  -51.526 1.00 101.33 ? 683  GLY A CA    1 
ATOM   218   C  C     . GLY A 1 35  ? -8.523  9.986   -51.543 1.00 95.71  ? 683  GLY A C     1 
ATOM   219   O  O     . GLY A 1 35  ? -9.502  10.353  -50.889 1.00 91.11  ? 683  GLY A O     1 
ATOM   220   N  N     . ARG A 1 36  ? -8.527  8.893   -52.294 1.00 96.02  ? 684  ARG A N     1 
ATOM   221   C  CA    . ARG A 1 36  ? -9.699  8.036   -52.372 1.00 95.77  ? 684  ARG A CA    1 
ATOM   222   C  C     . ARG A 1 36  ? -9.857  7.246   -51.072 1.00 89.29  ? 684  ARG A C     1 
ATOM   223   O  O     . ARG A 1 36  ? -10.931 6.720   -50.777 1.00 87.04  ? 684  ARG A O     1 
ATOM   224   C  CB    . ARG A 1 36  ? -9.582  7.093   -53.576 1.00 99.40  ? 684  ARG A CB    1 
ATOM   225   C  CG    . ARG A 1 36  ? -8.795  7.687   -54.744 1.00 97.04  ? 684  ARG A CG    1 
ATOM   226   C  CD    . ARG A 1 36  ? -9.427  7.365   -56.094 1.00 97.34  ? 684  ARG A CD    1 
ATOM   227   N  NE    . ARG A 1 36  ? -10.596 8.197   -56.383 1.00 94.02  ? 684  ARG A NE    1 
ATOM   228   C  CZ    . ARG A 1 36  ? -10.539 9.423   -56.903 1.00 90.53  ? 684  ARG A CZ    1 
ATOM   229   N  NH1   . ARG A 1 36  ? -9.368  9.980   -57.187 1.00 90.29  ? 684  ARG A NH1   1 
ATOM   230   N  NH2   . ARG A 1 36  ? -11.656 10.097  -57.137 1.00 88.83  ? 684  ARG A NH2   1 
ATOM   231   N  N     . SER A 1 37  ? -8.779  7.184   -50.293 1.00 87.02  ? 685  SER A N     1 
ATOM   232   C  CA    . SER A 1 37  ? -8.767  6.433   -49.043 1.00 84.23  ? 685  SER A CA    1 
ATOM   233   C  C     . SER A 1 37  ? -9.745  7.003   -48.022 1.00 83.06  ? 685  SER A C     1 
ATOM   234   O  O     . SER A 1 37  ? -10.586 6.278   -47.489 1.00 83.00  ? 685  SER A O     1 
ATOM   235   C  CB    . SER A 1 37  ? -7.359  6.403   -48.447 1.00 85.77  ? 685  SER A CB    1 
ATOM   236   O  OG    . SER A 1 37  ? -7.290  5.501   -47.355 1.00 84.17  ? 685  SER A OG    1 
ATOM   237   N  N     . LYS A 1 38  ? -9.622  8.297   -47.743 1.00 81.06  ? 686  LYS A N     1 
ATOM   238   C  CA    . LYS A 1 38  ? -10.528 8.966   -46.815 1.00 77.93  ? 686  LYS A CA    1 
ATOM   239   C  C     . LYS A 1 38  ? -10.348 8.490   -45.372 1.00 76.13  ? 686  LYS A C     1 
ATOM   240   O  O     . LYS A 1 38  ? -11.325 8.285   -44.650 1.00 72.45  ? 686  LYS A O     1 
ATOM   241   C  CB    . LYS A 1 38  ? -11.984 8.770   -47.249 1.00 75.66  ? 686  LYS A CB    1 
ATOM   242   C  CG    . LYS A 1 38  ? -12.367 9.490   -48.532 1.00 76.60  ? 686  LYS A CG    1 
ATOM   243   C  CD    . LYS A 1 38  ? -13.879 9.519   -48.704 1.00 75.05  ? 686  LYS A CD    1 
ATOM   244   C  CE    . LYS A 1 38  ? -14.311 10.545  -49.739 1.00 73.37  ? 686  LYS A CE    1 
ATOM   245   N  NZ    . LYS A 1 38  ? -15.788 10.746  -49.739 1.00 72.69  ? 686  LYS A NZ    1 
ATOM   246   N  N     . GLN A 1 39  ? -9.097  8.322   -44.957 1.00 75.78  ? 687  GLN A N     1 
ATOM   247   C  CA    . GLN A 1 39  ? -8.791  7.889   -43.601 1.00 75.48  ? 687  GLN A CA    1 
ATOM   248   C  C     . GLN A 1 39  ? -7.713  8.781   -42.993 1.00 77.94  ? 687  GLN A C     1 
ATOM   249   O  O     . GLN A 1 39  ? -6.925  9.389   -43.717 1.00 80.45  ? 687  GLN A O     1 
ATOM   250   C  CB    . GLN A 1 39  ? -8.336  6.427   -43.599 1.00 77.61  ? 687  GLN A CB    1 
ATOM   251   C  CG    . GLN A 1 39  ? -9.269  5.473   -44.346 1.00 77.11  ? 687  GLN A CG    1 
ATOM   252   C  CD    . GLN A 1 39  ? -10.585 5.201   -43.616 1.00 75.53  ? 687  GLN A CD    1 
ATOM   253   O  OE1   . GLN A 1 39  ? -10.703 5.398   -42.402 1.00 70.85  ? 687  GLN A OE1   1 
ATOM   254   N  NE2   . GLN A 1 39  ? -11.580 4.738   -44.364 1.00 74.01  ? 687  GLN A NE2   1 
ATOM   255   N  N     . ALA A 1 40  ? -7.679  8.852   -41.664 1.00 77.15  ? 688  ALA A N     1 
ATOM   256   C  CA    . ALA A 1 40  ? -6.729  9.710   -40.959 1.00 78.15  ? 688  ALA A CA    1 
ATOM   257   C  C     . ALA A 1 40  ? -5.393  9.010   -40.714 1.00 82.18  ? 688  ALA A C     1 
ATOM   258   O  O     . ALA A 1 40  ? -5.216  7.853   -41.083 1.00 83.05  ? 688  ALA A O     1 
ATOM   259   C  CB    . ALA A 1 40  ? -7.326  10.190  -39.645 1.00 77.48  ? 688  ALA A CB    1 
ATOM   260   N  N     . CYS A 1 41  ? -4.455  9.721   -40.096 1.00 85.46  ? 689  CYS A N     1 
ATOM   261   C  CA    . CYS A 1 41  ? -3.150  9.154   -39.783 1.00 87.76  ? 689  CYS A CA    1 
ATOM   262   C  C     . CYS A 1 41  ? -3.259  7.931   -38.878 1.00 89.35  ? 689  CYS A C     1 
ATOM   263   O  O     . CYS A 1 41  ? -4.116  7.870   -37.998 1.00 87.65  ? 689  CYS A O     1 
ATOM   264   C  CB    . CYS A 1 41  ? -2.253  10.194  -39.115 1.00 93.23  ? 689  CYS A CB    1 
ATOM   265   S  SG    . CYS A 1 41  ? -0.712  9.498   -38.462 1.00 105.02 ? 689  CYS A SG    1 
ATOM   266   N  N     . LEU A 1 42  ? -2.374  6.962   -39.099 1.00 92.08  ? 690  LEU A N     1 
ATOM   267   C  CA    . LEU A 1 42  ? -2.337  5.745   -38.295 1.00 88.69  ? 690  LEU A CA    1 
ATOM   268   C  C     . LEU A 1 42  ? -2.090  6.071   -36.826 1.00 89.19  ? 690  LEU A C     1 
ATOM   269   O  O     . LEU A 1 42  ? -2.619  5.408   -35.934 1.00 85.64  ? 690  LEU A O     1 
ATOM   270   C  CB    . LEU A 1 42  ? -1.262  4.794   -38.815 1.00 86.15  ? 690  LEU A CB    1 
ATOM   271   N  N     . LYS A 1 43  ? -1.287  7.102   -36.584 1.00 92.69  ? 691  LYS A N     1 
ATOM   272   C  CA    . LYS A 1 43  ? -0.964  7.524   -35.223 1.00 94.03  ? 691  LYS A CA    1 
ATOM   273   C  C     . LYS A 1 43  ? -2.025  8.468   -34.635 1.00 92.69  ? 691  LYS A C     1 
ATOM   274   O  O     . LYS A 1 43  ? -1.927  8.889   -33.477 1.00 90.74  ? 691  LYS A O     1 
ATOM   275   C  CB    . LYS A 1 43  ? 0.420   8.175   -35.183 1.00 89.57  ? 691  LYS A CB    1 
ATOM   276   N  N     . ARG A 1 44  ? -3.042  8.787   -35.433 1.00 90.22  ? 692  ARG A N     1 
ATOM   277   C  CA    . ARG A 1 44  ? -4.089  9.709   -35.001 1.00 86.09  ? 692  ARG A CA    1 
ATOM   278   C  C     . ARG A 1 44  ? -5.464  9.062   -34.877 1.00 83.66  ? 692  ARG A C     1 
ATOM   279   O  O     . ARG A 1 44  ? -6.485  9.731   -35.017 1.00 79.82  ? 692  ARG A O     1 
ATOM   280   C  CB    . ARG A 1 44  ? -4.165  10.907  -35.941 1.00 85.10  ? 692  ARG A CB    1 
ATOM   281   C  CG    . ARG A 1 44  ? -2.988  11.848  -35.824 1.00 88.56  ? 692  ARG A CG    1 
ATOM   282   C  CD    . ARG A 1 44  ? -3.023  12.894  -36.921 1.00 89.06  ? 692  ARG A CD    1 
ATOM   283   N  NE    . ARG A 1 44  ? -4.356  13.468  -37.095 1.00 85.14  ? 692  ARG A NE    1 
ATOM   284   C  CZ    . ARG A 1 44  ? -4.835  14.479  -36.380 1.00 80.92  ? 692  ARG A CZ    1 
ATOM   285   N  NH1   . ARG A 1 44  ? -6.056  14.942  -36.612 1.00 76.03  ? 692  ARG A NH1   1 
ATOM   286   N  NH2   . ARG A 1 44  ? -4.091  15.030  -35.434 1.00 87.01  ? 692  ARG A NH2   1 
ATOM   287   N  N     . ARG A 1 45  ? -5.498  7.762   -34.616 1.00 82.77  ? 693  ARG A N     1 
ATOM   288   C  CA    . ARG A 1 45  ? -6.764  7.120   -34.306 1.00 80.64  ? 693  ARG A CA    1 
ATOM   289   C  C     . ARG A 1 45  ? -7.082  7.294   -32.822 1.00 80.03  ? 693  ARG A C     1 
ATOM   290   O  O     . ARG A 1 45  ? -6.501  6.633   -31.964 1.00 78.99  ? 693  ARG A O     1 
ATOM   291   C  CB    . ARG A 1 45  ? -6.743  5.643   -34.697 1.00 84.34  ? 693  ARG A CB    1 
ATOM   292   C  CG    . ARG A 1 45  ? -7.387  5.341   -36.045 1.00 83.92  ? 693  ARG A CG    1 
ATOM   293   C  CD    . ARG A 1 45  ? -6.490  5.725   -37.212 1.00 85.59  ? 693  ARG A CD    1 
ATOM   294   N  NE    . ARG A 1 45  ? -7.152  5.482   -38.494 1.00 87.15  ? 693  ARG A NE    1 
ATOM   295   C  CZ    . ARG A 1 45  ? -6.518  5.357   -39.658 1.00 86.03  ? 693  ARG A CZ    1 
ATOM   296   N  NH1   . ARG A 1 45  ? -5.197  5.441   -39.706 1.00 89.40  ? 693  ARG A NH1   1 
ATOM   297   N  NH2   . ARG A 1 45  ? -7.203  5.140   -40.773 1.00 79.72  ? 693  ARG A NH2   1 
ATOM   298   N  N     . CYS A 1 46  ? -8.006  8.200   -32.528 1.00 82.11  ? 694  CYS A N     1 
ATOM   299   C  CA    . CYS A 1 46  ? -8.368  8.515   -31.150 1.00 82.77  ? 694  CYS A CA    1 
ATOM   300   C  C     . CYS A 1 46  ? -9.147  7.402   -30.444 1.00 82.23  ? 694  CYS A C     1 
ATOM   301   O  O     . CYS A 1 46  ? -10.290 7.107   -30.806 1.00 77.93  ? 694  CYS A O     1 
ATOM   302   C  CB    . CYS A 1 46  ? -9.174  9.814   -31.096 1.00 82.10  ? 694  CYS A CB    1 
ATOM   303   S  SG    . CYS A 1 46  ? -10.182 9.987   -29.599 1.00 82.75  ? 694  CYS A SG    1 
ATOM   304   N  N     . PRO A 1 47  ? -8.527  6.789   -29.421 1.00 80.65  ? 695  PRO A N     1 
ATOM   305   C  CA    . PRO A 1 47  ? -9.177  5.782   -28.576 1.00 77.14  ? 695  PRO A CA    1 
ATOM   306   C  C     . PRO A 1 47  ? -10.442 6.339   -27.937 1.00 76.62  ? 695  PRO A C     1 
ATOM   307   O  O     . PRO A 1 47  ? -11.437 5.619   -27.823 1.00 73.48  ? 695  PRO A O     1 
ATOM   308   C  CB    . PRO A 1 47  ? -8.130  5.509   -27.496 1.00 76.50  ? 695  PRO A CB    1 
ATOM   309   C  CG    . PRO A 1 47  ? -6.835  5.840   -28.141 1.00 79.63  ? 695  PRO A CG    1 
ATOM   310   C  CD    . PRO A 1 47  ? -7.118  6.995   -29.049 1.00 80.20  ? 695  PRO A CD    1 
ATOM   311   N  N     . ASN A 1 48  ? -10.395 7.607   -27.529 1.00 77.88  ? 696  ASN A N     1 
ATOM   312   C  CA    . ASN A 1 48  ? -11.550 8.272   -26.921 1.00 76.03  ? 696  ASN A CA    1 
ATOM   313   C  C     . ASN A 1 48  ? -12.645 8.550   -27.942 1.00 73.22  ? 696  ASN A C     1 
ATOM   314   O  O     . ASN A 1 48  ? -13.671 9.158   -27.631 1.00 68.34  ? 696  ASN A O     1 
ATOM   315   C  CB    . ASN A 1 48  ? -11.134 9.574   -26.226 1.00 73.01  ? 696  ASN A CB    1 
ATOM   316   C  CG    . ASN A 1 48  ? -10.335 9.332   -24.962 1.00 71.17  ? 696  ASN A CG    1 
ATOM   317   O  OD1   . ASN A 1 48  ? -10.437 8.271   -24.349 1.00 71.10  ? 696  ASN A OD1   1 
ATOM   318   N  ND2   . ASN A 1 48  ? -9.538  10.320  -24.562 1.00 72.25  ? 696  ASN A ND2   1 
ATOM   319   N  N     . LEU A 1 49  ? -12.410 8.102   -29.168 1.00 74.68  ? 697  LEU A N     1 
ATOM   320   C  CA    . LEU A 1 49  ? -13.385 8.259   -30.230 1.00 76.95  ? 697  LEU A CA    1 
ATOM   321   C  C     . LEU A 1 49  ? -14.783 7.919   -29.716 1.00 73.23  ? 697  LEU A C     1 
ATOM   322   O  O     . LEU A 1 49  ? -15.059 6.776   -29.366 1.00 77.36  ? 697  LEU A O     1 
ATOM   323   C  CB    . LEU A 1 49  ? -13.005 7.364   -31.414 1.00 76.24  ? 697  LEU A CB    1 
ATOM   324   C  CG    . LEU A 1 49  ? -13.630 7.650   -32.778 1.00 72.90  ? 697  LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1 49  ? -12.677 7.198   -33.864 1.00 70.48  ? 697  LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1 49  ? -14.993 6.973   -32.930 1.00 72.17  ? 697  LEU A CD2   1 
ATOM   327   N  N     . ALA A 1 50  ? -15.651 8.922   -29.650 1.00 70.72  ? 698  ALA A N     1 
ATOM   328   C  CA    . ALA A 1 50  ? -17.034 8.716   -29.245 1.00 76.11  ? 698  ALA A CA    1 
ATOM   329   C  C     . ALA A 1 50  ? -17.836 9.972   -29.532 1.00 77.28  ? 698  ALA A C     1 
ATOM   330   O  O     . ALA A 1 50  ? -17.267 11.012  -29.841 1.00 80.65  ? 698  ALA A O     1 
ATOM   331   C  CB    . ALA A 1 50  ? -17.118 8.356   -27.766 1.00 79.22  ? 698  ALA A CB    1 
ATOM   332   N  N     . VAL A 1 51  ? -19.156 9.880   -29.424 1.00 76.04  ? 699  VAL A N     1 
ATOM   333   C  CA    . VAL A 1 51  ? -20.021 11.012  -29.749 1.00 81.12  ? 699  VAL A CA    1 
ATOM   334   C  C     . VAL A 1 51  ? -19.727 12.248  -28.902 1.00 87.51  ? 699  VAL A C     1 
ATOM   335   O  O     . VAL A 1 51  ? -19.996 12.265  -27.706 1.00 86.02  ? 699  VAL A O     1 
ATOM   336   C  CB    . VAL A 1 51  ? -21.510 10.656  -29.577 1.00 77.45  ? 699  VAL A CB    1 
ATOM   337   N  N     . LYS A 1 52  ? -19.174 13.285  -29.522 1.00 92.49  ? 700  LYS A N     1 
ATOM   338   C  CA    . LYS A 1 52  ? -19.089 14.580  -28.860 1.00 93.44  ? 700  LYS A CA    1 
ATOM   339   C  C     . LYS A 1 52  ? -20.352 15.356  -29.228 1.00 100.41 ? 700  LYS A C     1 
ATOM   340   O  O     . LYS A 1 52  ? -20.325 16.581  -29.378 1.00 102.15 ? 700  LYS A O     1 
ATOM   341   C  CB    . LYS A 1 52  ? -17.836 15.355  -29.286 1.00 92.95  ? 700  LYS A CB    1 
ATOM   342   C  CG    . LYS A 1 52  ? -16.782 14.519  -30.009 1.00 89.59  ? 700  LYS A CG    1 
ATOM   343   C  CD    . LYS A 1 52  ? -16.808 14.755  -31.519 1.00 90.16  ? 700  LYS A CD    1 
ATOM   344   C  CE    . LYS A 1 52  ? -18.183 14.460  -32.106 1.00 90.78  ? 700  LYS A CE    1 
ATOM   345   N  NZ    . LYS A 1 52  ? -18.248 14.866  -33.528 1.00 94.16  ? 700  LYS A NZ    1 
ATOM   346   N  N     . GLU A 1 53  ? -21.453 14.625  -29.402 1.00 97.99  ? 701  GLU A N     1 
ATOM   347   C  CA    . GLU A 1 53  ? -22.760 15.235  -29.635 1.00 97.97  ? 701  GLU A CA    1 
ATOM   348   C  C     . GLU A 1 53  ? -23.266 15.899  -28.355 1.00 100.46 ? 701  GLU A C     1 
ATOM   349   O  O     . GLU A 1 53  ? -24.426 15.737  -27.965 1.00 98.50  ? 701  GLU A O     1 
ATOM   350   C  CB    . GLU A 1 53  ? -23.764 14.190  -30.126 1.00 96.19  ? 701  GLU A CB    1 
ATOM   351   N  N     . ALA A 1 54  ? -22.376 16.642  -27.704 1.00 102.83 ? 702  ALA A N     1 
ATOM   352   C  CA    . ALA A 1 54  ? -22.695 17.351  -26.474 1.00 105.54 ? 702  ALA A CA    1 
ATOM   353   C  C     . ALA A 1 54  ? -22.072 18.747  -26.514 1.00 106.55 ? 702  ALA A C     1 
ATOM   354   O  O     . ALA A 1 54  ? -21.117 18.984  -27.256 1.00 106.71 ? 702  ALA A O     1 
ATOM   355   C  CB    . ALA A 1 54  ? -22.192 16.564  -25.265 1.00 101.70 ? 702  ALA A CB    1 
ATOM   356   N  N     . ASP A 1 55  ? -22.614 19.674  -25.728 1.00 108.35 ? 703  ASP A N     1 
ATOM   357   C  CA    . ASP A 1 55  ? -22.086 21.037  -25.694 1.00 110.14 ? 703  ASP A CA    1 
ATOM   358   C  C     . ASP A 1 55  ? -22.112 21.631  -24.284 1.00 110.53 ? 703  ASP A C     1 
ATOM   359   O  O     . ASP A 1 55  ? -23.180 21.831  -23.699 1.00 106.38 ? 703  ASP A O     1 
ATOM   360   C  CB    . ASP A 1 55  ? -22.847 21.943  -26.666 1.00 107.47 ? 703  ASP A CB    1 
ATOM   361   N  N     . ASP A 1 56  ? -20.929 21.910  -23.744 1.00 107.57 ? 704  ASP A N     1 
ATOM   362   C  CA    . ASP A 1 56  ? -20.824 22.552  -22.440 1.00 106.16 ? 704  ASP A CA    1 
ATOM   363   C  C     . ASP A 1 56  ? -21.555 23.893  -22.455 1.00 109.19 ? 704  ASP A C     1 
ATOM   364   O  O     . ASP A 1 56  ? -21.766 24.489  -23.515 1.00 109.79 ? 704  ASP A O     1 
ATOM   365   C  CB    . ASP A 1 56  ? -19.360 22.743  -22.043 1.00 103.44 ? 704  ASP A CB    1 
ATOM   366   N  N     . ASP A 1 57  ? -21.948 24.356  -21.273 1.00 108.03 ? 705  ASP A N     1 
ATOM   367   C  CA    . ASP A 1 57  ? -22.639 25.632  -21.138 1.00 101.97 ? 705  ASP A CA    1 
ATOM   368   C  C     . ASP A 1 57  ? -21.799 26.589  -20.296 1.00 102.25 ? 705  ASP A C     1 
ATOM   369   O  O     . ASP A 1 57  ? -21.372 26.245  -19.192 1.00 101.75 ? 705  ASP A O     1 
ATOM   370   C  CB    . ASP A 1 57  ? -24.022 25.437  -20.504 1.00 90.28  ? 705  ASP A CB    1 
ATOM   371   N  N     . GLU A 1 58  ? -21.553 27.783  -20.832 1.00 99.85  ? 706  GLU A N     1 
ATOM   372   C  CA    . GLU A 1 58  ? -20.814 28.822  -20.117 1.00 100.38 ? 706  GLU A CA    1 
ATOM   373   C  C     . GLU A 1 58  ? -21.742 29.639  -19.215 1.00 99.91  ? 706  GLU A C     1 
ATOM   374   O  O     . GLU A 1 58  ? -22.960 29.632  -19.402 1.00 97.34  ? 706  GLU A O     1 
ATOM   375   C  CB    . GLU A 1 58  ? -20.108 29.749  -21.105 1.00 97.94  ? 706  GLU A CB    1 
ATOM   376   N  N     . GLU A 1 59  ? -21.170 30.338  -18.236 1.00 100.65 ? 707  GLU A N     1 
ATOM   377   C  CA    . GLU A 1 59  ? -21.949 31.261  -17.404 1.00 100.37 ? 707  GLU A CA    1 
ATOM   378   C  C     . GLU A 1 59  ? -22.141 32.598  -18.133 1.00 99.93  ? 707  GLU A C     1 
ATOM   379   O  O     . GLU A 1 59  ? -21.611 33.631  -17.711 1.00 96.85  ? 707  GLU A O     1 
ATOM   380   C  CB    . GLU A 1 59  ? -21.287 31.472  -16.037 1.00 93.50  ? 707  GLU A CB    1 
ATOM   381   N  N     . ALA A 1 60  ? -22.910 32.559  -19.224 1.00 101.02 ? 708  ALA A N     1 
ATOM   382   C  CA    . ALA A 1 60  ? -23.116 33.713  -20.104 1.00 97.65  ? 708  ALA A CA    1 
ATOM   383   C  C     . ALA A 1 60  ? -23.926 34.855  -19.469 1.00 96.04  ? 708  ALA A C     1 
ATOM   384   O  O     . ALA A 1 60  ? -23.713 36.028  -19.788 1.00 92.63  ? 708  ALA A O     1 
ATOM   385   C  CB    . ALA A 1 60  ? -23.755 33.263  -21.425 1.00 90.24  ? 708  ALA A CB    1 
ATOM   386   N  N     . ASP A 1 61  ? -24.851 34.513  -18.576 1.00 96.19  ? 709  ASP A N     1 
ATOM   387   C  CA    . ASP A 1 61  ? -25.650 35.528  -17.885 1.00 96.71  ? 709  ASP A CA    1 
ATOM   388   C  C     . ASP A 1 61  ? -24.811 36.472  -17.014 1.00 100.35 ? 709  ASP A C     1 
ATOM   389   O  O     . ASP A 1 61  ? -23.928 36.035  -16.268 1.00 98.89  ? 709  ASP A O     1 
ATOM   390   C  CB    . ASP A 1 61  ? -26.784 34.887  -17.069 1.00 90.30  ? 709  ASP A CB    1 
ATOM   391   C  CG    . ASP A 1 61  ? -26.316 33.705  -16.227 1.00 87.42  ? 709  ASP A CG    1 
ATOM   392   O  OD1   . ASP A 1 61  ? -26.685 33.653  -15.030 1.00 82.10  ? 709  ASP A OD1   1 
ATOM   393   O  OD2   . ASP A 1 61  ? -25.601 32.822  -16.762 1.00 85.93  ? 709  ASP A OD2   1 
ATOM   394   N  N     . ASP A 1 62  ? -25.101 37.767  -17.130 1.00 101.97 ? 710  ASP A N     1 
ATOM   395   C  CA    . ASP A 1 62  ? -24.412 38.814  -16.378 1.00 103.56 ? 710  ASP A CA    1 
ATOM   396   C  C     . ASP A 1 62  ? -24.772 38.777  -14.884 1.00 106.00 ? 710  ASP A C     1 
ATOM   397   O  O     . ASP A 1 62  ? -25.333 37.797  -14.388 1.00 101.14 ? 710  ASP A O     1 
ATOM   398   C  CB    . ASP A 1 62  ? -24.764 40.185  -16.980 1.00 106.95 ? 710  ASP A CB    1 
ATOM   399   C  CG    . ASP A 1 62  ? -24.040 41.341  -16.297 1.00 111.55 ? 710  ASP A CG    1 
ATOM   400   O  OD1   . ASP A 1 62  ? -24.606 42.459  -16.252 1.00 108.58 ? 710  ASP A OD1   1 
ATOM   401   O  OD2   . ASP A 1 62  ? -22.909 41.131  -15.808 1.00 112.47 ? 710  ASP A OD2   1 
ATOM   402   N  N     . ASP A 1 63  ? -24.439 39.851  -14.172 1.00 108.35 ? 711  ASP A N     1 
ATOM   403   C  CA    . ASP A 1 63  ? -24.805 40.008  -12.769 1.00 108.45 ? 711  ASP A CA    1 
ATOM   404   C  C     . ASP A 1 63  ? -26.317 39.887  -12.571 1.00 107.97 ? 711  ASP A C     1 
ATOM   405   O  O     . ASP A 1 63  ? -26.786 39.483  -11.503 1.00 104.70 ? 711  ASP A O     1 
ATOM   406   C  CB    . ASP A 1 63  ? -24.324 41.367  -12.256 1.00 102.98 ? 711  ASP A CB    1 
ATOM   407   N  N     . VAL A 1 64  ? -27.074 40.238  -13.610 1.00 106.33 ? 712  VAL A N     1 
ATOM   408   C  CA    . VAL A 1 64  ? -28.527 40.372  -13.499 1.00 100.30 ? 712  VAL A CA    1 
ATOM   409   C  C     . VAL A 1 64  ? -28.834 41.232  -12.281 1.00 99.18  ? 712  VAL A C     1 
ATOM   410   O  O     . VAL A 1 64  ? -29.853 41.060  -11.608 1.00 93.20  ? 712  VAL A O     1 
ATOM   411   C  CB    . VAL A 1 64  ? -29.243 39.012  -13.402 1.00 95.23  ? 712  VAL A CB    1 
ATOM   412   N  N     . SER A 1 65  ? -27.912 42.147  -12.002 1.00 102.25 ? 713  SER A N     1 
ATOM   413   C  CA    . SER A 1 65  ? -28.117 43.181  -11.005 1.00 103.84 ? 713  SER A CA    1 
ATOM   414   C  C     . SER A 1 65  ? -29.113 44.170  -11.588 1.00 100.59 ? 713  SER A C     1 
ATOM   415   O  O     . SER A 1 65  ? -28.751 45.294  -11.949 1.00 96.51  ? 713  SER A O     1 
ATOM   416   C  CB    . SER A 1 65  ? -26.798 43.885  -10.689 1.00 102.85 ? 713  SER A CB    1 
ATOM   417   N  N     . GLU A 1 66  ? -30.366 43.729  -11.699 1.00 97.31  ? 714  GLU A N     1 
ATOM   418   C  CA    . GLU A 1 66  ? -31.421 44.545  -12.284 1.00 94.02  ? 714  GLU A CA    1 
ATOM   419   C  C     . GLU A 1 66  ? -32.764 44.340  -11.585 1.00 90.93  ? 714  GLU A C     1 
ATOM   420   O  O     . GLU A 1 66  ? -32.980 43.342  -10.892 1.00 87.86  ? 714  GLU A O     1 
ATOM   421   C  CB    . GLU A 1 66  ? -31.555 44.256  -13.776 1.00 88.80  ? 714  GLU A CB    1 
ATOM   422   C  CG    . GLU A 1 66  ? -32.040 42.865  -14.089 1.00 81.02  ? 714  GLU A CG    1 
ATOM   423   C  CD    . GLU A 1 66  ? -32.202 42.653  -15.572 1.00 78.41  ? 714  GLU A CD    1 
ATOM   424   O  OE1   . GLU A 1 66  ? -33.358 42.606  -16.046 1.00 69.57  ? 714  GLU A OE1   1 
ATOM   425   O  OE2   . GLU A 1 66  ? -31.170 42.544  -16.266 1.00 82.56  ? 714  GLU A OE2   1 
ATOM   426   N  N     . MET A 1 67  ? -33.665 45.297  -11.782 1.00 90.26  ? 715  MET A N     1 
ATOM   427   C  CA    . MET A 1 67  ? -34.929 45.321  -11.060 1.00 91.44  ? 715  MET A CA    1 
ATOM   428   C  C     . MET A 1 67  ? -35.888 44.239  -11.535 1.00 86.18  ? 715  MET A C     1 
ATOM   429   O  O     . MET A 1 67  ? -35.853 43.839  -12.702 1.00 81.26  ? 715  MET A O     1 
ATOM   430   C  CB    . MET A 1 67  ? -35.591 46.699  -11.182 1.00 90.79  ? 715  MET A CB    1 
ATOM   431   N  N     . PRO A 1 68  ? -36.738 43.754  -10.617 1.00 86.78  ? 716  PRO A N     1 
ATOM   432   C  CA    . PRO A 1 68  ? -37.865 42.885  -10.961 1.00 87.07  ? 716  PRO A CA    1 
ATOM   433   C  C     . PRO A 1 68  ? -38.790 43.601  -11.936 1.00 85.76  ? 716  PRO A C     1 
ATOM   434   O  O     . PRO A 1 68  ? -38.823 44.834  -11.957 1.00 83.84  ? 716  PRO A O     1 
ATOM   435   C  CB    . PRO A 1 68  ? -38.577 42.683  -9.616  1.00 90.04  ? 716  PRO A CB    1 
ATOM   436   C  CG    . PRO A 1 68  ? -37.516 42.904  -8.587  1.00 90.78  ? 716  PRO A CG    1 
ATOM   437   C  CD    . PRO A 1 68  ? -36.627 43.971  -9.164  1.00 90.84  ? 716  PRO A CD    1 
ATOM   438   N  N     . SER A 1 69  ? -39.527 42.838  -12.735 1.00 81.88  ? 717  SER A N     1 
ATOM   439   C  CA    . SER A 1 69  ? -40.431 43.419  -13.718 1.00 85.08  ? 717  SER A CA    1 
ATOM   440   C  C     . SER A 1 69  ? -41.493 44.306  -13.054 1.00 87.24  ? 717  SER A C     1 
ATOM   441   O  O     . SER A 1 69  ? -42.241 43.850  -12.186 1.00 87.52  ? 717  SER A O     1 
ATOM   442   C  CB    . SER A 1 69  ? -41.091 42.317  -14.548 1.00 77.33  ? 717  SER A CB    1 
ATOM   443   N  N     . PRO A 1 70  ? -41.551 45.589  -13.448 1.00 86.85  ? 718  PRO A N     1 
ATOM   444   C  CA    . PRO A 1 70  ? -42.612 46.468  -12.943 1.00 83.58  ? 718  PRO A CA    1 
ATOM   445   C  C     . PRO A 1 70  ? -43.976 46.021  -13.459 1.00 77.84  ? 718  PRO A C     1 
ATOM   446   O  O     . PRO A 1 70  ? -44.043 45.315  -14.465 1.00 78.58  ? 718  PRO A O     1 
ATOM   447   C  CB    . PRO A 1 70  ? -42.244 47.838  -13.529 1.00 84.56  ? 718  PRO A CB    1 
ATOM   448   C  CG    . PRO A 1 70  ? -40.778 47.742  -13.853 1.00 83.77  ? 718  PRO A CG    1 
ATOM   449   C  CD    . PRO A 1 70  ? -40.570 46.319  -14.272 1.00 86.78  ? 718  PRO A CD    1 
ATOM   450   N  N     . LYS A 1 71  ? -45.043 46.429  -12.782 1.00 73.61  ? 719  LYS A N     1 
ATOM   451   C  CA    . LYS A 1 71  ? -46.387 46.024  -13.170 1.00 71.95  ? 719  LYS A CA    1 
ATOM   452   C  C     . LYS A 1 71  ? -46.742 46.527  -14.560 1.00 72.83  ? 719  LYS A C     1 
ATOM   453   O  O     . LYS A 1 71  ? -46.514 47.686  -14.886 1.00 77.30  ? 719  LYS A O     1 
ATOM   454   C  CB    . LYS A 1 71  ? -47.411 46.495  -12.142 1.00 73.89  ? 719  LYS A CB    1 
ATOM   455   C  CG    . LYS A 1 71  ? -47.272 45.799  -10.793 1.00 76.61  ? 719  LYS A CG    1 
ATOM   456   C  CD    . LYS A 1 71  ? -47.295 44.277  -10.956 1.00 74.24  ? 719  LYS A CD    1 
ATOM   457   C  CE    . LYS A 1 71  ? -46.989 43.564  -9.642  1.00 71.70  ? 719  LYS A CE    1 
ATOM   458   N  NZ    . LYS A 1 71  ? -46.962 42.082  -9.795  1.00 59.34  ? 719  LYS A NZ    1 
ATOM   459   N  N     . LYS A 1 72  ? -47.305 45.640  -15.373 1.00 73.82  ? 720  LYS A N     1 
ATOM   460   C  CA    . LYS A 1 72  ? -47.529 45.899  -16.797 1.00 72.66  ? 720  LYS A CA    1 
ATOM   461   C  C     . LYS A 1 72  ? -48.443 47.093  -17.081 1.00 74.99  ? 720  LYS A C     1 
ATOM   462   O  O     . LYS A 1 72  ? -48.018 48.072  -17.689 1.00 77.90  ? 720  LYS A O     1 
ATOM   463   C  CB    . LYS A 1 72  ? -48.067 44.645  -17.489 1.00 69.43  ? 720  LYS A CB    1 
ATOM   464   N  N     . LEU A 1 73  ? -49.698 47.009  -16.656 1.00 73.56  ? 721  LEU A N     1 
ATOM   465   C  CA    . LEU A 1 73  ? -50.652 48.078  -16.929 1.00 74.06  ? 721  LEU A CA    1 
ATOM   466   C  C     . LEU A 1 73  ? -50.587 49.144  -15.845 1.00 77.48  ? 721  LEU A C     1 
ATOM   467   O  O     . LEU A 1 73  ? -51.174 50.220  -15.980 1.00 79.19  ? 721  LEU A O     1 
ATOM   468   C  CB    . LEU A 1 73  ? -52.073 47.519  -17.067 1.00 67.93  ? 721  LEU A CB    1 
ATOM   469   C  CG    . LEU A 1 73  ? -52.156 46.292  -17.979 1.00 64.91  ? 721  LEU A CG    1 
ATOM   470   C  CD1   . LEU A 1 73  ? -52.136 45.018  -17.152 1.00 58.34  ? 721  LEU A CD1   1 
ATOM   471   C  CD2   . LEU A 1 73  ? -53.382 46.340  -18.878 1.00 59.24  ? 721  LEU A CD2   1 
ATOM   472   N  N     . HIS A 1 74  ? -49.859 48.841  -14.775 1.00 77.81  ? 722  HIS A N     1 
ATOM   473   C  CA    . HIS A 1 74  ? -49.719 49.768  -13.655 1.00 82.21  ? 722  HIS A CA    1 
ATOM   474   C  C     . HIS A 1 74  ? -48.628 50.807  -13.920 1.00 82.50  ? 722  HIS A C     1 
ATOM   475   O  O     . HIS A 1 74  ? -47.707 50.998  -13.121 1.00 80.89  ? 722  HIS A O     1 
ATOM   476   C  CB    . HIS A 1 74  ? -49.448 49.009  -12.352 1.00 83.01  ? 722  HIS A CB    1 
ATOM   477   N  N     . GLN A 1 75  ? -48.746 51.479  -15.057 1.00 82.51  ? 723  GLN A N     1 
ATOM   478   C  CA    . GLN A 1 75  ? -47.825 52.537  -15.423 1.00 85.06  ? 723  GLN A CA    1 
ATOM   479   C  C     . GLN A 1 75  ? -48.567 53.868  -15.360 1.00 89.99  ? 723  GLN A C     1 
ATOM   480   O  O     . GLN A 1 75  ? -48.088 54.881  -15.876 1.00 92.91  ? 723  GLN A O     1 
ATOM   481   C  CB    . GLN A 1 75  ? -47.297 52.283  -16.834 1.00 85.56  ? 723  GLN A CB    1 
ATOM   482   C  CG    . GLN A 1 75  ? -47.905 51.048  -17.489 1.00 84.00  ? 723  GLN A CG    1 
ATOM   483   C  CD    . GLN A 1 75  ? -47.324 50.755  -18.862 1.00 85.90  ? 723  GLN A CD    1 
ATOM   484   O  OE1   . GLN A 1 75  ? -48.025 50.824  -19.874 1.00 82.84  ? 723  GLN A OE1   1 
ATOM   485   N  NE2   . GLN A 1 75  ? -46.037 50.418  -18.903 1.00 87.03  ? 723  GLN A NE2   1 
ATOM   486   N  N     . GLY A 1 76  ? -49.735 53.854  -14.715 1.00 88.19  ? 724  GLY A N     1 
ATOM   487   C  CA    . GLY A 1 76  ? -50.639 54.992  -14.719 1.00 83.75  ? 724  GLY A CA    1 
ATOM   488   C  C     . GLY A 1 76  ? -50.741 55.551  -16.124 1.00 86.13  ? 724  GLY A C     1 
ATOM   489   O  O     . GLY A 1 76  ? -50.741 54.802  -17.105 1.00 86.31  ? 724  GLY A O     1 
ATOM   490   N  N     . LYS A 1 77  ? -50.826 56.871  -16.229 1.00 88.80  ? 725  LYS A N     1 
ATOM   491   C  CA    . LYS A 1 77  ? -50.711 57.516  -17.525 1.00 85.42  ? 725  LYS A CA    1 
ATOM   492   C  C     . LYS A 1 77  ? -51.679 56.899  -18.537 1.00 81.46  ? 725  LYS A C     1 
ATOM   493   O  O     . LYS A 1 77  ? -51.297 56.051  -19.347 1.00 79.60  ? 725  LYS A O     1 
ATOM   494   C  CB    . LYS A 1 77  ? -49.269 57.385  -18.016 1.00 84.57  ? 725  LYS A CB    1 
ATOM   495   N  N     . LYS A 1 78  ? -52.935 57.329  -18.478 1.00 78.59  ? 726  LYS A N     1 
ATOM   496   C  CA    . LYS A 1 78  ? -53.961 56.812  -19.373 1.00 77.69  ? 726  LYS A CA    1 
ATOM   497   C  C     . LYS A 1 78  ? -54.766 57.954  -19.979 1.00 77.09  ? 726  LYS A C     1 
ATOM   498   O  O     . LYS A 1 78  ? -55.443 58.695  -19.268 1.00 77.14  ? 726  LYS A O     1 
ATOM   499   C  CB    . LYS A 1 78  ? -54.882 55.850  -18.621 1.00 78.18  ? 726  LYS A CB    1 
ATOM   500   C  CG    . LYS A 1 78  ? -54.137 54.732  -17.915 1.00 79.07  ? 726  LYS A CG    1 
ATOM   501   C  CD    . LYS A 1 78  ? -54.966 54.129  -16.802 1.00 74.39  ? 726  LYS A CD    1 
ATOM   502   C  CE    . LYS A 1 78  ? -54.083 53.687  -15.642 1.00 76.24  ? 726  LYS A CE    1 
ATOM   503   N  NZ    . LYS A 1 78  ? -53.076 52.665  -16.035 1.00 74.61  ? 726  LYS A NZ    1 
ATOM   504   N  N     . LYS A 1 79  ? -54.679 58.091  -21.298 1.00 76.58  ? 727  LYS A N     1 
ATOM   505   C  CA    . LYS A 1 79  ? -55.374 59.153  -22.012 1.00 74.78  ? 727  LYS A CA    1 
ATOM   506   C  C     . LYS A 1 79  ? -56.880 59.159  -21.757 1.00 76.29  ? 727  LYS A C     1 
ATOM   507   O  O     . LYS A 1 79  ? -57.600 58.257  -22.185 1.00 75.61  ? 727  LYS A O     1 
ATOM   508   C  CB    . LYS A 1 79  ? -55.109 59.053  -23.515 1.00 72.65  ? 727  LYS A CB    1 
ATOM   509   C  CG    . LYS A 1 79  ? -56.036 59.922  -24.342 1.00 76.22  ? 727  LYS A CG    1 
ATOM   510   C  CD    . LYS A 1 79  ? -55.890 59.682  -25.835 1.00 74.70  ? 727  LYS A CD    1 
ATOM   511   C  CE    . LYS A 1 79  ? -56.937 60.474  -26.613 1.00 72.37  ? 727  LYS A CE    1 
ATOM   512   N  NZ    . LYS A 1 79  ? -56.953 60.142  -28.061 1.00 71.01  ? 727  LYS A NZ    1 
ATOM   513   N  N     . LYS A 1 80  ? -57.349 60.191  -21.060 1.00 83.09  ? 728  LYS A N     1 
ATOM   514   C  CA    . LYS A 1 80  ? -58.777 60.367  -20.800 1.00 84.21  ? 728  LYS A CA    1 
ATOM   515   C  C     . LYS A 1 80  ? -59.485 60.877  -22.050 1.00 82.08  ? 728  LYS A C     1 
ATOM   516   O  O     . LYS A 1 80  ? -59.001 61.792  -22.719 1.00 78.68  ? 728  LYS A O     1 
ATOM   517   C  CB    . LYS A 1 80  ? -59.004 61.339  -19.633 1.00 83.16  ? 728  LYS A CB    1 
ATOM   518   C  CG    . LYS A 1 80  ? -60.474 61.562  -19.271 1.00 82.02  ? 728  LYS A CG    1 
ATOM   519   C  CD    . LYS A 1 80  ? -60.621 62.403  -17.996 1.00 86.71  ? 728  LYS A CD    1 
ATOM   520   C  CE    . LYS A 1 80  ? -62.089 62.680  -17.641 1.00 87.90  ? 728  LYS A CE    1 
ATOM   521   N  NZ    . LYS A 1 80  ? -62.780 63.562  -18.635 1.00 87.34  ? 728  LYS A NZ    1 
ATOM   522   N  N     . GLN A 1 81  ? -60.626 60.276  -22.367 1.00 83.29  ? 729  GLN A N     1 
ATOM   523   C  CA    . GLN A 1 81  ? -61.426 60.724  -23.500 1.00 85.78  ? 729  GLN A CA    1 
ATOM   524   C  C     . GLN A 1 81  ? -62.391 61.823  -23.065 1.00 85.17  ? 729  GLN A C     1 
ATOM   525   O  O     . GLN A 1 81  ? -62.482 62.144  -21.875 1.00 83.90  ? 729  GLN A O     1 
ATOM   526   C  CB    . GLN A 1 81  ? -62.194 59.550  -24.118 1.00 80.94  ? 729  GLN A CB    1 
ATOM   527   C  CG    . GLN A 1 81  ? -61.307 58.484  -24.743 1.00 77.42  ? 729  GLN A CG    1 
ATOM   528   C  CD    . GLN A 1 81  ? -60.568 58.965  -25.987 1.00 83.19  ? 729  GLN A CD    1 
ATOM   529   O  OE1   . GLN A 1 81  ? -60.064 58.153  -26.767 1.00 84.52  ? 729  GLN A OE1   1 
ATOM   530   N  NE2   . GLN A 1 81  ? -60.498 60.284  -26.179 1.00 83.26  ? 729  GLN A NE2   1 
ATOM   531   N  N     . ASN A 1 82  ? -63.099 62.408  -24.030 1.00 83.04  ? 730  ASN A N     1 
ATOM   532   C  CA    . ASN A 1 82  ? -64.169 63.355  -23.720 1.00 80.58  ? 730  ASN A CA    1 
ATOM   533   C  C     . ASN A 1 82  ? -65.533 62.799  -24.108 1.00 78.38  ? 730  ASN A C     1 
ATOM   534   O  O     . ASN A 1 82  ? -65.823 62.590  -25.287 1.00 78.40  ? 730  ASN A O     1 
ATOM   535   C  CB    . ASN A 1 82  ? -63.929 64.710  -24.391 1.00 79.38  ? 730  ASN A CB    1 
ATOM   536   C  CG    . ASN A 1 82  ? -62.847 65.521  -23.701 1.00 77.24  ? 730  ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1 82  ? -62.581 65.342  -22.511 1.00 78.47  ? 730  ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1 82  ? -62.223 66.425  -24.444 1.00 75.14  ? 730  ASN A ND2   1 
ATOM   539   N  N     . LYS A 1 83  ? -66.363 62.545  -23.104 1.00 76.87  ? 731  LYS A N     1 
ATOM   540   C  CA    . LYS A 1 83  ? -67.690 61.994  -23.344 1.00 81.56  ? 731  LYS A CA    1 
ATOM   541   C  C     . LYS A 1 83  ? -68.773 63.016  -22.997 1.00 83.59  ? 731  LYS A C     1 
ATOM   542   O  O     . LYS A 1 83  ? -68.753 63.619  -21.922 1.00 83.59  ? 731  LYS A O     1 
ATOM   543   C  CB    . LYS A 1 83  ? -67.896 60.699  -22.559 1.00 75.89  ? 731  LYS A CB    1 
ATOM   544   N  N     . ASP A 1 84  ? -69.715 63.204  -23.917 1.00 81.19  ? 732  ASP A N     1 
ATOM   545   C  CA    . ASP A 1 84  ? -70.759 64.212  -23.764 1.00 82.55  ? 732  ASP A CA    1 
ATOM   546   C  C     . ASP A 1 84  ? -71.816 63.829  -22.719 1.00 85.82  ? 732  ASP A C     1 
ATOM   547   O  O     . ASP A 1 84  ? -72.126 64.617  -21.819 1.00 85.70  ? 732  ASP A O     1 
ATOM   548   C  CB    . ASP A 1 84  ? -71.415 64.503  -25.116 1.00 81.61  ? 732  ASP A CB    1 
ATOM   549   N  N     . ARG A 1 85  ? -72.369 62.623  -22.838 1.00 83.00  ? 733  ARG A N     1 
ATOM   550   C  CA    . ARG A 1 85  ? -73.430 62.182  -21.930 1.00 79.95  ? 733  ARG A CA    1 
ATOM   551   C  C     . ARG A 1 85  ? -73.168 60.787  -21.350 1.00 79.35  ? 733  ARG A C     1 
ATOM   552   O  O     . ARG A 1 85  ? -72.885 59.839  -22.087 1.00 78.48  ? 733  ARG A O     1 
ATOM   553   C  CB    . ARG A 1 85  ? -74.790 62.222  -22.629 1.00 76.52  ? 733  ARG A CB    1 
ATOM   554   N  N     . ILE A 1 86  ? -73.269 60.671  -20.026 1.00 74.79  ? 734  ILE A N     1 
ATOM   555   C  CA    . ILE A 1 86  ? -73.021 59.406  -19.342 1.00 69.70  ? 734  ILE A CA    1 
ATOM   556   C  C     . ILE A 1 86  ? -74.121 59.093  -18.335 1.00 64.52  ? 734  ILE A C     1 
ATOM   557   O  O     . ILE A 1 86  ? -74.020 59.461  -17.171 1.00 62.69  ? 734  ILE A O     1 
ATOM   558   C  CB    . ILE A 1 86  ? -71.668 59.423  -18.602 1.00 70.90  ? 734  ILE A CB    1 
ATOM   559   C  CG1   . ILE A 1 86  ? -70.595 60.101  -19.454 1.00 71.74  ? 734  ILE A CG1   1 
ATOM   560   C  CG2   . ILE A 1 86  ? -71.240 58.010  -18.237 1.00 72.96  ? 734  ILE A CG2   1 
ATOM   561   C  CD1   . ILE A 1 86  ? -69.308 59.304  -19.565 1.00 69.92  ? 734  ILE A CD1   1 
ATOM   562   N  N     . SER A 1 87  ? -75.161 58.395  -18.784 1.00 65.72  ? 735  SER A N     1 
ATOM   563   C  CA    . SER A 1 87  ? -76.326 58.119  -17.942 1.00 64.27  ? 735  SER A CA    1 
ATOM   564   C  C     . SER A 1 87  ? -76.432 56.661  -17.491 1.00 65.31  ? 735  SER A C     1 
ATOM   565   O  O     . SER A 1 87  ? -76.175 55.741  -18.266 1.00 65.28  ? 735  SER A O     1 
ATOM   566   C  CB    . SER A 1 87  ? -77.607 58.527  -18.668 1.00 62.25  ? 735  SER A CB    1 
ATOM   567   N  N     . TRP A 1 88  ? -76.817 56.455  -16.233 1.00 65.24  ? 736  TRP A N     1 
ATOM   568   C  CA    . TRP A 1 88  ? -77.091 55.111  -15.734 1.00 66.09  ? 736  TRP A CA    1 
ATOM   569   C  C     . TRP A 1 88  ? -78.276 54.516  -16.475 1.00 70.12  ? 736  TRP A C     1 
ATOM   570   O  O     . TRP A 1 88  ? -78.957 55.213  -17.224 1.00 70.80  ? 736  TRP A O     1 
ATOM   571   C  CB    . TRP A 1 88  ? -77.364 55.119  -14.228 1.00 64.47  ? 736  TRP A CB    1 
ATOM   572   C  CG    . TRP A 1 88  ? -76.183 55.535  -13.437 1.00 65.89  ? 736  TRP A CG    1 
ATOM   573   C  CD1   . TRP A 1 88  ? -76.087 56.616  -12.622 1.00 70.75  ? 736  TRP A CD1   1 
ATOM   574   C  CD2   . TRP A 1 88  ? -74.904 54.895  -13.406 1.00 68.79  ? 736  TRP A CD2   1 
ATOM   575   N  NE1   . TRP A 1 88  ? -74.832 56.689  -12.072 1.00 71.66  ? 736  TRP A NE1   1 
ATOM   576   C  CE2   . TRP A 1 88  ? -74.085 55.641  -12.539 1.00 70.78  ? 736  TRP A CE2   1 
ATOM   577   C  CE3   . TRP A 1 88  ? -74.373 53.758  -14.023 1.00 67.26  ? 736  TRP A CE3   1 
ATOM   578   C  CZ2   . TRP A 1 88  ? -72.765 55.289  -12.270 1.00 72.24  ? 736  TRP A CZ2   1 
ATOM   579   C  CZ3   . TRP A 1 88  ? -73.064 53.410  -13.757 1.00 65.45  ? 736  TRP A CZ3   1 
ATOM   580   C  CH2   . TRP A 1 88  ? -72.274 54.171  -12.888 1.00 69.03  ? 736  TRP A CH2   1 
ATOM   581   N  N     . LEU A 1 89  ? -78.520 53.226  -16.263 1.00 70.53  ? 737  LEU A N     1 
ATOM   582   C  CA    . LEU A 1 89  ? -79.622 52.535  -16.921 1.00 68.70  ? 737  LEU A CA    1 
ATOM   583   C  C     . LEU A 1 89  ? -80.262 51.505  -16.001 1.00 70.64  ? 737  LEU A C     1 
ATOM   584   O  O     . LEU A 1 89  ? -79.570 50.714  -15.363 1.00 73.07  ? 737  LEU A O     1 
ATOM   585   C  CB    . LEU A 1 89  ? -79.136 51.871  -18.209 1.00 68.37  ? 737  LEU A CB    1 
ATOM   586   C  CG    . LEU A 1 89  ? -79.223 52.742  -19.464 1.00 68.30  ? 737  LEU A CG    1 
ATOM   587   C  CD1   . LEU A 1 89  ? -78.144 52.379  -20.466 1.00 68.85  ? 737  LEU A CD1   1 
ATOM   588   C  CD2   . LEU A 1 89  ? -80.607 52.631  -20.088 1.00 70.06  ? 737  LEU A CD2   1 
ATOM   589   N  N     . GLY A 1 90  ? -81.589 51.520  -15.935 1.00 72.56  ? 738  GLY A N     1 
ATOM   590   C  CA    . GLY A 1 90  ? -82.316 50.609  -15.068 1.00 78.32  ? 738  GLY A CA    1 
ATOM   591   C  C     . GLY A 1 90  ? -82.160 51.000  -13.612 1.00 79.70  ? 738  GLY A C     1 
ATOM   592   O  O     . GLY A 1 90  ? -81.635 52.068  -13.304 1.00 81.94  ? 738  GLY A O     1 
ATOM   593   N  N     . GLN A 1 91  ? -82.616 50.144  -12.707 1.00 77.78  ? 739  GLN A N     1 
ATOM   594   C  CA    . GLN A 1 91  ? -82.491 50.444  -11.286 1.00 80.83  ? 739  GLN A CA    1 
ATOM   595   C  C     . GLN A 1 91  ? -81.148 49.973  -10.732 1.00 80.27  ? 739  GLN A C     1 
ATOM   596   O  O     . GLN A 1 91  ? -80.516 49.080  -11.301 1.00 79.58  ? 739  GLN A O     1 
ATOM   597   C  CB    . GLN A 1 91  ? -83.664 49.854  -10.489 1.00 82.47  ? 739  GLN A CB    1 
ATOM   598   C  CG    . GLN A 1 91  ? -84.945 50.698  -10.543 1.00 84.39  ? 739  GLN A CG    1 
ATOM   599   C  CD    . GLN A 1 91  ? -84.803 52.061  -9.853  1.00 83.90  ? 739  GLN A CD    1 
ATOM   600   O  OE1   . GLN A 1 91  ? -84.601 52.139  -8.640  1.00 79.88  ? 739  GLN A OE1   1 
ATOM   601   N  NE2   . GLN A 1 91  ? -84.914 53.138  -10.631 1.00 80.96  ? 739  GLN A NE2   1 
ATOM   602   N  N     . PRO A 1 92  ? -80.695 50.598  -9.633  1.00 80.45  ? 740  PRO A N     1 
ATOM   603   C  CA    . PRO A 1 92  ? -79.447 50.216  -8.964  1.00 78.88  ? 740  PRO A CA    1 
ATOM   604   C  C     . PRO A 1 92  ? -79.455 48.757  -8.523  1.00 75.13  ? 740  PRO A C     1 
ATOM   605   O  O     . PRO A 1 92  ? -80.470 48.278  -8.022  1.00 74.09  ? 740  PRO A O     1 
ATOM   606   C  CB    . PRO A 1 92  ? -79.420 51.131  -7.736  1.00 75.67  ? 740  PRO A CB    1 
ATOM   607   C  CG    . PRO A 1 92  ? -80.189 52.323  -8.150  1.00 75.98  ? 740  PRO A CG    1 
ATOM   608   C  CD    . PRO A 1 92  ? -81.292 51.802  -9.027  1.00 78.14  ? 740  PRO A CD    1 
ATOM   609   N  N     . MET A 1 93  ? -78.336 48.065  -8.720  1.00 75.40  ? 741  MET A N     1 
ATOM   610   C  CA    . MET A 1 93  ? -78.172 46.708  -8.212  1.00 72.41  ? 741  MET A CA    1 
ATOM   611   C  C     . MET A 1 93  ? -78.109 46.736  -6.694  1.00 69.91  ? 741  MET A C     1 
ATOM   612   O  O     . MET A 1 93  ? -78.866 46.040  -6.025  1.00 71.73  ? 741  MET A O     1 
ATOM   613   C  CB    . MET A 1 93  ? -76.894 46.059  -8.755  1.00 71.00  ? 741  MET A CB    1 
ATOM   614   C  CG    . MET A 1 93  ? -76.887 45.795  -10.248 1.00 71.42  ? 741  MET A CG    1 
ATOM   615   S  SD    . MET A 1 93  ? -75.619 44.591  -10.711 1.00 83.49  ? 741  MET A SD    1 
ATOM   616   C  CE    . MET A 1 93  ? -74.212 45.195  -9.781  1.00 72.49  ? 741  MET A CE    1 
ATOM   617   N  N     . LYS A 1 94  ? -77.199 47.541  -6.154  1.00 69.23  ? 742  LYS A N     1 
ATOM   618   C  CA    . LYS A 1 94  ? -77.019 47.624  -4.708  1.00 70.62  ? 742  LYS A CA    1 
ATOM   619   C  C     . LYS A 1 94  ? -76.574 48.999  -4.225  1.00 73.36  ? 742  LYS A C     1 
ATOM   620   O  O     . LYS A 1 94  ? -75.878 49.728  -4.933  1.00 72.06  ? 742  LYS A O     1 
ATOM   621   C  CB    . LYS A 1 94  ? -76.031 46.562  -4.218  1.00 70.77  ? 742  LYS A CB    1 
ATOM   622   C  CG    . LYS A 1 94  ? -75.496 46.821  -2.812  1.00 71.43  ? 742  LYS A CG    1 
ATOM   623   C  CD    . LYS A 1 94  ? -75.131 45.535  -2.086  1.00 73.07  ? 742  LYS A CD    1 
ATOM   624   C  CE    . LYS A 1 94  ? -74.622 45.824  -0.680  1.00 71.81  ? 742  LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1 94  ? -74.250 44.582  0.053   1.00 73.29  ? 742  LYS A NZ    1 
ATOM   626   N  N     . ILE A 1 95  ? -76.983 49.335  -3.004  1.00 74.44  ? 743  ILE A N     1 
ATOM   627   C  CA    . ILE A 1 95  ? -76.599 50.584  -2.361  1.00 74.63  ? 743  ILE A CA    1 
ATOM   628   C  C     . ILE A 1 95  ? -75.778 50.326  -1.106  1.00 76.33  ? 743  ILE A C     1 
ATOM   629   O  O     . ILE A 1 95  ? -76.242 49.675  -0.167  1.00 73.25  ? 743  ILE A O     1 
ATOM   630   C  CB    . ILE A 1 95  ? -77.828 51.416  -1.971  1.00 74.74  ? 743  ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1 95  ? -78.534 51.936  -3.225  1.00 74.30  ? 743  ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1 95  ? -77.417 52.569  -1.065  1.00 76.64  ? 743  ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1 95  ? -79.872 52.570  -2.949  1.00 72.85  ? 743  ILE A CD1   1 
ATOM   634   N  N     . GLU A 1 96  ? -74.554 50.846  -1.101  1.00 80.42  ? 744  GLU A N     1 
ATOM   635   C  CA    . GLU A 1 96  ? -73.663 50.724  0.044   1.00 80.39  ? 744  GLU A CA    1 
ATOM   636   C  C     . GLU A 1 96  ? -73.605 52.032  0.820   1.00 82.58  ? 744  GLU A C     1 
ATOM   637   O  O     . GLU A 1 96  ? -74.198 53.040  0.418   1.00 79.57  ? 744  GLU A O     1 
ATOM   638   C  CB    . GLU A 1 96  ? -72.254 50.326  -0.405  1.00 80.13  ? 744  GLU A CB    1 
ATOM   639   C  CG    . GLU A 1 96  ? -72.162 48.933  -1.010  1.00 80.34  ? 744  GLU A CG    1 
ATOM   640   C  CD    . GLU A 1 96  ? -70.739 48.542  -1.381  1.00 80.47  ? 744  GLU A CD    1 
ATOM   641   O  OE1   . GLU A 1 96  ? -69.818 49.377  -1.212  1.00 79.51  ? 744  GLU A OE1   1 
ATOM   642   O  OE2   . GLU A 1 96  ? -70.547 47.396  -1.842  1.00 77.30  ? 744  GLU A OE2   1 
ATOM   643   N  N     . GLU A 1 97  ? -72.882 52.004  1.935   1.00 83.17  ? 745  GLU A N     1 
ATOM   644   C  CA    . GLU A 1 97  ? -72.708 53.181  2.775   1.00 85.98  ? 745  GLU A CA    1 
ATOM   645   C  C     . GLU A 1 97  ? -72.163 54.372  1.985   1.00 86.81  ? 745  GLU A C     1 
ATOM   646   O  O     . GLU A 1 97  ? -72.654 55.496  2.124   1.00 86.67  ? 745  GLU A O     1 
ATOM   647   C  CB    . GLU A 1 97  ? -71.777 52.861  3.949   1.00 82.02  ? 745  GLU A CB    1 
ATOM   648   N  N     . ASN A 1 98  ? -71.164 54.120  1.142   1.00 83.53  ? 746  ASN A N     1 
ATOM   649   C  CA    . ASN A 1 98  ? -70.394 55.201  0.533   1.00 82.64  ? 746  ASN A CA    1 
ATOM   650   C  C     . ASN A 1 98  ? -70.517 55.314  -0.987  1.00 83.16  ? 746  ASN A C     1 
ATOM   651   O  O     . ASN A 1 98  ? -69.892 56.181  -1.603  1.00 84.13  ? 746  ASN A O     1 
ATOM   652   C  CB    . ASN A 1 98  ? -68.918 55.078  0.930   1.00 85.98  ? 746  ASN A CB    1 
ATOM   653   C  CG    . ASN A 1 98  ? -68.730 54.850  2.426   1.00 89.98  ? 746  ASN A CG    1 
ATOM   654   O  OD1   . ASN A 1 98  ? -68.870 55.773  3.233   1.00 87.63  ? 746  ASN A OD1   1 
ATOM   655   N  ND2   . ASN A 1 98  ? -68.404 53.615  2.799   1.00 90.12  ? 746  ASN A ND2   1 
ATOM   656   N  N     . ARG A 1 99  ? -71.317 54.440  -1.592  1.00 83.17  ? 747  ARG A N     1 
ATOM   657   C  CA    . ARG A 1 99  ? -71.486 54.446  -3.047  1.00 80.27  ? 747  ARG A CA    1 
ATOM   658   C  C     . ARG A 1 99  ? -72.696 53.622  -3.497  1.00 76.56  ? 747  ARG A C     1 
ATOM   659   O  O     . ARG A 1 99  ? -73.310 52.909  -2.704  1.00 76.79  ? 747  ARG A O     1 
ATOM   660   C  CB    . ARG A 1 99  ? -70.205 53.972  -3.746  1.00 79.31  ? 747  ARG A CB    1 
ATOM   661   C  CG    . ARG A 1 99  ? -69.751 52.576  -3.335  1.00 79.46  ? 747  ARG A CG    1 
ATOM   662   C  CD    . ARG A 1 99  ? -68.341 52.259  -3.823  1.00 79.70  ? 747  ARG A CD    1 
ATOM   663   N  NE    . ARG A 1 99  ? -67.329 53.068  -3.148  1.00 85.29  ? 747  ARG A NE    1 
ATOM   664   C  CZ    . ARG A 1 99  ? -66.038 52.756  -3.086  1.00 89.70  ? 747  ARG A CZ    1 
ATOM   665   N  NH1   . ARG A 1 99  ? -65.594 51.639  -3.653  1.00 86.79  ? 747  ARG A NH1   1 
ATOM   666   N  NH2   . ARG A 1 99  ? -65.190 53.556  -2.448  1.00 88.50  ? 747  ARG A NH2   1 
ATOM   667   N  N     . THR A 1 100 ? -73.035 53.732  -4.775  1.00 73.66  ? 748  THR A N     1 
ATOM   668   C  CA    . THR A 1 100 ? -74.237 53.099  -5.310  1.00 74.69  ? 748  THR A CA    1 
ATOM   669   C  C     . THR A 1 100 ? -73.933 52.384  -6.634  1.00 72.72  ? 748  THR A C     1 
ATOM   670   O  O     . THR A 1 100 ? -73.509 53.007  -7.609  1.00 71.49  ? 748  THR A O     1 
ATOM   671   C  CB    . THR A 1 100 ? -75.388 54.139  -5.464  1.00 75.78  ? 748  THR A CB    1 
ATOM   672   O  OG1   . THR A 1 100 ? -76.496 53.559  -6.164  1.00 73.64  ? 748  THR A OG1   1 
ATOM   673   C  CG2   . THR A 1 100 ? -74.906 55.375  -6.219  1.00 78.57  ? 748  THR A CG2   1 
ATOM   674   N  N     . TYR A 1 101 ? -74.146 51.070  -6.654  1.00 70.80  ? 749  TYR A N     1 
ATOM   675   C  CA    . TYR A 1 101 ? -73.729 50.238  -7.782  1.00 69.90  ? 749  TYR A CA    1 
ATOM   676   C  C     . TYR A 1 101 ? -74.832 49.983  -8.807  1.00 68.43  ? 749  TYR A C     1 
ATOM   677   O  O     . TYR A 1 101 ? -75.948 49.615  -8.449  1.00 68.91  ? 749  TYR A O     1 
ATOM   678   C  CB    . TYR A 1 101 ? -73.167 48.901  -7.282  1.00 69.36  ? 749  TYR A CB    1 
ATOM   679   C  CG    . TYR A 1 101 ? -71.828 49.007  -6.576  1.00 70.03  ? 749  TYR A CG    1 
ATOM   680   C  CD1   . TYR A 1 101 ? -70.661 49.252  -7.289  1.00 69.21  ? 749  TYR A CD1   1 
ATOM   681   C  CD2   . TYR A 1 101 ? -71.729 48.849  -5.198  1.00 72.15  ? 749  TYR A CD2   1 
ATOM   682   C  CE1   . TYR A 1 101 ? -69.429 49.351  -6.648  1.00 71.50  ? 749  TYR A CE1   1 
ATOM   683   C  CE2   . TYR A 1 101 ? -70.501 48.942  -4.548  1.00 73.95  ? 749  TYR A CE2   1 
ATOM   684   C  CZ    . TYR A 1 101 ? -69.354 49.192  -5.277  1.00 74.37  ? 749  TYR A CZ    1 
ATOM   685   O  OH    . TYR A 1 101 ? -68.136 49.284  -4.630  1.00 75.68  ? 749  TYR A OH    1 
ATOM   686   N  N     . TYR A 1 102 ? -74.501 50.175  -10.082 1.00 65.88  ? 750  TYR A N     1 
ATOM   687   C  CA    . TYR A 1 102 ? -75.413 49.864  -11.179 1.00 66.74  ? 750  TYR A CA    1 
ATOM   688   C  C     . TYR A 1 102 ? -74.881 48.705  -12.023 1.00 68.50  ? 750  TYR A C     1 
ATOM   689   O  O     . TYR A 1 102 ? -73.820 48.151  -11.743 1.00 68.53  ? 750  TYR A O     1 
ATOM   690   C  CB    . TYR A 1 102 ? -75.635 51.088  -12.069 1.00 66.47  ? 750  TYR A CB    1 
ATOM   691   C  CG    . TYR A 1 102 ? -76.211 52.288  -11.346 1.00 72.52  ? 750  TYR A CG    1 
ATOM   692   C  CD1   . TYR A 1 102 ? -75.379 53.200  -10.706 1.00 71.04  ? 750  TYR A CD1   1 
ATOM   693   C  CD2   . TYR A 1 102 ? -77.585 52.512  -11.307 1.00 72.86  ? 750  TYR A CD2   1 
ATOM   694   C  CE1   . TYR A 1 102 ? -75.894 54.295  -10.049 1.00 71.81  ? 750  TYR A CE1   1 
ATOM   695   C  CE2   . TYR A 1 102 ? -78.111 53.605  -10.647 1.00 71.91  ? 750  TYR A CE2   1 
ATOM   696   C  CZ    . TYR A 1 102 ? -77.260 54.496  -10.020 1.00 75.63  ? 750  TYR A CZ    1 
ATOM   697   O  OH    . TYR A 1 102 ? -77.768 55.597  -9.359  1.00 76.32  ? 750  TYR A OH    1 
ATOM   698   N  N     . GLN A 1 103 ? -75.623 48.345  -13.061 1.00 67.92  ? 751  GLN A N     1 
ATOM   699   C  CA    . GLN A 1 103 ? -75.234 47.244  -13.927 1.00 63.47  ? 751  GLN A CA    1 
ATOM   700   C  C     . GLN A 1 103 ? -75.067 47.710  -15.365 1.00 64.63  ? 751  GLN A C     1 
ATOM   701   O  O     . GLN A 1 103 ? -74.230 47.197  -16.107 1.00 64.50  ? 751  GLN A O     1 
ATOM   702   C  CB    . GLN A 1 103 ? -76.285 46.144  -13.873 1.00 65.29  ? 751  GLN A CB    1 
ATOM   703   C  CG    . GLN A 1 103 ? -76.101 45.073  -14.928 1.00 67.70  ? 751  GLN A CG    1 
ATOM   704   C  CD    . GLN A 1 103 ? -77.199 44.044  -14.887 1.00 70.47  ? 751  GLN A CD    1 
ATOM   705   O  OE1   . GLN A 1 103 ? -78.299 44.271  -15.399 1.00 70.15  ? 751  GLN A OE1   1 
ATOM   706   N  NE2   . GLN A 1 103 ? -76.918 42.905  -14.262 1.00 70.32  ? 751  GLN A NE2   1 
ATOM   707   N  N     . LYS A 1 104 ? -75.877 48.682  -15.756 1.00 63.37  ? 752  LYS A N     1 
ATOM   708   C  CA    . LYS A 1 104 ? -75.850 49.180  -17.117 1.00 63.99  ? 752  LYS A CA    1 
ATOM   709   C  C     . LYS A 1 104 ? -75.602 50.683  -17.129 1.00 67.21  ? 752  LYS A C     1 
ATOM   710   O  O     . LYS A 1 104 ? -76.108 51.412  -16.275 1.00 68.18  ? 752  LYS A O     1 
ATOM   711   C  CB    . LYS A 1 104 ? -77.163 48.839  -17.823 1.00 66.93  ? 752  LYS A CB    1 
ATOM   712   C  CG    . LYS A 1 104 ? -77.520 47.358  -17.762 1.00 71.88  ? 752  LYS A CG    1 
ATOM   713   C  CD    . LYS A 1 104 ? -78.682 47.003  -18.686 1.00 73.12  ? 752  LYS A CD    1 
ATOM   714   C  CE    . LYS A 1 104 ? -78.854 45.495  -18.803 1.00 70.14  ? 752  LYS A CE    1 
ATOM   715   N  NZ    . LYS A 1 104 ? -79.881 45.154  -19.819 1.00 70.36  ? 752  LYS A NZ    1 
ATOM   716   N  N     . VAL A 1 105 ? -74.805 51.141  -18.089 1.00 66.68  ? 753  VAL A N     1 
ATOM   717   C  CA    . VAL A 1 105 ? -74.550 52.565  -18.262 1.00 65.41  ? 753  VAL A CA    1 
ATOM   718   C  C     . VAL A 1 105 ? -74.413 52.876  -19.743 1.00 67.50  ? 753  VAL A C     1 
ATOM   719   O  O     . VAL A 1 105 ? -73.844 52.087  -20.492 1.00 66.64  ? 753  VAL A O     1 
ATOM   720   C  CB    . VAL A 1 105 ? -73.273 53.015  -17.532 1.00 62.33  ? 753  VAL A CB    1 
ATOM   721   C  CG1   . VAL A 1 105 ? -72.046 52.479  -18.234 1.00 61.60  ? 753  VAL A CG1   1 
ATOM   722   C  CG2   . VAL A 1 105 ? -73.218 54.529  -17.459 1.00 65.65  ? 753  VAL A CG2   1 
ATOM   723   N  N     . SER A 1 106 ? -74.947 54.018  -20.167 1.00 70.36  ? 754  SER A N     1 
ATOM   724   C  CA    . SER A 1 106 ? -74.846 54.430  -21.568 1.00 72.77  ? 754  SER A CA    1 
ATOM   725   C  C     . SER A 1 106 ? -73.938 55.650  -21.760 1.00 77.63  ? 754  SER A C     1 
ATOM   726   O  O     . SER A 1 106 ? -74.124 56.692  -21.123 1.00 76.09  ? 754  SER A O     1 
ATOM   727   C  CB    . SER A 1 106 ? -76.231 54.680  -22.175 1.00 71.37  ? 754  SER A CB    1 
ATOM   728   O  OG    . SER A 1 106 ? -76.870 55.783  -21.565 1.00 67.40  ? 754  SER A OG    1 
ATOM   729   N  N     . ILE A 1 107 ? -72.964 55.509  -22.654 1.00 78.41  ? 755  ILE A N     1 
ATOM   730   C  CA    . ILE A 1 107 ? -71.936 56.519  -22.860 1.00 78.72  ? 755  ILE A CA    1 
ATOM   731   C  C     . ILE A 1 107 ? -71.914 57.014  -24.300 1.00 82.38  ? 755  ILE A C     1 
ATOM   732   O  O     . ILE A 1 107 ? -71.477 56.300  -25.199 1.00 83.41  ? 755  ILE A O     1 
ATOM   733   C  CB    . ILE A 1 107 ? -70.552 55.951  -22.513 1.00 74.51  ? 755  ILE A CB    1 
ATOM   734   C  CG1   . ILE A 1 107 ? -70.509 55.567  -21.037 1.00 73.07  ? 755  ILE A CG1   1 
ATOM   735   C  CG2   . ILE A 1 107 ? -69.459 56.949  -22.853 1.00 75.84  ? 755  ILE A CG2   1 
ATOM   736   C  CD1   . ILE A 1 107 ? -69.149 55.122  -20.562 1.00 74.34  ? 755  ILE A CD1   1 
ATOM   737   N  N     . ASP A 1 108 ? -72.371 58.244  -24.512 1.00 83.69  ? 756  ASP A N     1 
ATOM   738   C  CA    . ASP A 1 108 ? -72.424 58.810  -25.856 1.00 85.77  ? 756  ASP A CA    1 
ATOM   739   C  C     . ASP A 1 108 ? -73.256 57.910  -26.750 1.00 90.37  ? 756  ASP A C     1 
ATOM   740   O  O     . ASP A 1 108 ? -72.818 57.519  -27.833 1.00 92.41  ? 756  ASP A O     1 
ATOM   741   C  CB    . ASP A 1 108 ? -71.017 58.963  -26.440 1.00 85.57  ? 756  ASP A CB    1 
ATOM   742   C  CG    . ASP A 1 108 ? -70.293 60.191  -25.914 1.00 86.49  ? 756  ASP A CG    1 
ATOM   743   O  OD1   . ASP A 1 108 ? -70.776 60.802  -24.933 1.00 85.95  ? 756  ASP A OD1   1 
ATOM   744   O  OD2   . ASP A 1 108 ? -69.236 60.543  -26.485 1.00 85.96  ? 756  ASP A OD2   1 
ATOM   745   N  N     . GLU A 1 109 ? -74.451 57.572  -26.276 1.00 92.26  ? 757  GLU A N     1 
ATOM   746   C  CA    . GLU A 1 109 ? -75.358 56.682  -26.997 1.00 95.26  ? 757  GLU A CA    1 
ATOM   747   C  C     . GLU A 1 109 ? -74.878 55.229  -26.996 1.00 94.05  ? 757  GLU A C     1 
ATOM   748   O  O     . GLU A 1 109 ? -75.486 54.369  -27.633 1.00 99.55  ? 757  GLU A O     1 
ATOM   749   C  CB    . GLU A 1 109 ? -75.575 57.169  -28.437 1.00 93.66  ? 757  GLU A CB    1 
ATOM   750   N  N     . GLU A 1 110 ? -73.792 54.949  -26.284 1.00 89.27  ? 758  GLU A N     1 
ATOM   751   C  CA    . GLU A 1 110 ? -73.249 53.593  -26.268 1.00 87.07  ? 758  GLU A CA    1 
ATOM   752   C  C     . GLU A 1 110 ? -73.550 52.912  -24.954 1.00 83.11  ? 758  GLU A C     1 
ATOM   753   O  O     . GLU A 1 110 ? -73.252 53.448  -23.888 1.00 82.58  ? 758  GLU A O     1 
ATOM   754   C  CB    . GLU A 1 110 ? -71.740 53.609  -26.488 1.00 88.65  ? 758  GLU A CB    1 
ATOM   755   C  CG    . GLU A 1 110 ? -71.307 54.485  -27.634 1.00 91.60  ? 758  GLU A CG    1 
ATOM   756   C  CD    . GLU A 1 110 ? -71.899 54.044  -28.958 1.00 97.63  ? 758  GLU A CD    1 
ATOM   757   O  OE1   . GLU A 1 110 ? -71.573 54.682  -29.981 1.00 100.31 ? 758  GLU A OE1   1 
ATOM   758   O  OE2   . GLU A 1 110 ? -72.680 53.063  -28.982 1.00 96.89  ? 758  GLU A OE2   1 
ATOM   759   N  N     . MET A 1 111 ? -74.128 51.721  -25.023 1.00 77.40  ? 759  MET A N     1 
ATOM   760   C  CA    . MET A 1 111 ? -74.497 51.021  -23.806 1.00 70.79  ? 759  MET A CA    1 
ATOM   761   C  C     . MET A 1 111 ? -73.400 50.050  -23.388 1.00 66.83  ? 759  MET A C     1 
ATOM   762   O  O     . MET A 1 111 ? -72.848 49.344  -24.226 1.00 68.91  ? 759  MET A O     1 
ATOM   763   C  CB    . MET A 1 111 ? -75.831 50.307  -23.996 1.00 67.58  ? 759  MET A CB    1 
ATOM   764   C  CG    . MET A 1 111 ? -76.364 49.652  -22.750 1.00 69.57  ? 759  MET A CG    1 
ATOM   765   S  SD    . MET A 1 111 ? -75.642 48.019  -22.506 1.00 78.93  ? 759  MET A SD    1 
ATOM   766   C  CE    . MET A 1 111 ? -76.397 47.545  -20.958 1.00 66.60  ? 759  MET A CE    1 
ATOM   767   N  N     . LEU A 1 112 ? -73.068 50.041  -22.099 1.00 64.23  ? 760  LEU A N     1 
ATOM   768   C  CA    . LEU A 1 112 ? -72.120 49.075  -21.544 1.00 63.42  ? 760  LEU A CA    1 
ATOM   769   C  C     . LEU A 1 112 ? -72.738 48.379  -20.329 1.00 63.64  ? 760  LEU A C     1 
ATOM   770   O  O     . LEU A 1 112 ? -73.748 48.840  -19.795 1.00 64.60  ? 760  LEU A O     1 
ATOM   771   C  CB    . LEU A 1 112 ? -70.788 49.736  -21.178 1.00 59.35  ? 760  LEU A CB    1 
ATOM   772   N  N     . GLU A 1 113 ? -72.137 47.268  -19.908 1.00 62.54  ? 761  GLU A N     1 
ATOM   773   C  CA    . GLU A 1 113 ? -72.665 46.448  -18.819 1.00 61.18  ? 761  GLU A CA    1 
ATOM   774   C  C     . GLU A 1 113 ? -71.509 45.778  -18.071 1.00 57.99  ? 761  GLU A C     1 
ATOM   775   O  O     . GLU A 1 113 ? -70.421 45.634  -18.623 1.00 55.55  ? 761  GLU A O     1 
ATOM   776   C  CB    . GLU A 1 113 ? -73.615 45.383  -19.382 1.00 61.00  ? 761  GLU A CB    1 
ATOM   777   C  CG    . GLU A 1 113 ? -74.416 44.626  -18.325 1.00 65.03  ? 761  GLU A CG    1 
ATOM   778   C  CD    . GLU A 1 113 ? -75.208 43.453  -18.891 1.00 65.78  ? 761  GLU A CD    1 
ATOM   779   O  OE1   . GLU A 1 113 ? -75.358 43.368  -20.133 1.00 62.48  ? 761  GLU A OE1   1 
ATOM   780   O  OE2   . GLU A 1 113 ? -75.677 42.616  -18.084 1.00 65.25  ? 761  GLU A OE2   1 
ATOM   781   N  N     . VAL A 1 114 ? -71.729 45.376  -16.820 1.00 55.35  ? 762  VAL A N     1 
ATOM   782   C  CA    . VAL A 1 114 ? -70.698 44.633  -16.100 1.00 56.19  ? 762  VAL A CA    1 
ATOM   783   C  C     . VAL A 1 114 ? -70.460 43.298  -16.809 1.00 58.10  ? 762  VAL A C     1 
ATOM   784   O  O     . VAL A 1 114 ? -71.413 42.586  -17.143 1.00 59.89  ? 762  VAL A O     1 
ATOM   785   C  CB    . VAL A 1 114 ? -71.052 44.395  -14.608 1.00 54.12  ? 762  VAL A CB    1 
ATOM   786   C  CG1   . VAL A 1 114 ? -71.624 45.649  -13.991 1.00 56.09  ? 762  VAL A CG1   1 
ATOM   787   C  CG2   . VAL A 1 114 ? -72.010 43.231  -14.451 1.00 57.29  ? 762  VAL A CG2   1 
ATOM   788   N  N     . GLY A 1 115 ? -69.194 42.972  -17.053 1.00 53.45  ? 763  GLY A N     1 
ATOM   789   C  CA    . GLY A 1 115 ? -68.854 41.770  -17.783 1.00 52.34  ? 763  GLY A CA    1 
ATOM   790   C  C     . GLY A 1 115 ? -68.386 42.090  -19.184 1.00 53.61  ? 763  GLY A C     1 
ATOM   791   O  O     . GLY A 1 115 ? -67.622 41.331  -19.779 1.00 57.99  ? 763  GLY A O     1 
ATOM   792   N  N     . ASP A 1 116 ? -68.851 43.212  -19.720 1.00 53.51  ? 764  ASP A N     1 
ATOM   793   C  CA    . ASP A 1 116 ? -68.343 43.715  -20.995 1.00 55.79  ? 764  ASP A CA    1 
ATOM   794   C  C     . ASP A 1 116 ? -66.843 43.979  -20.896 1.00 50.82  ? 764  ASP A C     1 
ATOM   795   O  O     . ASP A 1 116 ? -66.305 44.155  -19.800 1.00 49.84  ? 764  ASP A O     1 
ATOM   796   C  CB    . ASP A 1 116 ? -69.058 45.016  -21.396 1.00 60.72  ? 764  ASP A CB    1 
ATOM   797   C  CG    . ASP A 1 116 ? -70.238 44.787  -22.339 1.00 63.81  ? 764  ASP A CG    1 
ATOM   798   O  OD1   . ASP A 1 116 ? -70.365 43.664  -22.877 1.00 67.41  ? 764  ASP A OD1   1 
ATOM   799   O  OD2   . ASP A 1 116 ? -71.026 45.741  -22.558 1.00 58.22  ? 764  ASP A OD2   1 
ATOM   800   N  N     . CYS A 1 117 ? -66.181 44.012  -22.049 1.00 47.23  ? 765  CYS A N     1 
ATOM   801   C  CA    . CYS A 1 117 ? -64.765 44.337  -22.130 1.00 47.50  ? 765  CYS A CA    1 
ATOM   802   C  C     . CYS A 1 117 ? -64.570 45.626  -22.910 1.00 52.11  ? 765  CYS A C     1 
ATOM   803   O  O     . CYS A 1 117 ? -65.146 45.808  -23.981 1.00 52.14  ? 765  CYS A O     1 
ATOM   804   C  CB    . CYS A 1 117 ? -63.985 43.205  -22.795 1.00 48.88  ? 765  CYS A CB    1 
ATOM   805   S  SG    . CYS A 1 117 ? -63.677 41.785  -21.722 1.00 51.80  ? 765  CYS A SG    1 
ATOM   806   N  N     . VAL A 1 118 ? -63.749 46.518  -22.362 1.00 54.09  ? 766  VAL A N     1 
ATOM   807   C  CA    . VAL A 1 118 ? -63.533 47.846  -22.931 1.00 54.11  ? 766  VAL A CA    1 
ATOM   808   C  C     . VAL A 1 118 ? -62.057 48.082  -23.241 1.00 55.31  ? 766  VAL A C     1 
ATOM   809   O  O     . VAL A 1 118 ? -61.183 47.503  -22.598 1.00 56.51  ? 766  VAL A O     1 
ATOM   810   C  CB    . VAL A 1 118 ? -64.006 48.948  -21.955 1.00 49.43  ? 766  VAL A CB    1 
ATOM   811   N  N     . SER A 1 119 ? -61.777 48.926  -24.231 1.00 55.78  ? 767  SER A N     1 
ATOM   812   C  CA    . SER A 1 119 ? -60.405 49.332  -24.514 1.00 55.87  ? 767  SER A CA    1 
ATOM   813   C  C     . SER A 1 119 ? -60.129 50.691  -23.884 1.00 58.78  ? 767  SER A C     1 
ATOM   814   O  O     . SER A 1 119 ? -61.049 51.447  -23.587 1.00 60.74  ? 767  SER A O     1 
ATOM   815   C  CB    . SER A 1 119 ? -60.148 49.387  -26.018 1.00 58.52  ? 767  SER A CB    1 
ATOM   816   O  OG    . SER A 1 119 ? -61.016 50.315  -26.637 1.00 62.31  ? 767  SER A OG    1 
ATOM   817   N  N     . VAL A 1 120 ? -58.854 50.989  -23.676 1.00 58.96  ? 768  VAL A N     1 
ATOM   818   C  CA    . VAL A 1 120 ? -58.442 52.226  -23.034 1.00 60.33  ? 768  VAL A CA    1 
ATOM   819   C  C     . VAL A 1 120 ? -57.175 52.731  -23.727 1.00 67.27  ? 768  VAL A C     1 
ATOM   820   O  O     . VAL A 1 120 ? -56.457 51.950  -24.353 1.00 65.98  ? 768  VAL A O     1 
ATOM   821   C  CB    . VAL A 1 120 ? -58.229 52.014  -21.520 1.00 53.71  ? 768  VAL A CB    1 
ATOM   822   C  CG1   . VAL A 1 120 ? -57.569 53.212  -20.887 1.00 59.88  ? 768  VAL A CG1   1 
ATOM   823   C  CG2   . VAL A 1 120 ? -59.554 51.734  -20.849 1.00 49.74  ? 768  VAL A CG2   1 
ATOM   824   N  N     . ILE A 1 121 ? -56.915 54.034  -23.655 1.00 70.83  ? 769  ILE A N     1 
ATOM   825   C  CA    . ILE A 1 121 ? -55.771 54.596  -24.358 1.00 66.57  ? 769  ILE A CA    1 
ATOM   826   C  C     . ILE A 1 121 ? -54.669 54.969  -23.399 1.00 68.70  ? 769  ILE A C     1 
ATOM   827   O  O     . ILE A 1 121 ? -54.890 55.704  -22.441 1.00 70.28  ? 769  ILE A O     1 
ATOM   828   C  CB    . ILE A 1 121 ? -56.145 55.833  -25.153 1.00 72.43  ? 769  ILE A CB    1 
ATOM   829   C  CG1   . ILE A 1 121 ? -57.648 55.843  -25.437 1.00 74.17  ? 769  ILE A CG1   1 
ATOM   830   C  CG2   . ILE A 1 121 ? -55.317 55.891  -26.435 1.00 72.68  ? 769  ILE A CG2   1 
ATOM   831   C  CD1   . ILE A 1 121 ? -58.081 54.751  -26.377 1.00 71.85  ? 769  ILE A CD1   1 
ATOM   832   N  N     . PRO A 1 122 ? -53.471 54.446  -23.657 1.00 71.72  ? 770  PRO A N     1 
ATOM   833   C  CA    . PRO A 1 122 ? -52.279 54.685  -22.842 1.00 76.90  ? 770  PRO A CA    1 
ATOM   834   C  C     . PRO A 1 122 ? -51.638 56.041  -23.141 1.00 76.03  ? 770  PRO A C     1 
ATOM   835   O  O     . PRO A 1 122 ? -51.751 56.554  -24.260 1.00 71.19  ? 770  PRO A O     1 
ATOM   836   C  CB    . PRO A 1 122 ? -51.330 53.553  -23.264 1.00 73.75  ? 770  PRO A CB    1 
ATOM   837   C  CG    . PRO A 1 122 ? -52.164 52.605  -24.085 1.00 69.76  ? 770  PRO A CG    1 
ATOM   838   C  CD    . PRO A 1 122 ? -53.236 53.430  -24.691 1.00 68.87  ? 770  PRO A CD    1 
ATOM   839   N  N     . ASP A 1 123 ? -50.980 56.601  -22.128 1.00 76.90  ? 771  ASP A N     1 
ATOM   840   C  CA    . ASP A 1 123 ? -50.208 57.829  -22.262 1.00 78.48  ? 771  ASP A CA    1 
ATOM   841   C  C     . ASP A 1 123 ? -49.324 57.731  -23.492 1.00 77.43  ? 771  ASP A C     1 
ATOM   842   O  O     . ASP A 1 123 ? -49.458 58.512  -24.438 1.00 77.23  ? 771  ASP A O     1 
ATOM   843   C  CB    . ASP A 1 123 ? -49.319 58.013  -21.033 1.00 78.78  ? 771  ASP A CB    1 
ATOM   844   C  CG    . ASP A 1 123 ? -49.242 59.461  -20.565 1.00 81.10  ? 771  ASP A CG    1 
ATOM   845   O  OD1   . ASP A 1 123 ? -50.240 60.202  -20.709 1.00 78.44  ? 771  ASP A OD1   1 
ATOM   846   O  OD2   . ASP A 1 123 ? -48.180 59.852  -20.035 1.00 81.45  ? 771  ASP A OD2   1 
ATOM   847   N  N     . ASP A 1 124 ? -48.416 56.760  -23.463 1.00 73.63  ? 772  ASP A N     1 
ATOM   848   C  CA    . ASP A 1 124 ? -47.504 56.513  -24.568 1.00 70.70  ? 772  ASP A CA    1 
ATOM   849   C  C     . ASP A 1 124 ? -48.269 56.097  -25.822 1.00 74.02  ? 772  ASP A C     1 
ATOM   850   O  O     . ASP A 1 124 ? -49.180 55.276  -25.764 1.00 73.81  ? 772  ASP A O     1 
ATOM   851   C  CB    . ASP A 1 124 ? -46.490 55.446  -24.170 1.00 70.32  ? 772  ASP A CB    1 
ATOM   852   C  CG    . ASP A 1 124 ? -45.522 55.112  -25.283 1.00 75.10  ? 772  ASP A CG    1 
ATOM   853   O  OD1   . ASP A 1 124 ? -45.960 54.902  -26.428 1.00 72.35  ? 772  ASP A OD1   1 
ATOM   854   O  OD2   . ASP A 1 124 ? -44.309 55.054  -25.009 1.00 79.36  ? 772  ASP A OD2   1 
ATOM   855   N  N     . SER A 1 125 ? -47.890 56.680  -26.956 1.00 76.52  ? 773  SER A N     1 
ATOM   856   C  CA    . SER A 1 125 ? -48.559 56.420  -28.231 1.00 76.73  ? 773  SER A CA    1 
ATOM   857   C  C     . SER A 1 125 ? -48.130 55.084  -28.827 1.00 75.14  ? 773  SER A C     1 
ATOM   858   O  O     . SER A 1 125 ? -48.907 54.420  -29.511 1.00 75.26  ? 773  SER A O     1 
ATOM   859   C  CB    . SER A 1 125 ? -48.273 57.546  -29.223 1.00 73.34  ? 773  SER A CB    1 
ATOM   860   N  N     . SER A 1 126 ? -46.882 54.708  -28.571 1.00 73.03  ? 774  SER A N     1 
ATOM   861   C  CA    . SER A 1 126 ? -46.336 53.439  -29.036 1.00 72.89  ? 774  SER A CA    1 
ATOM   862   C  C     . SER A 1 126 ? -47.157 52.256  -28.519 1.00 80.21  ? 774  SER A C     1 
ATOM   863   O  O     . SER A 1 126 ? -47.619 51.416  -29.302 1.00 79.55  ? 774  SER A O     1 
ATOM   864   C  CB    . SER A 1 126 ? -44.879 53.300  -28.602 1.00 71.27  ? 774  SER A CB    1 
ATOM   865   N  N     . LYS A 1 127 ? -47.338 52.204  -27.198 1.00 80.29  ? 775  LYS A N     1 
ATOM   866   C  CA    . LYS A 1 127 ? -48.054 51.112  -26.536 1.00 74.58  ? 775  LYS A CA    1 
ATOM   867   C  C     . LYS A 1 127 ? -49.388 50.762  -27.187 1.00 74.34  ? 775  LYS A C     1 
ATOM   868   O  O     . LYS A 1 127 ? -50.162 51.644  -27.556 1.00 73.59  ? 775  LYS A O     1 
ATOM   869   C  CB    . LYS A 1 127 ? -48.291 51.441  -25.062 1.00 73.07  ? 775  LYS A CB    1 
ATOM   870   C  CG    . LYS A 1 127 ? -47.043 51.412  -24.205 1.00 77.50  ? 775  LYS A CG    1 
ATOM   871   C  CD    . LYS A 1 127 ? -47.362 51.845  -22.783 1.00 76.83  ? 775  LYS A CD    1 
ATOM   872   C  CE    . LYS A 1 127 ? -46.118 51.853  -21.923 1.00 77.99  ? 775  LYS A CE    1 
ATOM   873   N  NZ    . LYS A 1 127 ? -45.585 50.478  -21.740 1.00 81.30  ? 775  LYS A NZ    1 
ATOM   874   N  N     . PRO A 1 128 ? -49.663 49.458  -27.311 1.00 74.96  ? 776  PRO A N     1 
ATOM   875   C  CA    . PRO A 1 128 ? -50.938 48.952  -27.821 1.00 72.71  ? 776  PRO A CA    1 
ATOM   876   C  C     . PRO A 1 128 ? -52.040 49.215  -26.811 1.00 71.93  ? 776  PRO A C     1 
ATOM   877   O  O     . PRO A 1 128 ? -51.810 49.136  -25.600 1.00 70.22  ? 776  PRO A O     1 
ATOM   878   C  CB    . PRO A 1 128 ? -50.707 47.439  -27.925 1.00 70.74  ? 776  PRO A CB    1 
ATOM   879   C  CG    . PRO A 1 128 ? -49.238 47.234  -27.745 1.00 74.50  ? 776  PRO A CG    1 
ATOM   880   C  CD    . PRO A 1 128 ? -48.760 48.369  -26.913 1.00 75.36  ? 776  PRO A CD    1 
ATOM   881   N  N     . LEU A 1 129 ? -53.231 49.514  -27.307 1.00 70.20  ? 777  LEU A N     1 
ATOM   882   C  CA    . LEU A 1 129 ? -54.369 49.783  -26.441 1.00 67.40  ? 777  LEU A CA    1 
ATOM   883   C  C     . LEU A 1 129 ? -54.485 48.808  -25.266 1.00 65.15  ? 777  LEU A C     1 
ATOM   884   O  O     . LEU A 1 129 ? -54.289 47.602  -25.423 1.00 65.22  ? 777  LEU A O     1 
ATOM   885   C  CB    . LEU A 1 129 ? -55.660 49.782  -27.260 1.00 64.83  ? 777  LEU A CB    1 
ATOM   886   C  CG    . LEU A 1 129 ? -56.228 51.175  -27.538 1.00 70.05  ? 777  LEU A CG    1 
ATOM   887   C  CD1   . LEU A 1 129 ? -55.190 52.080  -28.213 1.00 70.34  ? 777  LEU A CD1   1 
ATOM   888   C  CD2   . LEU A 1 129 ? -57.500 51.065  -28.372 1.00 71.43  ? 777  LEU A CD2   1 
ATOM   889   N  N     . TYR A 1 130 ? -54.786 49.347  -24.088 1.00 62.15  ? 778  TYR A N     1 
ATOM   890   C  CA    . TYR A 1 130 ? -55.133 48.532  -22.933 1.00 59.12  ? 778  TYR A CA    1 
ATOM   891   C  C     . TYR A 1 130 ? -56.492 47.900  -23.156 1.00 57.01  ? 778  TYR A C     1 
ATOM   892   O  O     . TYR A 1 130 ? -57.354 48.480  -23.807 1.00 57.56  ? 778  TYR A O     1 
ATOM   893   C  CB    . TYR A 1 130 ? -55.216 49.388  -21.679 1.00 58.02  ? 778  TYR A CB    1 
ATOM   894   C  CG    . TYR A 1 130 ? -53.915 49.990  -21.241 1.00 63.39  ? 778  TYR A CG    1 
ATOM   895   C  CD1   . TYR A 1 130 ? -52.712 49.328  -21.446 1.00 64.33  ? 778  TYR A CD1   1 
ATOM   896   C  CD2   . TYR A 1 130 ? -53.889 51.226  -20.615 1.00 69.40  ? 778  TYR A CD2   1 
ATOM   897   C  CE1   . TYR A 1 130 ? -51.517 49.885  -21.035 1.00 70.00  ? 778  TYR A CE1   1 
ATOM   898   C  CE2   . TYR A 1 130 ? -52.703 51.795  -20.204 1.00 72.98  ? 778  TYR A CE2   1 
ATOM   899   C  CZ    . TYR A 1 130 ? -51.521 51.123  -20.412 1.00 74.22  ? 778  TYR A CZ    1 
ATOM   900   O  OH    . TYR A 1 130 ? -50.345 51.696  -19.994 1.00 77.31  ? 778  TYR A OH    1 
ATOM   901   N  N     . LEU A 1 131 ? -56.695 46.713  -22.605 1.00 56.68  ? 779  LEU A N     1 
ATOM   902   C  CA    . LEU A 1 131 ? -57.997 46.075  -22.693 1.00 51.58  ? 779  LEU A CA    1 
ATOM   903   C  C     . LEU A 1 131 ? -58.350 45.485  -21.347 1.00 48.90  ? 779  LEU A C     1 
ATOM   904   O  O     . LEU A 1 131 ? -57.486 44.954  -20.665 1.00 50.25  ? 779  LEU A O     1 
ATOM   905   C  CB    . LEU A 1 131 ? -57.991 45.003  -23.771 1.00 48.28  ? 779  LEU A CB    1 
ATOM   906   C  CG    . LEU A 1 131 ? -57.783 45.550  -25.181 1.00 51.09  ? 779  LEU A CG    1 
ATOM   907   C  CD1   . LEU A 1 131 ? -56.337 45.378  -25.611 1.00 53.51  ? 779  LEU A CD1   1 
ATOM   908   C  CD2   . LEU A 1 131 ? -58.717 44.861  -26.155 1.00 51.88  ? 779  LEU A CD2   1 
ATOM   909   N  N     . ALA A 1 132 ? -59.611 45.593  -20.949 1.00 47.61  ? 780  ALA A N     1 
ATOM   910   C  CA    . ALA A 1 132 ? -59.997 45.132  -19.624 1.00 47.76  ? 780  ALA A CA    1 
ATOM   911   C  C     . ALA A 1 132 ? -61.451 44.694  -19.554 1.00 48.86  ? 780  ALA A C     1 
ATOM   912   O  O     . ALA A 1 132 ? -62.232 44.929  -20.474 1.00 48.38  ? 780  ALA A O     1 
ATOM   913   C  CB    . ALA A 1 132 ? -59.711 46.204  -18.588 1.00 47.08  ? 780  ALA A CB    1 
ATOM   914   N  N     . ARG A 1 133 ? -61.800 44.040  -18.454 1.00 47.35  ? 781  ARG A N     1 
ATOM   915   C  CA    . ARG A 1 133 ? -63.174 43.631  -18.216 1.00 49.36  ? 781  ARG A CA    1 
ATOM   916   C  C     . ARG A 1 133 ? -63.788 44.501  -17.117 1.00 51.77  ? 781  ARG A C     1 
ATOM   917   O  O     . ARG A 1 133 ? -63.179 44.712  -16.065 1.00 52.49  ? 781  ARG A O     1 
ATOM   918   C  CB    . ARG A 1 133 ? -63.241 42.141  -17.843 1.00 50.85  ? 781  ARG A CB    1 
ATOM   919   C  CG    . ARG A 1 133 ? -64.599 41.692  -17.312 1.00 55.48  ? 781  ARG A CG    1 
ATOM   920   C  CD    . ARG A 1 133 ? -64.652 40.205  -17.017 1.00 59.25  ? 781  ARG A CD    1 
ATOM   921   N  NE    . ARG A 1 133 ? -64.842 39.417  -18.233 1.00 68.34  ? 781  ARG A NE    1 
ATOM   922   C  CZ    . ARG A 1 133 ? -64.699 38.093  -18.303 1.00 72.62  ? 781  ARG A CZ    1 
ATOM   923   N  NH1   . ARG A 1 133 ? -64.356 37.398  -17.220 1.00 70.26  ? 781  ARG A NH1   1 
ATOM   924   N  NH2   . ARG A 1 133 ? -64.892 37.461  -19.460 1.00 71.39  ? 781  ARG A NH2   1 
ATOM   925   N  N     . VAL A 1 134 ? -64.988 45.014  -17.374 1.00 49.08  ? 782  VAL A N     1 
ATOM   926   C  CA    . VAL A 1 134 ? -65.697 45.833  -16.401 1.00 50.53  ? 782  VAL A CA    1 
ATOM   927   C  C     . VAL A 1 134 ? -66.284 44.945  -15.311 1.00 49.01  ? 782  VAL A C     1 
ATOM   928   O  O     . VAL A 1 134 ? -67.139 44.113  -15.588 1.00 49.97  ? 782  VAL A O     1 
ATOM   929   C  CB    . VAL A 1 134 ? -66.835 46.622  -17.073 1.00 51.77  ? 782  VAL A CB    1 
ATOM   930   C  CG1   . VAL A 1 134 ? -67.514 47.532  -16.066 1.00 51.38  ? 782  VAL A CG1   1 
ATOM   931   C  CG2   . VAL A 1 134 ? -66.308 47.415  -18.266 1.00 45.77  ? 782  VAL A CG2   1 
ATOM   932   N  N     . THR A 1 135 ? -65.827 45.117  -14.075 1.00 48.84  ? 783  THR A N     1 
ATOM   933   C  CA    . THR A 1 135 ? -66.258 44.245  -12.984 1.00 52.84  ? 783  THR A CA    1 
ATOM   934   C  C     . THR A 1 135 ? -67.294 44.884  -12.062 1.00 54.06  ? 783  THR A C     1 
ATOM   935   O  O     . THR A 1 135 ? -67.924 44.200  -11.255 1.00 50.00  ? 783  THR A O     1 
ATOM   936   C  CB    . THR A 1 135 ? -65.072 43.779  -12.135 1.00 51.37  ? 783  THR A CB    1 
ATOM   937   O  OG1   . THR A 1 135 ? -64.734 44.800  -11.189 1.00 52.44  ? 783  THR A OG1   1 
ATOM   938   C  CG2   . THR A 1 135 ? -63.883 43.481  -13.022 1.00 49.13  ? 783  THR A CG2   1 
ATOM   939   N  N     . ALA A 1 136 ? -67.458 46.198  -12.178 1.00 56.62  ? 784  ALA A N     1 
ATOM   940   C  CA    . ALA A 1 136 ? -68.499 46.901  -11.437 1.00 57.70  ? 784  ALA A CA    1 
ATOM   941   C  C     . ALA A 1 136 ? -68.776 48.282  -12.023 1.00 57.67  ? 784  ALA A C     1 
ATOM   942   O  O     . ALA A 1 136 ? -67.927 48.858  -12.699 1.00 55.94  ? 784  ALA A O     1 
ATOM   943   C  CB    . ALA A 1 136 ? -68.130 47.008  -9.963  1.00 57.55  ? 784  ALA A CB    1 
ATOM   944   N  N     . LEU A 1 137 ? -69.981 48.788  -11.767 1.00 61.85  ? 785  LEU A N     1 
ATOM   945   C  CA    . LEU A 1 137 ? -70.352 50.168  -12.073 1.00 61.87  ? 785  LEU A CA    1 
ATOM   946   C  C     . LEU A 1 137 ? -70.928 50.830  -10.828 1.00 65.04  ? 785  LEU A C     1 
ATOM   947   O  O     . LEU A 1 137 ? -71.607 50.182  -10.033 1.00 66.42  ? 785  LEU A O     1 
ATOM   948   C  CB    . LEU A 1 137 ? -71.399 50.216  -13.178 1.00 59.05  ? 785  LEU A CB    1 
ATOM   949   C  CG    . LEU A 1 137 ? -70.989 49.719  -14.555 1.00 57.56  ? 785  LEU A CG    1 
ATOM   950   C  CD1   . LEU A 1 137 ? -72.180 49.794  -15.497 1.00 59.78  ? 785  LEU A CD1   1 
ATOM   951   C  CD2   . LEU A 1 137 ? -69.823 50.532  -15.078 1.00 57.43  ? 785  LEU A CD2   1 
ATOM   952   N  N     . TRP A 1 138 ? -70.667 52.122  -10.661 1.00 67.10  ? 786  TRP A N     1 
ATOM   953   C  CA    . TRP A 1 138 ? -71.214 52.849  -9.521  1.00 69.45  ? 786  TRP A CA    1 
ATOM   954   C  C     . TRP A 1 138 ? -70.962 54.350  -9.595  1.00 71.81  ? 786  TRP A C     1 
ATOM   955   O  O     . TRP A 1 138 ? -69.979 54.803  -10.188 1.00 69.36  ? 786  TRP A O     1 
ATOM   956   C  CB    . TRP A 1 138 ? -70.642 52.301  -8.210  1.00 68.48  ? 786  TRP A CB    1 
ATOM   957   C  CG    . TRP A 1 138 ? -69.246 52.773  -7.905  1.00 70.21  ? 786  TRP A CG    1 
ATOM   958   C  CD1   . TRP A 1 138 ? -68.892 53.795  -7.072  1.00 72.90  ? 786  TRP A CD1   1 
ATOM   959   C  CD2   . TRP A 1 138 ? -68.020 52.242  -8.427  1.00 70.89  ? 786  TRP A CD2   1 
ATOM   960   N  NE1   . TRP A 1 138 ? -67.525 53.933  -7.042  1.00 72.75  ? 786  TRP A NE1   1 
ATOM   961   C  CE2   . TRP A 1 138 ? -66.965 52.992  -7.866  1.00 70.35  ? 786  TRP A CE2   1 
ATOM   962   C  CE3   . TRP A 1 138 ? -67.711 51.203  -9.312  1.00 66.95  ? 786  TRP A CE3   1 
ATOM   963   C  CZ2   . TRP A 1 138 ? -65.626 52.737  -8.159  1.00 66.31  ? 786  TRP A CZ2   1 
ATOM   964   C  CZ3   . TRP A 1 138 ? -66.376 50.953  -9.603  1.00 64.23  ? 786  TRP A CZ3   1 
ATOM   965   C  CH2   . TRP A 1 138 ? -65.353 51.716  -9.029  1.00 63.01  ? 786  TRP A CH2   1 
ATOM   966   N  N     . GLU A 1 139 ? -71.863 55.117  -8.987  1.00 75.07  ? 787  GLU A N     1 
ATOM   967   C  CA    . GLU A 1 139 ? -71.619 56.534  -8.758  1.00 74.79  ? 787  GLU A CA    1 
ATOM   968   C  C     . GLU A 1 139 ? -71.195 56.731  -7.309  1.00 74.89  ? 787  GLU A C     1 
ATOM   969   O  O     . GLU A 1 139 ? -71.734 56.093  -6.406  1.00 72.40  ? 787  GLU A O     1 
ATOM   970   C  CB    . GLU A 1 139 ? -72.855 57.376  -9.073  1.00 73.67  ? 787  GLU A CB    1 
ATOM   971   C  CG    . GLU A 1 139 ? -72.541 58.857  -9.148  1.00 76.78  ? 787  GLU A CG    1 
ATOM   972   C  CD    . GLU A 1 139 ? -73.723 59.703  -9.574  1.00 76.81  ? 787  GLU A CD    1 
ATOM   973   O  OE1   . GLU A 1 139 ? -74.609 59.179  -10.284 1.00 74.20  ? 787  GLU A OE1   1 
ATOM   974   O  OE2   . GLU A 1 139 ? -73.759 60.897  -9.195  1.00 75.40  ? 787  GLU A OE2   1 
ATOM   975   N  N     . ASP A 1 140 ? -70.221 57.610  -7.096  1.00 78.48  ? 788  ASP A N     1 
ATOM   976   C  CA    . ASP A 1 140 ? -69.647 57.811  -5.769  1.00 81.88  ? 788  ASP A CA    1 
ATOM   977   C  C     . ASP A 1 140 ? -70.247 59.018  -5.048  1.00 81.73  ? 788  ASP A C     1 
ATOM   978   O  O     . ASP A 1 140 ? -71.119 59.704  -5.584  1.00 78.43  ? 788  ASP A O     1 
ATOM   979   C  CB    . ASP A 1 140 ? -68.128 57.968  -5.876  1.00 82.80  ? 788  ASP A CB    1 
ATOM   980   C  CG    . ASP A 1 140 ? -67.396 57.416  -4.666  1.00 87.03  ? 788  ASP A CG    1 
ATOM   981   O  OD1   . ASP A 1 140 ? -67.952 57.476  -3.544  1.00 87.99  ? 788  ASP A OD1   1 
ATOM   982   O  OD2   . ASP A 1 140 ? -66.263 56.916  -4.841  1.00 85.95  ? 788  ASP A OD2   1 
ATOM   983   N  N     . LYS A 1 141 ? -69.776 59.255  -3.824  1.00 85.03  ? 789  LYS A N     1 
ATOM   984   C  CA    . LYS A 1 141 ? -70.191 60.403  -3.023  1.00 86.69  ? 789  LYS A CA    1 
ATOM   985   C  C     . LYS A 1 141 ? -69.968 61.701  -3.788  1.00 86.07  ? 789  LYS A C     1 
ATOM   986   O  O     . LYS A 1 141 ? -70.839 62.573  -3.823  1.00 85.67  ? 789  LYS A O     1 
ATOM   987   C  CB    . LYS A 1 141 ? -69.381 60.473  -1.727  1.00 85.59  ? 789  LYS A CB    1 
ATOM   988   C  CG    . LYS A 1 141 ? -69.430 59.248  -0.841  1.00 82.34  ? 789  LYS A CG    1 
ATOM   989   C  CD    . LYS A 1 141 ? -68.528 59.468  0.366   1.00 82.71  ? 789  LYS A CD    1 
ATOM   990   C  CE    . LYS A 1 141 ? -68.562 58.300  1.332   1.00 85.24  ? 789  LYS A CE    1 
ATOM   991   N  NZ    . LYS A 1 141 ? -69.929 58.039  1.865   1.00 85.69  ? 789  LYS A NZ    1 
ATOM   992   N  N     . ASN A 1 142 ? -68.784 61.822  -4.384  1.00 85.47  ? 790  ASN A N     1 
ATOM   993   C  CA    . ASN A 1 142 ? -68.392 63.019  -5.124  1.00 83.89  ? 790  ASN A CA    1 
ATOM   994   C  C     . ASN A 1 142 ? -69.137 63.182  -6.446  1.00 82.12  ? 790  ASN A C     1 
ATOM   995   O  O     . ASN A 1 142 ? -68.769 64.017  -7.274  1.00 82.08  ? 790  ASN A O     1 
ATOM   996   C  CB    . ASN A 1 142 ? -66.882 63.016  -5.364  1.00 84.51  ? 790  ASN A CB    1 
ATOM   997   C  CG    . ASN A 1 142 ? -66.356 61.641  -5.753  1.00 89.63  ? 790  ASN A CG    1 
ATOM   998   O  OD1   . ASN A 1 142 ? -67.113 60.775  -6.199  1.00 86.47  ? 790  ASN A OD1   1 
ATOM   999   N  ND2   . ASN A 1 142 ? -65.052 61.434  -5.580  1.00 92.65  ? 790  ASN A ND2   1 
ATOM   1000  N  N     . GLY A 1 143 ? -70.180 62.375  -6.635  1.00 82.26  ? 791  GLY A N     1 
ATOM   1001  C  CA    . GLY A 1 143 ? -71.047 62.477  -7.796  1.00 78.01  ? 791  GLY A CA    1 
ATOM   1002  C  C     . GLY A 1 143 ? -70.355 62.011  -9.055  1.00 76.89  ? 791  GLY A C     1 
ATOM   1003  O  O     . GLY A 1 143 ? -70.844 62.224  -10.166 1.00 75.31  ? 791  GLY A O     1 
ATOM   1004  N  N     . GLN A 1 144 ? -69.206 61.370  -8.866  1.00 80.38  ? 792  GLN A N     1 
ATOM   1005  C  CA    . GLN A 1 144 ? -68.402 60.860  -9.968  1.00 78.93  ? 792  GLN A CA    1 
ATOM   1006  C  C     . GLN A 1 144 ? -68.898 59.483  -10.385 1.00 73.35  ? 792  GLN A C     1 
ATOM   1007  O  O     . GLN A 1 144 ? -69.234 58.653  -9.542  1.00 71.10  ? 792  GLN A O     1 
ATOM   1008  C  CB    . GLN A 1 144 ? -66.939 60.777  -9.542  1.00 78.76  ? 792  GLN A CB    1 
ATOM   1009  C  CG    . GLN A 1 144 ? -65.950 61.157  -10.621 1.00 81.56  ? 792  GLN A CG    1 
ATOM   1010  C  CD    . GLN A 1 144 ? -64.519 61.094  -10.127 1.00 87.81  ? 792  GLN A CD    1 
ATOM   1011  O  OE1   . GLN A 1 144 ? -63.572 61.129  -10.917 1.00 89.52  ? 792  GLN A OE1   1 
ATOM   1012  N  NE2   . GLN A 1 144 ? -64.352 60.990  -8.809  1.00 86.18  ? 792  GLN A NE2   1 
ATOM   1013  N  N     . MET A 1 145 ? -68.946 59.246  -11.691 1.00 74.76  ? 793  MET A N     1 
ATOM   1014  C  CA    . MET A 1 145 ? -69.401 57.959  -12.210 1.00 75.55  ? 793  MET A CA    1 
ATOM   1015  C  C     . MET A 1 145 ? -68.239 57.026  -12.555 1.00 70.95  ? 793  MET A C     1 
ATOM   1016  O  O     . MET A 1 145 ? -67.489 57.259  -13.504 1.00 72.25  ? 793  MET A O     1 
ATOM   1017  C  CB    . MET A 1 145 ? -70.323 58.165  -13.405 1.00 74.09  ? 793  MET A CB    1 
ATOM   1018  C  CG    . MET A 1 145 ? -71.668 58.746  -13.020 1.00 72.36  ? 793  MET A CG    1 
ATOM   1019  S  SD    . MET A 1 145 ? -72.624 59.187  -14.474 1.00 74.85  ? 793  MET A SD    1 
ATOM   1020  C  CE    . MET A 1 145 ? -71.597 60.489  -15.155 1.00 74.71  ? 793  MET A CE    1 
ATOM   1021  N  N     . MET A 1 146 ? -68.114 55.960  -11.775 1.00 67.44  ? 794  MET A N     1 
ATOM   1022  C  CA    . MET A 1 146 ? -66.914 55.137  -11.773 1.00 67.15  ? 794  MET A CA    1 
ATOM   1023  C  C     . MET A 1 146 ? -67.123 53.724  -12.310 1.00 64.65  ? 794  MET A C     1 
ATOM   1024  O  O     . MET A 1 146 ? -68.251 53.259  -12.466 1.00 63.55  ? 794  MET A O     1 
ATOM   1025  C  CB    . MET A 1 146 ? -66.375 55.044  -10.344 1.00 65.89  ? 794  MET A CB    1 
ATOM   1026  C  CG    . MET A 1 146 ? -65.665 56.282  -9.861  1.00 65.87  ? 794  MET A CG    1 
ATOM   1027  S  SD    . MET A 1 146 ? -64.185 56.541  -10.830 1.00 72.07  ? 794  MET A SD    1 
ATOM   1028  C  CE    . MET A 1 146 ? -63.397 57.874  -9.932  1.00 82.09  ? 794  MET A CE    1 
ATOM   1029  N  N     . PHE A 1 147 ? -66.013 53.048  -12.591 1.00 63.21  ? 795  PHE A N     1 
ATOM   1030  C  CA    . PHE A 1 147 ? -66.028 51.613  -12.840 1.00 60.38  ? 795  PHE A CA    1 
ATOM   1031  C  C     . PHE A 1 147 ? -64.702 50.988  -12.446 1.00 58.34  ? 795  PHE A C     1 
ATOM   1032  O  O     . PHE A 1 147 ? -63.704 51.678  -12.276 1.00 59.44  ? 795  PHE A O     1 
ATOM   1033  C  CB    . PHE A 1 147 ? -66.365 51.289  -14.297 1.00 60.04  ? 795  PHE A CB    1 
ATOM   1034  C  CG    . PHE A 1 147 ? -65.175 51.234  -15.207 1.00 56.55  ? 795  PHE A CG    1 
ATOM   1035  C  CD1   . PHE A 1 147 ? -64.444 50.070  -15.341 1.00 56.22  ? 795  PHE A CD1   1 
ATOM   1036  C  CD2   . PHE A 1 147 ? -64.805 52.337  -15.954 1.00 60.74  ? 795  PHE A CD2   1 
ATOM   1037  C  CE1   . PHE A 1 147 ? -63.356 50.013  -16.191 1.00 58.91  ? 795  PHE A CE1   1 
ATOM   1038  C  CE2   . PHE A 1 147 ? -63.715 52.286  -16.808 1.00 61.29  ? 795  PHE A CE2   1 
ATOM   1039  C  CZ    . PHE A 1 147 ? -62.991 51.125  -16.927 1.00 59.07  ? 795  PHE A CZ    1 
ATOM   1040  N  N     . HIS A 1 148 ? -64.710 49.672  -12.291 1.00 59.44  ? 796  HIS A N     1 
ATOM   1041  C  CA    . HIS A 1 148 ? -63.514 48.929  -11.931 1.00 56.25  ? 796  HIS A CA    1 
ATOM   1042  C  C     . HIS A 1 148 ? -63.046 48.090  -13.108 1.00 54.98  ? 796  HIS A C     1 
ATOM   1043  O  O     . HIS A 1 148 ? -63.814 47.320  -13.678 1.00 55.63  ? 796  HIS A O     1 
ATOM   1044  C  CB    . HIS A 1 148 ? -63.802 48.019  -10.747 1.00 53.58  ? 796  HIS A CB    1 
ATOM   1045  C  CG    . HIS A 1 148 ? -62.588 47.341  -10.202 1.00 54.66  ? 796  HIS A CG    1 
ATOM   1046  N  ND1   . HIS A 1 148 ? -61.627 48.010  -9.480  1.00 55.37  ? 796  HIS A ND1   1 
ATOM   1047  C  CD2   . HIS A 1 148 ? -62.179 46.053  -10.270 1.00 54.52  ? 796  HIS A CD2   1 
ATOM   1048  C  CE1   . HIS A 1 148 ? -60.679 47.164  -9.122  1.00 54.38  ? 796  HIS A CE1   1 
ATOM   1049  N  NE2   . HIS A 1 148 ? -60.990 45.970  -9.589  1.00 54.15  ? 796  HIS A NE2   1 
ATOM   1050  N  N     . ALA A 1 149 ? -61.783 48.232  -13.473 1.00 53.15  ? 797  ALA A N     1 
ATOM   1051  C  CA    . ALA A 1 149 ? -61.264 47.483  -14.600 1.00 52.50  ? 797  ALA A CA    1 
ATOM   1052  C  C     . ALA A 1 149 ? -60.404 46.322  -14.136 1.00 51.72  ? 797  ALA A C     1 
ATOM   1053  O  O     . ALA A 1 149 ? -59.510 46.496  -13.311 1.00 50.72  ? 797  ALA A O     1 
ATOM   1054  C  CB    . ALA A 1 149 ? -60.473 48.389  -15.521 1.00 52.95  ? 797  ALA A CB    1 
ATOM   1055  N  N     . HIS A 1 150 ? -60.700 45.131  -14.656 1.00 53.19  ? 798  HIS A N     1 
ATOM   1056  C  CA    . HIS A 1 150 ? -59.793 43.997  -14.531 1.00 49.03  ? 798  HIS A CA    1 
ATOM   1057  C  C     . HIS A 1 150 ? -59.004 43.865  -15.830 1.00 49.33  ? 798  HIS A C     1 
ATOM   1058  O  O     . HIS A 1 150 ? -59.564 43.577  -16.890 1.00 47.43  ? 798  HIS A O     1 
ATOM   1059  C  CB    . HIS A 1 150 ? -60.535 42.707  -14.213 1.00 45.26  ? 798  HIS A CB    1 
ATOM   1060  C  CG    . HIS A 1 150 ? -59.626 41.544  -13.967 1.00 47.76  ? 798  HIS A CG    1 
ATOM   1061  N  ND1   . HIS A 1 150 ? -60.082 40.306  -13.572 1.00 46.29  ? 798  HIS A ND1   1 
ATOM   1062  C  CD2   . HIS A 1 150 ? -58.278 41.433  -14.064 1.00 45.79  ? 798  HIS A CD2   1 
ATOM   1063  C  CE1   . HIS A 1 150 ? -59.059 39.484  -13.434 1.00 44.37  ? 798  HIS A CE1   1 
ATOM   1064  N  NE2   . HIS A 1 150 ? -57.952 40.145  -13.729 1.00 44.42  ? 798  HIS A NE2   1 
ATOM   1065  N  N     . TRP A 1 151 ? -57.699 44.093  -15.730 1.00 48.84  ? 799  TRP A N     1 
ATOM   1066  C  CA    . TRP A 1 151 ? -56.842 44.236  -16.894 1.00 46.55  ? 799  TRP A CA    1 
ATOM   1067  C  C     . TRP A 1 151 ? -56.610 42.925  -17.606 1.00 46.01  ? 799  TRP A C     1 
ATOM   1068  O  O     . TRP A 1 151 ? -56.432 41.887  -16.975 1.00 48.05  ? 799  TRP A O     1 
ATOM   1069  C  CB    . TRP A 1 151 ? -55.483 44.799  -16.478 1.00 50.75  ? 799  TRP A CB    1 
ATOM   1070  C  CG    . TRP A 1 151 ? -55.510 46.222  -16.011 1.00 56.79  ? 799  TRP A CG    1 
ATOM   1071  C  CD1   . TRP A 1 151 ? -55.208 46.684  -14.762 1.00 56.32  ? 799  TRP A CD1   1 
ATOM   1072  C  CD2   . TRP A 1 151 ? -55.856 47.372  -16.791 1.00 59.76  ? 799  TRP A CD2   1 
ATOM   1073  N  NE1   . TRP A 1 151 ? -55.347 48.050  -14.719 1.00 57.85  ? 799  TRP A NE1   1 
ATOM   1074  C  CE2   . TRP A 1 151 ? -55.743 48.496  -15.953 1.00 59.32  ? 799  TRP A CE2   1 
ATOM   1075  C  CE3   . TRP A 1 151 ? -56.255 47.560  -18.119 1.00 59.34  ? 799  TRP A CE3   1 
ATOM   1076  C  CZ2   . TRP A 1 151 ? -56.009 49.782  -16.396 1.00 62.27  ? 799  TRP A CZ2   1 
ATOM   1077  C  CZ3   . TRP A 1 151 ? -56.516 48.839  -18.556 1.00 59.38  ? 799  TRP A CZ3   1 
ATOM   1078  C  CH2   . TRP A 1 151 ? -56.394 49.933  -17.699 1.00 60.71  ? 799  TRP A CH2   1 
ATOM   1079  N  N     . PHE A 1 152 ? -56.606 42.976  -18.930 1.00 45.32  ? 800  PHE A N     1 
ATOM   1080  C  CA    . PHE A 1 152 ? -56.038 41.891  -19.706 1.00 42.13  ? 800  PHE A CA    1 
ATOM   1081  C  C     . PHE A 1 152 ? -54.572 42.194  -19.947 1.00 42.26  ? 800  PHE A C     1 
ATOM   1082  O  O     . PHE A 1 152 ? -54.017 43.131  -19.388 1.00 42.99  ? 800  PHE A O     1 
ATOM   1083  C  CB    . PHE A 1 152 ? -56.747 41.722  -21.039 1.00 40.87  ? 800  PHE A CB    1 
ATOM   1084  C  CG    . PHE A 1 152 ? -58.041 40.999  -20.942 1.00 42.60  ? 800  PHE A CG    1 
ATOM   1085  C  CD1   . PHE A 1 152 ? -58.070 39.642  -20.703 1.00 44.44  ? 800  PHE A CD1   1 
ATOM   1086  C  CD2   . PHE A 1 152 ? -59.237 41.673  -21.099 1.00 45.45  ? 800  PHE A CD2   1 
ATOM   1087  C  CE1   . PHE A 1 152 ? -59.275 38.970  -20.615 1.00 46.40  ? 800  PHE A CE1   1 
ATOM   1088  C  CE2   . PHE A 1 152 ? -60.444 41.010  -21.017 1.00 44.50  ? 800  PHE A CE2   1 
ATOM   1089  C  CZ    . PHE A 1 152 ? -60.463 39.656  -20.774 1.00 46.24  ? 800  PHE A CZ    1 
ATOM   1090  N  N     . CYS A 1 153 ? -53.953 41.398  -20.800 1.00 42.57  ? 801  CYS A N     1 
ATOM   1091  C  CA    . CYS A 1 153 ? -52.539 41.517  -21.053 1.00 40.56  ? 801  CYS A CA    1 
ATOM   1092  C  C     . CYS A 1 153 ? -52.285 40.852  -22.378 1.00 42.85  ? 801  CYS A C     1 
ATOM   1093  O  O     . CYS A 1 153 ? -52.637 39.693  -22.558 1.00 44.05  ? 801  CYS A O     1 
ATOM   1094  C  CB    . CYS A 1 153 ? -51.779 40.791  -19.960 1.00 39.20  ? 801  CYS A CB    1 
ATOM   1095  S  SG    . CYS A 1 153 ? -50.096 40.428  -20.371 1.00 41.73  ? 801  CYS A SG    1 
ATOM   1096  N  N     . ALA A 1 154 ? -51.702 41.585  -23.317 1.00 42.22  ? 802  ALA A N     1 
ATOM   1097  C  CA    . ALA A 1 154 ? -51.499 41.047  -24.655 1.00 43.69  ? 802  ALA A CA    1 
ATOM   1098  C  C     . ALA A 1 154 ? -50.376 40.031  -24.660 1.00 47.12  ? 802  ALA A C     1 
ATOM   1099  O  O     . ALA A 1 154 ? -49.424 40.137  -23.882 1.00 45.89  ? 802  ALA A O     1 
ATOM   1100  C  CB    . ALA A 1 154 ? -51.207 42.153  -25.641 1.00 44.18  ? 802  ALA A CB    1 
ATOM   1101  N  N     . GLY A 1 155 ? -50.497 39.041  -25.539 1.00 48.54  ? 803  GLY A N     1 
ATOM   1102  C  CA    . GLY A 1 155 ? -49.452 38.060  -25.716 1.00 45.50  ? 803  GLY A CA    1 
ATOM   1103  C  C     . GLY A 1 155 ? -48.097 38.730  -25.733 1.00 47.87  ? 803  GLY A C     1 
ATOM   1104  O  O     . GLY A 1 155 ? -47.201 38.350  -24.989 1.00 48.64  ? 803  GLY A O     1 
ATOM   1105  N  N     . THR A 1 156 ? -47.956 39.754  -26.567 1.00 48.72  ? 804  THR A N     1 
ATOM   1106  C  CA    . THR A 1 156 ? -46.677 40.445  -26.727 1.00 48.66  ? 804  THR A CA    1 
ATOM   1107  C  C     . THR A 1 156 ? -46.107 41.010  -25.417 1.00 49.20  ? 804  THR A C     1 
ATOM   1108  O  O     . THR A 1 156 ? -44.918 41.301  -25.330 1.00 52.11  ? 804  THR A O     1 
ATOM   1109  C  CB    . THR A 1 156 ? -46.776 41.566  -27.773 1.00 42.44  ? 804  THR A CB    1 
ATOM   1110  N  N     . ASP A 1 157 ? -46.948 41.149  -24.398 1.00 48.70  ? 805  ASP A N     1 
ATOM   1111  C  CA    . ASP A 1 157 ? -46.501 41.648  -23.095 1.00 48.87  ? 805  ASP A CA    1 
ATOM   1112  C  C     . ASP A 1 157 ? -45.924 40.544  -22.203 1.00 47.56  ? 805  ASP A C     1 
ATOM   1113  O  O     . ASP A 1 157 ? -45.339 40.818  -21.157 1.00 46.12  ? 805  ASP A O     1 
ATOM   1114  C  CB    . ASP A 1 157 ? -47.652 42.345  -22.357 1.00 50.21  ? 805  ASP A CB    1 
ATOM   1115  C  CG    . ASP A 1 157 ? -48.081 43.650  -23.021 1.00 54.21  ? 805  ASP A CG    1 
ATOM   1116  O  OD1   . ASP A 1 157 ? -47.226 44.300  -23.664 1.00 59.34  ? 805  ASP A OD1   1 
ATOM   1117  O  OD2   . ASP A 1 157 ? -49.271 44.027  -22.893 1.00 48.99  ? 805  ASP A OD2   1 
ATOM   1118  N  N     . THR A 1 158 ? -46.107 39.296  -22.619 1.00 48.65  ? 806  THR A N     1 
ATOM   1119  C  CA    . THR A 1 158 ? -45.652 38.140  -21.852 1.00 45.64  ? 806  THR A CA    1 
ATOM   1120  C  C     . THR A 1 158 ? -44.319 37.666  -22.400 1.00 45.06  ? 806  THR A C     1 
ATOM   1121  O  O     . THR A 1 158 ? -43.803 38.250  -23.353 1.00 47.16  ? 806  THR A O     1 
ATOM   1122  C  CB    . THR A 1 158 ? -46.672 36.990  -21.952 1.00 44.08  ? 806  THR A CB    1 
ATOM   1123  O  OG1   . THR A 1 158 ? -46.819 36.595  -23.318 1.00 43.38  ? 806  THR A OG1   1 
ATOM   1124  C  CG2   . THR A 1 158 ? -48.028 37.442  -21.458 1.00 42.76  ? 806  THR A CG2   1 
ATOM   1125  N  N     . VAL A 1 159 ? -43.767 36.607  -21.809 1.00 43.33  ? 807  VAL A N     1 
ATOM   1126  C  CA    . VAL A 1 159 ? -42.537 36.014  -22.319 1.00 41.44  ? 807  VAL A CA    1 
ATOM   1127  C  C     . VAL A 1 159 ? -42.722 35.710  -23.781 1.00 41.24  ? 807  VAL A C     1 
ATOM   1128  O  O     . VAL A 1 159 ? -41.810 35.881  -24.579 1.00 43.08  ? 807  VAL A O     1 
ATOM   1129  C  CB    . VAL A 1 159 ? -42.193 34.677  -21.660 1.00 40.10  ? 807  VAL A CB    1 
ATOM   1130  C  CG1   . VAL A 1 159 ? -40.736 34.663  -21.279 1.00 41.88  ? 807  VAL A CG1   1 
ATOM   1131  C  CG2   . VAL A 1 159 ? -43.061 34.410  -20.463 1.00 43.58  ? 807  VAL A CG2   1 
ATOM   1132  N  N     . LEU A 1 160 ? -43.917 35.238  -24.115 1.00 42.71  ? 808  LEU A N     1 
ATOM   1133  C  CA    . LEU A 1 160 ? -44.252 34.855  -25.475 1.00 44.56  ? 808  LEU A CA    1 
ATOM   1134  C  C     . LEU A 1 160 ? -43.758 35.884  -26.475 1.00 47.55  ? 808  LEU A C     1 
ATOM   1135  O  O     . LEU A 1 160 ? -43.372 35.543  -27.593 1.00 46.86  ? 808  LEU A O     1 
ATOM   1136  C  CB    . LEU A 1 160 ? -45.760 34.685  -25.609 1.00 44.25  ? 808  LEU A CB    1 
ATOM   1137  C  CG    . LEU A 1 160 ? -46.237 33.248  -25.781 1.00 44.44  ? 808  LEU A CG    1 
ATOM   1138  C  CD1   . LEU A 1 160 ? -45.305 32.302  -25.059 1.00 41.75  ? 808  LEU A CD1   1 
ATOM   1139  C  CD2   . LEU A 1 160 ? -47.650 33.110  -25.252 1.00 45.71  ? 808  LEU A CD2   1 
ATOM   1140  N  N     . GLY A 1 161 ? -43.776 37.147  -26.063 1.00 48.85  ? 809  GLY A N     1 
ATOM   1141  C  CA    . GLY A 1 161 ? -43.329 38.226  -26.918 1.00 49.68  ? 809  GLY A CA    1 
ATOM   1142  C  C     . GLY A 1 161 ? -44.026 38.204  -28.264 1.00 51.21  ? 809  GLY A C     1 
ATOM   1143  O  O     . GLY A 1 161 ? -45.234 37.956  -28.346 1.00 51.50  ? 809  GLY A O     1 
ATOM   1144  N  N     . ALA A 1 162 ? -43.254 38.452  -29.319 1.00 50.94  ? 810  ALA A N     1 
ATOM   1145  C  CA    . ALA A 1 162 ? -43.800 38.574  -30.666 1.00 49.59  ? 810  ALA A CA    1 
ATOM   1146  C  C     . ALA A 1 162 ? -44.390 37.268  -31.199 1.00 50.34  ? 810  ALA A C     1 
ATOM   1147  O  O     . ALA A 1 162 ? -45.233 37.287  -32.096 1.00 50.86  ? 810  ALA A O     1 
ATOM   1148  C  CB    . ALA A 1 162 ? -42.743 39.104  -31.609 1.00 51.55  ? 810  ALA A CB    1 
ATOM   1149  N  N     . THR A 1 163 ? -43.955 36.141  -30.638 1.00 49.18  ? 811  THR A N     1 
ATOM   1150  C  CA    . THR A 1 163 ? -44.439 34.830  -31.071 1.00 49.04  ? 811  THR A CA    1 
ATOM   1151  C  C     . THR A 1 163 ? -45.885 34.575  -30.654 1.00 49.72  ? 811  THR A C     1 
ATOM   1152  O  O     . THR A 1 163 ? -46.491 33.584  -31.063 1.00 49.80  ? 811  THR A O     1 
ATOM   1153  C  CB    . THR A 1 163 ? -43.580 33.682  -30.507 1.00 46.85  ? 811  THR A CB    1 
ATOM   1154  O  OG1   . THR A 1 163 ? -43.783 33.579  -29.091 1.00 45.46  ? 811  THR A OG1   1 
ATOM   1155  C  CG2   . THR A 1 163 ? -42.108 33.912  -30.804 1.00 44.72  ? 811  THR A CG2   1 
ATOM   1156  N  N     . SER A 1 164 ? -46.434 35.457  -29.828 1.00 50.07  ? 812  SER A N     1 
ATOM   1157  C  CA    . SER A 1 164 ? -47.811 35.296  -29.386 1.00 50.71  ? 812  SER A CA    1 
ATOM   1158  C  C     . SER A 1 164 ? -48.784 35.499  -30.546 1.00 52.19  ? 812  SER A C     1 
ATOM   1159  O  O     . SER A 1 164 ? -48.468 36.188  -31.516 1.00 53.55  ? 812  SER A O     1 
ATOM   1160  C  CB    . SER A 1 164 ? -48.127 36.269  -28.252 1.00 48.08  ? 812  SER A CB    1 
ATOM   1161  O  OG    . SER A 1 164 ? -49.508 36.238  -27.935 1.00 50.89  ? 812  SER A OG    1 
ATOM   1162  N  N     . ASP A 1 165 ? -49.958 34.885  -30.445 1.00 49.98  ? 813  ASP A N     1 
ATOM   1163  C  CA    . ASP A 1 165 ? -51.048 35.162  -31.366 1.00 49.12  ? 813  ASP A CA    1 
ATOM   1164  C  C     . ASP A 1 165 ? -51.600 36.540  -31.039 1.00 55.10  ? 813  ASP A C     1 
ATOM   1165  O  O     . ASP A 1 165 ? -52.034 36.786  -29.908 1.00 56.26  ? 813  ASP A O     1 
ATOM   1166  C  CB    . ASP A 1 165 ? -52.143 34.112  -31.207 1.00 54.90  ? 813  ASP A CB    1 
ATOM   1167  C  CG    . ASP A 1 165 ? -53.399 34.446  -31.995 1.00 58.46  ? 813  ASP A CG    1 
ATOM   1168  O  OD1   . ASP A 1 165 ? -53.500 35.574  -32.524 1.00 58.60  ? 813  ASP A OD1   1 
ATOM   1169  O  OD2   . ASP A 1 165 ? -54.297 33.576  -32.072 1.00 57.73  ? 813  ASP A OD2   1 
ATOM   1170  N  N     . PRO A 1 166 ? -51.588 37.450  -32.028 1.00 57.84  ? 814  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1 166 ? -51.997 38.846  -31.835 1.00 54.56  ? 814  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1 166 ? -53.365 38.968  -31.170 1.00 55.47  ? 814  PRO A C     1 
ATOM   1173  O  O     . PRO A 1 166 ? -53.592 39.904  -30.400 1.00 56.00  ? 814  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1 166 ? -52.073 39.380  -33.266 1.00 54.22  ? 814  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1 166 ? -51.126 38.550  -34.023 1.00 52.78  ? 814  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1 166 ? -51.228 37.178  -33.430 1.00 56.01  ? 814  PRO A CD    1 
ATOM   1177  N  N     . LEU A 1 167 ? -54.257 38.026  -31.460 1.00 52.59  ? 815  LEU A N     1 
ATOM   1178  C  CA    . LEU A 1 167 ? -55.623 38.084  -30.960 1.00 52.23  ? 815  LEU A CA    1 
ATOM   1179  C  C     . LEU A 1 167 ? -55.790 37.520  -29.554 1.00 52.49  ? 815  LEU A C     1 
ATOM   1180  O  O     . LEU A 1 167 ? -56.908 37.449  -29.042 1.00 51.65  ? 815  LEU A O     1 
ATOM   1181  C  CB    . LEU A 1 167 ? -56.567 37.355  -31.914 1.00 55.93  ? 815  LEU A CB    1 
ATOM   1182  C  CG    . LEU A 1 167 ? -56.780 38.060  -33.249 1.00 60.37  ? 815  LEU A CG    1 
ATOM   1183  C  CD1   . LEU A 1 167 ? -57.998 37.499  -33.981 1.00 61.09  ? 815  LEU A CD1   1 
ATOM   1184  C  CD2   . LEU A 1 167 ? -56.938 39.548  -33.001 1.00 56.99  ? 815  LEU A CD2   1 
ATOM   1185  N  N     . GLU A 1 168 ? -54.691 37.123  -28.924 1.00 51.75  ? 816  GLU A N     1 
ATOM   1186  C  CA    . GLU A 1 168 ? -54.790 36.502  -27.611 1.00 48.64  ? 816  GLU A CA    1 
ATOM   1187  C  C     . GLU A 1 168 ? -54.458 37.473  -26.490 1.00 48.90  ? 816  GLU A C     1 
ATOM   1188  O  O     . GLU A 1 168 ? -53.503 38.247  -26.582 1.00 50.93  ? 816  GLU A O     1 
ATOM   1189  C  CB    . GLU A 1 168 ? -53.910 35.251  -27.527 1.00 49.05  ? 816  GLU A CB    1 
ATOM   1190  C  CG    . GLU A 1 168 ? -54.077 34.464  -26.233 1.00 48.70  ? 816  GLU A CG    1 
ATOM   1191  C  CD    . GLU A 1 168 ? -53.654 33.002  -26.356 1.00 54.28  ? 816  GLU A CD    1 
ATOM   1192  O  OE1   . GLU A 1 168 ? -52.817 32.683  -27.238 1.00 57.68  ? 816  GLU A OE1   1 
ATOM   1193  O  OE2   . GLU A 1 168 ? -54.166 32.170  -25.568 1.00 49.50  ? 816  GLU A OE2   1 
ATOM   1194  N  N     . LEU A 1 169 ? -55.274 37.433  -25.441 1.00 46.41  ? 817  LEU A N     1 
ATOM   1195  C  CA    . LEU A 1 169 ? -55.040 38.207  -24.231 1.00 43.77  ? 817  LEU A CA    1 
ATOM   1196  C  C     . LEU A 1 169 ? -54.931 37.213  -23.091 1.00 42.66  ? 817  LEU A C     1 
ATOM   1197  O  O     . LEU A 1 169 ? -55.292 36.053  -23.249 1.00 41.67  ? 817  LEU A O     1 
ATOM   1198  C  CB    . LEU A 1 169 ? -56.205 39.155  -23.956 1.00 44.49  ? 817  LEU A CB    1 
ATOM   1199  C  CG    . LEU A 1 169 ? -56.719 40.054  -25.083 1.00 46.46  ? 817  LEU A CG    1 
ATOM   1200  C  CD1   . LEU A 1 169 ? -58.097 40.641  -24.749 1.00 43.48  ? 817  LEU A CD1   1 
ATOM   1201  C  CD2   . LEU A 1 169 ? -55.712 41.146  -25.378 1.00 48.55  ? 817  LEU A CD2   1 
ATOM   1202  N  N     . PHE A 1 170 ? -54.439 37.669  -21.945 1.00 43.00  ? 818  PHE A N     1 
ATOM   1203  C  CA    . PHE A 1 170 ? -54.331 36.822  -20.766 1.00 40.85  ? 818  PHE A CA    1 
ATOM   1204  C  C     . PHE A 1 170 ? -54.797 37.596  -19.543 1.00 41.23  ? 818  PHE A C     1 
ATOM   1205  O  O     . PHE A 1 170 ? -54.381 38.730  -19.334 1.00 41.88  ? 818  PHE A O     1 
ATOM   1206  C  CB    . PHE A 1 170 ? -52.883 36.365  -20.564 1.00 39.28  ? 818  PHE A CB    1 
ATOM   1207  C  CG    . PHE A 1 170 ? -52.315 35.602  -21.728 1.00 41.18  ? 818  PHE A CG    1 
ATOM   1208  C  CD1   . PHE A 1 170 ? -51.828 36.266  -22.838 1.00 43.63  ? 818  PHE A CD1   1 
ATOM   1209  C  CD2   . PHE A 1 170 ? -52.259 34.215  -21.710 1.00 43.19  ? 818  PHE A CD2   1 
ATOM   1210  C  CE1   . PHE A 1 170 ? -51.305 35.564  -23.914 1.00 46.15  ? 818  PHE A CE1   1 
ATOM   1211  C  CE2   . PHE A 1 170 ? -51.734 33.509  -22.779 1.00 41.16  ? 818  PHE A CE2   1 
ATOM   1212  C  CZ    . PHE A 1 170 ? -51.257 34.183  -23.880 1.00 42.92  ? 818  PHE A CZ    1 
ATOM   1213  N  N     . LEU A 1 171 ? -55.673 36.994  -18.748 1.00 40.87  ? 819  LEU A N     1 
ATOM   1214  C  CA    . LEU A 1 171 ? -56.041 37.572  -17.461 1.00 40.66  ? 819  LEU A CA    1 
ATOM   1215  C  C     . LEU A 1 171 ? -54.789 37.775  -16.624 1.00 41.26  ? 819  LEU A C     1 
ATOM   1216  O  O     . LEU A 1 171 ? -53.886 36.945  -16.632 1.00 41.41  ? 819  LEU A O     1 
ATOM   1217  C  CB    . LEU A 1 171 ? -56.990 36.649  -16.702 1.00 41.81  ? 819  LEU A CB    1 
ATOM   1218  C  CG    . LEU A 1 171 ? -58.331 36.305  -17.344 1.00 45.23  ? 819  LEU A CG    1 
ATOM   1219  C  CD1   . LEU A 1 171 ? -59.116 35.328  -16.472 1.00 43.87  ? 819  LEU A CD1   1 
ATOM   1220  C  CD2   . LEU A 1 171 ? -59.124 37.574  -17.607 1.00 46.15  ? 819  LEU A CD2   1 
ATOM   1221  N  N     . VAL A 1 172 ? -54.744 38.872  -15.888 1.00 42.36  ? 820  VAL A N     1 
ATOM   1222  C  CA    . VAL A 1 172 ? -53.589 39.187  -15.069 1.00 42.16  ? 820  VAL A CA    1 
ATOM   1223  C  C     . VAL A 1 172 ? -54.071 39.684  -13.712 1.00 42.93  ? 820  VAL A C     1 
ATOM   1224  O  O     . VAL A 1 172 ? -55.190 40.183  -13.597 1.00 43.99  ? 820  VAL A O     1 
ATOM   1225  C  CB    . VAL A 1 172 ? -52.725 40.261  -15.759 1.00 44.24  ? 820  VAL A CB    1 
ATOM   1226  C  CG1   . VAL A 1 172 ? -51.753 40.885  -14.778 1.00 49.48  ? 820  VAL A CG1   1 
ATOM   1227  C  CG2   . VAL A 1 172 ? -51.987 39.666  -16.939 1.00 39.22  ? 820  VAL A CG2   1 
ATOM   1228  N  N     . GLY A 1 173 ? -53.241 39.538  -12.684 1.00 41.01  ? 821  GLY A N     1 
ATOM   1229  C  CA    . GLY A 1 173 ? -53.589 40.018  -11.358 1.00 42.90  ? 821  GLY A CA    1 
ATOM   1230  C  C     . GLY A 1 173 ? -53.418 41.519  -11.200 1.00 44.84  ? 821  GLY A C     1 
ATOM   1231  O  O     . GLY A 1 173 ? -52.709 41.974  -10.307 1.00 42.54  ? 821  GLY A O     1 
ATOM   1232  N  N     . GLU A 1 174 ? -54.066 42.286  -12.075 1.00 44.35  ? 822  GLU A N     1 
ATOM   1233  C  CA    . GLU A 1 174 ? -53.999 43.741  -12.033 1.00 44.96  ? 822  GLU A CA    1 
ATOM   1234  C  C     . GLU A 1 174 ? -55.355 44.368  -12.314 1.00 46.95  ? 822  GLU A C     1 
ATOM   1235  O  O     . GLU A 1 174 ? -56.053 43.976  -13.245 1.00 46.30  ? 822  GLU A O     1 
ATOM   1236  C  CB    . GLU A 1 174 ? -52.976 44.261  -13.031 1.00 46.34  ? 822  GLU A CB    1 
ATOM   1237  C  CG    . GLU A 1 174 ? -51.562 43.824  -12.737 1.00 51.06  ? 822  GLU A CG    1 
ATOM   1238  C  CD    . GLU A 1 174 ? -50.572 44.360  -13.747 1.00 63.09  ? 822  GLU A CD    1 
ATOM   1239  O  OE1   . GLU A 1 174 ? -50.785 45.491  -14.239 1.00 65.74  ? 822  GLU A OE1   1 
ATOM   1240  O  OE2   . GLU A 1 174 ? -49.590 43.648  -14.054 1.00 63.70  ? 822  GLU A OE2   1 
ATOM   1241  N  N     . CYS A 1 175 ? -55.717 45.348  -11.493 1.00 48.34  ? 823  CYS A N     1 
ATOM   1242  C  CA    . CYS A 1 175 ? -57.001 46.021  -11.599 1.00 49.78  ? 823  CYS A CA    1 
ATOM   1243  C  C     . CYS A 1 175 ? -56.970 47.361  -10.871 1.00 54.42  ? 823  CYS A C     1 
ATOM   1244  O  O     . CYS A 1 175 ? -56.385 47.480  -9.790  1.00 55.12  ? 823  CYS A O     1 
ATOM   1245  C  CB    . CYS A 1 175 ? -58.098 45.147  -11.001 1.00 47.59  ? 823  CYS A CB    1 
ATOM   1246  S  SG    . CYS A 1 175 ? -57.797 44.729  -9.277  1.00 43.08  ? 823  CYS A SG    1 
ATOM   1247  N  N     . GLU A 1 176 ? -57.595 48.371  -11.472 1.00 55.80  ? 824  GLU A N     1 
ATOM   1248  C  CA    . GLU A 1 176 ? -57.752 49.665  -10.821 1.00 58.58  ? 824  GLU A CA    1 
ATOM   1249  C  C     . GLU A 1 176 ? -59.136 50.267  -11.066 1.00 58.79  ? 824  GLU A C     1 
ATOM   1250  O  O     . GLU A 1 176 ? -59.913 49.742  -11.864 1.00 57.13  ? 824  GLU A O     1 
ATOM   1251  C  CB    . GLU A 1 176 ? -56.648 50.629  -11.258 1.00 60.78  ? 824  GLU A CB    1 
ATOM   1252  C  CG    . GLU A 1 176 ? -56.320 50.575  -12.735 1.00 64.00  ? 824  GLU A CG    1 
ATOM   1253  C  CD    . GLU A 1 176 ? -55.178 51.511  -13.109 1.00 71.52  ? 824  GLU A CD    1 
ATOM   1254  O  OE1   . GLU A 1 176 ? -55.099 52.623  -12.538 1.00 73.22  ? 824  GLU A OE1   1 
ATOM   1255  O  OE2   . GLU A 1 176 ? -54.352 51.133  -13.971 1.00 69.44  ? 824  GLU A OE2   1 
ATOM   1256  N  N     . ASN A 1 177 ? -59.441 51.351  -10.353 1.00 58.19  ? 825  ASN A N     1 
ATOM   1257  C  CA    . ASN A 1 177 ? -60.690 52.085  -10.530 1.00 55.54  ? 825  ASN A CA    1 
ATOM   1258  C  C     . ASN A 1 177 ? -60.508 53.242  -11.502 1.00 57.87  ? 825  ASN A C     1 
ATOM   1259  O  O     . ASN A 1 177 ? -59.398 53.738  -11.669 1.00 58.00  ? 825  ASN A O     1 
ATOM   1260  C  CB    . ASN A 1 177 ? -61.167 52.632  -9.193  1.00 57.58  ? 825  ASN A CB    1 
ATOM   1261  C  CG    . ASN A 1 177 ? -61.463 51.543  -8.187  1.00 61.65  ? 825  ASN A CG    1 
ATOM   1262  O  OD1   . ASN A 1 177 ? -62.000 50.489  -8.529  1.00 63.05  ? 825  ASN A OD1   1 
ATOM   1263  N  ND2   . ASN A 1 177 ? -61.123 51.797  -6.932  1.00 65.44  ? 825  ASN A ND2   1 
ATOM   1264  N  N     . MET A 1 178 ? -61.597 53.684  -12.128 1.00 60.98  ? 826  MET A N     1 
ATOM   1265  C  CA    . MET A 1 178 ? -61.512 54.722  -13.159 1.00 63.97  ? 826  MET A CA    1 
ATOM   1266  C  C     . MET A 1 178 ? -62.818 55.405  -13.515 1.00 64.38  ? 826  MET A C     1 
ATOM   1267  O  O     . MET A 1 178 ? -63.875 54.781  -13.548 1.00 64.28  ? 826  MET A O     1 
ATOM   1268  C  CB    . MET A 1 178 ? -60.956 54.138  -14.444 1.00 63.17  ? 826  MET A CB    1 
ATOM   1269  C  CG    . MET A 1 178 ? -59.485 53.993  -14.449 1.00 62.91  ? 826  MET A CG    1 
ATOM   1270  S  SD    . MET A 1 178 ? -59.024 53.177  -15.955 1.00 71.71  ? 826  MET A SD    1 
ATOM   1271  C  CE    . MET A 1 178 ? -57.476 52.482  -15.406 1.00 70.79  ? 826  MET A CE    1 
ATOM   1272  N  N     . GLN A 1 179 ? -62.727 56.692  -13.825 1.00 66.57  ? 827  GLN A N     1 
ATOM   1273  C  CA    . GLN A 1 179 ? -63.879 57.415  -14.316 1.00 68.90  ? 827  GLN A CA    1 
ATOM   1274  C  C     . GLN A 1 179 ? -64.230 56.864  -15.687 1.00 66.06  ? 827  GLN A C     1 
ATOM   1275  O  O     . GLN A 1 179 ? -63.367 56.745  -16.554 1.00 63.00  ? 827  GLN A O     1 
ATOM   1276  C  CB    . GLN A 1 179 ? -63.595 58.915  -14.379 1.00 75.56  ? 827  GLN A CB    1 
ATOM   1277  C  CG    . GLN A 1 179 ? -64.855 59.774  -14.508 1.00 81.54  ? 827  GLN A CG    1 
ATOM   1278  C  CD    . GLN A 1 179 ? -64.645 61.204  -14.032 1.00 85.92  ? 827  GLN A CD    1 
ATOM   1279  O  OE1   . GLN A 1 179 ? -63.511 61.681  -13.940 1.00 86.19  ? 827  GLN A OE1   1 
ATOM   1280  N  NE2   . GLN A 1 179 ? -65.741 61.892  -13.717 1.00 81.49  ? 827  GLN A NE2   1 
ATOM   1281  N  N     . LEU A 1 180 ? -65.499 56.513  -15.864 1.00 66.55  ? 828  LEU A N     1 
ATOM   1282  C  CA    . LEU A 1 180 ? -65.982 55.932  -17.112 1.00 65.38  ? 828  LEU A CA    1 
ATOM   1283  C  C     . LEU A 1 180 ? -65.400 56.608  -18.340 1.00 68.10  ? 828  LEU A C     1 
ATOM   1284  O  O     . LEU A 1 180 ? -65.232 55.976  -19.379 1.00 69.49  ? 828  LEU A O     1 
ATOM   1285  C  CB    . LEU A 1 180 ? -67.507 56.003  -17.190 1.00 62.75  ? 828  LEU A CB    1 
ATOM   1286  C  CG    . LEU A 1 180 ? -68.298 55.224  -16.144 1.00 66.27  ? 828  LEU A CG    1 
ATOM   1287  C  CD1   . LEU A 1 180 ? -69.780 55.344  -16.423 1.00 67.56  ? 828  LEU A CD1   1 
ATOM   1288  C  CD2   . LEU A 1 180 ? -67.888 53.769  -16.145 1.00 68.09  ? 828  LEU A CD2   1 
ATOM   1289  N  N     . SER A 1 181 ? -65.101 57.897  -18.223 1.00 70.43  ? 829  SER A N     1 
ATOM   1290  C  CA    . SER A 1 181 ? -64.661 58.681  -19.372 1.00 70.09  ? 829  SER A CA    1 
ATOM   1291  C  C     . SER A 1 181 ? -63.295 58.252  -19.916 1.00 71.65  ? 829  SER A C     1 
ATOM   1292  O  O     . SER A 1 181 ? -62.885 58.696  -20.993 1.00 71.72  ? 829  SER A O     1 
ATOM   1293  C  CB    . SER A 1 181 ? -64.681 60.175  -19.039 1.00 73.35  ? 829  SER A CB    1 
ATOM   1294  O  OG    . SER A 1 181 ? -64.185 60.420  -17.734 1.00 75.44  ? 829  SER A OG    1 
ATOM   1295  N  N     . TYR A 1 182 ? -62.598 57.388  -19.178 1.00 71.46  ? 830  TYR A N     1 
ATOM   1296  C  CA    . TYR A 1 182 ? -61.318 56.841  -19.636 1.00 71.01  ? 830  TYR A CA    1 
ATOM   1297  C  C     . TYR A 1 182 ? -61.519 55.751  -20.689 1.00 66.77  ? 830  TYR A C     1 
ATOM   1298  O  O     . TYR A 1 182 ? -60.628 55.478  -21.503 1.00 63.61  ? 830  TYR A O     1 
ATOM   1299  C  CB    . TYR A 1 182 ? -60.498 56.303  -18.464 1.00 66.97  ? 830  TYR A CB    1 
ATOM   1300  C  CG    . TYR A 1 182 ? -59.813 57.374  -17.648 1.00 71.84  ? 830  TYR A CG    1 
ATOM   1301  C  CD1   . TYR A 1 182 ? -60.228 57.657  -16.355 1.00 74.47  ? 830  TYR A CD1   1 
ATOM   1302  C  CD2   . TYR A 1 182 ? -58.750 58.105  -18.171 1.00 74.17  ? 830  TYR A CD2   1 
ATOM   1303  C  CE1   . TYR A 1 182 ? -59.603 58.636  -15.598 1.00 77.44  ? 830  TYR A CE1   1 
ATOM   1304  C  CE2   . TYR A 1 182 ? -58.119 59.086  -17.423 1.00 75.42  ? 830  TYR A CE2   1 
ATOM   1305  C  CZ    . TYR A 1 182 ? -58.552 59.348  -16.138 1.00 80.05  ? 830  TYR A CZ    1 
ATOM   1306  O  OH    . TYR A 1 182 ? -57.940 60.319  -15.378 1.00 82.42  ? 830  TYR A OH    1 
ATOM   1307  N  N     . ILE A 1 183 ? -62.701 55.142  -20.663 1.00 62.88  ? 831  ILE A N     1 
ATOM   1308  C  CA    . ILE A 1 183 ? -63.102 54.153  -21.655 1.00 62.97  ? 831  ILE A CA    1 
ATOM   1309  C  C     . ILE A 1 183 ? -63.107 54.734  -23.065 1.00 63.98  ? 831  ILE A C     1 
ATOM   1310  O  O     . ILE A 1 183 ? -63.662 55.799  -23.297 1.00 68.18  ? 831  ILE A O     1 
ATOM   1311  C  CB    . ILE A 1 183 ? -64.520 53.622  -21.359 1.00 63.20  ? 831  ILE A CB    1 
ATOM   1312  C  CG1   . ILE A 1 183 ? -64.550 52.866  -20.029 1.00 58.66  ? 831  ILE A CG1   1 
ATOM   1313  C  CG2   . ILE A 1 183 ? -65.011 52.740  -22.498 1.00 62.57  ? 831  ILE A CG2   1 
ATOM   1314  C  CD1   . ILE A 1 183 ? -65.924 52.390  -19.640 1.00 57.56  ? 831  ILE A CD1   1 
ATOM   1315  N  N     . HIS A 1 184 ? -62.492 54.025  -24.004 1.00 64.43  ? 832  HIS A N     1 
ATOM   1316  C  CA    . HIS A 1 184 ? -62.537 54.405  -25.413 1.00 70.46  ? 832  HIS A CA    1 
ATOM   1317  C  C     . HIS A 1 184 ? -63.681 53.681  -26.133 1.00 71.24  ? 832  HIS A C     1 
ATOM   1318  O  O     . HIS A 1 184 ? -64.748 54.252  -26.373 1.00 72.01  ? 832  HIS A O     1 
ATOM   1319  C  CB    . HIS A 1 184 ? -61.197 54.091  -26.086 1.00 71.46  ? 832  HIS A CB    1 
ATOM   1320  C  CG    . HIS A 1 184 ? -61.224 54.190  -27.582 1.00 74.83  ? 832  HIS A CG    1 
ATOM   1321  N  ND1   . HIS A 1 184 ? -60.512 55.144  -28.278 1.00 78.23  ? 832  HIS A ND1   1 
ATOM   1322  C  CD2   . HIS A 1 184 ? -61.865 53.444  -28.513 1.00 72.53  ? 832  HIS A CD2   1 
ATOM   1323  C  CE1   . HIS A 1 184 ? -60.721 54.985  -29.573 1.00 81.68  ? 832  HIS A CE1   1 
ATOM   1324  N  NE2   . HIS A 1 184 ? -61.538 53.961  -29.743 1.00 78.96  ? 832  HIS A NE2   1 
ATOM   1325  N  N     . SER A 1 185 ? -63.453 52.418  -26.476 1.00 69.69  ? 833  SER A N     1 
ATOM   1326  C  CA    . SER A 1 185 ? -64.472 51.613  -27.140 1.00 68.10  ? 833  SER A CA    1 
ATOM   1327  C  C     . SER A 1 185 ? -64.775 50.362  -26.327 1.00 61.43  ? 833  SER A C     1 
ATOM   1328  O  O     . SER A 1 185 ? -64.042 50.018  -25.400 1.00 59.83  ? 833  SER A O     1 
ATOM   1329  C  CB    . SER A 1 185 ? -64.027 51.219  -28.550 1.00 64.22  ? 833  SER A CB    1 
ATOM   1330  N  N     . LYS A 1 186 ? -65.869 49.695  -26.672 1.00 57.62  ? 834  LYS A N     1 
ATOM   1331  C  CA    . LYS A 1 186 ? -66.173 48.394  -26.101 1.00 58.56  ? 834  LYS A CA    1 
ATOM   1332  C  C     . LYS A 1 186 ? -65.823 47.302  -27.123 1.00 59.54  ? 834  LYS A C     1 
ATOM   1333  O  O     . LYS A 1 186 ? -66.377 47.263  -28.225 1.00 60.51  ? 834  LYS A O     1 
ATOM   1334  C  CB    . LYS A 1 186 ? -67.640 48.331  -25.638 1.00 57.47  ? 834  LYS A CB    1 
ATOM   1335  C  CG    . LYS A 1 186 ? -68.520 47.300  -26.336 1.00 59.81  ? 834  LYS A CG    1 
ATOM   1336  C  CD    . LYS A 1 186 ? -69.950 47.342  -25.796 1.00 61.71  ? 834  LYS A CD    1 
ATOM   1337  C  CE    . LYS A 1 186 ? -70.899 46.482  -26.626 1.00 63.95  ? 834  LYS A CE    1 
ATOM   1338  N  NZ    . LYS A 1 186 ? -72.314 46.579  -26.159 1.00 63.03  ? 834  LYS A NZ    1 
ATOM   1339  N  N     . VAL A 1 187 ? -64.871 46.442  -26.764 1.00 55.07  ? 835  VAL A N     1 
ATOM   1340  C  CA    . VAL A 1 187 ? -64.441 45.359  -27.644 1.00 52.86  ? 835  VAL A CA    1 
ATOM   1341  C  C     . VAL A 1 187 ? -64.910 43.994  -27.140 1.00 52.39  ? 835  VAL A C     1 
ATOM   1342  O  O     . VAL A 1 187 ? -64.958 43.746  -25.931 1.00 51.67  ? 835  VAL A O     1 
ATOM   1343  C  CB    . VAL A 1 187 ? -62.907 45.354  -27.846 1.00 53.49  ? 835  VAL A CB    1 
ATOM   1344  C  CG1   . VAL A 1 187 ? -62.476 46.575  -28.647 1.00 60.73  ? 835  VAL A CG1   1 
ATOM   1345  C  CG2   . VAL A 1 187 ? -62.184 45.304  -26.514 1.00 49.56  ? 835  VAL A CG2   1 
ATOM   1346  N  N     . LYS A 1 188 ? -65.269 43.118  -28.072 1.00 48.39  ? 836  LYS A N     1 
ATOM   1347  C  CA    . LYS A 1 188 ? -65.736 41.785  -27.721 1.00 46.64  ? 836  LYS A CA    1 
ATOM   1348  C  C     . LYS A 1 188 ? -64.572 40.849  -27.440 1.00 50.72  ? 836  LYS A C     1 
ATOM   1349  O  O     . LYS A 1 188 ? -63.611 40.793  -28.212 1.00 53.02  ? 836  LYS A O     1 
ATOM   1350  C  CB    . LYS A 1 188 ? -66.595 41.208  -28.841 1.00 46.58  ? 836  LYS A CB    1 
ATOM   1351  C  CG    . LYS A 1 188 ? -66.431 39.713  -29.010 1.00 50.52  ? 836  LYS A CG    1 
ATOM   1352  C  CD    . LYS A 1 188 ? -67.478 39.126  -29.935 1.00 52.81  ? 836  LYS A CD    1 
ATOM   1353  C  CE    . LYS A 1 188 ? -68.851 39.164  -29.298 1.00 58.78  ? 836  LYS A CE    1 
ATOM   1354  N  NZ    . LYS A 1 188 ? -69.863 38.512  -30.175 1.00 65.35  ? 836  LYS A NZ    1 
ATOM   1355  N  N     . VAL A 1 189 ? -64.659 40.115  -26.333 1.00 48.84  ? 837  VAL A N     1 
ATOM   1356  C  CA    . VAL A 1 189 ? -63.622 39.151  -25.983 1.00 48.28  ? 837  VAL A CA    1 
ATOM   1357  C  C     . VAL A 1 189 ? -64.204 37.797  -25.591 1.00 50.32  ? 837  VAL A C     1 
ATOM   1358  O  O     . VAL A 1 189 ? -64.966 37.679  -24.626 1.00 49.68  ? 837  VAL A O     1 
ATOM   1359  C  CB    . VAL A 1 189 ? -62.694 39.674  -24.869 1.00 48.12  ? 837  VAL A CB    1 
ATOM   1360  C  CG1   . VAL A 1 189 ? -61.635 38.638  -24.522 1.00 46.47  ? 837  VAL A CG1   1 
ATOM   1361  C  CG2   . VAL A 1 189 ? -62.043 40.980  -25.294 1.00 46.80  ? 837  VAL A CG2   1 
ATOM   1362  N  N     . ILE A 1 190 ? -63.836 36.777  -26.363 1.00 52.60  ? 838  ILE A N     1 
ATOM   1363  C  CA    . ILE A 1 190 ? -64.303 35.410  -26.146 1.00 49.34  ? 838  ILE A CA    1 
ATOM   1364  C  C     . ILE A 1 190 ? -63.306 34.631  -25.295 1.00 49.59  ? 838  ILE A C     1 
ATOM   1365  O  O     . ILE A 1 190 ? -62.094 34.835  -25.386 1.00 47.33  ? 838  ILE A O     1 
ATOM   1366  C  CB    . ILE A 1 190 ? -64.522 34.663  -27.484 1.00 42.34  ? 838  ILE A CB    1 
ATOM   1367  N  N     . TYR A 1 191 ? -63.831 33.742  -24.460 1.00 49.51  ? 839  TYR A N     1 
ATOM   1368  C  CA    . TYR A 1 191 ? -63.003 32.898  -23.612 1.00 47.13  ? 839  TYR A CA    1 
ATOM   1369  C  C     . TYR A 1 191 ? -62.890 31.503  -24.227 1.00 47.06  ? 839  TYR A C     1 
ATOM   1370  O  O     . TYR A 1 191 ? -63.843 30.729  -24.189 1.00 48.95  ? 839  TYR A O     1 
ATOM   1371  C  CB    . TYR A 1 191 ? -63.600 32.841  -22.204 1.00 43.87  ? 839  TYR A CB    1 
ATOM   1372  C  CG    . TYR A 1 191 ? -63.138 31.670  -21.378 1.00 44.20  ? 839  TYR A CG    1 
ATOM   1373  C  CD1   . TYR A 1 191 ? -64.049 30.787  -20.825 1.00 44.32  ? 839  TYR A CD1   1 
ATOM   1374  C  CD2   . TYR A 1 191 ? -61.793 31.442  -21.159 1.00 45.28  ? 839  TYR A CD2   1 
ATOM   1375  C  CE1   . TYR A 1 191 ? -63.635 29.715  -20.073 1.00 44.76  ? 839  TYR A CE1   1 
ATOM   1376  C  CE2   . TYR A 1 191 ? -61.369 30.368  -20.407 1.00 47.14  ? 839  TYR A CE2   1 
ATOM   1377  C  CZ    . TYR A 1 191 ? -62.294 29.509  -19.867 1.00 45.62  ? 839  TYR A CZ    1 
ATOM   1378  O  OH    . TYR A 1 191 ? -61.869 28.441  -19.121 1.00 47.58  ? 839  TYR A OH    1 
ATOM   1379  N  N     . LYS A 1 192 ? -61.732 31.192  -24.810 1.00 45.67  ? 840  LYS A N     1 
ATOM   1380  C  CA    . LYS A 1 192 ? -61.536 29.906  -25.486 1.00 47.68  ? 840  LYS A CA    1 
ATOM   1381  C  C     . LYS A 1 192 ? -61.240 28.779  -24.494 1.00 49.72  ? 840  LYS A C     1 
ATOM   1382  O  O     . LYS A 1 192 ? -60.088 28.377  -24.323 1.00 51.96  ? 840  LYS A O     1 
ATOM   1383  C  CB    . LYS A 1 192 ? -60.434 29.995  -26.560 1.00 47.14  ? 840  LYS A CB    1 
ATOM   1384  C  CG    . LYS A 1 192 ? -60.220 28.706  -27.372 1.00 49.20  ? 840  LYS A CG    1 
ATOM   1385  C  CD    . LYS A 1 192 ? -59.410 28.936  -28.657 1.00 53.79  ? 840  LYS A CD    1 
ATOM   1386  C  CE    . LYS A 1 192 ? -60.193 29.766  -29.696 1.00 61.53  ? 840  LYS A CE    1 
ATOM   1387  N  NZ    . LYS A 1 192 ? -59.328 30.340  -30.793 1.00 54.35  ? 840  LYS A NZ    1 
ATOM   1388  N  N     . ALA A 1 193 ? -62.285 28.270  -23.846 1.00 48.00  ? 841  ALA A N     1 
ATOM   1389  C  CA    . ALA A 1 193 ? -62.133 27.170  -22.899 1.00 49.01  ? 841  ALA A CA    1 
ATOM   1390  C  C     . ALA A 1 193 ? -61.851 25.862  -23.626 1.00 50.00  ? 841  ALA A C     1 
ATOM   1391  O  O     . ALA A 1 193 ? -62.233 25.698  -24.786 1.00 47.52  ? 841  ALA A O     1 
ATOM   1392  C  CB    . ALA A 1 193 ? -63.370 27.039  -22.030 1.00 49.89  ? 841  ALA A CB    1 
ATOM   1393  N  N     . PRO A 1 194 ? -61.172 24.929  -22.941 1.00 51.08  ? 842  PRO A N     1 
ATOM   1394  C  CA    . PRO A 1 194 ? -60.797 23.629  -23.502 1.00 50.73  ? 842  PRO A CA    1 
ATOM   1395  C  C     . PRO A 1 194 ? -62.011 22.765  -23.847 1.00 54.13  ? 842  PRO A C     1 
ATOM   1396  O  O     . PRO A 1 194 ? -62.969 22.692  -23.068 1.00 52.35  ? 842  PRO A O     1 
ATOM   1397  C  CB    . PRO A 1 194 ? -59.993 22.983  -22.369 1.00 50.33  ? 842  PRO A CB    1 
ATOM   1398  C  CG    . PRO A 1 194 ? -59.499 24.116  -21.560 1.00 50.52  ? 842  PRO A CG    1 
ATOM   1399  C  CD    . PRO A 1 194 ? -60.614 25.116  -21.592 1.00 51.71  ? 842  PRO A CD    1 
ATOM   1400  N  N     . SER A 1 195 ? -61.952 22.118  -25.011 1.00 53.80  ? 843  SER A N     1 
ATOM   1401  C  CA    . SER A 1 195 ? -63.028 21.264  -25.507 1.00 54.34  ? 843  SER A CA    1 
ATOM   1402  C  C     . SER A 1 195 ? -63.339 20.093  -24.572 1.00 53.88  ? 843  SER A C     1 
ATOM   1403  O  O     . SER A 1 195 ? -62.531 19.742  -23.714 1.00 53.26  ? 843  SER A O     1 
ATOM   1404  C  CB    . SER A 1 195 ? -62.664 20.731  -26.897 1.00 55.17  ? 843  SER A CB    1 
ATOM   1405  O  OG    . SER A 1 195 ? -63.582 19.737  -27.322 1.00 60.75  ? 843  SER A OG    1 
ATOM   1406  N  N     . GLU A 1 196 ? -64.512 19.490  -24.741 1.00 55.43  ? 844  GLU A N     1 
ATOM   1407  C  CA    . GLU A 1 196 ? -64.866 18.299  -23.968 1.00 57.20  ? 844  GLU A CA    1 
ATOM   1408  C  C     . GLU A 1 196 ? -63.870 17.178  -24.255 1.00 54.53  ? 844  GLU A C     1 
ATOM   1409  O  O     . GLU A 1 196 ? -63.403 16.493  -23.340 1.00 50.78  ? 844  GLU A O     1 
ATOM   1410  C  CB    . GLU A 1 196 ? -66.295 17.847  -24.285 1.00 60.91  ? 844  GLU A CB    1 
ATOM   1411  N  N     . ASN A 1 197 ? -63.555 17.006  -25.537 1.00 52.51  ? 845  ASN A N     1 
ATOM   1412  C  CA    . ASN A 1 197 ? -62.580 16.014  -25.975 1.00 53.15  ? 845  ASN A CA    1 
ATOM   1413  C  C     . ASN A 1 197 ? -61.275 16.698  -26.344 1.00 52.98  ? 845  ASN A C     1 
ATOM   1414  O  O     . ASN A 1 197 ? -60.805 16.590  -27.481 1.00 54.35  ? 845  ASN A O     1 
ATOM   1415  C  CB    . ASN A 1 197 ? -63.111 15.205  -27.166 1.00 51.13  ? 845  ASN A CB    1 
ATOM   1416  N  N     . TRP A 1 198 ? -60.701 17.412  -25.381 1.00 50.95  ? 846  TRP A N     1 
ATOM   1417  C  CA    . TRP A 1 198 ? -59.426 18.091  -25.587 1.00 50.13  ? 846  TRP A CA    1 
ATOM   1418  C  C     . TRP A 1 198 ? -58.312 17.084  -25.860 1.00 48.39  ? 846  TRP A C     1 
ATOM   1419  O  O     . TRP A 1 198 ? -57.599 17.185  -26.855 1.00 48.27  ? 846  TRP A O     1 
ATOM   1420  C  CB    . TRP A 1 198 ? -59.082 18.967  -24.373 1.00 48.38  ? 846  TRP A CB    1 
ATOM   1421  C  CG    . TRP A 1 198 ? -57.705 19.582  -24.395 1.00 43.73  ? 846  TRP A CG    1 
ATOM   1422  C  CD1   . TRP A 1 198 ? -57.322 20.716  -25.049 1.00 43.93  ? 846  TRP A CD1   1 
ATOM   1423  C  CD2   . TRP A 1 198 ? -56.541 19.098  -23.720 1.00 41.04  ? 846  TRP A CD2   1 
ATOM   1424  N  NE1   . TRP A 1 198 ? -55.989 20.962  -24.831 1.00 41.79  ? 846  TRP A NE1   1 
ATOM   1425  C  CE2   . TRP A 1 198 ? -55.486 19.981  -24.016 1.00 41.60  ? 846  TRP A CE2   1 
ATOM   1426  C  CE3   . TRP A 1 198 ? -56.284 17.995  -22.904 1.00 40.38  ? 846  TRP A CE3   1 
ATOM   1427  C  CZ2   . TRP A 1 198 ? -54.197 19.799  -23.521 1.00 39.34  ? 846  TRP A CZ2   1 
ATOM   1428  C  CZ3   . TRP A 1 198 ? -55.006 17.818  -22.413 1.00 40.69  ? 846  TRP A CZ3   1 
ATOM   1429  C  CH2   . TRP A 1 198 ? -53.978 18.714  -22.722 1.00 38.30  ? 846  TRP A CH2   1 
ATOM   1430  N  N     . ALA A 1 199 ? -58.174 16.102  -24.979 1.00 45.76  ? 847  ALA A N     1 
ATOM   1431  C  CA    . ALA A 1 199 ? -57.101 15.129  -25.107 1.00 45.46  ? 847  ALA A CA    1 
ATOM   1432  C  C     . ALA A 1 199 ? -57.060 14.445  -26.481 1.00 48.14  ? 847  ALA A C     1 
ATOM   1433  O  O     . ALA A 1 199 ? -56.001 14.007  -26.942 1.00 48.09  ? 847  ALA A O     1 
ATOM   1434  C  CB    . ALA A 1 199 ? -57.209 14.100  -24.005 1.00 43.80  ? 847  ALA A CB    1 
ATOM   1435  N  N     . MET A 1 200 ? -58.206 14.366  -27.142 1.00 48.68  ? 848  MET A N     1 
ATOM   1436  C  CA    . MET A 1 200 ? -58.307 13.543  -28.342 1.00 50.70  ? 848  MET A CA    1 
ATOM   1437  C  C     . MET A 1 200 ? -58.050 14.277  -29.651 1.00 51.01  ? 848  MET A C     1 
ATOM   1438  O  O     . MET A 1 200 ? -58.116 13.666  -30.719 1.00 51.39  ? 848  MET A O     1 
ATOM   1439  C  CB    . MET A 1 200 ? -59.664 12.837  -28.395 1.00 48.77  ? 848  MET A CB    1 
ATOM   1440  C  CG    . MET A 1 200 ? -59.950 11.972  -27.183 1.00 49.22  ? 848  MET A CG    1 
ATOM   1441  S  SD    . MET A 1 200 ? -58.754 10.638  -26.978 1.00 55.04  ? 848  MET A SD    1 
ATOM   1442  C  CE    . MET A 1 200 ? -58.877 9.846   -28.581 1.00 47.87  ? 848  MET A CE    1 
ATOM   1443  N  N     . GLU A 1 201 ? -57.756 15.572  -29.575 1.00 50.83  ? 849  GLU A N     1 
ATOM   1444  C  CA    . GLU A 1 201 ? -57.523 16.370  -30.782 1.00 52.93  ? 849  GLU A CA    1 
ATOM   1445  C  C     . GLU A 1 201 ? -56.044 16.658  -31.051 1.00 52.77  ? 849  GLU A C     1 
ATOM   1446  O  O     . GLU A 1 201 ? -55.642 17.813  -31.140 1.00 50.30  ? 849  GLU A O     1 
ATOM   1447  C  CB    . GLU A 1 201 ? -58.320 17.676  -30.719 1.00 52.45  ? 849  GLU A CB    1 
ATOM   1448  C  CG    . GLU A 1 201 ? -58.544 18.183  -29.300 1.00 54.69  ? 849  GLU A CG    1 
ATOM   1449  C  CD    . GLU A 1 201 ? -59.409 19.438  -29.234 1.00 59.10  ? 849  GLU A CD    1 
ATOM   1450  O  OE1   . GLU A 1 201 ? -60.619 19.347  -29.548 1.00 58.14  ? 849  GLU A OE1   1 
ATOM   1451  O  OE2   . GLU A 1 201 ? -58.876 20.509  -28.856 1.00 56.79  ? 849  GLU A OE2   1 
ATOM   1452  N  N     . GLY A 1 202 ? -55.246 15.601  -31.188 1.00 52.11  ? 850  GLY A N     1 
ATOM   1453  C  CA    . GLY A 1 202 ? -53.829 15.739  -31.469 1.00 52.53  ? 850  GLY A CA    1 
ATOM   1454  C  C     . GLY A 1 202 ? -53.521 16.377  -32.818 1.00 61.51  ? 850  GLY A C     1 
ATOM   1455  O  O     . GLY A 1 202 ? -52.923 17.455  -32.878 1.00 58.73  ? 850  GLY A O     1 
ATOM   1456  N  N     . GLY A 1 203 ? -53.916 15.711  -33.903 1.00 65.05  ? 851  GLY A N     1 
ATOM   1457  C  CA    . GLY A 1 203 ? -53.690 16.234  -35.240 1.00 62.40  ? 851  GLY A CA    1 
ATOM   1458  C  C     . GLY A 1 203 ? -54.776 17.208  -35.672 1.00 70.51  ? 851  GLY A C     1 
ATOM   1459  O  O     . GLY A 1 203 ? -54.511 18.382  -35.951 1.00 70.82  ? 851  GLY A O     1 
ATOM   1460  N  N     . LYS A 1 217 ? -61.533 36.270  -36.211 1.00 67.03  ? 865  LYS A N     1 
ATOM   1461  C  CA    . LYS A 1 217 ? -61.006 37.627  -36.069 1.00 74.43  ? 865  LYS A CA    1 
ATOM   1462  C  C     . LYS A 1 217 ? -61.563 38.357  -34.837 1.00 71.79  ? 865  LYS A C     1 
ATOM   1463  O  O     . LYS A 1 217 ? -62.059 39.486  -34.936 1.00 68.75  ? 865  LYS A O     1 
ATOM   1464  C  CB    . LYS A 1 217 ? -61.256 38.447  -37.340 1.00 73.42  ? 865  LYS A CB    1 
ATOM   1465  N  N     . THR A 1 218 ? -61.460 37.710  -33.677 1.00 69.83  ? 866  THR A N     1 
ATOM   1466  C  CA    . THR A 1 218 ? -61.935 38.283  -32.415 1.00 63.96  ? 866  THR A CA    1 
ATOM   1467  C  C     . THR A 1 218 ? -60.906 38.140  -31.288 1.00 60.50  ? 866  THR A C     1 
ATOM   1468  O  O     . THR A 1 218 ? -60.135 37.181  -31.256 1.00 60.95  ? 866  THR A O     1 
ATOM   1469  C  CB    . THR A 1 218 ? -63.244 37.605  -31.961 1.00 56.56  ? 866  THR A CB    1 
ATOM   1470  N  N     . TYR A 1 219 ? -60.891 39.092  -30.361 1.00 56.98  ? 867  TYR A N     1 
ATOM   1471  C  CA    . TYR A 1 219 ? -60.064 38.954  -29.165 1.00 52.61  ? 867  TYR A CA    1 
ATOM   1472  C  C     . TYR A 1 219 ? -60.503 37.737  -28.350 1.00 51.16  ? 867  TYR A C     1 
ATOM   1473  O  O     . TYR A 1 219 ? -61.694 37.544  -28.105 1.00 50.41  ? 867  TYR A O     1 
ATOM   1474  C  CB    . TYR A 1 219 ? -60.150 40.208  -28.294 1.00 51.09  ? 867  TYR A CB    1 
ATOM   1475  C  CG    . TYR A 1 219 ? -59.198 41.313  -28.690 1.00 57.44  ? 867  TYR A CG    1 
ATOM   1476  C  CD1   . TYR A 1 219 ? -57.819 41.137  -28.605 1.00 54.85  ? 867  TYR A CD1   1 
ATOM   1477  C  CD2   . TYR A 1 219 ? -59.678 42.547  -29.129 1.00 59.02  ? 867  TYR A CD2   1 
ATOM   1478  C  CE1   . TYR A 1 219 ? -56.950 42.151  -28.961 1.00 55.15  ? 867  TYR A CE1   1 
ATOM   1479  C  CE2   . TYR A 1 219 ? -58.813 43.569  -29.485 1.00 52.76  ? 867  TYR A CE2   1 
ATOM   1480  C  CZ    . TYR A 1 219 ? -57.455 43.366  -29.399 1.00 54.66  ? 867  TYR A CZ    1 
ATOM   1481  O  OH    . TYR A 1 219 ? -56.596 44.382  -29.753 1.00 57.43  ? 867  TYR A OH    1 
ATOM   1482  N  N     . PHE A 1 220 ? -59.544 36.916  -27.933 1.00 48.43  ? 868  PHE A N     1 
ATOM   1483  C  CA    . PHE A 1 220 ? -59.856 35.752  -27.105 1.00 48.89  ? 868  PHE A CA    1 
ATOM   1484  C  C     . PHE A 1 220 ? -58.825 35.556  -26.000 1.00 44.39  ? 868  PHE A C     1 
ATOM   1485  O  O     . PHE A 1 220 ? -57.695 36.034  -26.090 1.00 44.09  ? 868  PHE A O     1 
ATOM   1486  C  CB    . PHE A 1 220 ? -59.938 34.478  -27.954 1.00 49.68  ? 868  PHE A CB    1 
ATOM   1487  C  CG    . PHE A 1 220 ? -58.598 33.872  -28.258 1.00 48.27  ? 868  PHE A CG    1 
ATOM   1488  C  CD1   . PHE A 1 220 ? -57.874 34.280  -29.361 1.00 48.25  ? 868  PHE A CD1   1 
ATOM   1489  C  CD2   . PHE A 1 220 ? -58.057 32.909  -27.429 1.00 47.17  ? 868  PHE A CD2   1 
ATOM   1490  C  CE1   . PHE A 1 220 ? -56.643 33.740  -29.630 1.00 47.67  ? 868  PHE A CE1   1 
ATOM   1491  C  CE2   . PHE A 1 220 ? -56.826 32.366  -27.694 1.00 47.37  ? 868  PHE A CE2   1 
ATOM   1492  C  CZ    . PHE A 1 220 ? -56.118 32.784  -28.796 1.00 50.32  ? 868  PHE A CZ    1 
ATOM   1493  N  N     . PHE A 1 221 ? -59.221 34.844  -24.956 1.00 41.92  ? 869  PHE A N     1 
ATOM   1494  C  CA    . PHE A 1 221 ? -58.288 34.481  -23.906 1.00 43.44  ? 869  PHE A CA    1 
ATOM   1495  C  C     . PHE A 1 221 ? -58.612 33.096  -23.375 1.00 44.33  ? 869  PHE A C     1 
ATOM   1496  O  O     . PHE A 1 221 ? -59.762 32.657  -23.417 1.00 44.91  ? 869  PHE A O     1 
ATOM   1497  C  CB    . PHE A 1 221 ? -58.312 35.504  -22.771 1.00 43.23  ? 869  PHE A CB    1 
ATOM   1498  C  CG    . PHE A 1 221 ? -59.440 35.313  -21.801 1.00 42.67  ? 869  PHE A CG    1 
ATOM   1499  C  CD1   . PHE A 1 221 ? -59.210 34.755  -20.558 1.00 43.10  ? 869  PHE A CD1   1 
ATOM   1500  C  CD2   . PHE A 1 221 ? -60.730 35.699  -22.129 1.00 45.21  ? 869  PHE A CD2   1 
ATOM   1501  C  CE1   . PHE A 1 221 ? -60.249 34.581  -19.658 1.00 44.49  ? 869  PHE A CE1   1 
ATOM   1502  C  CE2   . PHE A 1 221 ? -61.773 35.527  -21.233 1.00 46.42  ? 869  PHE A CE2   1 
ATOM   1503  C  CZ    . PHE A 1 221 ? -61.532 34.968  -20.000 1.00 45.81  ? 869  PHE A CZ    1 
ATOM   1504  N  N     . GLN A 1 222 ? -57.592 32.406  -22.883 1.00 42.84  ? 870  GLN A N     1 
ATOM   1505  C  CA    . GLN A 1 222 ? -57.790 31.089  -22.297 1.00 43.13  ? 870  GLN A CA    1 
ATOM   1506  C  C     . GLN A 1 222 ? -57.104 30.947  -20.937 1.00 40.50  ? 870  GLN A C     1 
ATOM   1507  O  O     . GLN A 1 222 ? -57.571 30.206  -20.076 1.00 38.27  ? 870  GLN A O     1 
ATOM   1508  C  CB    . GLN A 1 222 ? -57.324 29.998  -23.264 1.00 43.91  ? 870  GLN A CB    1 
ATOM   1509  C  CG    . GLN A 1 222 ? -55.885 30.132  -23.728 1.00 45.91  ? 870  GLN A CG    1 
ATOM   1510  C  CD    . GLN A 1 222 ? -55.508 29.093  -24.769 1.00 46.09  ? 870  GLN A CD    1 
ATOM   1511  O  OE1   . GLN A 1 222 ? -54.744 29.375  -25.695 1.00 46.18  ? 870  GLN A OE1   1 
ATOM   1512  N  NE2   . GLN A 1 222 ? -56.042 27.883  -24.621 1.00 44.51  ? 870  GLN A NE2   1 
ATOM   1513  N  N     . LEU A 1 223 ? -56.019 31.691  -20.741 1.00 40.56  ? 871  LEU A N     1 
ATOM   1514  C  CA    . LEU A 1 223 ? -55.169 31.522  -19.566 1.00 41.55  ? 871  LEU A CA    1 
ATOM   1515  C  C     . LEU A 1 223 ? -54.889 32.787  -18.747 1.00 41.04  ? 871  LEU A C     1 
ATOM   1516  O  O     . LEU A 1 223 ? -55.144 33.910  -19.176 1.00 40.72  ? 871  LEU A O     1 
ATOM   1517  C  CB    . LEU A 1 223 ? -53.834 30.891  -19.975 1.00 41.89  ? 871  LEU A CB    1 
ATOM   1518  C  CG    . LEU A 1 223 ? -53.878 29.427  -20.403 1.00 41.73  ? 871  LEU A CG    1 
ATOM   1519  C  CD1   . LEU A 1 223 ? -52.790 29.131  -21.422 1.00 40.86  ? 871  LEU A CD1   1 
ATOM   1520  C  CD2   . LEU A 1 223 ? -53.749 28.531  -19.189 1.00 39.69  ? 871  LEU A CD2   1 
ATOM   1521  N  N     . TRP A 1 224 ? -54.330 32.563  -17.564 1.00 40.49  ? 872  TRP A N     1 
ATOM   1522  C  CA    . TRP A 1 224 ? -53.972 33.608  -16.625 1.00 38.27  ? 872  TRP A CA    1 
ATOM   1523  C  C     . TRP A 1 224 ? -52.454 33.703  -16.618 1.00 41.52  ? 872  TRP A C     1 
ATOM   1524  O  O     . TRP A 1 224 ? -51.771 32.675  -16.655 1.00 42.29  ? 872  TRP A O     1 
ATOM   1525  C  CB    . TRP A 1 224 ? -54.459 33.182  -15.252 1.00 39.60  ? 872  TRP A CB    1 
ATOM   1526  C  CG    . TRP A 1 224 ? -54.334 34.198  -14.194 1.00 42.50  ? 872  TRP A CG    1 
ATOM   1527  C  CD1   . TRP A 1 224 ? -53.193 34.574  -13.547 1.00 40.96  ? 872  TRP A CD1   1 
ATOM   1528  C  CD2   . TRP A 1 224 ? -55.399 34.958  -13.612 1.00 43.08  ? 872  TRP A CD2   1 
ATOM   1529  N  NE1   . TRP A 1 224 ? -53.482 35.534  -12.604 1.00 40.42  ? 872  TRP A NE1   1 
ATOM   1530  C  CE2   . TRP A 1 224 ? -54.829 35.787  -12.626 1.00 39.74  ? 872  TRP A CE2   1 
ATOM   1531  C  CE3   . TRP A 1 224 ? -56.777 35.021  -13.833 1.00 41.53  ? 872  TRP A CE3   1 
ATOM   1532  C  CZ2   . TRP A 1 224 ? -55.587 36.668  -11.866 1.00 38.97  ? 872  TRP A CZ2   1 
ATOM   1533  C  CZ3   . TRP A 1 224 ? -57.524 35.898  -13.073 1.00 43.93  ? 872  TRP A CZ3   1 
ATOM   1534  C  CH2   . TRP A 1 224 ? -56.927 36.711  -12.103 1.00 41.33  ? 872  TRP A CH2   1 
ATOM   1535  N  N     . TYR A 1 225 ? -51.917 34.918  -16.571 1.00 39.04  ? 873  TYR A N     1 
ATOM   1536  C  CA    . TYR A 1 225 ? -50.472 35.101  -16.683 1.00 35.90  ? 873  TYR A CA    1 
ATOM   1537  C  C     . TYR A 1 225 ? -49.856 35.762  -15.462 1.00 38.39  ? 873  TYR A C     1 
ATOM   1538  O  O     . TYR A 1 225 ? -50.132 36.923  -15.149 1.00 42.10  ? 873  TYR A O     1 
ATOM   1539  C  CB    . TYR A 1 225 ? -50.123 35.898  -17.941 1.00 35.94  ? 873  TYR A CB    1 
ATOM   1540  C  CG    . TYR A 1 225 ? -48.647 36.194  -18.117 1.00 38.72  ? 873  TYR A CG    1 
ATOM   1541  C  CD1   . TYR A 1 225 ? -47.739 35.177  -18.366 1.00 39.44  ? 873  TYR A CD1   1 
ATOM   1542  C  CD2   . TYR A 1 225 ? -48.165 37.494  -18.063 1.00 38.69  ? 873  TYR A CD2   1 
ATOM   1543  C  CE1   . TYR A 1 225 ? -46.393 35.443  -18.543 1.00 39.31  ? 873  TYR A CE1   1 
ATOM   1544  C  CE2   . TYR A 1 225 ? -46.820 37.767  -18.235 1.00 40.52  ? 873  TYR A CE2   1 
ATOM   1545  C  CZ    . TYR A 1 225 ? -45.940 36.739  -18.477 1.00 41.07  ? 873  TYR A CZ    1 
ATOM   1546  O  OH    . TYR A 1 225 ? -44.600 37.001  -18.651 1.00 40.90  ? 873  TYR A OH    1 
ATOM   1547  N  N     . ASN A 1 226 ? -49.009 35.014  -14.773 1.00 39.51  ? 874  ASN A N     1 
ATOM   1548  C  CA    . ASN A 1 226 ? -48.219 35.577  -13.696 1.00 41.14  ? 874  ASN A CA    1 
ATOM   1549  C  C     . ASN A 1 226 ? -46.903 36.104  -14.253 1.00 42.61  ? 874  ASN A C     1 
ATOM   1550  O  O     . ASN A 1 226 ? -46.036 35.348  -14.674 1.00 40.05  ? 874  ASN A O     1 
ATOM   1551  C  CB    . ASN A 1 226 ? -47.973 34.539  -12.611 1.00 40.81  ? 874  ASN A CB    1 
ATOM   1552  C  CG    . ASN A 1 226 ? -47.378 35.137  -11.358 1.00 43.94  ? 874  ASN A CG    1 
ATOM   1553  O  OD1   . ASN A 1 226 ? -46.650 36.131  -11.411 1.00 45.43  ? 874  ASN A OD1   1 
ATOM   1554  N  ND2   . ASN A 1 226 ? -47.684 34.532  -10.215 1.00 42.77  ? 874  ASN A ND2   1 
ATOM   1555  N  N     . GLN A 1 227 ? -46.775 37.421  -14.259 1.00 46.96  ? 875  GLN A N     1 
ATOM   1556  C  CA    . GLN A 1 227 ? -45.628 38.084  -14.856 1.00 47.11  ? 875  GLN A CA    1 
ATOM   1557  C  C     . GLN A 1 227 ? -44.298 37.712  -14.190 1.00 46.13  ? 875  GLN A C     1 
ATOM   1558  O  O     . GLN A 1 227 ? -43.311 37.450  -14.865 1.00 45.32  ? 875  GLN A O     1 
ATOM   1559  C  CB    . GLN A 1 227 ? -45.849 39.594  -14.796 1.00 50.43  ? 875  GLN A CB    1 
ATOM   1560  C  CG    . GLN A 1 227 ? -44.744 40.439  -15.384 1.00 57.76  ? 875  GLN A CG    1 
ATOM   1561  C  CD    . GLN A 1 227 ? -45.072 41.907  -15.275 1.00 68.09  ? 875  GLN A CD    1 
ATOM   1562  O  OE1   . GLN A 1 227 ? -46.095 42.268  -14.690 1.00 67.57  ? 875  GLN A OE1   1 
ATOM   1563  N  NE2   . GLN A 1 227 ? -44.218 42.765  -15.837 1.00 72.85  ? 875  GLN A NE2   1 
ATOM   1564  N  N     . GLU A 1 228 ? -44.271 37.689  -12.865 1.00 46.57  ? 876  GLU A N     1 
ATOM   1565  C  CA    . GLU A 1 228 ? -43.008 37.555  -12.155 1.00 46.90  ? 876  GLU A CA    1 
ATOM   1566  C  C     . GLU A 1 228 ? -42.418 36.157  -12.268 1.00 47.94  ? 876  GLU A C     1 
ATOM   1567  O  O     . GLU A 1 228 ? -41.210 35.972  -12.116 1.00 50.04  ? 876  GLU A O     1 
ATOM   1568  C  CB    . GLU A 1 228 ? -43.169 37.945  -10.682 1.00 53.10  ? 876  GLU A CB    1 
ATOM   1569  C  CG    . GLU A 1 228 ? -41.836 38.094  -9.951  1.00 61.53  ? 876  GLU A CG    1 
ATOM   1570  C  CD    . GLU A 1 228 ? -41.982 38.398  -8.466  1.00 68.30  ? 876  GLU A CD    1 
ATOM   1571  O  OE1   . GLU A 1 228 ? -43.128 38.611  -8.006  1.00 70.62  ? 876  GLU A OE1   1 
ATOM   1572  O  OE2   . GLU A 1 228 ? -40.942 38.421  -7.764  1.00 66.57  ? 876  GLU A OE2   1 
ATOM   1573  N  N     . TYR A 1 229 ? -43.277 35.180  -12.547 1.00 47.18  ? 877  TYR A N     1 
ATOM   1574  C  CA    . TYR A 1 229 ? -42.901 33.767  -12.532 1.00 43.50  ? 877  TYR A CA    1 
ATOM   1575  C  C     . TYR A 1 229 ? -42.999 33.124  -13.912 1.00 42.68  ? 877  TYR A C     1 
ATOM   1576  O  O     . TYR A 1 229 ? -42.599 31.968  -14.107 1.00 39.83  ? 877  TYR A O     1 
ATOM   1577  C  CB    . TYR A 1 229 ? -43.803 33.021  -11.557 1.00 42.41  ? 877  TYR A CB    1 
ATOM   1578  C  CG    . TYR A 1 229 ? -43.522 33.355  -10.111 1.00 47.23  ? 877  TYR A CG    1 
ATOM   1579  C  CD1   . TYR A 1 229 ? -44.557 33.494  -9.193  1.00 46.39  ? 877  TYR A CD1   1 
ATOM   1580  C  CD2   . TYR A 1 229 ? -42.216 33.520  -9.662  1.00 48.74  ? 877  TYR A CD2   1 
ATOM   1581  C  CE1   . TYR A 1 229 ? -44.299 33.794  -7.872  1.00 49.38  ? 877  TYR A CE1   1 
ATOM   1582  C  CE2   . TYR A 1 229 ? -41.949 33.817  -8.343  1.00 51.69  ? 877  TYR A CE2   1 
ATOM   1583  C  CZ    . TYR A 1 229 ? -42.994 33.955  -7.449  1.00 54.88  ? 877  TYR A CZ    1 
ATOM   1584  O  OH    . TYR A 1 229 ? -42.729 34.254  -6.128  1.00 60.79  ? 877  TYR A OH    1 
ATOM   1585  N  N     . ALA A 1 230 ? -43.524 33.895  -14.863 1.00 43.80  ? 878  ALA A N     1 
ATOM   1586  C  CA    . ALA A 1 230 ? -43.822 33.416  -16.211 1.00 38.38  ? 878  ALA A CA    1 
ATOM   1587  C  C     . ALA A 1 230 ? -44.635 32.132  -16.151 1.00 38.13  ? 878  ALA A C     1 
ATOM   1588  O  O     . ALA A 1 230 ? -44.220 31.094  -16.654 1.00 38.88  ? 878  ALA A O     1 
ATOM   1589  C  CB    . ALA A 1 230 ? -42.555 33.214  -16.996 1.00 36.98  ? 878  ALA A CB    1 
ATOM   1590  N  N     . ARG A 1 231 ? -45.796 32.207  -15.519 1.00 36.48  ? 879  ARG A N     1 
ATOM   1591  C  CA    . ARG A 1 231 ? -46.653 31.054  -15.400 1.00 35.82  ? 879  ARG A CA    1 
ATOM   1592  C  C     . ARG A 1 231 ? -47.954 31.317  -16.112 1.00 37.75  ? 879  ARG A C     1 
ATOM   1593  O  O     . ARG A 1 231 ? -48.586 32.341  -15.911 1.00 38.29  ? 879  ARG A O     1 
ATOM   1594  C  CB    . ARG A 1 231 ? -46.930 30.746  -13.938 1.00 38.36  ? 879  ARG A CB    1 
ATOM   1595  C  CG    . ARG A 1 231 ? -45.704 30.356  -13.147 1.00 40.67  ? 879  ARG A CG    1 
ATOM   1596  C  CD    . ARG A 1 231 ? -46.060 30.157  -11.690 1.00 38.71  ? 879  ARG A CD    1 
ATOM   1597  N  NE    . ARG A 1 231 ? -47.127 29.176  -11.541 1.00 37.48  ? 879  ARG A NE    1 
ATOM   1598  C  CZ    . ARG A 1 231 ? -46.914 27.907  -11.217 1.00 39.56  ? 879  ARG A CZ    1 
ATOM   1599  N  NH1   . ARG A 1 231 ? -45.674 27.487  -11.002 1.00 41.17  ? 879  ARG A NH1   1 
ATOM   1600  N  NH2   . ARG A 1 231 ? -47.931 27.063  -11.101 1.00 35.55  ? 879  ARG A NH2   1 
ATOM   1601  N  N     . PHE A 1 232 ? -48.343 30.380  -16.960 1.00 38.03  ? 880  PHE A N     1 
ATOM   1602  C  CA    . PHE A 1 232 ? -49.638 30.429  -17.596 1.00 38.66  ? 880  PHE A CA    1 
ATOM   1603  C  C     . PHE A 1 232 ? -50.519 29.365  -16.950 1.00 38.78  ? 880  PHE A C     1 
ATOM   1604  O  O     . PHE A 1 232 ? -50.218 28.182  -17.043 1.00 38.52  ? 880  PHE A O     1 
ATOM   1605  C  CB    . PHE A 1 232 ? -49.489 30.157  -19.093 1.00 39.92  ? 880  PHE A CB    1 
ATOM   1606  C  CG    . PHE A 1 232 ? -48.737 31.230  -19.843 1.00 39.66  ? 880  PHE A CG    1 
ATOM   1607  C  CD1   . PHE A 1 232 ? -47.350 31.243  -19.864 1.00 37.82  ? 880  PHE A CD1   1 
ATOM   1608  C  CD2   . PHE A 1 232 ? -49.424 32.211  -20.551 1.00 38.85  ? 880  PHE A CD2   1 
ATOM   1609  C  CE1   . PHE A 1 232 ? -46.659 32.226  -20.565 1.00 38.75  ? 880  PHE A CE1   1 
ATOM   1610  C  CE2   . PHE A 1 232 ? -48.737 33.192  -21.253 1.00 39.21  ? 880  PHE A CE2   1 
ATOM   1611  C  CZ    . PHE A 1 232 ? -47.352 33.199  -21.258 1.00 38.10  ? 880  PHE A CZ    1 
ATOM   1612  N  N     . GLU A 1 233 ? -51.599 29.780  -16.293 1.00 40.91  ? 881  GLU A N     1 
ATOM   1613  C  CA    . GLU A 1 233 ? -52.469 28.834  -15.586 1.00 39.99  ? 881  GLU A CA    1 
ATOM   1614  C  C     . GLU A 1 233 ? -53.945 29.002  -15.930 1.00 39.93  ? 881  GLU A C     1 
ATOM   1615  O  O     . GLU A 1 233 ? -54.365 30.045  -16.432 1.00 38.28  ? 881  GLU A O     1 
ATOM   1616  C  CB    . GLU A 1 233 ? -52.272 28.949  -14.075 1.00 37.96  ? 881  GLU A CB    1 
ATOM   1617  C  CG    . GLU A 1 233 ? -50.845 28.672  -13.645 1.00 41.96  ? 881  GLU A CG    1 
ATOM   1618  C  CD    . GLU A 1 233 ? -50.606 28.898  -12.163 1.00 45.52  ? 881  GLU A CD    1 
ATOM   1619  O  OE1   . GLU A 1 233 ? -50.105 29.994  -11.814 1.00 44.44  ? 881  GLU A OE1   1 
ATOM   1620  O  OE2   . GLU A 1 233 ? -50.900 27.975  -11.358 1.00 44.19  ? 881  GLU A OE2   1 
ATOM   1621  N  N     . SER A 1 234 ? -54.722 27.960  -15.653 1.00 39.20  ? 882  SER A N     1 
ATOM   1622  C  CA    . SER A 1 234 ? -56.147 27.957  -15.937 1.00 38.22  ? 882  SER A CA    1 
ATOM   1623  C  C     . SER A 1 234 ? -56.850 28.986  -15.070 1.00 41.88  ? 882  SER A C     1 
ATOM   1624  O  O     . SER A 1 234 ? -56.541 29.113  -13.887 1.00 42.42  ? 882  SER A O     1 
ATOM   1625  C  CB    . SER A 1 234 ? -56.744 26.578  -15.663 1.00 38.69  ? 882  SER A CB    1 
ATOM   1626  O  OG    . SER A 1 234 ? -56.186 25.587  -16.500 1.00 38.35  ? 882  SER A OG    1 
ATOM   1627  N  N     . PRO A 1 235 ? -57.815 29.712  -15.656 1.00 42.72  ? 883  PRO A N     1 
ATOM   1628  C  CA    . PRO A 1 235 ? -58.594 30.721  -14.933 1.00 42.96  ? 883  PRO A CA    1 
ATOM   1629  C  C     . PRO A 1 235 ? -59.086 30.163  -13.605 1.00 45.99  ? 883  PRO A C     1 
ATOM   1630  O  O     . PRO A 1 235 ? -59.635 29.058  -13.585 1.00 47.11  ? 883  PRO A O     1 
ATOM   1631  C  CB    . PRO A 1 235 ? -59.791 30.960  -15.855 1.00 45.95  ? 883  PRO A CB    1 
ATOM   1632  C  CG    . PRO A 1 235 ? -59.311 30.589  -17.211 1.00 44.56  ? 883  PRO A CG    1 
ATOM   1633  C  CD    . PRO A 1 235 ? -58.323 29.485  -17.020 1.00 43.32  ? 883  PRO A CD    1 
ATOM   1634  N  N     . PRO A 1 236 ? -58.889 30.917  -12.510 1.00 46.33  ? 884  PRO A N     1 
ATOM   1635  C  CA    . PRO A 1 236 ? -59.291 30.553  -11.147 1.00 45.63  ? 884  PRO A CA    1 
ATOM   1636  C  C     . PRO A 1 236 ? -60.752 30.134  -11.072 1.00 47.37  ? 884  PRO A C     1 
ATOM   1637  O  O     . PRO A 1 236 ? -61.551 30.538  -11.913 1.00 49.85  ? 884  PRO A O     1 
ATOM   1638  C  CB    . PRO A 1 236 ? -59.096 31.858  -10.379 1.00 44.55  ? 884  PRO A CB    1 
ATOM   1639  C  CG    . PRO A 1 236 ? -58.004 32.536  -11.089 1.00 43.93  ? 884  PRO A CG    1 
ATOM   1640  C  CD    . PRO A 1 236 ? -58.217 32.226  -12.544 1.00 46.31  ? 884  PRO A CD    1 
ATOM   1641  N  N     . LYS A 1 237 ? -61.104 29.342  -10.069 1.00 46.44  ? 885  LYS A N     1 
ATOM   1642  C  CA    . LYS A 1 237 ? -62.489 28.913  -9.932  1.00 49.99  ? 885  LYS A CA    1 
ATOM   1643  C  C     . LYS A 1 237 ? -63.268 29.633  -8.828  1.00 53.98  ? 885  LYS A C     1 
ATOM   1644  O  O     . LYS A 1 237 ? -64.448 29.345  -8.610  1.00 53.31  ? 885  LYS A O     1 
ATOM   1645  C  CB    . LYS A 1 237 ? -62.567 27.395  -9.760  1.00 52.56  ? 885  LYS A CB    1 
ATOM   1646  C  CG    . LYS A 1 237 ? -62.308 26.633  -11.053 1.00 53.45  ? 885  LYS A CG    1 
ATOM   1647  C  CD    . LYS A 1 237 ? -62.640 25.154  -10.942 1.00 55.42  ? 885  LYS A CD    1 
ATOM   1648  C  CE    . LYS A 1 237 ? -62.377 24.439  -12.266 1.00 58.13  ? 885  LYS A CE    1 
ATOM   1649  N  NZ    . LYS A 1 237 ? -60.968 24.619  -12.731 1.00 57.21  ? 885  LYS A NZ    1 
ATOM   1650  N  N     . THR A 1 238 ? -62.613 30.578  -8.149  1.00 55.90  ? 886  THR A N     1 
ATOM   1651  C  CA    . THR A 1 238 ? -63.215 31.300  -7.019  1.00 51.60  ? 886  THR A CA    1 
ATOM   1652  C  C     . THR A 1 238 ? -64.626 31.819  -7.339  1.00 51.97  ? 886  THR A C     1 
ATOM   1653  O  O     . THR A 1 238 ? -64.897 32.261  -8.458  1.00 51.26  ? 886  THR A O     1 
ATOM   1654  C  CB    . THR A 1 238 ? -62.315 32.453  -6.547  1.00 45.63  ? 886  THR A CB    1 
ATOM   1655  N  N     . GLN A 1 239 ? -65.521 31.745  -6.356  1.00 49.12  ? 887  GLN A N     1 
ATOM   1656  C  CA    . GLN A 1 239 ? -66.933 32.052  -6.576  1.00 49.86  ? 887  GLN A CA    1 
ATOM   1657  C  C     . GLN A 1 239 ? -67.442 33.189  -5.690  1.00 50.65  ? 887  GLN A C     1 
ATOM   1658  O  O     . GLN A 1 239 ? -67.168 33.213  -4.492  1.00 50.65  ? 887  GLN A O     1 
ATOM   1659  C  CB    . GLN A 1 239 ? -67.788 30.797  -6.339  1.00 53.61  ? 887  GLN A CB    1 
ATOM   1660  C  CG    . GLN A 1 239 ? -67.584 29.683  -7.353  1.00 51.81  ? 887  GLN A CG    1 
ATOM   1661  C  CD    . GLN A 1 239 ? -67.937 30.099  -8.775  1.00 55.84  ? 887  GLN A CD    1 
ATOM   1662  O  OE1   . GLN A 1 239 ? -67.149 29.896  -9.705  1.00 54.69  ? 887  GLN A OE1   1 
ATOM   1663  N  NE2   . GLN A 1 239 ? -69.128 30.676  -8.951  1.00 54.78  ? 887  GLN A NE2   1 
ATOM   1664  N  N     . PRO A 1 240 ? -68.208 34.122  -6.279  1.00 50.52  ? 888  PRO A N     1 
ATOM   1665  C  CA    . PRO A 1 240 ? -68.810 35.284  -5.607  1.00 51.01  ? 888  PRO A CA    1 
ATOM   1666  C  C     . PRO A 1 240 ? -69.369 34.979  -4.216  1.00 55.65  ? 888  PRO A C     1 
ATOM   1667  O  O     . PRO A 1 240 ? -69.852 33.868  -3.970  1.00 58.44  ? 888  PRO A O     1 
ATOM   1668  C  CB    . PRO A 1 240 ? -69.960 35.655  -6.541  1.00 48.71  ? 888  PRO A CB    1 
ATOM   1669  C  CG    . PRO A 1 240 ? -69.473 35.272  -7.885  1.00 50.34  ? 888  PRO A CG    1 
ATOM   1670  C  CD    . PRO A 1 240 ? -68.589 34.057  -7.701  1.00 50.30  ? 888  PRO A CD    1 
ATOM   1671  N  N     . THR A 1 241 ? -69.302 35.956  -3.314  1.00 55.11  ? 889  THR A N     1 
ATOM   1672  C  CA    . THR A 1 241 ? -69.942 35.834  -2.007  1.00 56.76  ? 889  THR A CA    1 
ATOM   1673  C  C     . THR A 1 241 ? -71.244 36.619  -1.985  1.00 58.57  ? 889  THR A C     1 
ATOM   1674  O  O     . THR A 1 241 ? -71.701 37.101  -3.014  1.00 59.33  ? 889  THR A O     1 
ATOM   1675  C  CB    . THR A 1 241 ? -69.039 36.314  -0.857  1.00 56.30  ? 889  THR A CB    1 
ATOM   1676  O  OG1   . THR A 1 241 ? -68.507 37.607  -1.164  1.00 60.11  ? 889  THR A OG1   1 
ATOM   1677  C  CG2   . THR A 1 241 ? -67.895 35.344  -0.644  1.00 55.99  ? 889  THR A CG2   1 
ATOM   1678  N  N     . GLU A 1 242 ? -71.849 36.740  -0.811  1.00 60.93  ? 890  GLU A N     1 
ATOM   1679  C  CA    . GLU A 1 242 ? -73.064 37.533  -0.682  1.00 65.24  ? 890  GLU A CA    1 
ATOM   1680  C  C     . GLU A 1 242 ? -72.738 39.006  -0.920  1.00 65.04  ? 890  GLU A C     1 
ATOM   1681  O  O     . GLU A 1 242 ? -73.534 39.759  -1.488  1.00 62.34  ? 890  GLU A O     1 
ATOM   1682  C  CB    . GLU A 1 242 ? -73.675 37.346  0.703   1.00 63.62  ? 890  GLU A CB    1 
ATOM   1683  N  N     . ASP A 1 243 ? -71.536 39.392  -0.503  1.00 64.72  ? 891  ASP A N     1 
ATOM   1684  C  CA    . ASP A 1 243 ? -71.159 40.790  -0.406  1.00 64.06  ? 891  ASP A CA    1 
ATOM   1685  C  C     . ASP A 1 243 ? -70.495 41.342  -1.655  1.00 66.37  ? 891  ASP A C     1 
ATOM   1686  O  O     . ASP A 1 243 ? -70.410 42.559  -1.806  1.00 70.61  ? 891  ASP A O     1 
ATOM   1687  C  CB    . ASP A 1 243 ? -70.231 40.999  0.791   1.00 66.10  ? 891  ASP A CB    1 
ATOM   1688  C  CG    . ASP A 1 243 ? -70.806 40.440  2.077   1.00 72.38  ? 891  ASP A CG    1 
ATOM   1689  O  OD1   . ASP A 1 243 ? -70.832 41.187  3.081   1.00 76.00  ? 891  ASP A OD1   1 
ATOM   1690  O  OD2   . ASP A 1 243 ? -71.228 39.257  2.084   1.00 69.20  ? 891  ASP A OD2   1 
ATOM   1691  N  N     . ASN A 1 244 ? -70.023 40.469  -2.545  1.00 62.19  ? 892  ASN A N     1 
ATOM   1692  C  CA    . ASN A 1 244 ? -69.278 40.932  -3.722  1.00 62.04  ? 892  ASN A CA    1 
ATOM   1693  C  C     . ASN A 1 244 ? -69.884 40.563  -5.073  1.00 59.45  ? 892  ASN A C     1 
ATOM   1694  O  O     . ASN A 1 244 ? -69.300 40.838  -6.119  1.00 57.06  ? 892  ASN A O     1 
ATOM   1695  C  CB    . ASN A 1 244 ? -67.813 40.483  -3.666  1.00 61.83  ? 892  ASN A CB    1 
ATOM   1696  C  CG    . ASN A 1 244 ? -67.646 38.999  -3.892  1.00 55.63  ? 892  ASN A CG    1 
ATOM   1697  O  OD1   . ASN A 1 244 ? -68.620 38.278  -4.064  1.00 58.11  ? 892  ASN A OD1   1 
ATOM   1698  N  ND2   . ASN A 1 244 ? -66.405 38.535  -3.884  1.00 53.73  ? 892  ASN A ND2   1 
ATOM   1699  N  N     . LYS A 1 245 ? -71.059 39.945  -5.046  1.00 60.84  ? 893  LYS A N     1 
ATOM   1700  C  CA    . LYS A 1 245 ? -71.746 39.554  -6.273  1.00 60.69  ? 893  LYS A CA    1 
ATOM   1701  C  C     . LYS A 1 245 ? -71.867 40.720  -7.260  1.00 64.10  ? 893  LYS A C     1 
ATOM   1702  O  O     . LYS A 1 245 ? -71.697 40.548  -8.471  1.00 63.25  ? 893  LYS A O     1 
ATOM   1703  C  CB    . LYS A 1 245 ? -73.126 38.990  -5.949  1.00 55.99  ? 893  LYS A CB    1 
ATOM   1704  N  N     . HIS A 1 246 ? -72.153 41.908  -6.735  1.00 63.70  ? 894  HIS A N     1 
ATOM   1705  C  CA    . HIS A 1 246 ? -72.412 43.076  -7.570  1.00 62.91  ? 894  HIS A CA    1 
ATOM   1706  C  C     . HIS A 1 246 ? -71.138 43.723  -8.089  1.00 59.84  ? 894  HIS A C     1 
ATOM   1707  O  O     . HIS A 1 246 ? -71.191 44.711  -8.818  1.00 62.45  ? 894  HIS A O     1 
ATOM   1708  C  CB    . HIS A 1 246 ? -73.256 44.106  -6.801  1.00 65.73  ? 894  HIS A CB    1 
ATOM   1709  C  CG    . HIS A 1 246 ? -72.662 44.534  -5.491  1.00 67.63  ? 894  HIS A CG    1 
ATOM   1710  N  ND1   . HIS A 1 246 ? -72.756 43.772  -4.346  1.00 69.13  ? 894  HIS A ND1   1 
ATOM   1711  C  CD2   . HIS A 1 246 ? -71.983 45.653  -5.143  1.00 67.42  ? 894  HIS A CD2   1 
ATOM   1712  C  CE1   . HIS A 1 246 ? -72.153 44.398  -3.350  1.00 69.55  ? 894  HIS A CE1   1 
ATOM   1713  N  NE2   . HIS A 1 246 ? -71.674 45.541  -3.808  1.00 70.66  ? 894  HIS A NE2   1 
ATOM   1714  N  N     . LYS A 1 247 ? -69.992 43.163  -7.728  1.00 57.76  ? 895  LYS A N     1 
ATOM   1715  C  CA    . LYS A 1 247 ? -68.734 43.847  -7.975  1.00 58.84  ? 895  LYS A CA    1 
ATOM   1716  C  C     . LYS A 1 247 ? -67.583 42.857  -8.015  1.00 56.90  ? 895  LYS A C     1 
ATOM   1717  O  O     . LYS A 1 247 ? -66.467 43.164  -7.596  1.00 55.78  ? 895  LYS A O     1 
ATOM   1718  C  CB    . LYS A 1 247 ? -68.500 44.869  -6.868  1.00 62.32  ? 895  LYS A CB    1 
ATOM   1719  C  CG    . LYS A 1 247 ? -68.521 44.241  -5.483  1.00 64.28  ? 895  LYS A CG    1 
ATOM   1720  C  CD    . LYS A 1 247 ? -68.509 45.273  -4.374  1.00 70.62  ? 895  LYS A CD    1 
ATOM   1721  C  CE    . LYS A 1 247 ? -68.625 44.595  -3.011  1.00 73.80  ? 895  LYS A CE    1 
ATOM   1722  N  NZ    . LYS A 1 247 ? -68.783 45.552  -1.872  1.00 76.92  ? 895  LYS A NZ    1 
ATOM   1723  N  N     . PHE A 1 248 ? -67.866 41.670  -8.537  1.00 56.44  ? 896  PHE A N     1 
ATOM   1724  C  CA    . PHE A 1 248 ? -66.927 40.556  -8.494  1.00 54.32  ? 896  PHE A CA    1 
ATOM   1725  C  C     . PHE A 1 248 ? -65.722 40.721  -9.410  1.00 50.60  ? 896  PHE A C     1 
ATOM   1726  O  O     . PHE A 1 248 ? -65.868 40.817  -10.627 1.00 51.83  ? 896  PHE A O     1 
ATOM   1727  C  CB    . PHE A 1 248 ? -67.650 39.255  -8.833  1.00 55.95  ? 896  PHE A CB    1 
ATOM   1728  C  CG    . PHE A 1 248 ? -66.829 38.029  -8.578  1.00 53.49  ? 896  PHE A CG    1 
ATOM   1729  C  CD1   . PHE A 1 248 ? -66.578 37.613  -7.282  1.00 51.47  ? 896  PHE A CD1   1 
ATOM   1730  C  CD2   . PHE A 1 248 ? -66.308 37.296  -9.630  1.00 51.96  ? 896  PHE A CD2   1 
ATOM   1731  C  CE1   . PHE A 1 248 ? -65.826 36.490  -7.039  1.00 51.72  ? 896  PHE A CE1   1 
ATOM   1732  C  CE2   . PHE A 1 248 ? -65.558 36.169  -9.393  1.00 50.25  ? 896  PHE A CE2   1 
ATOM   1733  C  CZ    . PHE A 1 248 ? -65.313 35.766  -8.095  1.00 51.28  ? 896  PHE A CZ    1 
ATOM   1734  N  N     . CYS A 1 249 ? -64.535 40.736  -8.809  1.00 50.54  ? 897  CYS A N     1 
ATOM   1735  C  CA    . CYS A 1 249 ? -63.278 40.871  -9.545  1.00 50.72  ? 897  CYS A CA    1 
ATOM   1736  C  C     . CYS A 1 249 ? -62.221 39.891  -9.038  1.00 49.55  ? 897  CYS A C     1 
ATOM   1737  O  O     . CYS A 1 249 ? -61.853 39.901  -7.859  1.00 48.27  ? 897  CYS A O     1 
ATOM   1738  C  CB    . CYS A 1 249 ? -62.748 42.305  -9.456  1.00 48.95  ? 897  CYS A CB    1 
ATOM   1739  S  SG    . CYS A 1 249 ? -61.055 42.539  -10.034 1.00 48.29  ? 897  CYS A SG    1 
ATOM   1740  N  N     . LEU A 1 250 ? -61.727 39.051  -9.941  1.00 48.02  ? 898  LEU A N     1 
ATOM   1741  C  CA    . LEU A 1 250 ? -60.765 38.023  -9.570  1.00 47.90  ? 898  LEU A CA    1 
ATOM   1742  C  C     . LEU A 1 250 ? -59.438 38.612  -9.120  1.00 48.07  ? 898  LEU A C     1 
ATOM   1743  O  O     . LEU A 1 250 ? -58.859 38.157  -8.139  1.00 48.85  ? 898  LEU A O     1 
ATOM   1744  C  CB    . LEU A 1 250 ? -60.538 37.042  -10.722 1.00 47.70  ? 898  LEU A CB    1 
ATOM   1745  C  CG    . LEU A 1 250 ? -61.288 35.709  -10.677 1.00 46.86  ? 898  LEU A CG    1 
ATOM   1746  C  CD1   . LEU A 1 250 ? -62.753 35.904  -10.983 1.00 47.16  ? 898  LEU A CD1   1 
ATOM   1747  C  CD2   . LEU A 1 250 ? -60.674 34.745  -11.673 1.00 51.03  ? 898  LEU A CD2   1 
ATOM   1748  N  N     . SER A 1 251 ? -58.955 39.618  -9.839  1.00 46.22  ? 899  SER A N     1 
ATOM   1749  C  CA    . SER A 1 251 ? -57.689 40.244  -9.496  1.00 45.55  ? 899  SER A CA    1 
ATOM   1750  C  C     . SER A 1 251 ? -57.672 40.722  -8.046  1.00 46.32  ? 899  SER A C     1 
ATOM   1751  O  O     . SER A 1 251 ? -56.681 40.548  -7.339  1.00 46.71  ? 899  SER A O     1 
ATOM   1752  C  CB    . SER A 1 251 ? -57.396 41.406  -10.440 1.00 45.78  ? 899  SER A CB    1 
ATOM   1753  O  OG    . SER A 1 251 ? -56.160 42.015  -10.112 1.00 45.26  ? 899  SER A OG    1 
ATOM   1754  N  N     . CYS A 1 252 ? -58.775 41.319  -7.608  1.00 46.47  ? 900  CYS A N     1 
ATOM   1755  C  CA    . CYS A 1 252 ? -58.895 41.818  -6.241  1.00 49.03  ? 900  CYS A CA    1 
ATOM   1756  C  C     . CYS A 1 252 ? -58.783 40.701  -5.213  1.00 49.93  ? 900  CYS A C     1 
ATOM   1757  O  O     . CYS A 1 252 ? -57.974 40.763  -4.288  1.00 52.77  ? 900  CYS A O     1 
ATOM   1758  C  CB    . CYS A 1 252 ? -60.230 42.538  -6.054  1.00 49.98  ? 900  CYS A CB    1 
ATOM   1759  S  SG    . CYS A 1 252 ? -60.279 44.211  -6.702  1.00 55.29  ? 900  CYS A SG    1 
ATOM   1760  N  N     . ILE A 1 253 ? -59.617 39.686  -5.374  1.00 48.34  ? 901  ILE A N     1 
ATOM   1761  C  CA    . ILE A 1 253 ? -59.607 38.538  -4.484  1.00 49.10  ? 901  ILE A CA    1 
ATOM   1762  C  C     . ILE A 1 253 ? -58.245 37.854  -4.449  1.00 49.02  ? 901  ILE A C     1 
ATOM   1763  O  O     . ILE A 1 253 ? -57.725 37.550  -3.383  1.00 52.30  ? 901  ILE A O     1 
ATOM   1764  C  CB    . ILE A 1 253 ? -60.673 37.522  -4.906  1.00 46.91  ? 901  ILE A CB    1 
ATOM   1765  C  CG1   . ILE A 1 253 ? -62.012 38.240  -5.079  1.00 47.72  ? 901  ILE A CG1   1 
ATOM   1766  C  CG2   . ILE A 1 253 ? -60.754 36.391  -3.899  1.00 40.01  ? 901  ILE A CG2   1 
ATOM   1767  C  CD1   . ILE A 1 253 ? -63.144 37.340  -5.445  1.00 51.93  ? 901  ILE A CD1   1 
ATOM   1768  N  N     . ARG A 1 254 ? -57.668 37.604  -5.616  1.00 47.02  ? 902  ARG A N     1 
ATOM   1769  C  CA    . ARG A 1 254 ? -56.357 36.984  -5.655  1.00 50.35  ? 902  ARG A CA    1 
ATOM   1770  C  C     . ARG A 1 254 ? -55.451 37.742  -4.699  1.00 53.97  ? 902  ARG A C     1 
ATOM   1771  O  O     . ARG A 1 254 ? -54.872 37.158  -3.782  1.00 56.78  ? 902  ARG A O     1 
ATOM   1772  C  CB    . ARG A 1 254 ? -55.780 36.979  -7.070  1.00 48.39  ? 902  ARG A CB    1 
ATOM   1773  N  N     . LEU A 1 255 ? -55.357 39.052  -4.896  1.00 51.08  ? 903  LEU A N     1 
ATOM   1774  C  CA    . LEU A 1 255 ? -54.525 39.881  -4.033  1.00 53.71  ? 903  LEU A CA    1 
ATOM   1775  C  C     . LEU A 1 255 ? -54.980 39.793  -2.572  1.00 52.30  ? 903  LEU A C     1 
ATOM   1776  O  O     . LEU A 1 255 ? -54.159 39.741  -1.658  1.00 53.34  ? 903  LEU A O     1 
ATOM   1777  C  CB    . LEU A 1 255 ? -54.503 41.334  -4.527  1.00 52.49  ? 903  LEU A CB    1 
ATOM   1778  N  N     . ALA A 1 256 ? -56.289 39.759  -2.356  1.00 51.21  ? 904  ALA A N     1 
ATOM   1779  C  CA    . ALA A 1 256 ? -56.832 39.677  -1.007  1.00 50.84  ? 904  ALA A CA    1 
ATOM   1780  C  C     . ALA A 1 256 ? -56.298 38.450  -0.287  1.00 55.89  ? 904  ALA A C     1 
ATOM   1781  O  O     . ALA A 1 256 ? -55.737 38.555  0.805   1.00 56.43  ? 904  ALA A O     1 
ATOM   1782  C  CB    . ALA A 1 256 ? -58.342 39.637  -1.055  1.00 48.75  ? 904  ALA A CB    1 
ATOM   1783  N  N     . GLU A 1 257 ? -56.482 37.288  -0.914  1.00 58.62  ? 905  GLU A N     1 
ATOM   1784  C  CA    . GLU A 1 257 ? -56.038 36.007  -0.360  1.00 60.13  ? 905  GLU A CA    1 
ATOM   1785  C  C     . GLU A 1 257 ? -54.517 35.964  -0.187  1.00 58.11  ? 905  GLU A C     1 
ATOM   1786  O  O     . GLU A 1 257 ? -54.003 35.338  0.741   1.00 56.71  ? 905  GLU A O     1 
ATOM   1787  C  CB    . GLU A 1 257 ? -56.516 34.847  -1.240  1.00 54.97  ? 905  GLU A CB    1 
ATOM   1788  N  N     . LEU A 1 258 ? -53.806 36.635  -1.084  1.00 55.95  ? 906  LEU A N     1 
ATOM   1789  C  CA    . LEU A 1 258 ? -52.364 36.764  -0.965  1.00 56.41  ? 906  LEU A CA    1 
ATOM   1790  C  C     . LEU A 1 258 ? -51.996 37.393  0.366   1.00 57.68  ? 906  LEU A C     1 
ATOM   1791  O  O     . LEU A 1 258 ? -51.286 36.800  1.162   1.00 58.23  ? 906  LEU A O     1 
ATOM   1792  C  CB    . LEU A 1 258 ? -51.815 37.615  -2.108  1.00 58.53  ? 906  LEU A CB    1 
ATOM   1793  C  CG    . LEU A 1 258 ? -50.982 36.877  -3.152  1.00 60.14  ? 906  LEU A CG    1 
ATOM   1794  C  CD1   . LEU A 1 258 ? -49.698 36.353  -2.521  1.00 64.37  ? 906  LEU A CD1   1 
ATOM   1795  C  CD2   . LEU A 1 258 ? -51.791 35.739  -3.770  1.00 66.14  ? 906  LEU A CD2   1 
ATOM   1796  N  N     . ARG A 1 259 ? -52.500 38.599  0.600   1.00 60.43  ? 907  ARG A N     1 
ATOM   1797  C  CA    . ARG A 1 259 ? -52.185 39.362  1.806   1.00 61.85  ? 907  ARG A CA    1 
ATOM   1798  C  C     . ARG A 1 259 ? -52.560 38.629  3.090   1.00 60.79  ? 907  ARG A C     1 
ATOM   1799  O  O     . ARG A 1 259 ? -51.774 38.571  4.031   1.00 61.63  ? 907  ARG A O     1 
ATOM   1800  C  CB    . ARG A 1 259 ? -52.861 40.734  1.765   1.00 60.15  ? 907  ARG A CB    1 
ATOM   1801  N  N     . GLN A 1 260 ? -53.762 38.070  3.130   1.00 60.33  ? 908  GLN A N     1 
ATOM   1802  C  CA    . GLN A 1 260 ? -54.208 37.346  4.316   1.00 66.97  ? 908  GLN A CA    1 
ATOM   1803  C  C     . GLN A 1 260 ? -53.294 36.165  4.634   1.00 65.66  ? 908  GLN A C     1 
ATOM   1804  O  O     . GLN A 1 260 ? -53.154 35.754  5.787   1.00 65.71  ? 908  GLN A O     1 
ATOM   1805  C  CB    . GLN A 1 260 ? -55.660 36.886  4.156   1.00 67.05  ? 908  GLN A CB    1 
ATOM   1806  C  CG    . GLN A 1 260 ? -56.640 38.044  4.037   1.00 73.06  ? 908  GLN A CG    1 
ATOM   1807  C  CD    . GLN A 1 260 ? -56.466 39.074  5.152   1.00 76.46  ? 908  GLN A CD    1 
ATOM   1808  O  OE1   . GLN A 1 260 ? -56.253 38.715  6.317   1.00 76.41  ? 908  GLN A OE1   1 
ATOM   1809  N  NE2   . GLN A 1 260 ? -56.545 40.360  4.795   1.00 67.99  ? 908  GLN A NE2   1 
ATOM   1810  N  N     . LYS A 1 261 ? -52.668 35.625  3.598   1.00 64.03  ? 909  LYS A N     1 
ATOM   1811  C  CA    . LYS A 1 261 ? -51.704 34.556  3.773   1.00 62.31  ? 909  LYS A CA    1 
ATOM   1812  C  C     . LYS A 1 261 ? -50.349 35.131  4.188   1.00 61.80  ? 909  LYS A C     1 
ATOM   1813  O  O     . LYS A 1 261 ? -49.709 34.624  5.101   1.00 60.99  ? 909  LYS A O     1 
ATOM   1814  C  CB    . LYS A 1 261 ? -51.587 33.751  2.477   1.00 61.44  ? 909  LYS A CB    1 
ATOM   1815  C  CG    . LYS A 1 261 ? -50.602 32.598  2.521   1.00 63.22  ? 909  LYS A CG    1 
ATOM   1816  C  CD    . LYS A 1 261 ? -50.653 31.797  1.231   1.00 65.19  ? 909  LYS A CD    1 
ATOM   1817  C  CE    . LYS A 1 261 ? -49.486 30.824  1.116   1.00 68.49  ? 909  LYS A CE    1 
ATOM   1818  N  NZ    . LYS A 1 261 ? -49.539 30.046  -0.161  1.00 66.25  ? 909  LYS A NZ    1 
ATOM   1819  N  N     . GLU A 1 262 ? -49.933 36.210  3.533   1.00 62.93  ? 910  GLU A N     1 
ATOM   1820  C  CA    . GLU A 1 262 ? -48.616 36.800  3.764   1.00 61.94  ? 910  GLU A CA    1 
ATOM   1821  C  C     . GLU A 1 262 ? -48.445 37.358  5.168   1.00 61.79  ? 910  GLU A C     1 
ATOM   1822  O  O     . GLU A 1 262 ? -47.425 37.121  5.807   1.00 62.21  ? 910  GLU A O     1 
ATOM   1823  C  CB    . GLU A 1 262 ? -48.328 37.919  2.753   1.00 66.85  ? 910  GLU A CB    1 
ATOM   1824  C  CG    . GLU A 1 262 ? -48.549 37.561  1.277   1.00 68.21  ? 910  GLU A CG    1 
ATOM   1825  C  CD    . GLU A 1 262 ? -47.720 36.368  0.816   1.00 70.89  ? 910  GLU A CD    1 
ATOM   1826  O  OE1   . GLU A 1 262 ? -48.196 35.219  0.968   1.00 67.41  ? 910  GLU A OE1   1 
ATOM   1827  O  OE2   . GLU A 1 262 ? -46.600 36.583  0.297   1.00 70.89  ? 910  GLU A OE2   1 
ATOM   1828  N  N     . MET A 1 263 ? -49.434 38.110  5.644   1.00 65.56  ? 911  MET A N     1 
ATOM   1829  C  CA    . MET A 1 263 ? -49.305 38.818  6.922   1.00 67.35  ? 911  MET A CA    1 
ATOM   1830  C  C     . MET A 1 263 ? -49.493 37.921  8.148   1.00 63.36  ? 911  MET A C     1 
ATOM   1831  O  O     . MET A 1 263 ? -50.353 37.041  8.162   1.00 61.70  ? 911  MET A O     1 
ATOM   1832  C  CB    . MET A 1 263 ? -50.249 40.032  6.985   1.00 70.17  ? 911  MET A CB    1 
ATOM   1833  C  CG    . MET A 1 263 ? -51.745 39.696  7.018   1.00 75.51  ? 911  MET A CG    1 
ATOM   1834  S  SD    . MET A 1 263 ? -52.820 41.161  6.936   1.00 96.60  ? 911  MET A SD    1 
ATOM   1835  C  CE    . MET A 1 263 ? -52.493 41.927  8.525   1.00 94.27  ? 911  MET A CE    1 
ATOM   1836  N  N     . PRO A 1 264 ? -48.675 38.150  9.185   1.00 62.70  ? 912  PRO A N     1 
ATOM   1837  C  CA    . PRO A 1 264 ? -48.787 37.392  10.432  1.00 59.06  ? 912  PRO A CA    1 
ATOM   1838  C  C     . PRO A 1 264 ? -50.091 37.720  11.131  1.00 60.76  ? 912  PRO A C     1 
ATOM   1839  O  O     . PRO A 1 264 ? -50.449 38.888  11.240  1.00 63.92  ? 912  PRO A O     1 
ATOM   1840  C  CB    . PRO A 1 264 ? -47.615 37.913  11.278  1.00 58.80  ? 912  PRO A CB    1 
ATOM   1841  C  CG    . PRO A 1 264 ? -46.734 38.677  10.340  1.00 62.16  ? 912  PRO A CG    1 
ATOM   1842  C  CD    . PRO A 1 264 ? -47.628 39.182  9.254   1.00 65.52  ? 912  PRO A CD    1 
ATOM   1843  N  N     . LYS A 1 265 ? -50.797 36.691  11.578  1.00 61.07  ? 913  LYS A N     1 
ATOM   1844  C  CA    . LYS A 1 265 ? -51.943 36.853  12.454  1.00 61.07  ? 913  LYS A CA    1 
ATOM   1845  C  C     . LYS A 1 265 ? -51.612 36.096  13.735  1.00 65.22  ? 913  LYS A C     1 
ATOM   1846  O  O     . LYS A 1 265 ? -50.465 35.706  13.942  1.00 65.24  ? 913  LYS A O     1 
ATOM   1847  C  CB    . LYS A 1 265 ? -53.216 36.318  11.799  1.00 54.94  ? 913  LYS A CB    1 
ATOM   1848  N  N     . VAL A 1 266 ? -52.601 35.895  14.597  1.00 68.85  ? 914  VAL A N     1 
ATOM   1849  C  CA    . VAL A 1 266 ? -52.413 35.106  15.814  1.00 65.15  ? 914  VAL A CA    1 
ATOM   1850  C  C     . VAL A 1 266 ? -53.703 34.356  16.105  1.00 65.78  ? 914  VAL A C     1 
ATOM   1851  O  O     . VAL A 1 266 ? -54.784 34.838  15.770  1.00 67.91  ? 914  VAL A O     1 
ATOM   1852  C  CB    . VAL A 1 266 ? -52.027 35.988  17.013  1.00 65.33  ? 914  VAL A CB    1 
ATOM   1853  C  CG1   . VAL A 1 266 ? -52.983 37.157  17.128  1.00 67.83  ? 914  VAL A CG1   1 
ATOM   1854  C  CG2   . VAL A 1 266 ? -52.009 35.170  18.293  1.00 66.41  ? 914  VAL A CG2   1 
ATOM   1855  N  N     . LEU A 1 267 ? -53.593 33.178  16.715  1.00 67.60  ? 915  LEU A N     1 
ATOM   1856  C  CA    . LEU A 1 267 ? -54.744 32.286  16.862  1.00 67.85  ? 915  LEU A CA    1 
ATOM   1857  C  C     . LEU A 1 267 ? -55.145 32.015  18.310  1.00 69.32  ? 915  LEU A C     1 
ATOM   1858  O  O     . LEU A 1 267 ? -56.316 31.766  18.598  1.00 70.88  ? 915  LEU A O     1 
ATOM   1859  C  CB    . LEU A 1 267 ? -54.486 30.947  16.163  1.00 67.53  ? 915  LEU A CB    1 
ATOM   1860  C  CG    . LEU A 1 267 ? -54.088 30.864  14.685  1.00 64.06  ? 915  LEU A CG    1 
ATOM   1861  C  CD1   . LEU A 1 267 ? -54.591 32.059  13.881  1.00 63.37  ? 915  LEU A CD1   1 
ATOM   1862  C  CD2   . LEU A 1 267 ? -52.583 30.676  14.523  1.00 62.57  ? 915  LEU A CD2   1 
ATOM   1863  N  N     . GLU A 1 268 ? -54.169 32.034  19.212  1.00 70.67  ? 916  GLU A N     1 
ATOM   1864  C  CA    . GLU A 1 268 ? -54.421 31.762  20.624  1.00 72.42  ? 916  GLU A CA    1 
ATOM   1865  C  C     . GLU A 1 268 ? -53.562 32.660  21.507  1.00 74.23  ? 916  GLU A C     1 
ATOM   1866  O  O     . GLU A 1 268 ? -52.349 32.774  21.302  1.00 70.94  ? 916  GLU A O     1 
ATOM   1867  C  CB    . GLU A 1 268 ? -54.146 30.288  20.959  1.00 71.69  ? 916  GLU A CB    1 
ATOM   1868  C  CG    . GLU A 1 268 ? -55.180 29.301  20.415  1.00 75.25  ? 916  GLU A CG    1 
ATOM   1869  C  CD    . GLU A 1 268 ? -54.801 27.833  20.651  1.00 83.13  ? 916  GLU A CD    1 
ATOM   1870  O  OE1   . GLU A 1 268 ? -55.717 27.017  20.901  1.00 88.26  ? 916  GLU A OE1   1 
ATOM   1871  O  OE2   . GLU A 1 268 ? -53.596 27.490  20.576  1.00 78.25  ? 916  GLU A OE2   1 
ATOM   1872  N  N     . GLN A 1 269 ? -54.201 33.290  22.493  1.00 78.40  ? 917  GLN A N     1 
ATOM   1873  C  CA    . GLN A 1 269 ? -53.502 34.110  23.482  1.00 77.97  ? 917  GLN A CA    1 
ATOM   1874  C  C     . GLN A 1 269 ? -53.586 33.439  24.855  1.00 75.92  ? 917  GLN A C     1 
ATOM   1875  O  O     . GLN A 1 269 ? -54.662 33.032  25.287  1.00 74.89  ? 917  GLN A O     1 
ATOM   1876  C  CB    . GLN A 1 269 ? -54.099 35.523  23.523  1.00 76.49  ? 917  GLN A CB    1 
ATOM   1877  C  CG    . GLN A 1 269 ? -54.630 35.992  22.162  1.00 78.85  ? 917  GLN A CG    1 
ATOM   1878  C  CD    . GLN A 1 269 ? -55.018 37.465  22.120  1.00 81.67  ? 917  GLN A CD    1 
ATOM   1879  O  OE1   . GLN A 1 269 ? -54.338 38.321  22.689  1.00 81.05  ? 917  GLN A OE1   1 
ATOM   1880  N  NE2   . GLN A 1 269 ? -56.113 37.765  21.428  1.00 82.15  ? 917  GLN A NE2   1 
ATOM   1881  N  N     . ILE A 1 270 ? -52.447 33.299  25.527  1.00 75.71  ? 918  ILE A N     1 
ATOM   1882  C  CA    . ILE A 1 270 ? -52.404 32.657  26.842  1.00 77.15  ? 918  ILE A CA    1 
ATOM   1883  C  C     . ILE A 1 270 ? -52.800 33.628  27.961  1.00 77.99  ? 918  ILE A C     1 
ATOM   1884  O  O     . ILE A 1 270 ? -53.707 33.347  28.748  1.00 78.19  ? 918  ILE A O     1 
ATOM   1885  C  CB    . ILE A 1 270 ? -51.007 32.066  27.139  1.00 71.01  ? 918  ILE A CB    1 
ATOM   1886  N  N     . GLU A 1 271 ? -52.112 34.766  28.021  1.00 76.31  ? 919  GLU A N     1 
ATOM   1887  C  CA    . GLU A 1 271 ? -52.374 35.798  29.021  1.00 75.00  ? 919  GLU A CA    1 
ATOM   1888  C  C     . GLU A 1 271 ? -51.687 37.091  28.606  1.00 79.99  ? 919  GLU A C     1 
ATOM   1889  O  O     . GLU A 1 271 ? -50.870 37.095  27.683  1.00 79.52  ? 919  GLU A O     1 
ATOM   1890  C  CB    . GLU A 1 271 ? -51.856 35.370  30.394  1.00 71.64  ? 919  GLU A CB    1 
ATOM   1891  N  N     . GLU A 1 272 ? -52.016 38.189  29.283  1.00 82.48  ? 920  GLU A N     1 
ATOM   1892  C  CA    . GLU A 1 272 ? -51.302 39.448  29.082  1.00 81.22  ? 920  GLU A CA    1 
ATOM   1893  C  C     . GLU A 1 272 ? -50.320 39.684  30.233  1.00 81.99  ? 920  GLU A C     1 
ATOM   1894  O  O     . GLU A 1 272 ? -50.578 39.265  31.359  1.00 84.99  ? 920  GLU A O     1 
ATOM   1895  C  CB    . GLU A 1 272 ? -52.288 40.613  28.954  1.00 79.52  ? 920  GLU A CB    1 
ATOM   1896  C  CG    . GLU A 1 272 ? -51.635 41.952  28.624  1.00 84.65  ? 920  GLU A CG    1 
ATOM   1897  C  CD    . GLU A 1 272 ? -52.635 42.995  28.144  1.00 89.87  ? 920  GLU A CD    1 
ATOM   1898  O  OE1   . GLU A 1 272 ? -53.834 42.662  28.010  1.00 91.27  ? 920  GLU A OE1   1 
ATOM   1899  O  OE2   . GLU A 1 272 ? -52.222 44.149  27.896  1.00 91.15  ? 920  GLU A OE2   1 
ATOM   1900  N  N     . VAL A 1 273 ? -49.192 40.331  29.950  1.00 82.01  ? 921  VAL A N     1 
ATOM   1901  C  CA    . VAL A 1 273 ? -48.192 40.628  30.981  1.00 83.86  ? 921  VAL A CA    1 
ATOM   1902  C  C     . VAL A 1 273 ? -47.246 41.747  30.553  1.00 85.10  ? 921  VAL A C     1 
ATOM   1903  O  O     . VAL A 1 273 ? -46.671 41.693  29.470  1.00 85.06  ? 921  VAL A O     1 
ATOM   1904  C  CB    . VAL A 1 273 ? -47.329 39.387  31.330  1.00 81.44  ? 921  VAL A CB    1 
ATOM   1905  C  CG1   . VAL A 1 273 ? -46.057 39.809  32.061  1.00 80.23  ? 921  VAL A CG1   1 
ATOM   1906  C  CG2   . VAL A 1 273 ? -48.117 38.381  32.153  1.00 77.77  ? 921  VAL A CG2   1 
ATOM   1907  N  N     . ASP A 1 274 ? -47.082 42.753  31.407  1.00 87.11  ? 922  ASP A N     1 
ATOM   1908  C  CA    . ASP A 1 274 ? -46.103 43.818  31.170  1.00 92.26  ? 922  ASP A CA    1 
ATOM   1909  C  C     . ASP A 1 274 ? -46.192 44.442  29.773  1.00 93.39  ? 922  ASP A C     1 
ATOM   1910  O  O     . ASP A 1 274 ? -45.166 44.686  29.132  1.00 90.55  ? 922  ASP A O     1 
ATOM   1911  C  CB    . ASP A 1 274 ? -44.677 43.302  31.410  1.00 92.29  ? 922  ASP A CB    1 
ATOM   1912  C  CG    . ASP A 1 274 ? -44.242 43.434  32.858  1.00 94.41  ? 922  ASP A CG    1 
ATOM   1913  O  OD1   . ASP A 1 274 ? -45.123 43.463  33.746  1.00 95.77  ? 922  ASP A OD1   1 
ATOM   1914  O  OD2   . ASP A 1 274 ? -43.017 43.510  33.105  1.00 92.18  ? 922  ASP A OD2   1 
ATOM   1915  N  N     . GLY A 1 275 ? -47.414 44.702  29.311  1.00 93.87  ? 923  GLY A N     1 
ATOM   1916  C  CA    . GLY A 1 275 ? -47.628 45.277  27.993  1.00 90.44  ? 923  GLY A CA    1 
ATOM   1917  C  C     . GLY A 1 275 ? -47.197 44.339  26.879  1.00 89.26  ? 923  GLY A C     1 
ATOM   1918  O  O     . GLY A 1 275 ? -46.857 44.779  25.779  1.00 86.48  ? 923  GLY A O     1 
ATOM   1919  N  N     . ARG A 1 276 ? -47.211 43.041  27.177  1.00 88.30  ? 924  ARG A N     1 
ATOM   1920  C  CA    . ARG A 1 276 ? -46.816 42.005  26.224  1.00 84.68  ? 924  ARG A CA    1 
ATOM   1921  C  C     . ARG A 1 276 ? -47.724 40.781  26.332  1.00 82.69  ? 924  ARG A C     1 
ATOM   1922  O  O     . ARG A 1 276 ? -47.586 39.980  27.255  1.00 83.17  ? 924  ARG A O     1 
ATOM   1923  C  CB    . ARG A 1 276 ? -45.356 41.587  26.447  1.00 82.25  ? 924  ARG A CB    1 
ATOM   1924  C  CG    . ARG A 1 276 ? -44.343 42.428  25.687  1.00 83.56  ? 924  ARG A CG    1 
ATOM   1925  C  CD    . ARG A 1 276 ? -44.754 42.550  24.229  1.00 82.93  ? 924  ARG A CD    1 
ATOM   1926  N  NE    . ARG A 1 276 ? -43.731 43.173  23.396  1.00 84.08  ? 924  ARG A NE    1 
ATOM   1927  C  CZ    . ARG A 1 276 ? -43.069 42.541  22.431  1.00 82.89  ? 924  ARG A CZ    1 
ATOM   1928  N  NH1   . ARG A 1 276 ? -43.328 41.265  22.177  1.00 78.27  ? 924  ARG A NH1   1 
ATOM   1929  N  NH2   . ARG A 1 276 ? -42.149 43.186  21.718  1.00 83.23  ? 924  ARG A NH2   1 
ATOM   1930  N  N     . VAL A 1 277 ? -48.654 40.638  25.393  1.00 79.78  ? 925  VAL A N     1 
ATOM   1931  C  CA    . VAL A 1 277 ? -49.542 39.484  25.390  1.00 75.19  ? 925  VAL A CA    1 
ATOM   1932  C  C     . VAL A 1 277 ? -48.750 38.242  25.027  1.00 75.88  ? 925  VAL A C     1 
ATOM   1933  O  O     . VAL A 1 277 ? -47.974 38.251  24.072  1.00 75.37  ? 925  VAL A O     1 
ATOM   1934  C  CB    . VAL A 1 277 ? -50.706 39.651  24.397  1.00 74.02  ? 925  VAL A CB    1 
ATOM   1935  C  CG1   . VAL A 1 277 ? -51.484 38.351  24.261  1.00 74.10  ? 925  VAL A CG1   1 
ATOM   1936  C  CG2   . VAL A 1 277 ? -51.625 40.770  24.844  1.00 79.80  ? 925  VAL A CG2   1 
ATOM   1937  N  N     . TYR A 1 278 ? -48.942 37.179  25.803  1.00 74.93  ? 926  TYR A N     1 
ATOM   1938  C  CA    . TYR A 1 278 ? -48.299 35.901  25.531  1.00 73.28  ? 926  TYR A CA    1 
ATOM   1939  C  C     . TYR A 1 278 ? -49.224 34.971  24.747  1.00 73.55  ? 926  TYR A C     1 
ATOM   1940  O  O     . TYR A 1 278 ? -50.424 34.893  25.017  1.00 71.65  ? 926  TYR A O     1 
ATOM   1941  C  CB    . TYR A 1 278 ? -47.825 35.254  26.832  1.00 70.63  ? 926  TYR A CB    1 
ATOM   1942  C  CG    . TYR A 1 278 ? -46.503 35.804  27.309  1.00 69.08  ? 926  TYR A CG    1 
ATOM   1943  C  CD1   . TYR A 1 278 ? -45.453 34.959  27.642  1.00 71.22  ? 926  TYR A CD1   1 
ATOM   1944  C  CD2   . TYR A 1 278 ? -46.295 37.174  27.401  1.00 71.77  ? 926  TYR A CD2   1 
ATOM   1945  C  CE1   . TYR A 1 278 ? -44.236 35.463  28.071  1.00 74.99  ? 926  TYR A CE1   1 
ATOM   1946  C  CE2   . TYR A 1 278 ? -45.086 37.691  27.826  1.00 72.58  ? 926  TYR A CE2   1 
ATOM   1947  C  CZ    . TYR A 1 278 ? -44.057 36.833  28.160  1.00 75.44  ? 926  TYR A CZ    1 
ATOM   1948  O  OH    . TYR A 1 278 ? -42.850 37.348  28.581  1.00 72.19  ? 926  TYR A OH    1 
ATOM   1949  N  N     . CYS A 1 279 ? -48.657 34.280  23.763  1.00 72.77  ? 927  CYS A N     1 
ATOM   1950  C  CA    . CYS A 1 279 ? -49.442 33.459  22.852  1.00 71.59  ? 927  CYS A CA    1 
ATOM   1951  C  C     . CYS A 1 279 ? -49.012 32.004  22.864  1.00 70.08  ? 927  CYS A C     1 
ATOM   1952  O  O     . CYS A 1 279 ? -47.919 31.670  23.328  1.00 69.65  ? 927  CYS A O     1 
ATOM   1953  C  CB    . CYS A 1 279 ? -49.340 34.004  21.431  1.00 70.47  ? 927  CYS A CB    1 
ATOM   1954  S  SG    . CYS A 1 279 ? -50.175 35.572  21.200  1.00 75.13  ? 927  CYS A SG    1 
ATOM   1955  N  N     . SER A 1 280 ? -49.884 31.146  22.344  1.00 67.56  ? 928  SER A N     1 
ATOM   1956  C  CA    . SER A 1 280 ? -49.590 29.725  22.230  1.00 69.26  ? 928  SER A CA    1 
ATOM   1957  C  C     . SER A 1 280 ? -49.604 29.281  20.769  1.00 67.82  ? 928  SER A C     1 
ATOM   1958  O  O     . SER A 1 280 ? -48.998 28.273  20.414  1.00 64.19  ? 928  SER A O     1 
ATOM   1959  C  CB    . SER A 1 280 ? -50.601 28.904  23.033  1.00 67.02  ? 928  SER A CB    1 
ATOM   1960  O  OG    . SER A 1 280 ? -51.908 29.059  22.510  1.00 67.17  ? 928  SER A OG    1 
ATOM   1961  N  N     . SER A 1 281 ? -50.291 30.044  19.924  1.00 67.69  ? 929  SER A N     1 
ATOM   1962  C  CA    . SER A 1 281 ? -50.496 29.641  18.539  1.00 64.90  ? 929  SER A CA    1 
ATOM   1963  C  C     . SER A 1 281 ? -50.628 30.824  17.584  1.00 62.83  ? 929  SER A C     1 
ATOM   1964  O  O     . SER A 1 281 ? -51.623 31.544  17.607  1.00 63.56  ? 929  SER A O     1 
ATOM   1965  C  CB    . SER A 1 281 ? -51.735 28.743  18.435  1.00 68.06  ? 929  SER A CB    1 
ATOM   1966  O  OG    . SER A 1 281 ? -52.043 28.426  17.087  1.00 68.70  ? 929  SER A OG    1 
ATOM   1967  N  N     . ILE A 1 282 ? -49.618 31.006  16.741  1.00 61.25  ? 930  ILE A N     1 
ATOM   1968  C  CA    . ILE A 1 282 ? -49.647 32.025  15.695  1.00 61.54  ? 930  ILE A CA    1 
ATOM   1969  C  C     . ILE A 1 282 ? -49.511 31.399  14.303  1.00 58.85  ? 930  ILE A C     1 
ATOM   1970  O  O     . ILE A 1 282 ? -49.062 30.264  14.160  1.00 57.63  ? 930  ILE A O     1 
ATOM   1971  C  CB    . ILE A 1 282 ? -48.526 33.061  15.886  1.00 60.09  ? 930  ILE A CB    1 
ATOM   1972  C  CG1   . ILE A 1 282 ? -47.170 32.358  15.960  1.00 58.21  ? 930  ILE A CG1   1 
ATOM   1973  C  CG2   . ILE A 1 282 ? -48.766 33.887  17.135  1.00 60.97  ? 930  ILE A CG2   1 
ATOM   1974  C  CD1   . ILE A 1 282 ? -46.008 33.287  16.143  1.00 56.23  ? 930  ILE A CD1   1 
ATOM   1975  N  N     . THR A 1 283 ? -49.903 32.143  13.278  1.00 59.58  ? 931  THR A N     1 
ATOM   1976  C  CA    . THR A 1 283 ? -49.790 31.662  11.907  1.00 58.79  ? 931  THR A CA    1 
ATOM   1977  C  C     . THR A 1 283 ? -49.133 32.704  11.007  1.00 57.26  ? 931  THR A C     1 
ATOM   1978  O  O     . THR A 1 283 ? -49.268 33.900  11.231  1.00 58.50  ? 931  THR A O     1 
ATOM   1979  C  CB    . THR A 1 283 ? -51.172 31.276  11.329  1.00 59.42  ? 931  THR A CB    1 
ATOM   1980  O  OG1   . THR A 1 283 ? -51.012 30.711  10.021  1.00 62.47  ? 931  THR A OG1   1 
ATOM   1981  C  CG2   . THR A 1 283 ? -52.079 32.492  11.239  1.00 57.50  ? 931  THR A CG2   1 
ATOM   1982  N  N     . LYS A 1 284 ? -48.407 32.240  9.998   1.00 56.98  ? 932  LYS A N     1 
ATOM   1983  C  CA    . LYS A 1 284 ? -47.850 33.125  8.981   1.00 56.46  ? 932  LYS A CA    1 
ATOM   1984  C  C     . LYS A 1 284 ? -47.629 32.391  7.669   1.00 59.60  ? 932  LYS A C     1 
ATOM   1985  O  O     . LYS A 1 284 ? -47.002 31.328  7.634   1.00 60.39  ? 932  LYS A O     1 
ATOM   1986  C  CB    . LYS A 1 284 ? -46.524 33.742  9.431   1.00 53.81  ? 932  LYS A CB    1 
ATOM   1987  C  CG    . LYS A 1 284 ? -45.784 34.442  8.299   1.00 53.95  ? 932  LYS A CG    1 
ATOM   1988  C  CD    . LYS A 1 284 ? -44.504 35.124  8.759   1.00 54.34  ? 932  LYS A CD    1 
ATOM   1989  C  CE    . LYS A 1 284 ? -43.374 34.141  8.959   1.00 48.67  ? 932  LYS A CE    1 
ATOM   1990  N  NZ    . LYS A 1 284 ? -42.091 34.851  9.200   1.00 49.85  ? 932  LYS A NZ    1 
ATOM   1991  N  N     . ASN A 1 285 ? -48.148 32.965  6.592   1.00 59.17  ? 933  ASN A N     1 
ATOM   1992  C  CA    . ASN A 1 285 ? -47.847 32.479  5.257   1.00 61.33  ? 933  ASN A CA    1 
ATOM   1993  C  C     . ASN A 1 285 ? -48.399 31.073  4.997   1.00 63.17  ? 933  ASN A C     1 
ATOM   1994  O  O     . ASN A 1 285 ? -47.922 30.356  4.120   1.00 61.31  ? 933  ASN A O     1 
ATOM   1995  C  CB    . ASN A 1 285 ? -46.336 32.547  5.005   1.00 58.46  ? 933  ASN A CB    1 
ATOM   1996  C  CG    . ASN A 1 285 ? -45.961 32.099  3.616   1.00 65.28  ? 933  ASN A CG    1 
ATOM   1997  O  OD1   . ASN A 1 285 ? -46.282 32.764  2.631   1.00 68.21  ? 933  ASN A OD1   1 
ATOM   1998  N  ND2   . ASN A 1 285 ? -45.281 30.961  3.525   1.00 67.61  ? 933  ASN A ND2   1 
ATOM   1999  N  N     . GLY A 1 286 ? -49.415 30.685  5.759   1.00 61.70  ? 934  GLY A N     1 
ATOM   2000  C  CA    . GLY A 1 286 ? -50.048 29.399  5.546   1.00 57.21  ? 934  GLY A CA    1 
ATOM   2001  C  C     . GLY A 1 286 ? -49.603 28.355  6.541   1.00 56.45  ? 934  GLY A C     1 
ATOM   2002  O  O     . GLY A 1 286 ? -50.322 27.398  6.815   1.00 56.28  ? 934  GLY A O     1 
ATOM   2003  N  N     . VAL A 1 287 ? -48.410 28.537  7.088   1.00 58.04  ? 935  VAL A N     1 
ATOM   2004  C  CA    . VAL A 1 287 ? -47.913 27.628  8.115   1.00 58.08  ? 935  VAL A CA    1 
ATOM   2005  C  C     . VAL A 1 287 ? -48.415 28.075  9.489   1.00 57.47  ? 935  VAL A C     1 
ATOM   2006  O  O     . VAL A 1 287 ? -48.631 29.265  9.719   1.00 54.96  ? 935  VAL A O     1 
ATOM   2007  C  CB    . VAL A 1 287 ? -46.374 27.552  8.117   1.00 50.12  ? 935  VAL A CB    1 
ATOM   2008  N  N     . VAL A 1 288 ? -48.606 27.114  10.390  1.00 57.16  ? 936  VAL A N     1 
ATOM   2009  C  CA    . VAL A 1 288 ? -49.126 27.389  11.727  1.00 54.39  ? 936  VAL A CA    1 
ATOM   2010  C  C     . VAL A 1 288 ? -48.149 26.956  12.806  1.00 52.03  ? 936  VAL A C     1 
ATOM   2011  O  O     . VAL A 1 288 ? -47.798 25.787  12.905  1.00 53.64  ? 936  VAL A O     1 
ATOM   2012  C  CB    . VAL A 1 288 ? -50.438 26.647  11.973  1.00 53.18  ? 936  VAL A CB    1 
ATOM   2013  C  CG1   . VAL A 1 288 ? -50.934 26.927  13.379  1.00 54.33  ? 936  VAL A CG1   1 
ATOM   2014  C  CG2   . VAL A 1 288 ? -51.467 27.043  10.933  1.00 53.54  ? 936  VAL A CG2   1 
ATOM   2015  N  N     . TYR A 1 289 ? -47.727 27.901  13.631  1.00 52.98  ? 937  TYR A N     1 
ATOM   2016  C  CA    . TYR A 1 289 ? -46.747 27.611  14.666  1.00 56.43  ? 937  TYR A CA    1 
ATOM   2017  C  C     . TYR A 1 289 ? -47.396 27.543  16.053  1.00 58.95  ? 937  TYR A C     1 
ATOM   2018  O  O     . TYR A 1 289 ? -48.215 28.384  16.408  1.00 61.31  ? 937  TYR A O     1 
ATOM   2019  C  CB    . TYR A 1 289 ? -45.633 28.657  14.632  1.00 52.79  ? 937  TYR A CB    1 
ATOM   2020  C  CG    . TYR A 1 289 ? -45.003 28.836  13.263  1.00 51.44  ? 937  TYR A CG    1 
ATOM   2021  C  CD1   . TYR A 1 289 ? -43.738 28.341  12.985  1.00 45.48  ? 937  TYR A CD1   1 
ATOM   2022  C  CD2   . TYR A 1 289 ? -45.678 29.504  12.250  1.00 55.26  ? 937  TYR A CD2   1 
ATOM   2023  C  CE1   . TYR A 1 289 ? -43.169 28.507  11.746  1.00 45.11  ? 937  TYR A CE1   1 
ATOM   2024  C  CE2   . TYR A 1 289 ? -45.115 29.672  11.004  1.00 51.28  ? 937  TYR A CE2   1 
ATOM   2025  C  CZ    . TYR A 1 289 ? -43.862 29.171  10.758  1.00 47.85  ? 937  TYR A CZ    1 
ATOM   2026  O  OH    . TYR A 1 289 ? -43.300 29.341  9.515   1.00 48.67  ? 937  TYR A OH    1 
ATOM   2027  N  N     . ARG A 1 290 ? -47.039 26.522  16.822  1.00 59.33  ? 938  ARG A N     1 
ATOM   2028  C  CA    . ARG A 1 290 ? -47.546 26.364  18.177  1.00 61.10  ? 938  ARG A CA    1 
ATOM   2029  C  C     . ARG A 1 290 ? -46.368 26.154  19.108  1.00 62.05  ? 938  ARG A C     1 
ATOM   2030  O  O     . ARG A 1 290 ? -45.322 25.675  18.684  1.00 62.75  ? 938  ARG A O     1 
ATOM   2031  C  CB    . ARG A 1 290 ? -48.490 25.162  18.269  1.00 62.92  ? 938  ARG A CB    1 
ATOM   2032  C  CG    . ARG A 1 290 ? -49.829 25.351  17.579  1.00 64.76  ? 938  ARG A CG    1 
ATOM   2033  C  CD    . ARG A 1 290 ? -50.594 24.039  17.496  1.00 68.24  ? 938  ARG A CD    1 
ATOM   2034  N  NE    . ARG A 1 290 ? -49.859 23.039  16.723  1.00 79.44  ? 938  ARG A NE    1 
ATOM   2035  C  CZ    . ARG A 1 290 ? -50.323 21.831  16.407  1.00 86.50  ? 938  ARG A CZ    1 
ATOM   2036  N  NH1   . ARG A 1 290 ? -51.536 21.448  16.796  1.00 88.87  ? 938  ARG A NH1   1 
ATOM   2037  N  NH2   . ARG A 1 290 ? -49.568 21.001  15.698  1.00 84.82  ? 938  ARG A NH2   1 
ATOM   2038  N  N     . LEU A 1 291 ? -46.537 26.514  20.374  1.00 64.66  ? 939  LEU A N     1 
ATOM   2039  C  CA    . LEU A 1 291 ? -45.495 26.294  21.368  1.00 66.20  ? 939  LEU A CA    1 
ATOM   2040  C  C     . LEU A 1 291 ? -44.985 24.858  21.268  1.00 64.99  ? 939  LEU A C     1 
ATOM   2041  O  O     . LEU A 1 291 ? -45.775 23.922  21.123  1.00 63.70  ? 939  LEU A O     1 
ATOM   2042  C  CB    . LEU A 1 291 ? -46.023 26.591  22.778  1.00 64.79  ? 939  LEU A CB    1 
ATOM   2043  C  CG    . LEU A 1 291 ? -46.349 28.056  23.082  1.00 64.64  ? 939  LEU A CG    1 
ATOM   2044  C  CD1   . LEU A 1 291 ? -47.224 28.174  24.310  1.00 63.82  ? 939  LEU A CD1   1 
ATOM   2045  C  CD2   . LEU A 1 291 ? -45.075 28.890  23.243  1.00 70.33  ? 939  LEU A CD2   1 
ATOM   2046  N  N     . GLY A 1 292 ? -43.667 24.690  21.320  1.00 62.31  ? 940  GLY A N     1 
ATOM   2047  C  CA    . GLY A 1 292 ? -43.072 23.372  21.219  1.00 61.23  ? 940  GLY A CA    1 
ATOM   2048  C  C     . GLY A 1 292 ? -42.727 22.964  19.798  1.00 63.03  ? 940  GLY A C     1 
ATOM   2049  O  O     . GLY A 1 292 ? -42.024 21.978  19.586  1.00 64.38  ? 940  GLY A O     1 
ATOM   2050  N  N     . ASP A 1 293 ? -43.229 23.711  18.819  1.00 63.26  ? 941  ASP A N     1 
ATOM   2051  C  CA    . ASP A 1 293 ? -42.870 23.485  17.420  1.00 59.10  ? 941  ASP A CA    1 
ATOM   2052  C  C     . ASP A 1 293 ? -41.462 23.997  17.178  1.00 56.33  ? 941  ASP A C     1 
ATOM   2053  O  O     . ASP A 1 293 ? -40.898 24.686  18.030  1.00 58.65  ? 941  ASP A O     1 
ATOM   2054  C  CB    . ASP A 1 293 ? -43.844 24.214  16.490  1.00 58.19  ? 941  ASP A CB    1 
ATOM   2055  C  CG    . ASP A 1 293 ? -45.036 23.359  16.099  1.00 61.77  ? 941  ASP A CG    1 
ATOM   2056  O  OD1   . ASP A 1 293 ? -44.894 22.115  16.074  1.00 62.84  ? 941  ASP A OD1   1 
ATOM   2057  O  OD2   . ASP A 1 293 ? -46.109 23.936  15.803  1.00 57.61  ? 941  ASP A OD2   1 
ATOM   2058  N  N     . SER A 1 294 ? -40.889 23.673  16.024  1.00 49.98  ? 942  SER A N     1 
ATOM   2059  C  CA    . SER A 1 294 ? -39.562 24.196  15.688  1.00 50.38  ? 942  SER A CA    1 
ATOM   2060  C  C     . SER A 1 294 ? -39.556 25.083  14.448  1.00 51.20  ? 942  SER A C     1 
ATOM   2061  O  O     . SER A 1 294 ? -40.464 25.023  13.614  1.00 49.55  ? 942  SER A O     1 
ATOM   2062  C  CB    . SER A 1 294 ? -38.533 23.073  15.545  1.00 49.80  ? 942  SER A CB    1 
ATOM   2063  O  OG    . SER A 1 294 ? -38.201 22.524  16.809  1.00 56.16  ? 942  SER A OG    1 
ATOM   2064  N  N     . VAL A 1 295 ? -38.515 25.901  14.330  1.00 48.60  ? 943  VAL A N     1 
ATOM   2065  C  CA    . VAL A 1 295 ? -38.519 26.983  13.361  1.00 45.25  ? 943  VAL A CA    1 
ATOM   2066  C  C     . VAL A 1 295 ? -37.203 27.130  12.584  1.00 44.69  ? 943  VAL A C     1 
ATOM   2067  O  O     . VAL A 1 295 ? -36.126 26.864  13.112  1.00 46.23  ? 943  VAL A O     1 
ATOM   2068  C  CB    . VAL A 1 295 ? -38.918 28.299  14.065  1.00 43.20  ? 943  VAL A CB    1 
ATOM   2069  C  CG1   . VAL A 1 295 ? -37.980 29.428  13.699  1.00 47.24  ? 943  VAL A CG1   1 
ATOM   2070  C  CG2   . VAL A 1 295 ? -40.363 28.645  13.759  1.00 41.04  ? 943  VAL A CG2   1 
ATOM   2071  N  N     . TYR A 1 296 ? -37.313 27.534  11.318  1.00 44.42  ? 944  TYR A N     1 
ATOM   2072  C  CA    . TYR A 1 296 ? -36.160 27.795  10.455  1.00 44.50  ? 944  TYR A CA    1 
ATOM   2073  C  C     . TYR A 1 296 ? -35.781 29.275  10.506  1.00 46.14  ? 944  TYR A C     1 
ATOM   2074  O  O     . TYR A 1 296 ? -36.620 30.141  10.256  1.00 47.65  ? 944  TYR A O     1 
ATOM   2075  C  CB    . TYR A 1 296 ? -36.492 27.423  9.003   1.00 42.46  ? 944  TYR A CB    1 
ATOM   2076  C  CG    . TYR A 1 296 ? -36.368 25.947  8.647   1.00 46.13  ? 944  TYR A CG    1 
ATOM   2077  C  CD1   . TYR A 1 296 ? -35.382 25.146  9.215   1.00 44.02  ? 944  TYR A CD1   1 
ATOM   2078  C  CD2   . TYR A 1 296 ? -37.236 25.360  7.724   1.00 45.44  ? 944  TYR A CD2   1 
ATOM   2079  C  CE1   . TYR A 1 296 ? -35.273 23.810  8.882   1.00 41.71  ? 944  TYR A CE1   1 
ATOM   2080  C  CE2   . TYR A 1 296 ? -37.135 24.025  7.391   1.00 40.30  ? 944  TYR A CE2   1 
ATOM   2081  C  CZ    . TYR A 1 296 ? -36.151 23.257  7.968   1.00 41.88  ? 944  TYR A CZ    1 
ATOM   2082  O  OH    . TYR A 1 296 ? -36.047 21.926  7.632   1.00 43.93  ? 944  TYR A OH    1 
ATOM   2083  N  N     . LEU A 1 297 ? -34.527 29.577  10.822  1.00 43.55  ? 945  LEU A N     1 
ATOM   2084  C  CA    . LEU A 1 297 ? -34.088 30.972  10.861  1.00 46.90  ? 945  LEU A CA    1 
ATOM   2085  C  C     . LEU A 1 297 ? -32.805 31.178  10.073  1.00 48.49  ? 945  LEU A C     1 
ATOM   2086  O  O     . LEU A 1 297 ? -32.067 30.228  9.840   1.00 50.56  ? 945  LEU A O     1 
ATOM   2087  C  CB    . LEU A 1 297 ? -33.885 31.445  12.305  1.00 48.75  ? 945  LEU A CB    1 
ATOM   2088  C  CG    . LEU A 1 297 ? -35.136 31.605  13.173  1.00 50.05  ? 945  LEU A CG    1 
ATOM   2089  C  CD1   . LEU A 1 297 ? -34.750 31.702  14.630  1.00 51.90  ? 945  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A 1 297 ? -35.966 32.810  12.753  1.00 49.91  ? 945  LEU A CD2   1 
ATOM   2091  N  N     . PRO A 1 298 ? -32.548 32.422  9.642   1.00 46.70  ? 946  PRO A N     1 
ATOM   2092  C  CA    . PRO A 1 298 ? -31.301 32.813  8.975   1.00 47.38  ? 946  PRO A CA    1 
ATOM   2093  C  C     . PRO A 1 298 ? -30.112 32.726  9.915   1.00 51.16  ? 946  PRO A C     1 
ATOM   2094  O  O     . PRO A 1 298 ? -30.298 32.732  11.127  1.00 51.56  ? 946  PRO A O     1 
ATOM   2095  C  CB    . PRO A 1 298 ? -31.555 34.267  8.601   1.00 48.27  ? 946  PRO A CB    1 
ATOM   2096  C  CG    . PRO A 1 298 ? -33.028 34.360  8.472   1.00 47.90  ? 946  PRO A CG    1 
ATOM   2097  C  CD    . PRO A 1 298 ? -33.575 33.468  9.537   1.00 47.40  ? 946  PRO A CD    1 
ATOM   2098  N  N     . PRO A 1 299 ? -28.897 32.639  9.358   1.00 53.04  ? 947  PRO A N     1 
ATOM   2099  C  CA    . PRO A 1 299 ? -27.644 32.506  10.109  1.00 54.32  ? 947  PRO A CA    1 
ATOM   2100  C  C     . PRO A 1 299 ? -27.448 33.633  11.112  1.00 57.79  ? 947  PRO A C     1 
ATOM   2101  O  O     . PRO A 1 299 ? -26.911 33.416  12.199  1.00 58.19  ? 947  PRO A O     1 
ATOM   2102  C  CB    . PRO A 1 299 ? -26.580 32.610  9.019   1.00 56.27  ? 947  PRO A CB    1 
ATOM   2103  C  CG    . PRO A 1 299 ? -27.256 32.112  7.803   1.00 58.06  ? 947  PRO A CG    1 
ATOM   2104  C  CD    . PRO A 1 299 ? -28.675 32.578  7.906   1.00 55.05  ? 947  PRO A CD    1 
ATOM   2105  N  N     . GLU A 1 300 ? -27.881 34.831  10.735  1.00 58.82  ? 948  GLU A N     1 
ATOM   2106  C  CA    . GLU A 1 300 ? -27.656 36.024  11.539  1.00 54.89  ? 948  GLU A CA    1 
ATOM   2107  C  C     . GLU A 1 300 ? -28.720 36.210  12.616  1.00 56.55  ? 948  GLU A C     1 
ATOM   2108  O  O     . GLU A 1 300 ? -28.611 37.112  13.444  1.00 59.45  ? 948  GLU A O     1 
ATOM   2109  C  CB    . GLU A 1 300 ? -27.576 37.260  10.643  1.00 53.32  ? 948  GLU A CB    1 
ATOM   2110  C  CG    . GLU A 1 300 ? -28.268 37.106  9.288   1.00 56.79  ? 948  GLU A CG    1 
ATOM   2111  C  CD    . GLU A 1 300 ? -27.410 36.383  8.249   1.00 60.43  ? 948  GLU A CD    1 
ATOM   2112  O  OE1   . GLU A 1 300 ? -27.962 35.973  7.204   1.00 56.45  ? 948  GLU A OE1   1 
ATOM   2113  O  OE2   . GLU A 1 300 ? -26.187 36.233  8.471   1.00 61.79  ? 948  GLU A OE2   1 
ATOM   2114  N  N     . ALA A 1 301 ? -29.737 35.352  12.608  1.00 54.07  ? 949  ALA A N     1 
ATOM   2115  C  CA    . ALA A 1 301 ? -30.806 35.420  13.601  1.00 52.27  ? 949  ALA A CA    1 
ATOM   2116  C  C     . ALA A 1 301 ? -30.274 35.252  15.023  1.00 57.08  ? 949  ALA A C     1 
ATOM   2117  O  O     . ALA A 1 301 ? -30.814 35.845  15.955  1.00 61.28  ? 949  ALA A O     1 
ATOM   2118  C  CB    . ALA A 1 301 ? -31.885 34.390  13.311  1.00 52.17  ? 949  ALA A CB    1 
ATOM   2119  N  N     . PHE A 1 302 ? -29.229 34.444  15.195  1.00 55.91  ? 950  PHE A N     1 
ATOM   2120  C  CA    . PHE A 1 302 ? -28.569 34.351  16.496  1.00 58.81  ? 950  PHE A CA    1 
ATOM   2121  C  C     . PHE A 1 302 ? -27.184 33.714  16.477  1.00 61.16  ? 950  PHE A C     1 
ATOM   2122  O  O     . PHE A 1 302 ? -26.923 32.781  15.723  1.00 63.28  ? 950  PHE A O     1 
ATOM   2123  C  CB    . PHE A 1 302 ? -29.466 33.684  17.548  1.00 56.46  ? 950  PHE A CB    1 
ATOM   2124  C  CG    . PHE A 1 302 ? -29.757 32.239  17.289  1.00 55.30  ? 950  PHE A CG    1 
ATOM   2125  C  CD1   . PHE A 1 302 ? -31.040 31.821  16.983  1.00 54.09  ? 950  PHE A CD1   1 
ATOM   2126  C  CD2   . PHE A 1 302 ? -28.756 31.291  17.382  1.00 58.44  ? 950  PHE A CD2   1 
ATOM   2127  C  CE1   . PHE A 1 302 ? -31.317 30.477  16.761  1.00 52.92  ? 950  PHE A CE1   1 
ATOM   2128  C  CE2   . PHE A 1 302 ? -29.022 29.947  17.160  1.00 56.47  ? 950  PHE A CE2   1 
ATOM   2129  C  CZ    . PHE A 1 302 ? -30.305 29.540  16.850  1.00 53.57  ? 950  PHE A CZ    1 
ATOM   2130  N  N     . THR A 1 303 ? -26.297 34.239  17.316  1.00 63.64  ? 951  THR A N     1 
ATOM   2131  C  CA    . THR A 1 303 ? -24.947 33.705  17.437  1.00 66.88  ? 951  THR A CA    1 
ATOM   2132  C  C     . THR A 1 303 ? -24.958 32.477  18.339  1.00 66.34  ? 951  THR A C     1 
ATOM   2133  O  O     . THR A 1 303 ? -26.003 32.098  18.866  1.00 63.03  ? 951  THR A O     1 
ATOM   2134  C  CB    . THR A 1 303 ? -23.978 34.749  18.016  1.00 62.62  ? 951  THR A CB    1 
ATOM   2135  N  N     . PHE A 1 304 ? -23.799 31.846  18.500  1.00 69.30  ? 952  PHE A N     1 
ATOM   2136  C  CA    . PHE A 1 304 ? -23.671 30.716  19.417  1.00 73.58  ? 952  PHE A CA    1 
ATOM   2137  C  C     . PHE A 1 304 ? -22.824 31.077  20.638  1.00 81.32  ? 952  PHE A C     1 
ATOM   2138  O  O     . PHE A 1 304 ? -21.705 31.585  20.507  1.00 81.69  ? 952  PHE A O     1 
ATOM   2139  C  CB    . PHE A 1 304 ? -23.111 29.473  18.709  1.00 70.85  ? 952  PHE A CB    1 
ATOM   2140  C  CG    . PHE A 1 304 ? -24.133 28.729  17.888  1.00 67.08  ? 952  PHE A CG    1 
ATOM   2141  C  CD1   . PHE A 1 304 ? -25.145 28.007  18.504  1.00 61.34  ? 952  PHE A CD1   1 
ATOM   2142  C  CD2   . PHE A 1 304 ? -24.076 28.747  16.500  1.00 63.11  ? 952  PHE A CD2   1 
ATOM   2143  C  CE1   . PHE A 1 304 ? -26.080 27.330  17.758  1.00 56.43  ? 952  PHE A CE1   1 
ATOM   2144  C  CE2   . PHE A 1 304 ? -25.014 28.070  15.748  1.00 57.94  ? 952  PHE A CE2   1 
ATOM   2145  C  CZ    . PHE A 1 304 ? -26.016 27.362  16.379  1.00 57.42  ? 952  PHE A CZ    1 
ATOM   2146  N  N     . ASN A 1 305 ? -23.374 30.819  21.823  1.00 82.33  ? 953  ASN A N     1 
ATOM   2147  C  CA    . ASN A 1 305 ? -22.653 31.045  23.071  1.00 85.76  ? 953  ASN A CA    1 
ATOM   2148  C  C     . ASN A 1 305 ? -21.576 29.983  23.313  1.00 87.30  ? 953  ASN A C     1 
ATOM   2149  O  O     . ASN A 1 305 ? -21.532 29.350  24.373  1.00 89.36  ? 953  ASN A O     1 
ATOM   2150  C  CB    . ASN A 1 305 ? -23.621 31.116  24.259  1.00 86.92  ? 953  ASN A CB    1 
ATOM   2151  C  CG    . ASN A 1 305 ? -24.467 32.382  24.254  1.00 93.64  ? 953  ASN A CG    1 
ATOM   2152  O  OD1   . ASN A 1 305 ? -24.125 33.378  23.606  1.00 94.50  ? 953  ASN A OD1   1 
ATOM   2153  N  ND2   . ASN A 1 305 ? -25.575 32.351  24.990  1.00 92.50  ? 953  ASN A ND2   1 
ATOM   2154  N  N     . ILE A 1 306 ? -20.713 29.790  22.319  1.00 84.99  ? 954  ILE A N     1 
ATOM   2155  C  CA    . ILE A 1 306 ? -19.602 28.854  22.435  1.00 83.76  ? 954  ILE A CA    1 
ATOM   2156  C  C     . ILE A 1 306 ? -18.295 29.522  22.020  1.00 87.04  ? 954  ILE A C     1 
ATOM   2157  O  O     . ILE A 1 306 ? -18.139 29.957  20.879  1.00 84.87  ? 954  ILE A O     1 
ATOM   2158  C  CB    . ILE A 1 306 ? -19.818 27.593  21.577  1.00 82.55  ? 954  ILE A CB    1 
ATOM   2159  N  N     . LYS A 1 307 ? -17.358 29.598  22.957  1.00 89.92  ? 955  LYS A N     1 
ATOM   2160  C  CA    . LYS A 1 307 ? -16.062 30.214  22.699  1.00 91.77  ? 955  LYS A CA    1 
ATOM   2161  C  C     . LYS A 1 307 ? -15.442 29.709  21.402  1.00 94.23  ? 955  LYS A C     1 
ATOM   2162  O  O     . LYS A 1 307 ? -15.080 28.534  21.286  1.00 95.73  ? 955  LYS A O     1 
ATOM   2163  C  CB    . LYS A 1 307 ? -15.104 29.967  23.864  1.00 91.76  ? 955  LYS A CB    1 
ATOM   2164  N  N     . VAL A 1 308 ? -15.320 30.605  20.429  1.00 94.42  ? 956  VAL A N     1 
ATOM   2165  C  CA    . VAL A 1 308 ? -14.693 30.269  19.152  1.00 98.95  ? 956  VAL A CA    1 
ATOM   2166  C  C     . VAL A 1 308 ? -13.381 31.040  18.966  1.00 105.08 ? 956  VAL A C     1 
ATOM   2167  O  O     . VAL A 1 308 ? -13.374 32.269  18.931  1.00 108.48 ? 956  VAL A O     1 
ATOM   2168  C  CB    . VAL A 1 308 ? -15.634 30.561  17.968  1.00 92.49  ? 956  VAL A CB    1 
ATOM   2169  N  N     . ALA A 1 309 ? -12.275 30.313  18.851  1.00 105.80 ? 957  ALA A N     1 
ATOM   2170  C  CA    . ALA A 1 309 ? -10.961 30.935  18.729  1.00 108.14 ? 957  ALA A CA    1 
ATOM   2171  C  C     . ALA A 1 309 ? -10.629 31.301  17.289  1.00 111.69 ? 957  ALA A C     1 
ATOM   2172  O  O     . ALA A 1 309 ? -10.451 30.419  16.448  1.00 113.66 ? 957  ALA A O     1 
ATOM   2173  C  CB    . ALA A 1 309 ? -9.881  30.012  19.305  1.00 107.64 ? 957  ALA A CB    1 
ATOM   2174  N  N     . SER A 1 310 ? -10.558 32.596  16.996  1.00 109.44 ? 958  SER A N     1 
ATOM   2175  C  CA    . SER A 1 310 ? -10.204 33.065  15.653  1.00 111.52 ? 958  SER A CA    1 
ATOM   2176  C  C     . SER A 1 310 ? -8.841  32.506  15.220  1.00 113.86 ? 958  SER A C     1 
ATOM   2177  O  O     . SER A 1 310 ? -7.831  32.796  15.877  1.00 113.77 ? 958  SER A O     1 
ATOM   2178  C  CB    . SER A 1 310 ? -10.186 34.598  15.655  1.00 109.17 ? 958  SER A CB    1 
ATOM   2179  N  N     . PRO A 1 311 ? -8.812  31.686  14.140  1.00 115.38 ? 959  PRO A N     1 
ATOM   2180  C  CA    . PRO A 1 311 ? -7.620  31.014  13.603  1.00 114.86 ? 959  PRO A CA    1 
ATOM   2181  C  C     . PRO A 1 311 ? -6.468  31.982  13.354  1.00 116.24 ? 959  PRO A C     1 
ATOM   2182  O  O     . PRO A 1 311 ? -6.686  33.193  13.231  1.00 114.45 ? 959  PRO A O     1 
ATOM   2183  C  CB    . PRO A 1 311 ? -8.137  30.378  12.321  1.00 110.42 ? 959  PRO A CB    1 
ATOM   2184  N  N     . VAL A 1 312 ? -5.251  31.447  13.274  1.00 118.14 ? 960  VAL A N     1 
ATOM   2185  C  CA    . VAL A 1 312 ? -4.051  32.260  13.023  1.00 118.27 ? 960  VAL A CA    1 
ATOM   2186  C  C     . VAL A 1 312 ? -3.807  32.547  11.533  1.00 118.92 ? 960  VAL A C     1 
ATOM   2187  O  O     . VAL A 1 312 ? -3.960  31.672  10.679  1.00 117.14 ? 960  VAL A O     1 
ATOM   2188  C  CB    . VAL A 1 312 ? -2.799  31.581  13.597  1.00 112.70 ? 960  VAL A CB    1 
ATOM   2189  N  N     . LYS A 1 313 ? -3.408  33.782  11.240  1.00 117.47 ? 961  LYS A N     1 
ATOM   2190  C  CA    . LYS A 1 313 ? -3.086  34.198  9.872   1.00 115.86 ? 961  LYS A CA    1 
ATOM   2191  C  C     . LYS A 1 313 ? -2.029  33.288  9.237   1.00 117.29 ? 961  LYS A C     1 
ATOM   2192  O  O     . LYS A 1 313 ? -0.935  33.124  9.786   1.00 116.38 ? 961  LYS A O     1 
ATOM   2193  C  CB    . LYS A 1 313 ? -2.636  35.661  9.820   1.00 109.79 ? 961  LYS A CB    1 
ATOM   2194  N  N     . ARG A 1 314 ? -2.347  32.710  8.078   1.00 115.83 ? 962  ARG A N     1 
ATOM   2195  C  CA    . ARG A 1 314 ? -1.484  31.711  7.429   1.00 114.09 ? 962  ARG A CA    1 
ATOM   2196  C  C     . ARG A 1 314 ? 0.002   32.107  7.406   1.00 112.75 ? 962  ARG A C     1 
ATOM   2197  O  O     . ARG A 1 314 ? 0.321   33.301  7.336   1.00 109.80 ? 962  ARG A O     1 
ATOM   2198  C  CB    . ARG A 1 314 ? -2.007  31.441  6.010   1.00 107.28 ? 962  ARG A CB    1 
ATOM   2199  N  N     . PRO A 1 315 ? 0.908   31.110  7.491   1.00 110.10 ? 963  PRO A N     1 
ATOM   2200  C  CA    . PRO A 1 315 ? 2.362   31.294  7.453   1.00 111.62 ? 963  PRO A CA    1 
ATOM   2201  C  C     . PRO A 1 315 ? 2.814   32.023  6.181   1.00 114.09 ? 963  PRO A C     1 
ATOM   2202  O  O     . PRO A 1 315 ? 2.029   32.184  5.237   1.00 111.18 ? 963  PRO A O     1 
ATOM   2203  C  CB    . PRO A 1 315 ? 2.878   29.864  7.510   1.00 104.95 ? 963  PRO A CB    1 
ATOM   2204  N  N     . LYS A 1 316 ? 4.069   32.462  6.153   1.00 112.12 ? 964  LYS A N     1 
ATOM   2205  C  CA    . LYS A 1 316 ? 4.644   33.053  4.941   1.00 104.92 ? 964  LYS A CA    1 
ATOM   2206  C  C     . LYS A 1 316 ? 5.119   31.961  3.979   1.00 107.34 ? 964  LYS A C     1 
ATOM   2207  O  O     . LYS A 1 316 ? 5.979   31.138  4.317   1.00 106.05 ? 964  LYS A O     1 
ATOM   2208  C  CB    . LYS A 1 316 ? 5.788   33.990  5.309   1.00 96.03  ? 964  LYS A CB    1 
ATOM   2209  N  N     . LYS A 1 317 ? 4.549   31.963  2.777   1.00 105.12 ? 965  LYS A N     1 
ATOM   2210  C  CA    . LYS A 1 317 ? 4.890   30.964  1.763   1.00 101.62 ? 965  LYS A CA    1 
ATOM   2211  C  C     . LYS A 1 317 ? 6.096   31.385  0.915   1.00 97.91  ? 965  LYS A C     1 
ATOM   2212  O  O     . LYS A 1 317 ? 6.095   32.450  0.289   1.00 95.52  ? 965  LYS A O     1 
ATOM   2213  C  CB    . LYS A 1 317 ? 3.683   30.658  0.870   1.00 96.47  ? 965  LYS A CB    1 
ATOM   2214  N  N     . ASP A 1 318 ? 7.125   30.541  0.900   1.00 93.70  ? 966  ASP A N     1 
ATOM   2215  C  CA    . ASP A 1 318 ? 8.343   30.837  0.147   1.00 91.26  ? 966  ASP A CA    1 
ATOM   2216  C  C     . ASP A 1 318 ? 8.082   30.854  -1.360  1.00 86.80  ? 966  ASP A C     1 
ATOM   2217  O  O     . ASP A 1 318 ? 7.688   29.836  -1.935  1.00 83.35  ? 966  ASP A O     1 
ATOM   2218  C  CB    . ASP A 1 318 ? 9.445   29.829  0.481   1.00 90.70  ? 966  ASP A CB    1 
ATOM   2219  N  N     . PRO A 1 319 ? 8.308   32.016  -2.002  1.00 83.73  ? 967  PRO A N     1 
ATOM   2220  C  CA    . PRO A 1 319 ? 8.105   32.209  -3.444  1.00 80.37  ? 967  PRO A CA    1 
ATOM   2221  C  C     . PRO A 1 319 ? 8.450   30.965  -4.265  1.00 77.62  ? 967  PRO A C     1 
ATOM   2222  O  O     . PRO A 1 319 ? 9.576   30.461  -4.193  1.00 77.34  ? 967  PRO A O     1 
ATOM   2223  C  CB    . PRO A 1 319 ? 9.063   33.355  -3.769  1.00 74.61  ? 967  PRO A CB    1 
ATOM   2224  C  CG    . PRO A 1 319 ? 9.040   34.191  -2.522  1.00 73.19  ? 967  PRO A CG    1 
ATOM   2225  C  CD    . PRO A 1 319 ? 8.853   33.228  -1.362  1.00 77.91  ? 967  PRO A CD    1 
ATOM   2226  N  N     . VAL A 1 320 ? 7.478   30.471  -5.029  1.00 72.60  ? 968  VAL A N     1 
ATOM   2227  C  CA    . VAL A 1 320 ? 7.679   29.288  -5.864  1.00 64.15  ? 968  VAL A CA    1 
ATOM   2228  C  C     . VAL A 1 320 ? 8.829   29.490  -6.854  1.00 60.05  ? 968  VAL A C     1 
ATOM   2229  O  O     . VAL A 1 320 ? 8.960   30.547  -7.467  1.00 60.98  ? 968  VAL A O     1 
ATOM   2230  C  CB    . VAL A 1 320 ? 6.393   28.914  -6.628  1.00 52.77  ? 968  VAL A CB    1 
ATOM   2231  N  N     . ASN A 1 321 ? 9.670   28.474  -6.992  1.00 57.62  ? 969  ASN A N     1 
ATOM   2232  C  CA    . ASN A 1 321 ? 10.781  28.516  -7.934  1.00 54.83  ? 969  ASN A CA    1 
ATOM   2233  C  C     . ASN A 1 321 ? 10.277  28.656  -9.366  1.00 50.62  ? 969  ASN A C     1 
ATOM   2234  O  O     . ASN A 1 321 ? 9.695   27.739  -9.919  1.00 52.47  ? 969  ASN A O     1 
ATOM   2235  C  CB    . ASN A 1 321 ? 11.639  27.256  -7.784  1.00 55.08  ? 969  ASN A CB    1 
ATOM   2236  C  CG    . ASN A 1 321 ? 12.752  27.181  -8.803  1.00 54.11  ? 969  ASN A CG    1 
ATOM   2237  O  OD1   . ASN A 1 321 ? 12.598  27.613  -9.944  1.00 53.62  ? 969  ASN A OD1   1 
ATOM   2238  N  ND2   . ASN A 1 321 ? 13.883  26.620  -8.397  1.00 51.72  ? 969  ASN A ND2   1 
ATOM   2239  N  N     . GLU A 1 322 ? 10.506  29.813  -9.962  1.00 53.83  ? 970  GLU A N     1 
ATOM   2240  C  CA    . GLU A 1 322 ? 9.977   30.115  -11.286 1.00 53.68  ? 970  GLU A CA    1 
ATOM   2241  C  C     . GLU A 1 322 ? 10.522  29.222  -12.406 1.00 51.63  ? 970  GLU A C     1 
ATOM   2242  O  O     . GLU A 1 322 ? 9.915   29.112  -13.471 1.00 49.96  ? 970  GLU A O     1 
ATOM   2243  C  CB    . GLU A 1 322 ? 10.250  31.585  -11.615 1.00 57.52  ? 970  GLU A CB    1 
ATOM   2244  C  CG    . GLU A 1 322 ? 9.364   32.574  -10.877 1.00 57.22  ? 970  GLU A CG    1 
ATOM   2245  C  CD    . GLU A 1 322 ? 8.216   33.070  -11.740 1.00 60.94  ? 970  GLU A CD    1 
ATOM   2246  O  OE1   . GLU A 1 322 ? 8.108   34.303  -11.929 1.00 59.39  ? 970  GLU A OE1   1 
ATOM   2247  O  OE2   . GLU A 1 322 ? 7.425   32.231  -12.235 1.00 59.51  ? 970  GLU A OE2   1 
ATOM   2248  N  N     . THR A 1 323 ? 11.672  28.599  -12.176 1.00 51.20  ? 971  THR A N     1 
ATOM   2249  C  CA    . THR A 1 323 ? 12.310  27.796  -13.214 1.00 50.92  ? 971  THR A CA    1 
ATOM   2250  C  C     . THR A 1 323 ? 11.784  26.372  -13.177 1.00 51.07  ? 971  THR A C     1 
ATOM   2251  O  O     . THR A 1 323 ? 11.686  25.701  -14.209 1.00 48.36  ? 971  THR A O     1 
ATOM   2252  C  CB    . THR A 1 323 ? 13.838  27.765  -13.059 1.00 54.65  ? 971  THR A CB    1 
ATOM   2253  O  OG1   . THR A 1 323 ? 14.348  29.104  -12.968 1.00 60.70  ? 971  THR A OG1   1 
ATOM   2254  C  CG2   . THR A 1 323 ? 14.470  27.061  -14.250 1.00 52.60  ? 971  THR A CG2   1 
ATOM   2255  N  N     . LEU A 1 324 ? 11.448  25.921  -11.974 1.00 49.85  ? 972  LEU A N     1 
ATOM   2256  C  CA    . LEU A 1 324 ? 10.845  24.615  -11.787 1.00 48.42  ? 972  LEU A CA    1 
ATOM   2257  C  C     . LEU A 1 324 ? 9.349   24.684  -12.070 1.00 47.28  ? 972  LEU A C     1 
ATOM   2258  O  O     . LEU A 1 324 ? 8.747   23.720  -12.525 1.00 49.44  ? 972  LEU A O     1 
ATOM   2259  C  CB    . LEU A 1 324 ? 11.095  24.099  -10.367 1.00 47.88  ? 972  LEU A CB    1 
ATOM   2260  C  CG    . LEU A 1 324 ? 10.672  22.644  -10.120 1.00 49.55  ? 972  LEU A CG    1 
ATOM   2261  C  CD1   . LEU A 1 324 ? 11.352  21.695  -11.110 1.00 48.19  ? 972  LEU A CD1   1 
ATOM   2262  C  CD2   . LEU A 1 324 ? 10.947  22.207  -8.688  1.00 45.31  ? 972  LEU A CD2   1 
ATOM   2263  N  N     . TYR A 1 325 ? 8.751   25.835  -11.806 1.00 49.10  ? 973  TYR A N     1 
ATOM   2264  C  CA    . TYR A 1 325 ? 7.319   26.010  -12.002 1.00 48.76  ? 973  TYR A CA    1 
ATOM   2265  C  C     . TYR A 1 325 ? 7.073   27.237  -12.850 1.00 49.11  ? 973  TYR A C     1 
ATOM   2266  O  O     . TYR A 1 325 ? 6.567   28.243  -12.366 1.00 52.09  ? 973  TYR A O     1 
ATOM   2267  C  CB    . TYR A 1 325 ? 6.615   26.123  -10.649 1.00 46.03  ? 973  TYR A CB    1 
ATOM   2268  C  CG    . TYR A 1 325 ? 6.935   24.950  -9.762  1.00 46.47  ? 973  TYR A CG    1 
ATOM   2269  C  CD1   . TYR A 1 325 ? 6.286   23.734  -9.927  1.00 46.63  ? 973  TYR A CD1   1 
ATOM   2270  C  CD2   . TYR A 1 325 ? 7.911   25.039  -8.794  1.00 47.57  ? 973  TYR A CD2   1 
ATOM   2271  C  CE1   . TYR A 1 325 ? 6.585   22.650  -9.143  1.00 43.99  ? 973  TYR A CE1   1 
ATOM   2272  C  CE2   . TYR A 1 325 ? 8.214   23.956  -8.001  1.00 51.91  ? 973  TYR A CE2   1 
ATOM   2273  C  CZ    . TYR A 1 325 ? 7.547   22.761  -8.182  1.00 46.37  ? 973  TYR A CZ    1 
ATOM   2274  O  OH    . TYR A 1 325 ? 7.847   21.676  -7.392  1.00 46.71  ? 973  TYR A OH    1 
ATOM   2275  N  N     . PRO A 1 326 ? 7.435   27.154  -14.131 1.00 46.88  ? 974  PRO A N     1 
ATOM   2276  C  CA    . PRO A 1 326 ? 7.391   28.304  -15.030 1.00 47.06  ? 974  PRO A CA    1 
ATOM   2277  C  C     . PRO A 1 326 ? 5.975   28.833  -15.137 1.00 51.90  ? 974  PRO A C     1 
ATOM   2278  O  O     . PRO A 1 326 ? 5.750   30.032  -14.993 1.00 54.84  ? 974  PRO A O     1 
ATOM   2279  C  CB    . PRO A 1 326 ? 7.810   27.718  -16.377 1.00 44.19  ? 974  PRO A CB    1 
ATOM   2280  C  CG    . PRO A 1 326 ? 8.419   26.407  -16.066 1.00 48.73  ? 974  PRO A CG    1 
ATOM   2281  C  CD    . PRO A 1 326 ? 7.742   25.910  -14.843 1.00 47.44  ? 974  PRO A CD    1 
ATOM   2282  N  N     . GLU A 1 327 ? 5.027   27.931  -15.362 1.00 52.49  ? 975  GLU A N     1 
ATOM   2283  C  CA    . GLU A 1 327 ? 3.662   28.324  -15.674 1.00 50.47  ? 975  GLU A CA    1 
ATOM   2284  C  C     . GLU A 1 327 ? 2.827   28.599  -14.433 1.00 51.14  ? 975  GLU A C     1 
ATOM   2285  O  O     . GLU A 1 327 ? 1.611   28.718  -14.520 1.00 51.53  ? 975  GLU A O     1 
ATOM   2286  C  CB    . GLU A 1 327 ? 2.998   27.255  -16.538 1.00 48.31  ? 975  GLU A CB    1 
ATOM   2287  C  CG    . GLU A 1 327 ? 2.488   27.774  -17.876 1.00 49.51  ? 975  GLU A CG    1 
ATOM   2288  C  CD    . GLU A 1 327 ? 3.580   28.363  -18.740 1.00 50.83  ? 975  GLU A CD    1 
ATOM   2289  O  OE1   . GLU A 1 327 ? 3.283   29.283  -19.529 1.00 51.80  ? 975  GLU A OE1   1 
ATOM   2290  O  OE2   . GLU A 1 327 ? 4.735   27.905  -18.639 1.00 51.18  ? 975  GLU A OE2   1 
ATOM   2291  N  N     . HIS A 1 328 ? 3.486   28.717  -13.283 1.00 53.71  ? 976  HIS A N     1 
ATOM   2292  C  CA    . HIS A 1 328 ? 2.797   28.967  -12.018 1.00 50.54  ? 976  HIS A CA    1 
ATOM   2293  C  C     . HIS A 1 328 ? 2.392   30.420  -11.884 1.00 52.11  ? 976  HIS A C     1 
ATOM   2294  O  O     . HIS A 1 328 ? 1.472   30.741  -11.137 1.00 53.46  ? 976  HIS A O     1 
ATOM   2295  C  CB    . HIS A 1 328 ? 3.673   28.569  -10.831 1.00 51.12  ? 976  HIS A CB    1 
ATOM   2296  C  CG    . HIS A 1 328 ? 3.024   28.778  -9.499  1.00 51.39  ? 976  HIS A CG    1 
ATOM   2297  N  ND1   . HIS A 1 328 ? 3.074   29.982  -8.827  1.00 51.96  ? 976  HIS A ND1   1 
ATOM   2298  C  CD2   . HIS A 1 328 ? 2.318   27.937  -8.705  1.00 52.79  ? 976  HIS A CD2   1 
ATOM   2299  C  CE1   . HIS A 1 328 ? 2.426   29.873  -7.682  1.00 50.28  ? 976  HIS A CE1   1 
ATOM   2300  N  NE2   . HIS A 1 328 ? 1.957   28.641  -7.583  1.00 51.32  ? 976  HIS A NE2   1 
ATOM   2301  N  N     . TYR A 1 329 ? 3.081   31.301  -12.599 1.00 51.93  ? 977  TYR A N     1 
ATOM   2302  C  CA    . TYR A 1 329 ? 2.680   32.699  -12.610 1.00 53.59  ? 977  TYR A CA    1 
ATOM   2303  C  C     . TYR A 1 329 ? 1.256   32.823  -13.134 1.00 57.10  ? 977  TYR A C     1 
ATOM   2304  O  O     . TYR A 1 329 ? 0.458   33.594  -12.606 1.00 61.25  ? 977  TYR A O     1 
ATOM   2305  C  CB    . TYR A 1 329 ? 3.635   33.554  -13.445 1.00 56.49  ? 977  TYR A CB    1 
ATOM   2306  C  CG    . TYR A 1 329 ? 3.533   33.355  -14.943 1.00 54.15  ? 977  TYR A CG    1 
ATOM   2307  C  CD1   . TYR A 1 329 ? 2.709   34.156  -15.721 1.00 53.92  ? 977  TYR A CD1   1 
ATOM   2308  C  CD2   . TYR A 1 329 ? 4.284   32.386  -15.578 1.00 54.14  ? 977  TYR A CD2   1 
ATOM   2309  C  CE1   . TYR A 1 329 ? 2.631   33.982  -17.091 1.00 52.92  ? 977  TYR A CE1   1 
ATOM   2310  C  CE2   . TYR A 1 329 ? 4.211   32.203  -16.940 1.00 54.46  ? 977  TYR A CE2   1 
ATOM   2311  C  CZ    . TYR A 1 329 ? 3.385   32.999  -17.695 1.00 53.07  ? 977  TYR A CZ    1 
ATOM   2312  O  OH    . TYR A 1 329 ? 3.330   32.797  -19.058 1.00 50.18  ? 977  TYR A OH    1 
ATOM   2313  N  N     . ARG A 1 330 ? 0.935   32.044  -14.162 1.00 55.86  ? 978  ARG A N     1 
ATOM   2314  C  CA    . ARG A 1 330 ? -0.394  32.082  -14.764 1.00 57.17  ? 978  ARG A CA    1 
ATOM   2315  C  C     . ARG A 1 330 ? -1.519  31.897  -13.753 1.00 60.11  ? 978  ARG A C     1 
ATOM   2316  O  O     . ARG A 1 330 ? -2.680  32.171  -14.055 1.00 64.47  ? 978  ARG A O     1 
ATOM   2317  C  CB    . ARG A 1 330 ? -0.511  31.045  -15.877 1.00 52.48  ? 978  ARG A CB    1 
ATOM   2318  C  CG    . ARG A 1 330 ? 0.303   31.393  -17.095 1.00 51.60  ? 978  ARG A CG    1 
ATOM   2319  C  CD    . ARG A 1 330 ? 0.261   30.286  -18.097 1.00 46.98  ? 978  ARG A CD    1 
ATOM   2320  N  NE    . ARG A 1 330 ? -0.382  30.693  -19.334 1.00 46.31  ? 978  ARG A NE    1 
ATOM   2321  C  CZ    . ARG A 1 330 ? 0.272   31.202  -20.370 1.00 51.94  ? 978  ARG A CZ    1 
ATOM   2322  N  NH1   . ARG A 1 330 ? -0.376  31.541  -21.475 1.00 52.57  ? 978  ARG A NH1   1 
ATOM   2323  N  NH2   . ARG A 1 330 ? 1.585   31.372  -20.301 1.00 55.50  ? 978  ARG A NH2   1 
ATOM   2324  N  N     . LYS A 1 331 ? -1.178  31.435  -12.556 1.00 57.87  ? 979  LYS A N     1 
ATOM   2325  C  CA    . LYS A 1 331 ? -2.172  31.287  -11.500 1.00 62.31  ? 979  LYS A CA    1 
ATOM   2326  C  C     . LYS A 1 331 ? -2.433  32.600  -10.760 1.00 71.92  ? 979  LYS A C     1 
ATOM   2327  O  O     . LYS A 1 331 ? -2.484  32.614  -9.527  1.00 73.01  ? 979  LYS A O     1 
ATOM   2328  C  CB    . LYS A 1 331 ? -1.745  30.228  -10.488 1.00 56.49  ? 979  LYS A CB    1 
ATOM   2329  C  CG    . LYS A 1 331 ? -1.431  28.880  -11.080 1.00 53.95  ? 979  LYS A CG    1 
ATOM   2330  C  CD    . LYS A 1 331 ? -1.258  27.849  -9.985  1.00 52.71  ? 979  LYS A CD    1 
ATOM   2331  C  CE    . LYS A 1 331 ? -2.598  27.437  -9.413  1.00 54.36  ? 979  LYS A CE    1 
ATOM   2332  N  NZ    . LYS A 1 331 ? -2.438  26.430  -8.333  1.00 54.80  ? 979  LYS A NZ    1 
ATOM   2333  N  N     . TYR A 1 332 ? -2.585  33.697  -11.501 1.00 74.69  ? 980  TYR A N     1 
ATOM   2334  C  CA    . TYR A 1 332 ? -3.032  34.955  -10.906 1.00 79.64  ? 980  TYR A CA    1 
ATOM   2335  C  C     . TYR A 1 332 ? -4.181  34.616  -9.964  1.00 84.78  ? 980  TYR A C     1 
ATOM   2336  O  O     . TYR A 1 332 ? -5.055  33.826  -10.321 1.00 88.89  ? 980  TYR A O     1 
ATOM   2337  C  CB    . TYR A 1 332 ? -3.551  35.915  -11.985 1.00 79.60  ? 980  TYR A CB    1 
ATOM   2338  C  CG    . TYR A 1 332 ? -2.598  36.202  -13.138 1.00 74.85  ? 980  TYR A CG    1 
ATOM   2339  C  CD1   . TYR A 1 332 ? -1.283  36.598  -12.908 1.00 74.88  ? 980  TYR A CD1   1 
ATOM   2340  C  CD2   . TYR A 1 332 ? -3.025  36.092  -14.460 1.00 70.19  ? 980  TYR A CD2   1 
ATOM   2341  C  CE1   . TYR A 1 332 ? -0.415  36.871  -13.970 1.00 76.08  ? 980  TYR A CE1   1 
ATOM   2342  C  CE2   . TYR A 1 332 ? -2.169  36.359  -15.524 1.00 70.46  ? 980  TYR A CE2   1 
ATOM   2343  C  CZ    . TYR A 1 332 ? -0.864  36.748  -15.275 1.00 71.19  ? 980  TYR A CZ    1 
ATOM   2344  O  OH    . TYR A 1 332 ? -0.012  37.016  -16.327 1.00 61.98  ? 980  TYR A OH    1 
ATOM   2345  N  N     . SER A 1 333 ? -4.183  35.192  -8.766  1.00 87.46  ? 981  SER A N     1 
ATOM   2346  C  CA    . SER A 1 333 ? -5.263  34.948  -7.804  1.00 91.71  ? 981  SER A CA    1 
ATOM   2347  C  C     . SER A 1 333 ? -6.624  34.858  -8.503  1.00 94.77  ? 981  SER A C     1 
ATOM   2348  O  O     . SER A 1 333 ? -7.094  35.830  -9.099  1.00 96.92  ? 981  SER A O     1 
ATOM   2349  C  CB    . SER A 1 333 ? -5.293  36.043  -6.736  1.00 91.07  ? 981  SER A CB    1 
ATOM   2350  N  N     . ASP A 1 334 ? -7.249  33.685  -8.428  1.00 96.91  ? 982  ASP A N     1 
ATOM   2351  C  CA    . ASP A 1 334 ? -8.515  33.440  -9.115  1.00 100.49 ? 982  ASP A CA    1 
ATOM   2352  C  C     . ASP A 1 334 ? -9.464  32.580  -8.275  1.00 105.24 ? 982  ASP A C     1 
ATOM   2353  O  O     . ASP A 1 334 ? -9.026  31.728  -7.498  1.00 102.93 ? 982  ASP A O     1 
ATOM   2354  C  CB    . ASP A 1 334 ? -8.269  32.768  -10.469 1.00 97.14  ? 982  ASP A CB    1 
ATOM   2355  N  N     . TYR A 1 335 ? -10.766 32.811  -8.437  1.00 106.88 ? 983  TYR A N     1 
ATOM   2356  C  CA    . TYR A 1 335 ? -11.783 32.007  -7.759  1.00 106.29 ? 983  TYR A CA    1 
ATOM   2357  C  C     . TYR A 1 335 ? -11.534 30.515  -7.989  1.00 99.85  ? 983  TYR A C     1 
ATOM   2358  O  O     . TYR A 1 335 ? -11.675 30.021  -9.107  1.00 98.47  ? 983  TYR A O     1 
ATOM   2359  C  CB    . TYR A 1 335 ? -13.183 32.390  -8.245  1.00 103.88 ? 983  TYR A CB    1 
ATOM   2360  N  N     . ILE A 1 336 ? -11.156 29.806  -6.928  1.00 95.82  ? 984  ILE A N     1 
ATOM   2361  C  CA    . ILE A 1 336 ? -10.920 28.364  -7.004  1.00 93.67  ? 984  ILE A CA    1 
ATOM   2362  C  C     . ILE A 1 336 ? -12.171 27.598  -7.458  1.00 90.42  ? 984  ILE A C     1 
ATOM   2363  O  O     . ILE A 1 336 ? -13.151 27.485  -6.713  1.00 87.06  ? 984  ILE A O     1 
ATOM   2364  C  CB    . ILE A 1 336 ? -10.410 27.802  -5.648  1.00 89.52  ? 984  ILE A CB    1 
ATOM   2365  C  CG1   . ILE A 1 336 ? -8.906  28.049  -5.498  1.00 83.40  ? 984  ILE A CG1   1 
ATOM   2366  C  CG2   . ILE A 1 336 ? -10.720 26.317  -5.516  1.00 83.39  ? 984  ILE A CG2   1 
ATOM   2367  C  CD1   . ILE A 1 336 ? -8.317  27.472  -4.228  1.00 74.49  ? 984  ILE A CD1   1 
ATOM   2368  N  N     . LYS A 1 337 ? -12.134 27.086  -8.689  1.00 87.18  ? 985  LYS A N     1 
ATOM   2369  C  CA    . LYS A 1 337 ? -13.233 26.283  -9.228  1.00 82.11  ? 985  LYS A CA    1 
ATOM   2370  C  C     . LYS A 1 337 ? -13.483 25.058  -8.345  1.00 78.67  ? 985  LYS A C     1 
ATOM   2371  O  O     . LYS A 1 337 ? -12.551 24.315  -8.007  1.00 75.07  ? 985  LYS A O     1 
ATOM   2372  C  CB    . LYS A 1 337 ? -12.949 25.861  -10.672 1.00 74.38  ? 985  LYS A CB    1 
ATOM   2373  N  N     . GLY A 1 338 ? -14.744 24.859  -7.967  1.00 74.22  ? 986  GLY A N     1 
ATOM   2374  C  CA    . GLY A 1 338 ? -15.112 23.783  -7.061  1.00 69.01  ? 986  GLY A CA    1 
ATOM   2375  C  C     . GLY A 1 338 ? -14.653 24.024  -5.631  1.00 71.78  ? 986  GLY A C     1 
ATOM   2376  O  O     . GLY A 1 338 ? -13.981 23.177  -5.042  1.00 70.60  ? 986  GLY A O     1 
ATOM   2377  N  N     . SER A 1 339 ? -15.009 25.186  -5.080  1.00 77.45  ? 987  SER A N     1 
ATOM   2378  C  CA    . SER A 1 339 ? -14.669 25.543  -3.701  1.00 75.61  ? 987  SER A CA    1 
ATOM   2379  C  C     . SER A 1 339 ? -15.911 25.986  -2.931  1.00 74.17  ? 987  SER A C     1 
ATOM   2380  O  O     . SER A 1 339 ? -16.683 26.826  -3.408  1.00 73.54  ? 987  SER A O     1 
ATOM   2381  C  CB    . SER A 1 339 ? -13.607 26.645  -3.662  1.00 75.13  ? 987  SER A CB    1 
ATOM   2382  N  N     . ASN A 1 340 ? -16.099 25.407  -1.746  1.00 74.05  ? 988  ASN A N     1 
ATOM   2383  C  CA    . ASN A 1 340 ? -17.216 25.762  -0.869  1.00 75.85  ? 988  ASN A CA    1 
ATOM   2384  C  C     . ASN A 1 340 ? -16.821 26.820  0.171   1.00 74.58  ? 988  ASN A C     1 
ATOM   2385  O  O     . ASN A 1 340 ? -17.394 26.890  1.263   1.00 71.57  ? 988  ASN A O     1 
ATOM   2386  C  CB    . ASN A 1 340 ? -17.808 24.509  -0.192  1.00 74.99  ? 988  ASN A CB    1 
ATOM   2387  C  CG    . ASN A 1 340 ? -18.860 23.809  -1.057  1.00 67.08  ? 988  ASN A CG    1 
ATOM   2388  O  OD1   . ASN A 1 340 ? -19.618 24.456  -1.790  1.00 65.14  ? 988  ASN A OD1   1 
ATOM   2389  N  ND2   . ASN A 1 340 ? -18.910 22.484  -0.968  1.00 58.14  ? 988  ASN A ND2   1 
ATOM   2390  N  N     . LEU A 1 341 ? -15.831 27.637  -0.184  1.00 79.32  ? 989  LEU A N     1 
ATOM   2391  C  CA    . LEU A 1 341 ? -15.426 28.778  0.633   1.00 80.73  ? 989  LEU A CA    1 
ATOM   2392  C  C     . LEU A 1 341 ? -16.424 29.926  0.460   1.00 79.84  ? 989  LEU A C     1 
ATOM   2393  O  O     . LEU A 1 341 ? -16.364 30.937  1.163   1.00 79.39  ? 989  LEU A O     1 
ATOM   2394  C  CB    . LEU A 1 341 ? -14.013 29.233  0.251   1.00 80.08  ? 989  LEU A CB    1 
ATOM   2395  C  CG    . LEU A 1 341 ? -12.884 28.211  0.429   1.00 80.85  ? 989  LEU A CG    1 
ATOM   2396  C  CD1   . LEU A 1 341 ? -11.653 28.585  -0.394  1.00 80.22  ? 989  LEU A CD1   1 
ATOM   2397  C  CD2   . LEU A 1 341 ? -12.529 28.039  1.904   1.00 78.62  ? 989  LEU A CD2   1 
ATOM   2398  N  N     . ASP A 1 342 ? -17.341 29.758  -0.489  1.00 77.24  ? 990  ASP A N     1 
ATOM   2399  C  CA    . ASP A 1 342 ? -18.426 30.712  -0.687  1.00 75.06  ? 990  ASP A CA    1 
ATOM   2400  C  C     . ASP A 1 342 ? -19.737 30.196  -0.090  1.00 70.64  ? 990  ASP A C     1 
ATOM   2401  O  O     . ASP A 1 342 ? -20.691 30.952  0.079   1.00 68.18  ? 990  ASP A O     1 
ATOM   2402  C  CB    . ASP A 1 342 ? -18.606 31.026  -2.177  1.00 76.01  ? 990  ASP A CB    1 
ATOM   2403  C  CG    . ASP A 1 342 ? -17.932 32.330  -2.588  1.00 83.18  ? 990  ASP A CG    1 
ATOM   2404  O  OD1   . ASP A 1 342 ? -17.830 33.242  -1.737  1.00 80.00  ? 990  ASP A OD1   1 
ATOM   2405  O  OD2   . ASP A 1 342 ? -17.508 32.444  -3.762  1.00 86.78  ? 990  ASP A OD2   1 
ATOM   2406  N  N     . ALA A 1 343 ? -19.779 28.905  0.225   1.00 71.57  ? 991  ALA A N     1 
ATOM   2407  C  CA    . ALA A 1 343 ? -20.987 28.287  0.766   1.00 65.78  ? 991  ALA A CA    1 
ATOM   2408  C  C     . ALA A 1 343 ? -21.534 29.067  1.959   1.00 62.83  ? 991  ALA A C     1 
ATOM   2409  O  O     . ALA A 1 343 ? -20.804 29.354  2.910   1.00 63.97  ? 991  ALA A O     1 
ATOM   2410  C  CB    . ALA A 1 343 ? -20.716 26.836  1.159   1.00 64.20  ? 991  ALA A CB    1 
ATOM   2411  N  N     . PRO A 1 344 ? -22.820 29.435  1.899   1.00 54.56  ? 992  PRO A N     1 
ATOM   2412  C  CA    . PRO A 1 344 ? -23.493 30.031  3.053   1.00 50.98  ? 992  PRO A CA    1 
ATOM   2413  C  C     . PRO A 1 344 ? -23.623 29.003  4.164   1.00 55.60  ? 992  PRO A C     1 
ATOM   2414  O  O     . PRO A 1 344 ? -23.255 27.837  3.964   1.00 55.88  ? 992  PRO A O     1 
ATOM   2415  C  CB    . PRO A 1 344 ? -24.879 30.368  2.506   1.00 49.91  ? 992  PRO A CB    1 
ATOM   2416  C  CG    . PRO A 1 344 ? -24.683 30.510  1.044   1.00 56.13  ? 992  PRO A CG    1 
ATOM   2417  C  CD    . PRO A 1 344 ? -23.640 29.503  0.681   1.00 55.23  ? 992  PRO A CD    1 
ATOM   2418  N  N     . GLU A 1 345 ? -24.123 29.426  5.322   1.00 55.04  ? 993  GLU A N     1 
ATOM   2419  C  CA    . GLU A 1 345 ? -24.513 28.486  6.360   1.00 50.79  ? 993  GLU A CA    1 
ATOM   2420  C  C     . GLU A 1 345 ? -25.975 28.157  6.134   1.00 48.48  ? 993  GLU A C     1 
ATOM   2421  O  O     . GLU A 1 345 ? -26.713 28.960  5.564   1.00 49.74  ? 993  GLU A O     1 
ATOM   2422  C  CB    . GLU A 1 345 ? -24.344 29.092  7.750   1.00 55.19  ? 993  GLU A CB    1 
ATOM   2423  C  CG    . GLU A 1 345 ? -22.980 29.695  8.023   1.00 61.43  ? 993  GLU A CG    1 
ATOM   2424  C  CD    . GLU A 1 345 ? -22.823 30.144  9.468   1.00 66.59  ? 993  GLU A CD    1 
ATOM   2425  O  OE1   . GLU A 1 345 ? -22.347 31.278  9.690   1.00 65.17  ? 993  GLU A OE1   1 
ATOM   2426  O  OE2   . GLU A 1 345 ? -23.168 29.361  10.382  1.00 67.26  ? 993  GLU A OE2   1 
ATOM   2427  N  N     . PRO A 1 346 ? -26.398 26.970  6.571   1.00 45.55  ? 994  PRO A N     1 
ATOM   2428  C  CA    . PRO A 1 346 ? -27.802 26.556  6.512   1.00 44.95  ? 994  PRO A CA    1 
ATOM   2429  C  C     . PRO A 1 346 ? -28.609 27.279  7.575   1.00 46.94  ? 994  PRO A C     1 
ATOM   2430  O  O     . PRO A 1 346 ? -28.036 27.839  8.510   1.00 49.62  ? 994  PRO A O     1 
ATOM   2431  C  CB    . PRO A 1 346 ? -27.747 25.069  6.867   1.00 45.39  ? 994  PRO A CB    1 
ATOM   2432  C  CG    . PRO A 1 346 ? -26.302 24.683  6.797   1.00 46.71  ? 994  PRO A CG    1 
ATOM   2433  C  CD    . PRO A 1 346 ? -25.527 25.910  7.092   1.00 47.10  ? 994  PRO A CD    1 
ATOM   2434  N  N     . TYR A 1 347 ? -29.927 27.257  7.436   1.00 45.53  ? 995  TYR A N     1 
ATOM   2435  C  CA    . TYR A 1 347 ? -30.819 27.793  8.453   1.00 46.16  ? 995  TYR A CA    1 
ATOM   2436  C  C     . TYR A 1 347 ? -30.355 27.482  9.877   1.00 46.76  ? 995  TYR A C     1 
ATOM   2437  O  O     . TYR A 1 347 ? -29.815 26.410  10.150  1.00 44.78  ? 995  TYR A O     1 
ATOM   2438  C  CB    . TYR A 1 347 ? -32.219 27.209  8.271   1.00 46.64  ? 995  TYR A CB    1 
ATOM   2439  C  CG    . TYR A 1 347 ? -33.006 27.776  7.114   1.00 46.45  ? 995  TYR A CG    1 
ATOM   2440  C  CD1   . TYR A 1 347 ? -32.703 29.021  6.580   1.00 45.55  ? 995  TYR A CD1   1 
ATOM   2441  C  CD2   . TYR A 1 347 ? -34.068 27.070  6.569   1.00 45.80  ? 995  TYR A CD2   1 
ATOM   2442  C  CE1   . TYR A 1 347 ? -33.432 29.540  5.525   1.00 47.75  ? 995  TYR A CE1   1 
ATOM   2443  C  CE2   . TYR A 1 347 ? -34.804 27.582  5.516   1.00 47.13  ? 995  TYR A CE2   1 
ATOM   2444  C  CZ    . TYR A 1 347 ? -34.483 28.816  4.997   1.00 47.46  ? 995  TYR A CZ    1 
ATOM   2445  O  OH    . TYR A 1 347 ? -35.216 29.325  3.948   1.00 47.06  ? 995  TYR A OH    1 
ATOM   2446  N  N     . ARG A 1 348 ? -30.561 28.435  10.780  1.00 47.99  ? 996  ARG A N     1 
ATOM   2447  C  CA    . ARG A 1 348 ? -30.469 28.170  12.207  1.00 47.58  ? 996  ARG A CA    1 
ATOM   2448  C  C     . ARG A 1 348 ? -31.768 27.479  12.579  1.00 47.66  ? 996  ARG A C     1 
ATOM   2449  O  O     . ARG A 1 348 ? -32.805 27.713  11.956  1.00 46.83  ? 996  ARG A O     1 
ATOM   2450  C  CB    . ARG A 1 348 ? -30.348 29.470  13.002  1.00 47.28  ? 996  ARG A CB    1 
ATOM   2451  C  CG    . ARG A 1 348 ? -29.057 30.244  12.808  1.00 50.58  ? 996  ARG A CG    1 
ATOM   2452  C  CD    . ARG A 1 348 ? -27.953 29.667  13.657  1.00 51.90  ? 996  ARG A CD    1 
ATOM   2453  N  NE    . ARG A 1 348 ? -26.755 30.493  13.657  1.00 52.91  ? 996  ARG A NE    1 
ATOM   2454  C  CZ    . ARG A 1 348 ? -25.812 30.436  12.723  1.00 58.79  ? 996  ARG A CZ    1 
ATOM   2455  N  NH1   . ARG A 1 348 ? -25.939 29.597  11.703  1.00 59.22  ? 996  ARG A NH1   1 
ATOM   2456  N  NH2   . ARG A 1 348 ? -24.745 31.222  12.802  1.00 60.91  ? 996  ARG A NH2   1 
ATOM   2457  N  N     . ILE A 1 349 ? -31.723 26.626  13.588  1.00 45.73  ? 997  ILE A N     1 
ATOM   2458  C  CA    . ILE A 1 349 ? -32.934 25.964  14.022  1.00 45.26  ? 997  ILE A CA    1 
ATOM   2459  C  C     . ILE A 1 349 ? -33.083 26.115  15.522  1.00 50.11  ? 997  ILE A C     1 
ATOM   2460  O  O     . ILE A 1 349 ? -32.095 26.100  16.256  1.00 50.44  ? 997  ILE A O     1 
ATOM   2461  C  CB    . ILE A 1 349 ? -32.928 24.488  13.633  1.00 48.06  ? 997  ILE A CB    1 
ATOM   2462  C  CG1   . ILE A 1 349 ? -32.781 24.357  12.118  1.00 49.27  ? 997  ILE A CG1   1 
ATOM   2463  C  CG2   . ILE A 1 349 ? -34.203 23.812  14.091  1.00 47.92  ? 997  ILE A CG2   1 
ATOM   2464  C  CD1   . ILE A 1 349 ? -32.429 22.963  11.641  1.00 45.45  ? 997  ILE A CD1   1 
ATOM   2465  N  N     . GLY A 1 350 ? -34.327 26.282  15.961  1.00 50.51  ? 998  GLY A N     1 
ATOM   2466  C  CA    . GLY A 1 350 ? -34.643 26.425  17.368  1.00 53.38  ? 998  GLY A CA    1 
ATOM   2467  C  C     . GLY A 1 350 ? -36.052 25.963  17.682  1.00 56.04  ? 998  GLY A C     1 
ATOM   2468  O  O     . GLY A 1 350 ? -36.909 25.897  16.795  1.00 53.96  ? 998  GLY A O     1 
ATOM   2469  N  N     . ARG A 1 351 ? -36.280 25.638  18.952  1.00 58.68  ? 999  ARG A N     1 
ATOM   2470  C  CA    . ARG A 1 351 ? -37.585 25.207  19.441  1.00 58.63  ? 999  ARG A CA    1 
ATOM   2471  C  C     . ARG A 1 351 ? -38.256 26.393  20.096  1.00 61.37  ? 999  ARG A C     1 
ATOM   2472  O  O     . ARG A 1 351 ? -37.670 27.017  20.983  1.00 63.49  ? 999  ARG A O     1 
ATOM   2473  C  CB    . ARG A 1 351 ? -37.409 24.107  20.487  1.00 60.52  ? 999  ARG A CB    1 
ATOM   2474  C  CG    . ARG A 1 351 ? -38.693 23.413  20.916  1.00 60.14  ? 999  ARG A CG    1 
ATOM   2475  C  CD    . ARG A 1 351 ? -38.993 22.245  20.008  1.00 62.18  ? 999  ARG A CD    1 
ATOM   2476  N  NE    . ARG A 1 351 ? -39.714 21.185  20.702  1.00 68.81  ? 999  ARG A NE    1 
ATOM   2477  C  CZ    . ARG A 1 351 ? -39.133 20.163  21.325  1.00 72.37  ? 999  ARG A CZ    1 
ATOM   2478  N  NH1   . ARG A 1 351 ? -39.882 19.247  21.926  1.00 75.52  ? 999  ARG A NH1   1 
ATOM   2479  N  NH2   . ARG A 1 351 ? -37.810 20.051  21.347  1.00 67.72  ? 999  ARG A NH2   1 
ATOM   2480  N  N     . ILE A 1 352 ? -39.476 26.716  19.677  1.00 60.29  ? 1000 ILE A N     1 
ATOM   2481  C  CA    . ILE A 1 352 ? -40.159 27.861  20.275  1.00 64.04  ? 1000 ILE A CA    1 
ATOM   2482  C  C     . ILE A 1 352 ? -40.591 27.564  21.715  1.00 66.64  ? 1000 ILE A C     1 
ATOM   2483  O  O     . ILE A 1 352 ? -41.399 26.664  21.971  1.00 65.99  ? 1000 ILE A O     1 
ATOM   2484  C  CB    . ILE A 1 352 ? -41.344 28.386  19.424  1.00 62.09  ? 1000 ILE A CB    1 
ATOM   2485  C  CG1   . ILE A 1 352 ? -42.513 27.410  19.433  1.00 64.92  ? 1000 ILE A CG1   1 
ATOM   2486  C  CG2   . ILE A 1 352 ? -40.913 28.648  17.997  1.00 59.99  ? 1000 ILE A CG2   1 
ATOM   2487  C  CD1   . ILE A 1 352 ? -43.632 27.858  18.532  1.00 66.06  ? 1000 ILE A CD1   1 
ATOM   2488  N  N     . LYS A 1 353 ? -40.020 28.326  22.645  1.00 67.30  ? 1001 LYS A N     1 
ATOM   2489  C  CA    . LYS A 1 353 ? -40.293 28.194  24.072  1.00 69.64  ? 1001 LYS A CA    1 
ATOM   2490  C  C     . LYS A 1 353 ? -41.454 29.095  24.481  1.00 71.47  ? 1001 LYS A C     1 
ATOM   2491  O  O     . LYS A 1 353 ? -42.375 28.660  25.173  1.00 68.77  ? 1001 LYS A O     1 
ATOM   2492  C  CB    . LYS A 1 353 ? -39.038 28.553  24.868  1.00 70.87  ? 1001 LYS A CB    1 
ATOM   2493  C  CG    . LYS A 1 353 ? -39.206 28.622  26.372  1.00 73.04  ? 1001 LYS A CG    1 
ATOM   2494  C  CD    . LYS A 1 353 ? -37.865 28.943  27.023  1.00 75.54  ? 1001 LYS A CD    1 
ATOM   2495  C  CE    . LYS A 1 353 ? -37.995 29.184  28.520  1.00 77.36  ? 1001 LYS A CE    1 
ATOM   2496  N  NZ    . LYS A 1 353 ? -38.451 27.974  29.249  1.00 74.84  ? 1001 LYS A NZ    1 
ATOM   2497  N  N     . GLU A 1 354 ? -41.403 30.350  24.042  1.00 72.53  ? 1002 GLU A N     1 
ATOM   2498  C  CA    . GLU A 1 354 ? -42.473 31.302  24.314  1.00 73.44  ? 1002 GLU A CA    1 
ATOM   2499  C  C     . GLU A 1 354 ? -42.741 32.205  23.119  1.00 73.91  ? 1002 GLU A C     1 
ATOM   2500  O  O     . GLU A 1 354 ? -41.824 32.577  22.380  1.00 70.17  ? 1002 GLU A O     1 
ATOM   2501  C  CB    . GLU A 1 354 ? -42.115 32.185  25.506  1.00 74.84  ? 1002 GLU A CB    1 
ATOM   2502  C  CG    . GLU A 1 354 ? -41.715 31.436  26.753  1.00 78.75  ? 1002 GLU A CG    1 
ATOM   2503  C  CD    . GLU A 1 354 ? -40.983 32.327  27.738  1.00 84.62  ? 1002 GLU A CD    1 
ATOM   2504  O  OE1   . GLU A 1 354 ? -41.123 33.570  27.642  1.00 80.48  ? 1002 GLU A OE1   1 
ATOM   2505  O  OE2   . GLU A 1 354 ? -40.259 31.784  28.600  1.00 88.70  ? 1002 GLU A OE2   1 
ATOM   2506  N  N     . ILE A 1 355 ? -44.009 32.560  22.943  1.00 75.20  ? 1003 ILE A N     1 
ATOM   2507  C  CA    . ILE A 1 355 ? -44.397 33.559  21.960  1.00 70.74  ? 1003 ILE A CA    1 
ATOM   2508  C  C     . ILE A 1 355 ? -45.095 34.690  22.691  1.00 72.55  ? 1003 ILE A C     1 
ATOM   2509  O  O     . ILE A 1 355 ? -45.992 34.450  23.501  1.00 72.43  ? 1003 ILE A O     1 
ATOM   2510  C  CB    . ILE A 1 355 ? -45.394 33.000  20.939  1.00 68.38  ? 1003 ILE A CB    1 
ATOM   2511  C  CG1   . ILE A 1 355 ? -44.972 31.615  20.459  1.00 64.74  ? 1003 ILE A CG1   1 
ATOM   2512  C  CG2   . ILE A 1 355 ? -45.548 33.960  19.777  1.00 67.22  ? 1003 ILE A CG2   1 
ATOM   2513  C  CD1   . ILE A 1 355 ? -46.020 30.952  19.608  1.00 63.83  ? 1003 ILE A CD1   1 
ATOM   2514  N  N     . HIS A 1 356 ? -44.687 35.922  22.407  1.00 73.36  ? 1004 HIS A N     1 
ATOM   2515  C  CA    . HIS A 1 356 ? -45.345 37.086  22.984  1.00 71.50  ? 1004 HIS A CA    1 
ATOM   2516  C  C     . HIS A 1 356 ? -45.356 38.277  22.031  1.00 69.39  ? 1004 HIS A C     1 
ATOM   2517  O  O     . HIS A 1 356 ? -44.329 38.639  21.466  1.00 68.62  ? 1004 HIS A O     1 
ATOM   2518  C  CB    . HIS A 1 356 ? -44.721 37.460  24.336  1.00 73.30  ? 1004 HIS A CB    1 
ATOM   2519  C  CG    . HIS A 1 356 ? -43.245 37.724  24.286  1.00 72.01  ? 1004 HIS A CG    1 
ATOM   2520  N  ND1   . HIS A 1 356 ? -42.307 36.777  24.639  1.00 69.56  ? 1004 HIS A ND1   1 
ATOM   2521  C  CD2   . HIS A 1 356 ? -42.550 38.839  23.958  1.00 73.07  ? 1004 HIS A CD2   1 
ATOM   2522  C  CE1   . HIS A 1 356 ? -41.096 37.292  24.513  1.00 68.97  ? 1004 HIS A CE1   1 
ATOM   2523  N  NE2   . HIS A 1 356 ? -41.215 38.541  24.102  1.00 70.25  ? 1004 HIS A NE2   1 
ATOM   2524  N  N     . CYS A 1 357 ? -46.532 38.870  21.851  1.00 72.11  ? 1005 CYS A N     1 
ATOM   2525  C  CA    . CYS A 1 357 ? -46.686 40.031  20.977  1.00 75.79  ? 1005 CYS A CA    1 
ATOM   2526  C  C     . CYS A 1 357 ? -46.795 41.338  21.774  1.00 78.54  ? 1005 CYS A C     1 
ATOM   2527  O  O     . CYS A 1 357 ? -47.122 41.326  22.961  1.00 79.14  ? 1005 CYS A O     1 
ATOM   2528  C  CB    . CYS A 1 357 ? -47.907 39.858  20.069  1.00 70.74  ? 1005 CYS A CB    1 
ATOM   2529  N  N     . GLY A 1 358 ? -46.510 42.459  21.118  1.00 77.24  ? 1006 GLY A N     1 
ATOM   2530  C  CA    . GLY A 1 358 ? -46.715 43.768  21.713  1.00 78.09  ? 1006 GLY A CA    1 
ATOM   2531  C  C     . GLY A 1 358 ? -48.157 44.214  21.544  1.00 79.57  ? 1006 GLY A C     1 
ATOM   2532  O  O     . GLY A 1 358 ? -49.004 43.429  21.103  1.00 74.86  ? 1006 GLY A O     1 
ATOM   2533  N  N     . LYS A 1 359 ? -48.440 45.470  21.894  1.00 80.67  ? 1007 LYS A N     1 
ATOM   2534  C  CA    . LYS A 1 359 ? -49.793 46.023  21.764  1.00 80.62  ? 1007 LYS A CA    1 
ATOM   2535  C  C     . LYS A 1 359 ? -49.808 47.390  21.068  1.00 80.67  ? 1007 LYS A C     1 
ATOM   2536  O  O     . LYS A 1 359 ? -48.823 48.130  21.106  1.00 80.83  ? 1007 LYS A O     1 
ATOM   2537  C  CB    . LYS A 1 359 ? -50.488 46.104  23.127  1.00 74.18  ? 1007 LYS A CB    1 
ATOM   2538  N  N     . LYS A 1 360 ? -50.927 47.712  20.426  1.00 80.03  ? 1008 LYS A N     1 
ATOM   2539  C  CA    . LYS A 1 360 ? -51.064 48.972  19.699  1.00 84.85  ? 1008 LYS A CA    1 
ATOM   2540  C  C     . LYS A 1 360 ? -52.538 49.325  19.504  1.00 92.57  ? 1008 LYS A C     1 
ATOM   2541  O  O     . LYS A 1 360 ? -53.321 48.500  19.024  1.00 92.45  ? 1008 LYS A O     1 
ATOM   2542  C  CB    . LYS A 1 360 ? -50.341 48.915  18.348  1.00 79.94  ? 1008 LYS A CB    1 
ATOM   2543  N  N     . LYS A 1 361 ? -52.900 50.555  19.876  1.00 92.60  ? 1009 LYS A N     1 
ATOM   2544  C  CA    . LYS A 1 361 ? -54.289 51.014  19.859  1.00 90.67  ? 1009 LYS A CA    1 
ATOM   2545  C  C     . LYS A 1 361 ? -55.171 50.129  20.736  1.00 92.15  ? 1009 LYS A C     1 
ATOM   2546  O  O     . LYS A 1 361 ? -56.310 49.818  20.378  1.00 91.70  ? 1009 LYS A O     1 
ATOM   2547  C  CB    . LYS A 1 361 ? -54.840 51.086  18.434  1.00 84.82  ? 1009 LYS A CB    1 
ATOM   2548  N  N     . GLY A 1 362 ? -54.634 49.725  21.885  1.00 89.37  ? 1010 GLY A N     1 
ATOM   2549  C  CA    . GLY A 1 362 ? -55.367 48.892  22.823  1.00 91.37  ? 1010 GLY A CA    1 
ATOM   2550  C  C     . GLY A 1 362 ? -55.588 47.473  22.335  1.00 92.40  ? 1010 GLY A C     1 
ATOM   2551  O  O     . GLY A 1 362 ? -56.297 46.694  22.974  1.00 89.69  ? 1010 GLY A O     1 
ATOM   2552  N  N     . LYS A 1 363 ? -54.981 47.136  21.200  1.00 93.96  ? 1011 LYS A N     1 
ATOM   2553  C  CA    . LYS A 1 363 ? -55.118 45.802  20.620  1.00 90.52  ? 1011 LYS A CA    1 
ATOM   2554  C  C     . LYS A 1 363 ? -53.768 45.097  20.557  1.00 87.71  ? 1011 LYS A C     1 
ATOM   2555  O  O     . LYS A 1 363 ? -52.717 45.730  20.721  1.00 83.95  ? 1011 LYS A O     1 
ATOM   2556  C  CB    . LYS A 1 363 ? -55.734 45.877  19.221  1.00 85.87  ? 1011 LYS A CB    1 
ATOM   2557  N  N     . VAL A 1 364 ? -53.804 43.786  20.331  1.00 84.51  ? 1012 VAL A N     1 
ATOM   2558  C  CA    . VAL A 1 364 ? -52.588 43.012  20.134  1.00 78.81  ? 1012 VAL A CA    1 
ATOM   2559  C  C     . VAL A 1 364 ? -51.937 43.435  18.824  1.00 78.63  ? 1012 VAL A C     1 
ATOM   2560  O  O     . VAL A 1 364 ? -52.601 43.538  17.788  1.00 76.08  ? 1012 VAL A O     1 
ATOM   2561  C  CB    . VAL A 1 364 ? -52.873 41.498  20.102  1.00 75.79  ? 1012 VAL A CB    1 
ATOM   2562  C  CG1   . VAL A 1 364 ? -51.586 40.721  19.906  1.00 74.87  ? 1012 VAL A CG1   1 
ATOM   2563  C  CG2   . VAL A 1 364 ? -53.556 41.063  21.381  1.00 75.81  ? 1012 VAL A CG2   1 
ATOM   2564  N  N     . ASN A 1 365 ? -50.636 43.695  18.879  1.00 76.75  ? 1013 ASN A N     1 
ATOM   2565  C  CA    . ASN A 1 365 ? -49.890 44.098  17.697  1.00 73.55  ? 1013 ASN A CA    1 
ATOM   2566  C  C     . ASN A 1 365 ? -49.197 42.917  17.028  1.00 75.19  ? 1013 ASN A C     1 
ATOM   2567  O  O     . ASN A 1 365 ? -48.111 42.499  17.438  1.00 73.57  ? 1013 ASN A O     1 
ATOM   2568  C  CB    . ASN A 1 365 ? -48.875 45.173  18.051  1.00 71.91  ? 1013 ASN A CB    1 
ATOM   2569  C  CG    . ASN A 1 365 ? -48.084 45.620  16.859  1.00 71.86  ? 1013 ASN A CG    1 
ATOM   2570  O  OD1   . ASN A 1 365 ? -46.887 45.878  16.957  1.00 73.57  ? 1013 ASN A OD1   1 
ATOM   2571  N  ND2   . ASN A 1 365 ? -48.744 45.698  15.710  1.00 70.98  ? 1013 ASN A ND2   1 
ATOM   2572  N  N     . GLU A 1 366 ? -49.839 42.388  15.991  1.00 75.26  ? 1014 GLU A N     1 
ATOM   2573  C  CA    . GLU A 1 366 ? -49.363 41.197  15.299  1.00 69.74  ? 1014 GLU A CA    1 
ATOM   2574  C  C     . GLU A 1 366 ? -48.063 41.454  14.545  1.00 70.46  ? 1014 GLU A C     1 
ATOM   2575  O  O     . GLU A 1 366 ? -47.327 40.521  14.216  1.00 67.63  ? 1014 GLU A O     1 
ATOM   2576  C  CB    . GLU A 1 366 ? -50.448 40.671  14.361  1.00 66.48  ? 1014 GLU A CB    1 
ATOM   2577  C  CG    . GLU A 1 366 ? -51.664 40.146  15.107  1.00 70.29  ? 1014 GLU A CG    1 
ATOM   2578  C  CD    . GLU A 1 366 ? -52.882 39.951  14.220  1.00 71.46  ? 1014 GLU A CD    1 
ATOM   2579  O  OE1   . GLU A 1 366 ? -52.996 40.645  13.187  1.00 73.12  ? 1014 GLU A OE1   1 
ATOM   2580  O  OE2   . GLU A 1 366 ? -53.731 39.100  14.562  1.00 70.73  ? 1014 GLU A OE2   1 
ATOM   2581  N  N     . ALA A 1 367 ? -47.778 42.725  14.285  1.00 71.45  ? 1015 ALA A N     1 
ATOM   2582  C  CA    . ALA A 1 367 ? -46.539 43.101  13.617  1.00 70.33  ? 1015 ALA A CA    1 
ATOM   2583  C  C     . ALA A 1 367 ? -45.364 43.129  14.594  1.00 71.86  ? 1015 ALA A C     1 
ATOM   2584  O  O     . ALA A 1 367 ? -44.251 43.508  14.228  1.00 70.74  ? 1015 ALA A O     1 
ATOM   2585  C  CB    . ALA A 1 367 ? -46.697 44.445  12.921  1.00 67.92  ? 1015 ALA A CB    1 
ATOM   2586  N  N     . ASP A 1 368 ? -45.615 42.727  15.838  1.00 72.24  ? 1016 ASP A N     1 
ATOM   2587  C  CA    . ASP A 1 368 ? -44.564 42.694  16.855  1.00 75.85  ? 1016 ASP A CA    1 
ATOM   2588  C  C     . ASP A 1 368 ? -44.599 41.397  17.664  1.00 74.62  ? 1016 ASP A C     1 
ATOM   2589  O  O     . ASP A 1 368 ? -44.708 41.417  18.893  1.00 74.53  ? 1016 ASP A O     1 
ATOM   2590  C  CB    . ASP A 1 368 ? -44.656 43.914  17.783  1.00 78.42  ? 1016 ASP A CB    1 
ATOM   2591  C  CG    . ASP A 1 368 ? -43.436 44.061  18.691  1.00 82.79  ? 1016 ASP A CG    1 
ATOM   2592  O  OD1   . ASP A 1 368 ? -43.532 44.785  19.711  1.00 81.84  ? 1016 ASP A OD1   1 
ATOM   2593  O  OD2   . ASP A 1 368 ? -42.384 43.451  18.387  1.00 82.56  ? 1016 ASP A OD2   1 
ATOM   2594  N  N     . ILE A 1 369 ? -44.510 40.270  16.963  1.00 71.54  ? 1017 ILE A N     1 
ATOM   2595  C  CA    . ILE A 1 369 ? -44.449 38.972  17.615  1.00 66.98  ? 1017 ILE A CA    1 
ATOM   2596  C  C     . ILE A 1 369 ? -43.002 38.539  17.763  1.00 66.53  ? 1017 ILE A C     1 
ATOM   2597  O  O     . ILE A 1 369 ? -42.213 38.647  16.825  1.00 64.96  ? 1017 ILE A O     1 
ATOM   2598  C  CB    . ILE A 1 369 ? -45.191 37.902  16.821  1.00 60.94  ? 1017 ILE A CB    1 
ATOM   2599  C  CG1   . ILE A 1 369 ? -46.634 38.334  16.575  1.00 64.09  ? 1017 ILE A CG1   1 
ATOM   2600  C  CG2   . ILE A 1 369 ? -45.140 36.583  17.561  1.00 61.47  ? 1017 ILE A CG2   1 
ATOM   2601  C  CD1   . ILE A 1 369 ? -47.397 37.412  15.653  1.00 61.11  ? 1017 ILE A CD1   1 
ATOM   2602  N  N     . LYS A 1 370 ? -42.654 38.057  18.948  1.00 66.92  ? 1018 LYS A N     1 
ATOM   2603  C  CA    . LYS A 1 370 ? -41.293 37.611  19.202  1.00 66.26  ? 1018 LYS A CA    1 
ATOM   2604  C  C     . LYS A 1 370 ? -41.269 36.174  19.706  1.00 67.15  ? 1018 LYS A C     1 
ATOM   2605  O  O     . LYS A 1 370 ? -42.271 35.666  20.222  1.00 67.51  ? 1018 LYS A O     1 
ATOM   2606  C  CB    . LYS A 1 370 ? -40.574 38.564  20.164  1.00 65.76  ? 1018 LYS A CB    1 
ATOM   2607  C  CG    . LYS A 1 370 ? -40.326 39.932  19.550  1.00 71.61  ? 1018 LYS A CG    1 
ATOM   2608  C  CD    . LYS A 1 370 ? -39.282 40.746  20.299  1.00 76.36  ? 1018 LYS A CD    1 
ATOM   2609  C  CE    . LYS A 1 370 ? -38.936 42.017  19.519  1.00 79.29  ? 1018 LYS A CE    1 
ATOM   2610  N  NZ    . LYS A 1 370 ? -38.115 42.993  20.293  1.00 82.27  ? 1018 LYS A NZ    1 
ATOM   2611  N  N     . LEU A 1 371 ? -40.127 35.516  19.533  1.00 63.36  ? 1019 LEU A N     1 
ATOM   2612  C  CA    . LEU A 1 371 ? -40.001 34.120  19.914  1.00 60.89  ? 1019 LEU A CA    1 
ATOM   2613  C  C     . LEU A 1 371 ? -38.829 33.882  20.857  1.00 62.13  ? 1019 LEU A C     1 
ATOM   2614  O  O     . LEU A 1 371 ? -37.685 34.246  20.579  1.00 59.23  ? 1019 LEU A O     1 
ATOM   2615  C  CB    . LEU A 1 371 ? -39.896 33.222  18.678  1.00 60.75  ? 1019 LEU A CB    1 
ATOM   2616  C  CG    . LEU A 1 371 ? -41.124 33.151  17.765  1.00 59.97  ? 1019 LEU A CG    1 
ATOM   2617  C  CD1   . LEU A 1 371 ? -40.918 32.132  16.662  1.00 56.34  ? 1019 LEU A CD1   1 
ATOM   2618  C  CD2   . LEU A 1 371 ? -42.359 32.804  18.567  1.00 64.44  ? 1019 LEU A CD2   1 
ATOM   2619  N  N     . ARG A 1 372 ? -39.149 33.282  21.995  1.00 65.79  ? 1020 ARG A N     1 
ATOM   2620  C  CA    . ARG A 1 372 ? -38.162 32.822  22.948  1.00 65.54  ? 1020 ARG A CA    1 
ATOM   2621  C  C     . ARG A 1 372 ? -37.864 31.393  22.529  1.00 64.72  ? 1020 ARG A C     1 
ATOM   2622  O  O     . ARG A 1 372 ? -38.737 30.531  22.591  1.00 65.01  ? 1020 ARG A O     1 
ATOM   2623  C  CB    . ARG A 1 372 ? -38.764 32.880  24.356  1.00 71.23  ? 1020 ARG A CB    1 
ATOM   2624  C  CG    . ARG A 1 372 ? -37.929 32.261  25.470  1.00 75.02  ? 1020 ARG A CG    1 
ATOM   2625  C  CD    . ARG A 1 372 ? -36.637 33.026  25.739  1.00 74.02  ? 1020 ARG A CD    1 
ATOM   2626  N  NE    . ARG A 1 372 ? -36.864 34.419  26.112  1.00 74.10  ? 1020 ARG A NE    1 
ATOM   2627  C  CZ    . ARG A 1 372 ? -35.923 35.219  26.608  1.00 76.13  ? 1020 ARG A CZ    1 
ATOM   2628  N  NH1   . ARG A 1 372 ? -34.695 34.756  26.805  1.00 71.65  ? 1020 ARG A NH1   1 
ATOM   2629  N  NH2   . ARG A 1 372 ? -36.210 36.482  26.912  1.00 78.44  ? 1020 ARG A NH2   1 
ATOM   2630  N  N     . LEU A 1 373 ? -36.644 31.148  22.065  1.00 62.90  ? 1021 LEU A N     1 
ATOM   2631  C  CA    . LEU A 1 373 ? -36.311 29.856  21.471  1.00 62.20  ? 1021 LEU A CA    1 
ATOM   2632  C  C     . LEU A 1 373 ? -35.205 29.137  22.213  1.00 65.51  ? 1021 LEU A C     1 
ATOM   2633  O  O     . LEU A 1 373 ? -34.307 29.773  22.778  1.00 67.71  ? 1021 LEU A O     1 
ATOM   2634  C  CB    . LEU A 1 373 ? -35.832 30.040  20.033  1.00 58.70  ? 1021 LEU A CB    1 
ATOM   2635  C  CG    . LEU A 1 373 ? -36.700 30.817  19.058  1.00 58.06  ? 1021 LEU A CG    1 
ATOM   2636  C  CD1   . LEU A 1 373 ? -35.896 31.139  17.814  1.00 52.60  ? 1021 LEU A CD1   1 
ATOM   2637  C  CD2   . LEU A 1 373 ? -37.949 30.026  18.732  1.00 56.28  ? 1021 LEU A CD2   1 
ATOM   2638  N  N     . TYR A 1 374 ? -35.258 27.807  22.181  1.00 63.05  ? 1022 TYR A N     1 
ATOM   2639  C  CA    . TYR A 1 374 ? -34.110 26.990  22.550  1.00 64.28  ? 1022 TYR A CA    1 
ATOM   2640  C  C     . TYR A 1 374 ? -33.218 26.785  21.325  1.00 60.78  ? 1022 TYR A C     1 
ATOM   2641  O  O     . TYR A 1 374 ? -33.622 26.129  20.361  1.00 57.24  ? 1022 TYR A O     1 
ATOM   2642  C  CB    . TYR A 1 374 ? -34.559 25.626  23.060  1.00 65.07  ? 1022 TYR A CB    1 
ATOM   2643  C  CG    . TYR A 1 374 ? -35.248 25.626  24.406  1.00 71.70  ? 1022 TYR A CG    1 
ATOM   2644  C  CD1   . TYR A 1 374 ? -34.529 25.828  25.580  1.00 73.18  ? 1022 TYR A CD1   1 
ATOM   2645  C  CD2   . TYR A 1 374 ? -36.615 25.376  24.507  1.00 72.70  ? 1022 TYR A CD2   1 
ATOM   2646  C  CE1   . TYR A 1 374 ? -35.160 25.802  26.819  1.00 76.74  ? 1022 TYR A CE1   1 
ATOM   2647  C  CE2   . TYR A 1 374 ? -37.255 25.348  25.736  1.00 74.14  ? 1022 TYR A CE2   1 
ATOM   2648  C  CZ    . TYR A 1 374 ? -36.525 25.562  26.890  1.00 76.62  ? 1022 TYR A CZ    1 
ATOM   2649  O  OH    . TYR A 1 374 ? -37.162 25.534  28.113  1.00 73.77  ? 1022 TYR A OH    1 
ATOM   2650  N  N     . LYS A 1 375 ? -32.011 27.345  21.362  1.00 57.66  ? 1023 LYS A N     1 
ATOM   2651  C  CA    . LYS A 1 375 ? -31.042 27.148  20.290  1.00 54.96  ? 1023 LYS A CA    1 
ATOM   2652  C  C     . LYS A 1 375 ? -30.774 25.668  20.039  1.00 57.90  ? 1023 LYS A C     1 
ATOM   2653  O  O     . LYS A 1 375 ? -30.692 24.870  20.975  1.00 60.90  ? 1023 LYS A O     1 
ATOM   2654  C  CB    . LYS A 1 375 ? -29.716 27.817  20.630  1.00 55.09  ? 1023 LYS A CB    1 
ATOM   2655  C  CG    . LYS A 1 375 ? -29.681 29.330  20.563  1.00 56.98  ? 1023 LYS A CG    1 
ATOM   2656  C  CD    . LYS A 1 375 ? -28.279 29.775  20.964  1.00 62.81  ? 1023 LYS A CD    1 
ATOM   2657  C  CE    . LYS A 1 375 ? -28.050 31.266  20.883  1.00 62.77  ? 1023 LYS A CE    1 
ATOM   2658  N  NZ    . LYS A 1 375 ? -26.655 31.578  21.315  1.00 65.29  ? 1023 LYS A NZ    1 
ATOM   2659  N  N     . PHE A 1 376 ? -30.629 25.308  18.769  1.00 56.12  ? 1024 PHE A N     1 
ATOM   2660  C  CA    . PHE A 1 376 ? -30.228 23.964  18.388  1.00 53.97  ? 1024 PHE A CA    1 
ATOM   2661  C  C     . PHE A 1 376 ? -28.856 24.018  17.745  1.00 52.79  ? 1024 PHE A C     1 
ATOM   2662  O  O     . PHE A 1 376 ? -28.621 24.835  16.861  1.00 53.96  ? 1024 PHE A O     1 
ATOM   2663  C  CB    . PHE A 1 376 ? -31.219 23.377  17.393  1.00 51.71  ? 1024 PHE A CB    1 
ATOM   2664  C  CG    . PHE A 1 376 ? -32.259 22.498  18.013  1.00 52.43  ? 1024 PHE A CG    1 
ATOM   2665  C  CD1   . PHE A 1 376 ? -31.901 21.313  18.630  1.00 53.03  ? 1024 PHE A CD1   1 
ATOM   2666  C  CD2   . PHE A 1 376 ? -33.601 22.837  17.945  1.00 51.75  ? 1024 PHE A CD2   1 
ATOM   2667  C  CE1   . PHE A 1 376 ? -32.861 20.492  19.183  1.00 55.19  ? 1024 PHE A CE1   1 
ATOM   2668  C  CE2   . PHE A 1 376 ? -34.564 22.021  18.493  1.00 51.27  ? 1024 PHE A CE2   1 
ATOM   2669  C  CZ    . PHE A 1 376 ? -34.196 20.847  19.115  1.00 53.41  ? 1024 PHE A CZ    1 
ATOM   2670  N  N     . TYR A 1 377 ? -27.951 23.155  18.188  1.00 54.00  ? 1025 TYR A N     1 
ATOM   2671  C  CA    . TYR A 1 377 ? -26.629 23.067  17.581  1.00 56.51  ? 1025 TYR A CA    1 
ATOM   2672  C  C     . TYR A 1 377 ? -26.614 22.071  16.415  1.00 59.00  ? 1025 TYR A C     1 
ATOM   2673  O  O     . TYR A 1 377 ? -27.030 20.915  16.561  1.00 59.21  ? 1025 TYR A O     1 
ATOM   2674  C  CB    . TYR A 1 377 ? -25.584 22.657  18.625  1.00 59.36  ? 1025 TYR A CB    1 
ATOM   2675  C  CG    . TYR A 1 377 ? -24.948 23.810  19.382  1.00 65.50  ? 1025 TYR A CG    1 
ATOM   2676  C  CD1   . TYR A 1 377 ? -23.820 24.454  18.884  1.00 65.18  ? 1025 TYR A CD1   1 
ATOM   2677  C  CD2   . TYR A 1 377 ? -25.462 24.243  20.605  1.00 65.93  ? 1025 TYR A CD2   1 
ATOM   2678  C  CE1   . TYR A 1 377 ? -23.228 25.512  19.578  1.00 67.44  ? 1025 TYR A CE1   1 
ATOM   2679  C  CE2   . TYR A 1 377 ? -24.876 25.298  21.304  1.00 66.25  ? 1025 TYR A CE2   1 
ATOM   2680  C  CZ    . TYR A 1 377 ? -23.759 25.930  20.785  1.00 68.86  ? 1025 TYR A CZ    1 
ATOM   2681  O  OH    . TYR A 1 377 ? -23.168 26.977  21.466  1.00 71.54  ? 1025 TYR A OH    1 
ATOM   2682  N  N     . ARG A 1 378 ? -26.153 22.521  15.253  1.00 56.89  ? 1026 ARG A N     1 
ATOM   2683  C  CA    . ARG A 1 378 ? -25.837 21.592  14.176  1.00 56.44  ? 1026 ARG A CA    1 
ATOM   2684  C  C     . ARG A 1 378 ? -24.492 20.979  14.524  1.00 58.33  ? 1026 ARG A C     1 
ATOM   2685  O  O     . ARG A 1 378 ? -23.644 21.647  15.104  1.00 59.78  ? 1026 ARG A O     1 
ATOM   2686  C  CB    . ARG A 1 378 ? -25.769 22.305  12.824  1.00 54.11  ? 1026 ARG A CB    1 
ATOM   2687  C  CG    . ARG A 1 378 ? -27.120 22.526  12.178  1.00 49.23  ? 1026 ARG A CG    1 
ATOM   2688  C  CD    . ARG A 1 378 ? -27.004 23.320  10.896  1.00 47.59  ? 1026 ARG A CD    1 
ATOM   2689  N  NE    . ARG A 1 378 ? -28.294 23.886  10.520  1.00 48.34  ? 1026 ARG A NE    1 
ATOM   2690  C  CZ    . ARG A 1 378 ? -29.090 23.379  9.589   1.00 46.80  ? 1026 ARG A CZ    1 
ATOM   2691  N  NH1   . ARG A 1 378 ? -28.711 22.304  8.919   1.00 48.97  ? 1026 ARG A NH1   1 
ATOM   2692  N  NH2   . ARG A 1 378 ? -30.257 23.949  9.317   1.00 44.58  ? 1026 ARG A NH2   1 
ATOM   2693  N  N     . PRO A 1 379 ? -24.295 19.695  14.202  1.00 59.24  ? 1027 PRO A N     1 
ATOM   2694  C  CA    . PRO A 1 379 ? -23.023 19.097  14.606  1.00 58.32  ? 1027 PRO A CA    1 
ATOM   2695  C  C     . PRO A 1 379 ? -21.835 19.994  14.270  1.00 58.02  ? 1027 PRO A C     1 
ATOM   2696  O  O     . PRO A 1 379 ? -20.966 20.191  15.112  1.00 60.04  ? 1027 PRO A O     1 
ATOM   2697  C  CB    . PRO A 1 379 ? -22.995 17.799  13.808  1.00 58.12  ? 1027 PRO A CB    1 
ATOM   2698  C  CG    . PRO A 1 379 ? -24.453 17.413  13.723  1.00 56.10  ? 1027 PRO A CG    1 
ATOM   2699  C  CD    . PRO A 1 379 ? -25.202 18.711  13.581  1.00 57.43  ? 1027 PRO A CD    1 
ATOM   2700  N  N     . GLU A 1 380 ? -21.812 20.561  13.071  1.00 59.04  ? 1028 GLU A N     1 
ATOM   2701  C  CA    . GLU A 1 380 ? -20.700 21.423  12.677  1.00 62.07  ? 1028 GLU A CA    1 
ATOM   2702  C  C     . GLU A 1 380 ? -20.655 22.733  13.486  1.00 63.91  ? 1028 GLU A C     1 
ATOM   2703  O  O     . GLU A 1 380 ? -19.745 23.548  13.322  1.00 64.44  ? 1028 GLU A O     1 
ATOM   2704  C  CB    . GLU A 1 380 ? -20.716 21.693  11.159  1.00 62.99  ? 1028 GLU A CB    1 
ATOM   2705  C  CG    . GLU A 1 380 ? -21.810 22.645  10.661  1.00 62.66  ? 1028 GLU A CG    1 
ATOM   2706  C  CD    . GLU A 1 380 ? -23.047 21.931  10.115  1.00 60.86  ? 1028 GLU A CD    1 
ATOM   2707  O  OE1   . GLU A 1 380 ? -23.268 20.743  10.453  1.00 57.85  ? 1028 GLU A OE1   1 
ATOM   2708  O  OE2   . GLU A 1 380 ? -23.800 22.571  9.343   1.00 56.06  ? 1028 GLU A OE2   1 
ATOM   2709  N  N     . ASN A 1 381 ? -21.632 22.921  14.371  1.00 63.76  ? 1029 ASN A N     1 
ATOM   2710  C  CA    . ASN A 1 381 ? -21.695 24.117  15.216  1.00 63.54  ? 1029 ASN A CA    1 
ATOM   2711  C  C     . ASN A 1 381 ? -20.989 23.963  16.565  1.00 63.20  ? 1029 ASN A C     1 
ATOM   2712  O  O     . ASN A 1 381 ? -20.606 24.958  17.181  1.00 62.57  ? 1029 ASN A O     1 
ATOM   2713  C  CB    . ASN A 1 381 ? -23.146 24.562  15.432  1.00 61.32  ? 1029 ASN A CB    1 
ATOM   2714  C  CG    . ASN A 1 381 ? -23.710 25.306  14.238  1.00 60.92  ? 1029 ASN A CG    1 
ATOM   2715  O  OD1   . ASN A 1 381 ? -24.901 25.198  13.924  1.00 57.14  ? 1029 ASN A OD1   1 
ATOM   2716  N  ND2   . ASN A 1 381 ? -22.852 26.069  13.561  1.00 59.71  ? 1029 ASN A ND2   1 
ATOM   2717  N  N     . THR A 1 382 ? -20.823 22.721  17.019  1.00 61.37  ? 1030 THR A N     1 
ATOM   2718  C  CA    . THR A 1 382 ? -20.066 22.443  18.236  1.00 61.17  ? 1030 THR A CA    1 
ATOM   2719  C  C     . THR A 1 382 ? -18.575 22.710  18.027  1.00 60.36  ? 1030 THR A C     1 
ATOM   2720  O  O     . THR A 1 382 ? -18.163 23.211  16.986  1.00 62.51  ? 1030 THR A O     1 
ATOM   2721  C  CB    . THR A 1 382 ? -20.264 20.989  18.717  1.00 62.50  ? 1030 THR A CB    1 
ATOM   2722  O  OG1   . THR A 1 382 ? -19.637 20.086  17.802  1.00 62.53  ? 1030 THR A OG1   1 
ATOM   2723  C  CG2   . THR A 1 382 ? -21.740 20.650  18.818  1.00 61.93  ? 1030 THR A CG2   1 
ATOM   2724  N  N     . HIS A 1 383 ? -17.764 22.381  19.023  1.00 60.21  ? 1031 HIS A N     1 
ATOM   2725  C  CA    . HIS A 1 383 ? -16.325 22.594  18.918  1.00 63.81  ? 1031 HIS A CA    1 
ATOM   2726  C  C     . HIS A 1 383 ? -15.702 21.590  17.946  1.00 68.44  ? 1031 HIS A C     1 
ATOM   2727  O  O     . HIS A 1 383 ? -14.651 21.846  17.362  1.00 65.25  ? 1031 HIS A O     1 
ATOM   2728  C  CB    . HIS A 1 383 ? -15.672 22.465  20.296  1.00 67.60  ? 1031 HIS A CB    1 
ATOM   2729  C  CG    . HIS A 1 383 ? -15.801 21.100  20.898  1.00 67.55  ? 1031 HIS A CG    1 
ATOM   2730  N  ND1   . HIS A 1 383 ? -16.965 20.654  21.487  1.00 67.52  ? 1031 HIS A ND1   1 
ATOM   2731  C  CD2   . HIS A 1 383 ? -14.916 20.081  20.991  1.00 66.99  ? 1031 HIS A CD2   1 
ATOM   2732  C  CE1   . HIS A 1 383 ? -16.790 19.419  21.922  1.00 70.87  ? 1031 HIS A CE1   1 
ATOM   2733  N  NE2   . HIS A 1 383 ? -15.555 19.047  21.634  1.00 72.07  ? 1031 HIS A NE2   1 
ATOM   2734  N  N     . ARG A 1 384 ? -16.365 20.444  17.793  1.00 68.74  ? 1032 ARG A N     1 
ATOM   2735  C  CA    . ARG A 1 384 ? -15.949 19.398  16.862  1.00 63.89  ? 1032 ARG A CA    1 
ATOM   2736  C  C     . ARG A 1 384 ? -15.831 19.928  15.432  1.00 69.68  ? 1032 ARG A C     1 
ATOM   2737  O  O     . ARG A 1 384 ? -15.115 19.360  14.604  1.00 73.13  ? 1032 ARG A O     1 
ATOM   2738  C  CB    . ARG A 1 384 ? -16.928 18.236  16.907  1.00 58.84  ? 1032 ARG A CB    1 
ATOM   2739  N  N     . SER A 1 385 ? -16.539 21.016  15.145  1.00 66.95  ? 1033 SER A N     1 
ATOM   2740  C  CA    . SER A 1 385 ? -16.482 21.654  13.834  1.00 67.37  ? 1033 SER A CA    1 
ATOM   2741  C  C     . SER A 1 385 ? -16.856 20.668  12.731  1.00 70.55  ? 1033 SER A C     1 
ATOM   2742  O  O     . SER A 1 385 ? -17.474 19.635  12.995  1.00 70.72  ? 1033 SER A O     1 
ATOM   2743  C  CB    . SER A 1 385 ? -15.088 22.231  13.583  1.00 68.24  ? 1033 SER A CB    1 
ATOM   2744  O  OG    . SER A 1 385 ? -15.155 23.391  12.769  1.00 70.70  ? 1033 SER A OG    1 
ATOM   2745  N  N     . TYR A 1 386 ? -16.482 20.990  11.495  1.00 72.09  ? 1034 TYR A N     1 
ATOM   2746  C  CA    . TYR A 1 386 ? -16.773 20.118  10.360  1.00 72.76  ? 1034 TYR A CA    1 
ATOM   2747  C  C     . TYR A 1 386 ? -16.137 18.752  10.557  1.00 70.08  ? 1034 TYR A C     1 
ATOM   2748  O  O     . TYR A 1 386 ? -16.793 17.723  10.418  1.00 71.10  ? 1034 TYR A O     1 
ATOM   2749  C  CB    . TYR A 1 386 ? -16.252 20.734  9.065   1.00 72.92  ? 1034 TYR A CB    1 
ATOM   2750  C  CG    . TYR A 1 386 ? -16.755 22.133  8.812   1.00 77.52  ? 1034 TYR A CG    1 
ATOM   2751  C  CD1   . TYR A 1 386 ? -18.057 22.357  8.379   1.00 77.28  ? 1034 TYR A CD1   1 
ATOM   2752  C  CD2   . TYR A 1 386 ? -15.926 23.231  9.002   1.00 77.53  ? 1034 TYR A CD2   1 
ATOM   2753  C  CE1   . TYR A 1 386 ? -18.521 23.640  8.144   1.00 80.28  ? 1034 TYR A CE1   1 
ATOM   2754  C  CE2   . TYR A 1 386 ? -16.378 24.517  8.770   1.00 80.82  ? 1034 TYR A CE2   1 
ATOM   2755  C  CZ    . TYR A 1 386 ? -17.677 24.717  8.341   1.00 86.58  ? 1034 TYR A CZ    1 
ATOM   2756  O  OH    . TYR A 1 386 ? -18.131 26.000  8.110   1.00 94.61  ? 1034 TYR A OH    1 
ATOM   2757  N  N     . ASN A 1 387 ? -14.851 18.764  10.882  1.00 68.23  ? 1035 ASN A N     1 
ATOM   2758  C  CA    . ASN A 1 387 ? -14.084 17.555  11.138  1.00 68.09  ? 1035 ASN A CA    1 
ATOM   2759  C  C     . ASN A 1 387 ? -14.800 16.584  12.075  1.00 70.98  ? 1035 ASN A C     1 
ATOM   2760  O  O     . ASN A 1 387 ? -14.493 15.389  12.102  1.00 72.71  ? 1035 ASN A O     1 
ATOM   2761  C  CB    . ASN A 1 387 ? -12.720 17.940  11.706  1.00 68.87  ? 1035 ASN A CB    1 
ATOM   2762  C  CG    . ASN A 1 387 ? -12.093 19.114  10.964  1.00 72.61  ? 1035 ASN A CG    1 
ATOM   2763  O  OD1   . ASN A 1 387 ? -11.032 18.983  10.355  1.00 73.29  ? 1035 ASN A OD1   1 
ATOM   2764  N  ND2   . ASN A 1 387 ? -12.760 20.266  10.998  1.00 72.03  ? 1035 ASN A ND2   1 
ATOM   2765  N  N     . GLY A 1 388 ? -15.763 17.101  12.835  1.00 71.48  ? 1036 GLY A N     1 
ATOM   2766  C  CA    . GLY A 1 388 ? -16.536 16.286  13.756  1.00 72.91  ? 1036 GLY A CA    1 
ATOM   2767  C  C     . GLY A 1 388 ? -17.923 15.912  13.251  1.00 75.24  ? 1036 GLY A C     1 
ATOM   2768  O  O     . GLY A 1 388 ? -18.599 15.071  13.842  1.00 77.37  ? 1036 GLY A O     1 
ATOM   2769  N  N     . SER A 1 389 ? -18.353 16.530  12.156  1.00 72.60  ? 1037 SER A N     1 
ATOM   2770  C  CA    . SER A 1 389 ? -19.668 16.236  11.593  1.00 71.07  ? 1037 SER A CA    1 
ATOM   2771  C  C     . SER A 1 389 ? -19.635 15.455  10.261  1.00 71.68  ? 1037 SER A C     1 
ATOM   2772  O  O     . SER A 1 389 ? -20.679 15.271  9.626   1.00 70.50  ? 1037 SER A O     1 
ATOM   2773  C  CB    . SER A 1 389 ? -20.475 17.519  11.424  1.00 66.91  ? 1037 SER A CB    1 
ATOM   2774  N  N     . TYR A 1 390 ? -18.455 14.995  9.839   1.00 68.23  ? 1038 TYR A N     1 
ATOM   2775  C  CA    . TYR A 1 390 ? -18.325 14.286  8.559   1.00 64.60  ? 1038 TYR A CA    1 
ATOM   2776  C  C     . TYR A 1 390 ? -19.245 13.071  8.454   1.00 66.11  ? 1038 TYR A C     1 
ATOM   2777  O  O     . TYR A 1 390 ? -19.848 12.830  7.407   1.00 65.12  ? 1038 TYR A O     1 
ATOM   2778  C  CB    . TYR A 1 390 ? -16.882 13.835  8.321   1.00 62.28  ? 1038 TYR A CB    1 
ATOM   2779  C  CG    . TYR A 1 390 ? -15.926 14.948  7.969   1.00 62.86  ? 1038 TYR A CG    1 
ATOM   2780  C  CD1   . TYR A 1 390 ? -14.551 14.768  8.074   1.00 59.50  ? 1038 TYR A CD1   1 
ATOM   2781  C  CD2   . TYR A 1 390 ? -16.393 16.181  7.531   1.00 63.22  ? 1038 TYR A CD2   1 
ATOM   2782  C  CE1   . TYR A 1 390 ? -13.667 15.788  7.751   1.00 60.56  ? 1038 TYR A CE1   1 
ATOM   2783  C  CE2   . TYR A 1 390 ? -15.518 17.207  7.208   1.00 61.63  ? 1038 TYR A CE2   1 
ATOM   2784  C  CZ    . TYR A 1 390 ? -14.157 17.006  7.319   1.00 60.75  ? 1038 TYR A CZ    1 
ATOM   2785  O  OH    . TYR A 1 390 ? -13.290 18.029  6.997   1.00 58.16  ? 1038 TYR A OH    1 
ATOM   2786  N  N     . HIS A 1 391 ? -19.349 12.306  9.535   1.00 61.88  ? 1039 HIS A N     1 
ATOM   2787  C  CA    . HIS A 1 391 ? -20.031 11.023  9.477   1.00 57.67  ? 1039 HIS A CA    1 
ATOM   2788  C  C     . HIS A 1 391 ? -21.472 11.060  9.948   1.00 57.67  ? 1039 HIS A C     1 
ATOM   2789  O  O     . HIS A 1 391 ? -22.120 10.023  10.016  1.00 55.92  ? 1039 HIS A O     1 
ATOM   2790  C  CB    . HIS A 1 391 ? -19.272 9.993   10.303  1.00 61.40  ? 1039 HIS A CB    1 
ATOM   2791  C  CG    . HIS A 1 391 ? -17.913 9.674   9.767   1.00 68.26  ? 1039 HIS A CG    1 
ATOM   2792  N  ND1   . HIS A 1 391 ? -17.306 8.449   9.952   1.00 70.26  ? 1039 HIS A ND1   1 
ATOM   2793  C  CD2   . HIS A 1 391 ? -17.041 10.423  9.049   1.00 67.94  ? 1039 HIS A CD2   1 
ATOM   2794  C  CE1   . HIS A 1 391 ? -16.120 8.456   9.370   1.00 69.17  ? 1039 HIS A CE1   1 
ATOM   2795  N  NE2   . HIS A 1 391 ? -15.936 9.641   8.812   1.00 70.98  ? 1039 HIS A NE2   1 
ATOM   2796  N  N     . THR A 1 392 ? -21.979 12.245  10.264  1.00 59.16  ? 1040 THR A N     1 
ATOM   2797  C  CA    . THR A 1 392 ? -23.275 12.366  10.929  1.00 57.15  ? 1040 THR A CA    1 
ATOM   2798  C  C     . THR A 1 392 ? -24.423 12.534  9.951   1.00 51.20  ? 1040 THR A C     1 
ATOM   2799  O  O     . THR A 1 392 ? -24.218 12.958  8.818   1.00 53.24  ? 1040 THR A O     1 
ATOM   2800  C  CB    . THR A 1 392 ? -23.295 13.594  11.819  1.00 58.26  ? 1040 THR A CB    1 
ATOM   2801  O  OG1   . THR A 1 392 ? -23.707 14.719  11.035  1.00 60.38  ? 1040 THR A OG1   1 
ATOM   2802  C  CG2   . THR A 1 392 ? -21.906 13.858  12.386  1.00 59.13  ? 1040 THR A CG2   1 
ATOM   2803  N  N     . ASP A 1 393 ? -25.634 12.227  10.400  1.00 47.57  ? 1041 ASP A N     1 
ATOM   2804  C  CA    . ASP A 1 393 ? -26.819 12.480  9.593   1.00 47.78  ? 1041 ASP A CA    1 
ATOM   2805  C  C     . ASP A 1 393 ? -27.019 13.978  9.400   1.00 49.71  ? 1041 ASP A C     1 
ATOM   2806  O  O     . ASP A 1 393 ? -26.948 14.740  10.359  1.00 52.25  ? 1041 ASP A O     1 
ATOM   2807  C  CB    . ASP A 1 393 ? -28.055 11.876  10.250  1.00 47.37  ? 1041 ASP A CB    1 
ATOM   2808  C  CG    . ASP A 1 393 ? -28.100 10.375  10.121  1.00 54.12  ? 1041 ASP A CG    1 
ATOM   2809  O  OD1   . ASP A 1 393 ? -27.204 9.817   9.452   1.00 54.79  ? 1041 ASP A OD1   1 
ATOM   2810  O  OD2   . ASP A 1 393 ? -29.033 9.749   10.670  1.00 56.15  ? 1041 ASP A OD2   1 
ATOM   2811  N  N     . ILE A 1 394 ? -27.271 14.403  8.164   1.00 46.27  ? 1042 ILE A N     1 
ATOM   2812  C  CA    . ILE A 1 394 ? -27.420 15.826  7.881   1.00 45.61  ? 1042 ILE A CA    1 
ATOM   2813  C  C     . ILE A 1 394 ? -28.617 16.422  8.609   1.00 44.65  ? 1042 ILE A C     1 
ATOM   2814  O  O     . ILE A 1 394 ? -28.691 17.635  8.803   1.00 44.95  ? 1042 ILE A O     1 
ATOM   2815  C  CB    . ILE A 1 394 ? -27.561 16.131  6.363   1.00 46.10  ? 1042 ILE A CB    1 
ATOM   2816  C  CG1   . ILE A 1 394 ? -28.692 15.313  5.748   1.00 41.98  ? 1042 ILE A CG1   1 
ATOM   2817  C  CG2   . ILE A 1 394 ? -26.239 15.921  5.614   1.00 42.74  ? 1042 ILE A CG2   1 
ATOM   2818  C  CD1   . ILE A 1 394 ? -29.168 15.874  4.430   1.00 41.64  ? 1042 ILE A CD1   1 
ATOM   2819  N  N     . ASN A 1 395 ? -29.554 15.567  9.003   1.00 43.57  ? 1043 ASN A N     1 
ATOM   2820  C  CA    . ASN A 1 395 ? -30.755 16.021  9.689   1.00 43.02  ? 1043 ASN A CA    1 
ATOM   2821  C  C     . ASN A 1 395 ? -30.676 15.844  11.205  1.00 46.67  ? 1043 ASN A C     1 
ATOM   2822  O  O     . ASN A 1 395 ? -31.660 16.052  11.912  1.00 49.12  ? 1043 ASN A O     1 
ATOM   2823  C  CB    . ASN A 1 395 ? -31.996 15.317  9.132   1.00 41.37  ? 1043 ASN A CB    1 
ATOM   2824  C  CG    . ASN A 1 395 ? -32.033 13.834  9.467   1.00 46.54  ? 1043 ASN A CG    1 
ATOM   2825  O  OD1   . ASN A 1 395 ? -30.995 13.192  9.636   1.00 47.25  ? 1043 ASN A OD1   1 
ATOM   2826  N  ND2   . ASN A 1 395 ? -33.234 13.282  9.560   1.00 45.16  ? 1043 ASN A ND2   1 
ATOM   2827  N  N     . MET A 1 396 ? -29.509 15.461  11.708  1.00 47.52  ? 1044 MET A N     1 
ATOM   2828  C  CA    . MET A 1 396 ? -29.352 15.233  13.142  1.00 50.40  ? 1044 MET A CA    1 
ATOM   2829  C  C     . MET A 1 396 ? -28.869 16.483  13.853  1.00 53.07  ? 1044 MET A C     1 
ATOM   2830  O  O     . MET A 1 396 ? -27.910 17.139  13.424  1.00 50.51  ? 1044 MET A O     1 
ATOM   2831  C  CB    . MET A 1 396 ? -28.390 14.080  13.422  1.00 54.05  ? 1044 MET A CB    1 
ATOM   2832  C  CG    . MET A 1 396 ? -28.185 13.784  14.902  1.00 53.40  ? 1044 MET A CG    1 
ATOM   2833  S  SD    . MET A 1 396 ? -26.448 13.482  15.322  1.00 59.11  ? 1044 MET A SD    1 
ATOM   2834  C  CE    . MET A 1 396 ? -26.151 11.918  14.492  1.00 60.92  ? 1044 MET A CE    1 
ATOM   2835  N  N     . LEU A 1 397 ? -29.539 16.793  14.958  1.00 54.47  ? 1045 LEU A N     1 
ATOM   2836  C  CA    . LEU A 1 397 ? -29.261 18.004  15.710  1.00 55.57  ? 1045 LEU A CA    1 
ATOM   2837  C  C     . LEU A 1 397 ? -28.836 17.699  17.134  1.00 57.93  ? 1045 LEU A C     1 
ATOM   2838  O  O     . LEU A 1 397 ? -29.118 16.625  17.672  1.00 57.05  ? 1045 LEU A O     1 
ATOM   2839  C  CB    . LEU A 1 397 ? -30.487 18.915  15.714  1.00 52.90  ? 1045 LEU A CB    1 
ATOM   2840  C  CG    . LEU A 1 397 ? -30.757 19.585  14.375  1.00 48.45  ? 1045 LEU A CG    1 
ATOM   2841  C  CD1   . LEU A 1 397 ? -31.999 20.435  14.458  1.00 46.34  ? 1045 LEU A CD1   1 
ATOM   2842  C  CD2   . LEU A 1 397 ? -29.547 20.410  13.977  1.00 49.41  ? 1045 LEU A CD2   1 
ATOM   2843  N  N     . TYR A 1 398 ? -28.144 18.661  17.731  1.00 58.56  ? 1046 TYR A N     1 
ATOM   2844  C  CA    . TYR A 1 398 ? -27.776 18.593  19.134  1.00 62.48  ? 1046 TYR A CA    1 
ATOM   2845  C  C     . TYR A 1 398 ? -28.547 19.638  19.932  1.00 61.84  ? 1046 TYR A C     1 
ATOM   2846  O  O     . TYR A 1 398 ? -28.467 20.835  19.640  1.00 59.42  ? 1046 TYR A O     1 
ATOM   2847  C  CB    . TYR A 1 398 ? -26.277 18.823  19.280  1.00 62.82  ? 1046 TYR A CB    1 
ATOM   2848  C  CG    . TYR A 1 398 ? -25.457 17.595  19.008  1.00 63.86  ? 1046 TYR A CG    1 
ATOM   2849  C  CD1   . TYR A 1 398 ? -25.877 16.350  19.457  1.00 64.74  ? 1046 TYR A CD1   1 
ATOM   2850  C  CD2   . TYR A 1 398 ? -24.262 17.675  18.303  1.00 64.55  ? 1046 TYR A CD2   1 
ATOM   2851  C  CE1   . TYR A 1 398 ? -25.128 15.214  19.220  1.00 69.31  ? 1046 TYR A CE1   1 
ATOM   2852  C  CE2   . TYR A 1 398 ? -23.501 16.544  18.054  1.00 67.72  ? 1046 TYR A CE2   1 
ATOM   2853  C  CZ    . TYR A 1 398 ? -23.938 15.312  18.518  1.00 73.90  ? 1046 TYR A CZ    1 
ATOM   2854  O  OH    . TYR A 1 398 ? -23.191 14.173  18.282  1.00 75.74  ? 1046 TYR A OH    1 
ATOM   2855  N  N     . TRP A 1 399 ? -29.298 19.184  20.932  1.00 62.50  ? 1047 TRP A N     1 
ATOM   2856  C  CA    . TRP A 1 399 ? -30.059 20.093  21.785  1.00 66.13  ? 1047 TRP A CA    1 
ATOM   2857  C  C     . TRP A 1 399 ? -29.159 20.888  22.730  1.00 65.94  ? 1047 TRP A C     1 
ATOM   2858  O  O     . TRP A 1 399 ? -28.167 20.376  23.245  1.00 65.57  ? 1047 TRP A O     1 
ATOM   2859  C  CB    . TRP A 1 399 ? -31.117 19.338  22.603  1.00 68.22  ? 1047 TRP A CB    1 
ATOM   2860  C  CG    . TRP A 1 399 ? -31.781 20.202  23.644  1.00 66.99  ? 1047 TRP A CG    1 
ATOM   2861  C  CD1   . TRP A 1 399 ? -31.209 20.705  24.776  1.00 68.69  ? 1047 TRP A CD1   1 
ATOM   2862  C  CD2   . TRP A 1 399 ? -33.136 20.663  23.641  1.00 66.70  ? 1047 TRP A CD2   1 
ATOM   2863  N  NE1   . TRP A 1 399 ? -32.120 21.454  25.474  1.00 70.23  ? 1047 TRP A NE1   1 
ATOM   2864  C  CE2   . TRP A 1 399 ? -33.310 21.443  24.801  1.00 70.61  ? 1047 TRP A CE2   1 
ATOM   2865  C  CE3   . TRP A 1 399 ? -34.216 20.492  22.774  1.00 67.07  ? 1047 TRP A CE3   1 
ATOM   2866  C  CZ2   . TRP A 1 399 ? -34.525 22.052  25.113  1.00 71.43  ? 1047 TRP A CZ2   1 
ATOM   2867  C  CZ3   . TRP A 1 399 ? -35.422 21.097  23.087  1.00 69.72  ? 1047 TRP A CZ3   1 
ATOM   2868  C  CH2   . TRP A 1 399 ? -35.566 21.867  24.248  1.00 70.24  ? 1047 TRP A CH2   1 
ATOM   2869  N  N     . SER A 1 400 ? -29.522 22.145  22.953  1.00 66.49  ? 1048 SER A N     1 
ATOM   2870  C  CA    . SER A 1 400 ? -28.855 22.962  23.952  1.00 68.56  ? 1048 SER A CA    1 
ATOM   2871  C  C     . SER A 1 400 ? -29.906 23.635  24.817  1.00 71.00  ? 1048 SER A C     1 
ATOM   2872  O  O     . SER A 1 400 ? -31.093 23.626  24.487  1.00 70.19  ? 1048 SER A O     1 
ATOM   2873  C  CB    . SER A 1 400 ? -28.002 24.030  23.284  1.00 67.68  ? 1048 SER A CB    1 
ATOM   2874  O  OG    . SER A 1 400 ? -28.832 25.017  22.704  1.00 65.49  ? 1048 SER A OG    1 
ATOM   2875  N  N     . ASP A 1 401 ? -29.472 24.221  25.925  1.00 73.03  ? 1049 ASP A N     1 
ATOM   2876  C  CA    . ASP A 1 401 ? -30.382 24.997  26.752  1.00 74.03  ? 1049 ASP A CA    1 
ATOM   2877  C  C     . ASP A 1 401 ? -30.109 26.482  26.566  1.00 70.24  ? 1049 ASP A C     1 
ATOM   2878  O  O     . ASP A 1 401 ? -30.641 27.311  27.299  1.00 73.95  ? 1049 ASP A O     1 
ATOM   2879  C  CB    . ASP A 1 401 ? -30.294 24.584  28.227  1.00 71.05  ? 1049 ASP A CB    1 
ATOM   2880  C  CG    . ASP A 1 401 ? -31.251 23.447  28.575  1.00 75.86  ? 1049 ASP A CG    1 
ATOM   2881  O  OD1   . ASP A 1 401 ? -32.424 23.484  28.137  1.00 74.72  ? 1049 ASP A OD1   1 
ATOM   2882  O  OD2   . ASP A 1 401 ? -30.832 22.510  29.286  1.00 80.06  ? 1049 ASP A OD2   1 
ATOM   2883  N  N     . GLU A 1 402 ? -29.287 26.808  25.570  1.00 65.44  ? 1050 GLU A N     1 
ATOM   2884  C  CA    . GLU A 1 402 ? -29.004 28.200  25.226  1.00 67.86  ? 1050 GLU A CA    1 
ATOM   2885  C  C     . GLU A 1 402 ? -30.208 28.859  24.548  1.00 67.92  ? 1050 GLU A C     1 
ATOM   2886  O  O     . GLU A 1 402 ? -30.682 28.386  23.516  1.00 67.88  ? 1050 GLU A O     1 
ATOM   2887  C  CB    . GLU A 1 402 ? -27.786 28.295  24.307  1.00 67.06  ? 1050 GLU A CB    1 
ATOM   2888  C  CG    . GLU A 1 402 ? -26.537 27.634  24.845  1.00 71.34  ? 1050 GLU A CG    1 
ATOM   2889  C  CD    . GLU A 1 402 ? -25.348 27.781  23.911  1.00 75.10  ? 1050 GLU A CD    1 
ATOM   2890  O  OE1   . GLU A 1 402 ? -25.258 28.813  23.203  1.00 76.11  ? 1050 GLU A OE1   1 
ATOM   2891  O  OE2   . GLU A 1 402 ? -24.506 26.858  23.881  1.00 73.62  ? 1050 GLU A OE2   1 
ATOM   2892  N  N     . GLU A 1 403 ? -30.699 29.954  25.120  1.00 67.53  ? 1051 GLU A N     1 
ATOM   2893  C  CA    . GLU A 1 403 ? -31.892 30.604  24.585  1.00 65.42  ? 1051 GLU A CA    1 
ATOM   2894  C  C     . GLU A 1 403 ? -31.568 31.857  23.798  1.00 64.92  ? 1051 GLU A C     1 
ATOM   2895  O  O     . GLU A 1 403 ? -30.453 32.380  23.861  1.00 64.16  ? 1051 GLU A O     1 
ATOM   2896  C  CB    . GLU A 1 403 ? -32.867 30.952  25.705  1.00 64.94  ? 1051 GLU A CB    1 
ATOM   2897  C  CG    . GLU A 1 403 ? -33.540 29.753  26.321  1.00 71.08  ? 1051 GLU A CG    1 
ATOM   2898  C  CD    . GLU A 1 403 ? -34.314 30.108  27.567  1.00 75.11  ? 1051 GLU A CD    1 
ATOM   2899  O  OE1   . GLU A 1 403 ? -34.920 29.196  28.169  1.00 73.50  ? 1051 GLU A OE1   1 
ATOM   2900  O  OE2   . GLU A 1 403 ? -34.311 31.302  27.943  1.00 77.95  ? 1051 GLU A OE2   1 
ATOM   2901  N  N     . ALA A 1 404 ? -32.559 32.330  23.052  1.00 60.95  ? 1052 ALA A N     1 
ATOM   2902  C  CA    . ALA A 1 404 ? -32.439 33.588  22.335  1.00 61.97  ? 1052 ALA A CA    1 
ATOM   2903  C  C     . ALA A 1 404 ? -33.809 34.066  21.878  1.00 64.05  ? 1052 ALA A C     1 
ATOM   2904  O  O     . ALA A 1 404 ? -34.739 33.271  21.709  1.00 62.57  ? 1052 ALA A O     1 
ATOM   2905  C  CB    . ALA A 1 404 ? -31.496 33.448  21.156  1.00 62.67  ? 1052 ALA A CB    1 
ATOM   2906  N  N     . VAL A 1 405 ? -33.935 35.375  21.700  1.00 66.24  ? 1053 VAL A N     1 
ATOM   2907  C  CA    . VAL A 1 405 ? -35.195 35.954  21.260  1.00 67.08  ? 1053 VAL A CA    1 
ATOM   2908  C  C     . VAL A 1 405 ? -35.087 36.438  19.816  1.00 65.51  ? 1053 VAL A C     1 
ATOM   2909  O  O     . VAL A 1 405 ? -34.079 37.014  19.401  1.00 67.34  ? 1053 VAL A O     1 
ATOM   2910  C  CB    . VAL A 1 405 ? -35.668 37.084  22.190  1.00 65.93  ? 1053 VAL A CB    1 
ATOM   2911  C  CG1   . VAL A 1 405 ? -37.132 37.395  21.935  1.00 63.59  ? 1053 VAL A CG1   1 
ATOM   2912  C  CG2   . VAL A 1 405 ? -35.472 36.678  23.627  1.00 66.96  ? 1053 VAL A CG2   1 
ATOM   2913  N  N     . VAL A 1 406 ? -36.146 36.194  19.060  1.00 61.11  ? 1054 VAL A N     1 
ATOM   2914  C  CA    . VAL A 1 406 ? -36.115 36.349  17.624  1.00 57.83  ? 1054 VAL A CA    1 
ATOM   2915  C  C     . VAL A 1 406 ? -37.411 36.989  17.157  1.00 60.02  ? 1054 VAL A C     1 
ATOM   2916  O  O     . VAL A 1 406 ? -38.454 36.836  17.793  1.00 60.84  ? 1054 VAL A O     1 
ATOM   2917  C  CB    . VAL A 1 406 ? -35.933 34.969  16.964  1.00 57.53  ? 1054 VAL A CB    1 
ATOM   2918  C  CG1   . VAL A 1 406 ? -36.734 34.861  15.680  1.00 59.15  ? 1054 VAL A CG1   1 
ATOM   2919  C  CG2   . VAL A 1 406 ? -34.459 34.685  16.736  1.00 55.39  ? 1054 VAL A CG2   1 
ATOM   2920  N  N     . ASN A 1 407 ? -37.346 37.720  16.054  1.00 57.06  ? 1055 ASN A N     1 
ATOM   2921  C  CA    . ASN A 1 407 ? -38.537 38.346  15.521  1.00 56.99  ? 1055 ASN A CA    1 
ATOM   2922  C  C     . ASN A 1 407 ? -39.285 37.407  14.577  1.00 58.63  ? 1055 ASN A C     1 
ATOM   2923  O  O     . ASN A 1 407 ? -38.696 36.853  13.653  1.00 57.91  ? 1055 ASN A O     1 
ATOM   2924  C  CB    . ASN A 1 407 ? -38.169 39.639  14.814  1.00 58.62  ? 1055 ASN A CB    1 
ATOM   2925  C  CG    . ASN A 1 407 ? -39.175 40.728  15.067  1.00 68.63  ? 1055 ASN A CG    1 
ATOM   2926  O  OD1   . ASN A 1 407 ? -40.247 40.758  14.454  1.00 69.77  ? 1055 ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A 1 407 ? -38.850 41.625  15.992  1.00 73.29  ? 1055 ASN A ND2   1 
ATOM   2928  N  N     . PHE A 1 408 ? -40.581 37.229  14.810  1.00 59.24  ? 1056 PHE A N     1 
ATOM   2929  C  CA    . PHE A 1 408 ? -41.363 36.244  14.062  1.00 56.03  ? 1056 PHE A CA    1 
ATOM   2930  C  C     . PHE A 1 408 ? -41.358 36.535  12.574  1.00 56.20  ? 1056 PHE A C     1 
ATOM   2931  O  O     . PHE A 1 408 ? -41.759 35.694  11.768  1.00 56.49  ? 1056 PHE A O     1 
ATOM   2932  C  CB    . PHE A 1 408 ? -42.801 36.194  14.573  1.00 56.76  ? 1056 PHE A CB    1 
ATOM   2933  C  CG    . PHE A 1 408 ? -43.681 35.220  13.836  1.00 53.39  ? 1056 PHE A CG    1 
ATOM   2934  C  CD1   . PHE A 1 408 ? -44.873 35.634  13.272  1.00 54.61  ? 1056 PHE A CD1   1 
ATOM   2935  C  CD2   . PHE A 1 408 ? -43.324 33.890  13.719  1.00 55.10  ? 1056 PHE A CD2   1 
ATOM   2936  C  CE1   . PHE A 1 408 ? -45.696 34.738  12.609  1.00 54.32  ? 1056 PHE A CE1   1 
ATOM   2937  C  CE2   . PHE A 1 408 ? -44.141 32.989  13.054  1.00 52.75  ? 1056 PHE A CE2   1 
ATOM   2938  C  CZ    . PHE A 1 408 ? -45.328 33.414  12.501  1.00 53.10  ? 1056 PHE A CZ    1 
ATOM   2939  N  N     . SER A 1 409 ? -40.906 37.728  12.211  1.00 56.23  ? 1057 SER A N     1 
ATOM   2940  C  CA    . SER A 1 409 ? -40.831 38.110  10.810  1.00 55.97  ? 1057 SER A CA    1 
ATOM   2941  C  C     . SER A 1 409 ? -39.637 37.452  10.139  1.00 53.42  ? 1057 SER A C     1 
ATOM   2942  O  O     . SER A 1 409 ? -39.581 37.372  8.919   1.00 56.52  ? 1057 SER A O     1 
ATOM   2943  C  CB    . SER A 1 409 ? -40.690 39.618  10.684  1.00 56.06  ? 1057 SER A CB    1 
ATOM   2944  O  OG    . SER A 1 409 ? -39.360 39.992  10.986  1.00 56.10  ? 1057 SER A OG    1 
ATOM   2945  N  N     . ASP A 1 410 ? -38.677 36.998  10.937  1.00 52.61  ? 1058 ASP A N     1 
ATOM   2946  C  CA    . ASP A 1 410 ? -37.468 36.378  10.403  1.00 51.85  ? 1058 ASP A CA    1 
ATOM   2947  C  C     . ASP A 1 410 ? -37.620 34.881  10.208  1.00 49.79  ? 1058 ASP A C     1 
ATOM   2948  O  O     . ASP A 1 410 ? -36.761 34.239  9.615   1.00 48.50  ? 1058 ASP A O     1 
ATOM   2949  C  CB    . ASP A 1 410 ? -36.267 36.648  11.306  1.00 54.03  ? 1058 ASP A CB    1 
ATOM   2950  C  CG    . ASP A 1 410 ? -35.701 38.042  11.120  1.00 60.13  ? 1058 ASP A CG    1 
ATOM   2951  O  OD1   . ASP A 1 410 ? -35.944 38.645  10.050  1.00 61.11  ? 1058 ASP A OD1   1 
ATOM   2952  O  OD2   . ASP A 1 410 ? -35.009 38.528  12.043  1.00 59.97  ? 1058 ASP A OD2   1 
ATOM   2953  N  N     . VAL A 1 411 ? -38.712 34.325  10.713  1.00 50.47  ? 1059 VAL A N     1 
ATOM   2954  C  CA    . VAL A 1 411 ? -38.953 32.897  10.574  1.00 49.60  ? 1059 VAL A CA    1 
ATOM   2955  C  C     . VAL A 1 411 ? -39.119 32.520  9.104   1.00 50.06  ? 1059 VAL A C     1 
ATOM   2956  O  O     . VAL A 1 411 ? -39.883 33.162  8.378   1.00 46.76  ? 1059 VAL A O     1 
ATOM   2957  C  CB    . VAL A 1 411 ? -40.185 32.461  11.369  1.00 48.21  ? 1059 VAL A CB    1 
ATOM   2958  C  CG1   . VAL A 1 411 ? -40.531 31.023  11.037  1.00 48.17  ? 1059 VAL A CG1   1 
ATOM   2959  C  CG2   . VAL A 1 411 ? -39.929 32.630  12.856  1.00 46.89  ? 1059 VAL A CG2   1 
ATOM   2960  N  N     . GLN A 1 412 ? -38.395 31.482  8.677   1.00 50.23  ? 1060 GLN A N     1 
ATOM   2961  C  CA    . GLN A 1 412 ? -38.380 31.051  7.276   1.00 46.01  ? 1060 GLN A CA    1 
ATOM   2962  C  C     . GLN A 1 412 ? -39.348 29.913  7.006   1.00 45.39  ? 1060 GLN A C     1 
ATOM   2963  O  O     . GLN A 1 412 ? -39.813 29.746  5.888   1.00 47.45  ? 1060 GLN A O     1 
ATOM   2964  C  CB    . GLN A 1 412 ? -36.975 30.631  6.857   1.00 43.46  ? 1060 GLN A CB    1 
ATOM   2965  C  CG    . GLN A 1 412 ? -35.916 31.693  7.106   1.00 48.98  ? 1060 GLN A CG    1 
ATOM   2966  C  CD    . GLN A 1 412 ? -36.117 32.937  6.256   1.00 51.25  ? 1060 GLN A CD    1 
ATOM   2967  O  OE1   . GLN A 1 412 ? -37.063 33.700  6.464   1.00 52.72  ? 1060 GLN A OE1   1 
ATOM   2968  N  NE2   . GLN A 1 412 ? -35.226 33.146  5.288   1.00 48.52  ? 1060 GLN A NE2   1 
ATOM   2969  N  N     . GLY A 1 413 ? -39.646 29.126  8.032   1.00 46.99  ? 1061 GLY A N     1 
ATOM   2970  C  CA    . GLY A 1 413 ? -40.625 28.064  7.916   1.00 44.61  ? 1061 GLY A CA    1 
ATOM   2971  C  C     . GLY A 1 413 ? -40.661 27.240  9.178   1.00 42.99  ? 1061 GLY A C     1 
ATOM   2972  O  O     . GLY A 1 413 ? -39.862 27.449  10.085  1.00 44.09  ? 1061 GLY A O     1 
ATOM   2973  N  N     . ARG A 1 414 ? -41.594 26.304  9.245   1.00 44.70  ? 1062 ARG A N     1 
ATOM   2974  C  CA    . ARG A 1 414 ? -41.641 25.382  10.368  1.00 46.92  ? 1062 ARG A CA    1 
ATOM   2975  C  C     . ARG A 1 414 ? -40.847 24.166  9.977   1.00 46.72  ? 1062 ARG A C     1 
ATOM   2976  O  O     . ARG A 1 414 ? -40.782 23.813  8.800   1.00 48.02  ? 1062 ARG A O     1 
ATOM   2977  C  CB    . ARG A 1 414 ? -43.082 24.947  10.682  1.00 45.45  ? 1062 ARG A CB    1 
ATOM   2978  C  CG    . ARG A 1 414 ? -43.244 24.305  12.057  1.00 47.33  ? 1062 ARG A CG    1 
ATOM   2979  C  CD    . ARG A 1 414 ? -44.259 23.159  12.075  1.00 50.49  ? 1062 ARG A CD    1 
ATOM   2980  N  NE    . ARG A 1 414 ? -45.634 23.601  11.860  1.00 49.73  ? 1062 ARG A NE    1 
ATOM   2981  C  CZ    . ARG A 1 414 ? -46.436 23.112  10.916  1.00 51.26  ? 1062 ARG A CZ    1 
ATOM   2982  N  NH1   . ARG A 1 414 ? -46.000 22.165  10.098  1.00 51.15  ? 1062 ARG A NH1   1 
ATOM   2983  N  NH2   . ARG A 1 414 ? -47.675 23.568  10.783  1.00 51.76  ? 1062 ARG A NH2   1 
ATOM   2984  N  N     . CYS A 1 415 ? -40.233 23.525  10.957  1.00 45.36  ? 1063 CYS A N     1 
ATOM   2985  C  CA    . CYS A 1 415 ? -39.752 22.179  10.743  1.00 45.98  ? 1063 CYS A CA    1 
ATOM   2986  C  C     . CYS A 1 415 ? -40.117 21.309  11.931  1.00 48.71  ? 1063 CYS A C     1 
ATOM   2987  O  O     . CYS A 1 415 ? -40.719 21.774  12.901  1.00 49.68  ? 1063 CYS A O     1 
ATOM   2988  C  CB    . CYS A 1 415 ? -38.252 22.156  10.491  1.00 44.73  ? 1063 CYS A CB    1 
ATOM   2989  S  SG    . CYS A 1 415 ? -37.273 22.749  11.851  1.00 46.26  ? 1063 CYS A SG    1 
ATOM   2990  N  N     . THR A 1 416 ? -39.769 20.035  11.837  1.00 45.66  ? 1064 THR A N     1 
ATOM   2991  C  CA    . THR A 1 416 ? -40.039 19.104  12.906  1.00 44.36  ? 1064 THR A CA    1 
ATOM   2992  C  C     . THR A 1 416 ? -38.729 18.641  13.490  1.00 46.52  ? 1064 THR A C     1 
ATOM   2993  O  O     . THR A 1 416 ? -37.864 18.165  12.768  1.00 47.62  ? 1064 THR A O     1 
ATOM   2994  C  CB    . THR A 1 416 ? -40.790 17.881  12.396  1.00 42.95  ? 1064 THR A CB    1 
ATOM   2995  O  OG1   . THR A 1 416 ? -42.045 18.290  11.841  1.00 43.47  ? 1064 THR A OG1   1 
ATOM   2996  C  CG2   . THR A 1 416 ? -41.031 16.913  13.529  1.00 44.40  ? 1064 THR A CG2   1 
ATOM   2997  N  N     . VAL A 1 417 ? -38.577 18.789  14.799  1.00 50.99  ? 1065 VAL A N     1 
ATOM   2998  C  CA    . VAL A 1 417 ? -37.432 18.207  15.487  1.00 50.66  ? 1065 VAL A CA    1 
ATOM   2999  C  C     . VAL A 1 417 ? -37.906 17.334  16.640  1.00 52.79  ? 1065 VAL A C     1 
ATOM   3000  O  O     . VAL A 1 417 ? -38.568 17.805  17.562  1.00 59.91  ? 1065 VAL A O     1 
ATOM   3001  C  CB    . VAL A 1 417 ? -36.453 19.274  15.982  1.00 49.04  ? 1065 VAL A CB    1 
ATOM   3002  C  CG1   . VAL A 1 417 ? -35.320 18.622  16.739  1.00 50.60  ? 1065 VAL A CG1   1 
ATOM   3003  C  CG2   . VAL A 1 417 ? -35.918 20.070  14.806  1.00 46.13  ? 1065 VAL A CG2   1 
ATOM   3004  N  N     . GLU A 1 418 ? -37.574 16.052  16.567  1.00 54.02  ? 1066 GLU A N     1 
ATOM   3005  C  CA    . GLU A 1 418 ? -38.065 15.070  17.522  1.00 55.72  ? 1066 GLU A CA    1 
ATOM   3006  C  C     . GLU A 1 418 ? -36.923 14.390  18.260  1.00 60.03  ? 1066 GLU A C     1 
ATOM   3007  O  O     . GLU A 1 418 ? -35.855 14.144  17.697  1.00 57.05  ? 1066 GLU A O     1 
ATOM   3008  C  CB    . GLU A 1 418 ? -38.913 14.016  16.812  1.00 54.00  ? 1066 GLU A CB    1 
ATOM   3009  C  CG    . GLU A 1 418 ? -40.169 14.559  16.154  1.00 56.04  ? 1066 GLU A CG    1 
ATOM   3010  C  CD    . GLU A 1 418 ? -41.151 15.136  17.156  1.00 61.56  ? 1066 GLU A CD    1 
ATOM   3011  O  OE1   . GLU A 1 418 ? -41.839 14.341  17.840  1.00 57.83  ? 1066 GLU A OE1   1 
ATOM   3012  O  OE2   . GLU A 1 418 ? -41.234 16.386  17.254  1.00 63.34  ? 1066 GLU A OE2   1 
ATOM   3013  N  N     . TYR A 1 419 ? -37.156 14.093  19.532  1.00 66.12  ? 1067 TYR A N     1 
ATOM   3014  C  CA    . TYR A 1 419 ? -36.191 13.348  20.319  1.00 67.86  ? 1067 TYR A CA    1 
ATOM   3015  C  C     . TYR A 1 419 ? -35.996 11.965  19.691  1.00 68.18  ? 1067 TYR A C     1 
ATOM   3016  O  O     . TYR A 1 419 ? -36.970 11.260  19.397  1.00 64.81  ? 1067 TYR A O     1 
ATOM   3017  C  CB    . TYR A 1 419 ? -36.666 13.236  21.771  1.00 68.85  ? 1067 TYR A CB    1 
ATOM   3018  C  CG    . TYR A 1 419 ? -35.718 12.471  22.664  1.00 70.73  ? 1067 TYR A CG    1 
ATOM   3019  C  CD1   . TYR A 1 419 ? -36.161 11.395  23.429  1.00 72.00  ? 1067 TYR A CD1   1 
ATOM   3020  C  CD2   . TYR A 1 419 ? -34.373 12.814  22.730  1.00 69.20  ? 1067 TYR A CD2   1 
ATOM   3021  C  CE1   . TYR A 1 419 ? -35.286 10.687  24.242  1.00 70.87  ? 1067 TYR A CE1   1 
ATOM   3022  C  CE2   . TYR A 1 419 ? -33.492 12.113  23.540  1.00 69.97  ? 1067 TYR A CE2   1 
ATOM   3023  C  CZ    . TYR A 1 419 ? -33.952 11.053  24.292  1.00 70.89  ? 1067 TYR A CZ    1 
ATOM   3024  O  OH    . TYR A 1 419 ? -33.069 10.365  25.090  1.00 72.41  ? 1067 TYR A OH    1 
ATOM   3025  N  N     . GLY A 1 420 ? -34.736 11.595  19.469  1.00 66.41  ? 1068 GLY A N     1 
ATOM   3026  C  CA    . GLY A 1 420 ? -34.403 10.310  18.880  1.00 65.26  ? 1068 GLY A CA    1 
ATOM   3027  C  C     . GLY A 1 420 ? -35.234 9.167   19.434  1.00 69.30  ? 1068 GLY A C     1 
ATOM   3028  O  O     . GLY A 1 420 ? -36.042 8.568   18.722  1.00 66.40  ? 1068 GLY A O     1 
ATOM   3029  N  N     . GLU A 1 421 ? -35.040 8.889   20.720  1.00 71.53  ? 1069 GLU A N     1 
ATOM   3030  C  CA    . GLU A 1 421 ? -35.671 7.761   21.403  1.00 74.39  ? 1069 GLU A CA    1 
ATOM   3031  C  C     . GLU A 1 421 ? -37.199 7.843   21.433  1.00 73.61  ? 1069 GLU A C     1 
ATOM   3032  O  O     . GLU A 1 421 ? -37.889 6.829   21.319  1.00 74.23  ? 1069 GLU A O     1 
ATOM   3033  C  CB    . GLU A 1 421 ? -35.130 7.664   22.830  1.00 75.01  ? 1069 GLU A CB    1 
ATOM   3034  C  CG    . GLU A 1 421 ? -33.620 7.834   22.935  1.00 76.74  ? 1069 GLU A CG    1 
ATOM   3035  C  CD    . GLU A 1 421 ? -32.853 6.659   22.354  1.00 81.21  ? 1069 GLU A CD    1 
ATOM   3036  O  OE1   . GLU A 1 421 ? -33.496 5.668   21.947  1.00 83.31  ? 1069 GLU A OE1   1 
ATOM   3037  O  OE2   . GLU A 1 421 ? -31.605 6.724   22.306  1.00 78.69  ? 1069 GLU A OE2   1 
ATOM   3038  N  N     . ASP A 1 422 ? -37.714 9.058   21.586  1.00 72.44  ? 1070 ASP A N     1 
ATOM   3039  C  CA    . ASP A 1 422 ? -39.149 9.311   21.693  1.00 74.23  ? 1070 ASP A CA    1 
ATOM   3040  C  C     . ASP A 1 422 ? -39.951 8.781   20.498  1.00 73.72  ? 1070 ASP A C     1 
ATOM   3041  O  O     . ASP A 1 422 ? -41.142 8.501   20.616  1.00 69.04  ? 1070 ASP A O     1 
ATOM   3042  C  CB    . ASP A 1 422 ? -39.380 10.821  21.845  1.00 81.06  ? 1070 ASP A CB    1 
ATOM   3043  C  CG    . ASP A 1 422 ? -40.711 11.157  22.503  1.00 89.01  ? 1070 ASP A CG    1 
ATOM   3044  O  OD1   . ASP A 1 422 ? -40.797 11.077  23.750  1.00 93.15  ? 1070 ASP A OD1   1 
ATOM   3045  O  OD2   . ASP A 1 422 ? -41.663 11.523  21.777  1.00 88.78  ? 1070 ASP A OD2   1 
ATOM   3046  N  N     . LEU A 1 423 ? -39.290 8.651   19.350  1.00 77.85  ? 1071 LEU A N     1 
ATOM   3047  C  CA    . LEU A 1 423 ? -39.965 8.348   18.085  1.00 75.63  ? 1071 LEU A CA    1 
ATOM   3048  C  C     . LEU A 1 423 ? -40.533 6.935   18.054  1.00 75.46  ? 1071 LEU A C     1 
ATOM   3049  O  O     . LEU A 1 423 ? -39.891 5.988   18.511  1.00 76.94  ? 1071 LEU A O     1 
ATOM   3050  C  CB    . LEU A 1 423 ? -39.016 8.567   16.902  1.00 71.03  ? 1071 LEU A CB    1 
ATOM   3051  N  N     . LEU A 1 424 ? -41.735 6.793   17.502  1.00 74.79  ? 1072 LEU A N     1 
ATOM   3052  C  CA    . LEU A 1 424 ? -42.415 5.496   17.476  1.00 77.60  ? 1072 LEU A CA    1 
ATOM   3053  C  C     . LEU A 1 424 ? -41.974 4.577   16.323  1.00 77.72  ? 1072 LEU A C     1 
ATOM   3054  O  O     . LEU A 1 424 ? -42.561 3.511   16.118  1.00 75.57  ? 1072 LEU A O     1 
ATOM   3055  C  CB    . LEU A 1 424 ? -43.935 5.689   17.443  1.00 77.29  ? 1072 LEU A CB    1 
ATOM   3056  N  N     . GLU A 1 425 ? -40.945 4.992   15.583  1.00 78.29  ? 1073 GLU A N     1 
ATOM   3057  C  CA    . GLU A 1 425 ? -40.444 4.234   14.436  1.00 70.60  ? 1073 GLU A CA    1 
ATOM   3058  C  C     . GLU A 1 425 ? -38.924 4.311   14.374  1.00 69.00  ? 1073 GLU A C     1 
ATOM   3059  O  O     . GLU A 1 425 ? -38.283 4.793   15.305  1.00 70.07  ? 1073 GLU A O     1 
ATOM   3060  C  CB    . GLU A 1 425 ? -41.057 4.755   13.128  1.00 70.84  ? 1073 GLU A CB    1 
ATOM   3061  C  CG    . GLU A 1 425 ? -41.001 6.274   12.965  1.00 72.00  ? 1073 GLU A CG    1 
ATOM   3062  C  CD    . GLU A 1 425 ? -41.691 6.769   11.696  1.00 74.01  ? 1073 GLU A CD    1 
ATOM   3063  O  OE1   . GLU A 1 425 ? -42.021 7.979   11.626  1.00 73.62  ? 1073 GLU A OE1   1 
ATOM   3064  O  OE2   . GLU A 1 425 ? -41.893 5.950   10.769  1.00 69.53  ? 1073 GLU A OE2   1 
ATOM   3065  N  N     . SER A 1 426 ? -38.347 3.825   13.281  1.00 66.11  ? 1074 SER A N     1 
ATOM   3066  C  CA    . SER A 1 426 ? -36.906 3.922   13.089  1.00 62.87  ? 1074 SER A CA    1 
ATOM   3067  C  C     . SER A 1 426 ? -36.531 5.361   12.774  1.00 62.71  ? 1074 SER A C     1 
ATOM   3068  O  O     . SER A 1 426 ? -37.298 6.088   12.139  1.00 61.65  ? 1074 SER A O     1 
ATOM   3069  C  CB    . SER A 1 426 ? -36.442 3.006   11.963  1.00 61.51  ? 1074 SER A CB    1 
ATOM   3070  N  N     . ILE A 1 427 ? -35.354 5.777   13.223  1.00 61.05  ? 1075 ILE A N     1 
ATOM   3071  C  CA    . ILE A 1 427 ? -34.852 7.103   12.887  1.00 60.03  ? 1075 ILE A CA    1 
ATOM   3072  C  C     . ILE A 1 427 ? -34.842 7.301   11.373  1.00 61.23  ? 1075 ILE A C     1 
ATOM   3073  O  O     . ILE A 1 427 ? -35.320 8.318   10.867  1.00 56.61  ? 1075 ILE A O     1 
ATOM   3074  C  CB    . ILE A 1 427 ? -33.437 7.330   13.444  1.00 57.71  ? 1075 ILE A CB    1 
ATOM   3075  C  CG1   . ILE A 1 427 ? -33.492 7.471   14.966  1.00 56.70  ? 1075 ILE A CG1   1 
ATOM   3076  C  CG2   . ILE A 1 427 ? -32.806 8.563   12.804  1.00 56.22  ? 1075 ILE A CG2   1 
ATOM   3077  C  CD1   . ILE A 1 427 ? -32.140 7.624   15.624  1.00 57.80  ? 1075 ILE A CD1   1 
ATOM   3078  N  N     . GLN A 1 428 ? -34.300 6.320   10.654  1.00 61.91  ? 1076 GLN A N     1 
ATOM   3079  C  CA    . GLN A 1 428 ? -34.247 6.389   9.198   1.00 58.94  ? 1076 GLN A CA    1 
ATOM   3080  C  C     . GLN A 1 428 ? -35.654 6.409   8.603   1.00 59.28  ? 1076 GLN A C     1 
ATOM   3081  O  O     . GLN A 1 428 ? -35.933 7.166   7.668   1.00 61.09  ? 1076 GLN A O     1 
ATOM   3082  C  CB    . GLN A 1 428 ? -33.417 5.247   8.616   1.00 55.18  ? 1076 GLN A CB    1 
ATOM   3083  N  N     . ASP A 1 429 ? -36.546 5.590   9.143   1.00 54.95  ? 1077 ASP A N     1 
ATOM   3084  C  CA    . ASP A 1 429 ? -37.929 5.633   8.697   1.00 59.51  ? 1077 ASP A CA    1 
ATOM   3085  C  C     . ASP A 1 429 ? -38.485 7.049   8.859   1.00 60.50  ? 1077 ASP A C     1 
ATOM   3086  O  O     . ASP A 1 429 ? -39.118 7.600   7.952   1.00 57.27  ? 1077 ASP A O     1 
ATOM   3087  C  CB    . ASP A 1 429 ? -38.780 4.629   9.474   1.00 65.00  ? 1077 ASP A CB    1 
ATOM   3088  C  CG    . ASP A 1 429 ? -38.604 3.206   8.974   1.00 67.88  ? 1077 ASP A CG    1 
ATOM   3089  O  OD1   . ASP A 1 429 ? -38.582 2.281   9.815   1.00 69.75  ? 1077 ASP A OD1   1 
ATOM   3090  O  OD2   . ASP A 1 429 ? -38.492 3.013   7.740   1.00 64.84  ? 1077 ASP A OD2   1 
ATOM   3091  N  N     . TYR A 1 430 ? -38.231 7.630   10.025  1.00 61.50  ? 1078 TYR A N     1 
ATOM   3092  C  CA    . TYR A 1 430 ? -38.674 8.982   10.342  1.00 59.95  ? 1078 TYR A CA    1 
ATOM   3093  C  C     . TYR A 1 430 ? -38.135 10.013  9.347   1.00 56.85  ? 1078 TYR A C     1 
ATOM   3094  O  O     . TYR A 1 430 ? -38.902 10.772  8.755   1.00 56.15  ? 1078 TYR A O     1 
ATOM   3095  C  CB    . TYR A 1 430 ? -38.257 9.337   11.775  1.00 58.78  ? 1078 TYR A CB    1 
ATOM   3096  C  CG    . TYR A 1 430 ? -38.351 10.805  12.121  1.00 53.01  ? 1078 TYR A CG    1 
ATOM   3097  C  CD1   . TYR A 1 430 ? -37.210 11.546  12.405  1.00 49.38  ? 1078 TYR A CD1   1 
ATOM   3098  C  CD2   . TYR A 1 430 ? -39.584 11.450  12.163  1.00 54.27  ? 1078 TYR A CD2   1 
ATOM   3099  C  CE1   . TYR A 1 430 ? -37.293 12.891  12.723  1.00 52.78  ? 1078 TYR A CE1   1 
ATOM   3100  C  CE2   . TYR A 1 430 ? -39.682 12.794  12.482  1.00 49.88  ? 1078 TYR A CE2   1 
ATOM   3101  C  CZ    . TYR A 1 430 ? -38.538 13.511  12.761  1.00 52.29  ? 1078 TYR A CZ    1 
ATOM   3102  O  OH    . TYR A 1 430 ? -38.637 14.851  13.073  1.00 49.53  ? 1078 TYR A OH    1 
ATOM   3103  N  N     . SER A 1 431 ? -36.820 10.037  9.160   1.00 52.20  ? 1079 SER A N     1 
ATOM   3104  C  CA    . SER A 1 431 ? -36.216 11.013  8.268   1.00 51.74  ? 1079 SER A CA    1 
ATOM   3105  C  C     . SER A 1 431 ? -36.792 10.871  6.865   1.00 55.53  ? 1079 SER A C     1 
ATOM   3106  O  O     . SER A 1 431 ? -37.136 11.857  6.215   1.00 52.29  ? 1079 SER A O     1 
ATOM   3107  C  CB    . SER A 1 431 ? -34.701 10.835  8.219   1.00 50.27  ? 1079 SER A CB    1 
ATOM   3108  O  OG    . SER A 1 431 ? -34.191 10.471  9.484   1.00 50.53  ? 1079 SER A OG    1 
ATOM   3109  N  N     . GLN A 1 432 ? -36.897 9.633   6.399   1.00 56.63  ? 1080 GLN A N     1 
ATOM   3110  C  CA    . GLN A 1 432 ? -37.353 9.381   5.041   1.00 56.40  ? 1080 GLN A CA    1 
ATOM   3111  C  C     . GLN A 1 432 ? -38.848 9.695   4.902   1.00 56.59  ? 1080 GLN A C     1 
ATOM   3112  O  O     . GLN A 1 432 ? -39.365 9.856   3.795   1.00 55.02  ? 1080 GLN A O     1 
ATOM   3113  C  CB    . GLN A 1 432 ? -37.047 7.936   4.645   1.00 53.48  ? 1080 GLN A CB    1 
ATOM   3114  N  N     . GLY A 1 433 ? -39.528 9.806   6.039   1.00 56.87  ? 1081 GLY A N     1 
ATOM   3115  C  CA    . GLY A 1 433 ? -40.974 9.938   6.069   1.00 55.89  ? 1081 GLY A CA    1 
ATOM   3116  C  C     . GLY A 1 433 ? -41.550 11.203  5.467   1.00 53.93  ? 1081 GLY A C     1 
ATOM   3117  O  O     . GLY A 1 433 ? -42.626 11.180  4.872   1.00 54.10  ? 1081 GLY A O     1 
ATOM   3118  N  N     . GLY A 1 434 ? -40.845 12.316  5.622   1.00 55.62  ? 1082 GLY A N     1 
ATOM   3119  C  CA    . GLY A 1 434 ? -41.351 13.582  5.125   1.00 51.29  ? 1082 GLY A CA    1 
ATOM   3120  C  C     . GLY A 1 434 ? -40.303 14.670  5.096   1.00 49.26  ? 1082 GLY A C     1 
ATOM   3121  O  O     . GLY A 1 434 ? -39.166 14.473  5.523   1.00 48.94  ? 1082 GLY A O     1 
ATOM   3122  N  N     . PRO A 1 435 ? -40.687 15.842  4.589   1.00 49.64  ? 1083 PRO A N     1 
ATOM   3123  C  CA    . PRO A 1 435 ? -39.783 16.980  4.426   1.00 49.43  ? 1083 PRO A CA    1 
ATOM   3124  C  C     . PRO A 1 435 ? -39.568 17.727  5.735   1.00 49.03  ? 1083 PRO A C     1 
ATOM   3125  O  O     . PRO A 1 435 ? -40.472 17.769  6.574   1.00 49.81  ? 1083 PRO A O     1 
ATOM   3126  C  CB    . PRO A 1 435 ? -40.538 17.866  3.441   1.00 48.26  ? 1083 PRO A CB    1 
ATOM   3127  C  CG    . PRO A 1 435 ? -41.976 17.590  3.737   1.00 46.29  ? 1083 PRO A CG    1 
ATOM   3128  C  CD    . PRO A 1 435 ? -42.055 16.147  4.138   1.00 48.50  ? 1083 PRO A CD    1 
ATOM   3129  N  N     . ASP A 1 436 ? -38.381 18.299  5.906   1.00 46.87  ? 1084 ASP A N     1 
ATOM   3130  C  CA    . ASP A 1 436 ? -38.091 19.150  7.057   1.00 45.45  ? 1084 ASP A CA    1 
ATOM   3131  C  C     . ASP A 1 436 ? -38.060 18.413  8.391   1.00 46.46  ? 1084 ASP A C     1 
ATOM   3132  O  O     . ASP A 1 436 ? -38.359 19.013  9.412   1.00 48.52  ? 1084 ASP A O     1 
ATOM   3133  C  CB    . ASP A 1 436 ? -39.128 20.265  7.159   1.00 47.10  ? 1084 ASP A CB    1 
ATOM   3134  C  CG    . ASP A 1 436 ? -39.152 21.152  5.938   1.00 50.98  ? 1084 ASP A CG    1 
ATOM   3135  O  OD1   . ASP A 1 436 ? -38.065 21.616  5.524   1.00 50.34  ? 1084 ASP A OD1   1 
ATOM   3136  O  OD2   . ASP A 1 436 ? -40.259 21.381  5.395   1.00 50.21  ? 1084 ASP A OD2   1 
ATOM   3137  N  N     . ARG A 1 437 ? -37.708 17.128  8.388   1.00 47.02  ? 1085 ARG A N     1 
ATOM   3138  C  CA    . ARG A 1 437 ? -37.661 16.340  9.621   1.00 44.54  ? 1085 ARG A CA    1 
ATOM   3139  C  C     . ARG A 1 437 ? -36.245 16.192  10.181  1.00 45.01  ? 1085 ARG A C     1 
ATOM   3140  O  O     . ARG A 1 437 ? -35.391 15.557  9.564   1.00 45.46  ? 1085 ARG A O     1 
ATOM   3141  C  CB    . ARG A 1 437 ? -38.267 14.954  9.399   1.00 45.18  ? 1085 ARG A CB    1 
ATOM   3142  C  CG    . ARG A 1 437 ? -39.736 14.958  9.018   1.00 47.33  ? 1085 ARG A CG    1 
ATOM   3143  C  CD    . ARG A 1 437 ? -40.262 13.536  8.883   1.00 50.15  ? 1085 ARG A CD    1 
ATOM   3144  N  NE    . ARG A 1 437 ? -41.677 13.495  8.517   1.00 55.66  ? 1085 ARG A NE    1 
ATOM   3145  C  CZ    . ARG A 1 437 ? -42.431 12.397  8.554   1.00 56.21  ? 1085 ARG A CZ    1 
ATOM   3146  N  NH1   . ARG A 1 437 ? -41.909 11.242  8.946   1.00 58.23  ? 1085 ARG A NH1   1 
ATOM   3147  N  NH2   . ARG A 1 437 ? -43.711 12.453  8.206   1.00 53.57  ? 1085 ARG A NH2   1 
ATOM   3148  N  N     . PHE A 1 438 ? -36.004 16.781  11.351  1.00 44.60  ? 1086 PHE A N     1 
ATOM   3149  C  CA    . PHE A 1 438 ? -34.737 16.607  12.059  1.00 44.69  ? 1086 PHE A CA    1 
ATOM   3150  C  C     . PHE A 1 438 ? -34.951 15.764  13.309  1.00 47.10  ? 1086 PHE A C     1 
ATOM   3151  O  O     . PHE A 1 438 ? -36.086 15.483  13.681  1.00 45.56  ? 1086 PHE A O     1 
ATOM   3152  C  CB    . PHE A 1 438 ? -34.131 17.955  12.442  1.00 42.86  ? 1086 PHE A CB    1 
ATOM   3153  C  CG    . PHE A 1 438 ? -33.729 18.796  11.265  1.00 44.23  ? 1086 PHE A CG    1 
ATOM   3154  C  CD1   . PHE A 1 438 ? -32.402 18.909  10.897  1.00 42.34  ? 1086 PHE A CD1   1 
ATOM   3155  C  CD2   . PHE A 1 438 ? -34.680 19.479  10.528  1.00 45.07  ? 1086 PHE A CD2   1 
ATOM   3156  C  CE1   . PHE A 1 438 ? -32.040 19.675  9.823   1.00 39.02  ? 1086 PHE A CE1   1 
ATOM   3157  C  CE2   . PHE A 1 438 ? -34.317 20.248  9.452   1.00 40.10  ? 1086 PHE A CE2   1 
ATOM   3158  C  CZ    . PHE A 1 438 ? -32.999 20.341  9.101   1.00 38.42  ? 1086 PHE A CZ    1 
ATOM   3159  N  N     . TYR A 1 439 ? -33.858 15.347  13.940  1.00 46.72  ? 1087 TYR A N     1 
ATOM   3160  C  CA    . TYR A 1 439 ? -33.933 14.617  15.200  1.00 49.96  ? 1087 TYR A CA    1 
ATOM   3161  C  C     . TYR A 1 439 ? -32.675 14.919  16.008  1.00 53.10  ? 1087 TYR A C     1 
ATOM   3162  O  O     . TYR A 1 439 ? -31.655 15.339  15.454  1.00 51.50  ? 1087 TYR A O     1 
ATOM   3163  C  CB    . TYR A 1 439 ? -34.076 13.100  14.973  1.00 49.98  ? 1087 TYR A CB    1 
ATOM   3164  C  CG    . TYR A 1 439 ? -32.758 12.424  14.653  1.00 54.25  ? 1087 TYR A CG    1 
ATOM   3165  C  CD1   . TYR A 1 439 ? -31.901 12.002  15.666  1.00 53.63  ? 1087 TYR A CD1   1 
ATOM   3166  C  CD2   . TYR A 1 439 ? -32.353 12.235  13.335  1.00 55.73  ? 1087 TYR A CD2   1 
ATOM   3167  C  CE1   . TYR A 1 439 ? -30.678 11.410  15.374  1.00 53.70  ? 1087 TYR A CE1   1 
ATOM   3168  C  CE2   . TYR A 1 439 ? -31.135 11.637  13.035  1.00 54.16  ? 1087 TYR A CE2   1 
ATOM   3169  C  CZ    . TYR A 1 439 ? -30.305 11.228  14.058  1.00 53.92  ? 1087 TYR A CZ    1 
ATOM   3170  O  OH    . TYR A 1 439 ? -29.100 10.639  13.759  1.00 52.82  ? 1087 TYR A OH    1 
ATOM   3171  N  N     . PHE A 1 440 ? -32.754 14.708  17.318  1.00 56.70  ? 1088 PHE A N     1 
ATOM   3172  C  CA    . PHE A 1 440 ? -31.608 14.882  18.207  1.00 59.00  ? 1088 PHE A CA    1 
ATOM   3173  C  C     . PHE A 1 440 ? -31.532 13.715  19.198  1.00 60.71  ? 1088 PHE A C     1 
ATOM   3174  O  O     . PHE A 1 440 ? -32.561 13.187  19.632  1.00 59.77  ? 1088 PHE A O     1 
ATOM   3175  C  CB    . PHE A 1 440 ? -31.704 16.214  18.958  1.00 61.55  ? 1088 PHE A CB    1 
ATOM   3176  C  CG    . PHE A 1 440 ? -32.883 16.298  19.892  1.00 65.80  ? 1088 PHE A CG    1 
ATOM   3177  C  CD1   . PHE A 1 440 ? -32.786 15.847  21.199  1.00 67.51  ? 1088 PHE A CD1   1 
ATOM   3178  C  CD2   . PHE A 1 440 ? -34.095 16.812  19.457  1.00 63.12  ? 1088 PHE A CD2   1 
ATOM   3179  C  CE1   . PHE A 1 440 ? -33.874 15.909  22.052  1.00 68.39  ? 1088 PHE A CE1   1 
ATOM   3180  C  CE2   . PHE A 1 440 ? -35.184 16.879  20.309  1.00 64.82  ? 1088 PHE A CE2   1 
ATOM   3181  C  CZ    . PHE A 1 440 ? -35.073 16.425  21.607  1.00 67.53  ? 1088 PHE A CZ    1 
ATOM   3182  N  N     . LEU A 1 441 ? -30.312 13.315  19.546  1.00 60.30  ? 1089 LEU A N     1 
ATOM   3183  C  CA    . LEU A 1 441 ? -30.100 12.211  20.478  1.00 64.67  ? 1089 LEU A CA    1 
ATOM   3184  C  C     . LEU A 1 441 ? -29.527 12.707  21.792  1.00 65.76  ? 1089 LEU A C     1 
ATOM   3185  O  O     . LEU A 1 441 ? -30.011 12.353  22.864  1.00 65.61  ? 1089 LEU A O     1 
ATOM   3186  C  CB    . LEU A 1 441 ? -29.138 11.178  19.888  1.00 63.60  ? 1089 LEU A CB    1 
ATOM   3187  C  CG    . LEU A 1 441 ? -29.648 10.208  18.824  1.00 60.03  ? 1089 LEU A CG    1 
ATOM   3188  C  CD1   . LEU A 1 441 ? -28.540 9.239   18.459  1.00 57.52  ? 1089 LEU A CD1   1 
ATOM   3189  C  CD2   . LEU A 1 441 ? -30.889 9.470   19.305  1.00 59.45  ? 1089 LEU A CD2   1 
ATOM   3190  N  N     . GLU A 1 442 ? -28.477 13.513  21.688  1.00 67.84  ? 1090 GLU A N     1 
ATOM   3191  C  CA    . GLU A 1 442 ? -27.775 14.052  22.843  1.00 69.84  ? 1090 GLU A CA    1 
ATOM   3192  C  C     . GLU A 1 442 ? -28.040 15.551  22.979  1.00 71.70  ? 1090 GLU A C     1 
ATOM   3193  O  O     . GLU A 1 442 ? -28.764 16.139  22.176  1.00 71.85  ? 1090 GLU A O     1 
ATOM   3194  C  CB    . GLU A 1 442 ? -26.271 13.807  22.697  1.00 70.01  ? 1090 GLU A CB    1 
ATOM   3195  C  CG    . GLU A 1 442 ? -25.897 12.361  22.376  1.00 71.91  ? 1090 GLU A CG    1 
ATOM   3196  C  CD    . GLU A 1 442 ? -24.416 12.193  22.051  1.00 75.16  ? 1090 GLU A CD    1 
ATOM   3197  O  OE1   . GLU A 1 442 ? -23.571 12.566  22.891  1.00 74.49  ? 1090 GLU A OE1   1 
ATOM   3198  O  OE2   . GLU A 1 442 ? -24.094 11.698  20.949  1.00 74.87  ? 1090 GLU A OE2   1 
ATOM   3199  N  N     . ALA A 1 443 ? -27.455 16.165  24.003  1.00 71.39  ? 1091 ALA A N     1 
ATOM   3200  C  CA    . ALA A 1 443 ? -27.488 17.614  24.151  1.00 67.03  ? 1091 ALA A CA    1 
ATOM   3201  C  C     . ALA A 1 443 ? -26.063 18.128  24.310  1.00 68.35  ? 1091 ALA A C     1 
ATOM   3202  O  O     . ALA A 1 443 ? -25.161 17.367  24.654  1.00 72.65  ? 1091 ALA A O     1 
ATOM   3203  C  CB    . ALA A 1 443 ? -28.330 18.008  25.336  1.00 69.75  ? 1091 ALA A CB    1 
ATOM   3204  N  N     . TYR A 1 444 ? -25.857 19.414  24.060  1.00 64.85  ? 1092 TYR A N     1 
ATOM   3205  C  CA    . TYR A 1 444 ? -24.510 19.974  24.059  1.00 66.89  ? 1092 TYR A CA    1 
ATOM   3206  C  C     . TYR A 1 444 ? -24.301 21.026  25.154  1.00 74.16  ? 1092 TYR A C     1 
ATOM   3207  O  O     . TYR A 1 444 ? -25.206 21.797  25.492  1.00 75.66  ? 1092 TYR A O     1 
ATOM   3208  C  CB    . TYR A 1 444 ? -24.188 20.554  22.681  1.00 66.14  ? 1092 TYR A CB    1 
ATOM   3209  C  CG    . TYR A 1 444 ? -22.751 20.985  22.492  1.00 66.43  ? 1092 TYR A CG    1 
ATOM   3210  C  CD1   . TYR A 1 444 ? -21.703 20.150  22.848  1.00 67.86  ? 1092 TYR A CD1   1 
ATOM   3211  C  CD2   . TYR A 1 444 ? -22.443 22.218  21.932  1.00 65.53  ? 1092 TYR A CD2   1 
ATOM   3212  C  CE1   . TYR A 1 444 ? -20.387 20.537  22.669  1.00 66.18  ? 1092 TYR A CE1   1 
ATOM   3213  C  CE2   . TYR A 1 444 ? -21.131 22.611  21.749  1.00 64.43  ? 1092 TYR A CE2   1 
ATOM   3214  C  CZ    . TYR A 1 444 ? -20.110 21.765  22.120  1.00 62.85  ? 1092 TYR A CZ    1 
ATOM   3215  O  OH    . TYR A 1 444 ? -18.809 22.149  21.941  1.00 60.05  ? 1092 TYR A OH    1 
ATOM   3216  N  N     . ASN A 1 445 ? -23.096 21.043  25.710  1.00 71.42  ? 1093 ASN A N     1 
ATOM   3217  C  CA    . ASN A 1 445 ? -22.736 21.997  26.743  1.00 73.17  ? 1093 ASN A CA    1 
ATOM   3218  C  C     . ASN A 1 445 ? -21.606 22.854  26.210  1.00 72.98  ? 1093 ASN A C     1 
ATOM   3219  O  O     . ASN A 1 445 ? -20.455 22.431  26.230  1.00 73.14  ? 1093 ASN A O     1 
ATOM   3220  C  CB    . ASN A 1 445 ? -22.282 21.243  27.997  1.00 77.97  ? 1093 ASN A CB    1 
ATOM   3221  C  CG    . ASN A 1 445 ? -22.085 22.153  29.205  1.00 79.07  ? 1093 ASN A CG    1 
ATOM   3222  O  OD1   . ASN A 1 445 ? -21.800 23.349  29.076  1.00 74.04  ? 1093 ASN A OD1   1 
ATOM   3223  N  ND2   . ASN A 1 445 ? -22.228 21.576  30.393  1.00 77.89  ? 1093 ASN A ND2   1 
ATOM   3224  N  N     . SER A 1 446 ? -21.925 24.047  25.717  1.00 70.99  ? 1094 SER A N     1 
ATOM   3225  C  CA    . SER A 1 446 ? -20.900 24.908  25.122  1.00 74.06  ? 1094 SER A CA    1 
ATOM   3226  C  C     . SER A 1 446 ? -19.845 25.302  26.151  1.00 77.52  ? 1094 SER A C     1 
ATOM   3227  O  O     . SER A 1 446 ? -18.767 25.787  25.802  1.00 74.30  ? 1094 SER A O     1 
ATOM   3228  C  CB    . SER A 1 446 ? -21.520 26.163  24.501  1.00 77.49  ? 1094 SER A CB    1 
ATOM   3229  O  OG    . SER A 1 446 ? -21.935 27.084  25.499  1.00 82.00  ? 1094 SER A OG    1 
ATOM   3230  N  N     . LYS A 1 447 ? -20.177 25.085  27.424  1.00 82.12  ? 1095 LYS A N     1 
ATOM   3231  C  CA    . LYS A 1 447 ? -19.296 25.411  28.544  1.00 82.50  ? 1095 LYS A CA    1 
ATOM   3232  C  C     . LYS A 1 447 ? -18.328 24.265  28.846  1.00 80.93  ? 1095 LYS A C     1 
ATOM   3233  O  O     . LYS A 1 447 ? -17.107 24.407  28.691  1.00 79.08  ? 1095 LYS A O     1 
ATOM   3234  C  CB    . LYS A 1 447 ? -20.124 25.741  29.788  1.00 78.04  ? 1095 LYS A CB    1 
ATOM   3235  N  N     . THR A 1 448 ? -18.881 23.134  29.280  1.00 76.27  ? 1096 THR A N     1 
ATOM   3236  C  CA    . THR A 1 448 ? -18.079 21.950  29.567  1.00 79.23  ? 1096 THR A CA    1 
ATOM   3237  C  C     . THR A 1 448 ? -17.739 21.182  28.290  1.00 82.57  ? 1096 THR A C     1 
ATOM   3238  O  O     . THR A 1 448 ? -17.121 20.112  28.343  1.00 84.05  ? 1096 THR A O     1 
ATOM   3239  C  CB    . THR A 1 448 ? -18.794 20.993  30.552  1.00 79.50  ? 1096 THR A CB    1 
ATOM   3240  O  OG1   . THR A 1 448 ? -19.857 20.297  29.884  1.00 76.16  ? 1096 THR A OG1   1 
ATOM   3241  C  CG2   . THR A 1 448 ? -19.349 21.763  31.740  1.00 80.99  ? 1096 THR A CG2   1 
ATOM   3242  N  N     . LYS A 1 449 ? -18.148 21.731  27.147  1.00 79.60  ? 1097 LYS A N     1 
ATOM   3243  C  CA    . LYS A 1 449 ? -17.944 21.084  25.854  1.00 76.53  ? 1097 LYS A CA    1 
ATOM   3244  C  C     . LYS A 1 449 ? -18.209 19.582  25.926  1.00 75.15  ? 1097 LYS A C     1 
ATOM   3245  O  O     . LYS A 1 449 ? -17.518 18.789  25.291  1.00 75.88  ? 1097 LYS A O     1 
ATOM   3246  C  CB    . LYS A 1 449 ? -16.530 21.350  25.332  1.00 73.60  ? 1097 LYS A CB    1 
ATOM   3247  C  CG    . LYS A 1 449 ? -16.243 22.810  25.040  1.00 72.99  ? 1097 LYS A CG    1 
ATOM   3248  C  CD    . LYS A 1 449 ? -14.861 22.978  24.440  1.00 72.30  ? 1097 LYS A CD    1 
ATOM   3249  C  CE    . LYS A 1 449 ? -14.525 24.441  24.216  1.00 73.14  ? 1097 LYS A CE    1 
ATOM   3250  N  NZ    . LYS A 1 449 ? -13.134 24.604  23.697  1.00 76.03  ? 1097 LYS A NZ    1 
ATOM   3251  N  N     . ASN A 1 450 ? -19.210 19.192  26.705  1.00 72.79  ? 1098 ASN A N     1 
ATOM   3252  C  CA    . ASN A 1 450 ? -19.537 17.782  26.832  1.00 78.93  ? 1098 ASN A CA    1 
ATOM   3253  C  C     . ASN A 1 450 ? -20.854 17.446  26.141  1.00 75.73  ? 1098 ASN A C     1 
ATOM   3254  O  O     . ASN A 1 450 ? -21.508 18.318  25.572  1.00 73.19  ? 1098 ASN A O     1 
ATOM   3255  C  CB    . ASN A 1 450 ? -19.566 17.355  28.306  1.00 85.55  ? 1098 ASN A CB    1 
ATOM   3256  C  CG    . ASN A 1 450 ? -19.287 15.859  28.495  1.00 90.79  ? 1098 ASN A CG    1 
ATOM   3257  O  OD1   . ASN A 1 450 ? -19.361 15.072  27.545  1.00 86.26  ? 1098 ASN A OD1   1 
ATOM   3258  N  ND2   . ASN A 1 450 ? -18.965 15.466  29.727  1.00 98.10  ? 1098 ASN A ND2   1 
ATOM   3259  N  N     . PHE A 1 451 ? -21.237 16.176  26.199  1.00 74.73  ? 1099 PHE A N     1 
ATOM   3260  C  CA    . PHE A 1 451 ? -22.412 15.704  25.490  1.00 75.21  ? 1099 PHE A CA    1 
ATOM   3261  C  C     . PHE A 1 451 ? -23.313 14.858  26.369  1.00 74.90  ? 1099 PHE A C     1 
ATOM   3262  O  O     . PHE A 1 451 ? -23.452 13.656  26.150  1.00 76.72  ? 1099 PHE A O     1 
ATOM   3263  C  CB    . PHE A 1 451 ? -21.999 14.897  24.252  1.00 77.96  ? 1099 PHE A CB    1 
ATOM   3264  C  CG    . PHE A 1 451 ? -21.708 15.743  23.048  1.00 73.13  ? 1099 PHE A CG    1 
ATOM   3265  C  CD1   . PHE A 1 451 ? -22.723 16.085  22.173  1.00 70.59  ? 1099 PHE A CD1   1 
ATOM   3266  C  CD2   . PHE A 1 451 ? -20.425 16.200  22.796  1.00 73.31  ? 1099 PHE A CD2   1 
ATOM   3267  C  CE1   . PHE A 1 451 ? -22.467 16.867  21.070  1.00 69.16  ? 1099 PHE A CE1   1 
ATOM   3268  C  CE2   . PHE A 1 451 ? -20.160 16.983  21.690  1.00 69.99  ? 1099 PHE A CE2   1 
ATOM   3269  C  CZ    . PHE A 1 451 ? -21.185 17.316  20.826  1.00 69.94  ? 1099 PHE A CZ    1 
ATOM   3270  N  N     . GLU A 1 452 ? -23.928 15.480  27.366  1.00 78.20  ? 1100 GLU A N     1 
ATOM   3271  C  CA    . GLU A 1 452 ? -24.940 14.784  28.150  1.00 82.77  ? 1100 GLU A CA    1 
ATOM   3272  C  C     . GLU A 1 452 ? -26.122 14.505  27.230  1.00 76.94  ? 1100 GLU A C     1 
ATOM   3273  O  O     . GLU A 1 452 ? -26.109 14.905  26.067  1.00 73.05  ? 1100 GLU A O     1 
ATOM   3274  C  CB    . GLU A 1 452 ? -25.384 15.626  29.352  1.00 81.98  ? 1100 GLU A CB    1 
ATOM   3275  C  CG    . GLU A 1 452 ? -26.105 16.920  28.977  1.00 82.47  ? 1100 GLU A CG    1 
ATOM   3276  C  CD    . GLU A 1 452 ? -26.956 17.469  30.111  1.00 90.50  ? 1100 GLU A CD    1 
ATOM   3277  O  OE1   . GLU A 1 452 ? -26.910 16.889  31.222  1.00 91.50  ? 1100 GLU A OE1   1 
ATOM   3278  O  OE2   . GLU A 1 452 ? -27.674 18.474  29.887  1.00 88.66  ? 1100 GLU A OE2   1 
ATOM   3279  N  N     . ASP A 1 453 ? -27.141 13.821  27.739  1.00 77.26  ? 1101 ASP A N     1 
ATOM   3280  C  CA    . ASP A 1 453 ? -28.349 13.621  26.948  1.00 77.93  ? 1101 ASP A CA    1 
ATOM   3281  C  C     . ASP A 1 453 ? -29.474 14.582  27.344  1.00 78.67  ? 1101 ASP A C     1 
ATOM   3282  O  O     . ASP A 1 453 ? -29.475 15.134  28.445  1.00 78.83  ? 1101 ASP A O     1 
ATOM   3283  C  CB    . ASP A 1 453 ? -28.813 12.153  26.971  1.00 81.39  ? 1101 ASP A CB    1 
ATOM   3284  C  CG    . ASP A 1 453 ? -29.184 11.671  28.354  1.00 83.51  ? 1101 ASP A CG    1 
ATOM   3285  O  OD1   . ASP A 1 453 ? -29.462 12.521  29.225  1.00 84.76  ? 1101 ASP A OD1   1 
ATOM   3286  O  OD2   . ASP A 1 453 ? -29.208 10.434  28.561  1.00 84.05  ? 1101 ASP A OD2   1 
ATOM   3287  N  N     . PRO A 1 454 ? -30.417 14.803  26.421  1.00 76.77  ? 1102 PRO A N     1 
ATOM   3288  C  CA    . PRO A 1 454 ? -31.606 15.651  26.528  1.00 79.43  ? 1102 PRO A CA    1 
ATOM   3289  C  C     . PRO A 1 454 ? -32.300 15.683  27.887  1.00 79.75  ? 1102 PRO A C     1 
ATOM   3290  O  O     . PRO A 1 454 ? -32.676 14.638  28.422  1.00 77.35  ? 1102 PRO A O     1 
ATOM   3291  C  CB    . PRO A 1 454 ? -32.530 15.042  25.482  1.00 76.10  ? 1102 PRO A CB    1 
ATOM   3292  C  CG    . PRO A 1 454 ? -31.578 14.670  24.390  1.00 77.21  ? 1102 PRO A CG    1 
ATOM   3293  C  CD    . PRO A 1 454 ? -30.287 14.255  25.061  1.00 74.58  ? 1102 PRO A CD    1 
ATOM   3294  N  N     . PRO A 1 455 ? -32.473 16.899  28.430  1.00 81.81  ? 1103 PRO A N     1 
ATOM   3295  C  CA    . PRO A 1 455 ? -33.265 17.196  29.627  1.00 80.33  ? 1103 PRO A CA    1 
ATOM   3296  C  C     . PRO A 1 455 ? -34.706 16.729  29.471  1.00 80.22  ? 1103 PRO A C     1 
ATOM   3297  O  O     . PRO A 1 455 ? -35.198 16.583  28.356  1.00 80.15  ? 1103 PRO A O     1 
ATOM   3298  C  CB    . PRO A 1 455 ? -33.219 18.722  29.698  1.00 84.32  ? 1103 PRO A CB    1 
ATOM   3299  C  CG    . PRO A 1 455 ? -31.943 19.090  29.013  1.00 81.25  ? 1103 PRO A CG    1 
ATOM   3300  C  CD    . PRO A 1 455 ? -31.809 18.104  27.897  1.00 80.02  ? 1103 PRO A CD    1 
ATOM   3301  N  N     . ASN A 1 456 ? -35.374 16.509  30.595  1.00 84.34  ? 1104 ASN A N     1 
ATOM   3302  C  CA    . ASN A 1 456 ? -36.718 15.947  30.599  1.00 86.03  ? 1104 ASN A CA    1 
ATOM   3303  C  C     . ASN A 1 456 ? -37.762 16.833  29.905  1.00 86.33  ? 1104 ASN A C     1 
ATOM   3304  O  O     . ASN A 1 456 ? -38.845 16.363  29.551  1.00 85.42  ? 1104 ASN A O     1 
ATOM   3305  C  CB    . ASN A 1 456 ? -37.139 15.643  32.040  1.00 87.26  ? 1104 ASN A CB    1 
ATOM   3306  C  CG    . ASN A 1 456 ? -38.439 14.870  32.122  1.00 93.17  ? 1104 ASN A CG    1 
ATOM   3307  O  OD1   . ASN A 1 456 ? -38.857 14.220  31.160  1.00 93.68  ? 1104 ASN A OD1   1 
ATOM   3308  N  ND2   . ASN A 1 456 ? -39.086 14.933  33.283  1.00 94.62  ? 1104 ASN A ND2   1 
ATOM   3309  N  N     . HIS A 1 457 ? -37.432 18.107  29.704  1.00 85.80  ? 1105 HIS A N     1 
ATOM   3310  C  CA    . HIS A 1 457 ? -38.373 19.049  29.094  1.00 84.00  ? 1105 HIS A CA    1 
ATOM   3311  C  C     . HIS A 1 457 ? -38.257 19.127  27.571  1.00 85.17  ? 1105 HIS A C     1 
ATOM   3312  O  O     . HIS A 1 457 ? -39.112 19.714  26.905  1.00 83.85  ? 1105 HIS A O     1 
ATOM   3313  C  CB    . HIS A 1 457 ? -38.223 20.443  29.705  1.00 81.54  ? 1105 HIS A CB    1 
ATOM   3314  C  CG    . HIS A 1 457 ? -36.843 21.013  29.591  1.00 79.48  ? 1105 HIS A CG    1 
ATOM   3315  N  ND1   . HIS A 1 457 ? -36.552 22.097  28.793  1.00 80.15  ? 1105 HIS A ND1   1 
ATOM   3316  C  CD2   . HIS A 1 457 ? -35.680 20.659  30.185  1.00 82.25  ? 1105 HIS A CD2   1 
ATOM   3317  C  CE1   . HIS A 1 457 ? -35.266 22.386  28.897  1.00 79.68  ? 1105 HIS A CE1   1 
ATOM   3318  N  NE2   . HIS A 1 457 ? -34.713 21.530  29.735  1.00 82.12  ? 1105 HIS A NE2   1 
ATOM   3319  N  N     . ALA A 1 458 ? -37.200 18.533  27.025  1.00 84.98  ? 1106 ALA A N     1 
ATOM   3320  C  CA    . ALA A 1 458 ? -37.013 18.479  25.580  1.00 80.94  ? 1106 ALA A CA    1 
ATOM   3321  C  C     . ALA A 1 458 ? -37.894 17.390  24.967  1.00 81.26  ? 1106 ALA A C     1 
ATOM   3322  O  O     . ALA A 1 458 ? -38.406 17.534  23.859  1.00 81.34  ? 1106 ALA A O     1 
ATOM   3323  C  CB    . ALA A 1 458 ? -35.545 18.239  25.245  1.00 76.06  ? 1106 ALA A CB    1 
ATOM   3324  N  N     . ARG A 1 459 ? -38.067 16.302  25.705  1.00 82.23  ? 1107 ARG A N     1 
ATOM   3325  C  CA    . ARG A 1 459 ? -38.894 15.186  25.267  1.00 86.29  ? 1107 ARG A CA    1 
ATOM   3326  C  C     . ARG A 1 459 ? -40.376 15.554  25.375  1.00 88.63  ? 1107 ARG A C     1 
ATOM   3327  O  O     . ARG A 1 459 ? -40.716 16.584  25.952  1.00 90.47  ? 1107 ARG A O     1 
ATOM   3328  C  CB    . ARG A 1 459 ? -38.555 13.956  26.126  1.00 89.98  ? 1107 ARG A CB    1 
ATOM   3329  C  CG    . ARG A 1 459 ? -39.650 12.904  26.266  1.00 98.36  ? 1107 ARG A CG    1 
ATOM   3330  C  CD    . ARG A 1 459 ? -39.870 12.527  27.734  1.00 102.30 ? 1107 ARG A CD    1 
ATOM   3331  N  NE    . ARG A 1 459 ? -39.645 11.105  28.000  1.00 111.10 ? 1107 ARG A NE    1 
ATOM   3332  C  CZ    . ARG A 1 459 ? -39.805 10.527  29.190  1.00 113.67 ? 1107 ARG A CZ    1 
ATOM   3333  N  NH1   . ARG A 1 459 ? -40.198 11.246  30.238  1.00 109.87 ? 1107 ARG A NH1   1 
ATOM   3334  N  NH2   . ARG A 1 459 ? -39.573 9.225   29.335  1.00 111.99 ? 1107 ARG A NH2   1 
ATOM   3335  N  N     . SER A 1 460 ? -41.251 14.739  24.788  1.00 91.74  ? 1108 SER A N     1 
ATOM   3336  C  CA    . SER A 1 460 ? -42.680 14.791  25.099  1.00 99.07  ? 1108 SER A CA    1 
ATOM   3337  C  C     . SER A 1 460 ? -42.958 13.709  26.142  1.00 108.33 ? 1108 SER A C     1 
ATOM   3338  O  O     . SER A 1 460 ? -42.895 12.515  25.821  1.00 106.44 ? 1108 SER A O     1 
ATOM   3339  C  CB    . SER A 1 460 ? -43.534 14.526  23.857  1.00 94.46  ? 1108 SER A CB    1 
ATOM   3340  O  OG    . SER A 1 460 ? -43.158 15.357  22.775  1.00 95.16  ? 1108 SER A OG    1 
ATOM   3341  N  N     . PRO A 1 461 ? -43.262 14.115  27.393  1.00 112.27 ? 1109 PRO A N     1 
ATOM   3342  C  CA    . PRO A 1 461 ? -43.395 13.154  28.499  1.00 113.24 ? 1109 PRO A CA    1 
ATOM   3343  C  C     . PRO A 1 461 ? -44.097 11.855  28.088  1.00 115.20 ? 1109 PRO A C     1 
ATOM   3344  O  O     . PRO A 1 461 ? -45.282 11.879  27.747  1.00 113.85 ? 1109 PRO A O     1 
ATOM   3345  C  CB    . PRO A 1 461 ? -44.227 13.928  29.524  1.00 110.10 ? 1109 PRO A CB    1 
ATOM   3346  C  CG    . PRO A 1 461 ? -43.801 15.348  29.319  1.00 108.32 ? 1109 PRO A CG    1 
ATOM   3347  C  CD    . PRO A 1 461 ? -43.569 15.493  27.825  1.00 107.19 ? 1109 PRO A CD    1 
ATOM   3348  N  N     . GLY A 1 462 ? -43.357 10.746  28.111  1.00 115.68 ? 1110 GLY A N     1 
ATOM   3349  C  CA    . GLY A 1 462 ? -43.890 9.441   27.755  1.00 117.82 ? 1110 GLY A CA    1 
ATOM   3350  C  C     . GLY A 1 462 ? -43.357 8.321   28.638  1.00 123.85 ? 1110 GLY A C     1 
ATOM   3351  O  O     . GLY A 1 462 ? -42.739 8.577   29.675  1.00 124.44 ? 1110 GLY A O     1 
ATOM   3352  N  N     . ASN A 1 463 ? -43.596 7.076   28.221  1.00 125.37 ? 1111 ASN A N     1 
ATOM   3353  C  CA    . ASN A 1 463 ? -43.166 5.890   28.969  1.00 121.52 ? 1111 ASN A CA    1 
ATOM   3354  C  C     . ASN A 1 463 ? -41.649 5.682   28.954  1.00 123.79 ? 1111 ASN A C     1 
ATOM   3355  O  O     . ASN A 1 463 ? -41.001 5.831   27.915  1.00 121.68 ? 1111 ASN A O     1 
ATOM   3356  C  CB    . ASN A 1 463 ? -43.874 4.641   28.447  1.00 116.42 ? 1111 ASN A CB    1 
ATOM   3357  N  N     . LYS A 1 464 ? -41.095 5.328   30.113  1.00 125.02 ? 1112 LYS A N     1 
ATOM   3358  C  CA    . LYS A 1 464 ? -39.649 5.163   30.267  1.00 122.71 ? 1112 LYS A CA    1 
ATOM   3359  C  C     . LYS A 1 464 ? -39.083 4.077   29.347  1.00 122.69 ? 1112 LYS A C     1 
ATOM   3360  O  O     . LYS A 1 464 ? -39.794 3.156   28.933  1.00 123.19 ? 1112 LYS A O     1 
ATOM   3361  C  CB    . LYS A 1 464 ? -39.288 4.878   31.730  1.00 115.99 ? 1112 LYS A CB    1 
ATOM   3362  N  N     . GLY A 1 465 ? -37.798 4.198   29.028  1.00 119.27 ? 1113 GLY A N     1 
ATOM   3363  C  CA    . GLY A 1 465 ? -37.140 3.252   28.147  1.00 116.22 ? 1113 GLY A CA    1 
ATOM   3364  C  C     . GLY A 1 465 ? -36.359 3.948   27.050  1.00 114.84 ? 1113 GLY A C     1 
ATOM   3365  O  O     . GLY A 1 465 ? -36.528 5.147   26.804  1.00 111.35 ? 1113 GLY A O     1 
ATOM   3366  N  N     . LYS A 1 466 ? -35.490 3.188   26.393  1.00 113.02 ? 1114 LYS A N     1 
ATOM   3367  C  CA    . LYS A 1 466 ? -34.693 3.704   25.290  1.00 106.57 ? 1114 LYS A CA    1 
ATOM   3368  C  C     . LYS A 1 466 ? -34.884 2.798   24.072  1.00 107.95 ? 1114 LYS A C     1 
ATOM   3369  O  O     . LYS A 1 466 ? -34.820 1.570   24.186  1.00 109.72 ? 1114 LYS A O     1 
ATOM   3370  C  CB    . LYS A 1 466 ? -33.214 3.797   25.691  1.00 102.70 ? 1114 LYS A CB    1 
ATOM   3371  C  CG    . LYS A 1 466 ? -32.955 4.686   26.910  1.00 99.83  ? 1114 LYS A CG    1 
ATOM   3372  C  CD    . LYS A 1 466 ? -32.346 6.036   26.535  1.00 93.63  ? 1114 LYS A CD    1 
ATOM   3373  C  CE    . LYS A 1 466 ? -32.609 7.073   27.623  1.00 92.35  ? 1114 LYS A CE    1 
ATOM   3374  N  NZ    . LYS A 1 466 ? -31.482 8.029   27.822  1.00 88.98  ? 1114 LYS A NZ    1 
ATOM   3375  N  N     . GLY A 1 467 ? -35.135 3.408   22.916  1.00 104.09 ? 1115 GLY A N     1 
ATOM   3376  C  CA    . GLY A 1 467 ? -35.369 2.671   21.685  1.00 106.59 ? 1115 GLY A CA    1 
ATOM   3377  C  C     . GLY A 1 467 ? -34.495 1.440   21.510  1.00 107.69 ? 1115 GLY A C     1 
ATOM   3378  O  O     . GLY A 1 467 ? -33.314 1.439   21.864  1.00 105.35 ? 1115 GLY A O     1 
ATOM   3379  N  N     . LEU A 1 491 ? -52.153 6.171   -3.466  1.00 65.68  ? 1139 LEU A N     1 
ATOM   3380  C  CA    . LEU A 1 491 ? -51.854 7.134   -4.529  1.00 71.72  ? 1139 LEU A CA    1 
ATOM   3381  C  C     . LEU A 1 491 ? -51.463 6.460   -5.853  1.00 72.50  ? 1139 LEU A C     1 
ATOM   3382  O  O     . LEU A 1 491 ? -50.423 5.792   -5.941  1.00 65.39  ? 1139 LEU A O     1 
ATOM   3383  C  CB    . LEU A 1 491 ? -50.762 8.114   -4.090  1.00 66.60  ? 1139 LEU A CB    1 
ATOM   3384  N  N     . PRO A 1 492 ? -52.305 6.639   -6.889  1.00 70.99  ? 1140 PRO A N     1 
ATOM   3385  C  CA    . PRO A 1 492 ? -52.076 6.090   -8.229  1.00 63.33  ? 1140 PRO A CA    1 
ATOM   3386  C  C     . PRO A 1 492 ? -50.861 6.726   -8.881  1.00 61.77  ? 1140 PRO A C     1 
ATOM   3387  O  O     . PRO A 1 492 ? -50.607 7.923   -8.704  1.00 57.72  ? 1140 PRO A O     1 
ATOM   3388  C  CB    . PRO A 1 492 ? -53.335 6.501   -9.004  1.00 61.36  ? 1140 PRO A CB    1 
ATOM   3389  C  CG    . PRO A 1 492 ? -54.354 6.804   -7.968  1.00 67.43  ? 1140 PRO A CG    1 
ATOM   3390  C  CD    . PRO A 1 492 ? -53.579 7.372   -6.815  1.00 70.67  ? 1140 PRO A CD    1 
ATOM   3391  N  N     . LYS A 1 493 ? -50.119 5.925   -9.637  1.00 57.23  ? 1141 LYS A N     1 
ATOM   3392  C  CA    . LYS A 1 493 ? -48.977 6.434   -10.375 1.00 48.13  ? 1141 LYS A CA    1 
ATOM   3393  C  C     . LYS A 1 493 ? -49.367 6.793   -11.805 1.00 44.42  ? 1141 LYS A C     1 
ATOM   3394  O  O     . LYS A 1 493 ? -50.249 6.174   -12.403 1.00 41.86  ? 1141 LYS A O     1 
ATOM   3395  C  CB    . LYS A 1 493 ? -47.842 5.412   -10.376 1.00 45.56  ? 1141 LYS A CB    1 
ATOM   3396  C  CG    . LYS A 1 493 ? -47.278 5.089   -9.005  1.00 44.95  ? 1141 LYS A CG    1 
ATOM   3397  C  CD    . LYS A 1 493 ? -46.035 4.244   -9.148  1.00 43.97  ? 1141 LYS A CD    1 
ATOM   3398  C  CE    . LYS A 1 493 ? -45.629 3.606   -7.838  1.00 48.02  ? 1141 LYS A CE    1 
ATOM   3399  N  NZ    . LYS A 1 493 ? -44.395 2.772   -7.995  1.00 51.87  ? 1141 LYS A NZ    1 
ATOM   3400  N  N     . LEU A 1 494 ? -48.706 7.807   -12.347 1.00 41.70  ? 1142 LEU A N     1 
ATOM   3401  C  CA    . LEU A 1 494 ? -48.914 8.188   -13.732 1.00 40.73  ? 1142 LEU A CA    1 
ATOM   3402  C  C     . LEU A 1 494 ? -48.131 7.286   -14.693 1.00 40.20  ? 1142 LEU A C     1 
ATOM   3403  O  O     . LEU A 1 494 ? -46.908 7.142   -14.586 1.00 38.55  ? 1142 LEU A O     1 
ATOM   3404  C  CB    . LEU A 1 494 ? -48.512 9.644   -13.922 1.00 39.46  ? 1142 LEU A CB    1 
ATOM   3405  C  CG    . LEU A 1 494 ? -49.292 10.602  -13.027 1.00 40.49  ? 1142 LEU A CG    1 
ATOM   3406  C  CD1   . LEU A 1 494 ? -48.641 11.965  -12.991 1.00 42.75  ? 1142 LEU A CD1   1 
ATOM   3407  C  CD2   . LEU A 1 494 ? -50.725 10.710  -13.505 1.00 41.16  ? 1142 LEU A CD2   1 
ATOM   3408  N  N     . ARG A 1 495 ? -48.838 6.662   -15.625 1.00 37.63  ? 1143 ARG A N     1 
ATOM   3409  C  CA    . ARG A 1 495 ? -48.159 5.929   -16.673 1.00 37.09  ? 1143 ARG A CA    1 
ATOM   3410  C  C     . ARG A 1 495 ? -47.304 6.930   -17.438 1.00 36.36  ? 1143 ARG A C     1 
ATOM   3411  O  O     . ARG A 1 495 ? -47.839 7.809   -18.112 1.00 34.33  ? 1143 ARG A O     1 
ATOM   3412  C  CB    . ARG A 1 495 ? -49.170 5.275   -17.604 1.00 33.47  ? 1143 ARG A CB    1 
ATOM   3413  C  CG    . ARG A 1 495 ? -50.252 4.527   -16.880 1.00 32.93  ? 1143 ARG A CG    1 
ATOM   3414  C  CD    . ARG A 1 495 ? -51.124 3.752   -17.844 1.00 34.65  ? 1143 ARG A CD    1 
ATOM   3415  N  NE    . ARG A 1 495 ? -52.106 4.587   -18.524 1.00 34.66  ? 1143 ARG A NE    1 
ATOM   3416  C  CZ    . ARG A 1 495 ? -53.239 4.993   -17.966 1.00 35.20  ? 1143 ARG A CZ    1 
ATOM   3417  N  NH1   . ARG A 1 495 ? -53.520 4.653   -16.714 1.00 33.14  ? 1143 ARG A NH1   1 
ATOM   3418  N  NH2   . ARG A 1 495 ? -54.084 5.744   -18.654 1.00 34.93  ? 1143 ARG A NH2   1 
ATOM   3419  N  N     . THR A 1 496 ? -45.982 6.803   -17.322 1.00 36.53  ? 1144 THR A N     1 
ATOM   3420  C  CA    . THR A 1 496 ? -45.067 7.753   -17.952 1.00 35.98  ? 1144 THR A CA    1 
ATOM   3421  C  C     . THR A 1 496 ? -44.431 7.236   -19.239 1.00 33.79  ? 1144 THR A C     1 
ATOM   3422  O  O     . THR A 1 496 ? -44.050 6.079   -19.332 1.00 34.29  ? 1144 THR A O     1 
ATOM   3423  C  CB    . THR A 1 496 ? -43.924 8.149   -17.011 1.00 36.98  ? 1144 THR A CB    1 
ATOM   3424  O  OG1   . THR A 1 496 ? -44.454 8.732   -15.816 1.00 39.29  ? 1144 THR A OG1   1 
ATOM   3425  C  CG2   . THR A 1 496 ? -43.025 9.150   -17.692 1.00 35.40  ? 1144 THR A CG2   1 
ATOM   3426  N  N     . LEU A 1 497 ? -44.320 8.110   -20.230 1.00 33.35  ? 1145 LEU A N     1 
ATOM   3427  C  CA    . LEU A 1 497 ? -43.541 7.825   -21.423 1.00 32.30  ? 1145 LEU A CA    1 
ATOM   3428  C  C     . LEU A 1 497 ? -42.298 8.707   -21.405 1.00 32.64  ? 1145 LEU A C     1 
ATOM   3429  O  O     . LEU A 1 497 ? -42.392 9.921   -21.525 1.00 34.75  ? 1145 LEU A O     1 
ATOM   3430  C  CB    . LEU A 1 497 ? -44.365 8.111   -22.670 1.00 32.08  ? 1145 LEU A CB    1 
ATOM   3431  C  CG    . LEU A 1 497 ? -43.592 8.323   -23.971 1.00 33.16  ? 1145 LEU A CG    1 
ATOM   3432  C  CD1   . LEU A 1 497 ? -42.713 7.120   -24.309 1.00 33.03  ? 1145 LEU A CD1   1 
ATOM   3433  C  CD2   . LEU A 1 497 ? -44.575 8.610   -25.084 1.00 32.16  ? 1145 LEU A CD2   1 
ATOM   3434  N  N     . ASP A 1 498 ? -41.135 8.096   -21.245 1.00 31.03  ? 1146 ASP A N     1 
ATOM   3435  C  CA    . ASP A 1 498 ? -39.903 8.843   -21.127 1.00 30.43  ? 1146 ASP A CA    1 
ATOM   3436  C  C     . ASP A 1 498 ? -39.127 8.860   -22.437 1.00 34.48  ? 1146 ASP A C     1 
ATOM   3437  O  O     . ASP A 1 498 ? -38.553 7.853   -22.834 1.00 35.28  ? 1146 ASP A O     1 
ATOM   3438  C  CB    . ASP A 1 498 ? -39.041 8.238   -20.038 1.00 33.06  ? 1146 ASP A CB    1 
ATOM   3439  C  CG    . ASP A 1 498 ? -37.785 9.035   -19.796 1.00 40.53  ? 1146 ASP A CG    1 
ATOM   3440  O  OD1   . ASP A 1 498 ? -37.484 9.919   -20.630 1.00 40.80  ? 1146 ASP A OD1   1 
ATOM   3441  O  OD2   . ASP A 1 498 ? -37.097 8.784   -18.777 1.00 43.08  ? 1146 ASP A OD2   1 
ATOM   3442  N  N     . VAL A 1 499 ? -39.093 10.020  -23.087 1.00 34.12  ? 1147 VAL A N     1 
ATOM   3443  C  CA    . VAL A 1 499 ? -38.452 10.177  -24.389 1.00 34.62  ? 1147 VAL A CA    1 
ATOM   3444  C  C     . VAL A 1 499 ? -37.022 10.686  -24.264 1.00 37.13  ? 1147 VAL A C     1 
ATOM   3445  O  O     . VAL A 1 499 ? -36.723 11.516  -23.411 1.00 38.67  ? 1147 VAL A O     1 
ATOM   3446  C  CB    . VAL A 1 499 ? -39.240 11.148  -25.245 1.00 34.16  ? 1147 VAL A CB    1 
ATOM   3447  C  CG1   . VAL A 1 499 ? -38.788 11.070  -26.685 1.00 33.01  ? 1147 VAL A CG1   1 
ATOM   3448  C  CG2   . VAL A 1 499 ? -40.716 10.840  -25.111 1.00 36.57  ? 1147 VAL A CG2   1 
ATOM   3449  N  N     . PHE A 1 500 ? -36.140 10.202  -25.131 1.00 38.67  ? 1148 PHE A N     1 
ATOM   3450  C  CA    . PHE A 1 500 ? -34.716 10.446  -24.965 1.00 39.58  ? 1148 PHE A CA    1 
ATOM   3451  C  C     . PHE A 1 500 ? -34.406 10.130  -23.518 1.00 39.06  ? 1148 PHE A C     1 
ATOM   3452  O  O     . PHE A 1 500 ? -33.944 10.985  -22.767 1.00 39.67  ? 1148 PHE A O     1 
ATOM   3453  C  CB    . PHE A 1 500 ? -34.374 11.899  -25.264 1.00 39.42  ? 1148 PHE A CB    1 
ATOM   3454  C  CG    . PHE A 1 500 ? -35.153 12.478  -26.400 1.00 40.58  ? 1148 PHE A CG    1 
ATOM   3455  C  CD1   . PHE A 1 500 ? -34.880 12.104  -27.704 1.00 42.99  ? 1148 PHE A CD1   1 
ATOM   3456  C  CD2   . PHE A 1 500 ? -36.161 13.400  -26.167 1.00 39.60  ? 1148 PHE A CD2   1 
ATOM   3457  C  CE1   . PHE A 1 500 ? -35.598 12.635  -28.758 1.00 43.59  ? 1148 PHE A CE1   1 
ATOM   3458  C  CE2   . PHE A 1 500 ? -36.879 13.941  -27.216 1.00 39.88  ? 1148 PHE A CE2   1 
ATOM   3459  C  CZ    . PHE A 1 500 ? -36.598 13.557  -28.514 1.00 41.86  ? 1148 PHE A CZ    1 
ATOM   3460  N  N     . SER A 1 501 ? -34.687 8.893   -23.131 1.00 36.04  ? 1149 SER A N     1 
ATOM   3461  C  CA    . SER A 1 501 ? -34.666 8.522   -21.732 1.00 35.98  ? 1149 SER A CA    1 
ATOM   3462  C  C     . SER A 1 501 ? -33.246 8.388   -21.214 1.00 34.85  ? 1149 SER A C     1 
ATOM   3463  O  O     . SER A 1 501 ? -32.984 8.601   -20.035 1.00 36.08  ? 1149 SER A O     1 
ATOM   3464  C  CB    . SER A 1 501 ? -35.466 7.226   -21.499 1.00 36.48  ? 1149 SER A CB    1 
ATOM   3465  O  OG    . SER A 1 501 ? -34.830 6.090   -22.068 1.00 35.10  ? 1149 SER A OG    1 
ATOM   3466  N  N     . GLY A 1 502 ? -32.320 8.046   -22.091 1.00 31.83  ? 1150 GLY A N     1 
ATOM   3467  C  CA    . GLY A 1 502 ? -30.992 7.720   -21.626 1.00 34.32  ? 1150 GLY A CA    1 
ATOM   3468  C  C     . GLY A 1 502 ? -31.090 6.507   -20.731 1.00 31.31  ? 1150 GLY A C     1 
ATOM   3469  O  O     . GLY A 1 502 ? -32.031 5.738   -20.848 1.00 32.47  ? 1150 GLY A O     1 
ATOM   3470  N  N     . CYS A 1 503 ? -30.126 6.339   -19.835 1.00 32.00  ? 1151 CYS A N     1 
ATOM   3471  C  CA    . CYS A 1 503 ? -30.135 5.221   -18.901 1.00 30.71  ? 1151 CYS A CA    1 
ATOM   3472  C  C     . CYS A 1 503 ? -31.199 5.398   -17.824 1.00 32.34  ? 1151 CYS A C     1 
ATOM   3473  O  O     . CYS A 1 503 ? -31.413 4.507   -16.999 1.00 31.85  ? 1151 CYS A O     1 
ATOM   3474  C  CB    . CYS A 1 503 ? -28.767 5.050   -18.253 1.00 30.03  ? 1151 CYS A CB    1 
ATOM   3475  S  SG    . CYS A 1 503 ? -28.289 6.393   -17.194 1.00 36.81  ? 1151 CYS A SG    1 
ATOM   3476  N  N     . GLY A 1 504 ? -31.851 6.557   -17.827 1.00 32.80  ? 1152 GLY A N     1 
ATOM   3477  C  CA    . GLY A 1 504 ? -33.003 6.789   -16.975 1.00 34.48  ? 1152 GLY A CA    1 
ATOM   3478  C  C     . GLY A 1 504 ? -32.747 7.469   -15.642 1.00 35.74  ? 1152 GLY A C     1 
ATOM   3479  O  O     . GLY A 1 504 ? -33.317 7.071   -14.624 1.00 34.58  ? 1152 GLY A O     1 
ATOM   3480  N  N     . GLY A 1 505 ? -31.904 8.497   -15.641 1.00 34.42  ? 1153 GLY A N     1 
ATOM   3481  C  CA    . GLY A 1 505 ? -31.717 9.305   -14.449 1.00 33.60  ? 1153 GLY A CA    1 
ATOM   3482  C  C     . GLY A 1 505 ? -33.039 9.925   -14.026 1.00 34.02  ? 1153 GLY A C     1 
ATOM   3483  O  O     . GLY A 1 505 ? -33.459 9.811   -12.873 1.00 33.71  ? 1153 GLY A O     1 
ATOM   3484  N  N     . LEU A 1 506 ? -33.704 10.573  -14.977 1.00 34.72  ? 1154 LEU A N     1 
ATOM   3485  C  CA    . LEU A 1 506 ? -34.966 11.253  -14.718 1.00 33.28  ? 1154 LEU A CA    1 
ATOM   3486  C  C     . LEU A 1 506 ? -35.976 10.277  -14.137 1.00 33.74  ? 1154 LEU A C     1 
ATOM   3487  O  O     . LEU A 1 506 ? -36.427 10.435  -13.003 1.00 33.35  ? 1154 LEU A O     1 
ATOM   3488  C  CB    . LEU A 1 506 ? -35.511 11.877  -16.007 1.00 34.93  ? 1154 LEU A CB    1 
ATOM   3489  C  CG    . LEU A 1 506 ? -36.679 12.862  -15.915 1.00 32.29  ? 1154 LEU A CG    1 
ATOM   3490  C  CD1   . LEU A 1 506 ? -36.270 14.079  -15.121 1.00 32.07  ? 1154 LEU A CD1   1 
ATOM   3491  C  CD2   . LEU A 1 506 ? -37.150 13.272  -17.301 1.00 33.26  ? 1154 LEU A CD2   1 
ATOM   3492  N  N     . SER A 1 507 ? -36.328 9.263   -14.916 1.00 33.92  ? 1155 SER A N     1 
ATOM   3493  C  CA    . SER A 1 507 ? -37.265 8.256   -14.440 1.00 35.79  ? 1155 SER A CA    1 
ATOM   3494  C  C     . SER A 1 507 ? -36.885 7.756   -13.057 1.00 33.71  ? 1155 SER A C     1 
ATOM   3495  O  O     . SER A 1 507 ? -37.744 7.579   -12.203 1.00 33.94  ? 1155 SER A O     1 
ATOM   3496  C  CB    . SER A 1 507 ? -37.370 7.089   -15.424 1.00 36.80  ? 1155 SER A CB    1 
ATOM   3497  O  OG    . SER A 1 507 ? -38.395 7.329   -16.374 1.00 38.55  ? 1155 SER A OG    1 
ATOM   3498  N  N     . GLU A 1 508 ? -35.597 7.536   -12.835 1.00 30.39  ? 1156 GLU A N     1 
ATOM   3499  C  CA    . GLU A 1 508 ? -35.151 7.047   -11.544 1.00 30.94  ? 1156 GLU A CA    1 
ATOM   3500  C  C     . GLU A 1 508 ? -35.620 7.968   -10.421 1.00 32.99  ? 1156 GLU A C     1 
ATOM   3501  O  O     . GLU A 1 508 ? -36.238 7.529   -9.457  1.00 30.08  ? 1156 GLU A O     1 
ATOM   3502  C  CB    . GLU A 1 508 ? -33.634 6.889   -11.523 1.00 30.75  ? 1156 GLU A CB    1 
ATOM   3503  C  CG    . GLU A 1 508 ? -33.088 6.521   -10.160 1.00 30.79  ? 1156 GLU A CG    1 
ATOM   3504  C  CD    . GLU A 1 508 ? -33.748 5.292   -9.573  1.00 30.96  ? 1156 GLU A CD    1 
ATOM   3505  O  OE1   . GLU A 1 508 ? -34.450 4.575   -10.319 1.00 33.06  ? 1156 GLU A OE1   1 
ATOM   3506  O  OE2   . GLU A 1 508 ? -33.559 5.041   -8.365  1.00 30.46  ? 1156 GLU A OE2   1 
ATOM   3507  N  N     . GLY A 1 509 ? -35.332 9.255   -10.564 1.00 32.02  ? 1157 GLY A N     1 
ATOM   3508  C  CA    . GLY A 1 509 ? -35.788 10.248  -9.617  1.00 30.69  ? 1157 GLY A CA    1 
ATOM   3509  C  C     . GLY A 1 509 ? -37.298 10.306  -9.479  1.00 33.45  ? 1157 GLY A C     1 
ATOM   3510  O  O     . GLY A 1 509 ? -37.814 10.417  -8.373  1.00 33.06  ? 1157 GLY A O     1 
ATOM   3511  N  N     . PHE A 1 510 ? -38.015 10.253  -10.594 1.00 32.13  ? 1158 PHE A N     1 
ATOM   3512  C  CA    . PHE A 1 510 ? -39.469 10.221  -10.525 1.00 31.86  ? 1158 PHE A CA    1 
ATOM   3513  C  C     . PHE A 1 510 ? -39.911 9.022   -9.719  1.00 34.22  ? 1158 PHE A C     1 
ATOM   3514  O  O     . PHE A 1 510 ? -40.683 9.160   -8.776  1.00 36.54  ? 1158 PHE A O     1 
ATOM   3515  C  CB    . PHE A 1 510 ? -40.096 10.169  -11.914 1.00 34.04  ? 1158 PHE A CB    1 
ATOM   3516  C  CG    . PHE A 1 510 ? -40.275 11.520  -12.551 1.00 35.63  ? 1158 PHE A CG    1 
ATOM   3517  C  CD1   . PHE A 1 510 ? -39.859 12.672  -11.899 1.00 34.70  ? 1158 PHE A CD1   1 
ATOM   3518  C  CD2   . PHE A 1 510 ? -40.871 11.640  -13.791 1.00 34.39  ? 1158 PHE A CD2   1 
ATOM   3519  C  CE1   . PHE A 1 510 ? -40.024 13.914  -12.474 1.00 32.28  ? 1158 PHE A CE1   1 
ATOM   3520  C  CE2   . PHE A 1 510 ? -41.037 12.875  -14.371 1.00 35.71  ? 1158 PHE A CE2   1 
ATOM   3521  C  CZ    . PHE A 1 510 ? -40.611 14.017  -13.709 1.00 34.27  ? 1158 PHE A CZ    1 
ATOM   3522  N  N     . HIS A 1 511 ? -39.409 7.846   -10.086 1.00 34.70  ? 1159 HIS A N     1 
ATOM   3523  C  CA    . HIS A 1 511 ? -39.765 6.611   -9.398  1.00 33.06  ? 1159 HIS A CA    1 
ATOM   3524  C  C     . HIS A 1 511 ? -39.563 6.789   -7.906  1.00 31.86  ? 1159 HIS A C     1 
ATOM   3525  O  O     . HIS A 1 511 ? -40.437 6.475   -7.119  1.00 33.41  ? 1159 HIS A O     1 
ATOM   3526  C  CB    . HIS A 1 511 ? -38.923 5.435   -9.908  1.00 35.25  ? 1159 HIS A CB    1 
ATOM   3527  C  CG    . HIS A 1 511 ? -39.246 5.011   -11.307 1.00 38.28  ? 1159 HIS A CG    1 
ATOM   3528  N  ND1   . HIS A 1 511 ? -40.418 5.360   -11.944 1.00 39.43  ? 1159 HIS A ND1   1 
ATOM   3529  C  CD2   . HIS A 1 511 ? -38.550 4.263   -12.203 1.00 37.62  ? 1159 HIS A CD2   1 
ATOM   3530  C  CE1   . HIS A 1 511 ? -40.434 4.852   -13.165 1.00 39.66  ? 1159 HIS A CE1   1 
ATOM   3531  N  NE2   . HIS A 1 511 ? -39.299 4.179   -13.339 1.00 40.48  ? 1159 HIS A NE2   1 
ATOM   3532  N  N     . GLN A 1 512 ? -38.401 7.302   -7.524  1.00 33.78  ? 1160 GLN A N     1 
ATOM   3533  C  CA    . GLN A 1 512 ? -38.118 7.580   -6.120  1.00 33.35  ? 1160 GLN A CA    1 
ATOM   3534  C  C     . GLN A 1 512 ? -39.234 8.397   -5.470  1.00 33.96  ? 1160 GLN A C     1 
ATOM   3535  O  O     . GLN A 1 512 ? -39.626 8.120   -4.335  1.00 32.98  ? 1160 GLN A O     1 
ATOM   3536  C  CB    . GLN A 1 512 ? -36.770 8.292   -5.963  1.00 28.64  ? 1160 GLN A CB    1 
ATOM   3537  C  CG    . GLN A 1 512 ? -35.597 7.482   -6.479  1.00 29.56  ? 1160 GLN A CG    1 
ATOM   3538  C  CD    . GLN A 1 512 ? -34.251 8.034   -6.051  1.00 32.64  ? 1160 GLN A CD    1 
ATOM   3539  O  OE1   . GLN A 1 512 ? -34.167 9.123   -5.483  1.00 36.35  ? 1160 GLN A OE1   1 
ATOM   3540  N  NE2   . GLN A 1 512 ? -33.184 7.286   -6.327  1.00 30.26  ? 1160 GLN A NE2   1 
ATOM   3541  N  N     . ALA A 1 513 ? -39.743 9.395   -6.192  1.00 33.31  ? 1161 ALA A N     1 
ATOM   3542  C  CA    . ALA A 1 513 ? -40.831 10.236  -5.690  1.00 35.60  ? 1161 ALA A CA    1 
ATOM   3543  C  C     . ALA A 1 513 ? -42.162 9.486   -5.678  1.00 37.59  ? 1161 ALA A C     1 
ATOM   3544  O  O     . ALA A 1 513 ? -43.086 9.864   -4.965  1.00 40.19  ? 1161 ALA A O     1 
ATOM   3545  C  CB    . ALA A 1 513 ? -40.945 11.523  -6.497  1.00 33.29  ? 1161 ALA A CB    1 
ATOM   3546  N  N     . GLY A 1 514 ? -42.256 8.428   -6.474  1.00 35.91  ? 1162 GLY A N     1 
ATOM   3547  C  CA    . GLY A 1 514 ? -43.416 7.559   -6.446  1.00 37.19  ? 1162 GLY A CA    1 
ATOM   3548  C  C     . GLY A 1 514 ? -44.641 8.149   -7.110  1.00 42.00  ? 1162 GLY A C     1 
ATOM   3549  O  O     . GLY A 1 514 ? -45.767 7.983   -6.633  1.00 43.78  ? 1162 GLY A O     1 
ATOM   3550  N  N     . ILE A 1 515 ? -44.430 8.842   -8.220  1.00 41.33  ? 1163 ILE A N     1 
ATOM   3551  C  CA    . ILE A 1 515 ? -45.544 9.403   -8.962  1.00 41.17  ? 1163 ILE A CA    1 
ATOM   3552  C  C     . ILE A 1 515 ? -45.652 8.729   -10.311 1.00 43.62  ? 1163 ILE A C     1 
ATOM   3553  O  O     . ILE A 1 515 ? -46.691 8.796   -10.972 1.00 43.49  ? 1163 ILE A O     1 
ATOM   3554  C  CB    . ILE A 1 515 ? -45.356 10.892  -9.200  1.00 38.16  ? 1163 ILE A CB    1 
ATOM   3555  C  CG1   . ILE A 1 515 ? -44.082 11.130  -10.001 1.00 36.73  ? 1163 ILE A CG1   1 
ATOM   3556  C  CG2   . ILE A 1 515 ? -45.294 11.623  -7.880  1.00 43.27  ? 1163 ILE A CG2   1 
ATOM   3557  C  CD1   . ILE A 1 515 ? -44.018 12.503  -10.626 1.00 38.94  ? 1163 ILE A CD1   1 
ATOM   3558  N  N     . SER A 1 516 ? -44.571 8.081   -10.728 1.00 42.19  ? 1164 SER A N     1 
ATOM   3559  C  CA    . SER A 1 516 ? -44.564 7.493   -12.054 1.00 41.94  ? 1164 SER A CA    1 
ATOM   3560  C  C     . SER A 1 516 ? -44.329 5.988   -12.064 1.00 42.02  ? 1164 SER A C     1 
ATOM   3561  O  O     . SER A 1 516 ? -43.722 5.418   -11.159 1.00 41.40  ? 1164 SER A O     1 
ATOM   3562  C  CB    . SER A 1 516 ? -43.558 8.203   -12.968 1.00 40.13  ? 1164 SER A CB    1 
ATOM   3563  O  OG    . SER A 1 516 ? -42.226 7.888   -12.604 1.00 43.78  ? 1164 SER A OG    1 
ATOM   3564  N  N     . GLU A 1 517 ? -44.865 5.368   -13.106 1.00 41.58  ? 1165 GLU A N     1 
ATOM   3565  C  CA    . GLU A 1 517 ? -44.592 3.996   -13.465 1.00 40.68  ? 1165 GLU A CA    1 
ATOM   3566  C  C     . GLU A 1 517 ? -44.280 4.057   -14.957 1.00 40.74  ? 1165 GLU A C     1 
ATOM   3567  O  O     . GLU A 1 517 ? -45.191 4.100   -15.792 1.00 38.75  ? 1165 GLU A O     1 
ATOM   3568  C  CB    . GLU A 1 517 ? -45.824 3.131   -13.213 1.00 38.19  ? 1165 GLU A CB    1 
ATOM   3569  C  CG    . GLU A 1 517 ? -45.667 1.692   -13.629 1.00 39.40  ? 1165 GLU A CG    1 
ATOM   3570  C  CD    . GLU A 1 517 ? -46.992 1.039   -13.971 1.00 46.30  ? 1165 GLU A CD    1 
ATOM   3571  O  OE1   . GLU A 1 517 ? -47.997 1.769   -14.113 1.00 46.37  ? 1165 GLU A OE1   1 
ATOM   3572  O  OE2   . GLU A 1 517 ? -47.031 -0.205  -14.103 1.00 48.96  ? 1165 GLU A OE2   1 
ATOM   3573  N  N     . THR A 1 518 ? -42.995 4.105   -15.295 1.00 39.89  ? 1166 THR A N     1 
ATOM   3574  C  CA    . THR A 1 518 ? -42.610 4.235   -16.694 1.00 36.24  ? 1166 THR A CA    1 
ATOM   3575  C  C     . THR A 1 518 ? -42.944 2.956   -17.459 1.00 34.04  ? 1166 THR A C     1 
ATOM   3576  O  O     . THR A 1 518 ? -42.444 1.880   -17.153 1.00 34.09  ? 1166 THR A O     1 
ATOM   3577  C  CB    . THR A 1 518 ? -41.131 4.606   -16.847 1.00 35.12  ? 1166 THR A CB    1 
ATOM   3578  O  OG1   . THR A 1 518 ? -40.796 5.618   -15.890 1.00 38.36  ? 1166 THR A OG1   1 
ATOM   3579  C  CG2   . THR A 1 518 ? -40.859 5.138   -18.249 1.00 33.21  ? 1166 THR A CG2   1 
ATOM   3580  N  N     . LEU A 1 519 ? -43.819 3.089   -18.442 1.00 33.23  ? 1167 LEU A N     1 
ATOM   3581  C  CA    . LEU A 1 519 ? -44.288 1.947   -19.198 1.00 33.88  ? 1167 LEU A CA    1 
ATOM   3582  C  C     . LEU A 1 519 ? -43.638 1.895   -20.577 1.00 33.25  ? 1167 LEU A C     1 
ATOM   3583  O  O     . LEU A 1 519 ? -43.556 0.839   -21.192 1.00 34.08  ? 1167 LEU A O     1 
ATOM   3584  C  CB    . LEU A 1 519 ? -45.820 1.970   -19.302 1.00 34.07  ? 1167 LEU A CB    1 
ATOM   3585  C  CG    . LEU A 1 519 ? -46.578 1.726   -17.988 1.00 35.23  ? 1167 LEU A CG    1 
ATOM   3586  C  CD1   . LEU A 1 519 ? -48.076 1.661   -18.227 1.00 32.67  ? 1167 LEU A CD1   1 
ATOM   3587  C  CD2   . LEU A 1 519 ? -46.091 0.457   -17.307 1.00 32.75  ? 1167 LEU A CD2   1 
ATOM   3588  N  N     . TRP A 1 520 ? -43.165 3.040   -21.049 1.00 33.12  ? 1168 TRP A N     1 
ATOM   3589  C  CA    . TRP A 1 520 ? -42.506 3.121   -22.343 1.00 32.52  ? 1168 TRP A CA    1 
ATOM   3590  C  C     . TRP A 1 520 ? -41.340 4.092   -22.270 1.00 33.65  ? 1168 TRP A C     1 
ATOM   3591  O  O     . TRP A 1 520 ? -41.435 5.126   -21.620 1.00 34.15  ? 1168 TRP A O     1 
ATOM   3592  C  CB    . TRP A 1 520 ? -43.477 3.627   -23.402 1.00 32.49  ? 1168 TRP A CB    1 
ATOM   3593  C  CG    . TRP A 1 520 ? -44.838 3.039   -23.335 1.00 32.17  ? 1168 TRP A CG    1 
ATOM   3594  C  CD1   . TRP A 1 520 ? -45.305 1.994   -24.055 1.00 30.87  ? 1168 TRP A CD1   1 
ATOM   3595  C  CD2   . TRP A 1 520 ? -45.927 3.484   -22.518 1.00 35.80  ? 1168 TRP A CD2   1 
ATOM   3596  N  NE1   . TRP A 1 520 ? -46.615 1.750   -23.741 1.00 30.02  ? 1168 TRP A NE1   1 
ATOM   3597  C  CE2   . TRP A 1 520 ? -47.021 2.648   -22.795 1.00 33.43  ? 1168 TRP A CE2   1 
ATOM   3598  C  CE3   . TRP A 1 520 ? -46.081 4.511   -21.577 1.00 36.65  ? 1168 TRP A CE3   1 
ATOM   3599  C  CZ2   . TRP A 1 520 ? -48.258 2.800   -22.163 1.00 34.42  ? 1168 TRP A CZ2   1 
ATOM   3600  C  CZ3   . TRP A 1 520 ? -47.311 4.662   -20.952 1.00 34.64  ? 1168 TRP A CZ3   1 
ATOM   3601  C  CH2   . TRP A 1 520 ? -48.381 3.810   -21.249 1.00 34.64  ? 1168 TRP A CH2   1 
ATOM   3602  N  N     . ALA A 1 521 ? -40.249 3.767   -22.952 1.00 33.67  ? 1169 ALA A N     1 
ATOM   3603  C  CA    . ALA A 1 521 ? -39.102 4.664   -23.037 1.00 32.61  ? 1169 ALA A CA    1 
ATOM   3604  C  C     . ALA A 1 521 ? -38.537 4.666   -24.450 1.00 33.70  ? 1169 ALA A C     1 
ATOM   3605  O  O     . ALA A 1 521 ? -38.514 3.644   -25.110 1.00 36.72  ? 1169 ALA A O     1 
ATOM   3606  C  CB    . ALA A 1 521 ? -38.042 4.248   -22.053 1.00 31.59  ? 1169 ALA A CB    1 
ATOM   3607  N  N     . ILE A 1 522 ? -38.080 5.815   -24.918 1.00 33.27  ? 1170 ILE A N     1 
ATOM   3608  C  CA    . ILE A 1 522 ? -37.473 5.883   -26.234 1.00 33.13  ? 1170 ILE A CA    1 
ATOM   3609  C  C     . ILE A 1 522 ? -36.036 6.394   -26.123 1.00 37.60  ? 1170 ILE A C     1 
ATOM   3610  O  O     . ILE A 1 522 ? -35.783 7.461   -25.570 1.00 37.36  ? 1170 ILE A O     1 
ATOM   3611  C  CB    . ILE A 1 522 ? -38.298 6.763   -27.163 1.00 33.81  ? 1170 ILE A CB    1 
ATOM   3612  C  CG1   . ILE A 1 522 ? -39.687 6.156   -27.347 1.00 33.30  ? 1170 ILE A CG1   1 
ATOM   3613  C  CG2   . ILE A 1 522 ? -37.612 6.916   -28.493 1.00 38.14  ? 1170 ILE A CG2   1 
ATOM   3614  C  CD1   . ILE A 1 522 ? -40.671 7.078   -28.026 1.00 33.87  ? 1170 ILE A CD1   1 
ATOM   3615  N  N     . GLU A 1 523 ? -35.092 5.610   -26.630 1.00 38.96  ? 1171 GLU A N     1 
ATOM   3616  C  CA    . GLU A 1 523 ? -33.676 5.934   -26.510 1.00 38.62  ? 1171 GLU A CA    1 
ATOM   3617  C  C     . GLU A 1 523 ? -32.938 5.389   -27.724 1.00 41.94  ? 1171 GLU A C     1 
ATOM   3618  O  O     . GLU A 1 523 ? -32.787 4.177   -27.871 1.00 43.61  ? 1171 GLU A O     1 
ATOM   3619  C  CB    . GLU A 1 523 ? -33.105 5.352   -25.214 1.00 35.45  ? 1171 GLU A CB    1 
ATOM   3620  C  CG    . GLU A 1 523 ? -31.608 5.543   -25.032 1.00 37.53  ? 1171 GLU A CG    1 
ATOM   3621  C  CD    . GLU A 1 523 ? -31.134 6.946   -25.400 1.00 42.23  ? 1171 GLU A CD    1 
ATOM   3622  O  OE1   . GLU A 1 523 ? -31.177 7.856   -24.549 1.00 42.19  ? 1171 GLU A OE1   1 
ATOM   3623  O  OE2   . GLU A 1 523 ? -30.711 7.140   -26.554 1.00 45.22  ? 1171 GLU A OE2   1 
ATOM   3624  N  N     . MET A 1 524 ? -32.491 6.285   -28.598 1.00 41.75  ? 1172 MET A N     1 
ATOM   3625  C  CA    . MET A 1 524 ? -31.940 5.878   -29.880 1.00 43.82  ? 1172 MET A CA    1 
ATOM   3626  C  C     . MET A 1 524 ? -30.584 5.199   -29.719 1.00 43.61  ? 1172 MET A C     1 
ATOM   3627  O  O     . MET A 1 524 ? -30.180 4.391   -30.558 1.00 45.22  ? 1172 MET A O     1 
ATOM   3628  C  CB    . MET A 1 524 ? -31.838 7.077   -30.819 1.00 49.63  ? 1172 MET A CB    1 
ATOM   3629  C  CG    . MET A 1 524 ? -31.510 6.727   -32.266 1.00 56.38  ? 1172 MET A CG    1 
ATOM   3630  S  SD    . MET A 1 524 ? -31.288 8.196   -33.306 1.00 70.61  ? 1172 MET A SD    1 
ATOM   3631  C  CE    . MET A 1 524 ? -30.823 7.462   -34.875 1.00 73.90  ? 1172 MET A CE    1 
ATOM   3632  N  N     . TRP A 1 525 ? -29.890 5.517   -28.633 1.00 40.10  ? 1173 TRP A N     1 
ATOM   3633  C  CA    . TRP A 1 525 ? -28.550 4.991   -28.412 1.00 37.66  ? 1173 TRP A CA    1 
ATOM   3634  C  C     . TRP A 1 525 ? -28.598 3.668   -27.658 1.00 37.15  ? 1173 TRP A C     1 
ATOM   3635  O  O     . TRP A 1 525 ? -29.109 3.584   -26.546 1.00 37.37  ? 1173 TRP A O     1 
ATOM   3636  C  CB    . TRP A 1 525 ? -27.687 6.013   -27.677 1.00 36.75  ? 1173 TRP A CB    1 
ATOM   3637  C  CG    . TRP A 1 525 ? -26.256 5.617   -27.569 1.00 37.20  ? 1173 TRP A CG    1 
ATOM   3638  C  CD1   . TRP A 1 525 ? -25.472 5.115   -28.559 1.00 39.33  ? 1173 TRP A CD1   1 
ATOM   3639  C  CD2   . TRP A 1 525 ? -25.425 5.704   -26.403 1.00 38.26  ? 1173 TRP A CD2   1 
ATOM   3640  N  NE1   . TRP A 1 525 ? -24.206 4.869   -28.085 1.00 36.60  ? 1173 TRP A NE1   1 
ATOM   3641  C  CE2   . TRP A 1 525 ? -24.152 5.223   -26.765 1.00 36.71  ? 1173 TRP A CE2   1 
ATOM   3642  C  CE3   . TRP A 1 525 ? -25.636 6.138   -25.091 1.00 39.50  ? 1173 TRP A CE3   1 
ATOM   3643  C  CZ2   . TRP A 1 525 ? -23.096 5.164   -25.861 1.00 36.71  ? 1173 TRP A CZ2   1 
ATOM   3644  C  CZ3   . TRP A 1 525 ? -24.586 6.077   -24.197 1.00 38.25  ? 1173 TRP A CZ3   1 
ATOM   3645  C  CH2   . TRP A 1 525 ? -23.333 5.593   -24.586 1.00 39.52  ? 1173 TRP A CH2   1 
ATOM   3646  N  N     . ASP A 1 526 ? -28.044 2.633   -28.268 1.00 36.66  ? 1174 ASP A N     1 
ATOM   3647  C  CA    . ASP A 1 526 ? -28.260 1.276   -27.792 1.00 37.25  ? 1174 ASP A CA    1 
ATOM   3648  C  C     . ASP A 1 526 ? -27.718 0.938   -26.396 1.00 34.12  ? 1174 ASP A C     1 
ATOM   3649  O  O     . ASP A 1 526 ? -28.323 0.151   -25.674 1.00 33.45  ? 1174 ASP A O     1 
ATOM   3650  C  CB    . ASP A 1 526 ? -27.777 0.262   -28.827 1.00 36.04  ? 1174 ASP A CB    1 
ATOM   3651  C  CG    . ASP A 1 526 ? -27.843 -1.152  -28.315 1.00 42.03  ? 1174 ASP A CG    1 
ATOM   3652  O  OD1   . ASP A 1 526 ? -26.780 -1.684  -27.925 1.00 44.02  ? 1174 ASP A OD1   1 
ATOM   3653  O  OD2   . ASP A 1 526 ? -28.957 -1.725  -28.282 1.00 47.37  ? 1174 ASP A OD2   1 
ATOM   3654  N  N     . PRO A 1 527 ? -26.572 1.502   -26.012 1.00 34.18  ? 1175 PRO A N     1 
ATOM   3655  C  CA    . PRO A 1 527 ? -26.133 1.170   -24.653 1.00 35.26  ? 1175 PRO A CA    1 
ATOM   3656  C  C     . PRO A 1 527 ? -27.052 1.785   -23.590 1.00 35.28  ? 1175 PRO A C     1 
ATOM   3657  O  O     . PRO A 1 527 ? -27.439 1.112   -22.635 1.00 33.44  ? 1175 PRO A O     1 
ATOM   3658  C  CB    . PRO A 1 527 ? -24.733 1.787   -24.574 1.00 35.93  ? 1175 PRO A CB    1 
ATOM   3659  C  CG    . PRO A 1 527 ? -24.291 1.917   -25.986 1.00 35.07  ? 1175 PRO A CG    1 
ATOM   3660  C  CD    . PRO A 1 527 ? -25.534 2.207   -26.773 1.00 34.83  ? 1175 PRO A CD    1 
ATOM   3661  N  N     . ALA A 1 528 ? -27.388 3.059   -23.761 1.00 34.33  ? 1176 ALA A N     1 
ATOM   3662  C  CA    . ALA A 1 528 ? -28.308 3.734   -22.862 1.00 33.36  ? 1176 ALA A CA    1 
ATOM   3663  C  C     . ALA A 1 528 ? -29.625 2.968   -22.762 1.00 31.81  ? 1176 ALA A C     1 
ATOM   3664  O  O     . ALA A 1 528 ? -30.123 2.706   -21.670 1.00 31.10  ? 1176 ALA A O     1 
ATOM   3665  C  CB    . ALA A 1 528 ? -28.553 5.153   -23.335 1.00 34.74  ? 1176 ALA A CB    1 
ATOM   3666  N  N     . ALA A 1 529 ? -30.185 2.616   -23.910 1.00 31.13  ? 1177 ALA A N     1 
ATOM   3667  C  CA    . ALA A 1 529 ? -31.438 1.881   -23.955 1.00 30.53  ? 1177 ALA A CA    1 
ATOM   3668  C  C     . ALA A 1 529 ? -31.369 0.584   -23.156 1.00 30.89  ? 1177 ALA A C     1 
ATOM   3669  O  O     . ALA A 1 529 ? -32.324 0.214   -22.480 1.00 31.19  ? 1177 ALA A O     1 
ATOM   3670  C  CB    . ALA A 1 529 ? -31.818 1.592   -25.390 1.00 32.85  ? 1177 ALA A CB    1 
ATOM   3671  N  N     . GLN A 1 530 ? -30.241 -0.115  -23.243 1.00 31.89  ? 1178 GLN A N     1 
ATOM   3672  C  CA    . GLN A 1 530 ? -30.078 -1.366  -22.519 1.00 29.63  ? 1178 GLN A CA    1 
ATOM   3673  C  C     . GLN A 1 530 ? -30.023 -1.106  -21.025 1.00 30.64  ? 1178 GLN A C     1 
ATOM   3674  O  O     . GLN A 1 530 ? -30.754 -1.726  -20.271 1.00 28.54  ? 1178 GLN A O     1 
ATOM   3675  C  CB    . GLN A 1 530 ? -28.839 -2.124  -22.995 1.00 30.72  ? 1178 GLN A CB    1 
ATOM   3676  C  CG    . GLN A 1 530 ? -28.949 -2.654  -24.425 1.00 33.24  ? 1178 GLN A CG    1 
ATOM   3677  C  CD    . GLN A 1 530 ? -29.740 -3.962  -24.547 1.00 34.63  ? 1178 GLN A CD    1 
ATOM   3678  O  OE1   . GLN A 1 530 ? -30.969 -3.988  -24.434 1.00 33.61  ? 1178 GLN A OE1   1 
ATOM   3679  N  NE2   . GLN A 1 530 ? -29.028 -5.051  -24.799 1.00 33.38  ? 1178 GLN A NE2   1 
ATOM   3680  N  N     . ALA A 1 531 ? -29.171 -0.175  -20.602 1.00 31.07  ? 1179 ALA A N     1 
ATOM   3681  C  CA    . ALA A 1 531 ? -29.100 0.209   -19.190 1.00 29.97  ? 1179 ALA A CA    1 
ATOM   3682  C  C     . ALA A 1 531 ? -30.478 0.544   -18.631 1.00 29.31  ? 1179 ALA A C     1 
ATOM   3683  O  O     . ALA A 1 531 ? -30.807 0.174   -17.509 1.00 29.37  ? 1179 ALA A O     1 
ATOM   3684  C  CB    . ALA A 1 531 ? -28.145 1.362   -18.984 1.00 27.39  ? 1179 ALA A CB    1 
ATOM   3685  N  N     . PHE A 1 532 ? -31.288 1.239   -19.413 1.00 28.21  ? 1180 PHE A N     1 
ATOM   3686  C  CA    . PHE A 1 532 ? -32.645 1.509   -18.983 1.00 29.10  ? 1180 PHE A CA    1 
ATOM   3687  C  C     . PHE A 1 532 ? -33.424 0.209   -18.737 1.00 29.82  ? 1180 PHE A C     1 
ATOM   3688  O  O     . PHE A 1 532 ? -34.036 0.041   -17.686 1.00 31.12  ? 1180 PHE A O     1 
ATOM   3689  C  CB    . PHE A 1 532 ? -33.368 2.397   -19.983 1.00 28.72  ? 1180 PHE A CB    1 
ATOM   3690  C  CG    . PHE A 1 532 ? -34.574 3.071   -19.418 1.00 29.67  ? 1180 PHE A CG    1 
ATOM   3691  C  CD1   . PHE A 1 532 ? -34.500 4.365   -18.945 1.00 31.83  ? 1180 PHE A CD1   1 
ATOM   3692  C  CD2   . PHE A 1 532 ? -35.783 2.407   -19.348 1.00 30.56  ? 1180 PHE A CD2   1 
ATOM   3693  C  CE1   . PHE A 1 532 ? -35.614 4.988   -18.420 1.00 33.99  ? 1180 PHE A CE1   1 
ATOM   3694  C  CE2   . PHE A 1 532 ? -36.899 3.023   -18.822 1.00 30.52  ? 1180 PHE A CE2   1 
ATOM   3695  C  CZ    . PHE A 1 532 ? -36.815 4.315   -18.358 1.00 31.61  ? 1180 PHE A CZ    1 
ATOM   3696  N  N     . ARG A 1 533 ? -33.396 -0.706  -19.702 1.00 28.84  ? 1181 ARG A N     1 
ATOM   3697  C  CA    . ARG A 1 533 ? -34.068 -1.993  -19.553 1.00 28.15  ? 1181 ARG A CA    1 
ATOM   3698  C  C     . ARG A 1 533 ? -33.590 -2.696  -18.295 1.00 28.56  ? 1181 ARG A C     1 
ATOM   3699  O  O     . ARG A 1 533 ? -34.359 -3.356  -17.601 1.00 28.43  ? 1181 ARG A O     1 
ATOM   3700  C  CB    . ARG A 1 533 ? -33.788 -2.893  -20.754 1.00 28.12  ? 1181 ARG A CB    1 
ATOM   3701  C  CG    . ARG A 1 533 ? -34.439 -2.445  -22.031 1.00 29.41  ? 1181 ARG A CG    1 
ATOM   3702  C  CD    . ARG A 1 533 ? -34.381 -3.509  -23.090 1.00 28.69  ? 1181 ARG A CD    1 
ATOM   3703  N  NE    . ARG A 1 533 ? -34.872 -2.997  -24.362 1.00 31.35  ? 1181 ARG A NE    1 
ATOM   3704  C  CZ    . ARG A 1 533 ? -34.113 -2.367  -25.250 1.00 30.79  ? 1181 ARG A CZ    1 
ATOM   3705  N  NH1   . ARG A 1 533 ? -32.827 -2.178  -25.001 1.00 30.19  ? 1181 ARG A NH1   1 
ATOM   3706  N  NH2   . ARG A 1 533 ? -34.638 -1.927  -26.385 1.00 30.37  ? 1181 ARG A NH2   1 
ATOM   3707  N  N     . LEU A 1 534 ? -32.303 -2.551  -18.014 1.00 28.58  ? 1182 LEU A N     1 
ATOM   3708  C  CA    . LEU A 1 534 ? -31.693 -3.204  -16.876 1.00 28.06  ? 1182 LEU A CA    1 
ATOM   3709  C  C     . LEU A 1 534 ? -32.262 -2.711  -15.566 1.00 30.54  ? 1182 LEU A C     1 
ATOM   3710  O  O     . LEU A 1 534 ? -32.253 -3.429  -14.583 1.00 34.24  ? 1182 LEU A O     1 
ATOM   3711  C  CB    . LEU A 1 534 ? -30.191 -2.964  -16.872 1.00 27.87  ? 1182 LEU A CB    1 
ATOM   3712  C  CG    . LEU A 1 534 ? -29.403 -3.692  -17.948 1.00 28.29  ? 1182 LEU A CG    1 
ATOM   3713  C  CD1   . LEU A 1 534 ? -27.916 -3.454  -17.738 1.00 30.84  ? 1182 LEU A CD1   1 
ATOM   3714  C  CD2   . LEU A 1 534 ? -29.730 -5.170  -17.932 1.00 27.75  ? 1182 LEU A CD2   1 
ATOM   3715  N  N     . ASN A 1 535 ? -32.750 -1.479  -15.544 1.00 31.66  ? 1183 ASN A N     1 
ATOM   3716  C  CA    . ASN A 1 535 ? -33.198 -0.883  -14.294 1.00 29.99  ? 1183 ASN A CA    1 
ATOM   3717  C  C     . ASN A 1 535 ? -34.705 -0.858  -14.158 1.00 31.77  ? 1183 ASN A C     1 
ATOM   3718  O  O     . ASN A 1 535 ? -35.225 -0.552  -13.084 1.00 36.71  ? 1183 ASN A O     1 
ATOM   3719  C  CB    . ASN A 1 535 ? -32.648 0.527   -14.154 1.00 30.62  ? 1183 ASN A CB    1 
ATOM   3720  C  CG    . ASN A 1 535 ? -31.140 0.553   -14.089 1.00 33.14  ? 1183 ASN A CG    1 
ATOM   3721  O  OD1   . ASN A 1 535 ? -30.543 0.144   -13.093 1.00 33.60  ? 1183 ASN A OD1   1 
ATOM   3722  N  ND2   . ASN A 1 535 ? -30.514 1.050   -15.146 1.00 31.64  ? 1183 ASN A ND2   1 
ATOM   3723  N  N     . ASN A 1 536 ? -35.404 -1.177  -15.243 1.00 30.39  ? 1184 ASN A N     1 
ATOM   3724  C  CA    . ASN A 1 536 ? -36.859 -1.144  -15.256 1.00 30.67  ? 1184 ASN A CA    1 
ATOM   3725  C  C     . ASN A 1 536 ? -37.456 -2.297  -16.034 1.00 31.28  ? 1184 ASN A C     1 
ATOM   3726  O  O     . ASN A 1 536 ? -37.729 -2.167  -17.223 1.00 31.38  ? 1184 ASN A O     1 
ATOM   3727  C  CB    . ASN A 1 536 ? -37.351 0.155   -15.882 1.00 31.10  ? 1184 ASN A CB    1 
ATOM   3728  C  CG    . ASN A 1 536 ? -36.501 1.334   -15.518 1.00 30.88  ? 1184 ASN A CG    1 
ATOM   3729  O  OD1   . ASN A 1 536 ? -35.495 1.602   -16.165 1.00 30.82  ? 1184 ASN A OD1   1 
ATOM   3730  N  ND2   . ASN A 1 536 ? -36.901 2.058   -14.481 1.00 33.78  ? 1184 ASN A ND2   1 
ATOM   3731  N  N     . PRO A 1 537 ? -37.687 -3.428  -15.363 1.00 32.40  ? 1185 PRO A N     1 
ATOM   3732  C  CA    . PRO A 1 537 ? -38.198 -4.622  -16.048 1.00 32.10  ? 1185 PRO A CA    1 
ATOM   3733  C  C     . PRO A 1 537 ? -39.621 -4.449  -16.554 1.00 34.01  ? 1185 PRO A C     1 
ATOM   3734  O  O     . PRO A 1 537 ? -40.084 -5.248  -17.360 1.00 36.96  ? 1185 PRO A O     1 
ATOM   3735  C  CB    . PRO A 1 537 ? -38.167 -5.684  -14.953 1.00 30.97  ? 1185 PRO A CB    1 
ATOM   3736  C  CG    . PRO A 1 537 ? -38.257 -4.919  -13.690 1.00 30.51  ? 1185 PRO A CG    1 
ATOM   3737  C  CD    . PRO A 1 537 ? -37.499 -3.654  -13.922 1.00 30.71  ? 1185 PRO A CD    1 
ATOM   3738  N  N     . GLY A 1 538 ? -40.306 -3.412  -16.093 1.00 34.58  ? 1186 GLY A N     1 
ATOM   3739  C  CA    . GLY A 1 538 ? -41.706 -3.247  -16.423 1.00 35.80  ? 1186 GLY A CA    1 
ATOM   3740  C  C     . GLY A 1 538 ? -41.963 -2.413  -17.656 1.00 34.47  ? 1186 GLY A C     1 
ATOM   3741  O  O     . GLY A 1 538 ? -43.090 -2.348  -18.144 1.00 36.25  ? 1186 GLY A O     1 
ATOM   3742  N  N     . THR A 1 539 ? -40.915 -1.782  -18.169 1.00 33.25  ? 1187 THR A N     1 
ATOM   3743  C  CA    . THR A 1 539 ? -41.074 -0.825  -19.258 1.00 34.09  ? 1187 THR A CA    1 
ATOM   3744  C  C     . THR A 1 539 ? -40.570 -1.338  -20.612 1.00 32.69  ? 1187 THR A C     1 
ATOM   3745  O  O     . THR A 1 539 ? -39.599 -2.084  -20.695 1.00 32.41  ? 1187 THR A O     1 
ATOM   3746  C  CB    . THR A 1 539 ? -40.445 0.566   -18.895 1.00 34.48  ? 1187 THR A CB    1 
ATOM   3747  O  OG1   . THR A 1 539 ? -40.338 1.389   -20.066 1.00 35.89  ? 1187 THR A OG1   1 
ATOM   3748  C  CG2   . THR A 1 539 ? -39.082 0.400   -18.286 1.00 30.55  ? 1187 THR A CG2   1 
ATOM   3749  N  N     . THR A 1 540 ? -41.265 -0.922  -21.663 1.00 32.54  ? 1188 THR A N     1 
ATOM   3750  C  CA    . THR A 1 540 ? -40.918 -1.235  -23.040 1.00 32.25  ? 1188 THR A CA    1 
ATOM   3751  C  C     . THR A 1 540 ? -40.024 -0.152  -23.655 1.00 34.81  ? 1188 THR A C     1 
ATOM   3752  O  O     . THR A 1 540 ? -40.504 0.921   -24.030 1.00 35.23  ? 1188 THR A O     1 
ATOM   3753  C  CB    . THR A 1 540 ? -42.195 -1.324  -23.892 1.00 31.81  ? 1188 THR A CB    1 
ATOM   3754  O  OG1   . THR A 1 540 ? -43.226 -1.962  -23.132 1.00 35.81  ? 1188 THR A OG1   1 
ATOM   3755  C  CG2   . THR A 1 540 ? -41.947 -2.106  -25.158 1.00 35.62  ? 1188 THR A CG2   1 
ATOM   3756  N  N     . VAL A 1 541 ? -38.730 -0.435  -23.778 1.00 34.12  ? 1189 VAL A N     1 
ATOM   3757  C  CA    . VAL A 1 541 ? -37.814 0.513   -24.404 1.00 31.72  ? 1189 VAL A CA    1 
ATOM   3758  C  C     . VAL A 1 541 ? -37.726 0.329   -25.912 1.00 32.64  ? 1189 VAL A C     1 
ATOM   3759  O  O     . VAL A 1 541 ? -37.239 -0.685  -26.400 1.00 34.78  ? 1189 VAL A O     1 
ATOM   3760  C  CB    . VAL A 1 541 ? -36.402 0.403   -23.822 1.00 31.89  ? 1189 VAL A CB    1 
ATOM   3761  C  CG1   . VAL A 1 541 ? -35.515 1.464   -24.425 1.00 32.48  ? 1189 VAL A CG1   1 
ATOM   3762  C  CG2   . VAL A 1 541 ? -36.438 0.534   -22.309 1.00 32.24  ? 1189 VAL A CG2   1 
ATOM   3763  N  N     . PHE A 1 542 ? -38.201 1.323   -26.647 1.00 33.75  ? 1190 PHE A N     1 
ATOM   3764  C  CA    . PHE A 1 542 ? -38.071 1.344   -28.095 1.00 35.41  ? 1190 PHE A CA    1 
ATOM   3765  C  C     . PHE A 1 542 ? -36.726 1.954   -28.489 1.00 37.95  ? 1190 PHE A C     1 
ATOM   3766  O  O     . PHE A 1 542 ? -36.487 3.132   -28.257 1.00 38.73  ? 1190 PHE A O     1 
ATOM   3767  C  CB    . PHE A 1 542 ? -39.210 2.152   -28.720 1.00 34.68  ? 1190 PHE A CB    1 
ATOM   3768  C  CG    . PHE A 1 542 ? -40.585 1.688   -28.317 1.00 34.74  ? 1190 PHE A CG    1 
ATOM   3769  C  CD1   . PHE A 1 542 ? -41.307 0.835   -29.129 1.00 36.82  ? 1190 PHE A CD1   1 
ATOM   3770  C  CD2   . PHE A 1 542 ? -41.156 2.115   -27.129 1.00 34.84  ? 1190 PHE A CD2   1 
ATOM   3771  C  CE1   . PHE A 1 542 ? -42.570 0.409   -28.762 1.00 40.14  ? 1190 PHE A CE1   1 
ATOM   3772  C  CE2   . PHE A 1 542 ? -42.420 1.698   -26.754 1.00 36.12  ? 1190 PHE A CE2   1 
ATOM   3773  C  CZ    . PHE A 1 542 ? -43.129 0.843   -27.570 1.00 39.90  ? 1190 PHE A CZ    1 
ATOM   3774  N  N     . THR A 1 543 ? -35.841 1.153   -29.072 1.00 42.00  ? 1191 THR A N     1 
ATOM   3775  C  CA    . THR A 1 543 ? -34.550 1.664   -29.519 1.00 42.23  ? 1191 THR A CA    1 
ATOM   3776  C  C     . THR A 1 543 ? -34.708 2.198   -30.928 1.00 46.94  ? 1191 THR A C     1 
ATOM   3777  O  O     . THR A 1 543 ? -34.228 1.581   -31.880 1.00 54.66  ? 1191 THR A O     1 
ATOM   3778  C  CB    . THR A 1 543 ? -33.465 0.561   -29.528 1.00 44.80  ? 1191 THR A CB    1 
ATOM   3779  O  OG1   . THR A 1 543 ? -33.461 -0.136  -28.275 1.00 46.97  ? 1191 THR A OG1   1 
ATOM   3780  C  CG2   . THR A 1 543 ? -32.085 1.156   -29.771 1.00 43.82  ? 1191 THR A CG2   1 
ATOM   3781  N  N     . GLU A 1 544 ? -35.400 3.326   -31.067 1.00 43.73  ? 1192 GLU A N     1 
ATOM   3782  C  CA    . GLU A 1 544 ? -35.610 3.937   -32.380 1.00 49.16  ? 1192 GLU A CA    1 
ATOM   3783  C  C     . GLU A 1 544 ? -35.543 5.461   -32.378 1.00 56.48  ? 1192 GLU A C     1 
ATOM   3784  O  O     . GLU A 1 544 ? -35.381 6.105   -31.334 1.00 53.69  ? 1192 GLU A O     1 
ATOM   3785  C  CB    . GLU A 1 544 ? -36.935 3.485   -32.995 1.00 49.92  ? 1192 GLU A CB    1 
ATOM   3786  C  CG    . GLU A 1 544 ? -36.884 2.061   -33.506 1.00 64.21  ? 1192 GLU A CG    1 
ATOM   3787  C  CD    . GLU A 1 544 ? -38.213 1.554   -34.027 1.00 68.33  ? 1192 GLU A CD    1 
ATOM   3788  O  OE1   . GLU A 1 544 ? -38.526 1.840   -35.209 1.00 73.27  ? 1192 GLU A OE1   1 
ATOM   3789  O  OE2   . GLU A 1 544 ? -38.925 0.854   -33.259 1.00 58.25  ? 1192 GLU A OE2   1 
ATOM   3790  N  N     . ASP A 1 545 ? -35.645 6.031   -33.573 1.00 58.34  ? 1193 ASP A N     1 
ATOM   3791  C  CA    . ASP A 1 545 ? -35.737 7.472   -33.711 1.00 56.62  ? 1193 ASP A CA    1 
ATOM   3792  C  C     . ASP A 1 545 ? -37.173 7.873   -33.418 1.00 53.84  ? 1193 ASP A C     1 
ATOM   3793  O  O     . ASP A 1 545 ? -38.106 7.391   -34.065 1.00 51.70  ? 1193 ASP A O     1 
ATOM   3794  C  CB    . ASP A 1 545 ? -35.350 7.900   -35.123 1.00 61.28  ? 1193 ASP A CB    1 
ATOM   3795  C  CG    . ASP A 1 545 ? -35.585 9.374   -35.364 1.00 63.16  ? 1193 ASP A CG    1 
ATOM   3796  O  OD1   . ASP A 1 545 ? -36.198 9.710   -36.401 1.00 61.55  ? 1193 ASP A OD1   1 
ATOM   3797  O  OD2   . ASP A 1 545 ? -35.160 10.189  -34.511 1.00 60.85  ? 1193 ASP A OD2   1 
ATOM   3798  N  N     . CYS A 1 546 ? -37.348 8.750   -32.438 1.00 52.20  ? 1194 CYS A N     1 
ATOM   3799  C  CA    . CYS A 1 546 ? -38.676 9.099   -31.954 1.00 49.88  ? 1194 CYS A CA    1 
ATOM   3800  C  C     . CYS A 1 546 ? -39.598 9.503   -33.097 1.00 49.71  ? 1194 CYS A C     1 
ATOM   3801  O  O     . CYS A 1 546 ? -40.820 9.375   -32.999 1.00 42.93  ? 1194 CYS A O     1 
ATOM   3802  C  CB    . CYS A 1 546 ? -38.574 10.238  -30.953 1.00 47.76  ? 1194 CYS A CB    1 
ATOM   3803  S  SG    . CYS A 1 546 ? -37.942 11.748  -31.685 1.00 59.31  ? 1194 CYS A SG    1 
ATOM   3804  N  N     . ASN A 1 547 ? -38.999 9.990   -34.181 1.00 52.10  ? 1195 ASN A N     1 
ATOM   3805  C  CA    . ASN A 1 547 ? -39.754 10.480  -35.328 1.00 50.73  ? 1195 ASN A CA    1 
ATOM   3806  C  C     . ASN A 1 547 ? -40.572 9.415   -36.048 1.00 49.03  ? 1195 ASN A C     1 
ATOM   3807  O  O     . ASN A 1 547 ? -41.769 9.592   -36.285 1.00 45.76  ? 1195 ASN A O     1 
ATOM   3808  C  CB    . ASN A 1 547 ? -38.821 11.168  -36.314 1.00 51.83  ? 1195 ASN A CB    1 
ATOM   3809  C  CG    . ASN A 1 547 ? -38.502 12.589  -35.910 1.00 58.84  ? 1195 ASN A CG    1 
ATOM   3810  O  OD1   . ASN A 1 547 ? -39.291 13.506  -36.155 1.00 61.55  ? 1195 ASN A OD1   1 
ATOM   3811  N  ND2   . ASN A 1 547 ? -37.344 12.785  -35.285 1.00 58.28  ? 1195 ASN A ND2   1 
ATOM   3812  N  N     . VAL A 1 548 ? -39.920 8.313   -36.401 1.00 51.52  ? 1196 VAL A N     1 
ATOM   3813  C  CA    . VAL A 1 548 ? -40.600 7.214   -37.085 1.00 50.09  ? 1196 VAL A CA    1 
ATOM   3814  C  C     . VAL A 1 548 ? -41.563 6.486   -36.151 1.00 46.29  ? 1196 VAL A C     1 
ATOM   3815  O  O     . VAL A 1 548 ? -42.655 6.085   -36.558 1.00 43.92  ? 1196 VAL A O     1 
ATOM   3816  C  CB    . VAL A 1 548 ? -39.602 6.209   -37.700 1.00 51.78  ? 1196 VAL A CB    1 
ATOM   3817  C  CG1   . VAL A 1 548 ? -38.660 5.663   -36.634 1.00 53.27  ? 1196 VAL A CG1   1 
ATOM   3818  C  CG2   . VAL A 1 548 ? -40.350 5.088   -38.408 1.00 50.71  ? 1196 VAL A CG2   1 
ATOM   3819  N  N     . LEU A 1 549 ? -41.151 6.332   -34.897 1.00 46.00  ? 1197 LEU A N     1 
ATOM   3820  C  CA    . LEU A 1 549 ? -41.991 5.716   -33.880 1.00 42.90  ? 1197 LEU A CA    1 
ATOM   3821  C  C     . LEU A 1 549 ? -43.312 6.457   -33.771 1.00 43.22  ? 1197 LEU A C     1 
ATOM   3822  O  O     . LEU A 1 549 ? -44.366 5.847   -33.624 1.00 41.58  ? 1197 LEU A O     1 
ATOM   3823  C  CB    . LEU A 1 549 ? -41.276 5.720   -32.537 1.00 41.15  ? 1197 LEU A CB    1 
ATOM   3824  C  CG    . LEU A 1 549 ? -41.824 4.741   -31.510 1.00 40.09  ? 1197 LEU A CG    1 
ATOM   3825  C  CD1   . LEU A 1 549 ? -41.850 3.351   -32.097 1.00 45.14  ? 1197 LEU A CD1   1 
ATOM   3826  C  CD2   . LEU A 1 549 ? -40.973 4.756   -30.273 1.00 38.96  ? 1197 LEU A CD2   1 
ATOM   3827  N  N     . LEU A 1 550 ? -43.237 7.783   -33.856 1.00 47.28  ? 1198 LEU A N     1 
ATOM   3828  C  CA    . LEU A 1 550 ? -44.413 8.642   -33.835 1.00 44.30  ? 1198 LEU A CA    1 
ATOM   3829  C  C     . LEU A 1 550 ? -45.235 8.463   -35.102 1.00 47.68  ? 1198 LEU A C     1 
ATOM   3830  O  O     . LEU A 1 550 ? -46.443 8.215   -35.036 1.00 47.71  ? 1198 LEU A O     1 
ATOM   3831  C  CB    . LEU A 1 550 ? -43.994 10.103  -33.697 1.00 45.96  ? 1198 LEU A CB    1 
ATOM   3832  C  CG    . LEU A 1 550 ? -45.113 11.152  -33.726 1.00 49.41  ? 1198 LEU A CG    1 
ATOM   3833  C  CD1   . LEU A 1 550 ? -46.152 10.877  -32.640 1.00 49.01  ? 1198 LEU A CD1   1 
ATOM   3834  C  CD2   . LEU A 1 550 ? -44.540 12.556  -33.589 1.00 42.06  ? 1198 LEU A CD2   1 
ATOM   3835  N  N     . LYS A 1 551 ? -44.574 8.589   -36.253 1.00 47.77  ? 1199 LYS A N     1 
ATOM   3836  C  CA    . LYS A 1 551 ? -45.243 8.456   -37.548 1.00 48.10  ? 1199 LYS A CA    1 
ATOM   3837  C  C     . LYS A 1 551 ? -45.866 7.062   -37.711 1.00 49.36  ? 1199 LYS A C     1 
ATOM   3838  O  O     . LYS A 1 551 ? -46.715 6.838   -38.578 1.00 50.54  ? 1199 LYS A O     1 
ATOM   3839  C  CB    . LYS A 1 551 ? -44.282 8.777   -38.699 1.00 39.87  ? 1199 LYS A CB    1 
ATOM   3840  N  N     . LEU A 1 552 ? -45.446 6.130   -36.865 1.00 45.91  ? 1200 LEU A N     1 
ATOM   3841  C  CA    . LEU A 1 552 ? -46.037 4.804   -36.857 1.00 47.20  ? 1200 LEU A CA    1 
ATOM   3842  C  C     . LEU A 1 552 ? -47.439 4.834   -36.270 1.00 51.31  ? 1200 LEU A C     1 
ATOM   3843  O  O     . LEU A 1 552 ? -48.409 4.499   -36.949 1.00 53.33  ? 1200 LEU A O     1 
ATOM   3844  C  CB    . LEU A 1 552 ? -45.161 3.823   -36.079 1.00 46.12  ? 1200 LEU A CB    1 
ATOM   3845  C  CG    . LEU A 1 552 ? -44.253 2.970   -36.965 1.00 44.08  ? 1200 LEU A CG    1 
ATOM   3846  C  CD1   . LEU A 1 552 ? -43.156 2.303   -36.161 1.00 40.99  ? 1200 LEU A CD1   1 
ATOM   3847  C  CD2   . LEU A 1 552 ? -45.082 1.951   -37.710 1.00 45.37  ? 1200 LEU A CD2   1 
ATOM   3848  N  N     . VAL A 1 553 ? -47.543 5.239   -35.008 1.00 52.73  ? 1201 VAL A N     1 
ATOM   3849  C  CA    . VAL A 1 553 ? -48.822 5.193   -34.297 1.00 53.15  ? 1201 VAL A CA    1 
ATOM   3850  C  C     . VAL A 1 553 ? -49.846 6.135   -34.923 1.00 52.72  ? 1201 VAL A C     1 
ATOM   3851  O  O     . VAL A 1 553 ? -51.054 5.886   -34.858 1.00 50.11  ? 1201 VAL A O     1 
ATOM   3852  C  CB    . VAL A 1 553 ? -48.653 5.491   -32.790 1.00 49.80  ? 1201 VAL A CB    1 
ATOM   3853  C  CG1   . VAL A 1 553 ? -47.204 5.814   -32.470 1.00 45.69  ? 1201 VAL A CG1   1 
ATOM   3854  C  CG2   . VAL A 1 553 ? -49.565 6.624   -32.364 1.00 50.61  ? 1201 VAL A CG2   1 
ATOM   3855  N  N     . MET A 1 554 ? -49.351 7.209   -35.537 1.00 53.44  ? 1202 MET A N     1 
ATOM   3856  C  CA    . MET A 1 554 ? -50.210 8.149   -36.251 1.00 55.59  ? 1202 MET A CA    1 
ATOM   3857  C  C     . MET A 1 554 ? -50.863 7.470   -37.448 1.00 58.42  ? 1202 MET A C     1 
ATOM   3858  O  O     . MET A 1 554 ? -52.072 7.598   -37.672 1.00 57.82  ? 1202 MET A O     1 
ATOM   3859  C  CB    . MET A 1 554 ? -49.416 9.370   -36.707 1.00 51.53  ? 1202 MET A CB    1 
ATOM   3860  C  CG    . MET A 1 554 ? -48.903 10.217  -35.562 1.00 54.80  ? 1202 MET A CG    1 
ATOM   3861  S  SD    . MET A 1 554 ? -48.511 11.908  -36.057 1.00 66.31  ? 1202 MET A SD    1 
ATOM   3862  C  CE    . MET A 1 554 ? -50.144 12.527  -36.460 1.00 51.83  ? 1202 MET A CE    1 
ATOM   3863  N  N     . ALA A 1 555 ? -50.050 6.739   -38.206 1.00 58.22  ? 1203 ALA A N     1 
ATOM   3864  C  CA    . ALA A 1 555 ? -50.537 5.940   -39.325 1.00 56.87  ? 1203 ALA A CA    1 
ATOM   3865  C  C     . ALA A 1 555 ? -51.351 4.740   -38.847 1.00 55.35  ? 1203 ALA A C     1 
ATOM   3866  O  O     . ALA A 1 555 ? -51.599 3.811   -39.607 1.00 61.34  ? 1203 ALA A O     1 
ATOM   3867  C  CB    . ALA A 1 555 ? -49.372 5.479   -40.192 1.00 52.76  ? 1203 ALA A CB    1 
ATOM   3868  N  N     . GLY A 1 556 ? -51.752 4.753   -37.582 1.00 54.82  ? 1204 GLY A N     1 
ATOM   3869  C  CA    . GLY A 1 556 ? -52.636 3.728   -37.060 1.00 57.11  ? 1204 GLY A CA    1 
ATOM   3870  C  C     . GLY A 1 556 ? -51.984 2.379   -36.834 1.00 57.49  ? 1204 GLY A C     1 
ATOM   3871  O  O     . GLY A 1 556 ? -52.669 1.360   -36.776 1.00 58.94  ? 1204 GLY A O     1 
ATOM   3872  N  N     . GLU A 1 557 ? -50.661 2.372   -36.698 1.00 56.92  ? 1205 GLU A N     1 
ATOM   3873  C  CA    . GLU A 1 557 ? -49.929 1.150   -36.388 1.00 55.41  ? 1205 GLU A CA    1 
ATOM   3874  C  C     . GLU A 1 557 ? -50.056 0.771   -34.913 1.00 56.00  ? 1205 GLU A C     1 
ATOM   3875  O  O     . GLU A 1 557 ? -50.105 1.639   -34.044 1.00 56.36  ? 1205 GLU A O     1 
ATOM   3876  C  CB    . GLU A 1 557 ? -48.461 1.309   -36.773 1.00 55.49  ? 1205 GLU A CB    1 
ATOM   3877  C  CG    . GLU A 1 557 ? -48.220 1.226   -38.270 1.00 57.87  ? 1205 GLU A CG    1 
ATOM   3878  C  CD    . GLU A 1 557 ? -48.578 -0.141  -38.836 1.00 64.51  ? 1205 GLU A CD    1 
ATOM   3879  O  OE1   . GLU A 1 557 ? -48.602 -1.121  -38.054 1.00 65.18  ? 1205 GLU A OE1   1 
ATOM   3880  O  OE2   . GLU A 1 557 ? -48.839 -0.234  -40.057 1.00 65.84  ? 1205 GLU A OE2   1 
ATOM   3881  N  N     . VAL A 1 558 ? -50.103 -0.526  -34.631 1.00 54.59  ? 1206 VAL A N     1 
ATOM   3882  C  CA    . VAL A 1 558 ? -50.280 -0.993  -33.259 1.00 53.88  ? 1206 VAL A CA    1 
ATOM   3883  C  C     . VAL A 1 558 ? -48.971 -1.432  -32.604 1.00 52.98  ? 1206 VAL A C     1 
ATOM   3884  O  O     . VAL A 1 558 ? -48.843 -1.403  -31.379 1.00 54.85  ? 1206 VAL A O     1 
ATOM   3885  C  CB    . VAL A 1 558 ? -51.302 -2.144  -33.195 1.00 56.09  ? 1206 VAL A CB    1 
ATOM   3886  C  CG1   . VAL A 1 558 ? -51.313 -2.796  -31.813 1.00 51.36  ? 1206 VAL A CG1   1 
ATOM   3887  C  CG2   . VAL A 1 558 ? -52.679 -1.624  -33.547 1.00 62.25  ? 1206 VAL A CG2   1 
ATOM   3888  N  N     . THR A 1 559 ? -47.994 -1.820  -33.418 1.00 50.54  ? 1207 THR A N     1 
ATOM   3889  C  CA    . THR A 1 559 ? -46.740 -2.354  -32.898 1.00 47.51  ? 1207 THR A CA    1 
ATOM   3890  C  C     . THR A 1 559 ? -45.601 -2.106  -33.873 1.00 44.95  ? 1207 THR A C     1 
ATOM   3891  O  O     . THR A 1 559 ? -45.820 -2.101  -35.080 1.00 49.46  ? 1207 THR A O     1 
ATOM   3892  C  CB    . THR A 1 559 ? -46.857 -3.871  -32.676 1.00 49.30  ? 1207 THR A CB    1 
ATOM   3893  O  OG1   . THR A 1 559 ? -45.753 -4.321  -31.885 1.00 51.21  ? 1207 THR A OG1   1 
ATOM   3894  C  CG2   . THR A 1 559 ? -46.875 -4.624  -34.018 1.00 43.64  ? 1207 THR A CG2   1 
ATOM   3895  N  N     . ASN A 1 560 ? -44.387 -1.906  -33.370 1.00 41.59  ? 1208 ASN A N     1 
ATOM   3896  C  CA    . ASN A 1 560 ? -43.253 -1.748  -34.282 1.00 44.86  ? 1208 ASN A CA    1 
ATOM   3897  C  C     . ASN A 1 560 ? -42.817 -3.084  -34.892 1.00 44.66  ? 1208 ASN A C     1 
ATOM   3898  O  O     . ASN A 1 560 ? -43.361 -4.136  -34.547 1.00 44.20  ? 1208 ASN A O     1 
ATOM   3899  C  CB    . ASN A 1 560 ? -42.070 -1.036  -33.617 1.00 43.71  ? 1208 ASN A CB    1 
ATOM   3900  C  CG    . ASN A 1 560 ? -41.440 -1.850  -32.506 1.00 43.43  ? 1208 ASN A CG    1 
ATOM   3901  O  OD1   . ASN A 1 560 ? -41.925 -2.923  -32.149 1.00 42.38  ? 1208 ASN A OD1   1 
ATOM   3902  N  ND2   . ASN A 1 560 ? -40.344 -1.342  -31.955 1.00 43.99  ? 1208 ASN A ND2   1 
ATOM   3903  N  N     . SER A 1 561 ? -41.839 -3.040  -35.793 1.00 40.85  ? 1209 SER A N     1 
ATOM   3904  C  CA    . SER A 1 561 ? -41.405 -4.236  -36.512 1.00 41.81  ? 1209 SER A CA    1 
ATOM   3905  C  C     . SER A 1 561 ? -40.964 -5.386  -35.594 1.00 40.45  ? 1209 SER A C     1 
ATOM   3906  O  O     . SER A 1 561 ? -40.757 -6.508  -36.053 1.00 37.44  ? 1209 SER A O     1 
ATOM   3907  C  CB    . SER A 1 561 ? -40.294 -3.895  -37.515 1.00 41.81  ? 1209 SER A CB    1 
ATOM   3908  O  OG    . SER A 1 561 ? -39.105 -3.488  -36.858 1.00 41.54  ? 1209 SER A OG    1 
ATOM   3909  N  N     . LEU A 1 562 ? -40.822 -5.098  -34.305 1.00 39.50  ? 1210 LEU A N     1 
ATOM   3910  C  CA    . LEU A 1 562 ? -40.374 -6.088  -33.331 1.00 39.10  ? 1210 LEU A CA    1 
ATOM   3911  C  C     . LEU A 1 562 ? -41.519 -6.582  -32.465 1.00 38.46  ? 1210 LEU A C     1 
ATOM   3912  O  O     . LEU A 1 562 ? -41.300 -7.282  -31.473 1.00 35.32  ? 1210 LEU A O     1 
ATOM   3913  C  CB    . LEU A 1 562 ? -39.309 -5.486  -32.418 1.00 38.67  ? 1210 LEU A CB    1 
ATOM   3914  C  CG    . LEU A 1 562 ? -37.839 -5.609  -32.790 1.00 35.83  ? 1210 LEU A CG    1 
ATOM   3915  C  CD1   . LEU A 1 562 ? -37.629 -5.366  -34.264 1.00 35.92  ? 1210 LEU A CD1   1 
ATOM   3916  C  CD2   . LEU A 1 562 ? -37.046 -4.614  -31.973 1.00 39.38  ? 1210 LEU A CD2   1 
ATOM   3917  N  N     . GLY A 1 563 ? -42.736 -6.197  -32.826 1.00 39.17  ? 1211 GLY A N     1 
ATOM   3918  C  CA    . GLY A 1 563 ? -43.901 -6.565  -32.044 1.00 43.10  ? 1211 GLY A CA    1 
ATOM   3919  C  C     . GLY A 1 563 ? -43.887 -6.024  -30.624 1.00 44.22  ? 1211 GLY A C     1 
ATOM   3920  O  O     . GLY A 1 563 ? -44.197 -6.753  -29.673 1.00 48.00  ? 1211 GLY A O     1 
ATOM   3921  N  N     . GLN A 1 564 ? -43.513 -4.753  -30.477 1.00 41.09  ? 1212 GLN A N     1 
ATOM   3922  C  CA    . GLN A 1 564 ? -43.626 -4.063  -29.201 1.00 40.29  ? 1212 GLN A CA    1 
ATOM   3923  C  C     . GLN A 1 564 ? -44.870 -3.187  -29.247 1.00 42.72  ? 1212 GLN A C     1 
ATOM   3924  O  O     . GLN A 1 564 ? -45.036 -2.397  -30.174 1.00 43.89  ? 1212 GLN A O     1 
ATOM   3925  C  CB    . GLN A 1 564 ? -42.390 -3.205  -28.942 1.00 38.02  ? 1212 GLN A CB    1 
ATOM   3926  C  CG    . GLN A 1 564 ? -41.074 -3.921  -29.166 1.00 36.89  ? 1212 GLN A CG    1 
ATOM   3927  C  CD    . GLN A 1 564 ? -39.873 -3.118  -28.687 1.00 37.36  ? 1212 GLN A CD    1 
ATOM   3928  O  OE1   . GLN A 1 564 ? -39.124 -2.564  -29.489 1.00 38.18  ? 1212 GLN A OE1   1 
ATOM   3929  N  NE2   . GLN A 1 564 ? -39.679 -3.066  -27.376 1.00 34.55  ? 1212 GLN A NE2   1 
ATOM   3930  N  N     . ARG A 1 565 ? -45.748 -3.324  -28.258 1.00 42.83  ? 1213 ARG A N     1 
ATOM   3931  C  CA    . ARG A 1 565 ? -46.978 -2.529  -28.239 1.00 46.61  ? 1213 ARG A CA    1 
ATOM   3932  C  C     . ARG A 1 565 ? -46.738 -1.013  -28.153 1.00 47.78  ? 1213 ARG A C     1 
ATOM   3933  O  O     . ARG A 1 565 ? -46.202 -0.509  -27.163 1.00 44.75  ? 1213 ARG A O     1 
ATOM   3934  C  CB    . ARG A 1 565 ? -47.908 -2.962  -27.108 1.00 45.50  ? 1213 ARG A CB    1 
ATOM   3935  C  CG    . ARG A 1 565 ? -49.360 -3.022  -27.540 1.00 48.05  ? 1213 ARG A CG    1 
ATOM   3936  C  CD    . ARG A 1 565 ? -50.300 -3.082  -26.352 1.00 54.10  ? 1213 ARG A CD    1 
ATOM   3937  N  NE    . ARG A 1 565 ? -50.311 -1.813  -25.631 1.00 61.30  ? 1213 ARG A NE    1 
ATOM   3938  C  CZ    . ARG A 1 565 ? -50.936 -0.718  -26.060 1.00 57.59  ? 1213 ARG A CZ    1 
ATOM   3939  N  NH1   . ARG A 1 565 ? -51.603 -0.740  -27.213 1.00 57.14  ? 1213 ARG A NH1   1 
ATOM   3940  N  NH2   . ARG A 1 565 ? -50.890 0.400   -25.342 1.00 46.26  ? 1213 ARG A NH2   1 
ATOM   3941  N  N     . LEU A 1 566 ? -47.155 -0.300  -29.197 1.00 47.38  ? 1214 LEU A N     1 
ATOM   3942  C  CA    . LEU A 1 566 ? -47.077 1.155   -29.259 1.00 41.40  ? 1214 LEU A CA    1 
ATOM   3943  C  C     . LEU A 1 566 ? -48.074 1.818   -28.303 1.00 42.60  ? 1214 LEU A C     1 
ATOM   3944  O  O     . LEU A 1 566 ? -49.201 1.336   -28.150 1.00 44.55  ? 1214 LEU A O     1 
ATOM   3945  C  CB    . LEU A 1 566 ? -47.360 1.612   -30.691 1.00 41.84  ? 1214 LEU A CB    1 
ATOM   3946  C  CG    . LEU A 1 566 ? -46.174 1.974   -31.586 1.00 42.45  ? 1214 LEU A CG    1 
ATOM   3947  C  CD1   . LEU A 1 566 ? -45.014 1.031   -31.372 1.00 43.72  ? 1214 LEU A CD1   1 
ATOM   3948  C  CD2   . LEU A 1 566 ? -46.595 1.969   -33.043 1.00 44.83  ? 1214 LEU A CD2   1 
ATOM   3949  N  N     . PRO A 1 567 ? -47.655 2.921   -27.651 1.00 38.74  ? 1215 PRO A N     1 
ATOM   3950  C  CA    . PRO A 1 567 ? -48.485 3.786   -26.801 1.00 37.25  ? 1215 PRO A CA    1 
ATOM   3951  C  C     . PRO A 1 567 ? -49.600 4.478   -27.581 1.00 40.39  ? 1215 PRO A C     1 
ATOM   3952  O  O     . PRO A 1 567 ? -49.361 5.062   -28.634 1.00 40.09  ? 1215 PRO A O     1 
ATOM   3953  C  CB    . PRO A 1 567 ? -47.497 4.840   -26.314 1.00 34.51  ? 1215 PRO A CB    1 
ATOM   3954  C  CG    . PRO A 1 567 ? -46.200 4.202   -26.388 1.00 36.78  ? 1215 PRO A CG    1 
ATOM   3955  C  CD    . PRO A 1 567 ? -46.237 3.298   -27.573 1.00 38.26  ? 1215 PRO A CD    1 
ATOM   3956  N  N     . GLN A 1 568 ? -50.815 4.423   -27.055 1.00 41.57  ? 1216 GLN A N     1 
ATOM   3957  C  CA    . GLN A 1 568 ? -51.963 5.000   -27.737 1.00 41.96  ? 1216 GLN A CA    1 
ATOM   3958  C  C     . GLN A 1 568 ? -52.573 6.130   -26.913 1.00 42.63  ? 1216 GLN A C     1 
ATOM   3959  O  O     . GLN A 1 568 ? -52.493 6.116   -25.679 1.00 40.15  ? 1216 GLN A O     1 
ATOM   3960  C  CB    . GLN A 1 568 ? -53.008 3.914   -27.996 1.00 41.30  ? 1216 GLN A CB    1 
ATOM   3961  C  CG    . GLN A 1 568 ? -52.570 2.860   -28.982 1.00 39.85  ? 1216 GLN A CG    1 
ATOM   3962  C  CD    . GLN A 1 568 ? -52.271 3.432   -30.354 1.00 45.45  ? 1216 GLN A CD    1 
ATOM   3963  O  OE1   . GLN A 1 568 ? -51.547 2.829   -31.138 1.00 49.34  ? 1216 GLN A OE1   1 
ATOM   3964  N  NE2   . GLN A 1 568 ? -52.829 4.604   -30.651 1.00 49.88  ? 1216 GLN A NE2   1 
ATOM   3965  N  N     . LYS A 1 569 ? -53.174 7.109   -27.586 1.00 42.39  ? 1217 LYS A N     1 
ATOM   3966  C  CA    . LYS A 1 569 ? -53.838 8.191   -26.866 1.00 41.04  ? 1217 LYS A CA    1 
ATOM   3967  C  C     . LYS A 1 569 ? -54.609 7.585   -25.703 1.00 39.24  ? 1217 LYS A C     1 
ATOM   3968  O  O     . LYS A 1 569 ? -55.350 6.616   -25.883 1.00 36.47  ? 1217 LYS A O     1 
ATOM   3969  C  CB    . LYS A 1 569 ? -54.787 8.976   -27.774 1.00 40.06  ? 1217 LYS A CB    1 
ATOM   3970  C  CG    . LYS A 1 569 ? -54.109 9.760   -28.872 1.00 41.27  ? 1217 LYS A CG    1 
ATOM   3971  C  CD    . LYS A 1 569 ? -55.123 10.618  -29.609 1.00 45.08  ? 1217 LYS A CD    1 
ATOM   3972  C  CE    . LYS A 1 569 ? -54.475 11.397  -30.746 1.00 47.41  ? 1217 LYS A CE    1 
ATOM   3973  N  NZ    . LYS A 1 569 ? -55.474 12.212  -31.506 1.00 50.31  ? 1217 LYS A NZ    1 
ATOM   3974  N  N     . GLY A 1 570 ? -54.419 8.147   -24.513 1.00 37.69  ? 1218 GLY A N     1 
ATOM   3975  C  CA    . GLY A 1 570 ? -55.078 7.644   -23.324 1.00 37.56  ? 1218 GLY A CA    1 
ATOM   3976  C  C     . GLY A 1 570 ? -54.140 6.786   -22.504 1.00 37.22  ? 1218 GLY A C     1 
ATOM   3977  O  O     . GLY A 1 570 ? -54.274 6.663   -21.289 1.00 35.69  ? 1218 GLY A O     1 
ATOM   3978  N  N     . ASP A 1 571 ? -53.175 6.181   -23.177 1.00 39.16  ? 1219 ASP A N     1 
ATOM   3979  C  CA    . ASP A 1 571 ? -52.197 5.370   -22.483 1.00 39.49  ? 1219 ASP A CA    1 
ATOM   3980  C  C     . ASP A 1 571 ? -51.266 6.250   -21.664 1.00 36.95  ? 1219 ASP A C     1 
ATOM   3981  O  O     . ASP A 1 571 ? -51.066 6.011   -20.474 1.00 34.51  ? 1219 ASP A O     1 
ATOM   3982  C  CB    . ASP A 1 571 ? -51.411 4.517   -23.478 1.00 40.76  ? 1219 ASP A CB    1 
ATOM   3983  C  CG    . ASP A 1 571 ? -52.228 3.358   -24.019 1.00 45.10  ? 1219 ASP A CG    1 
ATOM   3984  O  OD1   . ASP A 1 571 ? -53.091 2.843   -23.273 1.00 44.37  ? 1219 ASP A OD1   1 
ATOM   3985  O  OD2   . ASP A 1 571 ? -52.008 2.960   -25.185 1.00 47.71  ? 1219 ASP A OD2   1 
ATOM   3986  N  N     . VAL A 1 572 ? -50.721 7.282   -22.305 1.00 36.82  ? 1220 VAL A N     1 
ATOM   3987  C  CA    . VAL A 1 572 ? -49.725 8.153   -21.679 1.00 36.93  ? 1220 VAL A CA    1 
ATOM   3988  C  C     . VAL A 1 572 ? -50.332 9.217   -20.768 1.00 36.07  ? 1220 VAL A C     1 
ATOM   3989  O  O     . VAL A 1 572 ? -51.096 10.069  -21.219 1.00 37.88  ? 1220 VAL A O     1 
ATOM   3990  C  CB    . VAL A 1 572 ? -48.876 8.880   -22.732 1.00 35.60  ? 1220 VAL A CB    1 
ATOM   3991  C  CG1   . VAL A 1 572 ? -47.712 9.585   -22.058 1.00 36.27  ? 1220 VAL A CG1   1 
ATOM   3992  C  CG2   . VAL A 1 572 ? -48.394 7.914   -23.807 1.00 32.20  ? 1220 VAL A CG2   1 
ATOM   3993  N  N     . GLU A 1 573 ? -49.977 9.180   -19.489 1.00 36.14  ? 1221 GLU A N     1 
ATOM   3994  C  CA    . GLU A 1 573 ? -50.487 10.167  -18.538 1.00 37.78  ? 1221 GLU A CA    1 
ATOM   3995  C  C     . GLU A 1 573 ? -49.469 11.263  -18.288 1.00 37.26  ? 1221 GLU A C     1 
ATOM   3996  O  O     . GLU A 1 573 ? -49.820 12.407  -18.029 1.00 37.83  ? 1221 GLU A O     1 
ATOM   3997  C  CB    . GLU A 1 573 ? -50.862 9.508   -17.216 1.00 36.63  ? 1221 GLU A CB    1 
ATOM   3998  C  CG    . GLU A 1 573 ? -52.175 8.770   -17.258 1.00 36.08  ? 1221 GLU A CG    1 
ATOM   3999  C  CD    . GLU A 1 573 ? -52.511 8.132   -15.930 1.00 40.92  ? 1221 GLU A CD    1 
ATOM   4000  O  OE1   . GLU A 1 573 ? -51.701 7.309   -15.437 1.00 39.66  ? 1221 GLU A OE1   1 
ATOM   4001  O  OE2   . GLU A 1 573 ? -53.583 8.463   -15.375 1.00 45.15  ? 1221 GLU A OE2   1 
ATOM   4002  N  N     . MET A 1 574 ? -48.199 10.896  -18.354 1.00 38.77  ? 1222 MET A N     1 
ATOM   4003  C  CA    . MET A 1 574 ? -47.125 11.856  -18.193 1.00 37.68  ? 1222 MET A CA    1 
ATOM   4004  C  C     . MET A 1 574 ? -46.093 11.658  -19.288 1.00 36.70  ? 1222 MET A C     1 
ATOM   4005  O  O     . MET A 1 574 ? -45.751 10.532  -19.636 1.00 35.18  ? 1222 MET A O     1 
ATOM   4006  C  CB    . MET A 1 574 ? -46.472 11.714  -16.822 1.00 36.56  ? 1222 MET A CB    1 
ATOM   4007  C  CG    . MET A 1 574 ? -45.251 12.589  -16.663 1.00 37.58  ? 1222 MET A CG    1 
ATOM   4008  S  SD    . MET A 1 574 ? -44.817 12.884  -14.946 1.00 44.24  ? 1222 MET A SD    1 
ATOM   4009  C  CE    . MET A 1 574 ? -43.972 14.452  -15.132 1.00 41.27  ? 1222 MET A CE    1 
ATOM   4010  N  N     . LEU A 1 575 ? -45.596 12.761  -19.827 1.00 34.23  ? 1223 LEU A N     1 
ATOM   4011  C  CA    . LEU A 1 575 ? -44.620 12.693  -20.891 1.00 34.46  ? 1223 LEU A CA    1 
ATOM   4012  C  C     . LEU A 1 575 ? -43.385 13.500  -20.515 1.00 34.83  ? 1223 LEU A C     1 
ATOM   4013  O  O     . LEU A 1 575 ? -43.423 14.723  -20.514 1.00 37.43  ? 1223 LEU A O     1 
ATOM   4014  C  CB    . LEU A 1 575 ? -45.245 13.226  -22.174 1.00 36.12  ? 1223 LEU A CB    1 
ATOM   4015  C  CG    . LEU A 1 575 ? -44.303 13.513  -23.336 1.00 36.90  ? 1223 LEU A CG    1 
ATOM   4016  C  CD1   . LEU A 1 575 ? -43.589 12.247  -23.726 1.00 36.27  ? 1223 LEU A CD1   1 
ATOM   4017  C  CD2   . LEU A 1 575 ? -45.092 14.070  -24.505 1.00 38.52  ? 1223 LEU A CD2   1 
ATOM   4018  N  N     . CYS A 1 576 ? -42.294 12.821  -20.183 1.00 30.60  ? 1224 CYS A N     1 
ATOM   4019  C  CA    . CYS A 1 576 ? -41.079 13.520  -19.803 1.00 31.74  ? 1224 CYS A CA    1 
ATOM   4020  C  C     . CYS A 1 576 ? -39.948 13.196  -20.756 1.00 33.18  ? 1224 CYS A C     1 
ATOM   4021  O  O     . CYS A 1 576 ? -39.894 12.113  -21.307 1.00 34.11  ? 1224 CYS A O     1 
ATOM   4022  C  CB    . CYS A 1 576 ? -40.687 13.191  -18.365 1.00 33.36  ? 1224 CYS A CB    1 
ATOM   4023  S  SG    . CYS A 1 576 ? -40.291 11.464  -18.041 1.00 40.22  ? 1224 CYS A SG    1 
ATOM   4024  N  N     . GLY A 1 577 ? -39.045 14.142  -20.963 1.00 35.37  ? 1225 GLY A N     1 
ATOM   4025  C  CA    . GLY A 1 577 ? -37.962 13.924  -21.898 1.00 36.66  ? 1225 GLY A CA    1 
ATOM   4026  C  C     . GLY A 1 577 ? -36.834 14.921  -21.778 1.00 38.02  ? 1225 GLY A C     1 
ATOM   4027  O  O     . GLY A 1 577 ? -36.955 15.928  -21.095 1.00 39.14  ? 1225 GLY A O     1 
ATOM   4028  N  N     . GLY A 1 578 ? -35.729 14.629  -22.448 1.00 39.03  ? 1226 GLY A N     1 
ATOM   4029  C  CA    . GLY A 1 578 ? -34.590 15.520  -22.476 1.00 39.35  ? 1226 GLY A CA    1 
ATOM   4030  C  C     . GLY A 1 578 ? -34.052 15.627  -23.884 1.00 39.30  ? 1226 GLY A C     1 
ATOM   4031  O  O     . GLY A 1 578 ? -32.991 15.092  -24.191 1.00 43.31  ? 1226 GLY A O     1 
ATOM   4032  N  N     . PRO A 1 579 ? -34.790 16.316  -24.754 1.00 38.97  ? 1227 PRO A N     1 
ATOM   4033  C  CA    . PRO A 1 579 ? -34.369 16.504  -26.142 1.00 44.00  ? 1227 PRO A CA    1 
ATOM   4034  C  C     . PRO A 1 579 ? -33.029 17.218  -26.206 1.00 49.46  ? 1227 PRO A C     1 
ATOM   4035  O  O     . PRO A 1 579 ? -32.838 18.231  -25.533 1.00 50.15  ? 1227 PRO A O     1 
ATOM   4036  C  CB    . PRO A 1 579 ? -35.457 17.415  -26.722 1.00 44.64  ? 1227 PRO A CB    1 
ATOM   4037  C  CG    . PRO A 1 579 ? -36.616 17.269  -25.819 1.00 42.62  ? 1227 PRO A CG    1 
ATOM   4038  C  CD    . PRO A 1 579 ? -36.045 17.021  -24.457 1.00 41.38  ? 1227 PRO A CD    1 
ATOM   4039  N  N     . PRO A 1 580 ? -32.098 16.692  -27.008 1.00 53.88  ? 1228 PRO A N     1 
ATOM   4040  C  CA    . PRO A 1 580 ? -30.827 17.373  -27.262 1.00 58.33  ? 1228 PRO A CA    1 
ATOM   4041  C  C     . PRO A 1 580 ? -31.038 18.578  -28.180 1.00 63.29  ? 1228 PRO A C     1 
ATOM   4042  O  O     . PRO A 1 580 ? -31.790 18.491  -29.155 1.00 57.10  ? 1228 PRO A O     1 
ATOM   4043  C  CB    . PRO A 1 580 ? -30.000 16.312  -27.993 1.00 57.16  ? 1228 PRO A CB    1 
ATOM   4044  C  CG    . PRO A 1 580 ? -30.710 15.021  -27.763 1.00 57.32  ? 1228 PRO A CG    1 
ATOM   4045  C  CD    . PRO A 1 580 ? -32.150 15.370  -27.645 1.00 51.65  ? 1228 PRO A CD    1 
ATOM   4046  N  N     . CYS A 1 581 ? -30.380 19.690  -27.871 1.00 68.56  ? 1229 CYS A N     1 
ATOM   4047  C  CA    . CYS A 1 581 ? -30.490 20.888  -28.698 1.00 72.95  ? 1229 CYS A CA    1 
ATOM   4048  C  C     . CYS A 1 581 ? -29.189 21.192  -29.431 1.00 78.29  ? 1229 CYS A C     1 
ATOM   4049  O  O     . CYS A 1 581 ? -29.010 22.287  -29.966 1.00 77.51  ? 1229 CYS A O     1 
ATOM   4050  C  CB    . CYS A 1 581 ? -30.922 22.094  -27.859 1.00 68.79  ? 1229 CYS A CB    1 
ATOM   4051  S  SG    . CYS A 1 581 ? -32.668 22.537  -28.057 1.00 73.44  ? 1229 CYS A SG    1 
ATOM   4052  N  N     . GLN A 1 582 ? -28.290 20.214  -29.462 1.00 79.06  ? 1230 GLN A N     1 
ATOM   4053  C  CA    . GLN A 1 582 ? -26.991 20.395  -30.101 1.00 84.23  ? 1230 GLN A CA    1 
ATOM   4054  C  C     . GLN A 1 582 ? -27.106 20.785  -31.579 1.00 85.13  ? 1230 GLN A C     1 
ATOM   4055  O  O     . GLN A 1 582 ? -26.198 21.414  -32.130 1.00 82.91  ? 1230 GLN A O     1 
ATOM   4056  C  CB    . GLN A 1 582 ? -26.118 19.144  -29.932 1.00 88.07  ? 1230 GLN A CB    1 
ATOM   4057  C  CG    . GLN A 1 582 ? -25.457 19.016  -28.555 1.00 93.67  ? 1230 GLN A CG    1 
ATOM   4058  C  CD    . GLN A 1 582 ? -26.253 18.152  -27.586 1.00 92.31  ? 1230 GLN A CD    1 
ATOM   4059  O  OE1   . GLN A 1 582 ? -27.365 17.715  -27.891 1.00 85.55  ? 1230 GLN A OE1   1 
ATOM   4060  N  NE2   . GLN A 1 582 ? -25.682 17.899  -26.411 1.00 96.24  ? 1230 GLN A NE2   1 
ATOM   4061  N  N     . GLY A 1 583 ? -28.222 20.429  -32.214 1.00 81.95  ? 1231 GLY A N     1 
ATOM   4062  C  CA    . GLY A 1 583 ? -28.441 20.767  -33.613 1.00 82.15  ? 1231 GLY A CA    1 
ATOM   4063  C  C     . GLY A 1 583 ? -28.316 22.253  -33.933 1.00 83.16  ? 1231 GLY A C     1 
ATOM   4064  O  O     . GLY A 1 583 ? -27.701 22.642  -34.928 1.00 83.71  ? 1231 GLY A O     1 
ATOM   4065  N  N     . PHE A 1 584 ? -28.894 23.087  -33.076 1.00 80.67  ? 1232 PHE A N     1 
ATOM   4066  C  CA    . PHE A 1 584 ? -28.959 24.527  -33.308 1.00 77.78  ? 1232 PHE A CA    1 
ATOM   4067  C  C     . PHE A 1 584 ? -28.702 25.297  -32.004 1.00 78.17  ? 1232 PHE A C     1 
ATOM   4068  O  O     . PHE A 1 584 ? -29.408 26.263  -31.693 1.00 73.96  ? 1232 PHE A O     1 
ATOM   4069  C  CB    . PHE A 1 584 ? -30.347 24.879  -33.840 1.00 76.73  ? 1232 PHE A CB    1 
ATOM   4070  C  CG    . PHE A 1 584 ? -31.450 24.414  -32.944 1.00 76.68  ? 1232 PHE A CG    1 
ATOM   4071  C  CD1   . PHE A 1 584 ? -31.880 23.094  -32.985 1.00 76.16  ? 1232 PHE A CD1   1 
ATOM   4072  C  CD2   . PHE A 1 584 ? -32.023 25.278  -32.026 1.00 69.42  ? 1232 PHE A CD2   1 
ATOM   4073  C  CE1   . PHE A 1 584 ? -32.878 22.649  -32.138 1.00 73.51  ? 1232 PHE A CE1   1 
ATOM   4074  C  CE2   . PHE A 1 584 ? -33.022 24.844  -31.177 1.00 68.63  ? 1232 PHE A CE2   1 
ATOM   4075  C  CZ    . PHE A 1 584 ? -33.453 23.527  -31.234 1.00 70.46  ? 1232 PHE A CZ    1 
ATOM   4076  N  N     . SER A 1 585 ? -27.701 24.861  -31.240 1.00 78.87  ? 1233 SER A N     1 
ATOM   4077  C  CA    . SER A 1 585 ? -27.359 25.519  -29.980 1.00 70.37  ? 1233 SER A CA    1 
ATOM   4078  C  C     . SER A 1 585 ? -26.658 26.854  -30.241 1.00 72.18  ? 1233 SER A C     1 
ATOM   4079  O  O     . SER A 1 585 ? -25.473 27.026  -29.939 1.00 72.36  ? 1233 SER A O     1 
ATOM   4080  C  CB    . SER A 1 585 ? -26.508 24.605  -29.081 1.00 70.13  ? 1233 SER A CB    1 
ATOM   4081  O  OG    . SER A 1 585 ? -25.169 24.481  -29.531 1.00 71.69  ? 1233 SER A OG    1 
ATOM   4082  N  N     . GLY A 1 586 ? -27.408 27.797  -30.804 1.00 70.02  ? 1234 GLY A N     1 
ATOM   4083  C  CA    . GLY A 1 586 ? -26.858 29.082  -31.183 1.00 71.76  ? 1234 GLY A CA    1 
ATOM   4084  C  C     . GLY A 1 586 ? -27.477 30.237  -30.428 1.00 69.57  ? 1234 GLY A C     1 
ATOM   4085  O  O     . GLY A 1 586 ? -28.641 30.179  -30.040 1.00 67.27  ? 1234 GLY A O     1 
ATOM   4086  N  N     . MET A 1 587 ? -26.688 31.291  -30.231 1.00 71.37  ? 1235 MET A N     1 
ATOM   4087  C  CA    . MET A 1 587 ? -27.122 32.466  -29.492 1.00 67.42  ? 1235 MET A CA    1 
ATOM   4088  C  C     . MET A 1 587 ? -27.622 33.581  -30.411 1.00 74.44  ? 1235 MET A C     1 
ATOM   4089  O  O     . MET A 1 587 ? -28.426 34.413  -29.990 1.00 75.72  ? 1235 MET A O     1 
ATOM   4090  C  CB    . MET A 1 587 ? -25.978 32.993  -28.622 1.00 72.26  ? 1235 MET A CB    1 
ATOM   4091  C  CG    . MET A 1 587 ? -25.608 32.097  -27.454 1.00 76.75  ? 1235 MET A CG    1 
ATOM   4092  S  SD    . MET A 1 587 ? -26.799 32.138  -26.091 1.00 77.53  ? 1235 MET A SD    1 
ATOM   4093  C  CE    . MET A 1 587 ? -26.166 30.821  -25.053 1.00 61.91  ? 1235 MET A CE    1 
ATOM   4094  N  N     . ASN A 1 588 ? -27.145 33.607  -31.657 1.00 75.70  ? 1236 ASN A N     1 
ATOM   4095  C  CA    . ASN A 1 588 ? -27.528 34.668  -32.595 1.00 75.81  ? 1236 ASN A CA    1 
ATOM   4096  C  C     . ASN A 1 588 ? -28.952 34.527  -33.122 1.00 72.53  ? 1236 ASN A C     1 
ATOM   4097  O  O     . ASN A 1 588 ? -29.577 33.489  -32.952 1.00 71.17  ? 1236 ASN A O     1 
ATOM   4098  C  CB    . ASN A 1 588 ? -26.534 34.773  -33.757 1.00 79.74  ? 1236 ASN A CB    1 
ATOM   4099  C  CG    . ASN A 1 588 ? -25.537 35.906  -33.571 1.00 82.54  ? 1236 ASN A CG    1 
ATOM   4100  O  OD1   . ASN A 1 588 ? -25.701 36.755  -32.692 1.00 82.09  ? 1236 ASN A OD1   1 
ATOM   4101  N  ND2   . ASN A 1 588 ? -24.504 35.931  -34.406 1.00 84.66  ? 1236 ASN A ND2   1 
ATOM   4102  N  N     . ARG A 1 589 ? -29.465 35.573  -33.760 1.00 76.16  ? 1237 ARG A N     1 
ATOM   4103  C  CA    . ARG A 1 589 ? -30.854 35.568  -34.218 1.00 78.96  ? 1237 ARG A CA    1 
ATOM   4104  C  C     . ARG A 1 589 ? -31.149 34.497  -35.276 1.00 81.14  ? 1237 ARG A C     1 
ATOM   4105  O  O     . ARG A 1 589 ? -30.284 34.133  -36.080 1.00 79.81  ? 1237 ARG A O     1 
ATOM   4106  C  CB    . ARG A 1 589 ? -31.272 36.955  -34.719 1.00 81.02  ? 1237 ARG A CB    1 
ATOM   4107  C  CG    . ARG A 1 589 ? -32.276 37.664  -33.812 1.00 83.69  ? 1237 ARG A CG    1 
ATOM   4108  C  CD    . ARG A 1 589 ? -32.444 39.143  -34.176 1.00 94.94  ? 1237 ARG A CD    1 
ATOM   4109  N  NE    . ARG A 1 589 ? -31.186 39.891  -34.088 1.00 100.60 ? 1237 ARG A NE    1 
ATOM   4110  C  CZ    . ARG A 1 589 ? -30.585 40.482  -35.119 1.00 101.92 ? 1237 ARG A CZ    1 
ATOM   4111  N  NH1   . ARG A 1 589 ? -31.126 40.429  -36.331 1.00 96.66  ? 1237 ARG A NH1   1 
ATOM   4112  N  NH2   . ARG A 1 589 ? -29.442 41.134  -34.936 1.00 104.08 ? 1237 ARG A NH2   1 
ATOM   4113  N  N     . PHE A 1 590 ? -32.378 33.987  -35.248 1.00 79.56  ? 1238 PHE A N     1 
ATOM   4114  C  CA    . PHE A 1 590 ? -32.858 33.056  -36.262 1.00 78.71  ? 1238 PHE A CA    1 
ATOM   4115  C  C     . PHE A 1 590 ? -32.756 33.694  -37.645 1.00 80.19  ? 1238 PHE A C     1 
ATOM   4116  O  O     . PHE A 1 590 ? -32.960 34.900  -37.796 1.00 77.36  ? 1238 PHE A O     1 
ATOM   4117  C  CB    . PHE A 1 590 ? -34.318 32.660  -35.983 1.00 75.63  ? 1238 PHE A CB    1 
ATOM   4118  C  CG    . PHE A 1 590 ? -34.473 31.405  -35.163 1.00 72.88  ? 1238 PHE A CG    1 
ATOM   4119  C  CD1   . PHE A 1 590 ? -35.523 31.266  -34.266 1.00 69.72  ? 1238 PHE A CD1   1 
ATOM   4120  C  CD2   . PHE A 1 590 ? -33.581 30.355  -35.304 1.00 75.00  ? 1238 PHE A CD2   1 
ATOM   4121  C  CE1   . PHE A 1 590 ? -35.666 30.107  -33.517 1.00 65.60  ? 1238 PHE A CE1   1 
ATOM   4122  C  CE2   . PHE A 1 590 ? -33.719 29.195  -34.558 1.00 70.72  ? 1238 PHE A CE2   1 
ATOM   4123  C  CZ    . PHE A 1 590 ? -34.761 29.072  -33.665 1.00 65.83  ? 1238 PHE A CZ    1 
ATOM   4124  N  N     . ASN A 1 591 ? -32.420 32.885  -38.646 1.00 82.72  ? 1239 ASN A N     1 
ATOM   4125  C  CA    . ASN A 1 591 ? -32.527 33.310  -40.042 1.00 85.16  ? 1239 ASN A CA    1 
ATOM   4126  C  C     . ASN A 1 591 ? -33.386 32.345  -40.864 1.00 87.28  ? 1239 ASN A C     1 
ATOM   4127  O  O     . ASN A 1 591 ? -34.170 31.576  -40.305 1.00 84.52  ? 1239 ASN A O     1 
ATOM   4128  C  CB    . ASN A 1 591 ? -31.150 33.540  -40.690 1.00 85.83  ? 1239 ASN A CB    1 
ATOM   4129  C  CG    . ASN A 1 591 ? -30.278 32.296  -40.692 1.00 88.00  ? 1239 ASN A CG    1 
ATOM   4130  O  OD1   . ASN A 1 591 ? -29.682 31.945  -39.673 1.00 89.37  ? 1239 ASN A OD1   1 
ATOM   4131  N  ND2   . ASN A 1 591 ? -30.183 31.634  -41.843 1.00 88.72  ? 1239 ASN A ND2   1 
ATOM   4132  N  N     . SER A 1 592 ? -33.236 32.399  -42.186 1.00 90.71  ? 1240 SER A N     1 
ATOM   4133  C  CA    . SER A 1 592 ? -34.058 31.607  -43.103 1.00 91.27  ? 1240 SER A CA    1 
ATOM   4134  C  C     . SER A 1 592 ? -33.921 30.101  -42.889 1.00 89.27  ? 1240 SER A C     1 
ATOM   4135  O  O     . SER A 1 592 ? -34.901 29.422  -42.571 1.00 85.69  ? 1240 SER A O     1 
ATOM   4136  C  CB    . SER A 1 592 ? -33.736 31.951  -44.564 1.00 93.78  ? 1240 SER A CB    1 
ATOM   4137  O  OG    . SER A 1 592 ? -32.742 32.961  -44.657 1.00 94.29  ? 1240 SER A OG    1 
ATOM   4138  N  N     . ARG A 1 593 ? -32.705 29.587  -43.068 1.00 89.80  ? 1241 ARG A N     1 
ATOM   4139  C  CA    . ARG A 1 593 ? -32.467 28.144  -43.014 1.00 91.52  ? 1241 ARG A CA    1 
ATOM   4140  C  C     . ARG A 1 593 ? -31.965 27.651  -41.653 1.00 87.38  ? 1241 ARG A C     1 
ATOM   4141  O  O     . ARG A 1 593 ? -31.851 26.439  -41.435 1.00 85.39  ? 1241 ARG A O     1 
ATOM   4142  C  CB    . ARG A 1 593 ? -31.527 27.689  -44.146 1.00 94.58  ? 1241 ARG A CB    1 
ATOM   4143  C  CG    . ARG A 1 593 ? -30.058 28.067  -43.971 1.00 94.49  ? 1241 ARG A CG    1 
ATOM   4144  C  CD    . ARG A 1 593 ? -29.202 27.590  -45.156 1.00 100.70 ? 1241 ARG A CD    1 
ATOM   4145  N  NE    . ARG A 1 593 ? -29.160 26.131  -45.298 1.00 104.64 ? 1241 ARG A NE    1 
ATOM   4146  C  CZ    . ARG A 1 593 ? -28.083 25.377  -45.077 1.00 102.16 ? 1241 ARG A CZ    1 
ATOM   4147  N  NH1   . ARG A 1 593 ? -26.940 25.936  -44.704 1.00 101.76 ? 1241 ARG A NH1   1 
ATOM   4148  N  NH2   . ARG A 1 593 ? -28.144 24.060  -45.235 1.00 98.10  ? 1241 ARG A NH2   1 
ATOM   4149  N  N     . THR A 1 594 ? -31.666 28.583  -40.749 1.00 85.86  ? 1242 THR A N     1 
ATOM   4150  C  CA    . THR A 1 594 ? -31.305 28.227  -39.380 1.00 83.45  ? 1242 THR A CA    1 
ATOM   4151  C  C     . THR A 1 594 ? -32.574 27.891  -38.604 1.00 80.45  ? 1242 THR A C     1 
ATOM   4152  O  O     . THR A 1 594 ? -32.569 27.039  -37.714 1.00 79.10  ? 1242 THR A O     1 
ATOM   4153  C  CB    . THR A 1 594 ? -30.550 29.370  -38.662 1.00 79.57  ? 1242 THR A CB    1 
ATOM   4154  O  OG1   . THR A 1 594 ? -29.406 28.841  -37.983 1.00 78.15  ? 1242 THR A OG1   1 
ATOM   4155  C  CG2   . THR A 1 594 ? -31.447 30.060  -37.654 1.00 78.50  ? 1242 THR A CG2   1 
ATOM   4156  N  N     . TYR A 1 595 ? -33.663 28.567  -38.957 1.00 79.54  ? 1243 TYR A N     1 
ATOM   4157  C  CA    . TYR A 1 595 ? -34.963 28.304  -38.353 1.00 77.37  ? 1243 TYR A CA    1 
ATOM   4158  C  C     . TYR A 1 595 ? -35.550 27.010  -38.899 1.00 74.77  ? 1243 TYR A C     1 
ATOM   4159  O  O     . TYR A 1 595 ? -36.376 26.371  -38.257 1.00 74.22  ? 1243 TYR A O     1 
ATOM   4160  C  CB    . TYR A 1 595 ? -35.914 29.464  -38.630 1.00 78.32  ? 1243 TYR A CB    1 
ATOM   4161  C  CG    . TYR A 1 595 ? -37.328 29.218  -38.163 1.00 77.69  ? 1243 TYR A CG    1 
ATOM   4162  C  CD1   . TYR A 1 595 ? -38.260 28.608  -38.997 1.00 80.05  ? 1243 TYR A CD1   1 
ATOM   4163  C  CD2   . TYR A 1 595 ? -37.733 29.595  -36.890 1.00 74.10  ? 1243 TYR A CD2   1 
ATOM   4164  C  CE1   . TYR A 1 595 ? -39.555 28.379  -38.573 1.00 81.85  ? 1243 TYR A CE1   1 
ATOM   4165  C  CE2   . TYR A 1 595 ? -39.023 29.376  -36.458 1.00 75.94  ? 1243 TYR A CE2   1 
ATOM   4166  C  CZ    . TYR A 1 595 ? -39.932 28.769  -37.301 1.00 81.79  ? 1243 TYR A CZ    1 
ATOM   4167  O  OH    . TYR A 1 595 ? -41.222 28.549  -36.870 1.00 83.31  ? 1243 TYR A OH    1 
ATOM   4168  N  N     . SER A 1 596 ? -35.122 26.637  -40.098 1.00 75.51  ? 1244 SER A N     1 
ATOM   4169  C  CA    . SER A 1 596 ? -35.543 25.386  -40.706 1.00 73.48  ? 1244 SER A CA    1 
ATOM   4170  C  C     . SER A 1 596 ? -34.903 24.219  -39.958 1.00 72.46  ? 1244 SER A C     1 
ATOM   4171  O  O     . SER A 1 596 ? -35.522 23.172  -39.767 1.00 69.61  ? 1244 SER A O     1 
ATOM   4172  C  CB    . SER A 1 596 ? -35.158 25.358  -42.181 1.00 73.41  ? 1244 SER A CB    1 
ATOM   4173  N  N     . LYS A 1 597 ? -33.658 24.413  -39.533 1.00 73.48  ? 1245 LYS A N     1 
ATOM   4174  C  CA    . LYS A 1 597 ? -32.944 23.408  -38.753 1.00 71.53  ? 1245 LYS A CA    1 
ATOM   4175  C  C     . LYS A 1 597 ? -33.672 23.164  -37.431 1.00 72.80  ? 1245 LYS A C     1 
ATOM   4176  O  O     . LYS A 1 597 ? -33.520 22.109  -36.800 1.00 71.46  ? 1245 LYS A O     1 
ATOM   4177  C  CB    . LYS A 1 597 ? -31.503 23.850  -38.498 1.00 67.73  ? 1245 LYS A CB    1 
ATOM   4178  N  N     . PHE A 1 598 ? -34.469 24.148  -37.023 1.00 71.11  ? 1246 PHE A N     1 
ATOM   4179  C  CA    . PHE A 1 598 ? -35.247 24.056  -35.792 1.00 67.84  ? 1246 PHE A CA    1 
ATOM   4180  C  C     . PHE A 1 598 ? -36.554 23.296  -36.004 1.00 64.48  ? 1246 PHE A C     1 
ATOM   4181  O  O     . PHE A 1 598 ? -36.857 22.353  -35.282 1.00 62.81  ? 1246 PHE A O     1 
ATOM   4182  C  CB    . PHE A 1 598 ? -35.530 25.452  -35.226 1.00 67.12  ? 1246 PHE A CB    1 
ATOM   4183  C  CG    . PHE A 1 598 ? -36.387 25.444  -33.989 1.00 63.09  ? 1246 PHE A CG    1 
ATOM   4184  C  CD1   . PHE A 1 598 ? -35.843 25.133  -32.755 1.00 62.76  ? 1246 PHE A CD1   1 
ATOM   4185  C  CD2   . PHE A 1 598 ? -37.736 25.751  -34.058 1.00 61.19  ? 1246 PHE A CD2   1 
ATOM   4186  C  CE1   . PHE A 1 598 ? -36.624 25.123  -31.614 1.00 58.37  ? 1246 PHE A CE1   1 
ATOM   4187  C  CE2   . PHE A 1 598 ? -38.524 25.745  -32.920 1.00 57.89  ? 1246 PHE A CE2   1 
ATOM   4188  C  CZ    . PHE A 1 598 ? -37.966 25.430  -31.696 1.00 56.08  ? 1246 PHE A CZ    1 
ATOM   4189  N  N     . LYS A 1 599 ? -37.328 23.709  -36.999 1.00 63.68  ? 1247 LYS A N     1 
ATOM   4190  C  CA    . LYS A 1 599 ? -38.609 23.075  -37.259 1.00 62.05  ? 1247 LYS A CA    1 
ATOM   4191  C  C     . LYS A 1 599 ? -38.429 21.566  -37.412 1.00 62.19  ? 1247 LYS A C     1 
ATOM   4192  O  O     . LYS A 1 599 ? -39.387 20.797  -37.316 1.00 61.68  ? 1247 LYS A O     1 
ATOM   4193  C  CB    . LYS A 1 599 ? -39.259 23.675  -38.501 1.00 63.32  ? 1247 LYS A CB    1 
ATOM   4194  N  N     . ASN A 1 600 ? -37.191 21.144  -37.639 1.00 61.34  ? 1248 ASN A N     1 
ATOM   4195  C  CA    . ASN A 1 600 ? -36.902 19.731  -37.817 1.00 64.61  ? 1248 ASN A CA    1 
ATOM   4196  C  C     . ASN A 1 600 ? -36.105 19.160  -36.650 1.00 66.49  ? 1248 ASN A C     1 
ATOM   4197  O  O     . ASN A 1 600 ? -35.626 18.023  -36.699 1.00 69.42  ? 1248 ASN A O     1 
ATOM   4198  C  CB    . ASN A 1 600 ? -36.176 19.494  -39.146 1.00 69.10  ? 1248 ASN A CB    1 
ATOM   4199  C  CG    . ASN A 1 600 ? -37.034 19.851  -40.353 1.00 67.41  ? 1248 ASN A CG    1 
ATOM   4200  O  OD1   . ASN A 1 600 ? -37.953 19.112  -40.718 1.00 62.39  ? 1248 ASN A OD1   1 
ATOM   4201  N  ND2   . ASN A 1 600 ? -36.736 20.989  -40.979 1.00 67.12  ? 1248 ASN A ND2   1 
ATOM   4202  N  N     . SER A 1 601 ? -35.979 19.953  -35.593 1.00 63.03  ? 1249 SER A N     1 
ATOM   4203  C  CA    . SER A 1 601 ? -35.248 19.544  -34.400 1.00 59.64  ? 1249 SER A CA    1 
ATOM   4204  C  C     . SER A 1 601 ? -35.952 18.451  -33.602 1.00 55.13  ? 1249 SER A C     1 
ATOM   4205  O  O     . SER A 1 601 ? -37.081 18.058  -33.907 1.00 55.26  ? 1249 SER A O     1 
ATOM   4206  C  CB    . SER A 1 601 ? -35.032 20.745  -33.490 1.00 60.29  ? 1249 SER A CB    1 
ATOM   4207  O  OG    . SER A 1 601 ? -36.270 21.212  -32.992 1.00 57.75  ? 1249 SER A OG    1 
ATOM   4208  N  N     . LEU A 1 602 ? -35.270 17.984  -32.563 1.00 54.28  ? 1250 LEU A N     1 
ATOM   4209  C  CA    . LEU A 1 602 ? -35.786 16.938  -31.686 1.00 51.74  ? 1250 LEU A CA    1 
ATOM   4210  C  C     . LEU A 1 602 ? -36.780 17.493  -30.679 1.00 50.10  ? 1250 LEU A C     1 
ATOM   4211  O  O     . LEU A 1 602 ? -37.744 16.823  -30.303 1.00 48.84  ? 1250 LEU A O     1 
ATOM   4212  C  CB    . LEU A 1 602 ? -34.636 16.266  -30.942 1.00 48.04  ? 1250 LEU A CB    1 
ATOM   4213  C  CG    . LEU A 1 602 ? -33.912 15.190  -31.738 1.00 47.75  ? 1250 LEU A CG    1 
ATOM   4214  C  CD1   . LEU A 1 602 ? -32.767 14.626  -30.923 1.00 51.42  ? 1250 LEU A CD1   1 
ATOM   4215  C  CD2   . LEU A 1 602 ? -34.896 14.101  -32.121 1.00 48.07  ? 1250 LEU A CD2   1 
ATOM   4216  N  N     . VAL A 1 603 ? -36.526 18.715  -30.228 1.00 48.55  ? 1251 VAL A N     1 
ATOM   4217  C  CA    . VAL A 1 603 ? -37.437 19.382  -29.317 1.00 48.22  ? 1251 VAL A CA    1 
ATOM   4218  C  C     . VAL A 1 603 ? -38.804 19.563  -29.980 1.00 48.61  ? 1251 VAL A C     1 
ATOM   4219  O  O     . VAL A 1 603 ? -39.841 19.463  -29.329 1.00 46.97  ? 1251 VAL A O     1 
ATOM   4220  C  CB    . VAL A 1 603 ? -36.868 20.733  -28.840 1.00 47.06  ? 1251 VAL A CB    1 
ATOM   4221  C  CG1   . VAL A 1 603 ? -35.698 21.145  -29.708 1.00 50.30  ? 1251 VAL A CG1   1 
ATOM   4222  C  CG2   . VAL A 1 603 ? -37.953 21.802  -28.833 1.00 46.08  ? 1251 VAL A CG2   1 
ATOM   4223  N  N     . VAL A 1 604 ? -38.804 19.806  -31.285 1.00 50.13  ? 1252 VAL A N     1 
ATOM   4224  C  CA    . VAL A 1 604 ? -40.056 19.941  -32.017 1.00 49.26  ? 1252 VAL A CA    1 
ATOM   4225  C  C     . VAL A 1 604 ? -40.757 18.587  -32.132 1.00 45.97  ? 1252 VAL A C     1 
ATOM   4226  O  O     . VAL A 1 604 ? -41.978 18.522  -32.268 1.00 44.49  ? 1252 VAL A O     1 
ATOM   4227  C  CB    . VAL A 1 604 ? -39.834 20.570  -33.410 1.00 51.31  ? 1252 VAL A CB    1 
ATOM   4228  C  CG1   . VAL A 1 604 ? -41.137 20.644  -34.176 1.00 47.54  ? 1252 VAL A CG1   1 
ATOM   4229  C  CG2   . VAL A 1 604 ? -39.235 21.953  -33.264 1.00 50.80  ? 1252 VAL A CG2   1 
ATOM   4230  N  N     . SER A 1 605 ? -39.981 17.509  -32.069 1.00 45.81  ? 1253 SER A N     1 
ATOM   4231  C  CA    . SER A 1 605 ? -40.551 16.167  -32.067 1.00 44.00  ? 1253 SER A CA    1 
ATOM   4232  C  C     . SER A 1 605 ? -41.191 15.911  -30.720 1.00 42.46  ? 1253 SER A C     1 
ATOM   4233  O  O     . SER A 1 605 ? -42.295 15.381  -30.637 1.00 42.48  ? 1253 SER A O     1 
ATOM   4234  C  CB    . SER A 1 605 ? -39.481 15.115  -32.334 1.00 47.00  ? 1253 SER A CB    1 
ATOM   4235  O  OG    . SER A 1 605 ? -38.818 15.366  -33.557 1.00 52.89  ? 1253 SER A OG    1 
ATOM   4236  N  N     . PHE A 1 606 ? -40.488 16.301  -29.664 1.00 41.78  ? 1254 PHE A N     1 
ATOM   4237  C  CA    . PHE A 1 606 ? -41.016 16.191  -28.315 1.00 40.72  ? 1254 PHE A CA    1 
ATOM   4238  C  C     . PHE A 1 606 ? -42.401 16.829  -28.235 1.00 39.23  ? 1254 PHE A C     1 
ATOM   4239  O  O     . PHE A 1 606 ? -43.326 16.243  -27.689 1.00 38.17  ? 1254 PHE A O     1 
ATOM   4240  C  CB    . PHE A 1 606 ? -40.054 16.841  -27.319 1.00 40.80  ? 1254 PHE A CB    1 
ATOM   4241  C  CG    . PHE A 1 606 ? -40.204 16.342  -25.908 1.00 38.03  ? 1254 PHE A CG    1 
ATOM   4242  C  CD1   . PHE A 1 606 ? -40.340 14.991  -25.647 1.00 36.75  ? 1254 PHE A CD1   1 
ATOM   4243  C  CD2   . PHE A 1 606 ? -40.185 17.224  -24.841 1.00 37.58  ? 1254 PHE A CD2   1 
ATOM   4244  C  CE1   . PHE A 1 606 ? -40.470 14.531  -24.347 1.00 37.80  ? 1254 PHE A CE1   1 
ATOM   4245  C  CE2   . PHE A 1 606 ? -40.309 16.768  -23.540 1.00 38.54  ? 1254 PHE A CE2   1 
ATOM   4246  C  CZ    . PHE A 1 606 ? -40.453 15.421  -23.294 1.00 37.31  ? 1254 PHE A CZ    1 
ATOM   4247  N  N     . LEU A 1 607 ? -42.545 18.021  -28.806 1.00 40.24  ? 1255 LEU A N     1 
ATOM   4248  C  CA    . LEU A 1 607 ? -43.814 18.746  -28.769 1.00 39.82  ? 1255 LEU A CA    1 
ATOM   4249  C  C     . LEU A 1 607 ? -44.897 18.068  -29.601 1.00 41.57  ? 1255 LEU A C     1 
ATOM   4250  O  O     . LEU A 1 607 ? -46.084 18.147  -29.273 1.00 40.88  ? 1255 LEU A O     1 
ATOM   4251  C  CB    . LEU A 1 607 ? -43.621 20.183  -29.241 1.00 39.78  ? 1255 LEU A CB    1 
ATOM   4252  C  CG    . LEU A 1 607 ? -42.490 20.916  -28.530 1.00 39.99  ? 1255 LEU A CG    1 
ATOM   4253  C  CD1   . LEU A 1 607 ? -42.440 22.367  -28.952 1.00 39.05  ? 1255 LEU A CD1   1 
ATOM   4254  C  CD2   . LEU A 1 607 ? -42.674 20.799  -27.042 1.00 36.14  ? 1255 LEU A CD2   1 
ATOM   4255  N  N     . SER A 1 608 ? -44.482 17.408  -30.681 1.00 43.96  ? 1256 SER A N     1 
ATOM   4256  C  CA    . SER A 1 608 ? -45.403 16.640  -31.520 1.00 43.02  ? 1256 SER A CA    1 
ATOM   4257  C  C     . SER A 1 608 ? -45.938 15.441  -30.755 1.00 41.53  ? 1256 SER A C     1 
ATOM   4258  O  O     . SER A 1 608 ? -47.060 14.997  -30.981 1.00 40.67  ? 1256 SER A O     1 
ATOM   4259  C  CB    . SER A 1 608 ? -44.719 16.187  -32.808 1.00 42.75  ? 1256 SER A CB    1 
ATOM   4260  O  OG    . SER A 1 608 ? -44.666 17.241  -33.752 1.00 45.08  ? 1256 SER A OG    1 
ATOM   4261  N  N     . TYR A 1 609 ? -45.118 14.927  -29.846 1.00 40.43  ? 1257 TYR A N     1 
ATOM   4262  C  CA    . TYR A 1 609 ? -45.550 13.901  -28.916 1.00 39.94  ? 1257 TYR A CA    1 
ATOM   4263  C  C     . TYR A 1 609 ? -46.537 14.468  -27.921 1.00 39.55  ? 1257 TYR A C     1 
ATOM   4264  O  O     . TYR A 1 609 ? -47.568 13.861  -27.646 1.00 41.17  ? 1257 TYR A O     1 
ATOM   4265  C  CB    . TYR A 1 609 ? -44.354 13.337  -28.162 1.00 40.24  ? 1257 TYR A CB    1 
ATOM   4266  C  CG    . TYR A 1 609 ? -43.723 12.155  -28.840 1.00 41.88  ? 1257 TYR A CG    1 
ATOM   4267  C  CD1   . TYR A 1 609 ? -43.841 10.881  -28.295 1.00 42.88  ? 1257 TYR A CD1   1 
ATOM   4268  C  CD2   . TYR A 1 609 ? -43.020 12.304  -30.030 1.00 39.70  ? 1257 TYR A CD2   1 
ATOM   4269  C  CE1   . TYR A 1 609 ? -43.266 9.786   -28.909 1.00 42.87  ? 1257 TYR A CE1   1 
ATOM   4270  C  CE2   . TYR A 1 609 ? -42.443 11.221  -30.651 1.00 43.17  ? 1257 TYR A CE2   1 
ATOM   4271  C  CZ    . TYR A 1 609 ? -42.570 9.959   -30.085 1.00 46.92  ? 1257 TYR A CZ    1 
ATOM   4272  O  OH    . TYR A 1 609 ? -42.001 8.863   -30.689 1.00 46.57  ? 1257 TYR A OH    1 
ATOM   4273  N  N     . CYS A 1 610 ? -46.209 15.630  -27.370 1.00 37.95  ? 1258 CYS A N     1 
ATOM   4274  C  CA    . CYS A 1 610 ? -47.085 16.274  -26.410 1.00 37.96  ? 1258 CYS A CA    1 
ATOM   4275  C  C     . CYS A 1 610 ? -48.395 16.606  -27.089 1.00 40.75  ? 1258 CYS A C     1 
ATOM   4276  O  O     . CYS A 1 610 ? -49.476 16.422  -26.521 1.00 40.84  ? 1258 CYS A O     1 
ATOM   4277  C  CB    . CYS A 1 610 ? -46.451 17.548  -25.859 1.00 38.52  ? 1258 CYS A CB    1 
ATOM   4278  S  SG    . CYS A 1 610 ? -47.300 18.205  -24.407 1.00 42.26  ? 1258 CYS A SG    1 
ATOM   4279  N  N     . ASP A 1 611 ? -48.293 17.091  -28.318 1.00 40.49  ? 1259 ASP A N     1 
ATOM   4280  C  CA    . ASP A 1 611 ? -49.474 17.465  -29.071 1.00 41.66  ? 1259 ASP A CA    1 
ATOM   4281  C  C     . ASP A 1 611 ? -50.365 16.255  -29.313 1.00 42.76  ? 1259 ASP A C     1 
ATOM   4282  O  O     . ASP A 1 611 ? -51.582 16.351  -29.195 1.00 43.80  ? 1259 ASP A O     1 
ATOM   4283  C  CB    . ASP A 1 611 ? -49.073 18.098  -30.397 1.00 44.70  ? 1259 ASP A CB    1 
ATOM   4284  C  CG    . ASP A 1 611 ? -50.264 18.583  -31.192 1.00 48.06  ? 1259 ASP A CG    1 
ATOM   4285  O  OD1   . ASP A 1 611 ? -51.134 19.259  -30.608 1.00 47.87  ? 1259 ASP A OD1   1 
ATOM   4286  O  OD2   . ASP A 1 611 ? -50.328 18.278  -32.401 1.00 51.62  ? 1259 ASP A OD2   1 
ATOM   4287  N  N     . TYR A 1 612 ? -49.749 15.118  -29.645 1.00 43.54  ? 1260 TYR A N     1 
ATOM   4288  C  CA    . TYR A 1 612 ? -50.482 13.886  -29.950 1.00 42.27  ? 1260 TYR A CA    1 
ATOM   4289  C  C     . TYR A 1 612 ? -51.060 13.186  -28.727 1.00 39.87  ? 1260 TYR A C     1 
ATOM   4290  O  O     . TYR A 1 612 ? -52.248 12.873  -28.688 1.00 40.40  ? 1260 TYR A O     1 
ATOM   4291  C  CB    . TYR A 1 612 ? -49.613 12.887  -30.724 1.00 44.18  ? 1260 TYR A CB    1 
ATOM   4292  C  CG    . TYR A 1 612 ? -50.393 11.666  -31.169 1.00 45.62  ? 1260 TYR A CG    1 
ATOM   4293  C  CD1   . TYR A 1 612 ? -50.430 10.517  -30.393 1.00 45.05  ? 1260 TYR A CD1   1 
ATOM   4294  C  CD2   . TYR A 1 612 ? -51.119 11.675  -32.353 1.00 46.37  ? 1260 TYR A CD2   1 
ATOM   4295  C  CE1   . TYR A 1 612 ? -51.160 9.406   -30.788 1.00 45.86  ? 1260 TYR A CE1   1 
ATOM   4296  C  CE2   . TYR A 1 612 ? -51.849 10.570  -32.757 1.00 48.22  ? 1260 TYR A CE2   1 
ATOM   4297  C  CZ    . TYR A 1 612 ? -51.867 9.439   -31.969 1.00 48.45  ? 1260 TYR A CZ    1 
ATOM   4298  O  OH    . TYR A 1 612 ? -52.592 8.338   -32.364 1.00 48.73  ? 1260 TYR A OH    1 
ATOM   4299  N  N     . TYR A 1 613 ? -50.225 12.925  -27.732 1.00 38.04  ? 1261 TYR A N     1 
ATOM   4300  C  CA    . TYR A 1 613 ? -50.699 12.168  -26.582 1.00 39.96  ? 1261 TYR A CA    1 
ATOM   4301  C  C     . TYR A 1 613 ? -51.552 12.972  -25.611 1.00 40.71  ? 1261 TYR A C     1 
ATOM   4302  O  O     . TYR A 1 613 ? -52.437 12.418  -24.964 1.00 39.36  ? 1261 TYR A O     1 
ATOM   4303  C  CB    . TYR A 1 613 ? -49.547 11.463  -25.866 1.00 37.84  ? 1261 TYR A CB    1 
ATOM   4304  C  CG    . TYR A 1 613 ? -49.010 10.295  -26.671 1.00 43.18  ? 1261 TYR A CG    1 
ATOM   4305  C  CD1   . TYR A 1 613 ? -47.759 10.357  -27.277 1.00 41.41  ? 1261 TYR A CD1   1 
ATOM   4306  C  CD2   . TYR A 1 613 ? -49.770 9.141   -26.856 1.00 39.56  ? 1261 TYR A CD2   1 
ATOM   4307  C  CE1   . TYR A 1 613 ? -47.276 9.306   -28.021 1.00 38.43  ? 1261 TYR A CE1   1 
ATOM   4308  C  CE2   . TYR A 1 613 ? -49.289 8.088   -27.599 1.00 38.04  ? 1261 TYR A CE2   1 
ATOM   4309  C  CZ    . TYR A 1 613 ? -48.044 8.177   -28.179 1.00 38.19  ? 1261 TYR A CZ    1 
ATOM   4310  O  OH    . TYR A 1 613 ? -47.554 7.134   -28.920 1.00 40.26  ? 1261 TYR A OH    1 
ATOM   4311  N  N     . ARG A 1 614 ? -51.303 14.278  -25.532 1.00 41.05  ? 1262 ARG A N     1 
ATOM   4312  C  CA    . ARG A 1 614 ? -52.005 15.139  -24.583 1.00 38.91  ? 1262 ARG A CA    1 
ATOM   4313  C  C     . ARG A 1 614 ? -51.979 14.553  -23.177 1.00 35.86  ? 1262 ARG A C     1 
ATOM   4314  O  O     . ARG A 1 614 ? -53.020 14.214  -22.622 1.00 36.61  ? 1262 ARG A O     1 
ATOM   4315  C  CB    . ARG A 1 614 ? -53.453 15.366  -25.023 1.00 40.26  ? 1262 ARG A CB    1 
ATOM   4316  C  CG    . ARG A 1 614 ? -53.592 16.078  -26.356 1.00 40.64  ? 1262 ARG A CG    1 
ATOM   4317  C  CD    . ARG A 1 614 ? -53.196 17.522  -26.232 1.00 41.24  ? 1262 ARG A CD    1 
ATOM   4318  N  NE    . ARG A 1 614 ? -53.156 18.209  -27.517 1.00 43.89  ? 1262 ARG A NE    1 
ATOM   4319  C  CZ    . ARG A 1 614 ? -54.195 18.831  -28.060 1.00 44.68  ? 1262 ARG A CZ    1 
ATOM   4320  N  NH1   . ARG A 1 614 ? -54.068 19.438  -29.230 1.00 45.11  ? 1262 ARG A NH1   1 
ATOM   4321  N  NH2   . ARG A 1 614 ? -55.364 18.844  -27.435 1.00 44.97  ? 1262 ARG A NH2   1 
ATOM   4322  N  N     . PRO A 1 615 ? -50.782 14.434  -22.597 1.00 34.55  ? 1263 PRO A N     1 
ATOM   4323  C  CA    . PRO A 1 615 ? -50.641 13.926  -21.231 1.00 36.27  ? 1263 PRO A CA    1 
ATOM   4324  C  C     . PRO A 1 615 ? -51.196 14.897  -20.194 1.00 36.30  ? 1263 PRO A C     1 
ATOM   4325  O  O     . PRO A 1 615 ? -51.326 16.085  -20.473 1.00 36.69  ? 1263 PRO A O     1 
ATOM   4326  C  CB    . PRO A 1 615 ? -49.126 13.817  -21.065 1.00 35.36  ? 1263 PRO A CB    1 
ATOM   4327  C  CG    . PRO A 1 615 ? -48.565 14.789  -22.036 1.00 33.23  ? 1263 PRO A CG    1 
ATOM   4328  C  CD    . PRO A 1 615 ? -49.481 14.752  -23.205 1.00 34.41  ? 1263 PRO A CD    1 
ATOM   4329  N  N     . ARG A 1 616 ? -51.516 14.398  -19.007 1.00 35.09  ? 1264 ARG A N     1 
ATOM   4330  C  CA    . ARG A 1 616 ? -51.857 15.279  -17.900 1.00 34.88  ? 1264 ARG A CA    1 
ATOM   4331  C  C     . ARG A 1 616 ? -50.657 16.159  -17.542 1.00 35.34  ? 1264 ARG A C     1 
ATOM   4332  O  O     . ARG A 1 616 ? -50.811 17.322  -17.168 1.00 35.22  ? 1264 ARG A O     1 
ATOM   4333  C  CB    . ARG A 1 616 ? -52.309 14.469  -16.689 1.00 33.67  ? 1264 ARG A CB    1 
ATOM   4334  C  CG    . ARG A 1 616 ? -53.433 13.513  -17.002 1.00 35.48  ? 1264 ARG A CG    1 
ATOM   4335  C  CD    . ARG A 1 616 ? -54.476 13.485  -15.908 1.00 35.53  ? 1264 ARG A CD    1 
ATOM   4336  N  NE    . ARG A 1 616 ? -54.102 12.648  -14.775 1.00 35.61  ? 1264 ARG A NE    1 
ATOM   4337  C  CZ    . ARG A 1 616 ? -54.006 13.085  -13.521 1.00 41.08  ? 1264 ARG A CZ    1 
ATOM   4338  N  NH1   . ARG A 1 616 ? -54.246 14.357  -13.232 1.00 37.28  ? 1264 ARG A NH1   1 
ATOM   4339  N  NH2   . ARG A 1 616 ? -53.672 12.250  -12.545 1.00 44.34  ? 1264 ARG A NH2   1 
ATOM   4340  N  N     . PHE A 1 617 ? -49.459 15.602  -17.675 1.00 34.56  ? 1265 PHE A N     1 
ATOM   4341  C  CA    . PHE A 1 617 ? -48.251 16.353  -17.367 1.00 34.24  ? 1265 PHE A CA    1 
ATOM   4342  C  C     . PHE A 1 617 ? -47.180 16.252  -18.450 1.00 35.46  ? 1265 PHE A C     1 
ATOM   4343  O  O     . PHE A 1 617 ? -47.149 15.301  -19.229 1.00 38.00  ? 1265 PHE A O     1 
ATOM   4344  C  CB    . PHE A 1 617 ? -47.714 15.946  -15.999 1.00 33.59  ? 1265 PHE A CB    1 
ATOM   4345  C  CG    . PHE A 1 617 ? -48.643 16.293  -14.883 1.00 35.95  ? 1265 PHE A CG    1 
ATOM   4346  C  CD1   . PHE A 1 617 ? -48.475 17.451  -14.160 1.00 38.66  ? 1265 PHE A CD1   1 
ATOM   4347  C  CD2   . PHE A 1 617 ? -49.720 15.485  -14.586 1.00 37.77  ? 1265 PHE A CD2   1 
ATOM   4348  C  CE1   . PHE A 1 617 ? -49.349 17.777  -13.143 1.00 38.62  ? 1265 PHE A CE1   1 
ATOM   4349  C  CE2   . PHE A 1 617 ? -50.591 15.813  -13.570 1.00 36.19  ? 1265 PHE A CE2   1 
ATOM   4350  C  CZ    . PHE A 1 617 ? -50.405 16.955  -12.853 1.00 35.30  ? 1265 PHE A CZ    1 
ATOM   4351  N  N     . PHE A 1 618 ? -46.308 17.250  -18.492 1.00 32.20  ? 1266 PHE A N     1 
ATOM   4352  C  CA    . PHE A 1 618 ? -45.306 17.363  -19.531 1.00 32.02  ? 1266 PHE A CA    1 
ATOM   4353  C  C     . PHE A 1 618 ? -44.077 17.990  -18.916 1.00 33.55  ? 1266 PHE A C     1 
ATOM   4354  O  O     . PHE A 1 618 ? -44.158 19.057  -18.313 1.00 33.86  ? 1266 PHE A O     1 
ATOM   4355  C  CB    . PHE A 1 618 ? -45.842 18.237  -20.668 1.00 34.48  ? 1266 PHE A CB    1 
ATOM   4356  C  CG    . PHE A 1 618 ? -44.799 18.661  -21.670 1.00 36.42  ? 1266 PHE A CG    1 
ATOM   4357  C  CD1   . PHE A 1 618 ? -43.990 19.759  -21.431 1.00 34.48  ? 1266 PHE A CD1   1 
ATOM   4358  C  CD2   . PHE A 1 618 ? -44.647 17.978  -22.867 1.00 37.54  ? 1266 PHE A CD2   1 
ATOM   4359  C  CE1   . PHE A 1 618 ? -43.044 20.148  -22.353 1.00 33.89  ? 1266 PHE A CE1   1 
ATOM   4360  C  CE2   . PHE A 1 618 ? -43.694 18.371  -23.793 1.00 35.43  ? 1266 PHE A CE2   1 
ATOM   4361  C  CZ    . PHE A 1 618 ? -42.897 19.449  -23.534 1.00 33.64  ? 1266 PHE A CZ    1 
ATOM   4362  N  N     . LEU A 1 619 ? -42.939 17.323  -19.056 1.00 32.75  ? 1267 LEU A N     1 
ATOM   4363  C  CA    . LEU A 1 619 ? -41.696 17.841  -18.513 1.00 33.22  ? 1267 LEU A CA    1 
ATOM   4364  C  C     . LEU A 1 619 ? -40.598 17.824  -19.568 1.00 35.04  ? 1267 LEU A C     1 
ATOM   4365  O  O     . LEU A 1 619 ? -40.208 16.761  -20.035 1.00 37.08  ? 1267 LEU A O     1 
ATOM   4366  C  CB    . LEU A 1 619 ? -41.262 17.001  -17.318 1.00 31.93  ? 1267 LEU A CB    1 
ATOM   4367  C  CG    . LEU A 1 619 ? -40.254 17.637  -16.358 1.00 32.54  ? 1267 LEU A CG    1 
ATOM   4368  C  CD1   . LEU A 1 619 ? -39.289 16.603  -15.842 1.00 33.38  ? 1267 LEU A CD1   1 
ATOM   4369  C  CD2   . LEU A 1 619 ? -39.487 18.751  -17.010 1.00 34.56  ? 1267 LEU A CD2   1 
ATOM   4370  N  N     . LEU A 1 620 ? -40.103 18.999  -19.947 1.00 31.65  ? 1268 LEU A N     1 
ATOM   4371  C  CA    . LEU A 1 620 ? -38.938 19.078  -20.817 1.00 32.15  ? 1268 LEU A CA    1 
ATOM   4372  C  C     . LEU A 1 620 ? -37.766 19.619  -20.014 1.00 34.06  ? 1268 LEU A C     1 
ATOM   4373  O  O     . LEU A 1 620 ? -37.847 20.707  -19.455 1.00 35.02  ? 1268 LEU A O     1 
ATOM   4374  C  CB    . LEU A 1 620 ? -39.221 19.976  -22.024 1.00 33.78  ? 1268 LEU A CB    1 
ATOM   4375  C  CG    . LEU A 1 620 ? -38.196 20.027  -23.167 1.00 37.70  ? 1268 LEU A CG    1 
ATOM   4376  C  CD1   . LEU A 1 620 ? -38.811 20.686  -24.387 1.00 39.19  ? 1268 LEU A CD1   1 
ATOM   4377  C  CD2   . LEU A 1 620 ? -36.915 20.760  -22.786 1.00 37.46  ? 1268 LEU A CD2   1 
ATOM   4378  N  N     . GLU A 1 621 ? -36.682 18.856  -19.941 1.00 34.80  ? 1269 GLU A N     1 
ATOM   4379  C  CA    . GLU A 1 621 ? -35.482 19.313  -19.250 1.00 34.79  ? 1269 GLU A CA    1 
ATOM   4380  C  C     . GLU A 1 621 ? -34.345 19.466  -20.247 1.00 38.88  ? 1269 GLU A C     1 
ATOM   4381  O  O     . GLU A 1 621 ? -34.206 18.670  -21.182 1.00 40.30  ? 1269 GLU A O     1 
ATOM   4382  C  CB    . GLU A 1 621 ? -35.084 18.354  -18.131 1.00 35.47  ? 1269 GLU A CB    1 
ATOM   4383  C  CG    . GLU A 1 621 ? -34.366 17.099  -18.607 1.00 39.09  ? 1269 GLU A CG    1 
ATOM   4384  C  CD    . GLU A 1 621 ? -32.855 17.273  -18.660 1.00 45.04  ? 1269 GLU A CD    1 
ATOM   4385  O  OE1   . GLU A 1 621 ? -32.155 16.359  -19.165 1.00 48.28  ? 1269 GLU A OE1   1 
ATOM   4386  O  OE2   . GLU A 1 621 ? -32.369 18.324  -18.185 1.00 44.21  ? 1269 GLU A OE2   1 
ATOM   4387  N  N     . ASN A 1 622 ? -33.542 20.506  -20.058 1.00 37.51  ? 1270 ASN A N     1 
ATOM   4388  C  CA    . ASN A 1 622 ? -32.442 20.779  -20.965 1.00 38.74  ? 1270 ASN A CA    1 
ATOM   4389  C  C     . ASN A 1 622 ? -31.283 21.420  -20.246 1.00 37.06  ? 1270 ASN A C     1 
ATOM   4390  O  O     . ASN A 1 622 ? -31.297 21.561  -19.036 1.00 38.13  ? 1270 ASN A O     1 
ATOM   4391  C  CB    . ASN A 1 622 ? -32.894 21.670  -22.119 1.00 39.62  ? 1270 ASN A CB    1 
ATOM   4392  C  CG    . ASN A 1 622 ? -32.532 21.091  -23.476 1.00 43.90  ? 1270 ASN A CG    1 
ATOM   4393  O  OD1   . ASN A 1 622 ? -31.407 21.247  -23.958 1.00 44.90  ? 1270 ASN A OD1   1 
ATOM   4394  N  ND2   . ASN A 1 622 ? -33.485 20.409  -24.093 1.00 44.21  ? 1270 ASN A ND2   1 
ATOM   4395  N  N     . VAL A 1 623 ? -30.265 21.792  -20.999 1.00 40.49  ? 1271 VAL A N     1 
ATOM   4396  C  CA    . VAL A 1 623 ? -29.158 22.529  -20.429 1.00 42.35  ? 1271 VAL A CA    1 
ATOM   4397  C  C     . VAL A 1 623 ? -29.668 23.896  -20.011 1.00 42.36  ? 1271 VAL A C     1 
ATOM   4398  O  O     . VAL A 1 623 ? -30.736 24.335  -20.436 1.00 40.68  ? 1271 VAL A O     1 
ATOM   4399  C  CB    . VAL A 1 623 ? -28.012 22.686  -21.436 1.00 45.18  ? 1271 VAL A CB    1 
ATOM   4400  C  CG1   . VAL A 1 623 ? -27.257 21.366  -21.581 1.00 44.96  ? 1271 VAL A CG1   1 
ATOM   4401  C  CG2   . VAL A 1 623 ? -28.550 23.170  -22.782 1.00 42.39  ? 1271 VAL A CG2   1 
ATOM   4402  N  N     . ARG A 1 624 ? -28.905 24.571  -19.168 1.00 42.93  ? 1272 ARG A N     1 
ATOM   4403  C  CA    . ARG A 1 624 ? -29.337 25.868  -18.690 1.00 42.91  ? 1272 ARG A CA    1 
ATOM   4404  C  C     . ARG A 1 624 ? -29.536 26.822  -19.859 1.00 44.21  ? 1272 ARG A C     1 
ATOM   4405  O  O     . ARG A 1 624 ? -30.456 27.632  -19.846 1.00 46.37  ? 1272 ARG A O     1 
ATOM   4406  C  CB    . ARG A 1 624 ? -28.335 26.424  -17.682 1.00 47.19  ? 1272 ARG A CB    1 
ATOM   4407  C  CG    . ARG A 1 624 ? -28.727 27.752  -17.075 1.00 46.36  ? 1272 ARG A CG    1 
ATOM   4408  C  CD    . ARG A 1 624 ? -28.322 28.899  -17.965 1.00 46.66  ? 1272 ARG A CD    1 
ATOM   4409  N  NE    . ARG A 1 624 ? -28.912 30.145  -17.509 1.00 50.93  ? 1272 ARG A NE    1 
ATOM   4410  C  CZ    . ARG A 1 624 ? -29.031 31.226  -18.264 1.00 54.13  ? 1272 ARG A CZ    1 
ATOM   4411  N  NH1   . ARG A 1 624 ? -28.594 31.208  -19.515 1.00 52.29  ? 1272 ARG A NH1   1 
ATOM   4412  N  NH2   . ARG A 1 624 ? -29.587 32.321  -17.766 1.00 55.39  ? 1272 ARG A NH2   1 
ATOM   4413  N  N     . ASN A 1 625 ? -28.691 26.711  -20.878 1.00 45.01  ? 1273 ASN A N     1 
ATOM   4414  C  CA    . ASN A 1 625 ? -28.744 27.647  -21.999 1.00 47.51  ? 1273 ASN A CA    1 
ATOM   4415  C  C     . ASN A 1 625 ? -29.969 27.532  -22.887 1.00 46.42  ? 1273 ASN A C     1 
ATOM   4416  O  O     . ASN A 1 625 ? -30.218 28.403  -23.713 1.00 46.59  ? 1273 ASN A O     1 
ATOM   4417  C  CB    . ASN A 1 625 ? -27.482 27.561  -22.848 1.00 51.08  ? 1273 ASN A CB    1 
ATOM   4418  C  CG    . ASN A 1 625 ? -26.421 28.543  -22.406 1.00 58.96  ? 1273 ASN A CG    1 
ATOM   4419  O  OD1   . ASN A 1 625 ? -26.695 29.482  -21.647 1.00 53.82  ? 1273 ASN A OD1   1 
ATOM   4420  N  ND2   . ASN A 1 625 ? -25.198 28.339  -22.886 1.00 68.53  ? 1273 ASN A ND2   1 
ATOM   4421  N  N     . PHE A 1 626 ? -30.730 26.458  -22.719 1.00 45.99  ? 1274 PHE A N     1 
ATOM   4422  C  CA    . PHE A 1 626 ? -31.951 26.281  -23.488 1.00 43.11  ? 1274 PHE A CA    1 
ATOM   4423  C  C     . PHE A 1 626 ? -32.729 27.587  -23.510 1.00 43.46  ? 1274 PHE A C     1 
ATOM   4424  O  O     . PHE A 1 626 ? -33.377 27.920  -24.501 1.00 44.17  ? 1274 PHE A O     1 
ATOM   4425  C  CB    . PHE A 1 626 ? -32.803 25.170  -22.876 1.00 41.45  ? 1274 PHE A CB    1 
ATOM   4426  C  CG    . PHE A 1 626 ? -34.111 24.934  -23.585 1.00 39.81  ? 1274 PHE A CG    1 
ATOM   4427  C  CD1   . PHE A 1 626 ? -34.242 23.909  -24.502 1.00 40.70  ? 1274 PHE A CD1   1 
ATOM   4428  C  CD2   . PHE A 1 626 ? -35.212 25.729  -23.321 1.00 38.31  ? 1274 PHE A CD2   1 
ATOM   4429  C  CE1   . PHE A 1 626 ? -35.437 23.689  -25.147 1.00 40.52  ? 1274 PHE A CE1   1 
ATOM   4430  C  CE2   . PHE A 1 626 ? -36.409 25.514  -23.965 1.00 38.30  ? 1274 PHE A CE2   1 
ATOM   4431  C  CZ    . PHE A 1 626 ? -36.520 24.492  -24.880 1.00 40.56  ? 1274 PHE A CZ    1 
ATOM   4432  N  N     . VAL A 1 627 ? -32.635 28.343  -22.421 1.00 44.81  ? 1275 VAL A N     1 
ATOM   4433  C  CA    . VAL A 1 627 ? -33.488 29.515  -22.227 1.00 44.14  ? 1275 VAL A CA    1 
ATOM   4434  C  C     . VAL A 1 627 ? -33.016 30.786  -22.928 1.00 43.56  ? 1275 VAL A C     1 
ATOM   4435  O  O     . VAL A 1 627 ? -33.686 31.808  -22.858 1.00 43.07  ? 1275 VAL A O     1 
ATOM   4436  C  CB    . VAL A 1 627 ? -33.674 29.825  -20.741 1.00 39.64  ? 1275 VAL A CB    1 
ATOM   4437  C  CG1   . VAL A 1 627 ? -33.883 28.546  -19.983 1.00 39.01  ? 1275 VAL A CG1   1 
ATOM   4438  C  CG2   . VAL A 1 627 ? -32.463 30.550  -20.205 1.00 42.25  ? 1275 VAL A CG2   1 
ATOM   4439  N  N     . SER A 1 628 ? -31.877 30.730  -23.604 1.00 45.60  ? 1276 SER A N     1 
ATOM   4440  C  CA    . SER A 1 628 ? -31.369 31.924  -24.270 1.00 48.95  ? 1276 SER A CA    1 
ATOM   4441  C  C     . SER A 1 628 ? -30.845 31.665  -25.683 1.00 52.12  ? 1276 SER A C     1 
ATOM   4442  O  O     . SER A 1 628 ? -30.438 32.595  -26.380 1.00 53.34  ? 1276 SER A O     1 
ATOM   4443  C  CB    . SER A 1 628 ? -30.312 32.605  -23.406 1.00 47.11  ? 1276 SER A CB    1 
ATOM   4444  O  OG    . SER A 1 628 ? -29.417 31.652  -22.875 1.00 49.64  ? 1276 SER A OG    1 
ATOM   4445  N  N     . TYR A 1 629 ? -30.865 30.401  -26.096 1.00 52.54  ? 1277 TYR A N     1 
ATOM   4446  C  CA    . TYR A 1 629 ? -30.559 30.028  -27.473 1.00 54.56  ? 1277 TYR A CA    1 
ATOM   4447  C  C     . TYR A 1 629 ? -31.437 30.823  -28.444 1.00 56.47  ? 1277 TYR A C     1 
ATOM   4448  O  O     . TYR A 1 629 ? -32.652 30.917  -28.251 1.00 54.05  ? 1277 TYR A O     1 
ATOM   4449  C  CB    . TYR A 1 629 ? -30.821 28.538  -27.689 1.00 53.31  ? 1277 TYR A CB    1 
ATOM   4450  C  CG    . TYR A 1 629 ? -29.787 27.578  -27.136 1.00 54.34  ? 1277 TYR A CG    1 
ATOM   4451  C  CD1   . TYR A 1 629 ? -30.091 26.228  -26.978 1.00 57.01  ? 1277 TYR A CD1   1 
ATOM   4452  C  CD2   . TYR A 1 629 ? -28.513 28.000  -26.795 1.00 56.34  ? 1277 TYR A CD2   1 
ATOM   4453  C  CE1   . TYR A 1 629 ? -29.160 25.325  -26.485 1.00 56.07  ? 1277 TYR A CE1   1 
ATOM   4454  C  CE2   . TYR A 1 629 ? -27.570 27.100  -26.297 1.00 58.24  ? 1277 TYR A CE2   1 
ATOM   4455  C  CZ    . TYR A 1 629 ? -27.903 25.763  -26.146 1.00 55.37  ? 1277 TYR A CZ    1 
ATOM   4456  O  OH    . TYR A 1 629 ? -26.978 24.862  -25.661 1.00 53.45  ? 1277 TYR A OH    1 
ATOM   4457  N  N     . ARG A 1 630 ? -30.816 31.380  -29.483 1.00 57.95  ? 1278 ARG A N     1 
ATOM   4458  C  CA    . ARG A 1 630 ? -31.513 32.155  -30.511 1.00 57.43  ? 1278 ARG A CA    1 
ATOM   4459  C  C     . ARG A 1 630 ? -32.254 33.362  -29.962 1.00 57.91  ? 1278 ARG A C     1 
ATOM   4460  O  O     . ARG A 1 630 ? -33.382 33.642  -30.376 1.00 53.17  ? 1278 ARG A O     1 
ATOM   4461  C  CB    . ARG A 1 630 ? -32.471 31.272  -31.302 1.00 58.57  ? 1278 ARG A CB    1 
ATOM   4462  C  CG    . ARG A 1 630 ? -31.756 30.245  -32.148 1.00 66.54  ? 1278 ARG A CG    1 
ATOM   4463  C  CD    . ARG A 1 630 ? -30.590 30.896  -32.866 1.00 70.62  ? 1278 ARG A CD    1 
ATOM   4464  N  NE    . ARG A 1 630 ? -29.885 29.980  -33.751 1.00 71.81  ? 1278 ARG A NE    1 
ATOM   4465  C  CZ    . ARG A 1 630 ? -28.633 30.156  -34.156 1.00 72.54  ? 1278 ARG A CZ    1 
ATOM   4466  N  NH1   . ARG A 1 630 ? -28.069 29.270  -34.962 1.00 75.57  ? 1278 ARG A NH1   1 
ATOM   4467  N  NH2   . ARG A 1 630 ? -27.941 31.210  -33.745 1.00 72.05  ? 1278 ARG A NH2   1 
ATOM   4468  N  N     . ARG A 1 631 ? -31.598 34.082  -29.053 1.00 59.79  ? 1279 ARG A N     1 
ATOM   4469  C  CA    . ARG A 1 631 ? -32.203 35.206  -28.338 1.00 58.89  ? 1279 ARG A CA    1 
ATOM   4470  C  C     . ARG A 1 631 ? -33.497 34.775  -27.664 1.00 56.58  ? 1279 ARG A C     1 
ATOM   4471  O  O     . ARG A 1 631 ? -34.459 35.541  -27.601 1.00 54.72  ? 1279 ARG A O     1 
ATOM   4472  C  CB    . ARG A 1 631 ? -32.457 36.393  -29.269 1.00 62.54  ? 1279 ARG A CB    1 
ATOM   4473  C  CG    . ARG A 1 631 ? -31.221 36.870  -30.017 1.00 70.02  ? 1279 ARG A CG    1 
ATOM   4474  C  CD    . ARG A 1 631 ? -30.186 37.529  -29.102 1.00 74.11  ? 1279 ARG A CD    1 
ATOM   4475  N  NE    . ARG A 1 631 ? -28.949 37.809  -29.832 1.00 80.76  ? 1279 ARG A NE    1 
ATOM   4476  C  CZ    . ARG A 1 631 ? -28.795 38.825  -30.681 1.00 88.54  ? 1279 ARG A CZ    1 
ATOM   4477  N  NH1   . ARG A 1 631 ? -29.799 39.667  -30.900 1.00 90.21  ? 1279 ARG A NH1   1 
ATOM   4478  N  NH2   . ARG A 1 631 ? -27.639 39.000  -31.315 1.00 86.61  ? 1279 ARG A NH2   1 
ATOM   4479  N  N     . SER A 1 632 ? -33.504 33.534  -27.178 1.00 52.87  ? 1280 SER A N     1 
ATOM   4480  C  CA    . SER A 1 632 ? -34.625 32.984  -26.426 1.00 48.51  ? 1280 SER A CA    1 
ATOM   4481  C  C     . SER A 1 632 ? -35.848 32.701  -27.297 1.00 48.31  ? 1280 SER A C     1 
ATOM   4482  O  O     . SER A 1 632 ? -36.975 32.636  -26.810 1.00 45.11  ? 1280 SER A O     1 
ATOM   4483  C  CB    . SER A 1 632 ? -34.986 33.908  -25.266 1.00 48.05  ? 1280 SER A CB    1 
ATOM   4484  O  OG    . SER A 1 632 ? -33.851 34.148  -24.453 1.00 48.53  ? 1280 SER A OG    1 
ATOM   4485  N  N     . MET A 1 633 ? -35.622 32.519  -28.590 1.00 52.14  ? 1281 MET A N     1 
ATOM   4486  C  CA    . MET A 1 633 ? -36.706 32.152  -29.481 1.00 48.44  ? 1281 MET A CA    1 
ATOM   4487  C  C     . MET A 1 633 ? -37.048 30.691  -29.292 1.00 45.78  ? 1281 MET A C     1 
ATOM   4488  O  O     . MET A 1 633 ? -38.167 30.275  -29.561 1.00 46.79  ? 1281 MET A O     1 
ATOM   4489  C  CB    . MET A 1 633 ? -36.348 32.444  -30.938 1.00 50.13  ? 1281 MET A CB    1 
ATOM   4490  C  CG    . MET A 1 633 ? -36.703 33.852  -31.363 1.00 50.10  ? 1281 MET A CG    1 
ATOM   4491  S  SD    . MET A 1 633 ? -38.459 34.195  -31.122 1.00 49.39  ? 1281 MET A SD    1 
ATOM   4492  C  CE    . MET A 1 633 ? -39.182 33.393  -32.547 1.00 46.74  ? 1281 MET A CE    1 
ATOM   4493  N  N     . VAL A 1 634 ? -36.086 29.911  -28.817 1.00 45.10  ? 1282 VAL A N     1 
ATOM   4494  C  CA    . VAL A 1 634 ? -36.326 28.496  -28.594 1.00 44.96  ? 1282 VAL A CA    1 
ATOM   4495  C  C     . VAL A 1 634 ? -37.351 28.346  -27.486 1.00 45.39  ? 1282 VAL A C     1 
ATOM   4496  O  O     . VAL A 1 634 ? -38.378 27.683  -27.646 1.00 43.43  ? 1282 VAL A O     1 
ATOM   4497  C  CB    . VAL A 1 634 ? -35.050 27.789  -28.171 1.00 47.70  ? 1282 VAL A CB    1 
ATOM   4498  C  CG1   . VAL A 1 634 ? -35.212 26.287  -28.312 1.00 48.55  ? 1282 VAL A CG1   1 
ATOM   4499  C  CG2   . VAL A 1 634 ? -33.890 28.291  -28.996 1.00 52.46  ? 1282 VAL A CG2   1 
ATOM   4500  N  N     . LEU A 1 635 ? -37.061 28.986  -26.360 1.00 42.90  ? 1283 LEU A N     1 
ATOM   4501  C  CA    . LEU A 1 635 ? -37.967 29.001  -25.229 1.00 39.86  ? 1283 LEU A CA    1 
ATOM   4502  C  C     . LEU A 1 635 ? -39.310 29.620  -25.602 1.00 40.69  ? 1283 LEU A C     1 
ATOM   4503  O  O     . LEU A 1 635 ? -40.364 29.043  -25.328 1.00 39.50  ? 1283 LEU A O     1 
ATOM   4504  C  CB    . LEU A 1 635 ? -37.332 29.765  -24.074 1.00 37.35  ? 1283 LEU A CB    1 
ATOM   4505  C  CG    . LEU A 1 635 ? -38.193 29.963  -22.836 1.00 33.71  ? 1283 LEU A CG    1 
ATOM   4506  C  CD1   . LEU A 1 635 ? -38.703 28.644  -22.338 1.00 34.25  ? 1283 LEU A CD1   1 
ATOM   4507  C  CD2   . LEU A 1 635 ? -37.380 30.646  -21.780 1.00 37.67  ? 1283 LEU A CD2   1 
ATOM   4508  N  N     . LYS A 1 636 ? -39.274 30.795  -26.225 1.00 41.10  ? 1284 LYS A N     1 
ATOM   4509  C  CA    . LYS A 1 636 ? -40.505 31.480  -26.598 1.00 41.05  ? 1284 LYS A CA    1 
ATOM   4510  C  C     . LYS A 1 636 ? -41.346 30.608  -27.518 1.00 40.25  ? 1284 LYS A C     1 
ATOM   4511  O  O     . LYS A 1 636 ? -42.562 30.557  -27.399 1.00 40.32  ? 1284 LYS A O     1 
ATOM   4512  C  CB    . LYS A 1 636 ? -40.213 32.829  -27.262 1.00 43.50  ? 1284 LYS A CB    1 
ATOM   4513  C  CG    . LYS A 1 636 ? -40.007 33.983  -26.290 1.00 43.84  ? 1284 LYS A CG    1 
ATOM   4514  C  CD    . LYS A 1 636 ? -39.890 35.330  -27.016 1.00 48.15  ? 1284 LYS A CD    1 
ATOM   4515  C  CE    . LYS A 1 636 ? -38.528 35.496  -27.701 1.00 53.18  ? 1284 LYS A CE    1 
ATOM   4516  N  NZ    . LYS A 1 636 ? -38.414 36.713  -28.574 1.00 49.21  ? 1284 LYS A NZ    1 
ATOM   4517  N  N     . LEU A 1 637 ? -40.696 29.906  -28.432 1.00 40.76  ? 1285 LEU A N     1 
ATOM   4518  C  CA    . LEU A 1 637 ? -41.431 29.107  -29.396 1.00 41.29  ? 1285 LEU A CA    1 
ATOM   4519  C  C     . LEU A 1 637 ? -42.004 27.834  -28.792 1.00 42.52  ? 1285 LEU A C     1 
ATOM   4520  O  O     . LEU A 1 637 ? -43.078 27.390  -29.196 1.00 44.00  ? 1285 LEU A O     1 
ATOM   4521  C  CB    . LEU A 1 637 ? -40.576 28.797  -30.623 1.00 43.45  ? 1285 LEU A CB    1 
ATOM   4522  C  CG    . LEU A 1 637 ? -40.498 29.953  -31.620 1.00 42.42  ? 1285 LEU A CG    1 
ATOM   4523  C  CD1   . LEU A 1 637 ? -39.493 29.666  -32.726 1.00 47.29  ? 1285 LEU A CD1   1 
ATOM   4524  C  CD2   . LEU A 1 637 ? -41.879 30.214  -32.182 1.00 39.39  ? 1285 LEU A CD2   1 
ATOM   4525  N  N     . THR A 1 638 ? -41.311 27.238  -27.827 1.00 40.81  ? 1286 THR A N     1 
ATOM   4526  C  CA    . THR A 1 638 ? -41.883 26.057  -27.194 1.00 39.98  ? 1286 THR A CA    1 
ATOM   4527  C  C     . THR A 1 638 ? -43.072 26.452  -26.324 1.00 40.25  ? 1286 THR A C     1 
ATOM   4528  O  O     . THR A 1 638 ? -44.109 25.798  -26.367 1.00 43.59  ? 1286 THR A O     1 
ATOM   4529  C  CB    . THR A 1 638 ? -40.867 25.217  -26.388 1.00 38.87  ? 1286 THR A CB    1 
ATOM   4530  O  OG1   . THR A 1 638 ? -40.821 25.676  -25.036 1.00 42.76  ? 1286 THR A OG1   1 
ATOM   4531  C  CG2   . THR A 1 638 ? -39.490 25.295  -27.003 1.00 39.75  ? 1286 THR A CG2   1 
ATOM   4532  N  N     . LEU A 1 639 ? -42.937 27.527  -25.555 1.00 37.79  ? 1287 LEU A N     1 
ATOM   4533  C  CA    . LEU A 1 639 ? -44.048 28.003  -24.737 1.00 38.54  ? 1287 LEU A CA    1 
ATOM   4534  C  C     . LEU A 1 639 ? -45.259 28.311  -25.598 1.00 40.96  ? 1287 LEU A C     1 
ATOM   4535  O  O     . LEU A 1 639 ? -46.379 27.908  -25.278 1.00 39.40  ? 1287 LEU A O     1 
ATOM   4536  C  CB    . LEU A 1 639 ? -43.651 29.243  -23.946 1.00 37.16  ? 1287 LEU A CB    1 
ATOM   4537  C  CG    . LEU A 1 639 ? -42.745 28.967  -22.756 1.00 36.40  ? 1287 LEU A CG    1 
ATOM   4538  C  CD1   . LEU A 1 639 ? -42.253 30.264  -22.180 1.00 37.95  ? 1287 LEU A CD1   1 
ATOM   4539  C  CD2   . LEU A 1 639 ? -43.474 28.148  -21.701 1.00 35.23  ? 1287 LEU A CD2   1 
ATOM   4540  N  N     . ARG A 1 640 ? -45.019 29.031  -26.693 1.00 43.13  ? 1288 ARG A N     1 
ATOM   4541  C  CA    . ARG A 1 640 ? -46.063 29.367  -27.658 1.00 43.21  ? 1288 ARG A CA    1 
ATOM   4542  C  C     . ARG A 1 640 ? -46.781 28.110  -28.115 1.00 45.50  ? 1288 ARG A C     1 
ATOM   4543  O  O     . ARG A 1 640 ? -48.006 28.091  -28.260 1.00 46.87  ? 1288 ARG A O     1 
ATOM   4544  C  CB    . ARG A 1 640 ? -45.469 30.087  -28.866 1.00 42.45  ? 1288 ARG A CB    1 
ATOM   4545  C  CG    . ARG A 1 640 ? -46.464 30.318  -29.984 1.00 47.87  ? 1288 ARG A CG    1 
ATOM   4546  C  CD    . ARG A 1 640 ? -47.681 31.072  -29.481 1.00 49.37  ? 1288 ARG A CD    1 
ATOM   4547  N  NE    . ARG A 1 640 ? -48.850 30.835  -30.318 1.00 51.99  ? 1288 ARG A NE    1 
ATOM   4548  C  CZ    . ARG A 1 640 ? -50.105 31.046  -29.927 1.00 56.33  ? 1288 ARG A CZ    1 
ATOM   4549  N  NH1   . ARG A 1 640 ? -50.354 31.508  -28.704 1.00 55.23  ? 1288 ARG A NH1   1 
ATOM   4550  N  NH2   . ARG A 1 640 ? -51.115 30.793  -30.757 1.00 58.66  ? 1288 ARG A NH2   1 
ATOM   4551  N  N     . CYS A 1 641 ? -46.006 27.055  -28.337 1.00 44.94  ? 1289 CYS A N     1 
ATOM   4552  C  CA    . CYS A 1 641 ? -46.562 25.779  -28.750 1.00 46.70  ? 1289 CYS A CA    1 
ATOM   4553  C  C     . CYS A 1 641 ? -47.499 25.236  -27.671 1.00 43.53  ? 1289 CYS A C     1 
ATOM   4554  O  O     . CYS A 1 641 ? -48.673 24.982  -27.923 1.00 44.39  ? 1289 CYS A O     1 
ATOM   4555  C  CB    . CYS A 1 641 ? -45.439 24.784  -29.045 1.00 45.07  ? 1289 CYS A CB    1 
ATOM   4556  S  SG    . CYS A 1 641 ? -45.965 23.364  -30.013 1.00 51.67  ? 1289 CYS A SG    1 
ATOM   4557  N  N     . LEU A 1 642 ? -46.974 25.074  -26.464 1.00 42.21  ? 1290 LEU A N     1 
ATOM   4558  C  CA    . LEU A 1 642 ? -47.762 24.557  -25.354 1.00 43.00  ? 1290 LEU A CA    1 
ATOM   4559  C  C     . LEU A 1 642 ? -49.057 25.338  -25.162 1.00 42.96  ? 1290 LEU A C     1 
ATOM   4560  O  O     . LEU A 1 642 ? -50.134 24.752  -25.046 1.00 41.34  ? 1290 LEU A O     1 
ATOM   4561  C  CB    . LEU A 1 642 ? -46.951 24.592  -24.061 1.00 39.18  ? 1290 LEU A CB    1 
ATOM   4562  C  CG    . LEU A 1 642 ? -45.746 23.664  -23.993 1.00 37.25  ? 1290 LEU A CG    1 
ATOM   4563  C  CD1   . LEU A 1 642 ? -44.799 24.112  -22.899 1.00 37.02  ? 1290 LEU A CD1   1 
ATOM   4564  C  CD2   . LEU A 1 642 ? -46.210 22.245  -23.768 1.00 36.94  ? 1290 LEU A CD2   1 
ATOM   4565  N  N     . VAL A 1 643 ? -48.955 26.662  -25.117 1.00 42.57  ? 1291 VAL A N     1 
ATOM   4566  C  CA    . VAL A 1 643 ? -50.143 27.464  -24.867 1.00 43.23  ? 1291 VAL A CA    1 
ATOM   4567  C  C     . VAL A 1 643 ? -51.119 27.312  -26.027 1.00 40.78  ? 1291 VAL A C     1 
ATOM   4568  O  O     . VAL A 1 643 ? -52.325 27.260  -25.818 1.00 40.69  ? 1291 VAL A O     1 
ATOM   4569  C  CB    . VAL A 1 643 ? -49.809 28.948  -24.563 1.00 41.63  ? 1291 VAL A CB    1 
ATOM   4570  C  CG1   . VAL A 1 643 ? -48.923 29.516  -25.628 1.00 46.86  ? 1291 VAL A CG1   1 
ATOM   4571  C  CG2   . VAL A 1 643 ? -51.075 29.769  -24.446 1.00 42.18  ? 1291 VAL A CG2   1 
ATOM   4572  N  N     . ARG A 1 644 ? -50.595 27.206  -27.244 1.00 40.81  ? 1292 ARG A N     1 
ATOM   4573  C  CA    . ARG A 1 644 ? -51.445 26.977  -28.402 1.00 42.15  ? 1292 ARG A CA    1 
ATOM   4574  C  C     . ARG A 1 644 ? -52.338 25.759  -28.177 1.00 43.96  ? 1292 ARG A C     1 
ATOM   4575  O  O     . ARG A 1 644 ? -53.543 25.809  -28.412 1.00 45.02  ? 1292 ARG A O     1 
ATOM   4576  C  CB    . ARG A 1 644 ? -50.610 26.788  -29.663 1.00 44.13  ? 1292 ARG A CB    1 
ATOM   4577  C  CG    . ARG A 1 644 ? -51.452 26.570  -30.911 1.00 49.66  ? 1292 ARG A CG    1 
ATOM   4578  C  CD    . ARG A 1 644 ? -50.607 26.401  -32.175 1.00 58.07  ? 1292 ARG A CD    1 
ATOM   4579  N  NE    . ARG A 1 644 ? -49.770 27.570  -32.464 1.00 64.50  ? 1292 ARG A NE    1 
ATOM   4580  C  CZ    . ARG A 1 644 ? -48.437 27.539  -32.549 1.00 64.87  ? 1292 ARG A CZ    1 
ATOM   4581  N  NH1   . ARG A 1 644 ? -47.776 26.387  -32.374 1.00 59.28  ? 1292 ARG A NH1   1 
ATOM   4582  N  NH2   . ARG A 1 644 ? -47.763 28.660  -32.814 1.00 55.67  ? 1292 ARG A NH2   1 
ATOM   4583  N  N     . MET A 1 645 ? -51.747 24.665  -27.708 1.00 44.75  ? 1293 MET A N     1 
ATOM   4584  C  CA    . MET A 1 645 ? -52.509 23.455  -27.425 1.00 42.78  ? 1293 MET A CA    1 
ATOM   4585  C  C     . MET A 1 645 ? -53.526 23.701  -26.326 1.00 42.79  ? 1293 MET A C     1 
ATOM   4586  O  O     . MET A 1 645 ? -54.557 23.037  -26.274 1.00 43.85  ? 1293 MET A O     1 
ATOM   4587  C  CB    . MET A 1 645 ? -51.587 22.324  -26.988 1.00 42.13  ? 1293 MET A CB    1 
ATOM   4588  C  CG    . MET A 1 645 ? -50.507 21.968  -27.982 1.00 43.20  ? 1293 MET A CG    1 
ATOM   4589  S  SD    . MET A 1 645 ? -49.394 20.740  -27.273 1.00 48.65  ? 1293 MET A SD    1 
ATOM   4590  C  CE    . MET A 1 645 ? -47.941 20.993  -28.283 1.00 45.29  ? 1293 MET A CE    1 
ATOM   4591  N  N     . GLY A 1 646 ? -53.218 24.642  -25.435 1.00 43.09  ? 1294 GLY A N     1 
ATOM   4592  C  CA    . GLY A 1 646 ? -54.080 24.950  -24.308 1.00 38.93  ? 1294 GLY A CA    1 
ATOM   4593  C  C     . GLY A 1 646 ? -53.542 24.457  -22.976 1.00 37.92  ? 1294 GLY A C     1 
ATOM   4594  O  O     . GLY A 1 646 ? -54.291 24.294  -22.023 1.00 40.56  ? 1294 GLY A O     1 
ATOM   4595  N  N     . TYR A 1 647 ? -52.240 24.221  -22.901 1.00 37.35  ? 1295 TYR A N     1 
ATOM   4596  C  CA    . TYR A 1 647 ? -51.624 23.754  -21.668 1.00 34.44  ? 1295 TYR A CA    1 
ATOM   4597  C  C     . TYR A 1 647 ? -51.325 24.893  -20.712 1.00 37.53  ? 1295 TYR A C     1 
ATOM   4598  O  O     . TYR A 1 647 ? -51.020 26.007  -21.133 1.00 39.75  ? 1295 TYR A O     1 
ATOM   4599  C  CB    . TYR A 1 647 ? -50.300 23.066  -21.974 1.00 35.92  ? 1295 TYR A CB    1 
ATOM   4600  C  CG    . TYR A 1 647 ? -50.390 21.587  -22.186 1.00 33.42  ? 1295 TYR A CG    1 
ATOM   4601  C  CD1   . TYR A 1 647 ? -50.401 21.058  -23.459 1.00 37.28  ? 1295 TYR A CD1   1 
ATOM   4602  C  CD2   . TYR A 1 647 ? -50.447 20.720  -21.113 1.00 33.56  ? 1295 TYR A CD2   1 
ATOM   4603  C  CE1   . TYR A 1 647 ? -50.475 19.701  -23.665 1.00 39.49  ? 1295 TYR A CE1   1 
ATOM   4604  C  CE2   . TYR A 1 647 ? -50.524 19.366  -21.301 1.00 35.46  ? 1295 TYR A CE2   1 
ATOM   4605  C  CZ    . TYR A 1 647 ? -50.539 18.859  -22.581 1.00 38.65  ? 1295 TYR A CZ    1 
ATOM   4606  O  OH    . TYR A 1 647 ? -50.617 17.505  -22.789 1.00 39.92  ? 1295 TYR A OH    1 
ATOM   4607  N  N     . GLN A 1 648 ? -51.389 24.611  -19.419 1.00 35.59  ? 1296 GLN A N     1 
ATOM   4608  C  CA    . GLN A 1 648 ? -50.804 25.514  -18.448 1.00 35.35  ? 1296 GLN A CA    1 
ATOM   4609  C  C     . GLN A 1 648 ? -49.313 25.205  -18.433 1.00 35.16  ? 1296 GLN A C     1 
ATOM   4610  O  O     . GLN A 1 648 ? -48.928 24.044  -18.487 1.00 36.06  ? 1296 GLN A O     1 
ATOM   4611  C  CB    . GLN A 1 648 ? -51.382 25.266  -17.063 1.00 36.27  ? 1296 GLN A CB    1 
ATOM   4612  C  CG    . GLN A 1 648 ? -52.858 24.988  -17.026 1.00 36.23  ? 1296 GLN A CG    1 
ATOM   4613  C  CD    . GLN A 1 648 ? -53.344 24.748  -15.613 1.00 37.79  ? 1296 GLN A CD    1 
ATOM   4614  O  OE1   . GLN A 1 648 ? -52.933 25.435  -14.685 1.00 40.28  ? 1296 GLN A OE1   1 
ATOM   4615  N  NE2   . GLN A 1 648 ? -54.211 23.762  -15.439 1.00 39.03  ? 1296 GLN A NE2   1 
ATOM   4616  N  N     . CYS A 1 649 ? -48.467 26.226  -18.354 1.00 35.10  ? 1297 CYS A N     1 
ATOM   4617  C  CA    . CYS A 1 649 ? -47.029 25.993  -18.445 1.00 33.87  ? 1297 CYS A CA    1 
ATOM   4618  C  C     . CYS A 1 649 ? -46.162 27.072  -17.816 1.00 33.36  ? 1297 CYS A C     1 
ATOM   4619  O  O     . CYS A 1 649 ? -46.532 28.238  -17.773 1.00 35.95  ? 1297 CYS A O     1 
ATOM   4620  C  CB    . CYS A 1 649 ? -46.614 25.801  -19.911 1.00 35.24  ? 1297 CYS A CB    1 
ATOM   4621  S  SG    . CYS A 1 649 ? -46.820 27.237  -20.985 1.00 36.30  ? 1297 CYS A SG    1 
ATOM   4622  N  N     . THR A 1 650 ? -44.992 26.666  -17.339 1.00 32.29  ? 1298 THR A N     1 
ATOM   4623  C  CA    . THR A 1 650 ? -43.995 27.602  -16.844 1.00 32.61  ? 1298 THR A CA    1 
ATOM   4624  C  C     . THR A 1 650 ? -42.609 27.055  -17.117 1.00 31.41  ? 1298 THR A C     1 
ATOM   4625  O  O     . THR A 1 650 ? -42.461 25.927  -17.569 1.00 29.95  ? 1298 THR A O     1 
ATOM   4626  C  CB    . THR A 1 650 ? -44.118 27.827  -15.341 1.00 36.33  ? 1298 THR A CB    1 
ATOM   4627  O  OG1   . THR A 1 650 ? -43.113 28.758  -14.910 1.00 35.76  ? 1298 THR A OG1   1 
ATOM   4628  C  CG2   . THR A 1 650 ? -43.945 26.507  -14.593 1.00 34.67  ? 1298 THR A CG2   1 
ATOM   4629  N  N     . PHE A 1 651 ? -41.595 27.865  -16.840 1.00 33.43  ? 1299 PHE A N     1 
ATOM   4630  C  CA    . PHE A 1 651 ? -40.215 27.445  -17.011 1.00 32.64  ? 1299 PHE A CA    1 
ATOM   4631  C  C     . PHE A 1 651 ? -39.370 27.969  -15.872 1.00 31.40  ? 1299 PHE A C     1 
ATOM   4632  O  O     . PHE A 1 651 ? -39.753 28.911  -15.199 1.00 35.12  ? 1299 PHE A O     1 
ATOM   4633  C  CB    . PHE A 1 651 ? -39.652 27.935  -18.348 1.00 31.87  ? 1299 PHE A CB    1 
ATOM   4634  C  CG    . PHE A 1 651 ? -39.394 29.412  -18.401 1.00 31.18  ? 1299 PHE A CG    1 
ATOM   4635  C  CD1   . PHE A 1 651 ? -38.135 29.922  -18.125 1.00 30.67  ? 1299 PHE A CD1   1 
ATOM   4636  C  CD2   . PHE A 1 651 ? -40.405 30.292  -18.745 1.00 33.74  ? 1299 PHE A CD2   1 
ATOM   4637  C  CE1   . PHE A 1 651 ? -37.890 31.284  -18.179 1.00 31.07  ? 1299 PHE A CE1   1 
ATOM   4638  C  CE2   . PHE A 1 651 ? -40.162 31.665  -18.804 1.00 35.38  ? 1299 PHE A CE2   1 
ATOM   4639  C  CZ    . PHE A 1 651 ? -38.902 32.154  -18.518 1.00 33.88  ? 1299 PHE A CZ    1 
ATOM   4640  N  N     . GLY A 1 652 ? -38.220 27.352  -15.656 1.00 30.32  ? 1300 GLY A N     1 
ATOM   4641  C  CA    . GLY A 1 652 ? -37.299 27.828  -14.655 1.00 30.32  ? 1300 GLY A CA    1 
ATOM   4642  C  C     . GLY A 1 652 ? -35.967 27.132  -14.776 1.00 33.72  ? 1300 GLY A C     1 
ATOM   4643  O  O     . GLY A 1 652 ? -35.838 26.129  -15.466 1.00 33.83  ? 1300 GLY A O     1 
ATOM   4644  N  N     . VAL A 1 653 ? -34.972 27.680  -14.094 1.00 36.14  ? 1301 VAL A N     1 
ATOM   4645  C  CA    . VAL A 1 653 ? -33.655 27.083  -14.026 1.00 31.71  ? 1301 VAL A CA    1 
ATOM   4646  C  C     . VAL A 1 653 ? -33.403 26.567  -12.615 1.00 34.60  ? 1301 VAL A C     1 
ATOM   4647  O  O     . VAL A 1 653 ? -33.726 27.224  -11.628 1.00 36.92  ? 1301 VAL A O     1 
ATOM   4648  C  CB    . VAL A 1 653 ? -32.591 28.107  -14.386 1.00 31.45  ? 1301 VAL A CB    1 
ATOM   4649  C  CG1   . VAL A 1 653 ? -31.207 27.502  -14.276 1.00 38.09  ? 1301 VAL A CG1   1 
ATOM   4650  C  CG2   . VAL A 1 653 ? -32.840 28.619  -15.780 1.00 33.86  ? 1301 VAL A CG2   1 
ATOM   4651  N  N     . LEU A 1 654 ? -32.828 25.378  -12.526 1.00 34.81  ? 1302 LEU A N     1 
ATOM   4652  C  CA    . LEU A 1 654 ? -32.539 24.767  -11.242 1.00 33.09  ? 1302 LEU A CA    1 
ATOM   4653  C  C     . LEU A 1 654 ? -31.071 24.401  -11.168 1.00 33.51  ? 1302 LEU A C     1 
ATOM   4654  O  O     . LEU A 1 654 ? -30.456 24.086  -12.171 1.00 37.15  ? 1302 LEU A O     1 
ATOM   4655  C  CB    . LEU A 1 654 ? -33.413 23.533  -11.050 1.00 30.74  ? 1302 LEU A CB    1 
ATOM   4656  C  CG    . LEU A 1 654 ? -34.902 23.879  -11.015 1.00 33.40  ? 1302 LEU A CG    1 
ATOM   4657  C  CD1   . LEU A 1 654 ? -35.774 22.641  -11.080 1.00 32.38  ? 1302 LEU A CD1   1 
ATOM   4658  C  CD2   . LEU A 1 654 ? -35.214 24.684  -9.770  1.00 35.01  ? 1302 LEU A CD2   1 
ATOM   4659  N  N     . GLN A 1 655 ? -30.503 24.463  -9.977  1.00 32.38  ? 1303 GLN A N     1 
ATOM   4660  C  CA    . GLN A 1 655 ? -29.125 24.078  -9.786  1.00 34.11  ? 1303 GLN A CA    1 
ATOM   4661  C  C     . GLN A 1 655 ? -29.119 22.813  -8.958  1.00 37.24  ? 1303 GLN A C     1 
ATOM   4662  O  O     . GLN A 1 655 ? -29.630 22.805  -7.848  1.00 38.28  ? 1303 GLN A O     1 
ATOM   4663  C  CB    . GLN A 1 655 ? -28.377 25.180  -9.058  1.00 35.50  ? 1303 GLN A CB    1 
ATOM   4664  C  CG    . GLN A 1 655 ? -27.223 24.680  -8.228  1.00 38.09  ? 1303 GLN A CG    1 
ATOM   4665  C  CD    . GLN A 1 655 ? -26.091 24.154  -9.073  1.00 41.25  ? 1303 GLN A CD    1 
ATOM   4666  O  OE1   . GLN A 1 655 ? -25.523 24.883  -9.886  1.00 42.64  ? 1303 GLN A OE1   1 
ATOM   4667  N  NE2   . GLN A 1 655 ? -25.757 22.879  -8.895  1.00 40.73  ? 1303 GLN A NE2   1 
ATOM   4668  N  N     . ALA A 1 656 ? -28.541 21.743  -9.494  1.00 38.37  ? 1304 ALA A N     1 
ATOM   4669  C  CA    . ALA A 1 656 ? -28.640 20.427  -8.868  1.00 37.06  ? 1304 ALA A CA    1 
ATOM   4670  C  C     . ALA A 1 656 ? -28.004 20.353  -7.481  1.00 38.35  ? 1304 ALA A C     1 
ATOM   4671  O  O     . ALA A 1 656 ? -28.489 19.628  -6.615  1.00 38.09  ? 1304 ALA A O     1 
ATOM   4672  C  CB    . ALA A 1 656 ? -28.048 19.363  -9.780  1.00 37.61  ? 1304 ALA A CB    1 
ATOM   4673  N  N     . GLY A 1 657 ? -26.916 21.092  -7.273  1.00 39.71  ? 1305 GLY A N     1 
ATOM   4674  C  CA    . GLY A 1 657 ? -26.219 21.076  -5.996  1.00 39.60  ? 1305 GLY A CA    1 
ATOM   4675  C  C     . GLY A 1 657 ? -27.168 21.364  -4.846  1.00 40.11  ? 1305 GLY A C     1 
ATOM   4676  O  O     . GLY A 1 657 ? -27.087 20.764  -3.770  1.00 37.95  ? 1305 GLY A O     1 
ATOM   4677  N  N     . GLN A 1 658 ? -28.088 22.287  -5.098  1.00 39.35  ? 1306 GLN A N     1 
ATOM   4678  C  CA    . GLN A 1 658 ? -29.063 22.711  -4.110  1.00 37.56  ? 1306 GLN A CA    1 
ATOM   4679  C  C     . GLN A 1 658 ? -30.040 21.614  -3.720  1.00 37.25  ? 1306 GLN A C     1 
ATOM   4680  O  O     . GLN A 1 658 ? -30.812 21.789  -2.788  1.00 39.82  ? 1306 GLN A O     1 
ATOM   4681  C  CB    . GLN A 1 658 ? -29.855 23.913  -4.628  1.00 38.10  ? 1306 GLN A CB    1 
ATOM   4682  C  CG    . GLN A 1 658 ? -29.024 25.136  -4.974  1.00 37.13  ? 1306 GLN A CG    1 
ATOM   4683  C  CD    . GLN A 1 658 ? -29.893 26.352  -5.190  1.00 37.72  ? 1306 GLN A CD    1 
ATOM   4684  O  OE1   . GLN A 1 658 ? -30.359 26.608  -6.297  1.00 38.03  ? 1306 GLN A OE1   1 
ATOM   4685  N  NE2   . GLN A 1 658 ? -30.138 27.098  -4.122  1.00 40.01  ? 1306 GLN A NE2   1 
ATOM   4686  N  N     . TYR A 1 659 ? -30.025 20.491  -4.429  1.00 37.37  ? 1307 TYR A N     1 
ATOM   4687  C  CA    . TYR A 1 659 ? -30.960 19.412  -4.118  1.00 36.53  ? 1307 TYR A CA    1 
ATOM   4688  C  C     . TYR A 1 659 ? -30.303 18.127  -3.654  1.00 37.66  ? 1307 TYR A C     1 
ATOM   4689  O  O     . TYR A 1 659 ? -30.959 17.087  -3.553  1.00 38.92  ? 1307 TYR A O     1 
ATOM   4690  C  CB    . TYR A 1 659 ? -31.884 19.139  -5.288  1.00 35.14  ? 1307 TYR A CB    1 
ATOM   4691  C  CG    . TYR A 1 659 ? -32.755 20.313  -5.588  1.00 36.29  ? 1307 TYR A CG    1 
ATOM   4692  C  CD1   . TYR A 1 659 ? -32.431 21.192  -6.607  1.00 36.74  ? 1307 TYR A CD1   1 
ATOM   4693  C  CD2   . TYR A 1 659 ? -33.885 20.570  -4.832  1.00 35.46  ? 1307 TYR A CD2   1 
ATOM   4694  C  CE1   . TYR A 1 659 ? -33.222 22.281  -6.886  1.00 35.22  ? 1307 TYR A CE1   1 
ATOM   4695  C  CE2   . TYR A 1 659 ? -34.678 21.658  -5.102  1.00 37.44  ? 1307 TYR A CE2   1 
ATOM   4696  C  CZ    . TYR A 1 659 ? -34.340 22.508  -6.135  1.00 36.47  ? 1307 TYR A CZ    1 
ATOM   4697  O  OH    . TYR A 1 659 ? -35.119 23.594  -6.424  1.00 40.27  ? 1307 TYR A OH    1 
ATOM   4698  N  N     . GLY A 1 660 ? -29.009 18.202  -3.366  1.00 38.97  ? 1308 GLY A N     1 
ATOM   4699  C  CA    . GLY A 1 660 ? -28.351 17.150  -2.614  1.00 40.75  ? 1308 GLY A CA    1 
ATOM   4700  C  C     . GLY A 1 660 ? -27.266 16.420  -3.363  1.00 39.23  ? 1308 GLY A C     1 
ATOM   4701  O  O     . GLY A 1 660 ? -27.119 15.207  -3.217  1.00 36.99  ? 1308 GLY A O     1 
ATOM   4702  N  N     . VAL A 1 661 ? -26.489 17.167  -4.142  1.00 38.71  ? 1309 VAL A N     1 
ATOM   4703  C  CA    . VAL A 1 661 ? -25.482 16.576  -5.006  1.00 36.67  ? 1309 VAL A CA    1 
ATOM   4704  C  C     . VAL A 1 661 ? -24.240 17.462  -5.106  1.00 36.31  ? 1309 VAL A C     1 
ATOM   4705  O  O     . VAL A 1 661 ? -24.343 18.668  -5.315  1.00 39.69  ? 1309 VAL A O     1 
ATOM   4706  C  CB    . VAL A 1 661 ? -26.092 16.280  -6.391  1.00 35.70  ? 1309 VAL A CB    1 
ATOM   4707  C  CG1   . VAL A 1 661 ? -25.139 16.667  -7.509  1.00 39.16  ? 1309 VAL A CG1   1 
ATOM   4708  C  CG2   . VAL A 1 661 ? -26.493 14.823  -6.478  1.00 32.89  ? 1309 VAL A CG2   1 
ATOM   4709  N  N     . ALA A 1 662 ? -23.066 16.863  -4.951  1.00 35.09  ? 1310 ALA A N     1 
ATOM   4710  C  CA    . ALA A 1 662 ? -21.816 17.618  -4.982  1.00 36.22  ? 1310 ALA A CA    1 
ATOM   4711  C  C     . ALA A 1 662 ? -21.351 17.947  -6.397  1.00 38.55  ? 1310 ALA A C     1 
ATOM   4712  O  O     . ALA A 1 662 ? -20.231 17.617  -6.777  1.00 37.90  ? 1310 ALA A O     1 
ATOM   4713  C  CB    . ALA A 1 662 ? -20.730 16.875  -4.242  1.00 38.43  ? 1310 ALA A CB    1 
ATOM   4714  N  N     . GLN A 1 663 ? -22.205 18.622  -7.158  1.00 38.99  ? 1311 GLN A N     1 
ATOM   4715  C  CA    . GLN A 1 663 ? -21.905 18.959  -8.541  1.00 39.91  ? 1311 GLN A CA    1 
ATOM   4716  C  C     . GLN A 1 663 ? -22.641 20.214  -8.990  1.00 42.21  ? 1311 GLN A C     1 
ATOM   4717  O  O     . GLN A 1 663 ? -23.813 20.399  -8.673  1.00 42.81  ? 1311 GLN A O     1 
ATOM   4718  C  CB    . GLN A 1 663 ? -22.306 17.797  -9.447  1.00 42.75  ? 1311 GLN A CB    1 
ATOM   4719  C  CG    . GLN A 1 663 ? -22.375 18.134  -10.936 1.00 41.86  ? 1311 GLN A CG    1 
ATOM   4720  C  CD    . GLN A 1 663 ? -23.198 17.120  -11.709 1.00 40.83  ? 1311 GLN A CD    1 
ATOM   4721  O  OE1   . GLN A 1 663 ? -23.735 16.172  -11.132 1.00 39.99  ? 1311 GLN A OE1   1 
ATOM   4722  N  NE2   . GLN A 1 663 ? -23.318 17.323  -13.013 1.00 41.64  ? 1311 GLN A NE2   1 
ATOM   4723  N  N     . THR A 1 664 ? -21.956 21.079  -9.731  1.00 45.03  ? 1312 THR A N     1 
ATOM   4724  C  CA    . THR A 1 664 ? -22.612 22.233  -10.337 1.00 42.94  ? 1312 THR A CA    1 
ATOM   4725  C  C     . THR A 1 664 ? -23.348 21.741  -11.566 1.00 43.41  ? 1312 THR A C     1 
ATOM   4726  O  O     . THR A 1 664 ? -22.774 21.068  -12.419 1.00 45.76  ? 1312 THR A O     1 
ATOM   4727  C  CB    . THR A 1 664 ? -21.609 23.308  -10.777 1.00 43.89  ? 1312 THR A CB    1 
ATOM   4728  O  OG1   . THR A 1 664 ? -20.680 23.556  -9.719  1.00 45.52  ? 1312 THR A OG1   1 
ATOM   4729  C  CG2   . THR A 1 664 ? -22.334 24.600  -11.145 1.00 44.50  ? 1312 THR A CG2   1 
ATOM   4730  N  N     . ARG A 1 665 ? -24.626 22.068  -11.654 1.00 43.48  ? 1313 ARG A N     1 
ATOM   4731  C  CA    . ARG A 1 665 ? -25.445 21.593  -12.755 1.00 41.62  ? 1313 ARG A CA    1 
ATOM   4732  C  C     . ARG A 1 665 ? -26.725 22.411  -12.804 1.00 38.63  ? 1313 ARG A C     1 
ATOM   4733  O  O     . ARG A 1 665 ? -27.625 22.239  -11.983 1.00 35.39  ? 1313 ARG A O     1 
ATOM   4734  C  CB    . ARG A 1 665 ? -25.750 20.100  -12.589 1.00 40.42  ? 1313 ARG A CB    1 
ATOM   4735  C  CG    . ARG A 1 665 ? -26.370 19.452  -13.814 1.00 38.94  ? 1313 ARG A CG    1 
ATOM   4736  C  CD    . ARG A 1 665 ? -26.203 17.941  -13.798 1.00 40.22  ? 1313 ARG A CD    1 
ATOM   4737  N  NE    . ARG A 1 665 ? -26.618 17.337  -15.061 1.00 41.07  ? 1313 ARG A NE    1 
ATOM   4738  C  CZ    . ARG A 1 665 ? -25.800 16.712  -15.901 1.00 39.29  ? 1313 ARG A CZ    1 
ATOM   4739  N  NH1   . ARG A 1 665 ? -24.506 16.580  -15.621 1.00 36.99  ? 1313 ARG A NH1   1 
ATOM   4740  N  NH2   . ARG A 1 665 ? -26.290 16.210  -17.023 1.00 40.07  ? 1313 ARG A NH2   1 
ATOM   4741  N  N     . ARG A 1 666 ? -26.777 23.336  -13.752 1.00 39.12  ? 1314 ARG A N     1 
ATOM   4742  C  CA    . ARG A 1 666 ? -27.960 24.150  -13.943 1.00 40.52  ? 1314 ARG A CA    1 
ATOM   4743  C  C     . ARG A 1 666 ? -28.686 23.599  -15.139 1.00 39.25  ? 1314 ARG A C     1 
ATOM   4744  O  O     . ARG A 1 666 ? -28.081 23.391  -16.184 1.00 42.40  ? 1314 ARG A O     1 
ATOM   4745  C  CB    . ARG A 1 666 ? -27.584 25.612  -14.170 1.00 42.01  ? 1314 ARG A CB    1 
ATOM   4746  C  CG    . ARG A 1 666 ? -26.920 26.251  -12.966 1.00 43.37  ? 1314 ARG A CG    1 
ATOM   4747  C  CD    . ARG A 1 666 ? -26.863 27.753  -13.101 1.00 46.51  ? 1314 ARG A CD    1 
ATOM   4748  N  NE    . ARG A 1 666 ? -26.010 28.161  -14.209 1.00 52.75  ? 1314 ARG A NE    1 
ATOM   4749  C  CZ    . ARG A 1 666 ? -26.179 29.283  -14.900 1.00 59.60  ? 1314 ARG A CZ    1 
ATOM   4750  N  NH1   . ARG A 1 666 ? -27.177 30.104  -14.600 1.00 55.64  ? 1314 ARG A NH1   1 
ATOM   4751  N  NH2   . ARG A 1 666 ? -25.356 29.579  -15.898 1.00 67.62  ? 1314 ARG A NH2   1 
ATOM   4752  N  N     . ARG A 1 667 ? -29.974 23.329  -14.981 1.00 36.05  ? 1315 ARG A N     1 
ATOM   4753  C  CA    . ARG A 1 667 ? -30.766 22.841  -16.093 1.00 36.84  ? 1315 ARG A CA    1 
ATOM   4754  C  C     . ARG A 1 667 ? -32.006 23.705  -16.249 1.00 33.16  ? 1315 ARG A C     1 
ATOM   4755  O  O     . ARG A 1 667 ? -32.521 24.222  -15.274 1.00 33.19  ? 1315 ARG A O     1 
ATOM   4756  C  CB    . ARG A 1 667 ? -31.095 21.362  -15.899 1.00 35.05  ? 1315 ARG A CB    1 
ATOM   4757  C  CG    . ARG A 1 667 ? -29.871 20.567  -15.443 1.00 38.34  ? 1315 ARG A CG    1 
ATOM   4758  C  CD    . ARG A 1 667 ? -29.898 19.077  -15.830 1.00 43.29  ? 1315 ARG A CD    1 
ATOM   4759  N  NE    . ARG A 1 667 ? -29.572 18.818  -17.238 1.00 46.19  ? 1315 ARG A NE    1 
ATOM   4760  C  CZ    . ARG A 1 667 ? -28.617 19.442  -17.929 1.00 46.35  ? 1315 ARG A CZ    1 
ATOM   4761  N  NH1   . ARG A 1 667 ? -27.863 20.380  -17.360 1.00 43.41  ? 1315 ARG A NH1   1 
ATOM   4762  N  NH2   . ARG A 1 667 ? -28.411 19.125  -19.200 1.00 45.00  ? 1315 ARG A NH2   1 
ATOM   4763  N  N     . ALA A 1 668 ? -32.439 23.919  -17.484 1.00 33.39  ? 1316 ALA A N     1 
ATOM   4764  C  CA    . ALA A 1 668 ? -33.697 24.603  -17.734 1.00 33.48  ? 1316 ALA A CA    1 
ATOM   4765  C  C     . ALA A 1 668 ? -34.806 23.571  -17.630 1.00 31.75  ? 1316 ALA A C     1 
ATOM   4766  O  O     . ALA A 1 668 ? -34.592 22.399  -17.897 1.00 34.56  ? 1316 ALA A O     1 
ATOM   4767  C  CB    . ALA A 1 668 ? -33.692 25.247  -19.095 1.00 34.86  ? 1316 ALA A CB    1 
ATOM   4768  N  N     . ILE A 1 669 ? -35.987 23.991  -17.218 1.00 29.61  ? 1317 ILE A N     1 
ATOM   4769  C  CA    . ILE A 1 669 ? -37.060 23.041  -17.015 1.00 31.32  ? 1317 ILE A CA    1 
ATOM   4770  C  C     . ILE A 1 669 ? -38.361 23.670  -17.469 1.00 32.69  ? 1317 ILE A C     1 
ATOM   4771  O  O     . ILE A 1 669 ? -38.666 24.801  -17.109 1.00 31.77  ? 1317 ILE A O     1 
ATOM   4772  C  CB    . ILE A 1 669 ? -37.186 22.641  -15.527 1.00 32.99  ? 1317 ILE A CB    1 
ATOM   4773  C  CG1   . ILE A 1 669 ? -35.838 22.182  -14.956 1.00 31.06  ? 1317 ILE A CG1   1 
ATOM   4774  C  CG2   . ILE A 1 669 ? -38.235 21.557  -15.351 1.00 32.41  ? 1317 ILE A CG2   1 
ATOM   4775  C  CD1   . ILE A 1 669 ? -35.454 20.769  -15.316 1.00 30.69  ? 1317 ILE A CD1   1 
ATOM   4776  N  N     . ILE A 1 670 ? -39.121 22.949  -18.280 1.00 32.27  ? 1318 ILE A N     1 
ATOM   4777  C  CA    . ILE A 1 670 ? -40.457 23.395  -18.643 1.00 30.55  ? 1318 ILE A CA    1 
ATOM   4778  C  C     . ILE A 1 670 ? -41.454 22.467  -17.988 1.00 30.98  ? 1318 ILE A C     1 
ATOM   4779  O  O     . ILE A 1 670 ? -41.315 21.247  -18.059 1.00 31.88  ? 1318 ILE A O     1 
ATOM   4780  C  CB    . ILE A 1 670 ? -40.703 23.388  -20.163 1.00 29.30  ? 1318 ILE A CB    1 
ATOM   4781  C  CG1   . ILE A 1 670 ? -40.080 24.611  -20.816 1.00 28.04  ? 1318 ILE A CG1   1 
ATOM   4782  C  CG2   . ILE A 1 670 ? -42.183 23.377  -20.454 1.00 30.30  ? 1318 ILE A CG2   1 
ATOM   4783  C  CD1   . ILE A 1 670 ? -38.609 24.677  -20.640 1.00 31.91  ? 1318 ILE A CD1   1 
ATOM   4784  N  N     . LEU A 1 671 ? -42.446 23.052  -17.327 1.00 30.80  ? 1319 LEU A N     1 
ATOM   4785  C  CA    . LEU A 1 671 ? -43.549 22.290  -16.772 1.00 31.41  ? 1319 LEU A CA    1 
ATOM   4786  C  C     . LEU A 1 671 ? -44.802 22.606  -17.546 1.00 31.38  ? 1319 LEU A C     1 
ATOM   4787  O  O     . LEU A 1 671 ? -45.008 23.729  -17.966 1.00 31.47  ? 1319 LEU A O     1 
ATOM   4788  C  CB    . LEU A 1 671 ? -43.752 22.605  -15.294 1.00 31.26  ? 1319 LEU A CB    1 
ATOM   4789  C  CG    . LEU A 1 671 ? -42.611 22.152  -14.386 1.00 33.00  ? 1319 LEU A CG    1 
ATOM   4790  C  CD1   . LEU A 1 671 ? -43.041 22.189  -12.938 1.00 33.61  ? 1319 LEU A CD1   1 
ATOM   4791  C  CD2   . LEU A 1 671 ? -42.152 20.751  -14.774 1.00 32.06  ? 1319 LEU A CD2   1 
ATOM   4792  N  N     . ALA A 1 672 ? -45.632 21.601  -17.753 1.00 33.83  ? 1320 ALA A N     1 
ATOM   4793  C  CA    . ALA A 1 672 ? -46.901 21.812  -18.417 1.00 33.84  ? 1320 ALA A CA    1 
ATOM   4794  C  C     . ALA A 1 672 ? -47.938 20.968  -17.708 1.00 33.11  ? 1320 ALA A C     1 
ATOM   4795  O  O     . ALA A 1 672 ? -47.603 19.975  -17.074 1.00 34.28  ? 1320 ALA A O     1 
ATOM   4796  C  CB    . ALA A 1 672 ? -46.802 21.436  -19.878 1.00 34.47  ? 1320 ALA A CB    1 
ATOM   4797  N  N     . ALA A 1 673 ? -49.195 21.372  -17.792 1.00 32.90  ? 1321 ALA A N     1 
ATOM   4798  C  CA    . ALA A 1 673 ? -50.248 20.624  -17.137 1.00 34.19  ? 1321 ALA A CA    1 
ATOM   4799  C  C     . ALA A 1 673 ? -51.532 20.721  -17.922 1.00 34.51  ? 1321 ALA A C     1 
ATOM   4800  O  O     . ALA A 1 673 ? -51.897 21.788  -18.405 1.00 34.16  ? 1321 ALA A O     1 
ATOM   4801  C  CB    . ALA A 1 673 ? -50.449 21.115  -15.723 1.00 37.69  ? 1321 ALA A CB    1 
ATOM   4802  N  N     . ALA A 1 674 ? -52.207 19.589  -18.059 1.00 36.79  ? 1322 ALA A N     1 
ATOM   4803  C  CA    . ALA A 1 674 ? -53.462 19.548  -18.782 1.00 38.16  ? 1322 ALA A CA    1 
ATOM   4804  C  C     . ALA A 1 674 ? -54.386 20.585  -18.177 1.00 39.69  ? 1322 ALA A C     1 
ATOM   4805  O  O     . ALA A 1 674 ? -54.270 20.912  -16.995 1.00 37.78  ? 1322 ALA A O     1 
ATOM   4806  C  CB    . ALA A 1 674 ? -54.079 18.166  -18.700 1.00 37.57  ? 1322 ALA A CB    1 
ATOM   4807  N  N     . PRO A 1 675 ? -55.302 21.115  -18.993 1.00 41.88  ? 1323 PRO A N     1 
ATOM   4808  C  CA    . PRO A 1 675 ? -56.264 22.122  -18.548 1.00 42.84  ? 1323 PRO A CA    1 
ATOM   4809  C  C     . PRO A 1 675 ? -56.860 21.791  -17.184 1.00 42.59  ? 1323 PRO A C     1 
ATOM   4810  O  O     . PRO A 1 675 ? -56.921 22.670  -16.315 1.00 44.43  ? 1323 PRO A O     1 
ATOM   4811  C  CB    . PRO A 1 675 ? -57.339 22.056  -19.629 1.00 43.74  ? 1323 PRO A CB    1 
ATOM   4812  C  CG    . PRO A 1 675 ? -56.575 21.731  -20.859 1.00 42.83  ? 1323 PRO A CG    1 
ATOM   4813  C  CD    . PRO A 1 675 ? -55.475 20.788  -20.418 1.00 41.65  ? 1323 PRO A CD    1 
ATOM   4814  N  N     . GLY A 1 676 ? -57.282 20.546  -16.990 1.00 39.34  ? 1324 GLY A N     1 
ATOM   4815  C  CA    . GLY A 1 676 ? -57.953 20.176  -15.756 1.00 42.65  ? 1324 GLY A CA    1 
ATOM   4816  C  C     . GLY A 1 676 ? -57.071 20.110  -14.517 1.00 44.14  ? 1324 GLY A C     1 
ATOM   4817  O  O     . GLY A 1 676 ? -57.572 19.887  -13.411 1.00 43.45  ? 1324 GLY A O     1 
ATOM   4818  N  N     . GLU A 1 677 ? -55.767 20.314  -14.693 1.00 43.45  ? 1325 GLU A N     1 
ATOM   4819  C  CA    . GLU A 1 677 ? -54.794 20.060  -13.627 1.00 41.99  ? 1325 GLU A CA    1 
ATOM   4820  C  C     . GLU A 1 677 ? -54.399 21.297  -12.850 1.00 39.73  ? 1325 GLU A C     1 
ATOM   4821  O  O     . GLU A 1 677 ? -54.890 22.387  -13.115 1.00 40.80  ? 1325 GLU A O     1 
ATOM   4822  C  CB    . GLU A 1 677 ? -53.519 19.455  -14.219 1.00 40.90  ? 1325 GLU A CB    1 
ATOM   4823  C  CG    . GLU A 1 677 ? -53.757 18.226  -15.051 1.00 40.63  ? 1325 GLU A CG    1 
ATOM   4824  C  CD    . GLU A 1 677 ? -54.393 17.119  -14.247 1.00 40.81  ? 1325 GLU A CD    1 
ATOM   4825  O  OE1   . GLU A 1 677 ? -55.102 16.284  -14.850 1.00 41.37  ? 1325 GLU A OE1   1 
ATOM   4826  O  OE2   . GLU A 1 677 ? -54.181 17.092  -13.014 1.00 40.00  ? 1325 GLU A OE2   1 
ATOM   4827  N  N     . LYS A 1 678 ? -53.501 21.103  -11.888 1.00 41.18  ? 1326 LYS A N     1 
ATOM   4828  C  CA    . LYS A 1 678 ? -52.781 22.194  -11.248 1.00 41.12  ? 1326 LYS A CA    1 
ATOM   4829  C  C     . LYS A 1 678 ? -51.370 22.207  -11.804 1.00 40.04  ? 1326 LYS A C     1 
ATOM   4830  O  O     . LYS A 1 678 ? -50.686 21.195  -11.764 1.00 42.70  ? 1326 LYS A O     1 
ATOM   4831  C  CB    . LYS A 1 678 ? -52.696 21.987  -9.735  1.00 42.58  ? 1326 LYS A CB    1 
ATOM   4832  C  CG    . LYS A 1 678 ? -54.028 21.916  -9.032  1.00 53.03  ? 1326 LYS A CG    1 
ATOM   4833  C  CD    . LYS A 1 678 ? -53.851 21.784  -7.523  1.00 65.61  ? 1326 LYS A CD    1 
ATOM   4834  C  CE    . LYS A 1 678 ? -55.204 21.870  -6.800  1.00 77.44  ? 1326 LYS A CE    1 
ATOM   4835  N  NZ    . LYS A 1 678 ? -55.127 21.569  -5.333  1.00 74.76  ? 1326 LYS A NZ    1 
ATOM   4836  N  N     . LEU A 1 679 ? -50.932 23.342  -12.326 1.00 40.03  ? 1327 LEU A N     1 
ATOM   4837  C  CA    . LEU A 1 679 ? -49.536 23.503  -12.711 1.00 38.41  ? 1327 LEU A CA    1 
ATOM   4838  C  C     . LEU A 1 679 ? -48.668 23.373  -11.463 1.00 37.42  ? 1327 LEU A C     1 
ATOM   4839  O  O     . LEU A 1 679 ? -48.885 24.079  -10.485 1.00 38.18  ? 1327 LEU A O     1 
ATOM   4840  C  CB    . LEU A 1 679 ? -49.325 24.876  -13.350 1.00 36.38  ? 1327 LEU A CB    1 
ATOM   4841  C  CG    . LEU A 1 679 ? -47.941 25.162  -13.913 1.00 36.60  ? 1327 LEU A CG    1 
ATOM   4842  C  CD1   . LEU A 1 679 ? -47.622 24.154  -14.999 1.00 37.65  ? 1327 LEU A CD1   1 
ATOM   4843  C  CD2   . LEU A 1 679 ? -47.878 26.574  -14.455 1.00 38.01  ? 1327 LEU A CD2   1 
ATOM   4844  N  N     . PRO A 1 680 ? -47.698 22.450  -11.477 1.00 36.65  ? 1328 PRO A N     1 
ATOM   4845  C  CA    . PRO A 1 680 ? -46.805 22.329  -10.318 1.00 36.48  ? 1328 PRO A CA    1 
ATOM   4846  C  C     . PRO A 1 680 ? -45.939 23.570  -10.103 1.00 35.22  ? 1328 PRO A C     1 
ATOM   4847  O  O     . PRO A 1 680 ? -45.881 24.466  -10.938 1.00 35.00  ? 1328 PRO A O     1 
ATOM   4848  C  CB    . PRO A 1 680 ? -45.917 21.130  -10.679 1.00 36.81  ? 1328 PRO A CB    1 
ATOM   4849  C  CG    . PRO A 1 680 ? -46.716 20.345  -11.660 1.00 37.58  ? 1328 PRO A CG    1 
ATOM   4850  C  CD    . PRO A 1 680 ? -47.507 21.355  -12.444 1.00 37.20  ? 1328 PRO A CD    1 
ATOM   4851  N  N     . LEU A 1 681 ? -45.269 23.610  -8.963  1.00 35.38  ? 1329 LEU A N     1 
ATOM   4852  C  CA    . LEU A 1 681 ? -44.317 24.661  -8.666  1.00 35.21  ? 1329 LEU A CA    1 
ATOM   4853  C  C     . LEU A 1 681 ? -42.925 24.079  -8.814  1.00 37.46  ? 1329 LEU A C     1 
ATOM   4854  O  O     . LEU A 1 681 ? -42.772 22.886  -9.067  1.00 39.82  ? 1329 LEU A O     1 
ATOM   4855  C  CB    . LEU A 1 681 ? -44.521 25.146  -7.237  1.00 35.47  ? 1329 LEU A CB    1 
ATOM   4856  C  CG    . LEU A 1 681 ? -45.877 25.786  -6.969  1.00 34.48  ? 1329 LEU A CG    1 
ATOM   4857  C  CD1   . LEU A 1 681 ? -46.124 25.889  -5.479  1.00 32.96  ? 1329 LEU A CD1   1 
ATOM   4858  C  CD2   . LEU A 1 681 ? -45.950 27.150  -7.639  1.00 33.85  ? 1329 LEU A CD2   1 
ATOM   4859  N  N     . PHE A 1 682 ? -41.903 24.906  -8.658  1.00 35.78  ? 1330 PHE A N     1 
ATOM   4860  C  CA    . PHE A 1 682 ? -40.548 24.385  -8.660  1.00 35.56  ? 1330 PHE A CA    1 
ATOM   4861  C  C     . PHE A 1 682 ? -40.168 23.984  -7.247  1.00 38.70  ? 1330 PHE A C     1 
ATOM   4862  O  O     . PHE A 1 682 ? -40.787 24.438  -6.287  1.00 41.81  ? 1330 PHE A O     1 
ATOM   4863  C  CB    . PHE A 1 682 ? -39.584 25.393  -9.276  1.00 36.15  ? 1330 PHE A CB    1 
ATOM   4864  C  CG    . PHE A 1 682 ? -39.625 25.401  -10.775 1.00 35.80  ? 1330 PHE A CG    1 
ATOM   4865  C  CD1   . PHE A 1 682 ? -38.547 24.973  -11.516 1.00 37.82  ? 1330 PHE A CD1   1 
ATOM   4866  C  CD2   . PHE A 1 682 ? -40.770 25.784  -11.442 1.00 37.49  ? 1330 PHE A CD2   1 
ATOM   4867  C  CE1   . PHE A 1 682 ? -38.604 24.958  -12.893 1.00 39.31  ? 1330 PHE A CE1   1 
ATOM   4868  C  CE2   . PHE A 1 682 ? -40.828 25.767  -12.817 1.00 35.92  ? 1330 PHE A CE2   1 
ATOM   4869  C  CZ    . PHE A 1 682 ? -39.746 25.356  -13.541 1.00 36.50  ? 1330 PHE A CZ    1 
ATOM   4870  N  N     . PRO A 1 683 ? -39.179 23.094  -7.109  1.00 37.47  ? 1331 PRO A N     1 
ATOM   4871  C  CA    . PRO A 1 683 ? -38.830 22.618  -5.770  1.00 37.66  ? 1331 PRO A CA    1 
ATOM   4872  C  C     . PRO A 1 683 ? -38.115 23.704  -4.995  1.00 38.24  ? 1331 PRO A C     1 
ATOM   4873  O  O     . PRO A 1 683 ? -37.570 24.630  -5.581  1.00 37.68  ? 1331 PRO A O     1 
ATOM   4874  C  CB    . PRO A 1 683 ? -37.865 21.466  -6.044  1.00 36.40  ? 1331 PRO A CB    1 
ATOM   4875  C  CG    . PRO A 1 683 ? -37.959 21.188  -7.496  1.00 36.52  ? 1331 PRO A CG    1 
ATOM   4876  C  CD    . PRO A 1 683 ? -38.373 22.447  -8.149  1.00 36.34  ? 1331 PRO A CD    1 
ATOM   4877  N  N     . GLU A 1 684 ? -38.124 23.597  -3.678  1.00 39.99  ? 1332 GLU A N     1 
ATOM   4878  C  CA    . GLU A 1 684 ? -37.389 24.539  -2.863  1.00 40.63  ? 1332 GLU A CA    1 
ATOM   4879  C  C     . GLU A 1 684 ? -36.055 23.904  -2.503  1.00 40.36  ? 1332 GLU A C     1 
ATOM   4880  O  O     . GLU A 1 684 ? -36.015 22.763  -2.040  1.00 37.62  ? 1332 GLU A O     1 
ATOM   4881  C  CB    . GLU A 1 684 ? -38.175 24.881  -1.602  1.00 40.36  ? 1332 GLU A CB    1 
ATOM   4882  C  CG    . GLU A 1 684 ? -38.011 26.314  -1.158  1.00 43.86  ? 1332 GLU A CG    1 
ATOM   4883  C  CD    . GLU A 1 684 ? -38.925 27.267  -1.904  1.00 45.27  ? 1332 GLU A CD    1 
ATOM   4884  O  OE1   . GLU A 1 684 ? -39.894 26.795  -2.532  1.00 48.52  ? 1332 GLU A OE1   1 
ATOM   4885  O  OE2   . GLU A 1 684 ? -38.685 28.488  -1.856  1.00 42.17  ? 1332 GLU A OE2   1 
ATOM   4886  N  N     . PRO A 1 685 ? -34.954 24.641  -2.726  1.00 41.80  ? 1333 PRO A N     1 
ATOM   4887  C  CA    . PRO A 1 685 ? -33.609 24.144  -2.415  1.00 39.68  ? 1333 PRO A CA    1 
ATOM   4888  C  C     . PRO A 1 685 ? -33.571 23.423  -1.066  1.00 38.74  ? 1333 PRO A C     1 
ATOM   4889  O  O     . PRO A 1 685 ? -34.206 23.862  -0.113  1.00 42.22  ? 1333 PRO A O     1 
ATOM   4890  C  CB    . PRO A 1 685 ? -32.778 25.426  -2.369  1.00 38.47  ? 1333 PRO A CB    1 
ATOM   4891  C  CG    . PRO A 1 685 ? -33.466 26.333  -3.325  1.00 39.23  ? 1333 PRO A CG    1 
ATOM   4892  C  CD    . PRO A 1 685 ? -34.931 26.033  -3.209  1.00 39.94  ? 1333 PRO A CD    1 
ATOM   4893  N  N     . LEU A 1 686 ? -32.849 22.315  -0.994  1.00 37.16  ? 1334 LEU A N     1 
ATOM   4894  C  CA    . LEU A 1 686 ? -32.711 21.589  0.262   1.00 39.42  ? 1334 LEU A CA    1 
ATOM   4895  C  C     . LEU A 1 686 ? -31.341 21.829  0.882   1.00 40.15  ? 1334 LEU A C     1 
ATOM   4896  O  O     . LEU A 1 686 ? -31.204 21.848  2.103   1.00 42.97  ? 1334 LEU A O     1 
ATOM   4897  C  CB    . LEU A 1 686 ? -32.946 20.088  0.058   1.00 38.62  ? 1334 LEU A CB    1 
ATOM   4898  C  CG    . LEU A 1 686 ? -34.308 19.721  -0.528  1.00 36.10  ? 1334 LEU A CG    1 
ATOM   4899  C  CD1   . LEU A 1 686 ? -34.471 18.229  -0.598  1.00 31.14  ? 1334 LEU A CD1   1 
ATOM   4900  C  CD2   . LEU A 1 686 ? -35.412 20.333  0.300   1.00 37.99  ? 1334 LEU A CD2   1 
ATOM   4901  N  N     . HIS A 1 687 ? -30.331 22.018  0.040   1.00 37.41  ? 1335 HIS A N     1 
ATOM   4902  C  CA    . HIS A 1 687 ? -28.978 22.240  0.523   1.00 38.55  ? 1335 HIS A CA    1 
ATOM   4903  C  C     . HIS A 1 687 ? -28.446 23.617  0.164   1.00 40.31  ? 1335 HIS A C     1 
ATOM   4904  O  O     . HIS A 1 687 ? -28.760 24.164  -0.894  1.00 37.96  ? 1335 HIS A O     1 
ATOM   4905  C  CB    . HIS A 1 687 ? -28.039 21.187  -0.043  1.00 38.12  ? 1335 HIS A CB    1 
ATOM   4906  C  CG    . HIS A 1 687 ? -28.469 19.790  0.239   1.00 39.29  ? 1335 HIS A CG    1 
ATOM   4907  N  ND1   . HIS A 1 687 ? -27.707 18.914  0.977   1.00 40.52  ? 1335 HIS A ND1   1 
ATOM   4908  C  CD2   . HIS A 1 687 ? -29.590 19.115  -0.111  1.00 39.40  ? 1335 HIS A CD2   1 
ATOM   4909  C  CE1   . HIS A 1 687 ? -28.336 17.755  1.066   1.00 40.13  ? 1335 HIS A CE1   1 
ATOM   4910  N  NE2   . HIS A 1 687 ? -29.479 17.851  0.412   1.00 41.21  ? 1335 HIS A NE2   1 
ATOM   4911  N  N     . VAL A 1 688 ? -27.628 24.172  1.051   1.00 40.24  ? 1336 VAL A N     1 
ATOM   4912  C  CA    . VAL A 1 688 ? -26.942 25.409  0.745   1.00 41.34  ? 1336 VAL A CA    1 
ATOM   4913  C  C     . VAL A 1 688 ? -25.916 25.102  -0.324  1.00 41.29  ? 1336 VAL A C     1 
ATOM   4914  O  O     . VAL A 1 688 ? -25.325 24.031  -0.331  1.00 41.25  ? 1336 VAL A O     1 
ATOM   4915  C  CB    . VAL A 1 688 ? -26.272 26.023  1.989   1.00 42.38  ? 1336 VAL A CB    1 
ATOM   4916  C  CG1   . VAL A 1 688 ? -27.325 26.538  2.952   1.00 45.70  ? 1336 VAL A CG1   1 
ATOM   4917  C  CG2   . VAL A 1 688 ? -25.388 25.012  2.677   1.00 43.45  ? 1336 VAL A CG2   1 
ATOM   4918  N  N     . PHE A 1 689 ? -25.720 26.034  -1.243  1.00 45.03  ? 1337 PHE A N     1 
ATOM   4919  C  CA    . PHE A 1 689 ? -24.772 25.823  -2.327  1.00 46.04  ? 1337 PHE A CA    1 
ATOM   4920  C  C     . PHE A 1 689 ? -24.085 27.128  -2.726  1.00 49.54  ? 1337 PHE A C     1 
ATOM   4921  O  O     . PHE A 1 689 ? -24.653 28.212  -2.569  1.00 52.25  ? 1337 PHE A O     1 
ATOM   4922  C  CB    . PHE A 1 689 ? -25.476 25.190  -3.528  1.00 45.49  ? 1337 PHE A CB    1 
ATOM   4923  C  CG    . PHE A 1 689 ? -24.546 24.479  -4.466  1.00 45.28  ? 1337 PHE A CG    1 
ATOM   4924  C  CD1   . PHE A 1 689 ? -24.383 24.916  -5.768  1.00 45.40  ? 1337 PHE A CD1   1 
ATOM   4925  C  CD2   . PHE A 1 689 ? -23.827 23.383  -4.039  1.00 43.61  ? 1337 PHE A CD2   1 
ATOM   4926  C  CE1   . PHE A 1 689 ? -23.528 24.265  -6.623  1.00 45.02  ? 1337 PHE A CE1   1 
ATOM   4927  C  CE2   . PHE A 1 689 ? -22.971 22.731  -4.890  1.00 46.45  ? 1337 PHE A CE2   1 
ATOM   4928  C  CZ    . PHE A 1 689 ? -22.820 23.172  -6.183  1.00 45.26  ? 1337 PHE A CZ    1 
ATOM   4929  N  N     . ALA A 1 690 ? -22.859 27.017  -3.232  1.00 48.65  ? 1338 ALA A N     1 
ATOM   4930  C  CA    . ALA A 1 690 ? -22.069 28.182  -3.612  1.00 48.94  ? 1338 ALA A CA    1 
ATOM   4931  C  C     . ALA A 1 690 ? -22.875 29.165  -4.467  1.00 49.55  ? 1338 ALA A C     1 
ATOM   4932  O  O     . ALA A 1 690 ? -23.454 28.781  -5.481  1.00 48.24  ? 1338 ALA A O     1 
ATOM   4933  C  CB    . ALA A 1 690 ? -20.821 27.744  -4.334  1.00 50.68  ? 1338 ALA A CB    1 
ATOM   4934  N  N     . PRO A 1 691 ? -22.905 30.443  -4.055  1.00 53.06  ? 1339 PRO A N     1 
ATOM   4935  C  CA    . PRO A 1 691 ? -23.766 31.484  -4.628  1.00 50.92  ? 1339 PRO A CA    1 
ATOM   4936  C  C     . PRO A 1 691 ? -23.525 31.713  -6.113  1.00 49.50  ? 1339 PRO A C     1 
ATOM   4937  O  O     . PRO A 1 691 ? -24.452 32.084  -6.829  1.00 48.04  ? 1339 PRO A O     1 
ATOM   4938  C  CB    . PRO A 1 691 ? -23.372 32.738  -3.842  1.00 50.25  ? 1339 PRO A CB    1 
ATOM   4939  C  CG    . PRO A 1 691 ? -22.770 32.231  -2.592  1.00 55.22  ? 1339 PRO A CG    1 
ATOM   4940  C  CD    . PRO A 1 691 ? -22.062 30.974  -2.973  1.00 57.31  ? 1339 PRO A CD    1 
ATOM   4941  N  N     . ARG A 1 692 ? -22.294 31.503  -6.566  1.00 49.96  ? 1340 ARG A N     1 
ATOM   4942  C  CA    . ARG A 1 692 ? -21.965 31.703  -7.976  1.00 51.74  ? 1340 ARG A CA    1 
ATOM   4943  C  C     . ARG A 1 692 ? -22.600 30.618  -8.851  1.00 50.18  ? 1340 ARG A C     1 
ATOM   4944  O  O     . ARG A 1 692 ? -22.966 30.852  -10.007 1.00 49.35  ? 1340 ARG A O     1 
ATOM   4945  C  CB    . ARG A 1 692 ? -20.447 31.728  -8.175  1.00 50.29  ? 1340 ARG A CB    1 
ATOM   4946  N  N     . ALA A 1 693 ? -22.731 29.423  -8.292  1.00 47.02  ? 1341 ALA A N     1 
ATOM   4947  C  CA    . ALA A 1 693 ? -23.297 28.320  -9.038  1.00 44.03  ? 1341 ALA A CA    1 
ATOM   4948  C  C     . ALA A 1 693 ? -24.806 28.441  -9.073  1.00 44.27  ? 1341 ALA A C     1 
ATOM   4949  O  O     . ALA A 1 693 ? -25.479 27.582  -9.629  1.00 47.18  ? 1341 ALA A O     1 
ATOM   4950  C  CB    . ALA A 1 693 ? -22.887 27.001  -8.416  1.00 43.02  ? 1341 ALA A CB    1 
ATOM   4951  N  N     . CYS A 1 694 ? -25.345 29.509  -8.494  1.00 42.54  ? 1342 CYS A N     1 
ATOM   4952  C  CA    . CYS A 1 694 ? -26.788 29.584  -8.300  1.00 39.99  ? 1342 CYS A CA    1 
ATOM   4953  C  C     . CYS A 1 694 ? -27.512 30.775  -8.932  1.00 41.07  ? 1342 CYS A C     1 
ATOM   4954  O  O     . CYS A 1 694 ? -28.464 31.290  -8.346  1.00 42.50  ? 1342 CYS A O     1 
ATOM   4955  C  CB    . CYS A 1 694 ? -27.118 29.521  -6.807  1.00 40.95  ? 1342 CYS A CB    1 
ATOM   4956  S  SG    . CYS A 1 694 ? -26.711 27.941  -5.999  1.00 45.73  ? 1342 CYS A SG    1 
ATOM   4957  N  N     . GLN A 1 695 ? -27.102 31.206  -10.121 1.00 38.87  ? 1343 GLN A N     1 
ATOM   4958  C  CA    . GLN A 1 695 ? -27.847 32.272  -10.792 1.00 41.04  ? 1343 GLN A CA    1 
ATOM   4959  C  C     . GLN A 1 695 ? -29.034 31.678  -11.541 1.00 42.66  ? 1343 GLN A C     1 
ATOM   4960  O  O     . GLN A 1 695 ? -28.907 31.223  -12.670 1.00 46.52  ? 1343 GLN A O     1 
ATOM   4961  C  CB    . GLN A 1 695 ? -26.958 33.092  -11.727 1.00 42.79  ? 1343 GLN A CB    1 
ATOM   4962  N  N     . LEU A 1 696 ? -30.195 31.685  -10.904 1.00 41.58  ? 1344 LEU A N     1 
ATOM   4963  C  CA    . LEU A 1 696 ? -31.340 30.964  -11.434 1.00 40.88  ? 1344 LEU A CA    1 
ATOM   4964  C  C     . LEU A 1 696 ? -32.292 31.864  -12.206 1.00 43.61  ? 1344 LEU A C     1 
ATOM   4965  O  O     . LEU A 1 696 ? -33.239 31.388  -12.835 1.00 42.89  ? 1344 LEU A O     1 
ATOM   4966  C  CB    . LEU A 1 696 ? -32.095 30.284  -10.297 1.00 41.76  ? 1344 LEU A CB    1 
ATOM   4967  C  CG    . LEU A 1 696 ? -31.261 29.572  -9.236  1.00 40.37  ? 1344 LEU A CG    1 
ATOM   4968  C  CD1   . LEU A 1 696 ? -32.195 29.003  -8.194  1.00 43.53  ? 1344 LEU A CD1   1 
ATOM   4969  C  CD2   . LEU A 1 696 ? -30.399 28.481  -9.846  1.00 35.49  ? 1344 LEU A CD2   1 
ATOM   4970  N  N     . SER A 1 697 ? -32.055 33.169  -12.141 1.00 46.03  ? 1345 SER A N     1 
ATOM   4971  C  CA    . SER A 1 697 ? -32.916 34.115  -12.838 1.00 46.69  ? 1345 SER A CA    1 
ATOM   4972  C  C     . SER A 1 697 ? -32.542 34.138  -14.308 1.00 42.50  ? 1345 SER A C     1 
ATOM   4973  O  O     . SER A 1 697 ? -31.401 33.867  -14.665 1.00 44.46  ? 1345 SER A O     1 
ATOM   4974  C  CB    . SER A 1 697 ? -32.820 35.510  -12.215 1.00 48.08  ? 1345 SER A CB    1 
ATOM   4975  O  OG    . SER A 1 697 ? -31.469 35.894  -12.038 1.00 51.42  ? 1345 SER A OG    1 
ATOM   4976  N  N     . VAL A 1 698 ? -33.513 34.439  -15.157 1.00 42.38  ? 1346 VAL A N     1 
ATOM   4977  C  CA    . VAL A 1 698 ? -33.291 34.432  -16.598 1.00 44.50  ? 1346 VAL A CA    1 
ATOM   4978  C  C     . VAL A 1 698 ? -33.917 35.647  -17.264 1.00 44.89  ? 1346 VAL A C     1 
ATOM   4979  O  O     . VAL A 1 698 ? -35.025 36.060  -16.922 1.00 46.11  ? 1346 VAL A O     1 
ATOM   4980  C  CB    . VAL A 1 698 ? -33.818 33.130  -17.261 1.00 43.41  ? 1346 VAL A CB    1 
ATOM   4981  C  CG1   . VAL A 1 698 ? -34.915 32.514  -16.433 1.00 42.59  ? 1346 VAL A CG1   1 
ATOM   4982  C  CG2   . VAL A 1 698 ? -34.320 33.408  -18.664 1.00 41.91  ? 1346 VAL A CG2   1 
ATOM   4983  N  N     . VAL A 1 699 ? -33.195 36.223  -18.215 1.00 45.23  ? 1347 VAL A N     1 
ATOM   4984  C  CA    . VAL A 1 699 ? -33.659 37.417  -18.901 1.00 44.96  ? 1347 VAL A CA    1 
ATOM   4985  C  C     . VAL A 1 699 ? -34.114 37.074  -20.313 1.00 43.62  ? 1347 VAL A C     1 
ATOM   4986  O  O     . VAL A 1 699 ? -33.385 36.441  -21.065 1.00 44.48  ? 1347 VAL A O     1 
ATOM   4987  C  CB    . VAL A 1 699 ? -32.546 38.482  -18.953 1.00 46.25  ? 1347 VAL A CB    1 
ATOM   4988  C  CG1   . VAL A 1 699 ? -33.040 39.743  -19.631 1.00 52.52  ? 1347 VAL A CG1   1 
ATOM   4989  C  CG2   . VAL A 1 699 ? -32.052 38.795  -17.551 1.00 49.30  ? 1347 VAL A CG2   1 
ATOM   4990  N  N     . VAL A 1 700 ? -35.327 37.490  -20.657 1.00 45.06  ? 1348 VAL A N     1 
ATOM   4991  C  CA    . VAL A 1 700 ? -35.885 37.300  -21.994 1.00 46.68  ? 1348 VAL A CA    1 
ATOM   4992  C  C     . VAL A 1 700 ? -36.471 38.630  -22.457 1.00 50.96  ? 1348 VAL A C     1 
ATOM   4993  O  O     . VAL A 1 700 ? -37.338 39.189  -21.784 1.00 51.60  ? 1348 VAL A O     1 
ATOM   4994  C  CB    . VAL A 1 700 ? -37.021 36.252  -21.982 1.00 46.64  ? 1348 VAL A CB    1 
ATOM   4995  C  CG1   . VAL A 1 700 ? -37.540 35.986  -23.390 1.00 45.40  ? 1348 VAL A CG1   1 
ATOM   4996  C  CG2   . VAL A 1 700 ? -36.556 34.968  -21.327 1.00 47.09  ? 1348 VAL A CG2   1 
ATOM   4997  N  N     . ASP A 1 701 ? -36.009 39.139  -23.596 1.00 50.49  ? 1349 ASP A N     1 
ATOM   4998  C  CA    . ASP A 1 701 ? -36.446 40.454  -24.069 1.00 54.51  ? 1349 ASP A CA    1 
ATOM   4999  C  C     . ASP A 1 701 ? -36.319 41.524  -22.982 1.00 58.02  ? 1349 ASP A C     1 
ATOM   5000  O  O     . ASP A 1 701 ? -37.275 42.258  -22.709 1.00 57.99  ? 1349 ASP A O     1 
ATOM   5001  C  CB    . ASP A 1 701 ? -37.895 40.416  -24.565 1.00 53.39  ? 1349 ASP A CB    1 
ATOM   5002  C  CG    . ASP A 1 701 ? -38.067 39.579  -25.815 1.00 57.66  ? 1349 ASP A CG    1 
ATOM   5003  O  OD1   . ASP A 1 701 ? -37.062 39.363  -26.530 1.00 56.99  ? 1349 ASP A OD1   1 
ATOM   5004  O  OD2   . ASP A 1 701 ? -39.213 39.144  -26.082 1.00 56.79  ? 1349 ASP A OD2   1 
ATOM   5005  N  N     . ASP A 1 702 ? -35.146 41.602  -22.360 1.00 57.11  ? 1350 ASP A N     1 
ATOM   5006  C  CA    . ASP A 1 702 ? -34.889 42.595  -21.317 1.00 59.98  ? 1350 ASP A CA    1 
ATOM   5007  C  C     . ASP A 1 702 ? -35.911 42.563  -20.176 1.00 57.81  ? 1350 ASP A C     1 
ATOM   5008  O  O     . ASP A 1 702 ? -36.062 43.535  -19.439 1.00 58.78  ? 1350 ASP A O     1 
ATOM   5009  C  CB    . ASP A 1 702 ? -34.801 44.001  -21.924 1.00 64.32  ? 1350 ASP A CB    1 
ATOM   5010  C  CG    . ASP A 1 702 ? -33.622 44.153  -22.882 1.00 70.54  ? 1350 ASP A CG    1 
ATOM   5011  O  OD1   . ASP A 1 702 ? -32.572 43.505  -22.651 1.00 71.35  ? 1350 ASP A OD1   1 
ATOM   5012  O  OD2   . ASP A 1 702 ? -33.746 44.919  -23.865 1.00 69.21  ? 1350 ASP A OD2   1 
ATOM   5013  N  N     . LYS A 1 703 ? -36.614 41.443  -20.041 1.00 56.02  ? 1351 LYS A N     1 
ATOM   5014  C  CA    . LYS A 1 703 ? -37.518 41.227  -18.913 1.00 54.64  ? 1351 LYS A CA    1 
ATOM   5015  C  C     . LYS A 1 703 ? -36.937 40.150  -18.006 1.00 49.74  ? 1351 LYS A C     1 
ATOM   5016  O  O     . LYS A 1 703 ? -36.375 39.166  -18.483 1.00 47.52  ? 1351 LYS A O     1 
ATOM   5017  C  CB    . LYS A 1 703 ? -38.910 40.815  -19.400 1.00 53.44  ? 1351 LYS A CB    1 
ATOM   5018  C  CG    . LYS A 1 703 ? -39.809 41.975  -19.811 1.00 53.78  ? 1351 LYS A CG    1 
ATOM   5019  C  CD    . LYS A 1 703 ? -40.960 41.499  -20.695 1.00 52.73  ? 1351 LYS A CD    1 
ATOM   5020  C  CE    . LYS A 1 703 ? -40.429 40.879  -21.985 1.00 54.19  ? 1351 LYS A CE    1 
ATOM   5021  N  NZ    . LYS A 1 703 ? -41.504 40.511  -22.950 1.00 50.69  ? 1351 LYS A NZ    1 
ATOM   5022  N  N     . LYS A 1 704 ? -37.064 40.342  -16.700 1.00 47.68  ? 1352 LYS A N     1 
ATOM   5023  C  CA    . LYS A 1 704 ? -36.473 39.416  -15.748 1.00 47.43  ? 1352 LYS A CA    1 
ATOM   5024  C  C     . LYS A 1 704 ? -37.507 38.446  -15.198 1.00 49.05  ? 1352 LYS A C     1 
ATOM   5025  O  O     . LYS A 1 704 ? -38.536 38.857  -14.651 1.00 50.22  ? 1352 LYS A O     1 
ATOM   5026  C  CB    . LYS A 1 704 ? -35.826 40.176  -14.597 1.00 52.67  ? 1352 LYS A CB    1 
ATOM   5027  C  CG    . LYS A 1 704 ? -35.148 39.291  -13.579 1.00 49.64  ? 1352 LYS A CG    1 
ATOM   5028  C  CD    . LYS A 1 704 ? -34.736 40.104  -12.378 1.00 58.84  ? 1352 LYS A CD    1 
ATOM   5029  C  CE    . LYS A 1 704 ? -34.004 39.261  -11.365 1.00 62.76  ? 1352 LYS A CE    1 
ATOM   5030  N  NZ    . LYS A 1 704 ? -33.748 40.055  -10.138 1.00 71.12  ? 1352 LYS A NZ    1 
ATOM   5031  N  N     . PHE A 1 705 ? -37.231 37.155  -15.340 1.00 43.79  ? 1353 PHE A N     1 
ATOM   5032  C  CA    . PHE A 1 705 ? -38.122 36.149  -14.795 1.00 42.41  ? 1353 PHE A CA    1 
ATOM   5033  C  C     . PHE A 1 705 ? -37.417 35.318  -13.735 1.00 42.50  ? 1353 PHE A C     1 
ATOM   5034  O  O     . PHE A 1 705 ? -36.212 35.081  -13.816 1.00 42.04  ? 1353 PHE A O     1 
ATOM   5035  C  CB    . PHE A 1 705 ? -38.647 35.246  -15.901 1.00 39.01  ? 1353 PHE A CB    1 
ATOM   5036  C  CG    . PHE A 1 705 ? -39.396 35.968  -16.973 1.00 38.89  ? 1353 PHE A CG    1 
ATOM   5037  C  CD1   . PHE A 1 705 ? -40.771 36.102  -16.906 1.00 41.12  ? 1353 PHE A CD1   1 
ATOM   5038  C  CD2   . PHE A 1 705 ? -38.734 36.496  -18.061 1.00 41.95  ? 1353 PHE A CD2   1 
ATOM   5039  C  CE1   . PHE A 1 705 ? -41.472 36.760  -17.901 1.00 38.88  ? 1353 PHE A CE1   1 
ATOM   5040  C  CE2   . PHE A 1 705 ? -39.427 37.154  -19.056 1.00 42.72  ? 1353 PHE A CE2   1 
ATOM   5041  C  CZ    . PHE A 1 705 ? -40.798 37.284  -18.974 1.00 40.87  ? 1353 PHE A CZ    1 
ATOM   5042  N  N     . VAL A 1 706 ? -38.177 34.891  -12.733 1.00 41.00  ? 1354 VAL A N     1 
ATOM   5043  C  CA    . VAL A 1 706 ? -37.670 33.989  -11.707 1.00 42.85  ? 1354 VAL A CA    1 
ATOM   5044  C  C     . VAL A 1 706 ? -38.710 32.921  -11.414 1.00 43.28  ? 1354 VAL A C     1 
ATOM   5045  O  O     . VAL A 1 706 ? -39.865 33.040  -11.825 1.00 43.91  ? 1354 VAL A O     1 
ATOM   5046  C  CB    . VAL A 1 706 ? -37.341 34.726  -10.395 1.00 43.85  ? 1354 VAL A CB    1 
ATOM   5047  C  CG1   . VAL A 1 706 ? -36.162 35.669  -10.589 1.00 43.83  ? 1354 VAL A CG1   1 
ATOM   5048  C  CG2   . VAL A 1 706 ? -38.569 35.461  -9.871  1.00 41.60  ? 1354 VAL A CG2   1 
ATOM   5049  N  N     . SER A 1 707 ? -38.303 31.871  -10.710 1.00 41.33  ? 1355 SER A N     1 
ATOM   5050  C  CA    . SER A 1 707 ? -39.252 30.843  -10.317 1.00 41.28  ? 1355 SER A CA    1 
ATOM   5051  C  C     . SER A 1 707 ? -39.741 31.115  -8.901  1.00 41.71  ? 1355 SER A C     1 
ATOM   5052  O  O     . SER A 1 707 ? -39.169 31.927  -8.174  1.00 40.16  ? 1355 SER A O     1 
ATOM   5053  C  CB    . SER A 1 707 ? -38.651 29.441  -10.434 1.00 36.69  ? 1355 SER A CB    1 
ATOM   5054  O  OG    . SER A 1 707 ? -37.774 29.163  -9.363  1.00 33.05  ? 1355 SER A OG    1 
ATOM   5055  N  N     . ASN A 1 708 ? -40.817 30.437  -8.533  1.00 42.20  ? 1356 ASN A N     1 
ATOM   5056  C  CA    . ASN A 1 708 ? -41.434 30.585  -7.229  1.00 43.40  ? 1356 ASN A CA    1 
ATOM   5057  C  C     . ASN A 1 708 ? -40.469 30.327  -6.083  1.00 42.53  ? 1356 ASN A C     1 
ATOM   5058  O  O     . ASN A 1 708 ? -40.806 30.560  -4.925  1.00 43.34  ? 1356 ASN A O     1 
ATOM   5059  C  CB    . ASN A 1 708 ? -42.592 29.606  -7.125  1.00 43.37  ? 1356 ASN A CB    1 
ATOM   5060  C  CG    . ASN A 1 708 ? -42.160 28.185  -7.392  1.00 40.46  ? 1356 ASN A CG    1 
ATOM   5061  O  OD1   . ASN A 1 708 ? -41.861 27.432  -6.464  1.00 41.00  ? 1356 ASN A OD1   1 
ATOM   5062  N  ND2   . ASN A 1 708 ? -42.101 27.815  -8.668  1.00 38.74  ? 1356 ASN A ND2   1 
ATOM   5063  N  N     . ILE A 1 709 ? -39.277 29.836  -6.406  1.00 40.92  ? 1357 ILE A N     1 
ATOM   5064  C  CA    . ILE A 1 709 ? -38.279 29.523  -5.390  1.00 41.30  ? 1357 ILE A CA    1 
ATOM   5065  C  C     . ILE A 1 709 ? -38.030 30.690  -4.448  1.00 42.20  ? 1357 ILE A C     1 
ATOM   5066  O  O     . ILE A 1 709 ? -37.758 31.805  -4.879  1.00 43.91  ? 1357 ILE A O     1 
ATOM   5067  C  CB    . ILE A 1 709 ? -36.946 29.101  -6.011  1.00 41.20  ? 1357 ILE A CB    1 
ATOM   5068  C  CG1   . ILE A 1 709 ? -37.115 27.817  -6.809  1.00 41.85  ? 1357 ILE A CG1   1 
ATOM   5069  C  CG2   . ILE A 1 709 ? -35.900 28.878  -4.938  1.00 43.00  ? 1357 ILE A CG2   1 
ATOM   5070  C  CD1   . ILE A 1 709 ? -35.803 27.270  -7.315  1.00 43.44  ? 1357 ILE A CD1   1 
ATOM   5071  N  N     . THR A 1 710 ? -38.109 30.406  -3.155  1.00 42.28  ? 1358 THR A N     1 
ATOM   5072  C  CA    . THR A 1 710 ? -38.005 31.412  -2.119  1.00 41.27  ? 1358 THR A CA    1 
ATOM   5073  C  C     . THR A 1 710 ? -36.656 31.365  -1.418  1.00 46.49  ? 1358 THR A C     1 
ATOM   5074  O  O     . THR A 1 710 ? -36.093 32.400  -1.068  1.00 49.01  ? 1358 THR A O     1 
ATOM   5075  C  CB    . THR A 1 710 ? -39.100 31.200  -1.093  1.00 41.65  ? 1358 THR A CB    1 
ATOM   5076  O  OG1   . THR A 1 710 ? -40.211 32.039  -1.421  1.00 42.04  ? 1358 THR A OG1   1 
ATOM   5077  C  CG2   . THR A 1 710 ? -38.596 31.522  0.306   1.00 44.96  ? 1358 THR A CG2   1 
ATOM   5078  N  N     . ARG A 1 711 ? -36.138 30.160  -1.212  1.00 46.57  ? 1359 ARG A N     1 
ATOM   5079  C  CA    . ARG A 1 711 ? -34.833 29.989  -0.588  1.00 48.01  ? 1359 ARG A CA    1 
ATOM   5080  C  C     . ARG A 1 711 ? -33.740 30.499  -1.508  1.00 52.41  ? 1359 ARG A C     1 
ATOM   5081  O  O     . ARG A 1 711 ? -33.196 29.744  -2.313  1.00 53.04  ? 1359 ARG A O     1 
ATOM   5082  C  CB    . ARG A 1 711 ? -34.578 28.516  -0.273  1.00 46.48  ? 1359 ARG A CB    1 
ATOM   5083  C  CG    . ARG A 1 711 ? -35.671 27.873  0.542   1.00 44.39  ? 1359 ARG A CG    1 
ATOM   5084  C  CD    . ARG A 1 711 ? -35.112 26.884  1.532   1.00 44.95  ? 1359 ARG A CD    1 
ATOM   5085  N  NE    . ARG A 1 711 ? -36.099 26.555  2.550   1.00 46.43  ? 1359 ARG A NE    1 
ATOM   5086  C  CZ    . ARG A 1 711 ? -36.888 25.489  2.508   1.00 47.01  ? 1359 ARG A CZ    1 
ATOM   5087  N  NH1   . ARG A 1 711 ? -36.801 24.638  1.495   1.00 41.71  ? 1359 ARG A NH1   1 
ATOM   5088  N  NH2   . ARG A 1 711 ? -37.761 25.274  3.484   1.00 50.53  ? 1359 ARG A NH2   1 
ATOM   5089  N  N     . LEU A 1 712 ? -33.412 31.779  -1.390  1.00 55.97  ? 1360 LEU A N     1 
ATOM   5090  C  CA    . LEU A 1 712 ? -32.427 32.375  -2.284  1.00 59.78  ? 1360 LEU A CA    1 
ATOM   5091  C  C     . LEU A 1 712 ? -31.002 31.981  -1.902  1.00 62.16  ? 1360 LEU A C     1 
ATOM   5092  O  O     . LEU A 1 712 ? -30.214 31.540  -2.748  1.00 61.81  ? 1360 LEU A O     1 
ATOM   5093  C  CB    . LEU A 1 712 ? -32.591 33.894  -2.329  1.00 57.65  ? 1360 LEU A CB    1 
ATOM   5094  C  CG    . LEU A 1 712 ? -33.975 34.295  -2.833  1.00 60.59  ? 1360 LEU A CG    1 
ATOM   5095  C  CD1   . LEU A 1 712 ? -34.085 35.804  -3.007  1.00 65.28  ? 1360 LEU A CD1   1 
ATOM   5096  C  CD2   . LEU A 1 712 ? -34.282 33.564  -4.142  1.00 56.85  ? 1360 LEU A CD2   1 
ATOM   5097  N  N     . SER A 1 713 ? -30.682 32.125  -0.621  1.00 61.12  ? 1361 SER A N     1 
ATOM   5098  C  CA    . SER A 1 713 ? -29.345 31.813  -0.139  1.00 62.74  ? 1361 SER A CA    1 
ATOM   5099  C  C     . SER A 1 713 ? -29.327 30.563  0.739   1.00 59.00  ? 1361 SER A C     1 
ATOM   5100  O  O     . SER A 1 713 ? -28.829 29.514  0.321   1.00 60.13  ? 1361 SER A O     1 
ATOM   5101  C  CB    . SER A 1 713 ? -28.758 33.009  0.615   1.00 66.89  ? 1361 SER A CB    1 
ATOM   5102  O  OG    . SER A 1 713 ? -29.613 33.414  1.671   1.00 68.53  ? 1361 SER A OG    1 
ATOM   5103  N  N     . SER A 1 714 ? -29.874 30.669  1.946   1.00 53.33  ? 1362 SER A N     1 
ATOM   5104  C  CA    . SER A 1 714 ? -29.762 29.578  2.909   1.00 52.91  ? 1362 SER A CA    1 
ATOM   5105  C  C     . SER A 1 714 ? -30.679 28.399  2.588   1.00 53.54  ? 1362 SER A C     1 
ATOM   5106  O  O     . SER A 1 714 ? -31.428 28.427  1.605   1.00 55.79  ? 1362 SER A O     1 
ATOM   5107  C  CB    . SER A 1 714 ? -30.018 30.078  4.324   1.00 51.23  ? 1362 SER A CB    1 
ATOM   5108  O  OG    . SER A 1 714 ? -29.252 29.341  5.256   1.00 51.32  ? 1362 SER A OG    1 
ATOM   5109  N  N     . GLY A 1 715 ? -30.600 27.359  3.413   1.00 46.66  ? 1363 GLY A N     1 
ATOM   5110  C  CA    . GLY A 1 715 ? -31.428 26.179  3.242   1.00 45.39  ? 1363 GLY A CA    1 
ATOM   5111  C  C     . GLY A 1 715 ? -31.383 25.279  4.463   1.00 44.80  ? 1363 GLY A C     1 
ATOM   5112  O  O     . GLY A 1 715 ? -30.602 25.522  5.381   1.00 46.57  ? 1363 GLY A O     1 
ATOM   5113  N  N     . PRO A 1 716 ? -32.229 24.241  4.485   1.00 41.71  ? 1364 PRO A N     1 
ATOM   5114  C  CA    . PRO A 1 716 ? -32.309 23.290  5.594   1.00 41.07  ? 1364 PRO A CA    1 
ATOM   5115  C  C     . PRO A 1 716 ? -31.012 22.539  5.845   1.00 42.55  ? 1364 PRO A C     1 
ATOM   5116  O  O     . PRO A 1 716 ? -30.670 22.337  7.008   1.00 42.12  ? 1364 PRO A O     1 
ATOM   5117  C  CB    . PRO A 1 716 ? -33.387 22.312  5.132   1.00 38.78  ? 1364 PRO A CB    1 
ATOM   5118  C  CG    . PRO A 1 716 ? -34.249 23.107  4.254   1.00 42.23  ? 1364 PRO A CG    1 
ATOM   5119  C  CD    . PRO A 1 716 ? -33.313 24.026  3.515   1.00 44.63  ? 1364 PRO A CD    1 
ATOM   5120  N  N     . PHE A 1 717 ? -30.302 22.141  4.790   1.00 42.18  ? 1365 PHE A N     1 
ATOM   5121  C  CA    . PHE A 1 717 ? -29.149 21.245  4.944   1.00 41.40  ? 1365 PHE A CA    1 
ATOM   5122  C  C     . PHE A 1 717 ? -27.814 21.821  4.473   1.00 41.39  ? 1365 PHE A C     1 
ATOM   5123  O  O     . PHE A 1 717 ? -27.775 22.781  3.708   1.00 40.62  ? 1365 PHE A O     1 
ATOM   5124  C  CB    . PHE A 1 717 ? -29.422 19.919  4.235   1.00 38.14  ? 1365 PHE A CB    1 
ATOM   5125  C  CG    . PHE A 1 717 ? -30.672 19.228  4.708   1.00 38.92  ? 1365 PHE A CG    1 
ATOM   5126  C  CD1   . PHE A 1 717 ? -31.773 19.116  3.885   1.00 39.12  ? 1365 PHE A CD1   1 
ATOM   5127  C  CD2   . PHE A 1 717 ? -30.745 18.696  5.979   1.00 39.69  ? 1365 PHE A CD2   1 
ATOM   5128  C  CE1   . PHE A 1 717 ? -32.918 18.476  4.320   1.00 38.20  ? 1365 PHE A CE1   1 
ATOM   5129  C  CE2   . PHE A 1 717 ? -31.888 18.066  6.416   1.00 38.64  ? 1365 PHE A CE2   1 
ATOM   5130  C  CZ    . PHE A 1 717 ? -32.975 17.958  5.586   1.00 35.80  ? 1365 PHE A CZ    1 
ATOM   5131  N  N     . ARG A 1 718 ? -26.719 21.226  4.937   1.00 41.23  ? 1366 ARG A N     1 
ATOM   5132  C  CA    . ARG A 1 718 ? -25.387 21.618  4.485   1.00 40.93  ? 1366 ARG A CA    1 
ATOM   5133  C  C     . ARG A 1 718 ? -25.141 21.129  3.070   1.00 45.50  ? 1366 ARG A C     1 
ATOM   5134  O  O     . ARG A 1 718 ? -25.787 20.191  2.607   1.00 46.30  ? 1366 ARG A O     1 
ATOM   5135  C  CB    . ARG A 1 718 ? -24.316 21.033  5.394   1.00 44.36  ? 1366 ARG A CB    1 
ATOM   5136  C  CG    . ARG A 1 718 ? -24.761 19.791  6.133   1.00 49.95  ? 1366 ARG A CG    1 
ATOM   5137  C  CD    . ARG A 1 718 ? -23.592 19.108  6.822   1.00 50.46  ? 1366 ARG A CD    1 
ATOM   5138  N  NE    . ARG A 1 718 ? -22.818 18.306  5.886   1.00 52.90  ? 1366 ARG A NE    1 
ATOM   5139  C  CZ    . ARG A 1 718 ? -22.273 17.135  6.194   1.00 59.36  ? 1366 ARG A CZ    1 
ATOM   5140  N  NH1   . ARG A 1 718 ? -22.417 16.641  7.421   1.00 62.81  ? 1366 ARG A NH1   1 
ATOM   5141  N  NH2   . ARG A 1 718 ? -21.587 16.459  5.280   1.00 54.33  ? 1366 ARG A NH2   1 
ATOM   5142  N  N     . THR A 1 719 ? -24.203 21.760  2.376   1.00 45.38  ? 1367 THR A N     1 
ATOM   5143  C  CA    . THR A 1 719 ? -23.890 21.344  1.021   1.00 43.82  ? 1367 THR A CA    1 
ATOM   5144  C  C     . THR A 1 719 ? -23.152 20.006  1.040   1.00 46.97  ? 1367 THR A C     1 
ATOM   5145  O  O     . THR A 1 719 ? -22.346 19.750  1.933   1.00 48.66  ? 1367 THR A O     1 
ATOM   5146  C  CB    . THR A 1 719 ? -23.042 22.392  0.294   1.00 46.72  ? 1367 THR A CB    1 
ATOM   5147  O  OG1   . THR A 1 719 ? -22.821 21.972  -1.061  1.00 52.16  ? 1367 THR A OG1   1 
ATOM   5148  C  CG2   . THR A 1 719 ? -21.708 22.581  0.999   1.00 48.80  ? 1367 THR A CG2   1 
ATOM   5149  N  N     . ILE A 1 720 ? -23.438 19.157  0.054   1.00 45.51  ? 1368 ILE A N     1 
ATOM   5150  C  CA    . ILE A 1 720 ? -22.777 17.867  -0.081  1.00 42.82  ? 1368 ILE A CA    1 
ATOM   5151  C  C     . ILE A 1 720 ? -21.411 18.029  -0.736  1.00 42.97  ? 1368 ILE A C     1 
ATOM   5152  O  O     . ILE A 1 720 ? -21.283 18.715  -1.744  1.00 43.16  ? 1368 ILE A O     1 
ATOM   5153  C  CB    . ILE A 1 720 ? -23.612 16.900  -0.930  1.00 41.47  ? 1368 ILE A CB    1 
ATOM   5154  C  CG1   . ILE A 1 720 ? -25.060 16.876  -0.443  1.00 40.52  ? 1368 ILE A CG1   1 
ATOM   5155  C  CG2   . ILE A 1 720 ? -23.001 15.504  -0.898  1.00 42.50  ? 1368 ILE A CG2   1 
ATOM   5156  C  CD1   . ILE A 1 720 ? -25.198 16.552  1.023   1.00 41.33  ? 1368 ILE A CD1   1 
ATOM   5157  N  N     . THR A 1 721 ? -20.391 17.392  -0.170  1.00 44.35  ? 1369 THR A N     1 
ATOM   5158  C  CA    . THR A 1 721 ? -19.035 17.552  -0.685  1.00 44.83  ? 1369 THR A CA    1 
ATOM   5159  C  C     . THR A 1 721 ? -18.492 16.337  -1.410  1.00 43.74  ? 1369 THR A C     1 
ATOM   5160  O  O     . THR A 1 721 ? -19.072 15.251  -1.371  1.00 43.05  ? 1369 THR A O     1 
ATOM   5161  C  CB    . THR A 1 721 ? -18.035 17.886  0.423   1.00 46.60  ? 1369 THR A CB    1 
ATOM   5162  O  OG1   . THR A 1 721 ? -18.144 16.915  1.474   1.00 45.84  ? 1369 THR A OG1   1 
ATOM   5163  C  CG2   . THR A 1 721 ? -18.297 19.275  0.966   1.00 47.07  ? 1369 THR A CG2   1 
ATOM   5164  N  N     . VAL A 1 722 ? -17.361 16.548  -2.072  1.00 42.36  ? 1370 VAL A N     1 
ATOM   5165  C  CA    . VAL A 1 722 ? -16.628 15.484  -2.729  1.00 40.90  ? 1370 VAL A CA    1 
ATOM   5166  C  C     . VAL A 1 722 ? -16.249 14.425  -1.699  1.00 42.82  ? 1370 VAL A C     1 
ATOM   5167  O  O     . VAL A 1 722 ? -16.270 13.226  -1.985  1.00 39.89  ? 1370 VAL A O     1 
ATOM   5168  C  CB    . VAL A 1 722 ? -15.385 16.045  -3.436  1.00 40.41  ? 1370 VAL A CB    1 
ATOM   5169  C  CG1   . VAL A 1 722 ? -14.357 14.971  -3.657  1.00 41.13  ? 1370 VAL A CG1   1 
ATOM   5170  C  CG2   . VAL A 1 722 ? -15.781 16.686  -4.749  1.00 39.89  ? 1370 VAL A CG2   1 
ATOM   5171  N  N     . ARG A 1 723 ? -15.931 14.867  -0.487  1.00 45.16  ? 1371 ARG A N     1 
ATOM   5172  C  CA    . ARG A 1 723 ? -15.694 13.929  0.606   1.00 44.44  ? 1371 ARG A CA    1 
ATOM   5173  C  C     . ARG A 1 723 ? -16.953 13.110  0.869   1.00 41.94  ? 1371 ARG A C     1 
ATOM   5174  O  O     . ARG A 1 723 ? -16.919 11.882  0.895   1.00 41.50  ? 1371 ARG A O     1 
ATOM   5175  C  CB    . ARG A 1 723 ? -15.283 14.664  1.876   1.00 45.90  ? 1371 ARG A CB    1 
ATOM   5176  C  CG    . ARG A 1 723 ? -14.796 13.744  2.983   1.00 46.22  ? 1371 ARG A CG    1 
ATOM   5177  C  CD    . ARG A 1 723 ? -14.632 14.501  4.284   1.00 50.93  ? 1371 ARG A CD    1 
ATOM   5178  N  NE    . ARG A 1 723 ? -13.992 15.790  4.060   1.00 54.75  ? 1371 ARG A NE    1 
ATOM   5179  C  CZ    . ARG A 1 723 ? -12.677 15.978  4.070   1.00 56.41  ? 1371 ARG A CZ    1 
ATOM   5180  N  NH1   . ARG A 1 723 ? -11.857 14.954  4.305   1.00 54.73  ? 1371 ARG A NH1   1 
ATOM   5181  N  NH2   . ARG A 1 723 ? -12.185 17.190  3.849   1.00 52.06  ? 1371 ARG A NH2   1 
ATOM   5182  N  N     . ASP A 1 724 ? -18.068 13.800  1.053   1.00 40.51  ? 1372 ASP A N     1 
ATOM   5183  C  CA    . ASP A 1 724 ? -19.339 13.134  1.286   1.00 42.68  ? 1372 ASP A CA    1 
ATOM   5184  C  C     . ASP A 1 724 ? -19.698 12.152  0.171   1.00 42.57  ? 1372 ASP A C     1 
ATOM   5185  O  O     . ASP A 1 724 ? -20.442 11.189  0.384   1.00 39.84  ? 1372 ASP A O     1 
ATOM   5186  C  CB    . ASP A 1 724 ? -20.447 14.176  1.432   1.00 44.44  ? 1372 ASP A CB    1 
ATOM   5187  C  CG    . ASP A 1 724 ? -20.350 14.950  2.730   1.00 50.28  ? 1372 ASP A CG    1 
ATOM   5188  O  OD1   . ASP A 1 724 ? -19.766 14.411  3.702   1.00 48.47  ? 1372 ASP A OD1   1 
ATOM   5189  O  OD2   . ASP A 1 724 ? -20.864 16.092  2.775   1.00 50.41  ? 1372 ASP A OD2   1 
ATOM   5190  N  N     . THR A 1 725 ? -19.156 12.408  -1.015  1.00 42.47  ? 1373 THR A N     1 
ATOM   5191  C  CA    . THR A 1 725 ? -19.563 11.706  -2.225  1.00 39.46  ? 1373 THR A CA    1 
ATOM   5192  C  C     . THR A 1 725 ? -18.893 10.351  -2.404  1.00 40.86  ? 1373 THR A C     1 
ATOM   5193  O  O     . THR A 1 725 ? -19.554 9.368   -2.733  1.00 40.66  ? 1373 THR A O     1 
ATOM   5194  C  CB    . THR A 1 725 ? -19.278 12.562  -3.476  1.00 38.00  ? 1373 THR A CB    1 
ATOM   5195  O  OG1   . THR A 1 725 ? -20.340 13.504  -3.663  1.00 37.88  ? 1373 THR A OG1   1 
ATOM   5196  C  CG2   . THR A 1 725 ? -19.175 11.683  -4.711  1.00 36.88  ? 1373 THR A CG2   1 
ATOM   5197  N  N     . MET A 1 726 ? -17.585 10.297  -2.174  1.00 41.44  ? 1374 MET A N     1 
ATOM   5198  C  CA    . MET A 1 726 ? -16.802 9.147   -2.593  1.00 38.85  ? 1374 MET A CA    1 
ATOM   5199  C  C     . MET A 1 726 ? -15.593 8.873   -1.705  1.00 42.08  ? 1374 MET A C     1 
ATOM   5200  O  O     . MET A 1 726 ? -14.531 8.499   -2.202  1.00 44.27  ? 1374 MET A O     1 
ATOM   5201  C  CB    . MET A 1 726 ? -16.312 9.389   -4.014  1.00 38.78  ? 1374 MET A CB    1 
ATOM   5202  C  CG    . MET A 1 726 ? -15.189 10.411  -4.085  1.00 40.57  ? 1374 MET A CG    1 
ATOM   5203  S  SD    . MET A 1 726 ? -15.179 11.424  -5.572  1.00 39.88  ? 1374 MET A SD    1 
ATOM   5204  C  CE    . MET A 1 726 ? -13.478 11.968  -5.512  1.00 42.62  ? 1374 MET A CE    1 
ATOM   5205  N  N     . SER A 1 727 ? -15.736 9.052   -0.397  1.00 43.03  ? 1375 SER A N     1 
ATOM   5206  C  CA    . SER A 1 727 ? -14.599 8.851   0.492   1.00 41.44  ? 1375 SER A CA    1 
ATOM   5207  C  C     . SER A 1 727 ? -14.457 7.394   0.900   1.00 43.87  ? 1375 SER A C     1 
ATOM   5208  O  O     . SER A 1 727 ? -13.375 6.960   1.278   1.00 47.92  ? 1375 SER A O     1 
ATOM   5209  C  CB    . SER A 1 727 ? -14.705 9.740   1.724   1.00 40.24  ? 1375 SER A CB    1 
ATOM   5210  O  OG    . SER A 1 727 ? -15.934 9.527   2.388   1.00 46.78  ? 1375 SER A OG    1 
ATOM   5211  N  N     . ASP A 1 728 ? -15.548 6.642   0.802   1.00 42.00  ? 1376 ASP A N     1 
ATOM   5212  C  CA    . ASP A 1 728 ? -15.551 5.239   1.191   1.00 43.21  ? 1376 ASP A CA    1 
ATOM   5213  C  C     . ASP A 1 728 ? -14.981 4.295   0.128   1.00 45.43  ? 1376 ASP A C     1 
ATOM   5214  O  O     . ASP A 1 728 ? -14.877 3.092   0.363   1.00 46.95  ? 1376 ASP A O     1 
ATOM   5215  C  CB    . ASP A 1 728 ? -16.969 4.789   1.558   1.00 47.07  ? 1376 ASP A CB    1 
ATOM   5216  C  CG    . ASP A 1 728 ? -17.913 4.775   0.361   1.00 46.26  ? 1376 ASP A CG    1 
ATOM   5217  O  OD1   . ASP A 1 728 ? -18.712 3.817   0.240   1.00 46.24  ? 1376 ASP A OD1   1 
ATOM   5218  O  OD2   . ASP A 1 728 ? -17.861 5.722   -0.453  1.00 44.72  ? 1376 ASP A OD2   1 
ATOM   5219  N  N     . LEU A 1 729 ? -14.617 4.827   -1.035  1.00 43.74  ? 1377 LEU A N     1 
ATOM   5220  C  CA    . LEU A 1 729 ? -14.185 3.977   -2.142  1.00 43.17  ? 1377 LEU A CA    1 
ATOM   5221  C  C     . LEU A 1 729 ? -12.735 3.540   -2.010  1.00 46.22  ? 1377 LEU A C     1 
ATOM   5222  O  O     . LEU A 1 729 ? -11.868 4.354   -1.692  1.00 48.88  ? 1377 LEU A O     1 
ATOM   5223  C  CB    . LEU A 1 729 ? -14.372 4.688   -3.477  1.00 40.97  ? 1377 LEU A CB    1 
ATOM   5224  C  CG    . LEU A 1 729 ? -15.748 5.285   -3.736  1.00 41.86  ? 1377 LEU A CG    1 
ATOM   5225  C  CD1   . LEU A 1 729 ? -15.890 5.615   -5.209  1.00 40.67  ? 1377 LEU A CD1   1 
ATOM   5226  C  CD2   . LEU A 1 729 ? -16.845 4.342   -3.289  1.00 40.92  ? 1377 LEU A CD2   1 
ATOM   5227  N  N     . PRO A 1 730 ? -12.467 2.249   -2.273  1.00 44.43  ? 1378 PRO A N     1 
ATOM   5228  C  CA    . PRO A 1 730 ? -11.114 1.683   -2.264  1.00 43.40  ? 1378 PRO A CA    1 
ATOM   5229  C  C     . PRO A 1 730 ? -10.202 2.461   -3.194  1.00 46.28  ? 1378 PRO A C     1 
ATOM   5230  O  O     . PRO A 1 730 ? -10.683 3.140   -4.097  1.00 47.91  ? 1378 PRO A O     1 
ATOM   5231  C  CB    . PRO A 1 730 ? -11.327 0.284   -2.829  1.00 44.22  ? 1378 PRO A CB    1 
ATOM   5232  C  CG    . PRO A 1 730 ? -12.728 -0.041  -2.501  1.00 46.89  ? 1378 PRO A CG    1 
ATOM   5233  C  CD    . PRO A 1 730 ? -13.480 1.243   -2.624  1.00 42.75  ? 1378 PRO A CD    1 
ATOM   5234  N  N     . GLU A 1 731 ? -8.898  2.370   -2.986  1.00 48.11  ? 1379 GLU A N     1 
ATOM   5235  C  CA    . GLU A 1 731 ? -7.967  3.078   -3.853  1.00 48.32  ? 1379 GLU A CA    1 
ATOM   5236  C  C     . GLU A 1 731 ? -7.708  2.268   -5.116  1.00 48.77  ? 1379 GLU A C     1 
ATOM   5237  O  O     . GLU A 1 731 ? -7.452  1.065   -5.045  1.00 49.89  ? 1379 GLU A O     1 
ATOM   5238  C  CB    . GLU A 1 731 ? -6.655  3.354   -3.126  1.00 48.29  ? 1379 GLU A CB    1 
ATOM   5239  C  CG    . GLU A 1 731 ? -5.563  3.917   -4.020  1.00 53.98  ? 1379 GLU A CG    1 
ATOM   5240  C  CD    . GLU A 1 731 ? -4.218  4.002   -3.316  1.00 58.67  ? 1379 GLU A CD    1 
ATOM   5241  O  OE1   . GLU A 1 731 ? -3.180  4.016   -4.017  1.00 60.00  ? 1379 GLU A OE1   1 
ATOM   5242  O  OE2   . GLU A 1 731 ? -4.204  4.052   -2.063  1.00 54.72  ? 1379 GLU A OE2   1 
ATOM   5243  N  N     . ILE A 1 732 ? -7.778  2.927   -6.269  1.00 46.94  ? 1380 ILE A N     1 
ATOM   5244  C  CA    . ILE A 1 732 ? -7.524  2.261   -7.541  1.00 44.20  ? 1380 ILE A CA    1 
ATOM   5245  C  C     . ILE A 1 732 ? -6.457  3.009   -8.330  1.00 44.97  ? 1380 ILE A C     1 
ATOM   5246  O  O     . ILE A 1 732 ? -6.186  4.176   -8.063  1.00 44.34  ? 1380 ILE A O     1 
ATOM   5247  C  CB    . ILE A 1 732 ? -8.802  2.128   -8.386  1.00 40.20  ? 1380 ILE A CB    1 
ATOM   5248  C  CG1   . ILE A 1 732 ? -9.247  3.488   -8.907  1.00 40.05  ? 1380 ILE A CG1   1 
ATOM   5249  C  CG2   . ILE A 1 732 ? -9.911  1.507   -7.573  1.00 40.71  ? 1380 ILE A CG2   1 
ATOM   5250  C  CD1   . ILE A 1 732 ? -10.581 3.444   -9.599  1.00 38.86  ? 1380 ILE A CD1   1 
ATOM   5251  N  N     . GLN A 1 733 ? -5.851  2.317   -9.294  1.00 47.90  ? 1381 GLN A N     1 
ATOM   5252  C  CA    . GLN A 1 733 ? -4.771  2.870   -10.107 1.00 45.85  ? 1381 GLN A CA    1 
ATOM   5253  C  C     . GLN A 1 733 ? -5.328  3.326   -11.443 1.00 42.57  ? 1381 GLN A C     1 
ATOM   5254  O  O     . GLN A 1 733 ? -6.491  3.088   -11.752 1.00 41.59  ? 1381 GLN A O     1 
ATOM   5255  C  CB    . GLN A 1 733 ? -3.677  1.816   -10.349 1.00 47.38  ? 1381 GLN A CB    1 
ATOM   5256  C  CG    . GLN A 1 733 ? -3.133  1.130   -9.088  1.00 54.09  ? 1381 GLN A CG    1 
ATOM   5257  C  CD    . GLN A 1 733 ? -2.282  2.053   -8.228  1.00 60.64  ? 1381 GLN A CD    1 
ATOM   5258  O  OE1   . GLN A 1 733 ? -1.421  2.775   -8.738  1.00 64.61  ? 1381 GLN A OE1   1 
ATOM   5259  N  NE2   . GLN A 1 733 ? -2.525  2.039   -6.917  1.00 59.30  ? 1381 GLN A NE2   1 
ATOM   5260  N  N     . ASN A 1 734 ? -4.489  3.977   -12.238 1.00 44.33  ? 1382 ASN A N     1 
ATOM   5261  C  CA    . ASN A 1 734 ? -4.874  4.381   -13.581 1.00 41.77  ? 1382 ASN A CA    1 
ATOM   5262  C  C     . ASN A 1 734 ? -5.191  3.180   -14.465 1.00 41.46  ? 1382 ASN A C     1 
ATOM   5263  O  O     . ASN A 1 734 ? -4.341  2.320   -14.678 1.00 41.58  ? 1382 ASN A O     1 
ATOM   5264  C  CB    . ASN A 1 734 ? -3.776  5.228   -14.225 1.00 37.60  ? 1382 ASN A CB    1 
ATOM   5265  C  CG    . ASN A 1 734 ? -4.148  5.689   -15.615 1.00 42.22  ? 1382 ASN A CG    1 
ATOM   5266  O  OD1   . ASN A 1 734 ? -3.431  5.441   -16.581 1.00 41.50  ? 1382 ASN A OD1   1 
ATOM   5267  N  ND2   . ASN A 1 734 ? -5.293  6.353   -15.727 1.00 45.68  ? 1382 ASN A ND2   1 
ATOM   5268  N  N     . GLY A 1 735 ? -6.415  3.126   -14.978 1.00 40.93  ? 1383 GLY A N     1 
ATOM   5269  C  CA    . GLY A 1 735 ? -6.813  2.060   -15.879 1.00 42.04  ? 1383 GLY A CA    1 
ATOM   5270  C  C     . GLY A 1 735 ? -7.601  0.945   -15.209 1.00 43.09  ? 1383 GLY A C     1 
ATOM   5271  O  O     . GLY A 1 735 ? -8.177  0.083   -15.883 1.00 44.82  ? 1383 GLY A O     1 
ATOM   5272  N  N     . ALA A 1 736 ? -7.626  0.961   -13.881 1.00 37.60  ? 1384 ALA A N     1 
ATOM   5273  C  CA    . ALA A 1 736 ? -8.353  -0.037  -13.116 1.00 38.25  ? 1384 ALA A CA    1 
ATOM   5274  C  C     . ALA A 1 736 ? -9.598  -0.515  -13.849 1.00 38.45  ? 1384 ALA A C     1 
ATOM   5275  O  O     . ALA A 1 736 ? -10.569 0.219   -13.957 1.00 40.03  ? 1384 ALA A O     1 
ATOM   5276  C  CB    . ALA A 1 736 ? -8.726  0.527   -11.770 1.00 41.16  ? 1384 ALA A CB    1 
ATOM   5277  N  N     . SER A 1 737 ? -9.576  -1.747  -14.346 1.00 39.73  ? 1385 SER A N     1 
ATOM   5278  C  CA    . SER A 1 737 ? -10.698 -2.252  -15.134 1.00 43.01  ? 1385 SER A CA    1 
ATOM   5279  C  C     . SER A 1 737 ? -11.625 -3.211  -14.372 1.00 44.77  ? 1385 SER A C     1 
ATOM   5280  O  O     . SER A 1 737 ? -12.684 -3.586  -14.877 1.00 47.03  ? 1385 SER A O     1 
ATOM   5281  C  CB    . SER A 1 737 ? -10.201 -2.904  -16.429 1.00 46.93  ? 1385 SER A CB    1 
ATOM   5282  O  OG    . SER A 1 737 ? -10.180 -4.325  -16.330 1.00 54.54  ? 1385 SER A OG    1 
ATOM   5283  N  N     . ASN A 1 738 ? -11.234 -3.590  -13.159 1.00 41.92  ? 1386 ASN A N     1 
ATOM   5284  C  CA    . ASN A 1 738 ? -12.005 -4.524  -12.347 1.00 42.74  ? 1386 ASN A CA    1 
ATOM   5285  C  C     . ASN A 1 738 ? -13.424 -4.044  -12.044 1.00 44.25  ? 1386 ASN A C     1 
ATOM   5286  O  O     . ASN A 1 738 ? -13.624 -3.234  -11.142 1.00 47.10  ? 1386 ASN A O     1 
ATOM   5287  C  CB    . ASN A 1 738 ? -11.270 -4.771  -11.036 1.00 47.29  ? 1386 ASN A CB    1 
ATOM   5288  C  CG    . ASN A 1 738 ? -11.341 -6.215  -10.587 1.00 49.99  ? 1386 ASN A CG    1 
ATOM   5289  O  OD1   . ASN A 1 738 ? -12.417 -6.827  -10.553 1.00 50.36  ? 1386 ASN A OD1   1 
ATOM   5290  N  ND2   . ASN A 1 738 ? -10.188 -6.772  -10.235 1.00 50.19  ? 1386 ASN A ND2   1 
ATOM   5291  N  N     . SER A 1 739 ? -14.407 -4.565  -12.776 1.00 45.50  ? 1387 SER A N     1 
ATOM   5292  C  CA    . SER A 1 739 ? -15.783 -4.078  -12.674 1.00 42.71  ? 1387 SER A CA    1 
ATOM   5293  C  C     . SER A 1 739 ? -16.542 -4.659  -11.498 1.00 42.14  ? 1387 SER A C     1 
ATOM   5294  O  O     . SER A 1 739 ? -17.734 -4.417  -11.347 1.00 39.92  ? 1387 SER A O     1 
ATOM   5295  C  CB    . SER A 1 739 ? -16.549 -4.330  -13.972 1.00 46.15  ? 1387 SER A CB    1 
ATOM   5296  O  OG    . SER A 1 739 ? -16.569 -3.171  -14.794 1.00 50.19  ? 1387 SER A OG    1 
ATOM   5297  N  N     . GLU A 1 740 ? -15.842 -5.442  -10.683 1.00 45.48  ? 1388 GLU A N     1 
ATOM   5298  C  CA    . GLU A 1 740 ? -16.370 -5.919  -9.408  1.00 45.29  ? 1388 GLU A CA    1 
ATOM   5299  C  C     . GLU A 1 740 ? -15.247 -6.090  -8.401  1.00 45.90  ? 1388 GLU A C     1 
ATOM   5300  O  O     . GLU A 1 740 ? -14.337 -6.895  -8.590  1.00 47.39  ? 1388 GLU A O     1 
ATOM   5301  C  CB    . GLU A 1 740 ? -17.136 -7.230  -9.556  1.00 46.49  ? 1388 GLU A CB    1 
ATOM   5302  C  CG    . GLU A 1 740 ? -18.565 -7.060  -10.022 1.00 51.29  ? 1388 GLU A CG    1 
ATOM   5303  C  CD    . GLU A 1 740 ? -19.320 -8.377  -10.077 1.00 56.99  ? 1388 GLU A CD    1 
ATOM   5304  O  OE1   . GLU A 1 740 ? -18.836 -9.367  -9.471  1.00 57.31  ? 1388 GLU A OE1   1 
ATOM   5305  O  OE2   . GLU A 1 740 ? -20.393 -8.414  -10.730 1.00 54.94  ? 1388 GLU A OE2   1 
ATOM   5306  N  N     . ILE A 1 741 ? -15.322 -5.303  -7.337  1.00 47.67  ? 1389 ILE A N     1 
ATOM   5307  C  CA    . ILE A 1 741 ? -14.366 -5.341  -6.246  1.00 47.29  ? 1389 ILE A CA    1 
ATOM   5308  C  C     . ILE A 1 741 ? -15.197 -5.176  -4.994  1.00 48.65  ? 1389 ILE A C     1 
ATOM   5309  O  O     . ILE A 1 741 ? -16.343 -4.740  -5.073  1.00 50.12  ? 1389 ILE A O     1 
ATOM   5310  C  CB    . ILE A 1 741 ? -13.365 -4.178  -6.340  1.00 48.83  ? 1389 ILE A CB    1 
ATOM   5311  C  CG1   . ILE A 1 741 ? -14.103 -2.837  -6.361  1.00 45.98  ? 1389 ILE A CG1   1 
ATOM   5312  C  CG2   . ILE A 1 741 ? -12.484 -4.314  -7.579  1.00 45.56  ? 1389 ILE A CG2   1 
ATOM   5313  C  CD1   . ILE A 1 741 ? -13.171 -1.643  -6.367  1.00 42.59  ? 1389 ILE A CD1   1 
ATOM   5314  N  N     . PRO A 1 742 ? -14.640 -5.523  -3.831  1.00 48.83  ? 1390 PRO A N     1 
ATOM   5315  C  CA    . PRO A 1 742 ? -15.445 -5.371  -2.622  1.00 51.68  ? 1390 PRO A CA    1 
ATOM   5316  C  C     . PRO A 1 742 ? -15.377 -3.935  -2.111  1.00 57.33  ? 1390 PRO A C     1 
ATOM   5317  O  O     . PRO A 1 742 ? -14.421 -3.212  -2.417  1.00 55.92  ? 1390 PRO A O     1 
ATOM   5318  C  CB    . PRO A 1 742 ? -14.743 -6.300  -1.641  1.00 50.92  ? 1390 PRO A CB    1 
ATOM   5319  C  CG    . PRO A 1 742 ? -13.312 -6.197  -2.034  1.00 52.75  ? 1390 PRO A CG    1 
ATOM   5320  C  CD    . PRO A 1 742 ? -13.292 -6.031  -3.534  1.00 49.39  ? 1390 PRO A CD    1 
ATOM   5321  N  N     . TYR A 1 743 ? -16.398 -3.515  -1.370  1.00 58.22  ? 1391 TYR A N     1 
ATOM   5322  C  CA    . TYR A 1 743 ? -16.293 -2.306  -0.571  1.00 58.90  ? 1391 TYR A CA    1 
ATOM   5323  C  C     . TYR A 1 743 ? -15.431 -2.698  0.616   1.00 66.33  ? 1391 TYR A C     1 
ATOM   5324  O  O     . TYR A 1 743 ? -15.891 -3.430  1.501   1.00 70.23  ? 1391 TYR A O     1 
ATOM   5325  C  CB    . TYR A 1 743 ? -17.645 -1.897  0.001   1.00 53.73  ? 1391 TYR A CB    1 
ATOM   5326  C  CG    . TYR A 1 743 ? -18.658 -1.311  -0.938  1.00 47.25  ? 1391 TYR A CG    1 
ATOM   5327  C  CD1   . TYR A 1 743 ? -18.518 -0.027  -1.425  1.00 45.51  ? 1391 TYR A CD1   1 
ATOM   5328  C  CD2   . TYR A 1 743 ? -19.805 -2.013  -1.263  1.00 47.52  ? 1391 TYR A CD2   1 
ATOM   5329  C  CE1   . TYR A 1 743 ? -19.471 0.527   -2.252  1.00 44.45  ? 1391 TYR A CE1   1 
ATOM   5330  C  CE2   . TYR A 1 743 ? -20.763 -1.474  -2.086  1.00 47.29  ? 1391 TYR A CE2   1 
ATOM   5331  C  CZ    . TYR A 1 743 ? -20.595 -0.204  -2.580  1.00 46.64  ? 1391 TYR A CZ    1 
ATOM   5332  O  OH    . TYR A 1 743 ? -21.563 0.327   -3.403  1.00 43.90  ? 1391 TYR A OH    1 
ATOM   5333  N  N     . ASN A 1 744 ? -14.190 -2.240  0.657   1.00 63.96  ? 1392 ASN A N     1 
ATOM   5334  C  CA    . ASN A 1 744 ? -13.393 -2.510  1.842   1.00 69.98  ? 1392 ASN A CA    1 
ATOM   5335  C  C     . ASN A 1 744 ? -13.644 -1.459  2.915   1.00 72.16  ? 1392 ASN A C     1 
ATOM   5336  O  O     . ASN A 1 744 ? -12.808 -0.582  3.153   1.00 75.37  ? 1392 ASN A O     1 
ATOM   5337  C  CB    . ASN A 1 744 ? -11.908 -2.634  1.510   1.00 73.90  ? 1392 ASN A CB    1 
ATOM   5338  C  CG    . ASN A 1 744 ? -11.399 -4.050  1.682   1.00 72.82  ? 1392 ASN A CG    1 
ATOM   5339  O  OD1   . ASN A 1 744 ? -11.192 -4.516  2.806   1.00 73.85  ? 1392 ASN A OD1   1 
ATOM   5340  N  ND2   . ASN A 1 744 ? -11.200 -4.748  0.568   1.00 69.98  ? 1392 ASN A ND2   1 
ATOM   5341  N  N     . GLY A 1 745 ? -14.812 -1.556  3.548   1.00 65.92  ? 1393 GLY A N     1 
ATOM   5342  C  CA    . GLY A 1 745 ? -15.229 -0.601  4.559   1.00 67.58  ? 1393 GLY A CA    1 
ATOM   5343  C  C     . GLY A 1 745 ? -16.712 -0.278  4.491   1.00 64.60  ? 1393 GLY A C     1 
ATOM   5344  O  O     . GLY A 1 745 ? -17.385 -0.590  3.507   1.00 63.73  ? 1393 GLY A O     1 
ATOM   5345  N  N     . GLU A 1 746 ? -17.223 0.349   5.545   1.00 61.99  ? 1394 GLU A N     1 
ATOM   5346  C  CA    . GLU A 1 746 ? -18.619 0.764   5.595   1.00 60.75  ? 1394 GLU A CA    1 
ATOM   5347  C  C     . GLU A 1 746 ? -18.768 2.196   5.079   1.00 60.40  ? 1394 GLU A C     1 
ATOM   5348  O  O     . GLU A 1 746 ? -17.768 2.888   4.854   1.00 57.42  ? 1394 GLU A O     1 
ATOM   5349  C  CB    . GLU A 1 746 ? -19.144 0.676   7.030   1.00 68.61  ? 1394 GLU A CB    1 
ATOM   5350  C  CG    . GLU A 1 746 ? -19.087 -0.715  7.638   1.00 79.19  ? 1394 GLU A CG    1 
ATOM   5351  C  CD    . GLU A 1 746 ? -20.019 -1.699  6.951   1.00 82.72  ? 1394 GLU A CD    1 
ATOM   5352  O  OE1   . GLU A 1 746 ? -19.513 -2.589  6.229   1.00 81.64  ? 1394 GLU A OE1   1 
ATOM   5353  O  OE2   . GLU A 1 746 ? -21.252 -1.588  7.140   1.00 80.79  ? 1394 GLU A OE2   1 
ATOM   5354  N  N     . PRO A 1 747 ? -20.019 2.646   4.877   1.00 58.01  ? 1395 PRO A N     1 
ATOM   5355  C  CA    . PRO A 1 747 ? -20.275 4.043   4.498   1.00 52.59  ? 1395 PRO A CA    1 
ATOM   5356  C  C     . PRO A 1 747 ? -19.743 5.021   5.546   1.00 49.79  ? 1395 PRO A C     1 
ATOM   5357  O  O     . PRO A 1 747 ? -19.880 4.777   6.741   1.00 51.33  ? 1395 PRO A O     1 
ATOM   5358  C  CB    . PRO A 1 747 ? -21.805 4.115   4.445   1.00 49.46  ? 1395 PRO A CB    1 
ATOM   5359  C  CG    . PRO A 1 747 ? -22.242 2.714   4.186   1.00 49.16  ? 1395 PRO A CG    1 
ATOM   5360  C  CD    . PRO A 1 747 ? -21.252 1.838   4.890   1.00 53.85  ? 1395 PRO A CD    1 
ATOM   5361  N  N     . LEU A 1 748 ? -19.148 6.117   5.097   1.00 45.96  ? 1396 LEU A N     1 
ATOM   5362  C  CA    . LEU A 1 748 ? -18.580 7.097   6.006   1.00 48.98  ? 1396 LEU A CA    1 
ATOM   5363  C  C     . LEU A 1 748 ? -19.281 8.438   5.866   1.00 52.18  ? 1396 LEU A C     1 
ATOM   5364  O  O     . LEU A 1 748 ? -18.728 9.474   6.229   1.00 58.21  ? 1396 LEU A O     1 
ATOM   5365  C  CB    . LEU A 1 748 ? -17.099 7.283   5.706   1.00 50.67  ? 1396 LEU A CB    1 
ATOM   5366  C  CG    . LEU A 1 748 ? -16.326 5.992   5.455   1.00 51.27  ? 1396 LEU A CG    1 
ATOM   5367  C  CD1   . LEU A 1 748 ? -14.911 6.301   5.014   1.00 47.99  ? 1396 LEU A CD1   1 
ATOM   5368  C  CD2   . LEU A 1 748 ? -16.328 5.119   6.692   1.00 53.41  ? 1396 LEU A CD2   1 
ATOM   5369  N  N     . SER A 1 749 ? -20.491 8.424   5.328   1.00 44.84  ? 1397 SER A N     1 
ATOM   5370  C  CA    . SER A 1 749 ? -21.186 9.660   5.021   1.00 42.93  ? 1397 SER A CA    1 
ATOM   5371  C  C     . SER A 1 749 ? -22.673 9.402   5.065   1.00 44.01  ? 1397 SER A C     1 
ATOM   5372  O  O     . SER A 1 749 ? -23.120 8.279   4.852   1.00 44.43  ? 1397 SER A O     1 
ATOM   5373  C  CB    . SER A 1 749 ? -20.799 10.166  3.633   1.00 41.09  ? 1397 SER A CB    1 
ATOM   5374  N  N     . TRP A 1 750 ? -23.449 10.437  5.351   1.00 45.05  ? 1398 TRP A N     1 
ATOM   5375  C  CA    . TRP A 1 750 ? -24.889 10.301  5.272   1.00 44.21  ? 1398 TRP A CA    1 
ATOM   5376  C  C     . TRP A 1 750 ? -25.217 9.993   3.822   1.00 43.02  ? 1398 TRP A C     1 
ATOM   5377  O  O     . TRP A 1 750 ? -26.019 9.103   3.519   1.00 41.68  ? 1398 TRP A O     1 
ATOM   5378  C  CB    . TRP A 1 750 ? -25.571 11.594  5.718   1.00 44.65  ? 1398 TRP A CB    1 
ATOM   5379  C  CG    . TRP A 1 750 ? -27.027 11.633  5.393   1.00 43.85  ? 1398 TRP A CG    1 
ATOM   5380  C  CD1   . TRP A 1 750 ? -28.053 11.146  6.148   1.00 43.19  ? 1398 TRP A CD1   1 
ATOM   5381  C  CD2   . TRP A 1 750 ? -27.622 12.186  4.215   1.00 40.74  ? 1398 TRP A CD2   1 
ATOM   5382  N  NE1   . TRP A 1 750 ? -29.253 11.364  5.513   1.00 41.78  ? 1398 TRP A NE1   1 
ATOM   5383  C  CE2   . TRP A 1 750 ? -29.012 12.002  4.324   1.00 40.55  ? 1398 TRP A CE2   1 
ATOM   5384  C  CE3   . TRP A 1 750 ? -27.111 12.812  3.077   1.00 36.82  ? 1398 TRP A CE3   1 
ATOM   5385  C  CZ2   . TRP A 1 750 ? -29.893 12.426  3.341   1.00 36.54  ? 1398 TRP A CZ2   1 
ATOM   5386  C  CZ3   . TRP A 1 750 ? -27.984 13.230  2.112   1.00 36.04  ? 1398 TRP A CZ3   1 
ATOM   5387  C  CH2   . TRP A 1 750 ? -29.361 13.037  2.246   1.00 35.32  ? 1398 TRP A CH2   1 
ATOM   5388  N  N     . PHE A 1 751 ? -24.566 10.734  2.932   1.00 43.15  ? 1399 PHE A N     1 
ATOM   5389  C  CA    . PHE A 1 751 ? -24.779 10.599  1.500   1.00 42.55  ? 1399 PHE A CA    1 
ATOM   5390  C  C     . PHE A 1 751 ? -24.523 9.168   1.047   1.00 42.80  ? 1399 PHE A C     1 
ATOM   5391  O  O     . PHE A 1 751 ? -25.269 8.614   0.238   1.00 41.35  ? 1399 PHE A O     1 
ATOM   5392  C  CB    . PHE A 1 751 ? -23.860 11.562  0.757   1.00 40.05  ? 1399 PHE A CB    1 
ATOM   5393  C  CG    . PHE A 1 751 ? -24.205 11.736  -0.692  1.00 39.17  ? 1399 PHE A CG    1 
ATOM   5394  C  CD1   . PHE A 1 751 ? -25.397 12.329  -1.065  1.00 38.64  ? 1399 PHE A CD1   1 
ATOM   5395  C  CD2   . PHE A 1 751 ? -23.328 11.323  -1.683  1.00 41.42  ? 1399 PHE A CD2   1 
ATOM   5396  C  CE1   . PHE A 1 751 ? -25.717 12.500  -2.398  1.00 37.29  ? 1399 PHE A CE1   1 
ATOM   5397  C  CE2   . PHE A 1 751 ? -23.643 11.494  -3.020  1.00 39.72  ? 1399 PHE A CE2   1 
ATOM   5398  C  CZ    . PHE A 1 751 ? -24.843 12.084  -3.376  1.00 36.61  ? 1399 PHE A CZ    1 
ATOM   5399  N  N     . GLN A 1 752 ? -23.466 8.571   1.583   1.00 42.08  ? 1400 GLN A N     1 
ATOM   5400  C  CA    . GLN A 1 752 ? -23.104 7.212   1.218   1.00 40.89  ? 1400 GLN A CA    1 
ATOM   5401  C  C     . GLN A 1 752 ? -24.101 6.215   1.777   1.00 43.06  ? 1400 GLN A C     1 
ATOM   5402  O  O     . GLN A 1 752 ? -24.536 5.310   1.072   1.00 45.43  ? 1400 GLN A O     1 
ATOM   5403  C  CB    . GLN A 1 752 ? -21.679 6.902   1.665   1.00 41.24  ? 1400 GLN A CB    1 
ATOM   5404  C  CG    . GLN A 1 752 ? -20.675 7.803   0.980   1.00 42.07  ? 1400 GLN A CG    1 
ATOM   5405  C  CD    . GLN A 1 752 ? -19.314 7.786   1.617   1.00 41.97  ? 1400 GLN A CD    1 
ATOM   5406  O  OE1   . GLN A 1 752 ? -18.949 6.836   2.294   1.00 42.99  ? 1400 GLN A OE1   1 
ATOM   5407  N  NE2   . GLN A 1 752 ? -18.550 8.849   1.405   1.00 43.26  ? 1400 GLN A NE2   1 
ATOM   5408  N  N     . ARG A 1 753 ? -24.483 6.384   3.036   1.00 44.57  ? 1401 ARG A N     1 
ATOM   5409  C  CA    . ARG A 1 753 ? -25.499 5.513   3.616   1.00 45.82  ? 1401 ARG A CA    1 
ATOM   5410  C  C     . ARG A 1 753 ? -26.805 5.563   2.819   1.00 45.56  ? 1401 ARG A C     1 
ATOM   5411  O  O     . ARG A 1 753 ? -27.548 4.586   2.760   1.00 47.51  ? 1401 ARG A O     1 
ATOM   5412  C  CB    . ARG A 1 753 ? -25.731 5.842   5.090   1.00 41.93  ? 1401 ARG A CB    1 
ATOM   5413  C  CG    . ARG A 1 753 ? -24.681 5.248   6.000   1.00 43.66  ? 1401 ARG A CG    1 
ATOM   5414  C  CD    . ARG A 1 753 ? -24.910 5.610   7.451   1.00 41.83  ? 1401 ARG A CD    1 
ATOM   5415  N  NE    . ARG A 1 753 ? -24.117 6.770   7.835   1.00 42.83  ? 1401 ARG A NE    1 
ATOM   5416  C  CZ    . ARG A 1 753 ? -24.620 7.983   8.025   1.00 44.87  ? 1401 ARG A CZ    1 
ATOM   5417  N  NH1   . ARG A 1 753 ? -25.923 8.196   7.881   1.00 45.96  ? 1401 ARG A NH1   1 
ATOM   5418  N  NH2   . ARG A 1 753 ? -23.822 8.979   8.372   1.00 43.98  ? 1401 ARG A NH2   1 
ATOM   5419  N  N     . GLN A 1 754 ? -27.076 6.700   2.196   1.00 43.30  ? 1402 GLN A N     1 
ATOM   5420  C  CA    . GLN A 1 754 ? -28.249 6.825   1.350   1.00 43.51  ? 1402 GLN A CA    1 
ATOM   5421  C  C     . GLN A 1 754 ? -28.061 6.069   0.042   1.00 44.30  ? 1402 GLN A C     1 
ATOM   5422  O  O     . GLN A 1 754 ? -28.961 5.363   -0.402  1.00 44.03  ? 1402 GLN A O     1 
ATOM   5423  C  CB    . GLN A 1 754 ? -28.548 8.300   1.070   1.00 45.38  ? 1402 GLN A CB    1 
ATOM   5424  C  CG    . GLN A 1 754 ? -28.966 9.070   2.294   1.00 42.16  ? 1402 GLN A CG    1 
ATOM   5425  C  CD    . GLN A 1 754 ? -30.218 8.493   2.910   1.00 45.80  ? 1402 GLN A CD    1 
ATOM   5426  O  OE1   . GLN A 1 754 ? -30.351 8.421   4.131   1.00 47.75  ? 1402 GLN A OE1   1 
ATOM   5427  N  NE2   . GLN A 1 754 ? -31.147 8.073   2.062   1.00 46.30  ? 1402 GLN A NE2   1 
ATOM   5428  N  N     . LEU A 1 755 ? -26.886 6.218   -0.568  1.00 42.74  ? 1403 LEU A N     1 
ATOM   5429  C  CA    . LEU A 1 755 ? -26.601 5.596   -1.864  1.00 41.30  ? 1403 LEU A CA    1 
ATOM   5430  C  C     . LEU A 1 755 ? -26.326 4.089   -1.802  1.00 43.14  ? 1403 LEU A C     1 
ATOM   5431  O  O     . LEU A 1 755 ? -26.574 3.367   -2.773  1.00 42.66  ? 1403 LEU A O     1 
ATOM   5432  C  CB    . LEU A 1 755 ? -25.442 6.315   -2.558  1.00 40.38  ? 1403 LEU A CB    1 
ATOM   5433  C  CG    . LEU A 1 755 ? -25.797 7.444   -3.536  1.00 38.23  ? 1403 LEU A CG    1 
ATOM   5434  C  CD1   . LEU A 1 755 ? -27.205 7.977   -3.303  1.00 37.89  ? 1403 LEU A CD1   1 
ATOM   5435  C  CD2   . LEU A 1 755 ? -24.782 8.560   -3.427  1.00 35.25  ? 1403 LEU A CD2   1 
ATOM   5436  N  N     . ARG A 1 756 ? -25.824 3.616   -0.665  1.00 45.28  ? 1404 ARG A N     1 
ATOM   5437  C  CA    . ARG A 1 756 ? -25.555 2.193   -0.488  1.00 43.67  ? 1404 ARG A CA    1 
ATOM   5438  C  C     . ARG A 1 756 ? -26.704 1.467   0.195   1.00 46.35  ? 1404 ARG A C     1 
ATOM   5439  O  O     . ARG A 1 756 ? -26.650 0.252   0.377   1.00 50.78  ? 1404 ARG A O     1 
ATOM   5440  C  CB    . ARG A 1 756 ? -24.264 1.985   0.297   1.00 43.25  ? 1404 ARG A CB    1 
ATOM   5441  C  CG    . ARG A 1 756 ? -23.057 2.613   -0.353  1.00 42.43  ? 1404 ARG A CG    1 
ATOM   5442  C  CD    . ARG A 1 756 ? -21.830 2.503   0.522   1.00 43.62  ? 1404 ARG A CD    1 
ATOM   5443  N  NE    . ARG A 1 756 ? -21.562 1.124   0.909   1.00 46.45  ? 1404 ARG A NE    1 
ATOM   5444  C  CZ    . ARG A 1 756 ? -20.379 0.692   1.330   1.00 49.07  ? 1404 ARG A CZ    1 
ATOM   5445  N  NH1   . ARG A 1 756 ? -20.218 -0.581  1.665   1.00 50.57  ? 1404 ARG A NH1   1 
ATOM   5446  N  NH2   . ARG A 1 756 ? -19.355 1.529   1.404   1.00 47.26  ? 1404 ARG A NH2   1 
ATOM   5447  N  N     . GLY A 1 757 ? -27.744 2.209   0.565   1.00 47.81  ? 1405 GLY A N     1 
ATOM   5448  C  CA    . GLY A 1 757 ? -28.890 1.639   1.259   1.00 51.70  ? 1405 GLY A CA    1 
ATOM   5449  C  C     . GLY A 1 757 ? -28.506 1.043   2.602   1.00 55.82  ? 1405 GLY A C     1 
ATOM   5450  O  O     . GLY A 1 757 ? -27.425 1.322   3.126   1.00 54.17  ? 1405 GLY A O     1 
ATOM   5451  N  N     . SER A 1 758 ? -29.387 0.219   3.166   1.00 61.36  ? 1406 SER A N     1 
ATOM   5452  C  CA    . SER A 1 758 ? -29.099 -0.447  4.442   1.00 65.81  ? 1406 SER A CA    1 
ATOM   5453  C  C     . SER A 1 758 ? -28.955 -1.970  4.300   1.00 68.14  ? 1406 SER A C     1 
ATOM   5454  O  O     . SER A 1 758 ? -28.173 -2.602  5.018   1.00 68.22  ? 1406 SER A O     1 
ATOM   5455  C  CB    . SER A 1 758 ? -30.135 -0.074  5.520   1.00 61.06  ? 1406 SER A CB    1 
ATOM   5456  O  OG    . SER A 1 758 ? -31.461 -0.109  5.017   1.00 62.51  ? 1406 SER A OG    1 
ATOM   5457  N  N     . HIS A 1 759 ? -29.706 -2.553  3.369   1.00 67.78  ? 1407 HIS A N     1 
ATOM   5458  C  CA    . HIS A 1 759 ? -29.569 -3.974  3.063   1.00 66.54  ? 1407 HIS A CA    1 
ATOM   5459  C  C     . HIS A 1 759 ? -28.121 -4.295  2.684   1.00 67.54  ? 1407 HIS A C     1 
ATOM   5460  O  O     . HIS A 1 759 ? -27.497 -3.583  1.891   1.00 64.98  ? 1407 HIS A O     1 
ATOM   5461  C  CB    . HIS A 1 759 ? -30.524 -4.392  1.943   1.00 62.51  ? 1407 HIS A CB    1 
ATOM   5462  N  N     . TYR A 1 760 ? -27.598 -5.367  3.273   1.00 70.52  ? 1408 TYR A N     1 
ATOM   5463  C  CA    . TYR A 1 760 ? -26.221 -5.819  3.067   1.00 67.11  ? 1408 TYR A CA    1 
ATOM   5464  C  C     . TYR A 1 760 ? -25.878 -5.981  1.589   1.00 62.75  ? 1408 TYR A C     1 
ATOM   5465  O  O     . TYR A 1 760 ? -26.564 -6.693  0.854   1.00 60.99  ? 1408 TYR A O     1 
ATOM   5466  C  CB    . TYR A 1 760 ? -26.005 -7.131  3.839   1.00 67.78  ? 1408 TYR A CB    1 
ATOM   5467  C  CG    . TYR A 1 760 ? -24.780 -7.948  3.470   1.00 64.61  ? 1408 TYR A CG    1 
ATOM   5468  C  CD1   . TYR A 1 760 ? -23.531 -7.667  4.024   1.00 60.83  ? 1408 TYR A CD1   1 
ATOM   5469  C  CD2   . TYR A 1 760 ? -24.886 -9.038  2.606   1.00 64.51  ? 1408 TYR A CD2   1 
ATOM   5470  C  CE1   . TYR A 1 760 ? -22.417 -8.429  3.702   1.00 59.21  ? 1408 TYR A CE1   1 
ATOM   5471  C  CE2   . TYR A 1 760 ? -23.781 -9.805  2.278   1.00 61.59  ? 1408 TYR A CE2   1 
ATOM   5472  C  CZ    . TYR A 1 760 ? -22.552 -9.498  2.826   1.00 61.39  ? 1408 TYR A CZ    1 
ATOM   5473  O  OH    . TYR A 1 760 ? -21.461 -10.265 2.491   1.00 58.72  ? 1408 TYR A OH    1 
ATOM   5474  N  N     . GLN A 1 761 ? -24.817 -5.300  1.164   1.00 60.40  ? 1409 GLN A N     1 
ATOM   5475  C  CA    . GLN A 1 761 ? -24.331 -5.387  -0.208  1.00 57.42  ? 1409 GLN A CA    1 
ATOM   5476  C  C     . GLN A 1 761 ? -22.822 -5.192  -0.201  1.00 54.12  ? 1409 GLN A C     1 
ATOM   5477  O  O     . GLN A 1 761 ? -22.341 -4.073  -0.045  1.00 52.63  ? 1409 GLN A O     1 
ATOM   5478  C  CB    . GLN A 1 761 ? -24.995 -4.316  -1.073  1.00 54.09  ? 1409 GLN A CB    1 
ATOM   5479  C  CG    . GLN A 1 761 ? -25.405 -4.784  -2.461  1.00 53.70  ? 1409 GLN A CG    1 
ATOM   5480  C  CD    . GLN A 1 761 ? -24.240 -4.863  -3.430  1.00 55.68  ? 1409 GLN A CD    1 
ATOM   5481  O  OE1   . GLN A 1 761 ? -23.129 -5.242  -3.055  1.00 53.69  ? 1409 GLN A OE1   1 
ATOM   5482  N  NE2   . GLN A 1 761 ? -24.489 -4.499  -4.690  1.00 55.61  ? 1409 GLN A NE2   1 
ATOM   5483  N  N     . PRO A 1 762 ? -22.066 -6.286  -0.369  1.00 54.59  ? 1410 PRO A N     1 
ATOM   5484  C  CA    . PRO A 1 762 ? -20.607 -6.229  -0.231  1.00 54.03  ? 1410 PRO A CA    1 
ATOM   5485  C  C     . PRO A 1 762 ? -19.861 -5.862  -1.525  1.00 53.24  ? 1410 PRO A C     1 
ATOM   5486  O  O     . PRO A 1 762 ? -18.667 -5.554  -1.458  1.00 52.33  ? 1410 PRO A O     1 
ATOM   5487  C  CB    . PRO A 1 762 ? -20.253 -7.655  0.209   1.00 51.35  ? 1410 PRO A CB    1 
ATOM   5488  C  CG    . PRO A 1 762 ? -21.421 -8.522  -0.255  1.00 51.47  ? 1410 PRO A CG    1 
ATOM   5489  C  CD    . PRO A 1 762 ? -22.529 -7.629  -0.750  1.00 50.85  ? 1410 PRO A CD    1 
ATOM   5490  N  N     . ILE A 1 763 ? -20.557 -5.879  -2.663  1.00 50.64  ? 1411 ILE A N     1 
ATOM   5491  C  CA    . ILE A 1 763 ? -19.930 -5.706  -3.973  1.00 48.33  ? 1411 ILE A CA    1 
ATOM   5492  C  C     . ILE A 1 763 ? -20.001 -4.281  -4.521  1.00 48.51  ? 1411 ILE A C     1 
ATOM   5493  O  O     . ILE A 1 763 ? -21.066 -3.664  -4.569  1.00 47.15  ? 1411 ILE A O     1 
ATOM   5494  C  CB    . ILE A 1 763 ? -20.536 -6.664  -5.016  1.00 49.83  ? 1411 ILE A CB    1 
ATOM   5495  C  CG1   . ILE A 1 763 ? -20.194 -8.116  -4.675  1.00 53.94  ? 1411 ILE A CG1   1 
ATOM   5496  C  CG2   . ILE A 1 763 ? -20.035 -6.324  -6.400  1.00 49.89  ? 1411 ILE A CG2   1 
ATOM   5497  C  CD1   . ILE A 1 763 ? -18.698 -8.391  -4.524  1.00 57.05  ? 1411 ILE A CD1   1 
ATOM   5498  N  N     . LEU A 1 764 ? -18.851 -3.772  -4.945  1.00 47.06  ? 1412 LEU A N     1 
ATOM   5499  C  CA    . LEU A 1 764 ? -18.756 -2.439  -5.509  1.00 43.50  ? 1412 LEU A CA    1 
ATOM   5500  C  C     . LEU A 1 764 ? -18.520 -2.522  -7.023  1.00 45.16  ? 1412 LEU A C     1 
ATOM   5501  O  O     . LEU A 1 764 ? -17.437 -2.909  -7.479  1.00 44.20  ? 1412 LEU A O     1 
ATOM   5502  C  CB    . LEU A 1 764 ? -17.635 -1.656  -4.826  1.00 42.93  ? 1412 LEU A CB    1 
ATOM   5503  C  CG    . LEU A 1 764 ? -17.278 -0.316  -5.477  1.00 44.63  ? 1412 LEU A CG    1 
ATOM   5504  C  CD1   . LEU A 1 764 ? -18.493 0.603   -5.516  1.00 41.04  ? 1412 LEU A CD1   1 
ATOM   5505  C  CD2   . LEU A 1 764 ? -16.092 0.364   -4.798  1.00 41.57  ? 1412 LEU A CD2   1 
ATOM   5506  N  N     . ARG A 1 765 ? -19.540 -2.148  -7.792  1.00 40.88  ? 1413 ARG A N     1 
ATOM   5507  C  CA    . ARG A 1 765 ? -19.496 -2.235  -9.243  1.00 39.88  ? 1413 ARG A CA    1 
ATOM   5508  C  C     . ARG A 1 765 ? -19.089 -0.926  -9.919  1.00 40.83  ? 1413 ARG A C     1 
ATOM   5509  O  O     . ARG A 1 765 ? -19.348 0.161   -9.403  1.00 40.71  ? 1413 ARG A O     1 
ATOM   5510  C  CB    . ARG A 1 765 ? -20.857 -2.671  -9.777  1.00 41.62  ? 1413 ARG A CB    1 
ATOM   5511  C  CG    . ARG A 1 765 ? -21.328 -4.015  -9.263  1.00 44.75  ? 1413 ARG A CG    1 
ATOM   5512  C  CD    . ARG A 1 765 ? -22.778 -4.246  -9.637  1.00 45.69  ? 1413 ARG A CD    1 
ATOM   5513  N  NE    . ARG A 1 765 ? -23.442 -5.108  -8.671  1.00 47.61  ? 1413 ARG A NE    1 
ATOM   5514  C  CZ    . ARG A 1 765 ? -23.539 -6.426  -8.785  1.00 50.12  ? 1413 ARG A CZ    1 
ATOM   5515  N  NH1   . ARG A 1 765 ? -23.017 -7.047  -9.832  1.00 52.74  ? 1413 ARG A NH1   1 
ATOM   5516  N  NH2   . ARG A 1 765 ? -24.166 -7.125  -7.847  1.00 56.06  ? 1413 ARG A NH2   1 
ATOM   5517  N  N     . ASP A 1 766 ? -18.453 -1.051  -11.082 1.00 41.26  ? 1414 ASP A N     1 
ATOM   5518  C  CA    . ASP A 1 766 ? -18.063 0.091   -11.913 1.00 40.10  ? 1414 ASP A CA    1 
ATOM   5519  C  C     . ASP A 1 766 ? -17.104 1.096   -11.258 1.00 38.67  ? 1414 ASP A C     1 
ATOM   5520  O  O     . ASP A 1 766 ? -17.162 2.289   -11.545 1.00 37.52  ? 1414 ASP A O     1 
ATOM   5521  C  CB    . ASP A 1 766 ? -19.300 0.807   -12.476 1.00 39.86  ? 1414 ASP A CB    1 
ATOM   5522  C  CG    . ASP A 1 766 ? -20.018 -0.011  -13.545 1.00 43.39  ? 1414 ASP A CG    1 
ATOM   5523  O  OD1   . ASP A 1 766 ? -21.256 -0.166  -13.443 1.00 41.11  ? 1414 ASP A OD1   1 
ATOM   5524  O  OD2   . ASP A 1 766 ? -19.350 -0.490  -14.493 1.00 44.69  ? 1414 ASP A OD2   1 
ATOM   5525  N  N     . HIS A 1 767 ? -16.215 0.616   -10.394 1.00 39.30  ? 1415 HIS A N     1 
ATOM   5526  C  CA    . HIS A 1 767 ? -15.167 1.475   -9.861  1.00 37.95  ? 1415 HIS A CA    1 
ATOM   5527  C  C     . HIS A 1 767 ? -13.957 1.314   -10.760 1.00 38.27  ? 1415 HIS A C     1 
ATOM   5528  O  O     . HIS A 1 767 ? -13.014 0.595   -10.432 1.00 39.24  ? 1415 HIS A O     1 
ATOM   5529  C  CB    . HIS A 1 767 ? -14.826 1.109   -8.417  1.00 37.96  ? 1415 HIS A CB    1 
ATOM   5530  C  CG    . HIS A 1 767 ? -14.101 2.189   -7.673  1.00 38.93  ? 1415 HIS A CG    1 
ATOM   5531  N  ND1   . HIS A 1 767 ? -14.023 3.486   -8.126  1.00 40.75  ? 1415 HIS A ND1   1 
ATOM   5532  C  CD2   . HIS A 1 767 ? -13.426 2.163   -6.497  1.00 40.41  ? 1415 HIS A CD2   1 
ATOM   5533  C  CE1   . HIS A 1 767 ? -13.327 4.214   -7.268  1.00 39.59  ? 1415 HIS A CE1   1 
ATOM   5534  N  NE2   . HIS A 1 767 ? -12.956 3.431   -6.271  1.00 39.81  ? 1415 HIS A NE2   1 
ATOM   5535  N  N     . ILE A 1 768 ? -14.006 1.984   -11.905 1.00 36.82  ? 1416 ILE A N     1 
ATOM   5536  C  CA    . ILE A 1 768 ? -13.035 1.788   -12.974 1.00 37.91  ? 1416 ILE A CA    1 
ATOM   5537  C  C     . ILE A 1 768 ? -12.759 3.104   -13.698 1.00 39.23  ? 1416 ILE A C     1 
ATOM   5538  O  O     . ILE A 1 768 ? -13.688 3.838   -14.032 1.00 40.04  ? 1416 ILE A O     1 
ATOM   5539  C  CB    . ILE A 1 768 ? -13.564 0.774   -14.008 1.00 38.15  ? 1416 ILE A CB    1 
ATOM   5540  C  CG1   . ILE A 1 768 ? -14.920 1.231   -14.543 1.00 37.09  ? 1416 ILE A CG1   1 
ATOM   5541  C  CG2   . ILE A 1 768 ? -13.702 -0.600  -13.395 1.00 39.03  ? 1416 ILE A CG2   1 
ATOM   5542  C  CD1   . ILE A 1 768 ? -15.529 0.288   -15.526 1.00 37.46  ? 1416 ILE A CD1   1 
ATOM   5543  N  N     . CYS A 1 769 ? -11.490 3.404   -13.952 1.00 37.25  ? 1417 CYS A N     1 
ATOM   5544  C  CA    . CYS A 1 769 ? -11.143 4.648   -14.630 1.00 38.07  ? 1417 CYS A CA    1 
ATOM   5545  C  C     . CYS A 1 769 ? -10.361 4.390   -15.906 1.00 40.29  ? 1417 CYS A C     1 
ATOM   5546  O  O     . CYS A 1 769 ? -9.786  3.316   -16.077 1.00 41.72  ? 1417 CYS A O     1 
ATOM   5547  C  CB    . CYS A 1 769 ? -10.331 5.537   -13.704 1.00 38.92  ? 1417 CYS A CB    1 
ATOM   5548  S  SG    . CYS A 1 769 ? -8.956  4.669   -12.973 1.00 45.52  ? 1417 CYS A SG    1 
ATOM   5549  N  N     . LYS A 1 770 ? -10.337 5.380   -16.796 1.00 36.75  ? 1418 LYS A N     1 
ATOM   5550  C  CA    . LYS A 1 770 ? -9.716  5.228   -18.103 1.00 36.47  ? 1418 LYS A CA    1 
ATOM   5551  C  C     . LYS A 1 770 ? -8.213  5.011   -17.975 1.00 41.21  ? 1418 LYS A C     1 
ATOM   5552  O  O     . LYS A 1 770 ? -7.588  5.519   -17.044 1.00 43.32  ? 1418 LYS A O     1 
ATOM   5553  C  CB    . LYS A 1 770 ? -9.997  6.457   -18.960 1.00 37.91  ? 1418 LYS A CB    1 
ATOM   5554  C  CG    . LYS A 1 770 ? -11.437 6.924   -18.928 1.00 38.29  ? 1418 LYS A CG    1 
ATOM   5555  C  CD    . LYS A 1 770 ? -11.570 8.323   -19.514 1.00 37.85  ? 1418 LYS A CD    1 
ATOM   5556  C  CE    . LYS A 1 770 ? -11.027 8.359   -20.922 1.00 44.75  ? 1418 LYS A CE    1 
ATOM   5557  N  NZ    . LYS A 1 770 ? -10.870 9.738   -21.451 1.00 48.95  ? 1418 LYS A NZ    1 
ATOM   5558  N  N     . ASP A 1 771 ? -7.638  4.250   -18.903 1.00 41.74  ? 1419 ASP A N     1 
ATOM   5559  C  CA    . ASP A 1 771 ? -6.199  3.979   -18.895 1.00 45.28  ? 1419 ASP A CA    1 
ATOM   5560  C  C     . ASP A 1 771 ? -5.475  5.067   -19.686 1.00 45.75  ? 1419 ASP A C     1 
ATOM   5561  O  O     . ASP A 1 771 ? -5.426  5.031   -20.916 1.00 45.98  ? 1419 ASP A O     1 
ATOM   5562  C  CB    . ASP A 1 771 ? -5.908  2.579   -19.463 1.00 45.33  ? 1419 ASP A CB    1 
ATOM   5563  C  CG    . ASP A 1 771 ? -4.430  2.207   -19.410 1.00 49.71  ? 1419 ASP A CG    1 
ATOM   5564  O  OD1   . ASP A 1 771 ? -3.845  1.956   -20.489 1.00 52.44  ? 1419 ASP A OD1   1 
ATOM   5565  O  OD2   . ASP A 1 771 ? -3.853  2.157   -18.299 1.00 48.78  ? 1419 ASP A OD2   1 
ATOM   5566  N  N     . MET A 1 772 ? -4.929  6.044   -18.975 1.00 42.20  ? 1420 MET A N     1 
ATOM   5567  C  CA    . MET A 1 772 ? -4.342  7.198   -19.631 1.00 44.61  ? 1420 MET A CA    1 
ATOM   5568  C  C     . MET A 1 772 ? -2.937  6.913   -20.131 1.00 48.10  ? 1420 MET A C     1 
ATOM   5569  O  O     . MET A 1 772 ? -2.197  6.144   -19.519 1.00 47.23  ? 1420 MET A O     1 
ATOM   5570  C  CB    . MET A 1 772 ? -4.338  8.398   -18.685 1.00 45.98  ? 1420 MET A CB    1 
ATOM   5571  C  CG    . MET A 1 772 ? -5.728  8.835   -18.263 1.00 46.08  ? 1420 MET A CG    1 
ATOM   5572  S  SD    . MET A 1 772 ? -6.564  9.802   -19.531 1.00 52.09  ? 1420 MET A SD    1 
ATOM   5573  C  CE    . MET A 1 772 ? -8.261  9.320   -19.266 1.00 40.66  ? 1420 MET A CE    1 
ATOM   5574  N  N     . SER A 1 773 ? -2.587  7.532   -21.257 1.00 48.23  ? 1421 SER A N     1 
ATOM   5575  C  CA    . SER A 1 773 ? -1.244  7.440   -21.816 1.00 48.73  ? 1421 SER A CA    1 
ATOM   5576  C  C     . SER A 1 773 ? -0.195  7.509   -20.710 1.00 49.96  ? 1421 SER A C     1 
ATOM   5577  O  O     . SER A 1 773 ? -0.396  8.190   -19.710 1.00 50.75  ? 1421 SER A O     1 
ATOM   5578  C  CB    . SER A 1 773 ? -1.022  8.578   -22.817 1.00 53.15  ? 1421 SER A CB    1 
ATOM   5579  O  OG    . SER A 1 773 ? 0.346   8.702   -23.183 1.00 57.17  ? 1421 SER A OG    1 
ATOM   5580  N  N     . PRO A 1 774 ? 0.927   6.792   -20.879 1.00 52.25  ? 1422 PRO A N     1 
ATOM   5581  C  CA    . PRO A 1 774 ? 2.012   6.851   -19.895 1.00 52.98  ? 1422 PRO A CA    1 
ATOM   5582  C  C     . PRO A 1 774 ? 2.447   8.291   -19.631 1.00 51.60  ? 1422 PRO A C     1 
ATOM   5583  O  O     . PRO A 1 774 ? 2.784   8.638   -18.497 1.00 51.92  ? 1422 PRO A O     1 
ATOM   5584  C  CB    . PRO A 1 774 ? 3.138   6.073   -20.576 1.00 58.52  ? 1422 PRO A CB    1 
ATOM   5585  C  CG    . PRO A 1 774 ? 2.433   5.108   -21.446 1.00 59.84  ? 1422 PRO A CG    1 
ATOM   5586  C  CD    . PRO A 1 774 ? 1.221   5.838   -21.961 1.00 57.03  ? 1422 PRO A CD    1 
ATOM   5587  N  N     . LEU A 1 775 ? 2.434   9.118   -20.671 1.00 50.82  ? 1423 LEU A N     1 
ATOM   5588  C  CA    . LEU A 1 775 ? 2.790   10.523  -20.534 1.00 48.76  ? 1423 LEU A CA    1 
ATOM   5589  C  C     . LEU A 1 775 ? 1.788   11.218  -19.634 1.00 47.64  ? 1423 LEU A C     1 
ATOM   5590  O  O     . LEU A 1 775 ? 2.160   11.859  -18.655 1.00 48.16  ? 1423 LEU A O     1 
ATOM   5591  C  CB    . LEU A 1 775 ? 2.810   11.201  -21.901 1.00 49.50  ? 1423 LEU A CB    1 
ATOM   5592  C  CG    . LEU A 1 775 ? 2.988   12.719  -21.920 1.00 46.74  ? 1423 LEU A CG    1 
ATOM   5593  C  CD1   . LEU A 1 775 ? 4.243   13.116  -21.172 1.00 46.59  ? 1423 LEU A CD1   1 
ATOM   5594  C  CD2   . LEU A 1 775 ? 3.022   13.229  -23.352 1.00 45.72  ? 1423 LEU A CD2   1 
ATOM   5595  N  N     . VAL A 1 776 ? 0.513   11.079  -19.978 1.00 46.42  ? 1424 VAL A N     1 
ATOM   5596  C  CA    . VAL A 1 776 ? -0.575  11.674  -19.216 1.00 46.11  ? 1424 VAL A CA    1 
ATOM   5597  C  C     . VAL A 1 776 ? -0.626  11.148  -17.781 1.00 46.01  ? 1424 VAL A C     1 
ATOM   5598  O  O     . VAL A 1 776 ? -1.013  11.863  -16.853 1.00 47.05  ? 1424 VAL A O     1 
ATOM   5599  C  CB    . VAL A 1 776 ? -1.921  11.402  -19.896 1.00 45.83  ? 1424 VAL A CB    1 
ATOM   5600  C  CG1   . VAL A 1 776 ? -3.059  11.963  -19.067 1.00 46.45  ? 1424 VAL A CG1   1 
ATOM   5601  C  CG2   . VAL A 1 776 ? -1.929  11.991  -21.295 1.00 47.38  ? 1424 VAL A CG2   1 
ATOM   5602  N  N     . ALA A 1 777 ? -0.239  9.895   -17.599 1.00 45.41  ? 1425 ALA A N     1 
ATOM   5603  C  CA    . ALA A 1 777 ? -0.224  9.310   -16.271 1.00 45.70  ? 1425 ALA A CA    1 
ATOM   5604  C  C     . ALA A 1 777 ? 0.858   9.992   -15.444 1.00 47.10  ? 1425 ALA A C     1 
ATOM   5605  O  O     . ALA A 1 777 ? 0.663   10.300  -14.269 1.00 47.68  ? 1425 ALA A O     1 
ATOM   5606  C  CB    . ALA A 1 777 ? 0.020   7.819   -16.354 1.00 44.20  ? 1425 ALA A CB    1 
ATOM   5607  N  N     . ALA A 1 778 ? 2.001   10.235  -16.073 1.00 46.96  ? 1426 ALA A N     1 
ATOM   5608  C  CA    . ALA A 1 778 ? 3.109   10.902  -15.407 1.00 47.59  ? 1426 ALA A CA    1 
ATOM   5609  C  C     . ALA A 1 778 ? 2.690   12.286  -14.925 1.00 45.99  ? 1426 ALA A C     1 
ATOM   5610  O  O     . ALA A 1 778 ? 2.923   12.652  -13.775 1.00 47.17  ? 1426 ALA A O     1 
ATOM   5611  C  CB    . ALA A 1 778 ? 4.302   10.994  -16.344 1.00 48.83  ? 1426 ALA A CB    1 
ATOM   5612  N  N     . ARG A 1 779 ? 2.066   13.048  -15.816 1.00 44.22  ? 1427 ARG A N     1 
ATOM   5613  C  CA    . ARG A 1 779 ? 1.555   14.369  -15.480 1.00 43.65  ? 1427 ARG A CA    1 
ATOM   5614  C  C     . ARG A 1 779 ? 0.686   14.322  -14.243 1.00 43.08  ? 1427 ARG A C     1 
ATOM   5615  O  O     . ARG A 1 779 ? 0.927   15.039  -13.279 1.00 44.57  ? 1427 ARG A O     1 
ATOM   5616  C  CB    . ARG A 1 779 ? 0.746   14.943  -16.642 1.00 44.34  ? 1427 ARG A CB    1 
ATOM   5617  C  CG    . ARG A 1 779 ? 1.587   15.434  -17.794 1.00 42.13  ? 1427 ARG A CG    1 
ATOM   5618  C  CD    . ARG A 1 779 ? 0.728   15.786  -18.975 1.00 41.12  ? 1427 ARG A CD    1 
ATOM   5619  N  NE    . ARG A 1 779 ? 1.517   16.412  -20.026 1.00 42.84  ? 1427 ARG A NE    1 
ATOM   5620  C  CZ    . ARG A 1 779 ? 1.288   16.248  -21.323 1.00 43.56  ? 1427 ARG A CZ    1 
ATOM   5621  N  NH1   . ARG A 1 779 ? 0.294   15.472  -21.726 1.00 44.26  ? 1427 ARG A NH1   1 
ATOM   5622  N  NH2   . ARG A 1 779 ? 2.052   16.855  -22.215 1.00 42.49  ? 1427 ARG A NH2   1 
ATOM   5623  N  N     . MET A 1 780 ? -0.335  13.478  -14.272 1.00 43.36  ? 1428 MET A N     1 
ATOM   5624  C  CA    . MET A 1 780 ? -1.244  13.379  -13.144 1.00 43.23  ? 1428 MET A CA    1 
ATOM   5625  C  C     . MET A 1 780 ? -0.491  13.091  -11.860 1.00 43.94  ? 1428 MET A C     1 
ATOM   5626  O  O     . MET A 1 780 ? -0.919  13.488  -10.784 1.00 45.90  ? 1428 MET A O     1 
ATOM   5627  C  CB    . MET A 1 780 ? -2.286  12.301  -13.389 1.00 41.17  ? 1428 MET A CB    1 
ATOM   5628  C  CG    . MET A 1 780 ? -3.125  12.554  -14.609 1.00 41.70  ? 1428 MET A CG    1 
ATOM   5629  S  SD    . MET A 1 780 ? -4.600  11.533  -14.617 1.00 46.20  ? 1428 MET A SD    1 
ATOM   5630  C  CE    . MET A 1 780 ? -3.902  9.907   -14.933 1.00 43.35  ? 1428 MET A CE    1 
ATOM   5631  N  N     . ARG A 1 781 ? 0.634   12.399  -11.970 1.00 44.45  ? 1429 ARG A N     1 
ATOM   5632  C  CA    . ARG A 1 781 ? 1.408   12.066  -10.789 1.00 46.32  ? 1429 ARG A CA    1 
ATOM   5633  C  C     . ARG A 1 781 ? 2.064   13.308  -10.198 1.00 48.57  ? 1429 ARG A C     1 
ATOM   5634  O  O     . ARG A 1 781 ? 2.327   13.368  -8.996  1.00 48.72  ? 1429 ARG A O     1 
ATOM   5635  C  CB    . ARG A 1 781 ? 2.467   11.018  -11.117 1.00 48.99  ? 1429 ARG A CB    1 
ATOM   5636  C  CG    . ARG A 1 781 ? 3.048   10.353  -9.881  1.00 53.46  ? 1429 ARG A CG    1 
ATOM   5637  C  CD    . ARG A 1 781 ? 3.872   9.118   -10.226 1.00 58.79  ? 1429 ARG A CD    1 
ATOM   5638  N  NE    . ARG A 1 781 ? 5.081   9.455   -10.974 1.00 62.24  ? 1429 ARG A NE    1 
ATOM   5639  C  CZ    . ARG A 1 781 ? 5.277   9.143   -12.253 1.00 63.57  ? 1429 ARG A CZ    1 
ATOM   5640  N  NH1   . ARG A 1 781 ? 4.339   8.472   -12.923 1.00 59.49  ? 1429 ARG A NH1   1 
ATOM   5641  N  NH2   . ARG A 1 781 ? 6.410   9.496   -12.859 1.00 59.34  ? 1429 ARG A NH2   1 
ATOM   5642  N  N     . HIS A 1 782 ? 2.306   14.302  -11.049 1.00 46.66  ? 1430 HIS A N     1 
ATOM   5643  C  CA    . HIS A 1 782 ? 3.077   15.485  -10.674 1.00 44.67  ? 1430 HIS A CA    1 
ATOM   5644  C  C     . HIS A 1 782 ? 2.234   16.727  -10.399 1.00 45.06  ? 1430 HIS A C     1 
ATOM   5645  O  O     . HIS A 1 782 ? 2.764   17.831  -10.269 1.00 44.88  ? 1430 HIS A O     1 
ATOM   5646  C  CB    . HIS A 1 782 ? 4.100   15.805  -11.758 1.00 45.65  ? 1430 HIS A CB    1 
ATOM   5647  C  CG    . HIS A 1 782 ? 5.252   14.853  -11.808 1.00 49.74  ? 1430 HIS A CG    1 
ATOM   5648  N  ND1   . HIS A 1 782 ? 6.330   14.949  -10.957 1.00 51.87  ? 1430 HIS A ND1   1 
ATOM   5649  C  CD2   . HIS A 1 782 ? 5.506   13.799  -12.620 1.00 52.18  ? 1430 HIS A CD2   1 
ATOM   5650  C  CE1   . HIS A 1 782 ? 7.196   13.989  -11.235 1.00 53.28  ? 1430 HIS A CE1   1 
ATOM   5651  N  NE2   . HIS A 1 782 ? 6.719   13.279  -12.240 1.00 54.42  ? 1430 HIS A NE2   1 
ATOM   5652  N  N     . ILE A 1 783 ? 0.924   16.555  -10.326 1.00 43.24  ? 1431 ILE A N     1 
ATOM   5653  C  CA    . ILE A 1 783 ? 0.072   17.634  -9.869  1.00 44.76  ? 1431 ILE A CA    1 
ATOM   5654  C  C     . ILE A 1 783 ? -0.028  17.536  -8.342  1.00 48.20  ? 1431 ILE A C     1 
ATOM   5655  O  O     . ILE A 1 783 ? -0.330  16.470  -7.798  1.00 47.90  ? 1431 ILE A O     1 
ATOM   5656  C  CB    . ILE A 1 783 ? -1.324  17.538  -10.494 1.00 44.90  ? 1431 ILE A CB    1 
ATOM   5657  C  CG1   . ILE A 1 783 ? -1.214  17.306  -12.002 1.00 42.78  ? 1431 ILE A CG1   1 
ATOM   5658  C  CG2   . ILE A 1 783 ? -2.141  18.778  -10.168 1.00 44.14  ? 1431 ILE A CG2   1 
ATOM   5659  C  CD1   . ILE A 1 783 ? -0.721  18.497  -12.772 1.00 43.01  ? 1431 ILE A CD1   1 
ATOM   5660  N  N     . PRO A 1 784 ? 0.261   18.641  -7.641  1.00 46.79  ? 1432 PRO A N     1 
ATOM   5661  C  CA    . PRO A 1 784 ? 0.202   18.686  -6.175  1.00 47.07  ? 1432 PRO A CA    1 
ATOM   5662  C  C     . PRO A 1 784 ? -1.159  18.236  -5.648  1.00 48.71  ? 1432 PRO A C     1 
ATOM   5663  O  O     . PRO A 1 784 ? -2.073  18.036  -6.445  1.00 48.07  ? 1432 PRO A O     1 
ATOM   5664  C  CB    . PRO A 1 784 ? 0.438   20.163  -5.873  1.00 47.31  ? 1432 PRO A CB    1 
ATOM   5665  C  CG    . PRO A 1 784 ? 1.288   20.626  -7.011  1.00 46.58  ? 1432 PRO A CG    1 
ATOM   5666  C  CD    . PRO A 1 784 ? 0.799   19.885  -8.214  1.00 44.59  ? 1432 PRO A CD    1 
ATOM   5667  N  N     . LEU A 1 785 ? -1.286  18.074  -4.333  1.00 48.64  ? 1433 LEU A N     1 
ATOM   5668  C  CA    . LEU A 1 785 ? -2.526  17.571  -3.742  1.00 49.82  ? 1433 LEU A CA    1 
ATOM   5669  C  C     . LEU A 1 785 ? -3.429  18.671  -3.175  1.00 52.57  ? 1433 LEU A C     1 
ATOM   5670  O  O     . LEU A 1 785 ? -4.635  18.471  -3.011  1.00 55.81  ? 1433 LEU A O     1 
ATOM   5671  C  CB    . LEU A 1 785 ? -2.216  16.541  -2.656  1.00 48.86  ? 1433 LEU A CB    1 
ATOM   5672  C  CG    . LEU A 1 785 ? -1.633  15.214  -3.130  1.00 50.27  ? 1433 LEU A CG    1 
ATOM   5673  C  CD1   . LEU A 1 785 ? -1.187  14.362  -1.951  1.00 53.00  ? 1433 LEU A CD1   1 
ATOM   5674  C  CD2   . LEU A 1 785 ? -2.653  14.474  -3.964  1.00 49.76  ? 1433 LEU A CD2   1 
ATOM   5675  N  N     . PHE A 1 786 ? -2.837  19.823  -2.878  1.00 50.57  ? 1434 PHE A N     1 
ATOM   5676  C  CA    . PHE A 1 786 ? -3.556  20.952  -2.295  1.00 50.57  ? 1434 PHE A CA    1 
ATOM   5677  C  C     . PHE A 1 786 ? -4.663  21.465  -3.207  1.00 50.63  ? 1434 PHE A C     1 
ATOM   5678  O  O     . PHE A 1 786 ? -4.546  21.410  -4.427  1.00 49.56  ? 1434 PHE A O     1 
ATOM   5679  C  CB    . PHE A 1 786 ? -2.571  22.088  -2.002  1.00 53.34  ? 1434 PHE A CB    1 
ATOM   5680  C  CG    . PHE A 1 786 ? -1.225  21.609  -1.533  1.00 59.18  ? 1434 PHE A CG    1 
ATOM   5681  C  CD1   . PHE A 1 786 ? -1.078  21.028  -0.275  1.00 61.62  ? 1434 PHE A CD1   1 
ATOM   5682  C  CD2   . PHE A 1 786 ? -0.105  21.725  -2.351  1.00 57.83  ? 1434 PHE A CD2   1 
ATOM   5683  C  CE1   . PHE A 1 786 ? 0.158   20.574  0.162   1.00 60.27  ? 1434 PHE A CE1   1 
ATOM   5684  C  CE2   . PHE A 1 786 ? 1.141   21.272  -1.921  1.00 58.65  ? 1434 PHE A CE2   1 
ATOM   5685  C  CZ    . PHE A 1 786 ? 1.272   20.697  -0.663  1.00 60.55  ? 1434 PHE A CZ    1 
ATOM   5686  N  N     . PRO A 1 787 ? -5.747  21.976  -2.611  1.00 52.25  ? 1435 PRO A N     1 
ATOM   5687  C  CA    . PRO A 1 787 ? -6.847  22.593  -3.360  1.00 54.34  ? 1435 PRO A CA    1 
ATOM   5688  C  C     . PRO A 1 787 ? -6.369  23.727  -4.266  1.00 54.95  ? 1435 PRO A C     1 
ATOM   5689  O  O     . PRO A 1 787 ? -5.684  24.649  -3.810  1.00 53.45  ? 1435 PRO A O     1 
ATOM   5690  C  CB    . PRO A 1 787 ? -7.746  23.149  -2.256  1.00 53.97  ? 1435 PRO A CB    1 
ATOM   5691  C  CG    . PRO A 1 787 ? -7.497  22.257  -1.101  1.00 52.13  ? 1435 PRO A CG    1 
ATOM   5692  C  CD    . PRO A 1 787 ? -6.034  21.916  -1.169  1.00 53.26  ? 1435 PRO A CD    1 
ATOM   5693  N  N     . GLY A 1 788 ? -6.733  23.648  -5.542  1.00 53.27  ? 1436 GLY A N     1 
ATOM   5694  C  CA    . GLY A 1 788 ? -6.345  24.651  -6.514  1.00 51.86  ? 1436 GLY A CA    1 
ATOM   5695  C  C     . GLY A 1 788 ? -5.335  24.137  -7.519  1.00 49.94  ? 1436 GLY A C     1 
ATOM   5696  O  O     . GLY A 1 788 ? -4.955  24.852  -8.449  1.00 51.92  ? 1436 GLY A O     1 
ATOM   5697  N  N     . SER A 1 789 ? -4.900  22.895  -7.333  1.00 46.96  ? 1437 SER A N     1 
ATOM   5698  C  CA    . SER A 1 789 ? -3.904  22.290  -8.212  1.00 46.28  ? 1437 SER A CA    1 
ATOM   5699  C  C     . SER A 1 789 ? -4.430  22.088  -9.618  1.00 45.86  ? 1437 SER A C     1 
ATOM   5700  O  O     . SER A 1 789 ? -5.542  21.596  -9.801  1.00 48.39  ? 1437 SER A O     1 
ATOM   5701  C  CB    . SER A 1 789 ? -3.455  20.934  -7.672  1.00 45.77  ? 1437 SER A CB    1 
ATOM   5702  O  OG    . SER A 1 789 ? -2.790  21.061  -6.432  1.00 49.66  ? 1437 SER A OG    1 
ATOM   5703  N  N     . ASP A 1 790 ? -3.631  22.473  -10.607 1.00 43.01  ? 1438 ASP A N     1 
ATOM   5704  C  CA    . ASP A 1 790 ? -3.864  22.056  -11.983 1.00 41.23  ? 1438 ASP A CA    1 
ATOM   5705  C  C     . ASP A 1 790 ? -2.577  22.190  -12.779 1.00 43.04  ? 1438 ASP A C     1 
ATOM   5706  O  O     . ASP A 1 790 ? -1.508  22.352  -12.199 1.00 44.25  ? 1438 ASP A O     1 
ATOM   5707  C  CB    . ASP A 1 790 ? -5.030  22.807  -12.638 1.00 41.99  ? 1438 ASP A CB    1 
ATOM   5708  C  CG    . ASP A 1 790 ? -4.836  24.313  -12.649 1.00 49.38  ? 1438 ASP A CG    1 
ATOM   5709  O  OD1   . ASP A 1 790 ? -5.841  25.038  -12.841 1.00 48.87  ? 1438 ASP A OD1   1 
ATOM   5710  O  OD2   . ASP A 1 790 ? -3.685  24.774  -12.474 1.00 52.23  ? 1438 ASP A OD2   1 
ATOM   5711  N  N     . TRP A 1 791 ? -2.680  22.128  -14.099 1.00 42.49  ? 1439 TRP A N     1 
ATOM   5712  C  CA    . TRP A 1 791 ? -1.499  22.061  -14.948 1.00 42.67  ? 1439 TRP A CA    1 
ATOM   5713  C  C     . TRP A 1 791 ? -0.491  23.160  -14.659 1.00 45.27  ? 1439 TRP A C     1 
ATOM   5714  O  O     . TRP A 1 791 ? 0.704   22.994  -14.876 1.00 45.82  ? 1439 TRP A O     1 
ATOM   5715  C  CB    . TRP A 1 791 ? -1.896  22.116  -16.416 1.00 43.20  ? 1439 TRP A CB    1 
ATOM   5716  C  CG    . TRP A 1 791 ? -2.276  23.481  -16.887 1.00 44.84  ? 1439 TRP A CG    1 
ATOM   5717  C  CD1   . TRP A 1 791 ? -3.489  24.087  -16.747 1.00 45.65  ? 1439 TRP A CD1   1 
ATOM   5718  C  CD2   . TRP A 1 791 ? -1.443  24.412  -17.589 1.00 45.73  ? 1439 TRP A CD2   1 
ATOM   5719  N  NE1   . TRP A 1 791 ? -3.464  25.337  -17.315 1.00 46.52  ? 1439 TRP A NE1   1 
ATOM   5720  C  CE2   . TRP A 1 791 ? -2.218  25.560  -17.840 1.00 47.17  ? 1439 TRP A CE2   1 
ATOM   5721  C  CE3   . TRP A 1 791 ? -0.119  24.388  -18.029 1.00 47.27  ? 1439 TRP A CE3   1 
ATOM   5722  C  CZ2   . TRP A 1 791 ? -1.711  26.670  -18.508 1.00 47.25  ? 1439 TRP A CZ2   1 
ATOM   5723  C  CZ3   . TRP A 1 791 ? 0.380   25.495  -18.702 1.00 46.71  ? 1439 TRP A CZ3   1 
ATOM   5724  C  CH2   . TRP A 1 791 ? -0.413  26.614  -18.934 1.00 45.64  ? 1439 TRP A CH2   1 
ATOM   5725  N  N     . ARG A 1 792 ? -0.969  24.290  -14.167 1.00 47.28  ? 1440 ARG A N     1 
ATOM   5726  C  CA    . ARG A 1 792 ? -0.087  25.422  -13.953 1.00 47.11  ? 1440 ARG A CA    1 
ATOM   5727  C  C     . ARG A 1 792 ? 0.916   25.147  -12.839 1.00 47.47  ? 1440 ARG A C     1 
ATOM   5728  O  O     . ARG A 1 792 ? 1.911   25.864  -12.698 1.00 47.98  ? 1440 ARG A O     1 
ATOM   5729  C  CB    . ARG A 1 792 ? -0.907  26.680  -13.684 1.00 48.76  ? 1440 ARG A CB    1 
ATOM   5730  C  CG    . ARG A 1 792 ? -1.723  27.117  -14.892 1.00 48.41  ? 1440 ARG A CG    1 
ATOM   5731  C  CD    . ARG A 1 792 ? -2.601  28.281  -14.559 1.00 51.74  ? 1440 ARG A CD    1 
ATOM   5732  N  NE    . ARG A 1 792 ? -3.516  27.936  -13.482 1.00 54.54  ? 1440 ARG A NE    1 
ATOM   5733  C  CZ    . ARG A 1 792 ? -4.749  28.414  -13.375 1.00 54.57  ? 1440 ARG A CZ    1 
ATOM   5734  N  NH1   . ARG A 1 792 ? -5.207  29.257  -14.290 1.00 55.05  ? 1440 ARG A NH1   1 
ATOM   5735  N  NH2   . ARG A 1 792 ? -5.522  28.045  -12.364 1.00 49.70  ? 1440 ARG A NH2   1 
ATOM   5736  N  N     . ASP A 1 793 ? 0.653   24.088  -12.072 1.00 47.39  ? 1441 ASP A N     1 
ATOM   5737  C  CA    . ASP A 1 793 ? 1.489   23.687  -10.939 1.00 45.73  ? 1441 ASP A CA    1 
ATOM   5738  C  C     . ASP A 1 793 ? 2.510   22.626  -11.330 1.00 46.24  ? 1441 ASP A C     1 
ATOM   5739  O  O     . ASP A 1 793 ? 3.180   22.068  -10.464 1.00 44.61  ? 1441 ASP A O     1 
ATOM   5740  C  CB    . ASP A 1 793 ? 0.630   23.114  -9.807  1.00 45.95  ? 1441 ASP A CB    1 
ATOM   5741  C  CG    . ASP A 1 793 ? -0.118  24.165  -9.063  1.00 50.57  ? 1441 ASP A CG    1 
ATOM   5742  O  OD1   . ASP A 1 793 ? 0.363   25.318  -9.059  1.00 54.71  ? 1441 ASP A OD1   1 
ATOM   5743  O  OD2   . ASP A 1 793 ? -1.173  23.849  -8.464  1.00 51.41  ? 1441 ASP A OD2   1 
ATOM   5744  N  N     . LEU A 1 794 ? 2.617   22.333  -12.624 1.00 47.04  ? 1442 LEU A N     1 
ATOM   5745  C  CA    . LEU A 1 794 ? 3.476   21.246  -13.085 1.00 45.19  ? 1442 LEU A CA    1 
ATOM   5746  C  C     . LEU A 1 794 ? 4.937   21.653  -13.122 1.00 46.92  ? 1442 LEU A C     1 
ATOM   5747  O  O     . LEU A 1 794 ? 5.253   22.796  -13.445 1.00 46.60  ? 1442 LEU A O     1 
ATOM   5748  C  CB    . LEU A 1 794 ? 3.044   20.767  -14.465 1.00 43.30  ? 1442 LEU A CB    1 
ATOM   5749  C  CG    . LEU A 1 794 ? 1.962   19.697  -14.435 1.00 44.03  ? 1442 LEU A CG    1 
ATOM   5750  C  CD1   . LEU A 1 794 ? 1.426   19.461  -15.828 1.00 44.67  ? 1442 LEU A CD1   1 
ATOM   5751  C  CD2   . LEU A 1 794 ? 2.517   18.417  -13.846 1.00 42.53  ? 1442 LEU A CD2   1 
ATOM   5752  N  N     . PRO A 1 795 ? 5.833   20.712  -12.782 1.00 46.88  ? 1443 PRO A N     1 
ATOM   5753  C  CA    . PRO A 1 795 ? 7.288   20.881  -12.822 1.00 45.50  ? 1443 PRO A CA    1 
ATOM   5754  C  C     . PRO A 1 795 ? 7.774   20.858  -14.260 1.00 47.80  ? 1443 PRO A C     1 
ATOM   5755  O  O     . PRO A 1 795 ? 7.313   20.024  -15.034 1.00 48.77  ? 1443 PRO A O     1 
ATOM   5756  C  CB    . PRO A 1 795 ? 7.807   19.623  -12.118 1.00 44.37  ? 1443 PRO A CB    1 
ATOM   5757  C  CG    . PRO A 1 795 ? 6.619   18.976  -11.501 1.00 46.50  ? 1443 PRO A CG    1 
ATOM   5758  C  CD    . PRO A 1 795 ? 5.457   19.369  -12.323 1.00 46.04  ? 1443 PRO A CD    1 
ATOM   5759  N  N     . ASN A 1 796 ? 8.686   21.751  -14.619 1.00 46.34  ? 1444 ASN A N     1 
ATOM   5760  C  CA    . ASN A 1 796 ? 9.324   21.665  -15.921 1.00 45.75  ? 1444 ASN A CA    1 
ATOM   5761  C  C     . ASN A 1 796 ? 10.574  20.811  -15.799 1.00 49.11  ? 1444 ASN A C     1 
ATOM   5762  O  O     . ASN A 1 796 ? 11.695  21.320  -15.796 1.00 50.53  ? 1444 ASN A O     1 
ATOM   5763  C  CB    . ASN A 1 796 ? 9.662   23.046  -16.477 1.00 44.64  ? 1444 ASN A CB    1 
ATOM   5764  C  CG    . ASN A 1 796 ? 9.896   23.022  -17.970 1.00 46.32  ? 1444 ASN A CG    1 
ATOM   5765  O  OD1   . ASN A 1 796 ? 9.669   22.005  -18.626 1.00 47.93  ? 1444 ASN A OD1   1 
ATOM   5766  N  ND2   . ASN A 1 796 ? 10.337  24.146  -18.521 1.00 46.46  ? 1444 ASN A ND2   1 
ATOM   5767  N  N     . ILE A 1 797 ? 10.367  19.506  -15.674 1.00 47.44  ? 1445 ILE A N     1 
ATOM   5768  C  CA    . ILE A 1 797 ? 11.466  18.571  -15.548 1.00 48.55  ? 1445 ILE A CA    1 
ATOM   5769  C  C     . ILE A 1 797 ? 11.391  17.488  -16.604 1.00 53.56  ? 1445 ILE A C     1 
ATOM   5770  O  O     . ILE A 1 797 ? 10.417  17.381  -17.349 1.00 53.43  ? 1445 ILE A O     1 
ATOM   5771  C  CB    . ILE A 1 797 ? 11.474  17.888  -14.177 1.00 48.00  ? 1445 ILE A CB    1 
ATOM   5772  C  CG1   . ILE A 1 797 ? 10.248  16.999  -14.021 1.00 48.49  ? 1445 ILE A CG1   1 
ATOM   5773  C  CG2   . ILE A 1 797 ? 11.515  18.915  -13.080 1.00 50.74  ? 1445 ILE A CG2   1 
ATOM   5774  C  CD1   . ILE A 1 797 ? 10.141  16.358  -12.669 1.00 49.23  ? 1445 ILE A CD1   1 
ATOM   5775  N  N     . GLN A 1 798 ? 12.442  16.682  -16.645 1.00 56.75  ? 1446 GLN A N     1 
ATOM   5776  C  CA    . GLN A 1 798 ? 12.569  15.583  -17.581 1.00 57.08  ? 1446 GLN A CA    1 
ATOM   5777  C  C     . GLN A 1 798 ? 12.206  14.312  -16.831 1.00 58.62  ? 1446 GLN A C     1 
ATOM   5778  O  O     . GLN A 1 798 ? 12.680  14.087  -15.716 1.00 58.69  ? 1446 GLN A O     1 
ATOM   5779  C  CB    . GLN A 1 798 ? 14.011  15.532  -18.074 1.00 60.02  ? 1446 GLN A CB    1 
ATOM   5780  C  CG    . GLN A 1 798 ? 14.343  14.386  -18.990 1.00 69.41  ? 1446 GLN A CG    1 
ATOM   5781  C  CD    . GLN A 1 798 ? 15.839  14.288  -19.247 1.00 75.51  ? 1446 GLN A CD    1 
ATOM   5782  O  OE1   . GLN A 1 798 ? 16.551  13.536  -18.572 1.00 77.32  ? 1446 GLN A OE1   1 
ATOM   5783  N  NE2   . GLN A 1 798 ? 16.323  15.056  -20.219 1.00 73.96  ? 1446 GLN A NE2   1 
ATOM   5784  N  N     . VAL A 1 799 ? 11.345  13.490  -17.421 1.00 60.25  ? 1447 VAL A N     1 
ATOM   5785  C  CA    . VAL A 1 799 ? 10.856  12.303  -16.723 1.00 62.22  ? 1447 VAL A CA    1 
ATOM   5786  C  C     . VAL A 1 799 ? 10.970  11.037  -17.561 1.00 63.07  ? 1447 VAL A C     1 
ATOM   5787  O  O     . VAL A 1 799 ? 10.448  10.962  -18.672 1.00 62.41  ? 1447 VAL A O     1 
ATOM   5788  C  CB    . VAL A 1 799 ? 9.383   12.458  -16.275 1.00 60.81  ? 1447 VAL A CB    1 
ATOM   5789  C  CG1   . VAL A 1 799 ? 8.970   11.282  -15.413 1.00 62.58  ? 1447 VAL A CG1   1 
ATOM   5790  C  CG2   . VAL A 1 799 ? 9.179   13.761  -15.519 1.00 57.62  ? 1447 VAL A CG2   1 
ATOM   5791  N  N     . ARG A 1 800 ? 11.667  10.046  -17.019 1.00 62.71  ? 1448 ARG A N     1 
ATOM   5792  C  CA    . ARG A 1 800 ? 11.674  8.714   -17.602 1.00 67.83  ? 1448 ARG A CA    1 
ATOM   5793  C  C     . ARG A 1 800 ? 10.351  8.039   -17.248 1.00 74.01  ? 1448 ARG A C     1 
ATOM   5794  O  O     . ARG A 1 800 ? 10.101  7.718   -16.083 1.00 73.69  ? 1448 ARG A O     1 
ATOM   5795  C  CB    . ARG A 1 800 ? 12.848  7.897   -17.067 1.00 68.52  ? 1448 ARG A CB    1 
ATOM   5796  N  N     . LEU A 1 801 ? 9.495   7.842   -18.250 1.00 75.60  ? 1449 LEU A N     1 
ATOM   5797  C  CA    . LEU A 1 801 ? 8.176   7.262   -18.024 1.00 73.69  ? 1449 LEU A CA    1 
ATOM   5798  C  C     . LEU A 1 801 ? 8.288   5.752   -17.882 1.00 79.99  ? 1449 LEU A C     1 
ATOM   5799  O  O     . LEU A 1 801 ? 9.331   5.169   -18.185 1.00 81.37  ? 1449 LEU A O     1 
ATOM   5800  C  CB    . LEU A 1 801 ? 7.241   7.586   -19.190 1.00 69.63  ? 1449 LEU A CB    1 
ATOM   5801  C  CG    . LEU A 1 801 ? 7.403   8.950   -19.856 1.00 65.40  ? 1449 LEU A CG    1 
ATOM   5802  C  CD1   . LEU A 1 801 ? 6.320   9.179   -20.897 1.00 59.91  ? 1449 LEU A CD1   1 
ATOM   5803  C  CD2   . LEU A 1 801 ? 7.373   10.042  -18.813 1.00 67.50  ? 1449 LEU A CD2   1 
ATOM   5804  N  N     . GLY A 1 802 ? 7.212   5.122   -17.419 1.00 82.09  ? 1450 GLY A N     1 
ATOM   5805  C  CA    . GLY A 1 802 ? 7.113   3.673   -17.443 1.00 85.99  ? 1450 GLY A CA    1 
ATOM   5806  C  C     . GLY A 1 802 ? 6.747   3.219   -18.849 1.00 86.78  ? 1450 GLY A C     1 
ATOM   5807  O  O     . GLY A 1 802 ? 5.923   2.323   -19.036 1.00 84.88  ? 1450 GLY A O     1 
ATOM   5808  N  N     . ASP A 1 803 ? 7.369   3.856   -19.839 1.00 86.42  ? 1451 ASP A N     1 
ATOM   5809  C  CA    . ASP A 1 803 ? 7.066   3.631   -21.247 1.00 85.50  ? 1451 ASP A CA    1 
ATOM   5810  C  C     . ASP A 1 803 ? 8.384   3.398   -21.983 1.00 86.30  ? 1451 ASP A C     1 
ATOM   5811  O  O     . ASP A 1 803 ? 8.419   2.792   -23.058 1.00 84.50  ? 1451 ASP A O     1 
ATOM   5812  C  CB    . ASP A 1 803 ? 6.345   4.864   -21.816 1.00 82.95  ? 1451 ASP A CB    1 
ATOM   5813  C  CG    . ASP A 1 803 ? 5.575   4.574   -23.105 1.00 84.09  ? 1451 ASP A CG    1 
ATOM   5814  O  OD1   . ASP A 1 803 ? 5.308   3.390   -23.405 1.00 83.60  ? 1451 ASP A OD1   1 
ATOM   5815  O  OD2   . ASP A 1 803 ? 5.219   5.547   -23.810 1.00 82.85  ? 1451 ASP A OD2   1 
ATOM   5816  N  N     . GLY A 1 804 ? 9.470   3.872   -21.379 1.00 83.85  ? 1452 GLY A N     1 
ATOM   5817  C  CA    . GLY A 1 804 ? 10.770  3.863   -22.023 1.00 85.98  ? 1452 GLY A CA    1 
ATOM   5818  C  C     . GLY A 1 804 ? 11.047  5.201   -22.683 1.00 86.05  ? 1452 GLY A C     1 
ATOM   5819  O  O     . GLY A 1 804 ? 12.174  5.704   -22.665 1.00 81.80  ? 1452 GLY A O     1 
ATOM   5820  N  N     . VAL A 1 805 ? 10.002  5.779   -23.269 1.00 83.01  ? 1453 VAL A N     1 
ATOM   5821  C  CA    . VAL A 1 805 ? 10.086  7.112   -23.850 1.00 78.96  ? 1453 VAL A CA    1 
ATOM   5822  C  C     . VAL A 1 805 ? 10.351  8.142   -22.746 1.00 77.01  ? 1453 VAL A C     1 
ATOM   5823  O  O     . VAL A 1 805 ? 10.021  7.919   -21.578 1.00 76.12  ? 1453 VAL A O     1 
ATOM   5824  C  CB    . VAL A 1 805 ? 8.798   7.475   -24.607 1.00 70.99  ? 1453 VAL A CB    1 
ATOM   5825  N  N     . ILE A 1 806 ? 10.967  9.260   -23.115 1.00 73.90  ? 1454 ILE A N     1 
ATOM   5826  C  CA    . ILE A 1 806 ? 11.305  10.293  -22.147 1.00 69.72  ? 1454 ILE A CA    1 
ATOM   5827  C  C     . ILE A 1 806 ? 10.584  11.597  -22.450 1.00 68.98  ? 1454 ILE A C     1 
ATOM   5828  O  O     . ILE A 1 806 ? 10.670  12.120  -23.566 1.00 68.19  ? 1454 ILE A O     1 
ATOM   5829  C  CB    . ILE A 1 806 ? 12.822  10.546  -22.086 1.00 68.57  ? 1454 ILE A CB    1 
ATOM   5830  C  CG1   . ILE A 1 806 ? 13.492  9.481   -21.215 1.00 72.25  ? 1454 ILE A CG1   1 
ATOM   5831  C  CG2   . ILE A 1 806 ? 13.108  11.923  -21.521 1.00 67.32  ? 1454 ILE A CG2   1 
ATOM   5832  C  CD1   . ILE A 1 806 ? 14.962  9.738   -20.943 1.00 74.34  ? 1454 ILE A CD1   1 
ATOM   5833  N  N     . ALA A 1 807 ? 9.863   12.103  -21.449 1.00 67.86  ? 1455 ALA A N     1 
ATOM   5834  C  CA    . ALA A 1 807 ? 9.189   13.394  -21.530 1.00 60.81  ? 1455 ALA A CA    1 
ATOM   5835  C  C     . ALA A 1 807 ? 10.172  14.496  -21.150 1.00 60.39  ? 1455 ALA A C     1 
ATOM   5836  O  O     . ALA A 1 807 ? 10.760  14.474  -20.065 1.00 60.36  ? 1455 ALA A O     1 
ATOM   5837  C  CB    . ALA A 1 807 ? 7.979   13.418  -20.615 1.00 55.91  ? 1455 ALA A CB    1 
ATOM   5838  N  N     . HIS A 1 808 ? 10.344  15.459  -22.048 1.00 58.19  ? 1456 HIS A N     1 
ATOM   5839  C  CA    . HIS A 1 808 ? 11.400  16.454  -21.907 1.00 60.46  ? 1456 HIS A CA    1 
ATOM   5840  C  C     . HIS A 1 808 ? 10.942  17.733  -21.204 1.00 57.41  ? 1456 HIS A C     1 
ATOM   5841  O  O     . HIS A 1 808 ? 9.768   17.887  -20.856 1.00 53.71  ? 1456 HIS A O     1 
ATOM   5842  C  CB    . HIS A 1 808 ? 11.975  16.803  -23.284 1.00 62.60  ? 1456 HIS A CB    1 
ATOM   5843  C  CG    . HIS A 1 808 ? 12.268  15.608  -24.139 1.00 67.09  ? 1456 HIS A CG    1 
ATOM   5844  N  ND1   . HIS A 1 808 ? 11.449  15.216  -25.176 1.00 66.44  ? 1456 HIS A ND1   1 
ATOM   5845  C  CD2   . HIS A 1 808 ? 13.289  14.717  -24.106 1.00 67.52  ? 1456 HIS A CD2   1 
ATOM   5846  C  CE1   . HIS A 1 808 ? 11.953  14.135  -25.748 1.00 67.56  ? 1456 HIS A CE1   1 
ATOM   5847  N  NE2   . HIS A 1 808 ? 13.067  13.812  -25.116 1.00 69.33  ? 1456 HIS A NE2   1 
ATOM   5848  N  N     . LYS A 1 809 ? 11.890  18.643  -20.989 1.00 57.36  ? 1457 LYS A N     1 
ATOM   5849  C  CA    . LYS A 1 809 ? 11.566  19.991  -20.546 1.00 53.06  ? 1457 LYS A CA    1 
ATOM   5850  C  C     . LYS A 1 809 ? 10.968  20.746  -21.718 1.00 50.76  ? 1457 LYS A C     1 
ATOM   5851  O  O     . LYS A 1 809 ? 11.348  20.533  -22.870 1.00 50.83  ? 1457 LYS A O     1 
ATOM   5852  C  CB    . LYS A 1 809 ? 12.813  20.739  -20.082 1.00 50.05  ? 1457 LYS A CB    1 
ATOM   5853  C  CG    . LYS A 1 809 ? 13.410  20.290  -18.776 1.00 50.90  ? 1457 LYS A CG    1 
ATOM   5854  C  CD    . LYS A 1 809 ? 14.594  21.183  -18.447 1.00 58.84  ? 1457 LYS A CD    1 
ATOM   5855  C  CE    . LYS A 1 809 ? 15.307  20.767  -17.170 1.00 68.51  ? 1457 LYS A CE    1 
ATOM   5856  N  NZ    . LYS A 1 809 ? 16.299  21.806  -16.750 1.00 63.38  ? 1457 LYS A NZ    1 
ATOM   5857  N  N     . LEU A 1 810 ? 10.024  21.626  -21.421 1.00 48.13  ? 1458 LEU A N     1 
ATOM   5858  C  CA    . LEU A 1 810 ? 9.515   22.540  -22.420 1.00 47.76  ? 1458 LEU A CA    1 
ATOM   5859  C  C     . LEU A 1 810 ? 10.521  23.683  -22.500 1.00 53.01  ? 1458 LEU A C     1 
ATOM   5860  O  O     . LEU A 1 810 ? 11.164  24.030  -21.501 1.00 52.08  ? 1458 LEU A O     1 
ATOM   5861  C  CB    . LEU A 1 810 ? 8.137   23.042  -22.001 1.00 45.66  ? 1458 LEU A CB    1 
ATOM   5862  C  CG    . LEU A 1 810 ? 7.303   23.912  -22.937 1.00 45.72  ? 1458 LEU A CG    1 
ATOM   5863  C  CD1   . LEU A 1 810 ? 7.158   23.267  -24.293 1.00 47.67  ? 1458 LEU A CD1   1 
ATOM   5864  C  CD2   . LEU A 1 810 ? 5.940   24.141  -22.313 1.00 43.03  ? 1458 LEU A CD2   1 
ATOM   5865  N  N     . GLN A 1 811 ? 10.686  24.259  -23.685 1.00 52.94  ? 1459 GLN A N     1 
ATOM   5866  C  CA    . GLN A 1 811 ? 11.636  25.356  -23.832 1.00 54.96  ? 1459 GLN A CA    1 
ATOM   5867  C  C     . GLN A 1 811 ? 11.007  26.677  -24.275 1.00 54.98  ? 1459 GLN A C     1 
ATOM   5868  O  O     . GLN A 1 811 ? 10.270  26.733  -25.264 1.00 54.58  ? 1459 GLN A O     1 
ATOM   5869  C  CB    . GLN A 1 811 ? 12.793  24.956  -24.745 1.00 58.34  ? 1459 GLN A CB    1 
ATOM   5870  C  CG    . GLN A 1 811 ? 13.907  24.248  -23.992 1.00 63.62  ? 1459 GLN A CG    1 
ATOM   5871  C  CD    . GLN A 1 811 ? 14.980  23.704  -24.905 1.00 73.51  ? 1459 GLN A CD    1 
ATOM   5872  O  OE1   . GLN A 1 811 ? 14.761  23.529  -26.109 1.00 74.64  ? 1459 GLN A OE1   1 
ATOM   5873  N  NE2   . GLN A 1 811 ? 16.154  23.431  -24.339 1.00 70.51  ? 1459 GLN A NE2   1 
ATOM   5874  N  N     . TYR A 1 812 ? 11.316  27.737  -23.531 1.00 51.88  ? 1460 TYR A N     1 
ATOM   5875  C  CA    . TYR A 1 812 ? 10.797  29.068  -23.821 1.00 48.17  ? 1460 TYR A CA    1 
ATOM   5876  C  C     . TYR A 1 812 ? 11.784  29.892  -24.639 1.00 46.08  ? 1460 TYR A C     1 
ATOM   5877  O  O     . TYR A 1 812 ? 12.772  30.402  -24.116 1.00 45.36  ? 1460 TYR A O     1 
ATOM   5878  C  CB    . TYR A 1 812 ? 10.443  29.763  -22.517 1.00 48.43  ? 1460 TYR A CB    1 
ATOM   5879  C  CG    . TYR A 1 812 ? 9.485   28.942  -21.691 1.00 49.97  ? 1460 TYR A CG    1 
ATOM   5880  C  CD1   . TYR A 1 812 ? 9.949   27.940  -20.859 1.00 47.97  ? 1460 TYR A CD1   1 
ATOM   5881  C  CD2   . TYR A 1 812 ? 8.114   29.150  -21.769 1.00 49.36  ? 1460 TYR A CD2   1 
ATOM   5882  C  CE1   . TYR A 1 812 ? 9.083   27.179  -20.114 1.00 46.17  ? 1460 TYR A CE1   1 
ATOM   5883  C  CE2   . TYR A 1 812 ? 7.238   28.393  -21.025 1.00 47.39  ? 1460 TYR A CE2   1 
ATOM   5884  C  CZ    . TYR A 1 812 ? 7.730   27.409  -20.198 1.00 46.92  ? 1460 TYR A CZ    1 
ATOM   5885  O  OH    . TYR A 1 812 ? 6.867   26.650  -19.449 1.00 47.80  ? 1460 TYR A OH    1 
ATOM   5886  N  N     . THR A 1 813 ? 11.503  30.013  -25.930 1.00 45.95  ? 1461 THR A N     1 
ATOM   5887  C  CA    . THR A 1 813 ? 12.442  30.607  -26.871 1.00 48.31  ? 1461 THR A CA    1 
ATOM   5888  C  C     . THR A 1 813 ? 11.897  31.871  -27.526 1.00 49.77  ? 1461 THR A C     1 
ATOM   5889  O  O     . THR A 1 813 ? 12.476  32.379  -28.486 1.00 52.42  ? 1461 THR A O     1 
ATOM   5890  C  CB    . THR A 1 813 ? 12.824  29.601  -27.969 1.00 49.07  ? 1461 THR A CB    1 
ATOM   5891  O  OG1   . THR A 1 813 ? 11.678  28.806  -28.303 1.00 49.89  ? 1461 THR A OG1   1 
ATOM   5892  C  CG2   . THR A 1 813 ? 13.932  28.688  -27.482 1.00 47.72  ? 1461 THR A CG2   1 
ATOM   5893  N  N     . PHE A 1 814 ? 10.780  32.370  -27.009 1.00 48.91  ? 1462 PHE A N     1 
ATOM   5894  C  CA    . PHE A 1 814 ? 10.176  33.591  -27.522 1.00 49.65  ? 1462 PHE A CA    1 
ATOM   5895  C  C     . PHE A 1 814 ? 9.684   34.454  -26.380 1.00 50.62  ? 1462 PHE A C     1 
ATOM   5896  O  O     . PHE A 1 814 ? 9.373   33.961  -25.297 1.00 46.88  ? 1462 PHE A O     1 
ATOM   5897  C  CB    . PHE A 1 814 ? 9.015   33.273  -28.453 1.00 51.27  ? 1462 PHE A CB    1 
ATOM   5898  C  CG    . PHE A 1 814 ? 9.396   32.407  -29.605 1.00 53.33  ? 1462 PHE A CG    1 
ATOM   5899  C  CD1   . PHE A 1 814 ? 10.005  32.950  -30.723 1.00 54.14  ? 1462 PHE A CD1   1 
ATOM   5900  C  CD2   . PHE A 1 814 ? 9.156   31.044  -29.570 1.00 51.64  ? 1462 PHE A CD2   1 
ATOM   5901  C  CE1   . PHE A 1 814 ? 10.361  32.149  -31.785 1.00 55.94  ? 1462 PHE A CE1   1 
ATOM   5902  C  CE2   . PHE A 1 814 ? 9.510   30.239  -30.629 1.00 51.96  ? 1462 PHE A CE2   1 
ATOM   5903  C  CZ    . PHE A 1 814 ? 10.112  30.788  -31.737 1.00 53.89  ? 1462 PHE A CZ    1 
ATOM   5904  N  N     . HIS A 1 815 ? 9.609   35.754  -26.625 1.00 52.59  ? 1463 HIS A N     1 
ATOM   5905  C  CA    . HIS A 1 815 ? 9.178   36.653  -25.581 1.00 53.91  ? 1463 HIS A CA    1 
ATOM   5906  C  C     . HIS A 1 815 ? 7.682   36.905  -25.657 1.00 55.37  ? 1463 HIS A C     1 
ATOM   5907  O  O     . HIS A 1 815 ? 7.137   37.143  -26.731 1.00 55.99  ? 1463 HIS A O     1 
ATOM   5908  C  CB    . HIS A 1 815 ? 9.948   37.968  -25.620 1.00 53.09  ? 1463 HIS A CB    1 
ATOM   5909  C  CG    . HIS A 1 815 ? 9.709   38.813  -24.415 1.00 57.12  ? 1463 HIS A CG    1 
ATOM   5910  N  ND1   . HIS A 1 815 ? 9.224   40.101  -24.489 1.00 57.08  ? 1463 HIS A ND1   1 
ATOM   5911  C  CD2   . HIS A 1 815 ? 9.839   38.534  -23.096 1.00 56.07  ? 1463 HIS A CD2   1 
ATOM   5912  C  CE1   . HIS A 1 815 ? 9.093   40.587  -23.269 1.00 59.49  ? 1463 HIS A CE1   1 
ATOM   5913  N  NE2   . HIS A 1 815 ? 9.458   39.656  -22.404 1.00 56.79  ? 1463 HIS A NE2   1 
ATOM   5914  N  N     . ASP A 1 816 ? 7.021   36.842  -24.509 1.00 53.92  ? 1464 ASP A N     1 
ATOM   5915  C  CA    . ASP A 1 816 ? 5.586   37.046  -24.461 1.00 55.33  ? 1464 ASP A CA    1 
ATOM   5916  C  C     . ASP A 1 816 ? 5.280   38.486  -24.068 1.00 57.10  ? 1464 ASP A C     1 
ATOM   5917  O  O     . ASP A 1 816 ? 5.302   38.834  -22.888 1.00 56.80  ? 1464 ASP A O     1 
ATOM   5918  C  CB    . ASP A 1 816 ? 4.945   36.067  -23.475 1.00 53.90  ? 1464 ASP A CB    1 
ATOM   5919  C  CG    . ASP A 1 816 ? 3.450   35.937  -23.674 1.00 57.58  ? 1464 ASP A CG    1 
ATOM   5920  O  OD1   . ASP A 1 816 ? 2.798   36.959  -23.991 1.00 61.66  ? 1464 ASP A OD1   1 
ATOM   5921  O  OD2   . ASP A 1 816 ? 2.928   34.812  -23.522 1.00 54.57  ? 1464 ASP A OD2   1 
ATOM   5922  N  N     . VAL A 1 817 ? 4.987   39.319  -25.062 1.00 56.89  ? 1465 VAL A N     1 
ATOM   5923  C  CA    . VAL A 1 817 ? 4.752   40.744  -24.825 1.00 59.27  ? 1465 VAL A CA    1 
ATOM   5924  C  C     . VAL A 1 817 ? 3.724   41.027  -23.725 1.00 59.44  ? 1465 VAL A C     1 
ATOM   5925  O  O     . VAL A 1 817 ? 3.886   41.968  -22.949 1.00 60.69  ? 1465 VAL A O     1 
ATOM   5926  C  CB    . VAL A 1 817 ? 4.317   41.486  -26.105 1.00 60.36  ? 1465 VAL A CB    1 
ATOM   5927  C  CG1   . VAL A 1 817 ? 4.199   42.981  -25.824 1.00 62.76  ? 1465 VAL A CG1   1 
ATOM   5928  C  CG2   . VAL A 1 817 ? 5.297   41.224  -27.245 1.00 56.07  ? 1465 VAL A CG2   1 
ATOM   5929  N  N     . LYS A 1 818 ? 2.669   40.221  -23.658 1.00 55.82  ? 1466 LYS A N     1 
ATOM   5930  C  CA    . LYS A 1 818 ? 1.622   40.448  -22.671 1.00 52.24  ? 1466 LYS A CA    1 
ATOM   5931  C  C     . LYS A 1 818 ? 2.049   40.004  -21.280 1.00 53.00  ? 1466 LYS A C     1 
ATOM   5932  O  O     . LYS A 1 818 ? 1.701   40.630  -20.290 1.00 53.19  ? 1466 LYS A O     1 
ATOM   5933  C  CB    . LYS A 1 818 ? 0.328   39.747  -23.073 1.00 50.06  ? 1466 LYS A CB    1 
ATOM   5934  N  N     . ASN A 1 819 ? 2.810   38.921  -21.208 1.00 55.92  ? 1467 ASN A N     1 
ATOM   5935  C  CA    . ASN A 1 819 ? 3.083   38.284  -19.926 1.00 54.99  ? 1467 ASN A CA    1 
ATOM   5936  C  C     . ASN A 1 819 ? 4.450   38.623  -19.349 1.00 53.86  ? 1467 ASN A C     1 
ATOM   5937  O  O     . ASN A 1 819 ? 4.729   38.331  -18.191 1.00 52.13  ? 1467 ASN A O     1 
ATOM   5938  C  CB    . ASN A 1 819 ? 2.895   36.768  -20.031 1.00 54.02  ? 1467 ASN A CB    1 
ATOM   5939  C  CG    . ASN A 1 819 ? 1.446   36.375  -20.240 1.00 54.11  ? 1467 ASN A CG    1 
ATOM   5940  O  OD1   . ASN A 1 819 ? 0.610   37.199  -20.607 1.00 52.88  ? 1467 ASN A OD1   1 
ATOM   5941  N  ND2   . ASN A 1 819 ? 1.140   35.108  -20.001 1.00 56.79  ? 1467 ASN A ND2   1 
ATOM   5942  N  N     . GLY A 1 820 ? 5.300   39.235  -20.164 1.00 55.39  ? 1468 GLY A N     1 
ATOM   5943  C  CA    . GLY A 1 820 ? 6.574   39.744  -19.684 1.00 56.29  ? 1468 GLY A CA    1 
ATOM   5944  C  C     . GLY A 1 820 ? 7.649   38.711  -19.396 1.00 56.39  ? 1468 GLY A C     1 
ATOM   5945  O  O     . GLY A 1 820 ? 7.881   37.794  -20.185 1.00 58.52  ? 1468 GLY A O     1 
ATOM   5946  N  N     . TYR A 1 821 ? 8.321   38.869  -18.261 1.00 55.45  ? 1469 TYR A N     1 
ATOM   5947  C  CA    . TYR A 1 821 ? 9.445   38.009  -17.916 1.00 54.58  ? 1469 TYR A CA    1 
ATOM   5948  C  C     . TYR A 1 821 ? 9.219   37.238  -16.620 1.00 56.97  ? 1469 TYR A C     1 
ATOM   5949  O  O     . TYR A 1 821 ? 8.310   37.538  -15.840 1.00 55.49  ? 1469 TYR A O     1 
ATOM   5950  C  CB    . TYR A 1 821 ? 10.731  38.828  -17.790 1.00 52.38  ? 1469 TYR A CB    1 
ATOM   5951  C  CG    . TYR A 1 821 ? 11.239  39.393  -19.092 1.00 52.75  ? 1469 TYR A CG    1 
ATOM   5952  C  CD1   . TYR A 1 821 ? 12.024  38.630  -19.938 1.00 55.26  ? 1469 TYR A CD1   1 
ATOM   5953  C  CD2   . TYR A 1 821 ? 10.953  40.694  -19.468 1.00 55.64  ? 1469 TYR A CD2   1 
ATOM   5954  C  CE1   . TYR A 1 821 ? 12.499  39.141  -21.134 1.00 55.24  ? 1469 TYR A CE1   1 
ATOM   5955  C  CE2   . TYR A 1 821 ? 11.428  41.216  -20.661 1.00 56.20  ? 1469 TYR A CE2   1 
ATOM   5956  C  CZ    . TYR A 1 821 ? 12.200  40.434  -21.490 1.00 55.37  ? 1469 TYR A CZ    1 
ATOM   5957  O  OH    . TYR A 1 821 ? 12.675  40.939  -22.681 1.00 53.72  ? 1469 TYR A OH    1 
ATOM   5958  N  N     . SER A 1 822 ? 10.065  36.240  -16.400 1.00 55.26  ? 1470 SER A N     1 
ATOM   5959  C  CA    . SER A 1 822 ? 10.102  35.533  -15.136 1.00 56.04  ? 1470 SER A CA    1 
ATOM   5960  C  C     . SER A 1 822 ? 10.502  36.528  -14.052 1.00 55.54  ? 1470 SER A C     1 
ATOM   5961  O  O     . SER A 1 822 ? 10.757  37.694  -14.336 1.00 54.68  ? 1470 SER A O     1 
ATOM   5962  C  CB    . SER A 1 822 ? 11.122  34.391  -15.216 1.00 56.71  ? 1470 SER A CB    1 
ATOM   5963  O  OG    . SER A 1 822 ? 11.139  33.612  -14.030 1.00 59.27  ? 1470 SER A OG    1 
ATOM   5964  N  N     . SER A 1 823 ? 10.556  36.069  -12.809 1.00 54.71  ? 1471 SER A N     1 
ATOM   5965  C  CA    . SER A 1 823 ? 11.092  36.889  -11.736 1.00 56.65  ? 1471 SER A CA    1 
ATOM   5966  C  C     . SER A 1 823 ? 12.613  36.991  -11.873 1.00 56.56  ? 1471 SER A C     1 
ATOM   5967  O  O     . SER A 1 823 ? 13.266  37.748  -11.155 1.00 54.01  ? 1471 SER A O     1 
ATOM   5968  C  CB    . SER A 1 823 ? 10.724  36.283  -10.381 1.00 60.40  ? 1471 SER A CB    1 
ATOM   5969  O  OG    . SER A 1 823 ? 9.353   35.930  -10.343 1.00 59.87  ? 1471 SER A OG    1 
ATOM   5970  N  N     . THR A 1 824 ? 13.166  36.216  -12.803 1.00 57.05  ? 1472 THR A N     1 
ATOM   5971  C  CA    . THR A 1 824 ? 14.606  36.160  -13.029 1.00 54.08  ? 1472 THR A CA    1 
ATOM   5972  C  C     . THR A 1 824 ? 14.940  36.509  -14.476 1.00 52.62  ? 1472 THR A C     1 
ATOM   5973  O  O     . THR A 1 824 ? 16.050  36.266  -14.947 1.00 54.16  ? 1472 THR A O     1 
ATOM   5974  C  CB    . THR A 1 824 ? 15.183  34.758  -12.704 1.00 55.33  ? 1472 THR A CB    1 
ATOM   5975  O  OG1   . THR A 1 824 ? 14.632  33.788  -13.602 1.00 59.58  ? 1472 THR A OG1   1 
ATOM   5976  C  CG2   . THR A 1 824 ? 14.849  34.352  -11.284 1.00 51.61  ? 1472 THR A CG2   1 
ATOM   5977  N  N     . GLY A 1 825 ? 13.971  37.068  -15.187 1.00 51.96  ? 1473 GLY A N     1 
ATOM   5978  C  CA    . GLY A 1 825 ? 14.212  37.539  -16.538 1.00 57.21  ? 1473 GLY A CA    1 
ATOM   5979  C  C     . GLY A 1 825 ? 14.230  36.445  -17.585 1.00 55.82  ? 1473 GLY A C     1 
ATOM   5980  O  O     . GLY A 1 825 ? 14.942  36.541  -18.584 1.00 53.31  ? 1473 GLY A O     1 
ATOM   5981  N  N     . ALA A 1 826 ? 13.438  35.404  -17.352 1.00 55.46  ? 1474 ALA A N     1 
ATOM   5982  C  CA    . ALA A 1 826 ? 13.329  34.289  -18.286 1.00 54.95  ? 1474 ALA A CA    1 
ATOM   5983  C  C     . ALA A 1 826 ? 12.159  34.488  -19.248 1.00 52.05  ? 1474 ALA A C     1 
ATOM   5984  O  O     . ALA A 1 826 ? 11.157  35.101  -18.890 1.00 54.41  ? 1474 ALA A O     1 
ATOM   5985  C  CB    . ALA A 1 826 ? 13.173  32.981  -17.519 1.00 53.60  ? 1474 ALA A CB    1 
ATOM   5986  N  N     . LEU A 1 827 ? 12.288  33.971  -20.466 1.00 49.32  ? 1475 LEU A N     1 
ATOM   5987  C  CA    . LEU A 1 827 ? 11.211  34.048  -21.451 1.00 48.60  ? 1475 LEU A CA    1 
ATOM   5988  C  C     . LEU A 1 827 ? 10.023  33.171  -21.070 1.00 48.70  ? 1475 LEU A C     1 
ATOM   5989  O  O     . LEU A 1 827 ? 10.177  32.182  -20.355 1.00 46.85  ? 1475 LEU A O     1 
ATOM   5990  C  CB    . LEU A 1 827 ? 11.715  33.654  -22.837 1.00 46.89  ? 1475 LEU A CB    1 
ATOM   5991  C  CG    . LEU A 1 827 ? 12.389  34.760  -23.640 1.00 48.33  ? 1475 LEU A CG    1 
ATOM   5992  C  CD1   . LEU A 1 827 ? 13.591  35.299  -22.892 1.00 51.63  ? 1475 LEU A CD1   1 
ATOM   5993  C  CD2   . LEU A 1 827 ? 12.785  34.260  -25.014 1.00 45.53  ? 1475 LEU A CD2   1 
ATOM   5994  N  N     . ARG A 1 828 ? 8.840   33.534  -21.561 1.00 48.92  ? 1476 ARG A N     1 
ATOM   5995  C  CA    . ARG A 1 828 ? 7.612   32.835  -21.194 1.00 47.96  ? 1476 ARG A CA    1 
ATOM   5996  C  C     . ARG A 1 828 ? 6.739   32.477  -22.387 1.00 47.81  ? 1476 ARG A C     1 
ATOM   5997  O  O     . ARG A 1 828 ? 5.600   32.034  -22.216 1.00 47.25  ? 1476 ARG A O     1 
ATOM   5998  C  CB    . ARG A 1 828 ? 6.795   33.669  -20.211 1.00 49.11  ? 1476 ARG A CB    1 
ATOM   5999  C  CG    . ARG A 1 828 ? 7.350   33.717  -18.803 1.00 49.98  ? 1476 ARG A CG    1 
ATOM   6000  C  CD    . ARG A 1 828 ? 6.518   34.647  -17.956 1.00 52.54  ? 1476 ARG A CD    1 
ATOM   6001  N  NE    . ARG A 1 828 ? 6.850   34.570  -16.539 1.00 55.96  ? 1476 ARG A NE    1 
ATOM   6002  C  CZ    . ARG A 1 828 ? 6.206   35.249  -15.595 1.00 55.94  ? 1476 ARG A CZ    1 
ATOM   6003  N  NH1   . ARG A 1 828 ? 5.201   36.044  -15.931 1.00 53.14  ? 1476 ARG A NH1   1 
ATOM   6004  N  NH2   . ARG A 1 828 ? 6.556   35.132  -14.322 1.00 57.32  ? 1476 ARG A NH2   1 
ATOM   6005  N  N     . GLY A 1 829 ? 7.279   32.667  -23.588 1.00 48.13  ? 1477 GLY A N     1 
ATOM   6006  C  CA    . GLY A 1 829 ? 6.554   32.394  -24.816 1.00 48.34  ? 1477 GLY A CA    1 
ATOM   6007  C  C     . GLY A 1 829 ? 7.128   31.200  -25.545 1.00 50.22  ? 1477 GLY A C     1 
ATOM   6008  O  O     . GLY A 1 829 ? 8.343   31.016  -25.584 1.00 50.48  ? 1477 GLY A O     1 
ATOM   6009  N  N     . VAL A 1 830 ? 6.254   30.385  -26.129 1.00 52.27  ? 1478 VAL A N     1 
ATOM   6010  C  CA    . VAL A 1 830 ? 6.685   29.140  -26.762 1.00 49.35  ? 1478 VAL A CA    1 
ATOM   6011  C  C     . VAL A 1 830 ? 6.462   29.130  -28.272 1.00 50.38  ? 1478 VAL A C     1 
ATOM   6012  O  O     . VAL A 1 830 ? 6.752   28.133  -28.935 1.00 51.18  ? 1478 VAL A O     1 
ATOM   6013  C  CB    . VAL A 1 830 ? 5.994   27.914  -26.132 1.00 48.10  ? 1478 VAL A CB    1 
ATOM   6014  C  CG1   . VAL A 1 830 ? 6.345   27.808  -24.661 1.00 47.87  ? 1478 VAL A CG1   1 
ATOM   6015  C  CG2   . VAL A 1 830 ? 4.494   28.001  -26.309 1.00 49.12  ? 1478 VAL A CG2   1 
ATOM   6016  N  N     . CYS A 1 831 ? 5.954   30.241  -28.807 1.00 50.08  ? 1479 CYS A N     1 
ATOM   6017  C  CA    . CYS A 1 831 ? 5.759   30.389  -30.249 1.00 51.55  ? 1479 CYS A CA    1 
ATOM   6018  C  C     . CYS A 1 831 ? 6.018   31.814  -30.729 1.00 52.02  ? 1479 CYS A C     1 
ATOM   6019  O  O     . CYS A 1 831 ? 6.000   32.758  -29.950 1.00 53.26  ? 1479 CYS A O     1 
ATOM   6020  C  CB    . CYS A 1 831 ? 4.343   29.959  -30.655 1.00 53.97  ? 1479 CYS A CB    1 
ATOM   6021  S  SG    . CYS A 1 831 ? 4.061   29.800  -32.454 1.00 62.16  ? 1479 CYS A SG    1 
ATOM   6022  N  N     . SER A 1 832 ? 6.251   31.955  -32.028 1.00 54.08  ? 1480 SER A N     1 
ATOM   6023  C  CA    . SER A 1 832 ? 6.441   33.257  -32.646 1.00 54.32  ? 1480 SER A CA    1 
ATOM   6024  C  C     . SER A 1 832 ? 5.218   34.147  -32.415 1.00 57.51  ? 1480 SER A C     1 
ATOM   6025  O  O     . SER A 1 832 ? 5.296   35.374  -32.500 1.00 61.10  ? 1480 SER A O     1 
ATOM   6026  C  CB    . SER A 1 832 ? 6.701   33.097  -34.143 1.00 55.92  ? 1480 SER A CB    1 
ATOM   6027  N  N     . CYS A 1 833 ? 4.087   33.524  -32.112 1.00 56.98  ? 1481 CYS A N     1 
ATOM   6028  C  CA    . CYS A 1 833 ? 2.844   34.259  -31.924 1.00 58.82  ? 1481 CYS A CA    1 
ATOM   6029  C  C     . CYS A 1 833 ? 2.779   34.941  -30.557 1.00 59.02  ? 1481 CYS A C     1 
ATOM   6030  O  O     . CYS A 1 833 ? 1.880   35.747  -30.302 1.00 58.01  ? 1481 CYS A O     1 
ATOM   6031  C  CB    . CYS A 1 833 ? 1.643   33.331  -32.107 1.00 56.71  ? 1481 CYS A CB    1 
ATOM   6032  S  SG    . CYS A 1 833 ? 1.453   32.119  -30.799 1.00 48.90  ? 1481 CYS A SG    1 
ATOM   6033  N  N     . ALA A 1 834 ? 3.722   34.611  -29.679 1.00 57.09  ? 1482 ALA A N     1 
ATOM   6034  C  CA    . ALA A 1 834 ? 3.790   35.241  -28.365 1.00 57.00  ? 1482 ALA A CA    1 
ATOM   6035  C  C     . ALA A 1 834 ? 4.483   36.591  -28.480 1.00 56.98  ? 1482 ALA A C     1 
ATOM   6036  O  O     . ALA A 1 834 ? 4.387   37.430  -27.582 1.00 57.09  ? 1482 ALA A O     1 
ATOM   6037  C  CB    . ALA A 1 834 ? 4.525   34.352  -27.385 1.00 55.05  ? 1482 ALA A CB    1 
ATOM   6038  N  N     . GLU A 1 835 ? 5.188   36.779  -29.591 1.00 55.03  ? 1483 GLU A N     1 
ATOM   6039  C  CA    . GLU A 1 835 ? 5.888   38.021  -29.869 1.00 55.11  ? 1483 GLU A CA    1 
ATOM   6040  C  C     . GLU A 1 835 ? 5.045   38.865  -30.812 1.00 59.40  ? 1483 GLU A C     1 
ATOM   6041  O  O     . GLU A 1 835 ? 5.503   39.875  -31.347 1.00 62.04  ? 1483 GLU A O     1 
ATOM   6042  C  CB    . GLU A 1 835 ? 7.258   37.735  -30.491 1.00 56.43  ? 1483 GLU A CB    1 
ATOM   6043  C  CG    . GLU A 1 835 ? 8.244   37.053  -29.542 1.00 58.38  ? 1483 GLU A CG    1 
ATOM   6044  C  CD    . GLU A 1 835 ? 9.674   37.007  -30.081 1.00 62.07  ? 1483 GLU A CD    1 
ATOM   6045  O  OE1   . GLU A 1 835 ? 9.898   37.421  -31.244 1.00 64.21  ? 1483 GLU A OE1   1 
ATOM   6046  O  OE2   . GLU A 1 835 ? 10.574  36.556  -29.333 1.00 57.64  ? 1483 GLU A OE2   1 
ATOM   6047  N  N     . GLY A 1 836 ? 3.803   38.445  -31.013 1.00 57.74  ? 1484 GLY A N     1 
ATOM   6048  C  CA    . GLY A 1 836 ? 2.906   39.160  -31.898 1.00 58.56  ? 1484 GLY A CA    1 
ATOM   6049  C  C     . GLY A 1 836 ? 3.034   38.713  -33.339 1.00 59.72  ? 1484 GLY A C     1 
ATOM   6050  O  O     . GLY A 1 836 ? 2.152   38.972  -34.154 1.00 63.28  ? 1484 GLY A O     1 
ATOM   6051  N  N     . LYS A 1 837 ? 4.132   38.039  -33.658 1.00 58.56  ? 1485 LYS A N     1 
ATOM   6052  C  CA    . LYS A 1 837 ? 4.352   37.554  -35.014 1.00 59.45  ? 1485 LYS A CA    1 
ATOM   6053  C  C     . LYS A 1 837 ? 3.512   36.313  -35.326 1.00 61.16  ? 1485 LYS A C     1 
ATOM   6054  O  O     . LYS A 1 837 ? 2.750   35.829  -34.483 1.00 57.25  ? 1485 LYS A O     1 
ATOM   6055  C  CB    . LYS A 1 837 ? 5.842   37.295  -35.255 1.00 59.05  ? 1485 LYS A CB    1 
ATOM   6056  C  CG    . LYS A 1 837 ? 6.671   38.571  -35.288 1.00 63.52  ? 1485 LYS A CG    1 
ATOM   6057  C  CD    . LYS A 1 837 ? 8.131   38.311  -34.955 1.00 66.88  ? 1485 LYS A CD    1 
ATOM   6058  C  CE    . LYS A 1 837 ? 8.876   39.623  -34.719 1.00 66.46  ? 1485 LYS A CE    1 
ATOM   6059  N  NZ    . LYS A 1 837 ? 10.284  39.408  -34.262 1.00 68.03  ? 1485 LYS A NZ    1 
ATOM   6060  N  N     . ALA A 1 838 ? 3.649   35.811  -36.549 1.00 62.00  ? 1486 ALA A N     1 
ATOM   6061  C  CA    . ALA A 1 838 ? 2.854   34.679  -37.005 1.00 62.63  ? 1486 ALA A CA    1 
ATOM   6062  C  C     . ALA A 1 838 ? 3.385   33.349  -36.480 1.00 64.95  ? 1486 ALA A C     1 
ATOM   6063  O  O     . ALA A 1 838 ? 4.599   33.146  -36.359 1.00 63.50  ? 1486 ALA A O     1 
ATOM   6064  C  CB    . ALA A 1 838 ? 2.791   34.660  -38.520 1.00 66.64  ? 1486 ALA A CB    1 
ATOM   6065  N  N     . CYS A 1 839 ? 2.455   32.449  -36.174 1.00 66.28  ? 1487 CYS A N     1 
ATOM   6066  C  CA    . CYS A 1 839 ? 2.780   31.107  -35.707 1.00 63.04  ? 1487 CYS A CA    1 
ATOM   6067  C  C     . CYS A 1 839 ? 3.764   30.422  -36.633 1.00 63.62  ? 1487 CYS A C     1 
ATOM   6068  O  O     . CYS A 1 839 ? 3.556   30.371  -37.842 1.00 63.62  ? 1487 CYS A O     1 
ATOM   6069  C  CB    . CYS A 1 839 ? 1.515   30.252  -35.623 1.00 61.91  ? 1487 CYS A CB    1 
ATOM   6070  S  SG    . CYS A 1 839 ? 0.738   30.186  -34.001 1.00 58.76  ? 1487 CYS A SG    1 
ATOM   6071  N  N     . ASP A 1 840 ? 4.838   29.897  -36.058 1.00 65.03  ? 1488 ASP A N     1 
ATOM   6072  C  CA    . ASP A 1 840 ? 5.746   29.034  -36.794 1.00 66.12  ? 1488 ASP A CA    1 
ATOM   6073  C  C     . ASP A 1 840 ? 5.420   27.584  -36.423 1.00 66.24  ? 1488 ASP A C     1 
ATOM   6074  O  O     . ASP A 1 840 ? 5.476   27.213  -35.252 1.00 66.61  ? 1488 ASP A O     1 
ATOM   6075  C  CB    . ASP A 1 840 ? 7.195   29.376  -36.454 1.00 67.90  ? 1488 ASP A CB    1 
ATOM   6076  C  CG    . ASP A 1 840 ? 8.182   28.738  -37.409 1.00 71.33  ? 1488 ASP A CG    1 
ATOM   6077  O  OD1   . ASP A 1 840 ? 9.268   29.329  -37.619 1.00 69.04  ? 1488 ASP A OD1   1 
ATOM   6078  O  OD2   . ASP A 1 840 ? 7.865   27.651  -37.949 1.00 70.15  ? 1488 ASP A OD2   1 
ATOM   6079  N  N     . PRO A 1 841 ? 5.053   26.763  -37.417 1.00 64.86  ? 1489 PRO A N     1 
ATOM   6080  C  CA    . PRO A 1 841 ? 4.598   25.400  -37.122 1.00 64.83  ? 1489 PRO A CA    1 
ATOM   6081  C  C     . PRO A 1 841 ? 5.723   24.529  -36.582 1.00 66.73  ? 1489 PRO A C     1 
ATOM   6082  O  O     . PRO A 1 841 ? 5.460   23.594  -35.826 1.00 63.65  ? 1489 PRO A O     1 
ATOM   6083  C  CB    . PRO A 1 841 ? 4.137   24.878  -38.486 1.00 62.83  ? 1489 PRO A CB    1 
ATOM   6084  C  CG    . PRO A 1 841 ? 3.920   26.102  -39.315 1.00 67.26  ? 1489 PRO A CG    1 
ATOM   6085  C  CD    . PRO A 1 841 ? 4.951   27.077  -38.849 1.00 65.47  ? 1489 PRO A CD    1 
ATOM   6086  N  N     . GLU A 1 842 ? 6.959   24.835  -36.963 1.00 67.88  ? 1490 GLU A N     1 
ATOM   6087  C  CA    . GLU A 1 842 ? 8.110   24.081  -36.479 1.00 66.67  ? 1490 GLU A CA    1 
ATOM   6088  C  C     . GLU A 1 842 ? 8.363   24.345  -34.998 1.00 64.39  ? 1490 GLU A C     1 
ATOM   6089  O  O     . GLU A 1 842 ? 9.137   23.633  -34.359 1.00 63.63  ? 1490 GLU A O     1 
ATOM   6090  C  CB    . GLU A 1 842 ? 9.365   24.404  -37.297 1.00 68.21  ? 1490 GLU A CB    1 
ATOM   6091  C  CG    . GLU A 1 842 ? 9.309   23.936  -38.750 1.00 73.46  ? 1490 GLU A CG    1 
ATOM   6092  C  CD    . GLU A 1 842 ? 8.878   22.479  -38.891 1.00 74.91  ? 1490 GLU A CD    1 
ATOM   6093  O  OE1   . GLU A 1 842 ? 7.652   22.218  -38.923 1.00 72.93  ? 1490 GLU A OE1   1 
ATOM   6094  O  OE2   . GLU A 1 842 ? 9.762   21.595  -38.979 1.00 73.36  ? 1490 GLU A OE2   1 
ATOM   6095  N  N     . SER A 1 843 ? 7.702   25.368  -34.460 1.00 62.96  ? 1491 SER A N     1 
ATOM   6096  C  CA    . SER A 1 843 ? 7.887   25.770  -33.065 1.00 60.74  ? 1491 SER A CA    1 
ATOM   6097  C  C     . SER A 1 843 ? 7.195   24.839  -32.074 1.00 61.06  ? 1491 SER A C     1 
ATOM   6098  O  O     . SER A 1 843 ? 7.427   24.929  -30.863 1.00 58.64  ? 1491 SER A O     1 
ATOM   6099  C  CB    . SER A 1 843 ? 7.384   27.196  -32.842 1.00 57.71  ? 1491 SER A CB    1 
ATOM   6100  O  OG    . SER A 1 843 ? 8.264   28.140  -33.412 1.00 61.56  ? 1491 SER A OG    1 
ATOM   6101  N  N     . ARG A 1 844 ? 6.338   23.959  -32.582 1.00 59.14  ? 1492 ARG A N     1 
ATOM   6102  C  CA    . ARG A 1 844 ? 5.585   23.061  -31.724 1.00 54.61  ? 1492 ARG A CA    1 
ATOM   6103  C  C     . ARG A 1 844 ? 6.538   22.082  -31.039 1.00 55.93  ? 1492 ARG A C     1 
ATOM   6104  O  O     . ARG A 1 844 ? 7.552   21.692  -31.622 1.00 56.21  ? 1492 ARG A O     1 
ATOM   6105  C  CB    . ARG A 1 844 ? 4.506   22.330  -32.530 1.00 55.38  ? 1492 ARG A CB    1 
ATOM   6106  C  CG    . ARG A 1 844 ? 3.698   21.344  -31.706 1.00 61.36  ? 1492 ARG A CG    1 
ATOM   6107  C  CD    . ARG A 1 844 ? 2.386   20.919  -32.364 1.00 68.40  ? 1492 ARG A CD    1 
ATOM   6108  N  NE    . ARG A 1 844 ? 1.682   19.955  -31.512 1.00 78.42  ? 1492 ARG A NE    1 
ATOM   6109  C  CZ    . ARG A 1 844 ? 0.528   19.361  -31.812 1.00 86.32  ? 1492 ARG A CZ    1 
ATOM   6110  N  NH1   . ARG A 1 844 ? -0.088  19.623  -32.958 1.00 86.99  ? 1492 ARG A NH1   1 
ATOM   6111  N  NH2   . ARG A 1 844 ? -0.013  18.498  -30.956 1.00 87.42  ? 1492 ARG A NH2   1 
ATOM   6112  N  N     . GLN A 1 845 ? 6.221   21.711  -29.798 1.00 53.66  ? 1493 GLN A N     1 
ATOM   6113  C  CA    . GLN A 1 845 ? 7.035   20.767  -29.025 1.00 51.72  ? 1493 GLN A CA    1 
ATOM   6114  C  C     . GLN A 1 845 ? 6.226   19.541  -28.582 1.00 53.44  ? 1493 GLN A C     1 
ATOM   6115  O  O     . GLN A 1 845 ? 5.067   19.668  -28.179 1.00 53.56  ? 1493 GLN A O     1 
ATOM   6116  C  CB    . GLN A 1 845 ? 7.658   21.463  -27.810 1.00 46.70  ? 1493 GLN A CB    1 
ATOM   6117  C  CG    . GLN A 1 845 ? 8.881   22.307  -28.135 1.00 48.00  ? 1493 GLN A CG    1 
ATOM   6118  C  CD    . GLN A 1 845 ? 9.237   23.289  -27.034 1.00 49.66  ? 1493 GLN A CD    1 
ATOM   6119  O  OE1   . GLN A 1 845 ? 9.677   22.903  -25.950 1.00 49.03  ? 1493 GLN A OE1   1 
ATOM   6120  N  NE2   . GLN A 1 845 ? 9.047   24.573  -27.311 1.00 50.58  ? 1493 GLN A NE2   1 
ATOM   6121  N  N     . PHE A 1 846 ? 6.840   18.360  -28.653 1.00 51.68  ? 1494 PHE A N     1 
ATOM   6122  C  CA    . PHE A 1 846 ? 6.131   17.119  -28.331 1.00 52.10  ? 1494 PHE A CA    1 
ATOM   6123  C  C     . PHE A 1 846 ? 6.647   16.408  -27.080 1.00 48.75  ? 1494 PHE A C     1 
ATOM   6124  O  O     . PHE A 1 846 ? 7.766   16.651  -26.631 1.00 47.56  ? 1494 PHE A O     1 
ATOM   6125  C  CB    . PHE A 1 846 ? 6.157   16.156  -29.523 1.00 52.65  ? 1494 PHE A CB    1 
ATOM   6126  C  CG    . PHE A 1 846 ? 5.737   16.785  -30.816 1.00 56.16  ? 1494 PHE A CG    1 
ATOM   6127  C  CD1   . PHE A 1 846 ? 6.657   16.997  -31.824 1.00 57.50  ? 1494 PHE A CD1   1 
ATOM   6128  C  CD2   . PHE A 1 846 ? 4.425   17.176  -31.021 1.00 62.75  ? 1494 PHE A CD2   1 
ATOM   6129  C  CE1   . PHE A 1 846 ? 6.278   17.580  -33.015 1.00 59.93  ? 1494 PHE A CE1   1 
ATOM   6130  C  CE2   . PHE A 1 846 ? 4.040   17.764  -32.211 1.00 65.85  ? 1494 PHE A CE2   1 
ATOM   6131  C  CZ    . PHE A 1 846 ? 4.968   17.967  -33.209 1.00 64.25  ? 1494 PHE A CZ    1 
ATOM   6132  N  N     . SER A 1 847 ? 5.817   15.520  -26.539 1.00 47.02  ? 1495 SER A N     1 
ATOM   6133  C  CA    . SER A 1 847 ? 6.168   14.724  -25.367 1.00 47.52  ? 1495 SER A CA    1 
ATOM   6134  C  C     . SER A 1 847 ? 6.892   15.559  -24.320 1.00 49.58  ? 1495 SER A C     1 
ATOM   6135  O  O     . SER A 1 847 ? 8.044   15.295  -23.975 1.00 53.78  ? 1495 SER A O     1 
ATOM   6136  C  CB    . SER A 1 847 ? 7.009   13.506  -25.761 1.00 47.52  ? 1495 SER A CB    1 
ATOM   6137  N  N     . THR A 1 848 ? 6.204   16.576  -23.821 1.00 48.75  ? 1496 THR A N     1 
ATOM   6138  C  CA    . THR A 1 848 ? 6.762   17.450  -22.800 1.00 49.71  ? 1496 THR A CA    1 
ATOM   6139  C  C     . THR A 1 848 ? 5.853   17.420  -21.583 1.00 45.51  ? 1496 THR A C     1 
ATOM   6140  O  O     . THR A 1 848 ? 4.639   17.365  -21.724 1.00 46.19  ? 1496 THR A O     1 
ATOM   6141  C  CB    . THR A 1 848 ? 6.897   18.891  -23.314 1.00 47.37  ? 1496 THR A CB    1 
ATOM   6142  O  OG1   . THR A 1 848 ? 7.108   19.761  -22.204 1.00 49.13  ? 1496 THR A OG1   1 
ATOM   6143  C  CG2   . THR A 1 848 ? 5.634   19.323  -24.055 1.00 46.12  ? 1496 THR A CG2   1 
ATOM   6144  N  N     . LEU A 1 849 ? 6.427   17.439  -20.388 1.00 45.27  ? 1497 LEU A N     1 
ATOM   6145  C  CA    . LEU A 1 849 ? 5.612   17.290  -19.190 1.00 45.09  ? 1497 LEU A CA    1 
ATOM   6146  C  C     . LEU A 1 849 ? 4.539   18.374  -19.135 1.00 45.50  ? 1497 LEU A C     1 
ATOM   6147  O  O     . LEU A 1 849 ? 3.364   18.086  -18.903 1.00 44.65  ? 1497 LEU A O     1 
ATOM   6148  C  CB    . LEU A 1 849 ? 6.470   17.306  -17.929 1.00 42.89  ? 1497 LEU A CB    1 
ATOM   6149  C  CG    . LEU A 1 849 ? 5.801   16.603  -16.754 1.00 39.87  ? 1497 LEU A CG    1 
ATOM   6150  C  CD1   . LEU A 1 849 ? 5.718   15.120  -17.019 1.00 42.45  ? 1497 LEU A CD1   1 
ATOM   6151  C  CD2   . LEU A 1 849 ? 6.543   16.871  -15.469 1.00 45.35  ? 1497 LEU A CD2   1 
ATOM   6152  N  N     . ILE A 1 850 ? 4.950   19.619  -19.356 1.00 43.73  ? 1498 ILE A N     1 
ATOM   6153  C  CA    . ILE A 1 850 ? 4.002   20.713  -19.518 1.00 44.02  ? 1498 ILE A CA    1 
ATOM   6154  C  C     . ILE A 1 850 ? 3.545   20.726  -20.978 1.00 44.57  ? 1498 ILE A C     1 
ATOM   6155  O  O     . ILE A 1 850 ? 4.357   20.908  -21.881 1.00 45.35  ? 1498 ILE A O     1 
ATOM   6156  C  CB    . ILE A 1 850 ? 4.636   22.071  -19.131 1.00 42.82  ? 1498 ILE A CB    1 
ATOM   6157  C  CG1   . ILE A 1 850 ? 4.920   22.119  -17.630 1.00 43.72  ? 1498 ILE A CG1   1 
ATOM   6158  C  CG2   . ILE A 1 850 ? 3.728   23.220  -19.504 1.00 41.57  ? 1498 ILE A CG2   1 
ATOM   6159  C  CD1   . ILE A 1 850 ? 5.663   23.354  -17.190 1.00 43.20  ? 1498 ILE A CD1   1 
ATOM   6160  N  N     . PRO A 1 851 ? 2.247   20.499  -21.223 1.00 42.80  ? 1499 PRO A N     1 
ATOM   6161  C  CA    . PRO A 1 851 ? 1.789   20.439  -22.614 1.00 44.70  ? 1499 PRO A CA    1 
ATOM   6162  C  C     . PRO A 1 851 ? 2.053   21.740  -23.368 1.00 46.11  ? 1499 PRO A C     1 
ATOM   6163  O  O     . PRO A 1 851 ? 1.409   22.746  -23.080 1.00 46.31  ? 1499 PRO A O     1 
ATOM   6164  C  CB    . PRO A 1 851 ? 0.282   20.209  -22.475 1.00 44.05  ? 1499 PRO A CB    1 
ATOM   6165  C  CG    . PRO A 1 851 ? 0.114   19.589  -21.152 1.00 43.33  ? 1499 PRO A CG    1 
ATOM   6166  C  CD    . PRO A 1 851 ? 1.165   20.197  -20.275 1.00 43.04  ? 1499 PRO A CD    1 
ATOM   6167  N  N     . TRP A 1 852 ? 2.978   21.710  -24.324 1.00 46.10  ? 1500 TRP A N     1 
ATOM   6168  C  CA    . TRP A 1 852 ? 3.324   22.893  -25.114 1.00 44.96  ? 1500 TRP A CA    1 
ATOM   6169  C  C     . TRP A 1 852 ? 2.105   23.704  -25.541 1.00 47.57  ? 1500 TRP A C     1 
ATOM   6170  O  O     . TRP A 1 852 ? 2.128   24.932  -25.507 1.00 49.95  ? 1500 TRP A O     1 
ATOM   6171  C  CB    . TRP A 1 852 ? 4.134   22.498  -26.350 1.00 46.60  ? 1500 TRP A CB    1 
ATOM   6172  C  CG    . TRP A 1 852 ? 4.411   23.634  -27.282 1.00 47.85  ? 1500 TRP A CG    1 
ATOM   6173  C  CD1   . TRP A 1 852 ? 5.499   24.459  -27.270 1.00 49.77  ? 1500 TRP A CD1   1 
ATOM   6174  C  CD2   . TRP A 1 852 ? 3.588   24.074  -28.368 1.00 50.26  ? 1500 TRP A CD2   1 
ATOM   6175  N  NE1   . TRP A 1 852 ? 5.403   25.391  -28.280 1.00 49.34  ? 1500 TRP A NE1   1 
ATOM   6176  C  CE2   . TRP A 1 852 ? 4.237   25.175  -28.969 1.00 51.09  ? 1500 TRP A CE2   1 
ATOM   6177  C  CE3   . TRP A 1 852 ? 2.362   23.650  -28.891 1.00 50.71  ? 1500 TRP A CE3   1 
ATOM   6178  C  CZ2   . TRP A 1 852 ? 3.703   25.849  -30.067 1.00 50.21  ? 1500 TRP A CZ2   1 
ATOM   6179  C  CZ3   . TRP A 1 852 ? 1.830   24.326  -29.981 1.00 47.98  ? 1500 TRP A CZ3   1 
ATOM   6180  C  CH2   . TRP A 1 852 ? 2.501   25.409  -30.555 1.00 49.37  ? 1500 TRP A CH2   1 
ATOM   6181  N  N     . CYS A 1 853 ? 1.036   23.027  -25.940 1.00 47.13  ? 1501 CYS A N     1 
ATOM   6182  C  CA    . CYS A 1 853 ? -0.133  23.729  -26.452 1.00 45.56  ? 1501 CYS A CA    1 
ATOM   6183  C  C     . CYS A 1 853 ? -0.808  24.633  -25.419 1.00 45.14  ? 1501 CYS A C     1 
ATOM   6184  O  O     . CYS A 1 853 ? -1.395  25.641  -25.780 1.00 48.66  ? 1501 CYS A O     1 
ATOM   6185  C  CB    . CYS A 1 853 ? -1.136  22.740  -27.033 1.00 45.47  ? 1501 CYS A CB    1 
ATOM   6186  S  SG    . CYS A 1 853 ? -1.673  21.515  -25.847 1.00 58.78  ? 1501 CYS A SG    1 
ATOM   6187  N  N     . LEU A 1 854 ? -0.723  24.288  -24.141 1.00 43.23  ? 1502 LEU A N     1 
ATOM   6188  C  CA    . LEU A 1 854 ? -1.395  25.075  -23.109 1.00 44.38  ? 1502 LEU A CA    1 
ATOM   6189  C  C     . LEU A 1 854 ? -0.880  26.515  -22.969 1.00 47.37  ? 1502 LEU A C     1 
ATOM   6190  O  O     . LEU A 1 854 ? -1.646  27.465  -23.113 1.00 48.64  ? 1502 LEU A O     1 
ATOM   6191  C  CB    . LEU A 1 854 ? -1.355  24.357  -21.763 1.00 45.14  ? 1502 LEU A CB    1 
ATOM   6192  C  CG    . LEU A 1 854 ? -2.265  23.134  -21.713 1.00 48.54  ? 1502 LEU A CG    1 
ATOM   6193  C  CD1   . LEU A 1 854 ? -2.199  22.442  -20.356 1.00 46.14  ? 1502 LEU A CD1   1 
ATOM   6194  C  CD2   . LEU A 1 854 ? -3.682  23.559  -22.044 1.00 48.84  ? 1502 LEU A CD2   1 
ATOM   6195  N  N     . PRO A 1 855 ? 0.417   26.690  -22.682 1.00 46.24  ? 1503 PRO A N     1 
ATOM   6196  C  CA    . PRO A 1 855 ? 0.897   28.064  -22.579 1.00 46.43  ? 1503 PRO A CA    1 
ATOM   6197  C  C     . PRO A 1 855 ? 0.767   28.730  -23.931 1.00 47.93  ? 1503 PRO A C     1 
ATOM   6198  O  O     . PRO A 1 855 ? 0.752   29.955  -24.017 1.00 50.84  ? 1503 PRO A O     1 
ATOM   6199  C  CB    . PRO A 1 855 ? 2.379   27.897  -22.239 1.00 46.64  ? 1503 PRO A CB    1 
ATOM   6200  C  CG    . PRO A 1 855 ? 2.543   26.487  -21.832 1.00 47.55  ? 1503 PRO A CG    1 
ATOM   6201  C  CD    . PRO A 1 855 ? 1.516   25.723  -22.582 1.00 47.32  ? 1503 PRO A CD    1 
ATOM   6202  N  N     . HIS A 1 856 ? 0.663   27.919  -24.977 1.00 46.16  ? 1504 HIS A N     1 
ATOM   6203  C  CA    . HIS A 1 856 ? 0.620   28.422  -26.344 1.00 47.34  ? 1504 HIS A CA    1 
ATOM   6204  C  C     . HIS A 1 856 ? -0.642  29.215  -26.663 1.00 47.60  ? 1504 HIS A C     1 
ATOM   6205  O  O     . HIS A 1 856 ? -0.614  30.114  -27.502 1.00 49.91  ? 1504 HIS A O     1 
ATOM   6206  C  CB    . HIS A 1 856 ? 0.770   27.275  -27.338 1.00 47.03  ? 1504 HIS A CB    1 
ATOM   6207  C  CG    . HIS A 1 856 ? 0.695   27.706  -28.768 1.00 48.50  ? 1504 HIS A CG    1 
ATOM   6208  N  ND1   . HIS A 1 856 ? -0.185  27.150  -29.669 1.00 49.49  ? 1504 HIS A ND1   1 
ATOM   6209  C  CD2   . HIS A 1 856 ? 1.392   28.647  -29.451 1.00 49.21  ? 1504 HIS A CD2   1 
ATOM   6210  C  CE1   . HIS A 1 856 ? -0.027  27.728  -30.849 1.00 51.27  ? 1504 HIS A CE1   1 
ATOM   6211  N  NE2   . HIS A 1 856 ? 0.927   28.635  -30.743 1.00 50.61  ? 1504 HIS A NE2   1 
ATOM   6212  N  N     . THR A 1 857 ? -1.744  28.877  -26.001 1.00 46.44  ? 1505 THR A N     1 
ATOM   6213  C  CA    . THR A 1 857 ? -3.018  29.555  -26.232 1.00 48.00  ? 1505 THR A CA    1 
ATOM   6214  C  C     . THR A 1 857 ? -3.620  30.111  -24.941 1.00 49.41  ? 1505 THR A C     1 
ATOM   6215  O  O     . THR A 1 857 ? -4.658  30.777  -24.964 1.00 47.98  ? 1505 THR A O     1 
ATOM   6216  C  CB    . THR A 1 857 ? -4.050  28.607  -26.868 1.00 48.98  ? 1505 THR A CB    1 
ATOM   6217  O  OG1   . THR A 1 857 ? -4.188  27.432  -26.058 1.00 43.34  ? 1505 THR A OG1   1 
ATOM   6218  C  CG2   . THR A 1 857 ? -3.623  28.202  -28.269 1.00 51.00  ? 1505 THR A CG2   1 
ATOM   6219  N  N     . GLY A 1 858 ? -2.960  29.829  -23.821 1.00 48.80  ? 1506 GLY A N     1 
ATOM   6220  C  CA    . GLY A 1 858 ? -3.459  30.186  -22.506 1.00 49.48  ? 1506 GLY A CA    1 
ATOM   6221  C  C     . GLY A 1 858 ? -3.946  31.615  -22.368 1.00 49.18  ? 1506 GLY A C     1 
ATOM   6222  O  O     . GLY A 1 858 ? -4.941  31.878  -21.697 1.00 48.17  ? 1506 GLY A O     1 
ATOM   6223  N  N     . ASN A 1 859 ? -3.242  32.541  -23.004 1.00 49.27  ? 1507 ASN A N     1 
ATOM   6224  C  CA    . ASN A 1 859 ? -3.594  33.950  -22.920 1.00 50.28  ? 1507 ASN A CA    1 
ATOM   6225  C  C     . ASN A 1 859 ? -4.978  34.274  -23.475 1.00 49.77  ? 1507 ASN A C     1 
ATOM   6226  O  O     . ASN A 1 859 ? -5.734  35.035  -22.868 1.00 48.12  ? 1507 ASN A O     1 
ATOM   6227  C  CB    . ASN A 1 859 ? -2.523  34.797  -23.593 1.00 49.96  ? 1507 ASN A CB    1 
ATOM   6228  C  CG    . ASN A 1 859 ? -1.234  34.801  -22.817 1.00 52.95  ? 1507 ASN A CG    1 
ATOM   6229  O  OD1   . ASN A 1 859 ? -1.145  34.195  -21.752 1.00 53.07  ? 1507 ASN A OD1   1 
ATOM   6230  N  ND2   . ASN A 1 859 ? -0.223  35.480  -23.343 1.00 54.43  ? 1507 ASN A ND2   1 
ATOM   6231  N  N     . ARG A 1 860 ? -5.318  33.687  -24.616 1.00 47.10  ? 1508 ARG A N     1 
ATOM   6232  C  CA    . ARG A 1 860 ? -6.617  33.945  -25.218 1.00 48.35  ? 1508 ARG A CA    1 
ATOM   6233  C  C     . ARG A 1 860 ? -7.707  33.018  -24.693 1.00 50.42  ? 1508 ARG A C     1 
ATOM   6234  O  O     . ARG A 1 860 ? -8.831  33.045  -25.180 1.00 52.23  ? 1508 ARG A O     1 
ATOM   6235  C  CB    . ARG A 1 860 ? -6.542  33.880  -26.747 1.00 54.88  ? 1508 ARG A CB    1 
ATOM   6236  C  CG    . ARG A 1 860 ? -5.608  34.916  -27.366 1.00 60.71  ? 1508 ARG A CG    1 
ATOM   6237  C  CD    . ARG A 1 860 ? -5.909  35.148  -28.836 1.00 65.23  ? 1508 ARG A CD    1 
ATOM   6238  N  NE    . ARG A 1 860 ? -4.994  36.118  -29.435 1.00 77.76  ? 1508 ARG A NE    1 
ATOM   6239  C  CZ    . ARG A 1 860 ? -3.899  35.794  -30.123 1.00 89.05  ? 1508 ARG A CZ    1 
ATOM   6240  N  NH1   . ARG A 1 860 ? -3.575  34.515  -30.305 1.00 87.07  ? 1508 ARG A NH1   1 
ATOM   6241  N  NH2   . ARG A 1 860 ? -3.126  36.749  -30.634 1.00 89.82  ? 1508 ARG A NH2   1 
ATOM   6242  N  N     . HIS A 1 861 ? -7.380  32.209  -23.691 1.00 50.48  ? 1509 HIS A N     1 
ATOM   6243  C  CA    . HIS A 1 861 ? -8.353  31.274  -23.136 1.00 50.30  ? 1509 HIS A CA    1 
ATOM   6244  C  C     . HIS A 1 861 ? -8.265  31.149  -21.620 1.00 51.82  ? 1509 HIS A C     1 
ATOM   6245  O  O     . HIS A 1 861 ? -8.482  30.066  -21.074 1.00 52.34  ? 1509 HIS A O     1 
ATOM   6246  C  CB    . HIS A 1 861 ? -8.183  29.886  -23.747 1.00 50.51  ? 1509 HIS A CB    1 
ATOM   6247  C  CG    . HIS A 1 861 ? -8.244  29.863  -25.241 1.00 52.84  ? 1509 HIS A CG    1 
ATOM   6248  N  ND1   . HIS A 1 861 ? -9.379  29.502  -25.933 1.00 54.85  ? 1509 HIS A ND1   1 
ATOM   6249  C  CD2   . HIS A 1 861 ? -7.300  30.129  -26.176 1.00 51.39  ? 1509 HIS A CD2   1 
ATOM   6250  C  CE1   . HIS A 1 861 ? -9.136  29.556  -27.231 1.00 60.00  ? 1509 HIS A CE1   1 
ATOM   6251  N  NE2   . HIS A 1 861 ? -7.882  29.933  -27.405 1.00 56.89  ? 1509 HIS A NE2   1 
ATOM   6252  N  N     . ASN A 1 862 ? -7.935  32.239  -20.938 1.00 50.25  ? 1510 ASN A N     1 
ATOM   6253  C  CA    . ASN A 1 862 ? -8.050  32.263  -19.485 1.00 54.33  ? 1510 ASN A CA    1 
ATOM   6254  C  C     . ASN A 1 862 ? -7.048  31.340  -18.773 1.00 54.13  ? 1510 ASN A C     1 
ATOM   6255  O  O     . ASN A 1 862 ? -7.259  30.937  -17.629 1.00 53.59  ? 1510 ASN A O     1 
ATOM   6256  C  CB    . ASN A 1 862 ? -9.496  31.914  -19.097 1.00 59.36  ? 1510 ASN A CB    1 
ATOM   6257  C  CG    . ASN A 1 862 ? -9.704  31.812  -17.592 1.00 64.25  ? 1510 ASN A CG    1 
ATOM   6258  O  OD1   . ASN A 1 862 ? -9.210  32.640  -16.824 1.00 66.81  ? 1510 ASN A OD1   1 
ATOM   6259  N  ND2   . ASN A 1 862 ? -10.441 30.788  -17.165 1.00 59.77  ? 1510 ASN A ND2   1 
ATOM   6260  N  N     . HIS A 1 863 ? -5.957  31.006  -19.453 1.00 53.01  ? 1511 HIS A N     1 
ATOM   6261  C  CA    . HIS A 1 863 ? -4.912  30.182  -18.853 1.00 51.26  ? 1511 HIS A CA    1 
ATOM   6262  C  C     . HIS A 1 863 ? -5.426  28.790  -18.511 1.00 51.73  ? 1511 HIS A C     1 
ATOM   6263  O  O     . HIS A 1 863 ? -4.941  28.153  -17.577 1.00 51.05  ? 1511 HIS A O     1 
ATOM   6264  C  CB    . HIS A 1 863 ? -4.383  30.847  -17.585 1.00 53.25  ? 1511 HIS A CB    1 
ATOM   6265  C  CG    . HIS A 1 863 ? -3.835  32.219  -17.809 1.00 54.63  ? 1511 HIS A CG    1 
ATOM   6266  N  ND1   . HIS A 1 863 ? -3.219  32.591  -18.984 1.00 54.24  ? 1511 HIS A ND1   1 
ATOM   6267  C  CD2   . HIS A 1 863 ? -3.810  33.311  -17.008 1.00 55.77  ? 1511 HIS A CD2   1 
ATOM   6268  C  CE1   . HIS A 1 863 ? -2.833  33.852  -18.896 1.00 56.54  ? 1511 HIS A CE1   1 
ATOM   6269  N  NE2   . HIS A 1 863 ? -3.182  34.312  -17.707 1.00 57.24  ? 1511 HIS A NE2   1 
ATOM   6270  N  N     . TRP A 1 864 ? -6.419  28.334  -19.267 1.00 51.72  ? 1512 TRP A N     1 
ATOM   6271  C  CA    . TRP A 1 864 ? -6.997  27.001  -19.090 1.00 48.24  ? 1512 TRP A CA    1 
ATOM   6272  C  C     . TRP A 1 864 ? -7.081  26.571  -17.628 1.00 45.68  ? 1512 TRP A C     1 
ATOM   6273  O  O     . TRP A 1 864 ? -6.673  25.473  -17.269 1.00 44.44  ? 1512 TRP A O     1 
ATOM   6274  C  CB    . TRP A 1 864 ? -6.223  25.958  -19.902 1.00 47.35  ? 1512 TRP A CB    1 
ATOM   6275  C  CG    . TRP A 1 864 ? -6.062  26.345  -21.327 1.00 46.39  ? 1512 TRP A CG    1 
ATOM   6276  C  CD1   . TRP A 1 864 ? -4.962  26.894  -21.903 1.00 47.32  ? 1512 TRP A CD1   1 
ATOM   6277  C  CD2   . TRP A 1 864 ? -7.044  26.237  -22.357 1.00 48.99  ? 1512 TRP A CD2   1 
ATOM   6278  N  NE1   . TRP A 1 864 ? -5.190  27.130  -23.232 1.00 46.30  ? 1512 TRP A NE1   1 
ATOM   6279  C  CE2   . TRP A 1 864 ? -6.465  26.736  -23.538 1.00 47.82  ? 1512 TRP A CE2   1 
ATOM   6280  C  CE3   . TRP A 1 864 ? -8.360  25.764  -22.400 1.00 48.97  ? 1512 TRP A CE3   1 
ATOM   6281  C  CZ2   . TRP A 1 864 ? -7.150  26.774  -24.747 1.00 48.47  ? 1512 TRP A CZ2   1 
ATOM   6282  C  CZ3   . TRP A 1 864 ? -9.041  25.804  -23.604 1.00 50.93  ? 1512 TRP A CZ3   1 
ATOM   6283  C  CH2   . TRP A 1 864 ? -8.434  26.307  -24.761 1.00 49.06  ? 1512 TRP A CH2   1 
ATOM   6284  N  N     . ALA A 1 865 ? -7.610  27.451  -16.789 1.00 48.84  ? 1513 ALA A N     1 
ATOM   6285  C  CA    . ALA A 1 865 ? -7.857  27.110  -15.398 1.00 47.06  ? 1513 ALA A CA    1 
ATOM   6286  C  C     . ALA A 1 865 ? -8.625  25.802  -15.357 1.00 46.91  ? 1513 ALA A C     1 
ATOM   6287  O  O     . ALA A 1 865 ? -9.607  25.626  -16.080 1.00 46.09  ? 1513 ALA A O     1 
ATOM   6288  C  CB    . ALA A 1 865 ? -8.650  28.211  -14.708 1.00 46.84  ? 1513 ALA A CB    1 
ATOM   6289  N  N     . GLY A 1 866 ? -8.163  24.874  -14.528 1.00 43.89  ? 1514 GLY A N     1 
ATOM   6290  C  CA    . GLY A 1 866 ? -8.896  23.645  -14.304 1.00 42.68  ? 1514 GLY A CA    1 
ATOM   6291  C  C     . GLY A 1 866 ? -8.293  22.423  -14.964 1.00 45.16  ? 1514 GLY A C     1 
ATOM   6292  O  O     . GLY A 1 866 ? -8.330  21.338  -14.392 1.00 46.40  ? 1514 GLY A O     1 
ATOM   6293  N  N     . LEU A 1 867 ? -7.746  22.587  -16.165 1.00 44.78  ? 1515 LEU A N     1 
ATOM   6294  C  CA    . LEU A 1 867 ? -7.123  21.470  -16.867 1.00 43.07  ? 1515 LEU A CA    1 
ATOM   6295  C  C     . LEU A 1 867 ? -6.070  20.802  -15.991 1.00 42.25  ? 1515 LEU A C     1 
ATOM   6296  O  O     . LEU A 1 867 ? -5.357  21.468  -15.244 1.00 42.20  ? 1515 LEU A O     1 
ATOM   6297  C  CB    . LEU A 1 867 ? -6.527  21.919  -18.202 1.00 43.85  ? 1515 LEU A CB    1 
ATOM   6298  C  CG    . LEU A 1 867 ? -7.509  22.082  -19.365 1.00 42.56  ? 1515 LEU A CG    1 
ATOM   6299  C  CD1   . LEU A 1 867 ? -8.539  23.157  -19.084 1.00 43.61  ? 1515 LEU A CD1   1 
ATOM   6300  C  CD2   . LEU A 1 867 ? -6.767  22.386  -20.640 1.00 43.64  ? 1515 LEU A CD2   1 
ATOM   6301  N  N     . TYR A 1 868 ? -5.995  19.478  -16.088 1.00 44.88  ? 1516 TYR A N     1 
ATOM   6302  C  CA    . TYR A 1 868 ? -5.185  18.653  -15.189 1.00 43.04  ? 1516 TYR A CA    1 
ATOM   6303  C  C     . TYR A 1 868 ? -5.412  18.999  -13.725 1.00 41.88  ? 1516 TYR A C     1 
ATOM   6304  O  O     . TYR A 1 868 ? -4.555  18.755  -12.880 1.00 41.73  ? 1516 TYR A O     1 
ATOM   6305  C  CB    . TYR A 1 868 ? -3.698  18.702  -15.558 1.00 39.73  ? 1516 TYR A CB    1 
ATOM   6306  C  CG    . TYR A 1 868 ? -3.370  17.845  -16.760 1.00 41.47  ? 1516 TYR A CG    1 
ATOM   6307  C  CD1   . TYR A 1 868 ? -2.913  16.548  -16.607 1.00 41.30  ? 1516 TYR A CD1   1 
ATOM   6308  C  CD2   . TYR A 1 868 ? -3.542  18.326  -18.052 1.00 45.32  ? 1516 TYR A CD2   1 
ATOM   6309  C  CE1   . TYR A 1 868 ? -2.623  15.758  -17.706 1.00 43.89  ? 1516 TYR A CE1   1 
ATOM   6310  C  CE2   . TYR A 1 868 ? -3.256  17.543  -19.153 1.00 43.42  ? 1516 TYR A CE2   1 
ATOM   6311  C  CZ    . TYR A 1 868 ? -2.797  16.262  -18.974 1.00 44.63  ? 1516 TYR A CZ    1 
ATOM   6312  O  OH    . TYR A 1 868 ? -2.511  15.479  -20.066 1.00 48.17  ? 1516 TYR A OH    1 
ATOM   6313  N  N     . GLY A 1 869 ? -6.589  19.542  -13.432 1.00 41.91  ? 1517 GLY A N     1 
ATOM   6314  C  CA    . GLY A 1 869 ? -6.916  19.981  -12.092 1.00 41.78  ? 1517 GLY A CA    1 
ATOM   6315  C  C     . GLY A 1 869 ? -7.477  18.871  -11.236 1.00 43.66  ? 1517 GLY A C     1 
ATOM   6316  O  O     . GLY A 1 869 ? -8.064  17.916  -11.741 1.00 44.51  ? 1517 GLY A O     1 
ATOM   6317  N  N     . ARG A 1 870 ? -7.299  18.998  -9.928  1.00 42.37  ? 1518 ARG A N     1 
ATOM   6318  C  CA    . ARG A 1 870 ? -7.856  18.033  -8.998  1.00 42.73  ? 1518 ARG A CA    1 
ATOM   6319  C  C     . ARG A 1 870 ? -9.080  18.590  -8.289  1.00 42.66  ? 1518 ARG A C     1 
ATOM   6320  O  O     . ARG A 1 870 ? -9.155  19.783  -8.002  1.00 42.35  ? 1518 ARG A O     1 
ATOM   6321  C  CB    . ARG A 1 870 ? -6.819  17.641  -7.951  1.00 45.30  ? 1518 ARG A CB    1 
ATOM   6322  C  CG    . ARG A 1 870 ? -5.533  17.076  -8.504  1.00 44.43  ? 1518 ARG A CG    1 
ATOM   6323  C  CD    . ARG A 1 870 ? -4.664  16.592  -7.370  1.00 43.34  ? 1518 ARG A CD    1 
ATOM   6324  N  NE    . ARG A 1 870 ? -4.583  15.141  -7.344  1.00 45.20  ? 1518 ARG A NE    1 
ATOM   6325  C  CZ    . ARG A 1 870 ? -3.534  14.451  -7.778  1.00 47.52  ? 1518 ARG A CZ    1 
ATOM   6326  N  NH1   . ARG A 1 870 ? -2.480  15.087  -8.261  1.00 45.51  ? 1518 ARG A NH1   1 
ATOM   6327  N  NH2   . ARG A 1 870 ? -3.533  13.125  -7.719  1.00 46.24  ? 1518 ARG A NH2   1 
ATOM   6328  N  N     . LEU A 1 871 ? -10.036 17.715  -8.007  1.00 43.76  ? 1519 LEU A N     1 
ATOM   6329  C  CA    . LEU A 1 871 ? -11.165 18.071  -7.170  1.00 43.75  ? 1519 LEU A CA    1 
ATOM   6330  C  C     . LEU A 1 871 ? -10.633 18.172  -5.757  1.00 43.86  ? 1519 LEU A C     1 
ATOM   6331  O  O     . LEU A 1 871 ? -9.562  17.645  -5.456  1.00 42.25  ? 1519 LEU A O     1 
ATOM   6332  C  CB    . LEU A 1 871 ? -12.245 16.994  -7.224  1.00 41.00  ? 1519 LEU A CB    1 
ATOM   6333  C  CG    . LEU A 1 871 ? -12.668 16.378  -8.556  1.00 37.20  ? 1519 LEU A CG    1 
ATOM   6334  C  CD1   . LEU A 1 871 ? -13.780 15.399  -8.302  1.00 38.92  ? 1519 LEU A CD1   1 
ATOM   6335  C  CD2   . LEU A 1 871 ? -13.129 17.419  -9.533  1.00 42.03  ? 1519 LEU A CD2   1 
ATOM   6336  N  N     . GLU A 1 872 ? -11.372 18.852  -4.890  1.00 44.03  ? 1520 GLU A N     1 
ATOM   6337  C  CA    . GLU A 1 872 ? -10.958 18.954  -3.500  1.00 48.26  ? 1520 GLU A CA    1 
ATOM   6338  C  C     . GLU A 1 872 ? -12.015 18.398  -2.565  1.00 47.93  ? 1520 GLU A C     1 
ATOM   6339  O  O     . GLU A 1 872 ? -13.210 18.497  -2.833  1.00 46.75  ? 1520 GLU A O     1 
ATOM   6340  C  CB    . GLU A 1 872 ? -10.602 20.394  -3.127  1.00 51.99  ? 1520 GLU A CB    1 
ATOM   6341  C  CG    . GLU A 1 872 ? -11.561 21.447  -3.648  1.00 57.24  ? 1520 GLU A CG    1 
ATOM   6342  C  CD    . GLU A 1 872 ? -11.371 22.792  -2.953  1.00 69.19  ? 1520 GLU A CD    1 
ATOM   6343  O  OE1   . GLU A 1 872 ? -11.408 23.843  -3.643  1.00 70.50  ? 1520 GLU A OE1   1 
ATOM   6344  O  OE2   . GLU A 1 872 ? -11.187 22.786  -1.710  1.00 67.21  ? 1520 GLU A OE2   1 
ATOM   6345  N  N     . TRP A 1 873 ? -11.563 17.816  -1.462  1.00 45.25  ? 1521 TRP A N     1 
ATOM   6346  C  CA    . TRP A 1 873 ? -12.461 17.119  -0.556  1.00 47.30  ? 1521 TRP A CA    1 
ATOM   6347  C  C     . TRP A 1 873 ? -13.634 17.971  -0.082  1.00 49.63  ? 1521 TRP A C     1 
ATOM   6348  O  O     . TRP A 1 873 ? -14.705 17.438  0.219   1.00 51.34  ? 1521 TRP A O     1 
ATOM   6349  C  CB    . TRP A 1 873 ? -11.695 16.552  0.641   1.00 46.62  ? 1521 TRP A CB    1 
ATOM   6350  C  CG    . TRP A 1 873 ? -10.796 15.429  0.274   1.00 44.89  ? 1521 TRP A CG    1 
ATOM   6351  C  CD1   . TRP A 1 873 ? -9.438  15.405  0.354   1.00 47.17  ? 1521 TRP A CD1   1 
ATOM   6352  C  CD2   . TRP A 1 873 ? -11.189 14.165  -0.256  1.00 43.83  ? 1521 TRP A CD2   1 
ATOM   6353  N  NE1   . TRP A 1 873 ? -8.958  14.195  -0.085  1.00 43.44  ? 1521 TRP A NE1   1 
ATOM   6354  C  CE2   . TRP A 1 873 ? -10.016 13.417  -0.466  1.00 42.99  ? 1521 TRP A CE2   1 
ATOM   6355  C  CE3   . TRP A 1 873 ? -12.422 13.590  -0.573  1.00 44.02  ? 1521 TRP A CE3   1 
ATOM   6356  C  CZ2   . TRP A 1 873 ? -10.041 12.125  -0.971  1.00 44.97  ? 1521 TRP A CZ2   1 
ATOM   6357  C  CZ3   . TRP A 1 873 ? -12.444 12.303  -1.074  1.00 42.08  ? 1521 TRP A CZ3   1 
ATOM   6358  C  CH2   . TRP A 1 873 ? -11.263 11.586  -1.269  1.00 43.41  ? 1521 TRP A CH2   1 
ATOM   6359  N  N     . ASP A 1 874 ? -13.441 19.284  -0.019  1.00 48.08  ? 1522 ASP A N     1 
ATOM   6360  C  CA    . ASP A 1 874 ? -14.468 20.157  0.535   1.00 49.91  ? 1522 ASP A CA    1 
ATOM   6361  C  C     . ASP A 1 874 ? -15.259 20.893  -0.542  1.00 55.01  ? 1522 ASP A C     1 
ATOM   6362  O  O     . ASP A 1 874 ? -16.177 21.662  -0.238  1.00 56.45  ? 1522 ASP A O     1 
ATOM   6363  C  CB    . ASP A 1 874 ? -13.847 21.162  1.504   1.00 51.18  ? 1522 ASP A CB    1 
ATOM   6364  C  CG    . ASP A 1 874 ? -13.279 20.505  2.746   1.00 52.14  ? 1522 ASP A CG    1 
ATOM   6365  O  OD1   . ASP A 1 874 ? -13.692 19.370  3.067   1.00 54.14  ? 1522 ASP A OD1   1 
ATOM   6366  O  OD2   . ASP A 1 874 ? -12.421 21.130  3.406   1.00 51.77  ? 1522 ASP A OD2   1 
ATOM   6367  N  N     . GLY A 1 875 ? -14.902 20.656  -1.800  1.00 52.61  ? 1523 GLY A N     1 
ATOM   6368  C  CA    . GLY A 1 875 ? -15.507 21.379  -2.901  1.00 54.21  ? 1523 GLY A CA    1 
ATOM   6369  C  C     . GLY A 1 875 ? -16.608 20.592  -3.569  1.00 49.22  ? 1523 GLY A C     1 
ATOM   6370  O  O     . GLY A 1 875 ? -17.375 19.902  -2.911  1.00 48.61  ? 1523 GLY A O     1 
ATOM   6371  N  N     . PHE A 1 876 ? -16.687 20.697  -4.886  1.00 48.47  ? 1524 PHE A N     1 
ATOM   6372  C  CA    . PHE A 1 876 ? -17.693 19.963  -5.628  1.00 46.26  ? 1524 PHE A CA    1 
ATOM   6373  C  C     . PHE A 1 876 ? -17.245 19.705  -7.062  1.00 47.18  ? 1524 PHE A C     1 
ATOM   6374  O  O     . PHE A 1 876 ? -16.355 20.382  -7.577  1.00 49.81  ? 1524 PHE A O     1 
ATOM   6375  C  CB    . PHE A 1 876 ? -19.023 20.722  -5.611  1.00 47.31  ? 1524 PHE A CB    1 
ATOM   6376  C  CG    . PHE A 1 876 ? -18.909 22.153  -6.043  1.00 50.75  ? 1524 PHE A CG    1 
ATOM   6377  C  CD1   . PHE A 1 876 ? -18.980 23.178  -5.117  1.00 56.58  ? 1524 PHE A CD1   1 
ATOM   6378  C  CD2   . PHE A 1 876 ? -18.720 22.477  -7.374  1.00 50.69  ? 1524 PHE A CD2   1 
ATOM   6379  C  CE1   . PHE A 1 876 ? -18.870 24.496  -5.509  1.00 54.54  ? 1524 PHE A CE1   1 
ATOM   6380  C  CE2   . PHE A 1 876 ? -18.606 23.791  -7.767  1.00 51.87  ? 1524 PHE A CE2   1 
ATOM   6381  C  CZ    . PHE A 1 876 ? -18.684 24.799  -6.832  1.00 52.73  ? 1524 PHE A CZ    1 
ATOM   6382  N  N     . PHE A 1 877 ? -17.859 18.711  -7.696  1.00 43.78  ? 1525 PHE A N     1 
ATOM   6383  C  CA    . PHE A 1 877 ? -17.624 18.440  -9.104  1.00 42.63  ? 1525 PHE A CA    1 
ATOM   6384  C  C     . PHE A 1 877 ? -18.121 19.599  -9.933  1.00 44.65  ? 1525 PHE A C     1 
ATOM   6385  O  O     . PHE A 1 877 ? -19.235 20.078  -9.726  1.00 46.39  ? 1525 PHE A O     1 
ATOM   6386  C  CB    . PHE A 1 877 ? -18.415 17.210  -9.545  1.00 43.34  ? 1525 PHE A CB    1 
ATOM   6387  C  CG    . PHE A 1 877 ? -17.803 15.912  -9.143  1.00 40.14  ? 1525 PHE A CG    1 
ATOM   6388  C  CD1   . PHE A 1 877 ? -17.193 15.114  -10.084 1.00 38.78  ? 1525 PHE A CD1   1 
ATOM   6389  C  CD2   . PHE A 1 877 ? -17.847 15.486  -7.828  1.00 38.70  ? 1525 PHE A CD2   1 
ATOM   6390  C  CE1   . PHE A 1 877 ? -16.631 13.923  -9.722  1.00 41.25  ? 1525 PHE A CE1   1 
ATOM   6391  C  CE2   . PHE A 1 877 ? -17.286 14.294  -7.455  1.00 38.43  ? 1525 PHE A CE2   1 
ATOM   6392  C  CZ    . PHE A 1 877 ? -16.673 13.509  -8.401  1.00 41.61  ? 1525 PHE A CZ    1 
ATOM   6393  N  N     . SER A 1 878 ? -17.311 20.044  -10.882 1.00 45.01  ? 1526 SER A N     1 
ATOM   6394  C  CA    . SER A 1 878 ? -17.831 20.873  -11.952 1.00 47.65  ? 1526 SER A CA    1 
ATOM   6395  C  C     . SER A 1 878 ? -18.708 19.934  -12.753 1.00 47.57  ? 1526 SER A C     1 
ATOM   6396  O  O     . SER A 1 878 ? -18.518 18.721  -12.672 1.00 49.92  ? 1526 SER A O     1 
ATOM   6397  C  CB    . SER A 1 878 ? -16.687 21.374  -12.803 1.00 52.08  ? 1526 SER A CB    1 
ATOM   6398  O  OG    . SER A 1 878 ? -15.592 21.676  -11.968 1.00 55.36  ? 1526 SER A OG    1 
ATOM   6399  N  N     . THR A 1 879 ? -19.663 20.464  -13.513 1.00 44.69  ? 1527 THR A N     1 
ATOM   6400  C  CA    . THR A 1 879 ? -20.633 19.607  -14.197 1.00 44.04  ? 1527 THR A CA    1 
ATOM   6401  C  C     . THR A 1 879 ? -20.051 18.258  -14.620 1.00 43.93  ? 1527 THR A C     1 
ATOM   6402  O  O     . THR A 1 879 ? -19.102 18.212  -15.398 1.00 46.00  ? 1527 THR A O     1 
ATOM   6403  C  CB    . THR A 1 879 ? -21.209 20.274  -15.440 1.00 44.03  ? 1527 THR A CB    1 
ATOM   6404  O  OG1   . THR A 1 879 ? -21.860 21.493  -15.075 1.00 45.26  ? 1527 THR A OG1   1 
ATOM   6405  C  CG2   . THR A 1 879 ? -22.213 19.346  -16.096 1.00 44.98  ? 1527 THR A CG2   1 
ATOM   6406  N  N     . THR A 1 880 ? -20.617 17.169  -14.098 1.00 43.75  ? 1528 THR A N     1 
ATOM   6407  C  CA    . THR A 1 880 ? -20.174 15.821  -14.462 1.00 43.86  ? 1528 THR A CA    1 
ATOM   6408  C  C     . THR A 1 880 ? -20.129 15.705  -15.973 1.00 44.51  ? 1528 THR A C     1 
ATOM   6409  O  O     . THR A 1 880 ? -21.042 16.153  -16.673 1.00 44.79  ? 1528 THR A O     1 
ATOM   6410  C  CB    . THR A 1 880 ? -21.089 14.714  -13.901 1.00 40.23  ? 1528 THR A CB    1 
ATOM   6411  O  OG1   . THR A 1 880 ? -21.013 14.706  -12.475 1.00 41.60  ? 1528 THR A OG1   1 
ATOM   6412  C  CG2   . THR A 1 880 ? -20.650 13.354  -14.411 1.00 38.52  ? 1528 THR A CG2   1 
ATOM   6413  N  N     . VAL A 1 881 ? -19.059 15.109  -16.470 1.00 40.20  ? 1529 VAL A N     1 
ATOM   6414  C  CA    . VAL A 1 881 ? -18.815 15.127  -17.886 1.00 42.77  ? 1529 VAL A CA    1 
ATOM   6415  C  C     . VAL A 1 881 ? -19.045 13.723  -18.420 1.00 44.37  ? 1529 VAL A C     1 
ATOM   6416  O  O     . VAL A 1 881 ? -19.109 12.772  -17.643 1.00 41.22  ? 1529 VAL A O     1 
ATOM   6417  C  CB    . VAL A 1 881 ? -17.394 15.635  -18.179 1.00 43.89  ? 1529 VAL A CB    1 
ATOM   6418  C  CG1   . VAL A 1 881 ? -16.358 14.657  -17.639 1.00 43.36  ? 1529 VAL A CG1   1 
ATOM   6419  C  CG2   . VAL A 1 881 ? -17.203 15.862  -19.676 1.00 45.85  ? 1529 VAL A CG2   1 
ATOM   6420  N  N     . THR A 1 882 ? -19.179 13.605  -19.739 1.00 42.02  ? 1530 THR A N     1 
ATOM   6421  C  CA    . THR A 1 882 ? -19.468 12.335  -20.386 1.00 39.87  ? 1530 THR A CA    1 
ATOM   6422  C  C     . THR A 1 882 ? -18.211 11.528  -20.714 1.00 43.03  ? 1530 THR A C     1 
ATOM   6423  O  O     . THR A 1 882 ? -18.289 10.333  -21.013 1.00 43.04  ? 1530 THR A O     1 
ATOM   6424  C  CB    . THR A 1 882 ? -20.223 12.574  -21.675 1.00 43.46  ? 1530 THR A CB    1 
ATOM   6425  O  OG1   . THR A 1 882 ? -19.649 13.707  -22.337 1.00 48.14  ? 1530 THR A OG1   1 
ATOM   6426  C  CG2   . THR A 1 882 ? -21.687 12.852  -21.387 1.00 40.13  ? 1530 THR A CG2   1 
ATOM   6427  N  N     . ASN A 1 883 ? -17.058 12.190  -20.683 1.00 43.54  ? 1531 ASN A N     1 
ATOM   6428  C  CA    . ASN A 1 883 ? -15.773 11.531  -20.905 1.00 41.16  ? 1531 ASN A CA    1 
ATOM   6429  C  C     . ASN A 1 883 ? -14.633 12.337  -20.294 1.00 44.76  ? 1531 ASN A C     1 
ATOM   6430  O  O     . ASN A 1 883 ? -14.272 13.397  -20.802 1.00 49.67  ? 1531 ASN A O     1 
ATOM   6431  C  CB    . ASN A 1 883 ? -15.524 11.326  -22.396 1.00 43.79  ? 1531 ASN A CB    1 
ATOM   6432  C  CG    . ASN A 1 883 ? -14.275 10.511  -22.672 1.00 47.59  ? 1531 ASN A CG    1 
ATOM   6433  O  OD1   . ASN A 1 883 ? -13.595 10.062  -21.747 1.00 47.28  ? 1531 ASN A OD1   1 
ATOM   6434  N  ND2   . ASN A 1 883 ? -13.978 10.297  -23.949 1.00 48.42  ? 1531 ASN A ND2   1 
ATOM   6435  N  N     . PRO A 1 884 ? -14.059 11.837  -19.196 1.00 44.56  ? 1532 PRO A N     1 
ATOM   6436  C  CA    . PRO A 1 884 ? -13.068 12.582  -18.408 1.00 43.78  ? 1532 PRO A CA    1 
ATOM   6437  C  C     . PRO A 1 884 ? -11.723 12.791  -19.103 1.00 45.54  ? 1532 PRO A C     1 
ATOM   6438  O  O     . PRO A 1 884 ? -10.912 11.877  -19.161 1.00 46.86  ? 1532 PRO A O     1 
ATOM   6439  C  CB    . PRO A 1 884 ? -12.876 11.702  -17.170 1.00 41.05  ? 1532 PRO A CB    1 
ATOM   6440  C  CG    . PRO A 1 884 ? -14.095 10.821  -17.128 1.00 41.71  ? 1532 PRO A CG    1 
ATOM   6441  C  CD    . PRO A 1 884 ? -14.437 10.569  -18.554 1.00 42.99  ? 1532 PRO A CD    1 
ATOM   6442  N  N     . GLU A 1 885 ? -11.484 13.995  -19.605 1.00 48.50  ? 1533 GLU A N     1 
ATOM   6443  C  CA    . GLU A 1 885 ? -10.187 14.334  -20.181 1.00 49.29  ? 1533 GLU A CA    1 
ATOM   6444  C  C     . GLU A 1 885 ? -9.531  15.454  -19.399 1.00 47.32  ? 1533 GLU A C     1 
ATOM   6445  O  O     . GLU A 1 885 ? -10.104 16.524  -19.257 1.00 49.92  ? 1533 GLU A O     1 
ATOM   6446  C  CB    . GLU A 1 885 ? -10.328 14.739  -21.648 1.00 51.97  ? 1533 GLU A CB    1 
ATOM   6447  C  CG    . GLU A 1 885 ? -10.129 13.592  -22.618 1.00 57.90  ? 1533 GLU A CG    1 
ATOM   6448  C  CD    . GLU A 1 885 ? -8.763  12.938  -22.468 1.00 62.97  ? 1533 GLU A CD    1 
ATOM   6449  O  OE1   . GLU A 1 885 ? -8.719  11.700  -22.265 1.00 60.74  ? 1533 GLU A OE1   1 
ATOM   6450  O  OE2   . GLU A 1 885 ? -7.739  13.660  -22.555 1.00 63.03  ? 1533 GLU A OE2   1 
ATOM   6451  N  N     . PRO A 1 886 ? -8.324  15.206  -18.885 1.00 46.15  ? 1534 PRO A N     1 
ATOM   6452  C  CA    . PRO A 1 886 ? -7.595  16.233  -18.143 1.00 44.27  ? 1534 PRO A CA    1 
ATOM   6453  C  C     . PRO A 1 886 ? -7.418  17.485  -18.984 1.00 45.83  ? 1534 PRO A C     1 
ATOM   6454  O  O     . PRO A 1 886 ? -7.138  18.551  -18.443 1.00 44.55  ? 1534 PRO A O     1 
ATOM   6455  C  CB    . PRO A 1 886 ? -6.235  15.581  -17.901 1.00 42.41  ? 1534 PRO A CB    1 
ATOM   6456  C  CG    . PRO A 1 886 ? -6.517  14.132  -17.904 1.00 42.92  ? 1534 PRO A CG    1 
ATOM   6457  C  CD    . PRO A 1 886 ? -7.599  13.927  -18.914 1.00 46.09  ? 1534 PRO A CD    1 
ATOM   6458  N  N     . MET A 1 887 ? -7.583  17.358  -20.296 1.00 47.06  ? 1535 MET A N     1 
ATOM   6459  C  CA    . MET A 1 887 ? -7.320  18.478  -21.186 1.00 47.73  ? 1535 MET A CA    1 
ATOM   6460  C  C     . MET A 1 887 ? -8.518  18.844  -22.053 1.00 49.85  ? 1535 MET A C     1 
ATOM   6461  O  O     . MET A 1 887 ? -8.380  19.542  -23.052 1.00 49.37  ? 1535 MET A O     1 
ATOM   6462  C  CB    . MET A 1 887 ? -6.098  18.193  -22.051 1.00 48.13  ? 1535 MET A CB    1 
ATOM   6463  C  CG    . MET A 1 887 ? -5.292  19.430  -22.360 1.00 49.95  ? 1535 MET A CG    1 
ATOM   6464  S  SD    . MET A 1 887 ? -3.797  19.068  -23.283 1.00 60.12  ? 1535 MET A SD    1 
ATOM   6465  C  CE    . MET A 1 887 ? -3.040  17.825  -22.244 1.00 50.75  ? 1535 MET A CE    1 
ATOM   6466  N  N     . GLY A 1 888 ? -9.694  18.365  -21.664 1.00 52.00  ? 1536 GLY A N     1 
ATOM   6467  C  CA    . GLY A 1 888 ? -10.931 18.804  -22.280 1.00 52.61  ? 1536 GLY A CA    1 
ATOM   6468  C  C     . GLY A 1 888 ? -11.261 20.150  -21.678 1.00 55.51  ? 1536 GLY A C     1 
ATOM   6469  O  O     . GLY A 1 888 ? -10.492 20.654  -20.868 1.00 57.29  ? 1536 GLY A O     1 
ATOM   6470  N  N     . LYS A 1 889 ? -12.389 20.740  -22.054 1.00 57.67  ? 1537 LYS A N     1 
ATOM   6471  C  CA    . LYS A 1 889 ? -12.724 22.069  -21.549 1.00 57.20  ? 1537 LYS A CA    1 
ATOM   6472  C  C     . LYS A 1 889 ? -13.143 22.033  -20.085 1.00 58.90  ? 1537 LYS A C     1 
ATOM   6473  O  O     . LYS A 1 889 ? -12.655 22.827  -19.276 1.00 58.09  ? 1537 LYS A O     1 
ATOM   6474  C  CB    . LYS A 1 889 ? -13.785 22.741  -22.424 1.00 60.47  ? 1537 LYS A CB    1 
ATOM   6475  C  CG    . LYS A 1 889 ? -13.220 23.253  -23.746 1.00 63.26  ? 1537 LYS A CG    1 
ATOM   6476  C  CD    . LYS A 1 889 ? -14.309 23.680  -24.714 1.00 67.73  ? 1537 LYS A CD    1 
ATOM   6477  C  CE    . LYS A 1 889 ? -13.717 24.102  -26.053 1.00 65.22  ? 1537 LYS A CE    1 
ATOM   6478  N  NZ    . LYS A 1 889 ? -12.708 25.183  -25.888 1.00 58.81  ? 1537 LYS A NZ    1 
ATOM   6479  N  N     . GLN A 1 890 ? -14.029 21.101  -19.743 1.00 56.88  ? 1538 GLN A N     1 
ATOM   6480  C  CA    . GLN A 1 890 ? -14.461 20.935  -18.356 1.00 60.06  ? 1538 GLN A CA    1 
ATOM   6481  C  C     . GLN A 1 890 ? -13.491 20.030  -17.593 1.00 61.61  ? 1538 GLN A C     1 
ATOM   6482  O  O     . GLN A 1 890 ? -13.907 19.218  -16.764 1.00 59.32  ? 1538 GLN A O     1 
ATOM   6483  C  CB    . GLN A 1 890 ? -15.877 20.363  -18.300 1.00 58.19  ? 1538 GLN A CB    1 
ATOM   6484  N  N     . GLY A 1 891 ? -12.197 20.203  -17.858 1.00 57.95  ? 1539 GLY A N     1 
ATOM   6485  C  CA    . GLY A 1 891 ? -11.183 19.246  -17.451 1.00 51.49  ? 1539 GLY A CA    1 
ATOM   6486  C  C     . GLY A 1 891 ? -10.677 19.194  -16.015 1.00 50.74  ? 1539 GLY A C     1 
ATOM   6487  O  O     . GLY A 1 891 ? -9.549  18.746  -15.796 1.00 49.64  ? 1539 GLY A O     1 
ATOM   6488  N  N     . ARG A 1 892 ? -11.473 19.618  -15.032 1.00 50.31  ? 1540 ARG A N     1 
ATOM   6489  C  CA    . ARG A 1 892 ? -11.067 19.415  -13.635 1.00 47.73  ? 1540 ARG A CA    1 
ATOM   6490  C  C     . ARG A 1 892 ? -11.576 18.067  -13.109 1.00 45.61  ? 1540 ARG A C     1 
ATOM   6491  O  O     . ARG A 1 892 ? -12.641 17.987  -12.496 1.00 44.87  ? 1540 ARG A O     1 
ATOM   6492  C  CB    . ARG A 1 892 ? -11.508 20.570  -12.727 1.00 47.43  ? 1540 ARG A CB    1 
ATOM   6493  C  CG    . ARG A 1 892 ? -10.480 20.854  -11.626 1.00 51.84  ? 1540 ARG A CG    1 
ATOM   6494  C  CD    . ARG A 1 892 ? -10.930 21.875  -10.584 1.00 53.34  ? 1540 ARG A CD    1 
ATOM   6495  N  NE    . ARG A 1 892 ? -12.035 21.358  -9.789  1.00 58.37  ? 1540 ARG A NE    1 
ATOM   6496  C  CZ    . ARG A 1 892 ? -13.307 21.647  -10.031 1.00 61.84  ? 1540 ARG A CZ    1 
ATOM   6497  N  NH1   . ARG A 1 892 ? -13.602 22.463  -11.034 1.00 65.41  ? 1540 ARG A NH1   1 
ATOM   6498  N  NH2   . ARG A 1 892 ? -14.275 21.142  -9.274  1.00 56.17  ? 1540 ARG A NH2   1 
ATOM   6499  N  N     . VAL A 1 893 ? -10.800 17.011  -13.351 1.00 45.22  ? 1541 VAL A N     1 
ATOM   6500  C  CA    . VAL A 1 893 ? -11.297 15.643  -13.198 1.00 43.59  ? 1541 VAL A CA    1 
ATOM   6501  C  C     . VAL A 1 893 ? -10.341 14.648  -12.546 1.00 42.12  ? 1541 VAL A C     1 
ATOM   6502  O  O     . VAL A 1 893 ? -10.559 13.441  -12.632 1.00 39.79  ? 1541 VAL A O     1 
ATOM   6503  C  CB    . VAL A 1 893 ? -11.701 15.049  -14.562 1.00 41.58  ? 1541 VAL A CB    1 
ATOM   6504  C  CG1   . VAL A 1 893 ? -12.976 15.704  -15.070 1.00 43.19  ? 1541 VAL A CG1   1 
ATOM   6505  C  CG2   . VAL A 1 893 ? -10.565 15.204  -15.568 1.00 40.93  ? 1541 VAL A CG2   1 
ATOM   6506  N  N     . LEU A 1 894 ? -9.286  15.135  -11.904 1.00 41.91  ? 1542 LEU A N     1 
ATOM   6507  C  CA    . LEU A 1 894 ? -8.365  14.230  -11.231 1.00 40.31  ? 1542 LEU A CA    1 
ATOM   6508  C  C     . LEU A 1 894 ? -8.849  13.967  -9.814  1.00 40.71  ? 1542 LEU A C     1 
ATOM   6509  O  O     . LEU A 1 894 ? -9.448  14.831  -9.184  1.00 42.56  ? 1542 LEU A O     1 
ATOM   6510  C  CB    . LEU A 1 894 ? -6.943  14.790  -11.229 1.00 39.16  ? 1542 LEU A CB    1 
ATOM   6511  C  CG    . LEU A 1 894 ? -6.416  15.209  -12.604 1.00 39.91  ? 1542 LEU A CG    1 
ATOM   6512  C  CD1   . LEU A 1 894 ? -4.894  15.242  -12.646 1.00 39.73  ? 1542 LEU A CD1   1 
ATOM   6513  C  CD2   . LEU A 1 894 ? -6.951  14.301  -13.685 1.00 40.38  ? 1542 LEU A CD2   1 
ATOM   6514  N  N     . HIS A 1 895 ? -8.614  12.764  -9.316  1.00 39.32  ? 1543 HIS A N     1 
ATOM   6515  C  CA    . HIS A 1 895 ? -8.989  12.452  -7.951  1.00 39.84  ? 1543 HIS A CA    1 
ATOM   6516  C  C     . HIS A 1 895 ? -8.239  13.404  -7.021  1.00 43.45  ? 1543 HIS A C     1 
ATOM   6517  O  O     . HIS A 1 895 ? -7.134  13.845  -7.342  1.00 44.70  ? 1543 HIS A O     1 
ATOM   6518  C  CB    . HIS A 1 895 ? -8.638  11.003  -7.639  1.00 38.17  ? 1543 HIS A CB    1 
ATOM   6519  C  CG    . HIS A 1 895 ? -9.270  10.480  -6.390  1.00 39.78  ? 1543 HIS A CG    1 
ATOM   6520  N  ND1   . HIS A 1 895 ? -8.749  10.716  -5.138  1.00 41.03  ? 1543 HIS A ND1   1 
ATOM   6521  C  CD2   . HIS A 1 895 ? -10.374 9.720   -6.201  1.00 41.30  ? 1543 HIS A CD2   1 
ATOM   6522  C  CE1   . HIS A 1 895 ? -9.505  10.125  -4.230  1.00 42.74  ? 1543 HIS A CE1   1 
ATOM   6523  N  NE2   . HIS A 1 895 ? -10.497 9.512   -4.849  1.00 42.84  ? 1543 HIS A NE2   1 
ATOM   6524  N  N     . PRO A 1 896 ? -8.842  13.740  -5.871  1.00 43.25  ? 1544 PRO A N     1 
ATOM   6525  C  CA    . PRO A 1 896 ? -8.212  14.629  -4.886  1.00 43.43  ? 1544 PRO A CA    1 
ATOM   6526  C  C     . PRO A 1 896 ? -6.826  14.166  -4.439  1.00 44.63  ? 1544 PRO A C     1 
ATOM   6527  O  O     . PRO A 1 896 ? -5.962  15.012  -4.199  1.00 46.70  ? 1544 PRO A O     1 
ATOM   6528  C  CB    . PRO A 1 896 ? -9.178  14.570  -3.702  1.00 43.71  ? 1544 PRO A CB    1 
ATOM   6529  C  CG    . PRO A 1 896 ? -10.495 14.276  -4.314  1.00 44.20  ? 1544 PRO A CG    1 
ATOM   6530  C  CD    . PRO A 1 896 ? -10.213 13.372  -5.481  1.00 43.16  ? 1544 PRO A CD    1 
ATOM   6531  N  N     . GLU A 1 897 ? -6.621  12.855  -4.326  1.00 43.82  ? 1545 GLU A N     1 
ATOM   6532  C  CA    . GLU A 1 897 ? -5.362  12.312  -3.817  1.00 44.80  ? 1545 GLU A CA    1 
ATOM   6533  C  C     . GLU A 1 897 ? -4.675  11.342  -4.780  1.00 46.29  ? 1545 GLU A C     1 
ATOM   6534  O  O     . GLU A 1 897 ? -3.474  11.462  -5.044  1.00 46.53  ? 1545 GLU A O     1 
ATOM   6535  C  CB    . GLU A 1 897 ? -5.583  11.620  -2.475  1.00 42.86  ? 1545 GLU A CB    1 
ATOM   6536  C  CG    . GLU A 1 897 ? -6.029  12.544  -1.372  1.00 44.36  ? 1545 GLU A CG    1 
ATOM   6537  C  CD    . GLU A 1 897 ? -6.148  11.830  -0.043  1.00 52.32  ? 1545 GLU A CD    1 
ATOM   6538  O  OE1   . GLU A 1 897 ? -5.684  10.671  0.065   1.00 50.68  ? 1545 GLU A OE1   1 
ATOM   6539  O  OE2   . GLU A 1 897 ? -6.709  12.431  0.897   1.00 54.99  ? 1545 GLU A OE2   1 
ATOM   6540  N  N     . GLN A 1 898 ? -5.436  10.374  -5.283  1.00 42.95  ? 1546 GLN A N     1 
ATOM   6541  C  CA    . GLN A 1 898 ? -4.908  9.360   -6.190  1.00 40.04  ? 1546 GLN A CA    1 
ATOM   6542  C  C     . GLN A 1 898 ? -4.552  9.954   -7.543  1.00 41.47  ? 1546 GLN A C     1 
ATOM   6543  O  O     . GLN A 1 898 ? -5.131  10.957  -7.954  1.00 41.72  ? 1546 GLN A O     1 
ATOM   6544  C  CB    . GLN A 1 898 ? -5.914  8.227   -6.324  1.00 40.18  ? 1546 GLN A CB    1 
ATOM   6545  C  CG    . GLN A 1 898 ? -6.039  7.454   -5.029  1.00 45.72  ? 1546 GLN A CG    1 
ATOM   6546  C  CD    . GLN A 1 898 ? -7.390  6.816   -4.837  1.00 44.86  ? 1546 GLN A CD    1 
ATOM   6547  O  OE1   . GLN A 1 898 ? -7.947  6.222   -5.756  1.00 45.69  ? 1546 GLN A OE1   1 
ATOM   6548  N  NE2   . GLN A 1 898 ? -7.926  6.934   -3.632  1.00 45.01  ? 1546 GLN A NE2   1 
ATOM   6549  N  N     . HIS A 1 899 ? -3.588  9.344   -8.225  1.00 38.91  ? 1547 HIS A N     1 
ATOM   6550  C  CA    . HIS A 1 899 ? -3.050  9.923   -9.456  1.00 40.87  ? 1547 HIS A CA    1 
ATOM   6551  C  C     . HIS A 1 899 ? -3.777  9.437   -10.692 1.00 39.20  ? 1547 HIS A C     1 
ATOM   6552  O  O     . HIS A 1 899 ? -3.243  8.652   -11.466 1.00 39.78  ? 1547 HIS A O     1 
ATOM   6553  C  CB    . HIS A 1 899 ? -1.551  9.640   -9.580  1.00 42.43  ? 1547 HIS A CB    1 
ATOM   6554  C  CG    . HIS A 1 899 ? -0.751  10.172  -8.437  1.00 45.22  ? 1547 HIS A CG    1 
ATOM   6555  N  ND1   . HIS A 1 899 ? -1.104  11.317  -7.757  1.00 45.92  ? 1547 HIS A ND1   1 
ATOM   6556  C  CD2   . HIS A 1 899 ? 0.370   9.708   -7.836  1.00 47.53  ? 1547 HIS A CD2   1 
ATOM   6557  C  CE1   . HIS A 1 899 ? -0.235  11.539  -6.788  1.00 47.13  ? 1547 HIS A CE1   1 
ATOM   6558  N  NE2   . HIS A 1 899 ? 0.669   10.576  -6.816  1.00 51.23  ? 1547 HIS A NE2   1 
ATOM   6559  N  N     . ARG A 1 900 ? -4.991  9.927   -10.886 1.00 38.49  ? 1548 ARG A N     1 
ATOM   6560  C  CA    . ARG A 1 900 ? -5.839  9.390   -11.927 1.00 37.90  ? 1548 ARG A CA    1 
ATOM   6561  C  C     . ARG A 1 900 ? -7.071  10.237  -12.164 1.00 37.55  ? 1548 ARG A C     1 
ATOM   6562  O  O     . ARG A 1 900 ? -7.339  11.181  -11.435 1.00 39.79  ? 1548 ARG A O     1 
ATOM   6563  C  CB    . ARG A 1 900 ? -6.261  7.973   -11.550 1.00 38.54  ? 1548 ARG A CB    1 
ATOM   6564  C  CG    . ARG A 1 900 ? -6.751  7.819   -10.116 1.00 36.64  ? 1548 ARG A CG    1 
ATOM   6565  C  CD    . ARG A 1 900 ? -8.056  7.045   -10.108 1.00 39.38  ? 1548 ARG A CD    1 
ATOM   6566  N  NE    . ARG A 1 900 ? -8.522  6.658   -8.779  1.00 37.99  ? 1548 ARG A NE    1 
ATOM   6567  C  CZ    . ARG A 1 900 ? -9.764  6.861   -8.350  1.00 39.04  ? 1548 ARG A CZ    1 
ATOM   6568  N  NH1   . ARG A 1 900 ? -10.130 6.472   -7.136  1.00 39.43  ? 1548 ARG A NH1   1 
ATOM   6569  N  NH2   . ARG A 1 900 ? -10.644 7.459   -9.142  1.00 37.02  ? 1548 ARG A NH2   1 
ATOM   6570  N  N     . VAL A 1 901 ? -7.816  9.885   -13.201 1.00 38.83  ? 1549 VAL A N     1 
ATOM   6571  C  CA    . VAL A 1 901 ? -9.107  10.494  -13.476 1.00 37.30  ? 1549 VAL A CA    1 
ATOM   6572  C  C     . VAL A 1 901 ? -10.175 9.799   -12.633 1.00 37.05  ? 1549 VAL A C     1 
ATOM   6573  O  O     . VAL A 1 901 ? -9.915  8.761   -12.024 1.00 37.37  ? 1549 VAL A O     1 
ATOM   6574  C  CB    . VAL A 1 901 ? -9.453  10.368  -14.965 1.00 37.24  ? 1549 VAL A CB    1 
ATOM   6575  C  CG1   . VAL A 1 901 ? -8.608  11.320  -15.794 1.00 36.39  ? 1549 VAL A CG1   1 
ATOM   6576  C  CG2   . VAL A 1 901 ? -9.240  8.940   -15.426 1.00 40.05  ? 1549 VAL A CG2   1 
ATOM   6577  N  N     . VAL A 1 902 ? -11.376 10.364  -12.587 1.00 38.12  ? 1550 VAL A N     1 
ATOM   6578  C  CA    . VAL A 1 902 ? -12.419 9.815   -11.722 1.00 37.14  ? 1550 VAL A CA    1 
ATOM   6579  C  C     . VAL A 1 902 ? -13.047 8.573   -12.322 1.00 38.10  ? 1550 VAL A C     1 
ATOM   6580  O  O     . VAL A 1 902 ? -13.234 8.484   -13.531 1.00 38.98  ? 1550 VAL A O     1 
ATOM   6581  C  CB    . VAL A 1 902 ? -13.525 10.841  -11.387 1.00 37.78  ? 1550 VAL A CB    1 
ATOM   6582  C  CG1   . VAL A 1 902 ? -13.097 11.728  -10.225 1.00 37.62  ? 1550 VAL A CG1   1 
ATOM   6583  C  CG2   . VAL A 1 902 ? -13.895 11.667  -12.615 1.00 39.87  ? 1550 VAL A CG2   1 
ATOM   6584  N  N     . SER A 1 903 ? -13.360 7.612   -11.460 1.00 37.64  ? 1551 SER A N     1 
ATOM   6585  C  CA    . SER A 1 903 ? -13.966 6.360   -11.873 1.00 35.22  ? 1551 SER A CA    1 
ATOM   6586  C  C     . SER A 1 903 ? -15.429 6.560   -12.245 1.00 35.70  ? 1551 SER A C     1 
ATOM   6587  O  O     . SER A 1 903 ? -16.043 7.551   -11.863 1.00 35.89  ? 1551 SER A O     1 
ATOM   6588  C  CB    . SER A 1 903 ? -13.866 5.354   -10.738 1.00 36.99  ? 1551 SER A CB    1 
ATOM   6589  O  OG    . SER A 1 903 ? -14.641 5.781   -9.632  1.00 38.53  ? 1551 SER A OG    1 
ATOM   6590  N  N     . VAL A 1 904 ? -15.982 5.606   -12.984 1.00 35.69  ? 1552 VAL A N     1 
ATOM   6591  C  CA    . VAL A 1 904 ? -17.374 5.668   -13.404 1.00 34.47  ? 1552 VAL A CA    1 
ATOM   6592  C  C     . VAL A 1 904 ? -18.312 5.793   -12.213 1.00 33.02  ? 1552 VAL A C     1 
ATOM   6593  O  O     . VAL A 1 904 ? -19.307 6.508   -12.283 1.00 32.95  ? 1552 VAL A O     1 
ATOM   6594  C  CB    . VAL A 1 904 ? -17.769 4.433   -14.229 1.00 34.73  ? 1552 VAL A CB    1 
ATOM   6595  C  CG1   . VAL A 1 904 ? -19.245 4.468   -14.552 1.00 34.45  ? 1552 VAL A CG1   1 
ATOM   6596  C  CG2   . VAL A 1 904 ? -16.952 4.368   -15.503 1.00 36.01  ? 1552 VAL A CG2   1 
ATOM   6597  N  N     . ARG A 1 905 ? -17.995 5.095   -11.124 1.00 33.89  ? 1553 ARG A N     1 
ATOM   6598  C  CA    . ARG A 1 905 ? -18.802 5.169   -9.906  1.00 34.45  ? 1553 ARG A CA    1 
ATOM   6599  C  C     . ARG A 1 905 ? -18.742 6.565   -9.293  1.00 36.70  ? 1553 ARG A C     1 
ATOM   6600  O  O     . ARG A 1 905 ? -19.767 7.146   -8.929  1.00 35.46  ? 1553 ARG A O     1 
ATOM   6601  C  CB    . ARG A 1 905 ? -18.332 4.154   -8.871  1.00 33.86  ? 1553 ARG A CB    1 
ATOM   6602  C  CG    . ARG A 1 905 ? -19.243 4.062   -7.658  1.00 32.03  ? 1553 ARG A CG    1 
ATOM   6603  C  CD    . ARG A 1 905 ? -20.235 2.935   -7.822  1.00 35.62  ? 1553 ARG A CD    1 
ATOM   6604  N  NE    . ARG A 1 905 ? -21.524 3.377   -8.337  1.00 35.86  ? 1553 ARG A NE    1 
ATOM   6605  C  CZ    . ARG A 1 905 ? -22.331 2.615   -9.072  1.00 37.31  ? 1553 ARG A CZ    1 
ATOM   6606  N  NH1   . ARG A 1 905 ? -21.969 1.382   -9.393  1.00 34.13  ? 1553 ARG A NH1   1 
ATOM   6607  N  NH2   . ARG A 1 905 ? -23.497 3.089   -9.503  1.00 39.37  ? 1553 ARG A NH2   1 
ATOM   6608  N  N     . GLU A 1 906 ? -17.531 7.098   -9.174  1.00 34.45  ? 1554 GLU A N     1 
ATOM   6609  C  CA    . GLU A 1 906 ? -17.363 8.412   -8.608  1.00 31.92  ? 1554 GLU A CA    1 
ATOM   6610  C  C     . GLU A 1 906 ? -18.222 9.403   -9.368  1.00 33.03  ? 1554 GLU A C     1 
ATOM   6611  O  O     . GLU A 1 906 ? -18.770 10.323  -8.784  1.00 34.36  ? 1554 GLU A O     1 
ATOM   6612  C  CB    . GLU A 1 906 ? -15.898 8.802   -8.622  1.00 33.76  ? 1554 GLU A CB    1 
ATOM   6613  C  CG    . GLU A 1 906 ? -15.078 7.911   -7.738  1.00 36.36  ? 1554 GLU A CG    1 
ATOM   6614  C  CD    . GLU A 1 906 ? -13.599 8.181   -7.824  1.00 39.61  ? 1554 GLU A CD    1 
ATOM   6615  O  OE1   . GLU A 1 906 ? -13.091 8.376   -8.945  1.00 37.88  ? 1554 GLU A OE1   1 
ATOM   6616  O  OE2   . GLU A 1 906 ? -12.943 8.196   -6.762  1.00 43.20  ? 1554 GLU A OE2   1 
ATOM   6617  N  N     . CYS A 1 907 ? -18.366 9.206   -10.670 1.00 32.07  ? 1555 CYS A N     1 
ATOM   6618  C  CA    . CYS A 1 907 ? -19.239 10.075  -11.442 1.00 33.68  ? 1555 CYS A CA    1 
ATOM   6619  C  C     . CYS A 1 907 ? -20.699 9.776   -11.148 1.00 35.06  ? 1555 CYS A C     1 
ATOM   6620  O  O     . CYS A 1 907 ? -21.481 10.682  -10.883 1.00 36.64  ? 1555 CYS A O     1 
ATOM   6621  C  CB    . CYS A 1 907 ? -18.960 9.954   -12.936 1.00 34.99  ? 1555 CYS A CB    1 
ATOM   6622  S  SG    . CYS A 1 907 ? -17.444 10.782  -13.453 1.00 39.06  ? 1555 CYS A SG    1 
ATOM   6623  N  N     . ALA A 1 908 ? -21.073 8.504   -11.192 1.00 34.16  ? 1556 ALA A N     1 
ATOM   6624  C  CA    . ALA A 1 908 ? -22.433 8.122   -10.849 1.00 33.08  ? 1556 ALA A CA    1 
ATOM   6625  C  C     . ALA A 1 908 ? -22.787 8.707   -9.479  1.00 34.70  ? 1556 ALA A C     1 
ATOM   6626  O  O     . ALA A 1 908 ? -23.943 9.060   -9.210  1.00 34.04  ? 1556 ALA A O     1 
ATOM   6627  C  CB    . ALA A 1 908 ? -22.573 6.610   -10.855 1.00 30.63  ? 1556 ALA A CB    1 
ATOM   6628  N  N     . ARG A 1 909 ? -21.770 8.824   -8.628  1.00 34.11  ? 1557 ARG A N     1 
ATOM   6629  C  CA    . ARG A 1 909 ? -21.934 9.307   -7.261  1.00 34.20  ? 1557 ARG A CA    1 
ATOM   6630  C  C     . ARG A 1 909 ? -22.048 10.815  -7.203  1.00 32.76  ? 1557 ARG A C     1 
ATOM   6631  O  O     . ARG A 1 909 ? -22.669 11.350  -6.299  1.00 34.07  ? 1557 ARG A O     1 
ATOM   6632  C  CB    . ARG A 1 909 ? -20.759 8.862   -6.387  1.00 35.12  ? 1557 ARG A CB    1 
ATOM   6633  C  CG    . ARG A 1 909 ? -20.864 7.451   -5.843  1.00 34.25  ? 1557 ARG A CG    1 
ATOM   6634  C  CD    . ARG A 1 909 ? -21.366 7.469   -4.427  1.00 33.50  ? 1557 ARG A CD    1 
ATOM   6635  N  NE    . ARG A 1 909 ? -21.333 6.149   -3.813  1.00 36.29  ? 1557 ARG A NE    1 
ATOM   6636  C  CZ    . ARG A 1 909 ? -20.395 5.735   -2.965  1.00 39.47  ? 1557 ARG A CZ    1 
ATOM   6637  N  NH1   . ARG A 1 909 ? -19.399 6.539   -2.624  1.00 39.20  ? 1557 ARG A NH1   1 
ATOM   6638  N  NH2   . ARG A 1 909 ? -20.456 4.511   -2.454  1.00 39.99  ? 1557 ARG A NH2   1 
ATOM   6639  N  N     . SER A 1 910 ? -21.432 11.497  -8.159  1.00 32.03  ? 1558 SER A N     1 
ATOM   6640  C  CA    . SER A 1 910 ? -21.482 12.947  -8.201  1.00 33.02  ? 1558 SER A CA    1 
ATOM   6641  C  C     . SER A 1 910 ? -22.841 13.369  -8.712  1.00 36.67  ? 1558 SER A C     1 
ATOM   6642  O  O     . SER A 1 910 ? -23.350 14.424  -8.343  1.00 40.13  ? 1558 SER A O     1 
ATOM   6643  C  CB    . SER A 1 910 ? -20.398 13.498  -9.110  1.00 36.41  ? 1558 SER A CB    1 
ATOM   6644  O  OG    . SER A 1 910 ? -20.715 13.238  -10.461 1.00 39.79  ? 1558 SER A OG    1 
ATOM   6645  N  N     . GLN A 1 911 ? -23.418 12.550  -9.584  1.00 35.77  ? 1559 GLN A N     1 
ATOM   6646  C  CA    . GLN A 1 911 ? -24.835 12.648  -9.896  1.00 34.17  ? 1559 GLN A CA    1 
ATOM   6647  C  C     . GLN A 1 911 ? -25.542 12.001  -8.722  1.00 35.44  ? 1559 GLN A C     1 
ATOM   6648  O  O     . GLN A 1 911 ? -24.932 11.798  -7.674  1.00 38.01  ? 1559 GLN A O     1 
ATOM   6649  C  CB    . GLN A 1 911 ? -25.129 11.886  -11.173 1.00 34.69  ? 1559 GLN A CB    1 
ATOM   6650  C  CG    . GLN A 1 911 ? -24.284 12.329  -12.351 1.00 34.75  ? 1559 GLN A CG    1 
ATOM   6651  C  CD    . GLN A 1 911 ? -24.951 13.412  -13.173 1.00 35.82  ? 1559 GLN A CD    1 
ATOM   6652  O  OE1   . GLN A 1 911 ? -25.518 14.365  -12.636 1.00 35.43  ? 1559 GLN A OE1   1 
ATOM   6653  N  NE2   . GLN A 1 911 ? -24.893 13.266  -14.487 1.00 36.25  ? 1559 GLN A NE2   1 
ATOM   6654  N  N     . GLY A 1 912 ? -26.807 11.636  -8.865  1.00 35.07  ? 1560 GLY A N     1 
ATOM   6655  C  CA    . GLY A 1 912 ? -27.477 11.036  -7.718  1.00 34.46  ? 1560 GLY A CA    1 
ATOM   6656  C  C     . GLY A 1 912 ? -27.727 9.533   -7.682  1.00 34.41  ? 1560 GLY A C     1 
ATOM   6657  O  O     . GLY A 1 912 ? -28.569 9.082   -6.900  1.00 36.07  ? 1560 GLY A O     1 
ATOM   6658  N  N     . PHE A 1 913 ? -27.005 8.756   -8.490  1.00 32.56  ? 1561 PHE A N     1 
ATOM   6659  C  CA    . PHE A 1 913 ? -27.338 7.335   -8.681  1.00 31.79  ? 1561 PHE A CA    1 
ATOM   6660  C  C     . PHE A 1 913 ? -27.084 6.438   -7.468  1.00 30.75  ? 1561 PHE A C     1 
ATOM   6661  O  O     . PHE A 1 913 ? -25.966 6.365   -6.953  1.00 32.05  ? 1561 PHE A O     1 
ATOM   6662  C  CB    . PHE A 1 913 ? -26.599 6.745   -9.891  1.00 34.47  ? 1561 PHE A CB    1 
ATOM   6663  C  CG    . PHE A 1 913 ? -26.991 7.353   -11.206 1.00 32.79  ? 1561 PHE A CG    1 
ATOM   6664  C  CD1   . PHE A 1 913 ? -26.236 8.379   -11.763 1.00 33.48  ? 1561 PHE A CD1   1 
ATOM   6665  C  CD2   . PHE A 1 913 ? -28.098 6.893   -11.889 1.00 30.52  ? 1561 PHE A CD2   1 
ATOM   6666  C  CE1   . PHE A 1 913 ? -26.586 8.943   -12.972 1.00 31.36  ? 1561 PHE A CE1   1 
ATOM   6667  C  CE2   . PHE A 1 913 ? -28.455 7.449   -13.087 1.00 33.43  ? 1561 PHE A CE2   1 
ATOM   6668  C  CZ    . PHE A 1 913 ? -27.698 8.481   -13.632 1.00 33.70  ? 1561 PHE A CZ    1 
ATOM   6669  N  N     . PRO A 1 914 ? -28.126 5.730   -7.023  1.00 29.13  ? 1562 PRO A N     1 
ATOM   6670  C  CA    . PRO A 1 914 ? -27.956 4.694   -6.006  1.00 31.64  ? 1562 PRO A CA    1 
ATOM   6671  C  C     . PRO A 1 914 ? -26.942 3.688   -6.516  1.00 34.12  ? 1562 PRO A C     1 
ATOM   6672  O  O     . PRO A 1 914 ? -26.991 3.339   -7.690  1.00 36.93  ? 1562 PRO A O     1 
ATOM   6673  C  CB    . PRO A 1 914 ? -29.334 4.034   -5.943  1.00 28.31  ? 1562 PRO A CB    1 
ATOM   6674  C  CG    . PRO A 1 914 ? -30.267 5.022   -6.487  1.00 28.82  ? 1562 PRO A CG    1 
ATOM   6675  C  CD    . PRO A 1 914 ? -29.513 5.827   -7.495  1.00 30.21  ? 1562 PRO A CD    1 
ATOM   6676  N  N     . ASP A 1 915 ? -26.036 3.228   -5.670  1.00 32.71  ? 1563 ASP A N     1 
ATOM   6677  C  CA    . ASP A 1 915 ? -25.029 2.287   -6.126  1.00 34.59  ? 1563 ASP A CA    1 
ATOM   6678  C  C     . ASP A 1 915 ? -25.664 1.061   -6.786  1.00 33.89  ? 1563 ASP A C     1 
ATOM   6679  O  O     . ASP A 1 915 ? -25.012 0.347   -7.532  1.00 33.28  ? 1563 ASP A O     1 
ATOM   6680  C  CB    . ASP A 1 915 ? -24.126 1.878   -4.964  1.00 38.61  ? 1563 ASP A CB    1 
ATOM   6681  C  CG    . ASP A 1 915 ? -23.195 2.991   -4.536  1.00 39.54  ? 1563 ASP A CG    1 
ATOM   6682  O  OD1   . ASP A 1 915 ? -23.356 4.124   -5.041  1.00 40.26  ? 1563 ASP A OD1   1 
ATOM   6683  O  OD2   . ASP A 1 915 ? -22.302 2.734   -3.701  1.00 37.96  ? 1563 ASP A OD2   1 
ATOM   6684  N  N     . SER A 1 916 ? -26.943 0.831   -6.504  1.00 36.04  ? 1564 SER A N     1 
ATOM   6685  C  CA    . SER A 1 916 ? -27.685 -0.299  -7.058  1.00 32.39  ? 1564 SER A CA    1 
ATOM   6686  C  C     . SER A 1 916 ? -27.869 -0.114  -8.555  1.00 35.16  ? 1564 SER A C     1 
ATOM   6687  O  O     . SER A 1 916 ? -27.973 -1.084  -9.299  1.00 35.29  ? 1564 SER A O     1 
ATOM   6688  C  CB    . SER A 1 916 ? -29.056 -0.418  -6.390  1.00 26.51  ? 1564 SER A CB    1 
ATOM   6689  N  N     . TYR A 1 917 ? -27.904 1.142   -8.991  1.00 36.86  ? 1565 TYR A N     1 
ATOM   6690  C  CA    . TYR A 1 917 ? -28.215 1.464   -10.379 1.00 35.10  ? 1565 TYR A CA    1 
ATOM   6691  C  C     . TYR A 1 917 ? -27.160 0.914   -11.313 1.00 33.22  ? 1565 TYR A C     1 
ATOM   6692  O  O     . TYR A 1 917 ? -25.966 1.099   -11.086 1.00 34.10  ? 1565 TYR A O     1 
ATOM   6693  C  CB    . TYR A 1 917 ? -28.387 2.972   -10.577 1.00 32.91  ? 1565 TYR A CB    1 
ATOM   6694  C  CG    . TYR A 1 917 ? -29.414 3.291   -11.634 1.00 31.99  ? 1565 TYR A CG    1 
ATOM   6695  C  CD1   . TYR A 1 917 ? -29.034 3.592   -12.932 1.00 33.08  ? 1565 TYR A CD1   1 
ATOM   6696  C  CD2   . TYR A 1 917 ? -30.765 3.258   -11.341 1.00 30.87  ? 1565 TYR A CD2   1 
ATOM   6697  C  CE1   . TYR A 1 917 ? -29.973 3.868   -13.903 1.00 33.14  ? 1565 TYR A CE1   1 
ATOM   6698  C  CE2   . TYR A 1 917 ? -31.710 3.534   -12.303 1.00 30.92  ? 1565 TYR A CE2   1 
ATOM   6699  C  CZ    . TYR A 1 917 ? -31.309 3.836   -13.584 1.00 32.37  ? 1565 TYR A CZ    1 
ATOM   6700  O  OH    . TYR A 1 917 ? -32.249 4.108   -14.552 1.00 34.85  ? 1565 TYR A OH    1 
ATOM   6701  N  N     . ARG A 1 918 ? -27.622 0.232   -12.358 1.00 35.02  ? 1566 ARG A N     1 
ATOM   6702  C  CA    . ARG A 1 918 ? -26.753 -0.501  -13.280 1.00 36.51  ? 1566 ARG A CA    1 
ATOM   6703  C  C     . ARG A 1 918 ? -26.553 0.267   -14.578 1.00 34.55  ? 1566 ARG A C     1 
ATOM   6704  O  O     . ARG A 1 918 ? -27.497 0.847   -15.119 1.00 33.40  ? 1566 ARG A O     1 
ATOM   6705  C  CB    . ARG A 1 918 ? -27.354 -1.872  -13.617 1.00 34.03  ? 1566 ARG A CB    1 
ATOM   6706  C  CG    . ARG A 1 918 ? -27.815 -2.690  -12.431 1.00 34.17  ? 1566 ARG A CG    1 
ATOM   6707  C  CD    . ARG A 1 918 ? -26.658 -3.045  -11.526 1.00 42.06  ? 1566 ARG A CD    1 
ATOM   6708  N  NE    . ARG A 1 918 ? -25.624 -3.818  -12.217 1.00 50.91  ? 1566 ARG A NE    1 
ATOM   6709  C  CZ    . ARG A 1 918 ? -25.472 -5.139  -12.111 1.00 52.49  ? 1566 ARG A CZ    1 
ATOM   6710  N  NH1   . ARG A 1 918 ? -26.295 -5.858  -11.340 1.00 49.34  ? 1566 ARG A NH1   1 
ATOM   6711  N  NH2   . ARG A 1 918 ? -24.495 -5.744  -12.779 1.00 47.64  ? 1566 ARG A NH2   1 
ATOM   6712  N  N     . PHE A 1 919 ? -25.326 0.255   -15.084 1.00 32.19  ? 1567 PHE A N     1 
ATOM   6713  C  CA    . PHE A 1 919 ? -25.040 0.858   -16.377 1.00 32.55  ? 1567 PHE A CA    1 
ATOM   6714  C  C     . PHE A 1 919 ? -24.641 -0.221  -17.387 1.00 35.86  ? 1567 PHE A C     1 
ATOM   6715  O  O     . PHE A 1 919 ? -24.596 -1.412  -17.052 1.00 35.13  ? 1567 PHE A O     1 
ATOM   6716  C  CB    . PHE A 1 919 ? -23.966 1.926   -16.220 1.00 31.79  ? 1567 PHE A CB    1 
ATOM   6717  C  CG    . PHE A 1 919 ? -24.268 2.908   -15.125 1.00 33.66  ? 1567 PHE A CG    1 
ATOM   6718  C  CD1   . PHE A 1 919 ? -25.339 3.778   -15.238 1.00 33.28  ? 1567 PHE A CD1   1 
ATOM   6719  C  CD2   . PHE A 1 919 ? -23.498 2.953   -13.978 1.00 33.03  ? 1567 PHE A CD2   1 
ATOM   6720  C  CE1   . PHE A 1 919 ? -25.626 4.668   -14.239 1.00 30.96  ? 1567 PHE A CE1   1 
ATOM   6721  C  CE2   . PHE A 1 919 ? -23.786 3.849   -12.975 1.00 30.40  ? 1567 PHE A CE2   1 
ATOM   6722  C  CZ    . PHE A 1 919 ? -24.848 4.704   -13.107 1.00 31.78  ? 1567 PHE A CZ    1 
ATOM   6723  N  N     . PHE A 1 920 ? -24.366 0.174   -18.624 1.00 33.28  ? 1568 PHE A N     1 
ATOM   6724  C  CA    . PHE A 1 920 ? -24.121 -0.828  -19.651 1.00 34.07  ? 1568 PHE A CA    1 
ATOM   6725  C  C     . PHE A 1 920 ? -23.221 -0.355  -20.773 1.00 36.02  ? 1568 PHE A C     1 
ATOM   6726  O  O     . PHE A 1 920 ? -23.500 0.649   -21.418 1.00 36.14  ? 1568 PHE A O     1 
ATOM   6727  C  CB    . PHE A 1 920 ? -25.440 -1.304  -20.244 1.00 32.21  ? 1568 PHE A CB    1 
ATOM   6728  C  CG    . PHE A 1 920 ? -25.284 -2.401  -21.250 1.00 34.25  ? 1568 PHE A CG    1 
ATOM   6729  C  CD1   . PHE A 1 920 ? -25.209 -3.722  -20.844 1.00 36.93  ? 1568 PHE A CD1   1 
ATOM   6730  C  CD2   . PHE A 1 920 ? -25.213 -2.117  -22.598 1.00 34.17  ? 1568 PHE A CD2   1 
ATOM   6731  C  CE1   . PHE A 1 920 ? -25.068 -4.740  -21.765 1.00 37.41  ? 1568 PHE A CE1   1 
ATOM   6732  C  CE2   . PHE A 1 920 ? -25.073 -3.127  -23.524 1.00 34.29  ? 1568 PHE A CE2   1 
ATOM   6733  C  CZ    . PHE A 1 920 ? -25.002 -4.439  -23.108 1.00 37.85  ? 1568 PHE A CZ    1 
ATOM   6734  N  N     . GLY A 1 921 ? -22.154 -1.107  -21.021 1.00 36.08  ? 1569 GLY A N     1 
ATOM   6735  C  CA    . GLY A 1 921 ? -21.249 -0.796  -22.105 1.00 33.82  ? 1569 GLY A CA    1 
ATOM   6736  C  C     . GLY A 1 921 ? -19.809 -0.763  -21.653 1.00 35.15  ? 1569 GLY A C     1 
ATOM   6737  O  O     . GLY A 1 921 ? -19.504 -1.021  -20.489 1.00 33.99  ? 1569 GLY A O     1 
ATOM   6738  N  N     . ASN A 1 922 ? -18.917 -0.453  -22.587 1.00 36.47  ? 1570 ASN A N     1 
ATOM   6739  C  CA    . ASN A 1 922 ? -17.516 -0.261  -22.251 1.00 37.39  ? 1570 ASN A CA    1 
ATOM   6740  C  C     . ASN A 1 922 ? -17.401 0.927   -21.314 1.00 37.05  ? 1570 ASN A C     1 
ATOM   6741  O  O     . ASN A 1 922 ? -18.374 1.650   -21.101 1.00 37.12  ? 1570 ASN A O     1 
ATOM   6742  C  CB    . ASN A 1 922 ? -16.660 -0.064  -23.508 1.00 38.17  ? 1570 ASN A CB    1 
ATOM   6743  C  CG    . ASN A 1 922 ? -17.144 1.082   -24.374 1.00 37.15  ? 1570 ASN A CG    1 
ATOM   6744  O  OD1   . ASN A 1 922 ? -17.884 1.944   -23.920 1.00 37.76  ? 1570 ASN A OD1   1 
ATOM   6745  N  ND2   . ASN A 1 922 ? -16.720 1.096   -25.627 1.00 37.38  ? 1570 ASN A ND2   1 
ATOM   6746  N  N     . ILE A 1 923 ? -16.219 1.128   -20.746 1.00 36.99  ? 1571 ILE A N     1 
ATOM   6747  C  CA    . ILE A 1 923 ? -16.046 2.192   -19.776 1.00 36.93  ? 1571 ILE A CA    1 
ATOM   6748  C  C     . ILE A 1 923 ? -16.510 3.534   -20.337 1.00 36.99  ? 1571 ILE A C     1 
ATOM   6749  O  O     . ILE A 1 923 ? -17.063 4.357   -19.607 1.00 37.73  ? 1571 ILE A O     1 
ATOM   6750  C  CB    . ILE A 1 923 ? -14.599 2.297   -19.292 1.00 34.44  ? 1571 ILE A CB    1 
ATOM   6751  C  CG1   . ILE A 1 923 ? -14.506 3.299   -18.140 1.00 34.69  ? 1571 ILE A CG1   1 
ATOM   6752  C  CG2   . ILE A 1 923 ? -13.698 2.686   -20.441 1.00 34.70  ? 1571 ILE A CG2   1 
ATOM   6753  C  CD1   . ILE A 1 923 ? -13.214 3.229   -17.378 1.00 36.29  ? 1571 ILE A CD1   1 
ATOM   6754  N  N     . LEU A 1 924 ? -16.301 3.750   -21.631 1.00 34.62  ? 1572 LEU A N     1 
ATOM   6755  C  CA    . LEU A 1 924 ? -16.737 4.995   -22.247 1.00 36.31  ? 1572 LEU A CA    1 
ATOM   6756  C  C     . LEU A 1 924 ? -18.259 5.117   -22.294 1.00 38.43  ? 1572 LEU A C     1 
ATOM   6757  O  O     . LEU A 1 924 ? -18.816 6.128   -21.869 1.00 39.49  ? 1572 LEU A O     1 
ATOM   6758  C  CB    . LEU A 1 924 ? -16.129 5.165   -23.639 1.00 37.77  ? 1572 LEU A CB    1 
ATOM   6759  C  CG    . LEU A 1 924 ? -14.621 5.415   -23.598 1.00 38.39  ? 1572 LEU A CG    1 
ATOM   6760  C  CD1   . LEU A 1 924 ? -14.131 6.163   -24.821 1.00 45.22  ? 1572 LEU A CD1   1 
ATOM   6761  C  CD2   . LEU A 1 924 ? -14.274 6.179   -22.348 1.00 40.84  ? 1572 LEU A CD2   1 
ATOM   6762  N  N     . ASP A 1 925 ? -18.929 4.093   -22.812 1.00 37.79  ? 1573 ASP A N     1 
ATOM   6763  C  CA    . ASP A 1 925 ? -20.385 4.084   -22.846 1.00 35.81  ? 1573 ASP A CA    1 
ATOM   6764  C  C     . ASP A 1 925 ? -20.958 4.484   -21.489 1.00 36.65  ? 1573 ASP A C     1 
ATOM   6765  O  O     . ASP A 1 925 ? -21.848 5.332   -21.394 1.00 35.64  ? 1573 ASP A O     1 
ATOM   6766  C  CB    . ASP A 1 925 ? -20.895 2.700   -23.231 1.00 35.28  ? 1573 ASP A CB    1 
ATOM   6767  C  CG    . ASP A 1 925 ? -20.511 2.313   -24.637 1.00 37.18  ? 1573 ASP A CG    1 
ATOM   6768  O  OD1   . ASP A 1 925 ? -20.417 1.102   -24.925 1.00 38.62  ? 1573 ASP A OD1   1 
ATOM   6769  O  OD2   . ASP A 1 925 ? -20.292 3.222   -25.456 1.00 38.48  ? 1573 ASP A OD2   1 
ATOM   6770  N  N     . ARG A 1 926 ? -20.429 3.871   -20.436 1.00 37.72  ? 1574 ARG A N     1 
ATOM   6771  C  CA    . ARG A 1 926 ? -20.926 4.107   -19.088 1.00 37.35  ? 1574 ARG A CA    1 
ATOM   6772  C  C     . ARG A 1 926 ? -20.763 5.559   -18.663 1.00 36.86  ? 1574 ARG A C     1 
ATOM   6773  O  O     . ARG A 1 926 ? -21.723 6.179   -18.216 1.00 36.72  ? 1574 ARG A O     1 
ATOM   6774  C  CB    . ARG A 1 926 ? -20.271 3.146   -18.091 1.00 36.56  ? 1574 ARG A CB    1 
ATOM   6775  C  CG    . ARG A 1 926 ? -20.729 1.718   -18.297 1.00 35.78  ? 1574 ARG A CG    1 
ATOM   6776  C  CD    . ARG A 1 926 ? -20.021 0.711   -17.408 1.00 37.97  ? 1574 ARG A CD    1 
ATOM   6777  N  NE    . ARG A 1 926 ? -20.364 -0.638  -17.853 1.00 41.41  ? 1574 ARG A NE    1 
ATOM   6778  C  CZ    . ARG A 1 926 ? -21.163 -1.481  -17.202 1.00 39.11  ? 1574 ARG A CZ    1 
ATOM   6779  N  NH1   . ARG A 1 926 ? -21.694 -1.151  -16.032 1.00 36.91  ? 1574 ARG A NH1   1 
ATOM   6780  N  NH2   . ARG A 1 926 ? -21.418 -2.672  -17.722 1.00 39.37  ? 1574 ARG A NH2   1 
ATOM   6781  N  N     . HIS A 1 927 ? -19.560 6.104   -18.816 1.00 35.67  ? 1575 HIS A N     1 
ATOM   6782  C  CA    . HIS A 1 927 ? -19.327 7.497   -18.458 1.00 35.14  ? 1575 HIS A CA    1 
ATOM   6783  C  C     . HIS A 1 927 ? -20.350 8.392   -19.137 1.00 36.67  ? 1575 HIS A C     1 
ATOM   6784  O  O     . HIS A 1 927 ? -20.982 9.222   -18.492 1.00 39.06  ? 1575 HIS A O     1 
ATOM   6785  C  CB    . HIS A 1 927 ? -17.917 7.938   -18.837 1.00 36.68  ? 1575 HIS A CB    1 
ATOM   6786  C  CG    . HIS A 1 927 ? -16.896 7.675   -17.779 1.00 34.99  ? 1575 HIS A CG    1 
ATOM   6787  N  ND1   . HIS A 1 927 ? -17.002 8.183   -16.505 1.00 36.07  ? 1575 HIS A ND1   1 
ATOM   6788  C  CD2   . HIS A 1 927 ? -15.747 6.959   -17.805 1.00 37.31  ? 1575 HIS A CD2   1 
ATOM   6789  C  CE1   . HIS A 1 927 ? -15.964 7.790   -15.788 1.00 37.38  ? 1575 HIS A CE1   1 
ATOM   6790  N  NE2   . HIS A 1 927 ? -15.187 7.046   -16.553 1.00 38.25  ? 1575 HIS A NE2   1 
ATOM   6791  N  N     . ARG A 1 928 ? -20.516 8.215   -20.441 1.00 37.03  ? 1576 ARG A N     1 
ATOM   6792  C  CA    . ARG A 1 928 ? -21.453 9.027   -21.203 1.00 39.99  ? 1576 ARG A CA    1 
ATOM   6793  C  C     . ARG A 1 928 ? -22.877 8.948   -20.650 1.00 38.21  ? 1576 ARG A C     1 
ATOM   6794  O  O     . ARG A 1 928 ? -23.566 9.964   -20.544 1.00 37.27  ? 1576 ARG A O     1 
ATOM   6795  C  CB    . ARG A 1 928 ? -21.424 8.631   -22.680 1.00 42.29  ? 1576 ARG A CB    1 
ATOM   6796  C  CG    . ARG A 1 928 ? -22.590 9.180   -23.482 1.00 46.15  ? 1576 ARG A CG    1 
ATOM   6797  C  CD    . ARG A 1 928 ? -22.238 9.392   -24.947 1.00 51.85  ? 1576 ARG A CD    1 
ATOM   6798  N  NE    . ARG A 1 928 ? -21.223 10.432  -25.113 1.00 63.45  ? 1576 ARG A NE    1 
ATOM   6799  C  CZ    . ARG A 1 928 ? -19.921 10.194  -25.282 1.00 70.13  ? 1576 ARG A CZ    1 
ATOM   6800  N  NH1   . ARG A 1 928 ? -19.461 8.944   -25.318 1.00 69.24  ? 1576 ARG A NH1   1 
ATOM   6801  N  NH2   . ARG A 1 928 ? -19.073 11.208  -25.418 1.00 70.75  ? 1576 ARG A NH2   1 
ATOM   6802  N  N     . GLN A 1 929 ? -23.312 7.742   -20.298 1.00 36.56  ? 1577 GLN A N     1 
ATOM   6803  C  CA    . GLN A 1 929 ? -24.642 7.547   -19.739 1.00 35.40  ? 1577 GLN A CA    1 
ATOM   6804  C  C     . GLN A 1 929 ? -24.812 8.309   -18.443 1.00 35.37  ? 1577 GLN A C     1 
ATOM   6805  O  O     . GLN A 1 929 ? -25.824 8.966   -18.233 1.00 37.04  ? 1577 GLN A O     1 
ATOM   6806  C  CB    . GLN A 1 929 ? -24.885 6.075   -19.455 1.00 36.54  ? 1577 GLN A CB    1 
ATOM   6807  C  CG    . GLN A 1 929 ? -24.897 5.213   -20.670 1.00 38.50  ? 1577 GLN A CG    1 
ATOM   6808  C  CD    . GLN A 1 929 ? -24.984 3.762   -20.315 1.00 34.54  ? 1577 GLN A CD    1 
ATOM   6809  O  OE1   . GLN A 1 929 ? -25.093 3.407   -19.140 1.00 32.06  ? 1577 GLN A OE1   1 
ATOM   6810  N  NE2   . GLN A 1 929 ? -24.933 2.905   -21.329 1.00 33.69  ? 1577 GLN A NE2   1 
ATOM   6811  N  N     . VAL A 1 930 ? -23.828 8.194   -17.562 1.00 34.11  ? 1578 VAL A N     1 
ATOM   6812  C  CA    . VAL A 1 930 ? -23.883 8.881   -16.288 1.00 34.40  ? 1578 VAL A CA    1 
ATOM   6813  C  C     . VAL A 1 930 ? -23.953 10.390  -16.506 1.00 35.80  ? 1578 VAL A C     1 
ATOM   6814  O  O     . VAL A 1 930 ? -24.908 11.039  -16.085 1.00 36.24  ? 1578 VAL A O     1 
ATOM   6815  C  CB    . VAL A 1 930 ? -22.662 8.552   -15.422 1.00 35.44  ? 1578 VAL A CB    1 
ATOM   6816  C  CG1   . VAL A 1 930 ? -22.731 9.314   -14.110 1.00 36.59  ? 1578 VAL A CG1   1 
ATOM   6817  C  CG2   . VAL A 1 930 ? -22.580 7.064   -15.160 1.00 33.77  ? 1578 VAL A CG2   1 
ATOM   6818  N  N     . GLY A 1 931 ? -22.947 10.940  -17.178 1.00 33.76  ? 1579 GLY A N     1 
ATOM   6819  C  CA    . GLY A 1 931 ? -22.887 12.367  -17.437 1.00 36.73  ? 1579 GLY A CA    1 
ATOM   6820  C  C     . GLY A 1 931 ? -24.102 12.995  -18.110 1.00 36.32  ? 1579 GLY A C     1 
ATOM   6821  O  O     . GLY A 1 931 ? -24.365 14.184  -17.927 1.00 34.17  ? 1579 GLY A O     1 
ATOM   6822  N  N     . ASN A 1 932 ? -24.830 12.206  -18.894 1.00 34.67  ? 1580 ASN A N     1 
ATOM   6823  C  CA    . ASN A 1 932 ? -25.968 12.703  -19.660 1.00 33.69  ? 1580 ASN A CA    1 
ATOM   6824  C  C     . ASN A 1 932 ? -27.228 12.806  -18.844 1.00 35.73  ? 1580 ASN A C     1 
ATOM   6825  O  O     . ASN A 1 932 ? -28.175 13.487  -19.234 1.00 38.89  ? 1580 ASN A O     1 
ATOM   6826  C  CB    . ASN A 1 932 ? -26.286 11.753  -20.807 1.00 37.20  ? 1580 ASN A CB    1 
ATOM   6827  C  CG    . ASN A 1 932 ? -25.590 12.122  -22.092 1.00 42.24  ? 1580 ASN A CG    1 
ATOM   6828  O  OD1   . ASN A 1 932 ? -25.055 13.224  -22.239 1.00 42.72  ? 1580 ASN A OD1   1 
ATOM   6829  N  ND2   . ASN A 1 932 ? -25.605 11.199  -23.045 1.00 42.44  ? 1580 ASN A ND2   1 
ATOM   6830  N  N     . ALA A 1 933 ? -27.254 12.094  -17.727 1.00 33.35  ? 1581 ALA A N     1 
ATOM   6831  C  CA    . ALA A 1 933 ? -28.507 11.818  -17.047 1.00 33.68  ? 1581 ALA A CA    1 
ATOM   6832  C  C     . ALA A 1 933 ? -28.887 12.907  -16.070 1.00 34.41  ? 1581 ALA A C     1 
ATOM   6833  O  O     . ALA A 1 933 ? -28.017 13.562  -15.500 1.00 35.67  ? 1581 ALA A O     1 
ATOM   6834  C  CB    . ALA A 1 933 ? -28.430 10.481  -16.338 1.00 35.46  ? 1581 ALA A CB    1 
ATOM   6835  N  N     . VAL A 1 934 ? -30.189 13.096  -15.871 1.00 32.93  ? 1582 VAL A N     1 
ATOM   6836  C  CA    . VAL A 1 934 ? -30.649 14.012  -14.841 1.00 33.01  ? 1582 VAL A CA    1 
ATOM   6837  C  C     . VAL A 1 934 ? -30.363 13.392  -13.496 1.00 31.61  ? 1582 VAL A C     1 
ATOM   6838  O  O     . VAL A 1 934 ? -30.735 12.246  -13.250 1.00 31.76  ? 1582 VAL A O     1 
ATOM   6839  C  CB    . VAL A 1 934 ? -32.149 14.300  -14.921 1.00 33.72  ? 1582 VAL A CB    1 
ATOM   6840  C  CG1   . VAL A 1 934 ? -32.570 15.161  -13.738 1.00 31.01  ? 1582 VAL A CG1   1 
ATOM   6841  C  CG2   . VAL A 1 934 ? -32.482 14.995  -16.218 1.00 35.52  ? 1582 VAL A CG2   1 
ATOM   6842  N  N     . PRO A 1 935 ? -29.683 14.143  -12.622 1.00 31.23  ? 1583 PRO A N     1 
ATOM   6843  C  CA    . PRO A 1 935 ? -29.384 13.652  -11.273 1.00 33.20  ? 1583 PRO A CA    1 
ATOM   6844  C  C     . PRO A 1 935 ? -30.670 13.242  -10.556 1.00 30.99  ? 1583 PRO A C     1 
ATOM   6845  O  O     . PRO A 1 935 ? -31.578 14.050  -10.398 1.00 31.02  ? 1583 PRO A O     1 
ATOM   6846  C  CB    . PRO A 1 935 ? -28.741 14.865  -10.602 1.00 33.53  ? 1583 PRO A CB    1 
ATOM   6847  C  CG    . PRO A 1 935 ? -28.143 15.638  -11.737 1.00 31.49  ? 1583 PRO A CG    1 
ATOM   6848  C  CD    . PRO A 1 935 ? -29.102 15.471  -12.873 1.00 30.56  ? 1583 PRO A CD    1 
ATOM   6849  N  N     . PRO A 1 936 ? -30.766 11.974  -10.155 1.00 31.02  ? 1584 PRO A N     1 
ATOM   6850  C  CA    . PRO A 1 936 ? -32.002 11.534  -9.510  1.00 32.32  ? 1584 PRO A CA    1 
ATOM   6851  C  C     . PRO A 1 936 ? -32.508 12.474  -8.392  1.00 30.33  ? 1584 PRO A C     1 
ATOM   6852  O  O     . PRO A 1 936 ? -33.709 12.751  -8.353  1.00 33.43  ? 1584 PRO A O     1 
ATOM   6853  C  CB    . PRO A 1 936 ? -31.631 10.141  -8.988  1.00 30.66  ? 1584 PRO A CB    1 
ATOM   6854  C  CG    . PRO A 1 936 ? -30.632 9.656   -9.972  1.00 29.84  ? 1584 PRO A CG    1 
ATOM   6855  C  CD    . PRO A 1 936 ? -29.834 10.855  -10.385 1.00 32.26  ? 1584 PRO A CD    1 
ATOM   6856  N  N     . PRO A 1 937 ? -31.615 12.954  -7.506  1.00 29.48  ? 1585 PRO A N     1 
ATOM   6857  C  CA    . PRO A 1 937 ? -32.015 13.903  -6.465  1.00 28.89  ? 1585 PRO A CA    1 
ATOM   6858  C  C     . PRO A 1 937 ? -32.834 15.068  -7.007  1.00 29.46  ? 1585 PRO A C     1 
ATOM   6859  O  O     . PRO A 1 937 ? -33.822 15.463  -6.382  1.00 29.04  ? 1585 PRO A O     1 
ATOM   6860  C  CB    . PRO A 1 937 ? -30.675 14.404  -5.937  1.00 29.13  ? 1585 PRO A CB    1 
ATOM   6861  C  CG    . PRO A 1 937 ? -29.790 13.256  -6.087  1.00 28.76  ? 1585 PRO A CG    1 
ATOM   6862  C  CD    . PRO A 1 937 ? -30.196 12.594  -7.374  1.00 30.44  ? 1585 PRO A CD    1 
ATOM   6863  N  N     . LEU A 1 938 ? -32.420 15.606  -8.150  1.00 29.06  ? 1586 LEU A N     1 
ATOM   6864  C  CA    . LEU A 1 938 ? -33.141 16.682  -8.817  1.00 28.18  ? 1586 LEU A CA    1 
ATOM   6865  C  C     . LEU A 1 938 ? -34.456 16.187  -9.402  1.00 29.77  ? 1586 LEU A C     1 
ATOM   6866  O  O     . LEU A 1 938 ? -35.486 16.845  -9.306  1.00 31.13  ? 1586 LEU A O     1 
ATOM   6867  C  CB    . LEU A 1 938 ? -32.289 17.250  -9.946  1.00 30.43  ? 1586 LEU A CB    1 
ATOM   6868  C  CG    . LEU A 1 938 ? -32.750 18.566  -10.568 1.00 31.58  ? 1586 LEU A CG    1 
ATOM   6869  C  CD1   . LEU A 1 938 ? -32.509 19.702  -9.586  1.00 32.90  ? 1586 LEU A CD1   1 
ATOM   6870  C  CD2   . LEU A 1 938 ? -32.034 18.815  -11.879 1.00 26.73  ? 1586 LEU A CD2   1 
ATOM   6871  N  N     . ALA A 1 939 ? -34.418 15.021  -10.028 1.00 30.93  ? 1587 ALA A N     1 
ATOM   6872  C  CA    . ALA A 1 939 ? -35.601 14.502  -10.677 1.00 29.52  ? 1587 ALA A CA    1 
ATOM   6873  C  C     . ALA A 1 939 ? -36.606 14.156  -9.605  1.00 29.86  ? 1587 ALA A C     1 
ATOM   6874  O  O     . ALA A 1 939 ? -37.807 14.282  -9.809  1.00 31.64  ? 1587 ALA A O     1 
ATOM   6875  C  CB    . ALA A 1 939 ? -35.258 13.296  -11.498 1.00 31.99  ? 1587 ALA A CB    1 
ATOM   6876  N  N     . LYS A 1 940 ? -36.103 13.730  -8.454  1.00 29.91  ? 1588 LYS A N     1 
ATOM   6877  C  CA    . LYS A 1 940 ? -36.959 13.408  -7.322  1.00 29.59  ? 1588 LYS A CA    1 
ATOM   6878  C  C     . LYS A 1 940 ? -37.631 14.664  -6.786  1.00 32.01  ? 1588 LYS A C     1 
ATOM   6879  O  O     . LYS A 1 940 ? -38.846 14.680  -6.577  1.00 31.45  ? 1588 LYS A O     1 
ATOM   6880  C  CB    . LYS A 1 940 ? -36.151 12.744  -6.211  1.00 29.91  ? 1588 LYS A CB    1 
ATOM   6881  C  CG    . LYS A 1 940 ? -36.982 12.254  -5.043  1.00 29.37  ? 1588 LYS A CG    1 
ATOM   6882  C  CD    . LYS A 1 940 ? -36.083 11.877  -3.894  1.00 29.45  ? 1588 LYS A CD    1 
ATOM   6883  C  CE    . LYS A 1 940 ? -36.872 11.422  -2.686  1.00 32.53  ? 1588 LYS A CE    1 
ATOM   6884  N  NZ    . LYS A 1 940 ? -36.016 11.523  -1.472  1.00 37.27  ? 1588 LYS A NZ    1 
ATOM   6885  N  N     . ALA A 1 941 ? -36.833 15.710  -6.565  1.00 30.30  ? 1589 ALA A N     1 
ATOM   6886  C  CA    . ALA A 1 941 ? -37.345 16.984  -6.082  1.00 29.91  ? 1589 ALA A CA    1 
ATOM   6887  C  C     . ALA A 1 941 ? -38.494 17.468  -6.950  1.00 33.03  ? 1589 ALA A C     1 
ATOM   6888  O  O     . ALA A 1 941 ? -39.542 17.880  -6.447  1.00 34.93  ? 1589 ALA A O     1 
ATOM   6889  C  CB    . ALA A 1 941 ? -36.250 18.014  -6.043  1.00 29.31  ? 1589 ALA A CB    1 
ATOM   6890  N  N     . ILE A 1 942 ? -38.315 17.422  -8.259  1.00 30.44  ? 1590 ILE A N     1 
ATOM   6891  C  CA    . ILE A 1 942 ? -39.414 17.808  -9.116  1.00 33.37  ? 1590 ILE A CA    1 
ATOM   6892  C  C     . ILE A 1 942 ? -40.568 16.826  -8.944  1.00 33.64  ? 1590 ILE A C     1 
ATOM   6893  O  O     . ILE A 1 942 ? -41.721 17.223  -8.781  1.00 35.15  ? 1590 ILE A O     1 
ATOM   6894  C  CB    . ILE A 1 942 ? -38.999 17.843  -10.583 1.00 33.81  ? 1590 ILE A CB    1 
ATOM   6895  C  CG1   . ILE A 1 942 ? -37.790 18.753  -10.772 1.00 32.18  ? 1590 ILE A CG1   1 
ATOM   6896  C  CG2   . ILE A 1 942 ? -40.159 18.314  -11.435 1.00 33.62  ? 1590 ILE A CG2   1 
ATOM   6897  C  CD1   . ILE A 1 942 ? -37.340 18.841  -12.219 1.00 32.90  ? 1590 ILE A CD1   1 
ATOM   6898  N  N     . GLY A 1 943 ? -40.249 15.539  -8.983  1.00 30.40  ? 1591 GLY A N     1 
ATOM   6899  C  CA    . GLY A 1 943 ? -41.257 14.510  -8.837  1.00 32.65  ? 1591 GLY A CA    1 
ATOM   6900  C  C     . GLY A 1 943 ? -42.201 14.807  -7.692  1.00 35.39  ? 1591 GLY A C     1 
ATOM   6901  O  O     . GLY A 1 943 ? -43.415 14.720  -7.851  1.00 34.95  ? 1591 GLY A O     1 
ATOM   6902  N  N     . LEU A 1 944 ? -41.646 15.172  -6.538  1.00 34.89  ? 1592 LEU A N     1 
ATOM   6903  C  CA    . LEU A 1 944 ? -42.456 15.451  -5.357  1.00 32.81  ? 1592 LEU A CA    1 
ATOM   6904  C  C     . LEU A 1 944 ? -43.349 16.670  -5.547  1.00 38.15  ? 1592 LEU A C     1 
ATOM   6905  O  O     . LEU A 1 944 ? -44.447 16.741  -4.993  1.00 40.54  ? 1592 LEU A O     1 
ATOM   6906  C  CB    . LEU A 1 944 ? -41.576 15.626  -4.125  1.00 29.87  ? 1592 LEU A CB    1 
ATOM   6907  C  CG    . LEU A 1 944 ? -40.857 14.349  -3.696  1.00 34.37  ? 1592 LEU A CG    1 
ATOM   6908  C  CD1   . LEU A 1 944 ? -39.910 14.602  -2.541  1.00 31.39  ? 1592 LEU A CD1   1 
ATOM   6909  C  CD2   . LEU A 1 944 ? -41.860 13.259  -3.339  1.00 34.91  ? 1592 LEU A CD2   1 
ATOM   6910  N  N     . GLU A 1 945 ? -42.884 17.635  -6.329  1.00 36.58  ? 1593 GLU A N     1 
ATOM   6911  C  CA    . GLU A 1 945 ? -43.699 18.801  -6.603  1.00 36.27  ? 1593 GLU A CA    1 
ATOM   6912  C  C     . GLU A 1 945 ? -44.918 18.407  -7.412  1.00 37.89  ? 1593 GLU A C     1 
ATOM   6913  O  O     . GLU A 1 945 ? -45.970 19.020  -7.295  1.00 42.29  ? 1593 GLU A O     1 
ATOM   6914  C  CB    . GLU A 1 945 ? -42.896 19.864  -7.344  1.00 37.35  ? 1593 GLU A CB    1 
ATOM   6915  C  CG    . GLU A 1 945 ? -41.890 20.572  -6.470  1.00 40.17  ? 1593 GLU A CG    1 
ATOM   6916  C  CD    . GLU A 1 945 ? -42.533 21.223  -5.259  1.00 43.94  ? 1593 GLU A CD    1 
ATOM   6917  O  OE1   . GLU A 1 945 ? -43.750 21.500  -5.310  1.00 41.06  ? 1593 GLU A OE1   1 
ATOM   6918  O  OE2   . GLU A 1 945 ? -41.819 21.453  -4.257  1.00 47.13  ? 1593 GLU A OE2   1 
ATOM   6919  N  N     . ILE A 1 946 ? -44.777 17.382  -8.237  1.00 35.21  ? 1594 ILE A N     1 
ATOM   6920  C  CA    . ILE A 1 946 ? -45.883 16.940  -9.069  1.00 37.79  ? 1594 ILE A CA    1 
ATOM   6921  C  C     . ILE A 1 946 ? -46.866 16.116  -8.247  1.00 39.79  ? 1594 ILE A C     1 
ATOM   6922  O  O     . ILE A 1 946 ? -48.075 16.200  -8.436  1.00 40.86  ? 1594 ILE A O     1 
ATOM   6923  C  CB    . ILE A 1 946 ? -45.369 16.139  -10.272 1.00 37.05  ? 1594 ILE A CB    1 
ATOM   6924  C  CG1   . ILE A 1 946 ? -44.371 16.988  -11.062 1.00 35.74  ? 1594 ILE A CG1   1 
ATOM   6925  C  CG2   . ILE A 1 946 ? -46.518 15.687  -11.153 1.00 34.40  ? 1594 ILE A CG2   1 
ATOM   6926  C  CD1   . ILE A 1 946 ? -43.983 16.413  -12.385 1.00 34.24  ? 1594 ILE A CD1   1 
ATOM   6927  N  N     . LYS A 1 947 ? -46.328 15.325  -7.328  1.00 39.31  ? 1595 LYS A N     1 
ATOM   6928  C  CA    . LYS A 1 947 ? -47.134 14.576  -6.376  1.00 41.41  ? 1595 LYS A CA    1 
ATOM   6929  C  C     . LYS A 1 947 ? -48.180 15.474  -5.711  1.00 46.16  ? 1595 LYS A C     1 
ATOM   6930  O  O     . LYS A 1 947 ? -49.318 15.056  -5.492  1.00 48.45  ? 1595 LYS A O     1 
ATOM   6931  C  CB    . LYS A 1 947 ? -46.230 13.964  -5.304  1.00 40.66  ? 1595 LYS A CB    1 
ATOM   6932  C  CG    . LYS A 1 947 ? -46.797 12.738  -4.608  1.00 42.10  ? 1595 LYS A CG    1 
ATOM   6933  C  CD    . LYS A 1 947 ? -45.823 12.207  -3.567  1.00 44.82  ? 1595 LYS A CD    1 
ATOM   6934  C  CE    . LYS A 1 947 ? -45.868 10.681  -3.472  1.00 47.48  ? 1595 LYS A CE    1 
ATOM   6935  N  NZ    . LYS A 1 947 ? -44.802 10.128  -2.568  1.00 47.64  ? 1595 LYS A NZ    1 
ATOM   6936  N  N     . LEU A 1 948 ? -47.792 16.706  -5.389  1.00 43.83  ? 1596 LEU A N     1 
ATOM   6937  C  CA    . LEU A 1 948 ? -48.698 17.633  -4.717  1.00 44.12  ? 1596 LEU A CA    1 
ATOM   6938  C  C     . LEU A 1 948 ? -49.869 18.052  -5.599  1.00 45.51  ? 1596 LEU A C     1 
ATOM   6939  O  O     . LEU A 1 948 ? -50.846 18.615  -5.118  1.00 50.12  ? 1596 LEU A O     1 
ATOM   6940  C  CB    . LEU A 1 948 ? -47.946 18.868  -4.222  1.00 42.55  ? 1596 LEU A CB    1 
ATOM   6941  C  CG    . LEU A 1 948 ? -47.096 18.685  -2.966  1.00 43.41  ? 1596 LEU A CG    1 
ATOM   6942  C  CD1   . LEU A 1 948 ? -46.214 19.888  -2.727  1.00 43.45  ? 1596 LEU A CD1   1 
ATOM   6943  C  CD2   . LEU A 1 948 ? -47.983 18.437  -1.764  1.00 51.94  ? 1596 LEU A CD2   1 
ATOM   6944  N  N     . CYS A 1 949 ? -49.775 17.771  -6.890  1.00 43.76  ? 1597 CYS A N     1 
ATOM   6945  C  CA    . CYS A 1 949 ? -50.828 18.167  -7.812  1.00 48.29  ? 1597 CYS A CA    1 
ATOM   6946  C  C     . CYS A 1 949 ? -51.777 17.015  -8.113  1.00 51.14  ? 1597 CYS A C     1 
ATOM   6947  O  O     . CYS A 1 949 ? -52.749 17.175  -8.848  1.00 51.88  ? 1597 CYS A O     1 
ATOM   6948  C  CB    . CYS A 1 949 ? -50.225 18.708  -9.106  1.00 44.41  ? 1597 CYS A CB    1 
ATOM   6949  S  SG    . CYS A 1 949 ? -48.972 19.957  -8.812  1.00 49.10  ? 1597 CYS A SG    1 
ATOM   6950  N  N     . LEU A 1 950 ? -51.484 15.848  -7.554  1.00 50.45  ? 1598 LEU A N     1 
ATOM   6951  C  CA    . LEU A 1 950 ? -52.364 14.699  -7.711  1.00 52.59  ? 1598 LEU A CA    1 
ATOM   6952  C  C     . LEU A 1 950 ? -53.159 14.513  -6.433  1.00 58.89  ? 1598 LEU A C     1 
ATOM   6953  O  O     . LEU A 1 950 ? -54.264 13.968  -6.438  1.00 60.65  ? 1598 LEU A O     1 
ATOM   6954  C  CB    . LEU A 1 950 ? -51.555 13.442  -8.003  1.00 49.24  ? 1598 LEU A CB    1 
ATOM   6955  C  CG    . LEU A 1 950 ? -50.676 13.504  -9.246  1.00 48.31  ? 1598 LEU A CG    1 
ATOM   6956  C  CD1   . LEU A 1 950 ? -49.900 12.211  -9.386  1.00 46.09  ? 1598 LEU A CD1   1 
ATOM   6957  C  CD2   . LEU A 1 950 ? -51.517 13.780  -10.486 1.00 45.34  ? 1598 LEU A CD2   1 
ATOM   6958  N  N     . LEU A 1 951 ? -52.569 14.976  -5.336  1.00 60.17  ? 1599 LEU A N     1 
ATOM   6959  C  CA    . LEU A 1 951 ? -53.185 14.913  -4.021  1.00 64.05  ? 1599 LEU A CA    1 
ATOM   6960  C  C     . LEU A 1 951 ? -54.056 16.161  -3.804  1.00 69.40  ? 1599 LEU A C     1 
ATOM   6961  O  O     . LEU A 1 951 ? -54.646 16.361  -2.736  1.00 71.90  ? 1599 LEU A O     1 
ATOM   6962  C  CB    . LEU A 1 951 ? -52.091 14.797  -2.959  1.00 65.41  ? 1599 LEU A CB    1 
ATOM   6963  C  CG    . LEU A 1 951 ? -52.495 14.476  -1.519  1.00 79.16  ? 1599 LEU A CG    1 
ATOM   6964  C  CD1   . LEU A 1 951 ? -53.212 13.127  -1.423  1.00 77.73  ? 1599 LEU A CD1   1 
ATOM   6965  C  CD2   . LEU A 1 951 ? -51.269 14.511  -0.616  1.00 79.73  ? 1599 LEU A CD2   1 
ATOM   6966  N  N     . SER A 1 952 ? -54.126 16.989  -4.847  1.00 68.65  ? 1600 SER A N     1 
ATOM   6967  C  CA    . SER A 1 952 ? -54.961 18.190  -4.876  1.00 70.51  ? 1600 SER A CA    1 
ATOM   6968  C  C     . SER A 1 952 ? -56.321 17.955  -4.218  1.00 75.44  ? 1600 SER A C     1 
ATOM   6969  O  O     . SER A 1 952 ? -56.966 18.891  -3.741  1.00 76.80  ? 1600 SER A O     1 
ATOM   6970  C  CB    . SER A 1 952 ? -55.156 18.648  -6.322  1.00 65.66  ? 1600 SER A CB    1 
ATOM   6971  O  "O5'" . DT  B 2 1   ? -12.245 54.291  -37.542 1.00 95.71  ? 1    DT  C "O5'" 1 
ATOM   6972  C  "C5'" . DT  B 2 1   ? -12.174 54.130  -36.129 1.00 103.19 ? 1    DT  C "C5'" 1 
ATOM   6973  C  "C4'" . DT  B 2 1   ? -12.669 52.764  -35.681 1.00 107.03 ? 1    DT  C "C4'" 1 
ATOM   6974  O  "O4'" . DT  B 2 1   ? -14.115 52.693  -35.662 1.00 108.78 ? 1    DT  C "O4'" 1 
ATOM   6975  C  "C3'" . DT  B 2 1   ? -12.251 51.589  -36.553 1.00 107.60 ? 1    DT  C "C3'" 1 
ATOM   6976  O  "O3'" . DT  B 2 1   ? -10.991 51.117  -36.067 1.00 112.46 ? 1    DT  C "O3'" 1 
ATOM   6977  C  "C2'" . DT  B 2 1   ? -13.402 50.583  -36.396 1.00 105.20 ? 1    DT  C "C2'" 1 
ATOM   6978  C  "C1'" . DT  B 2 1   ? -14.458 51.324  -35.569 1.00 105.72 ? 1    DT  C "C1'" 1 
ATOM   6979  N  N1    . DT  B 2 1   ? -15.887 51.120  -36.020 1.00 103.98 ? 1    DT  C N1    1 
ATOM   6980  C  C2    . DT  B 2 1   ? -16.899 50.995  -35.080 1.00 104.35 ? 1    DT  C C2    1 
ATOM   6981  O  O2    . DT  B 2 1   ? -16.724 51.038  -33.870 1.00 102.71 ? 1    DT  C O2    1 
ATOM   6982  N  N3    . DT  B 2 1   ? -18.154 50.817  -35.616 1.00 103.97 ? 1    DT  C N3    1 
ATOM   6983  C  C4    . DT  B 2 1   ? -18.499 50.748  -36.955 1.00 101.15 ? 1    DT  C C4    1 
ATOM   6984  O  O4    . DT  B 2 1   ? -19.658 50.583  -37.326 1.00 98.98  ? 1    DT  C O4    1 
ATOM   6985  C  C5    . DT  B 2 1   ? -17.398 50.884  -37.877 1.00 99.24  ? 1    DT  C C5    1 
ATOM   6986  C  C7    . DT  B 2 1   ? -17.644 50.829  -39.357 1.00 94.69  ? 1    DT  C C7    1 
ATOM   6987  C  C6    . DT  B 2 1   ? -16.167 51.059  -37.373 1.00 100.37 ? 1    DT  C C6    1 
ATOM   6988  P  P     . DC  B 2 2   ? -10.431 49.674  -36.508 1.00 119.82 ? 2    DC  C P     1 
ATOM   6989  O  OP1   . DC  B 2 2   ? -8.958  49.685  -36.332 1.00 110.21 ? 2    DC  C OP1   1 
ATOM   6990  O  OP2   . DC  B 2 2   ? -11.024 49.333  -37.827 1.00 114.39 ? 2    DC  C OP2   1 
ATOM   6991  O  "O5'" . DC  B 2 2   ? -11.047 48.687  -35.411 1.00 110.73 ? 2    DC  C "O5'" 1 
ATOM   6992  C  "C5'" . DC  B 2 2   ? -11.134 49.150  -34.069 1.00 109.21 ? 2    DC  C "C5'" 1 
ATOM   6993  C  "C4'" . DC  B 2 2   ? -12.192 48.368  -33.319 1.00 112.08 ? 2    DC  C "C4'" 1 
ATOM   6994  O  "O4'" . DC  B 2 2   ? -13.490 48.593  -33.924 1.00 111.19 ? 2    DC  C "O4'" 1 
ATOM   6995  C  "C3'" . DC  B 2 2   ? -11.962 46.860  -33.336 1.00 112.81 ? 2    DC  C "C3'" 1 
ATOM   6996  O  "O3'" . DC  B 2 2   ? -11.506 46.444  -32.039 1.00 114.79 ? 2    DC  C "O3'" 1 
ATOM   6997  C  "C2'" . DC  B 2 2   ? -13.321 46.265  -33.726 1.00 109.03 ? 2    DC  C "C2'" 1 
ATOM   6998  C  "C1'" . DC  B 2 2   ? -14.287 47.449  -33.708 1.00 107.02 ? 2    DC  C "C1'" 1 
ATOM   6999  N  N1    . DC  B 2 2   ? -15.366 47.397  -34.751 1.00 104.32 ? 2    DC  C N1    1 
ATOM   7000  C  C2    . DC  B 2 2   ? -16.706 47.409  -34.342 1.00 101.87 ? 2    DC  C C2    1 
ATOM   7001  O  O2    . DC  B 2 2   ? -16.967 47.464  -33.133 1.00 99.98  ? 2    DC  C O2    1 
ATOM   7002  N  N3    . DC  B 2 2   ? -17.681 47.362  -35.285 1.00 100.96 ? 2    DC  C N3    1 
ATOM   7003  C  C4    . DC  B 2 2   ? -17.362 47.307  -36.581 1.00 100.17 ? 2    DC  C C4    1 
ATOM   7004  N  N4    . DC  B 2 2   ? -18.365 47.264  -37.465 1.00 99.09  ? 2    DC  C N4    1 
ATOM   7005  C  C5    . DC  B 2 2   ? -16.003 47.293  -37.019 1.00 99.90  ? 2    DC  C C5    1 
ATOM   7006  C  C6    . DC  B 2 2   ? -15.047 47.338  -36.081 1.00 102.65 ? 2    DC  C C6    1 
ATOM   7007  P  P     . DC  B 2 3   ? -10.772 45.023  -31.845 1.00 115.83 ? 3    DC  C P     1 
ATOM   7008  O  OP1   . DC  B 2 3   ? -9.343  45.283  -31.534 1.00 104.02 ? 3    DC  C OP1   1 
ATOM   7009  O  OP2   . DC  B 2 3   ? -11.123 44.161  -33.000 1.00 109.23 ? 3    DC  C OP2   1 
ATOM   7010  O  "O5'" . DC  B 2 3   ? -11.497 44.412  -30.554 1.00 110.15 ? 3    DC  C "O5'" 1 
ATOM   7011  C  "C5'" . DC  B 2 3   ? -12.704 45.029  -30.098 1.00 107.05 ? 3    DC  C "C5'" 1 
ATOM   7012  C  "C4'" . DC  B 2 3   ? -13.897 44.115  -30.312 1.00 108.21 ? 3    DC  C "C4'" 1 
ATOM   7013  O  "O4'" . DC  B 2 3   ? -14.572 44.387  -31.562 1.00 107.57 ? 3    DC  C "O4'" 1 
ATOM   7014  C  "C3'" . DC  B 2 3   ? -13.545 42.635  -30.364 1.00 109.13 ? 3    DC  C "C3'" 1 
ATOM   7015  O  "O3'" . DC  B 2 3   ? -13.840 42.088  -29.086 1.00 110.43 ? 3    DC  C "O3'" 1 
ATOM   7016  C  "C2'" . DC  B 2 3   ? -14.415 42.056  -31.487 1.00 105.15 ? 3    DC  C "C2'" 1 
ATOM   7017  C  "C1'" . DC  B 2 3   ? -15.298 43.225  -31.911 1.00 104.50 ? 3    DC  C "C1'" 1 
ATOM   7018  N  N1    . DC  B 2 3   ? -15.601 43.278  -33.374 1.00 102.86 ? 3    DC  C N1    1 
ATOM   7019  C  C2    . DC  B 2 3   ? -16.932 43.291  -33.821 1.00 103.30 ? 3    DC  C C2    1 
ATOM   7020  O  O2    . DC  B 2 3   ? -17.854 43.250  -32.993 1.00 103.69 ? 3    DC  C O2    1 
ATOM   7021  N  N3    . DC  B 2 3   ? -17.178 43.346  -35.159 1.00 101.44 ? 3    DC  C N3    1 
ATOM   7022  C  C4    . DC  B 2 3   ? -16.164 43.387  -36.028 1.00 102.13 ? 3    DC  C C4    1 
ATOM   7023  N  N4    . DC  B 2 3   ? -16.449 43.440  -37.336 1.00 100.45 ? 3    DC  C N4    1 
ATOM   7024  C  C5    . DC  B 2 3   ? -14.806 43.376  -35.586 1.00 103.30 ? 3    DC  C C5    1 
ATOM   7025  C  C6    . DC  B 2 3   ? -14.573 43.320  -34.269 1.00 103.10 ? 3    DC  C C6    1 
ATOM   7026  P  P     . DC  B 2 4   ? -13.616 40.525  -28.800 1.00 109.76 ? 4    DC  C P     1 
ATOM   7027  O  OP1   . DC  B 2 4   ? -13.300 40.368  -27.360 1.00 106.69 ? 4    DC  C OP1   1 
ATOM   7028  O  OP2   . DC  B 2 4   ? -12.675 40.004  -29.819 1.00 108.65 ? 4    DC  C OP2   1 
ATOM   7029  O  "O5'" . DC  B 2 4   ? -15.053 39.886  -29.090 1.00 107.62 ? 4    DC  C "O5'" 1 
ATOM   7030  C  "C5'" . DC  B 2 4   ? -16.195 40.400  -28.415 1.00 107.13 ? 4    DC  C "C5'" 1 
ATOM   7031  C  "C4'" . DC  B 2 4   ? -17.441 39.709  -28.923 1.00 109.26 ? 4    DC  C "C4'" 1 
ATOM   7032  O  "O4'" . DC  B 2 4   ? -17.702 40.124  -30.287 1.00 106.91 ? 4    DC  C "O4'" 1 
ATOM   7033  C  "C3'" . DC  B 2 4   ? -17.332 38.189  -28.942 1.00 114.28 ? 4    DC  C "C3'" 1 
ATOM   7034  O  "O3'" . DC  B 2 4   ? -18.524 37.639  -28.374 1.00 118.93 ? 4    DC  C "O3'" 1 
ATOM   7035  C  "C2'" . DC  B 2 4   ? -17.137 37.847  -30.422 1.00 107.19 ? 4    DC  C "C2'" 1 
ATOM   7036  C  "C1'" . DC  B 2 4   ? -17.867 38.989  -31.118 1.00 106.52 ? 4    DC  C "C1'" 1 
ATOM   7037  N  N1    . DC  B 2 4   ? -17.328 39.314  -32.471 1.00 103.92 ? 4    DC  C N1    1 
ATOM   7038  C  C2    . DC  B 2 4   ? -18.209 39.597  -33.529 1.00 101.25 ? 4    DC  C C2    1 
ATOM   7039  O  O2    . DC  B 2 4   ? -19.434 39.573  -33.337 1.00 101.89 ? 4    DC  C O2    1 
ATOM   7040  N  N3    . DC  B 2 4   ? -17.692 39.895  -34.746 1.00 98.41  ? 4    DC  C N3    1 
ATOM   7041  C  C4    . DC  B 2 4   ? -16.369 39.916  -34.927 1.00 99.43  ? 4    DC  C C4    1 
ATOM   7042  N  N4    . DC  B 2 4   ? -15.912 40.214  -36.150 1.00 97.94  ? 4    DC  C N4    1 
ATOM   7043  C  C5    . DC  B 2 4   ? -15.460 39.631  -33.863 1.00 101.15 ? 4    DC  C C5    1 
ATOM   7044  C  C6    . DC  B 2 4   ? -15.977 39.336  -32.664 1.00 102.88 ? 4    DC  C C6    1 
ATOM   7045  P  P     . DG  B 2 5   ? -18.676 36.049  -28.171 1.00 128.69 ? 5    DG  C P     1 
ATOM   7046  O  OP1   . DG  B 2 5   ? -19.496 35.823  -26.953 1.00 121.24 ? 5    DG  C OP1   1 
ATOM   7047  O  OP2   . DG  B 2 5   ? -17.323 35.441  -28.258 1.00 115.12 ? 5    DG  C OP2   1 
ATOM   7048  O  "O5'" . DG  B 2 5   ? -19.512 35.585  -29.466 1.00 116.18 ? 5    DG  C "O5'" 1 
ATOM   7049  C  "C5'" . DG  B 2 5   ? -20.818 36.130  -29.735 1.00 109.93 ? 5    DG  C "C5'" 1 
ATOM   7050  C  "C4'" . DG  B 2 5   ? -21.408 35.594  -31.038 1.00 103.69 ? 5    DG  C "C4'" 1 
ATOM   7051  O  "O4'" . DG  B 2 5   ? -20.796 36.255  -32.182 1.00 103.80 ? 5    DG  C "O4'" 1 
ATOM   7052  C  "C3'" . DG  B 2 5   ? -21.228 34.091  -31.270 1.00 100.20 ? 5    DG  C "C3'" 1 
ATOM   7053  O  "O3'" . DG  B 2 5   ? -22.423 33.508  -31.790 1.00 96.99  ? 5    DG  C "O3'" 1 
ATOM   7054  C  "C2'" . DG  B 2 5   ? -20.093 34.032  -32.285 1.00 98.64  ? 5    DG  C "C2'" 1 
ATOM   7055  C  "C1'" . DG  B 2 5   ? -20.410 35.267  -33.120 1.00 100.23 ? 5    DG  C "C1'" 1 
ATOM   7056  N  N9    . DG  B 2 5   ? -19.274 35.716  -33.930 1.00 98.55  ? 5    DG  C N9    1 
ATOM   7057  C  C8    . DG  B 2 5   ? -17.952 35.751  -33.551 1.00 96.22  ? 5    DG  C C8    1 
ATOM   7058  N  N7    . DG  B 2 5   ? -17.159 36.193  -34.487 1.00 94.76  ? 5    DG  C N7    1 
ATOM   7059  C  C5    . DG  B 2 5   ? -18.005 36.467  -35.558 1.00 94.77  ? 5    DG  C C5    1 
ATOM   7060  C  C6    . DG  B 2 5   ? -17.714 36.972  -36.852 1.00 94.60  ? 5    DG  C C6    1 
ATOM   7061  O  O6    . DG  B 2 5   ? -16.611 37.288  -37.326 1.00 94.43  ? 5    DG  C O6    1 
ATOM   7062  N  N1    . DG  B 2 5   ? -18.864 37.100  -37.630 1.00 93.88  ? 5    DG  C N1    1 
ATOM   7063  C  C2    . DG  B 2 5   ? -20.135 36.782  -37.213 1.00 94.06  ? 5    DG  C C2    1 
ATOM   7064  N  N2    . DG  B 2 5   ? -21.120 36.971  -38.105 1.00 94.67  ? 5    DG  C N2    1 
ATOM   7065  N  N3    . DG  B 2 5   ? -20.422 36.311  -36.005 1.00 94.41  ? 5    DG  C N3    1 
ATOM   7066  C  C4    . DG  B 2 5   ? -19.312 36.177  -35.232 1.00 95.88  ? 5    DG  C C4    1 
ATOM   7067  P  P     . DT  B 2 6   ? -22.660 31.916  -31.697 1.00 101.43 ? 6    DT  C P     1 
ATOM   7068  O  OP1   . DT  B 2 6   ? -24.119 31.669  -31.774 1.00 89.86  ? 6    DT  C OP1   1 
ATOM   7069  O  OP2   . DT  B 2 6   ? -21.869 31.398  -30.554 1.00 97.87  ? 6    DT  C OP2   1 
ATOM   7070  O  "O5'" . DT  B 2 6   ? -21.971 31.348  -33.029 1.00 96.16  ? 6    DT  C "O5'" 1 
ATOM   7071  C  "C5'" . DT  B 2 6   ? -22.755 31.078  -34.195 1.00 92.91  ? 6    DT  C "C5'" 1 
ATOM   7072  C  "C4'" . DT  B 2 6   ? -22.801 32.272  -35.134 1.00 90.68  ? 6    DT  C "C4'" 1 
ATOM   7073  O  "O4'" . DT  B 2 6   ? -21.482 32.854  -35.207 1.00 90.75  ? 6    DT  C "O4'" 1 
ATOM   7074  C  "C3'" . DT  B 2 6   ? -23.174 31.930  -36.578 1.00 90.79  ? 6    DT  C "C3'" 1 
ATOM   7075  O  "O3'" . DT  B 2 6   ? -24.366 32.592  -36.976 1.00 89.64  ? 6    DT  C "O3'" 1 
ATOM   7076  C  "C2'" . DT  B 2 6   ? -21.990 32.364  -37.445 1.00 92.19  ? 6    DT  C "C2'" 1 
ATOM   7077  C  "C1'" . DT  B 2 6   ? -21.227 33.297  -36.521 1.00 92.32  ? 6    DT  C "C1'" 1 
ATOM   7078  N  N1    . DT  B 2 6   ? -19.749 33.260  -36.725 1.00 93.55  ? 6    DT  C N1    1 
ATOM   7079  C  C2    . DT  B 2 6   ? -19.195 33.640  -37.935 1.00 91.78  ? 6    DT  C C2    1 
ATOM   7080  O  O2    . DT  B 2 6   ? -19.855 34.019  -38.892 1.00 88.75  ? 6    DT  C O2    1 
ATOM   7081  N  N3    . DT  B 2 6   ? -17.819 33.556  -37.972 1.00 90.87  ? 6    DT  C N3    1 
ATOM   7082  C  C4    . DT  B 2 6   ? -16.966 33.143  -36.956 1.00 89.88  ? 6    DT  C C4    1 
ATOM   7083  O  O4    . DT  B 2 6   ? -15.746 33.102  -37.083 1.00 87.71  ? 6    DT  C O4    1 
ATOM   7084  C  C5    . DT  B 2 6   ? -17.615 32.761  -35.727 1.00 90.97  ? 6    DT  C C5    1 
ATOM   7085  C  C7    . DT  B 2 6   ? -16.807 32.298  -34.551 1.00 86.79  ? 6    DT  C C7    1 
ATOM   7086  C  C6    . DT  B 2 6   ? -18.952 32.839  -35.677 1.00 92.26  ? 6    DT  C C6    1 
ATOM   7087  P  P     . DG  B 2 7   ? -25.800 31.900  -36.718 1.00 89.23  ? 7    DG  C P     1 
ATOM   7088  O  OP1   . DG  B 2 7   ? -26.832 32.969  -36.686 1.00 84.66  ? 7    DG  C OP1   1 
ATOM   7089  O  OP2   . DG  B 2 7   ? -25.660 30.971  -35.569 1.00 88.48  ? 7    DG  C OP2   1 
ATOM   7090  O  "O5'" . DG  B 2 7   ? -26.043 31.020  -38.031 1.00 86.37  ? 7    DG  C "O5'" 1 
ATOM   7091  C  "C5'" . DG  B 2 7   ? -26.058 31.645  -39.298 1.00 88.30  ? 7    DG  C "C5'" 1 
ATOM   7092  C  "C4'" . DG  B 2 7   ? -25.114 30.919  -40.234 1.00 89.69  ? 7    DG  C "C4'" 1 
ATOM   7093  O  "O4'" . DG  B 2 7   ? -23.735 31.051  -39.793 1.00 90.46  ? 7    DG  C "O4'" 1 
ATOM   7094  C  "C3'" . DG  B 2 7   ? -25.360 29.423  -40.328 1.00 90.24  ? 7    DG  C "C3'" 1 
ATOM   7095  O  "O3'" . DG  B 2 7   ? -25.208 29.079  -41.677 1.00 90.96  ? 7    DG  C "O3'" 1 
ATOM   7096  C  "C2'" . DG  B 2 7   ? -24.219 28.844  -39.504 1.00 91.06  ? 7    DG  C "C2'" 1 
ATOM   7097  C  "C1'" . DG  B 2 7   ? -23.129 29.791  -39.964 1.00 89.39  ? 7    DG  C "C1'" 1 
ATOM   7098  N  N9    . DG  B 2 7   ? -21.892 29.673  -39.201 1.00 90.50  ? 7    DG  C N9    1 
ATOM   7099  C  C8    . DG  B 2 7   ? -21.708 29.064  -37.981 1.00 90.21  ? 7    DG  C C8    1 
ATOM   7100  N  N7    . DG  B 2 7   ? -20.473 29.113  -37.560 1.00 91.61  ? 7    DG  C N7    1 
ATOM   7101  C  C5    . DG  B 2 7   ? -19.797 29.796  -38.570 1.00 92.47  ? 7    DG  C C5    1 
ATOM   7102  C  C6    . DG  B 2 7   ? -18.430 30.160  -38.692 1.00 90.50  ? 7    DG  C C6    1 
ATOM   7103  O  O6    . DG  B 2 7   ? -17.497 29.948  -37.905 1.00 88.62  ? 7    DG  C O6    1 
ATOM   7104  N  N1    . DG  B 2 7   ? -18.184 30.842  -39.884 1.00 89.51  ? 7    DG  C N1    1 
ATOM   7105  C  C2    . DG  B 2 7   ? -19.126 31.139  -40.841 1.00 89.05  ? 7    DG  C C2    1 
ATOM   7106  N  N2    . DG  B 2 7   ? -18.690 31.802  -41.922 1.00 88.75  ? 7    DG  C N2    1 
ATOM   7107  N  N3    . DG  B 2 7   ? -20.405 30.806  -40.743 1.00 89.24  ? 7    DG  C N3    1 
ATOM   7108  C  C4    . DG  B 2 7   ? -20.660 30.141  -39.589 1.00 91.21  ? 7    DG  C C4    1 
ATOM   7109  P  P     . DA  B 2 8   ? -26.465 29.152  -42.671 1.00 98.51  ? 8    DA  C P     1 
ATOM   7110  O  OP1   . DA  B 2 8   ? -26.967 30.549  -42.673 1.00 95.92  ? 8    DA  C OP1   1 
ATOM   7111  O  OP2   . DA  B 2 8   ? -27.378 28.030  -42.330 1.00 94.34  ? 8    DA  C OP2   1 
ATOM   7112  O  "O5'" . DA  B 2 8   ? -25.816 28.886  -44.107 1.00 95.31  ? 8    DA  C "O5'" 1 
ATOM   7113  C  "C5'" . DA  B 2 8   ? -25.811 29.943  -45.056 1.00 96.43  ? 8    DA  C "C5'" 1 
ATOM   7114  C  "C4'" . DA  B 2 8   ? -24.591 29.887  -45.963 1.00 97.05  ? 8    DA  C "C4'" 1 
ATOM   7115  O  "O4'" . DA  B 2 8   ? -23.383 29.769  -45.166 1.00 95.82  ? 8    DA  C "O4'" 1 
ATOM   7116  C  "C3'" . DA  B 2 8   ? -24.553 28.722  -46.944 1.00 100.64 ? 8    DA  C "C3'" 1 
ATOM   7117  O  "O3'" . DA  B 2 8   ? -23.926 29.195  -48.133 1.00 101.36 ? 8    DA  C "O3'" 1 
ATOM   7118  C  "C2'" . DA  B 2 8   ? -23.730 27.672  -46.199 1.00 95.98  ? 8    DA  C "C2'" 1 
ATOM   7119  C  "C1'" . DA  B 2 8   ? -22.735 28.536  -45.433 1.00 94.62  ? 8    DA  C "C1'" 1 
ATOM   7120  N  N9    . DA  B 2 8   ? -22.266 27.962  -44.168 1.00 92.57  ? 8    DA  C N9    1 
ATOM   7121  C  C8    . DA  B 2 8   ? -22.972 27.214  -43.263 1.00 91.39  ? 8    DA  C C8    1 
ATOM   7122  N  N7    . DA  B 2 8   ? -22.272 26.848  -42.215 1.00 88.71  ? 8    DA  C N7    1 
ATOM   7123  C  C5    . DA  B 2 8   ? -21.020 27.395  -42.442 1.00 88.58  ? 8    DA  C C5    1 
ATOM   7124  C  C6    . DA  B 2 8   ? -19.820 27.373  -41.700 1.00 88.74  ? 8    DA  C C6    1 
ATOM   7125  N  N6    . DA  B 2 8   ? -19.679 26.750  -40.524 1.00 89.24  ? 8    DA  C N6    1 
ATOM   7126  N  N1    . DA  B 2 8   ? -18.758 28.020  -42.220 1.00 88.19  ? 8    DA  C N1    1 
ATOM   7127  C  C2    . DA  B 2 8   ? -18.888 28.646  -43.394 1.00 89.03  ? 8    DA  C C2    1 
ATOM   7128  N  N3    . DA  B 2 8   ? -19.959 28.735  -44.178 1.00 89.57  ? 8    DA  C N3    1 
ATOM   7129  C  C4    . DA  B 2 8   ? -21.000 28.082  -43.640 1.00 90.07  ? 8    DA  C C4    1 
ATOM   7130  P  P     . DG  B 2 9   ? -23.648 28.197  -49.362 1.00 104.50 ? 9    DG  C P     1 
ATOM   7131  O  OP1   . DG  B 2 9   ? -23.584 29.012  -50.600 1.00 100.74 ? 9    DG  C OP1   1 
ATOM   7132  O  OP2   . DG  B 2 9   ? -24.613 27.072  -49.272 1.00 94.04  ? 9    DG  C OP2   1 
ATOM   7133  O  "O5'" . DG  B 2 9   ? -22.187 27.622  -49.049 1.00 99.20  ? 9    DG  C "O5'" 1 
ATOM   7134  C  "C5'" . DG  B 2 9   ? -21.084 28.524  -48.966 1.00 98.24  ? 9    DG  C "C5'" 1 
ATOM   7135  C  "C4'" . DG  B 2 9   ? -19.796 27.778  -48.674 1.00 96.91  ? 9    DG  C "C4'" 1 
ATOM   7136  O  "O4'" . DG  B 2 9   ? -19.789 27.372  -47.283 1.00 97.78  ? 9    DG  C "O4'" 1 
ATOM   7137  C  "C3'" . DG  B 2 9   ? -19.584 26.507  -49.494 1.00 98.26  ? 9    DG  C "C3'" 1 
ATOM   7138  O  "O3'" . DG  B 2 9   ? -18.226 26.443  -49.932 1.00 101.52 ? 9    DG  C "O3'" 1 
ATOM   7139  C  "C2'" . DG  B 2 9   ? -19.935 25.391  -48.510 1.00 96.73  ? 9    DG  C "C2'" 1 
ATOM   7140  C  "C1'" . DG  B 2 9   ? -19.442 26.004  -47.205 1.00 95.33  ? 9    DG  C "C1'" 1 
ATOM   7141  N  N9    . DG  B 2 9   ? -20.010 25.426  -45.986 1.00 93.74  ? 9    DG  C N9    1 
ATOM   7142  C  C8    . DG  B 2 9   ? -21.313 25.057  -45.728 1.00 92.58  ? 9    DG  C C8    1 
ATOM   7143  N  N7    . DG  B 2 9   ? -21.491 24.570  -44.527 1.00 89.07  ? 9    DG  C N7    1 
ATOM   7144  C  C5    . DG  B 2 9   ? -20.224 24.623  -43.952 1.00 90.37  ? 9    DG  C C5    1 
ATOM   7145  C  C6    . DG  B 2 9   ? -19.777 24.234  -42.665 1.00 90.39  ? 9    DG  C C6    1 
ATOM   7146  O  O6    . DG  B 2 9   ? -20.441 23.747  -41.735 1.00 92.15  ? 9    DG  C O6    1 
ATOM   7147  N  N1    . DG  B 2 9   ? -18.409 24.465  -42.503 1.00 87.79  ? 9    DG  C N1    1 
ATOM   7148  C  C2    . DG  B 2 9   ? -17.574 25.000  -43.458 1.00 87.81  ? 9    DG  C C2    1 
ATOM   7149  N  N2    . DG  B 2 9   ? -16.283 25.148  -43.124 1.00 88.63  ? 9    DG  C N2    1 
ATOM   7150  N  N3    . DG  B 2 9   ? -17.978 25.363  -44.665 1.00 89.51  ? 9    DG  C N3    1 
ATOM   7151  C  C4    . DG  B 2 9   ? -19.306 25.148  -44.837 1.00 92.16  ? 9    DG  C C4    1 
ATOM   7152  P  P     . DC  B 2 10  ? -17.804 25.455  -51.133 1.00 110.09 ? 10   DC  C P     1 
ATOM   7153  O  OP1   . DC  B 2 10  ? -17.431 26.292  -52.306 1.00 98.57  ? 10   DC  C OP1   1 
ATOM   7154  O  OP2   . DC  B 2 10  ? -18.849 24.404  -51.249 1.00 101.22 ? 10   DC  C OP2   1 
ATOM   7155  O  "O5'" . DC  B 2 10  ? -16.473 24.747  -50.587 1.00 101.01 ? 10   DC  C "O5'" 1 
ATOM   7156  C  "C5'" . DC  B 2 10  ? -15.304 25.530  -50.362 1.00 99.05  ? 10   DC  C "C5'" 1 
ATOM   7157  C  "C4'" . DC  B 2 10  ? -14.499 24.961  -49.209 1.00 96.13  ? 10   DC  C "C4'" 1 
ATOM   7158  O  "O4'" . DC  B 2 10  ? -15.390 24.632  -48.111 1.00 98.86  ? 10   DC  C "O4'" 1 
ATOM   7159  C  "C3'" . DC  B 2 10  ? -13.734 23.675  -49.500 1.00 93.13  ? 10   DC  C "C3'" 1 
ATOM   7160  O  "O3'" . DC  B 2 10  ? -12.504 23.733  -48.794 1.00 96.10  ? 10   DC  C "O3'" 1 
ATOM   7161  C  "C2'" . DC  B 2 10  ? -14.653 22.606  -48.923 1.00 91.54  ? 10   DC  C "C2'" 1 
ATOM   7162  C  "C1'" . DC  B 2 10  ? -15.079 23.333  -47.656 1.00 94.32  ? 10   DC  C "C1'" 1 
ATOM   7163  N  N1    . DC  B 2 10  ? -16.255 22.727  -46.955 1.00 91.83  ? 10   DC  C N1    1 
ATOM   7164  C  C2    . DC  B 2 10  ? -16.110 22.316  -45.624 1.00 87.85  ? 10   DC  C C2    1 
ATOM   7165  O  O2    . DC  B 2 10  ? -15.017 22.474  -45.064 1.00 87.10  ? 10   DC  C O2    1 
ATOM   7166  N  N3    . DC  B 2 10  ? -17.174 21.758  -44.993 1.00 88.19  ? 10   DC  C N3    1 
ATOM   7167  C  C4    . DC  B 2 10  ? -18.335 21.606  -45.639 1.00 89.81  ? 10   DC  C C4    1 
ATOM   7168  N  N4    . DC  B 2 10  ? -19.358 21.051  -44.972 1.00 88.57  ? 10   DC  C N4    1 
ATOM   7169  C  C5    . DC  B 2 10  ? -18.498 22.018  -46.997 1.00 89.85  ? 10   DC  C C5    1 
ATOM   7170  C  C6    . DC  B 2 10  ? -17.443 22.566  -47.611 1.00 92.09  ? 10   DC  C C6    1 
ATOM   7171  P  P     . DC  B 2 11  ? -11.458 22.516  -48.883 1.00 97.65  ? 11   DC  C P     1 
ATOM   7172  O  OP1   . DC  B 2 11  ? -10.099 23.091  -48.999 1.00 92.33  ? 11   DC  C OP1   1 
ATOM   7173  O  OP2   . DC  B 2 11  ? -11.956 21.559  -49.901 1.00 94.95  ? 11   DC  C OP2   1 
ATOM   7174  O  "O5'" . DC  B 2 11  ? -11.572 21.821  -47.448 1.00 93.23  ? 11   DC  C "O5'" 1 
ATOM   7175  C  "C5'" . DC  B 2 11  ? -11.143 22.521  -46.290 1.00 90.81  ? 11   DC  C "C5'" 1 
ATOM   7176  C  "C4'" . DC  B 2 11  ? -11.068 21.546  -45.134 1.00 89.50  ? 11   DC  C "C4'" 1 
ATOM   7177  O  "O4'" . DC  B 2 11  ? -12.408 21.142  -44.752 1.00 88.28  ? 11   DC  C "O4'" 1 
ATOM   7178  C  "C3'" . DC  B 2 11  ? -10.299 20.266  -45.448 1.00 88.15  ? 11   DC  C "C3'" 1 
ATOM   7179  O  "O3'" . DC  B 2 11  ? -9.442  19.978  -44.358 1.00 87.83  ? 11   DC  C "O3'" 1 
ATOM   7180  C  "C2'" . DC  B 2 11  ? -11.388 19.211  -45.625 1.00 84.36  ? 11   DC  C "C2'" 1 
ATOM   7181  C  "C1'" . DC  B 2 11  ? -12.495 19.731  -44.716 1.00 85.05  ? 11   DC  C "C1'" 1 
ATOM   7182  N  N1    . DC  B 2 11  ? -13.862 19.344  -45.159 1.00 83.65  ? 11   DC  C N1    1 
ATOM   7183  C  C2    . DC  B 2 11  ? -14.741 18.724  -44.260 1.00 84.34  ? 11   DC  C C2    1 
ATOM   7184  O  O2    . DC  B 2 11  ? -14.362 18.502  -43.101 1.00 83.55  ? 11   DC  C O2    1 
ATOM   7185  N  N3    . DC  B 2 11  ? -15.987 18.383  -44.687 1.00 83.31  ? 11   DC  C N3    1 
ATOM   7186  C  C4    . DC  B 2 11  ? -16.356 18.637  -45.943 1.00 82.03  ? 11   DC  C C4    1 
ATOM   7187  N  N4    . DC  B 2 11  ? -17.588 18.285  -46.319 1.00 79.85  ? 11   DC  C N4    1 
ATOM   7188  C  C5    . DC  B 2 11  ? -15.472 19.265  -46.868 1.00 84.64  ? 11   DC  C C5    1 
ATOM   7189  C  C6    . DC  B 2 11  ? -14.249 19.598  -46.440 1.00 84.58  ? 11   DC  C C6    1 
ATOM   7190  P  P     . DT  B 2 12  ? -8.494  18.681  -44.390 1.00 94.28  ? 12   DT  C P     1 
ATOM   7191  O  OP1   . DT  B 2 12  ? -7.205  19.042  -43.740 1.00 83.69  ? 12   DT  C OP1   1 
ATOM   7192  O  OP2   . DT  B 2 12  ? -8.486  18.154  -45.775 1.00 85.66  ? 12   DT  C OP2   1 
ATOM   7193  O  "O5'" . DT  B 2 12  ? -9.293  17.614  -43.490 1.00 86.23  ? 12   DT  C "O5'" 1 
ATOM   7194  C  "C5'" . DT  B 2 12  ? -9.839  17.985  -42.221 1.00 79.64  ? 12   DT  C "C5'" 1 
ATOM   7195  C  "C4'" . DT  B 2 12  ? -10.488 16.804  -41.511 1.00 77.08  ? 12   DT  C "C4'" 1 
ATOM   7196  O  "O4'" . DT  B 2 12  ? -11.866 16.641  -41.937 1.00 75.27  ? 12   DT  C "O4'" 1 
ATOM   7197  C  "C3'" . DT  B 2 12  ? -9.796  15.454  -41.704 1.00 78.52  ? 12   DT  C "C3'" 1 
ATOM   7198  O  "O3'" . DT  B 2 12  ? -9.365  14.944  -40.424 1.00 77.16  ? 12   DT  C "O3'" 1 
ATOM   7199  C  "C2'" . DT  B 2 12  ? -10.848 14.575  -42.393 1.00 77.16  ? 12   DT  C "C2'" 1 
ATOM   7200  C  "C1'" . DT  B 2 12  ? -12.175 15.271  -42.120 1.00 74.35  ? 12   DT  C "C1'" 1 
ATOM   7201  N  N1    . DT  B 2 12  ? -13.160 15.195  -43.250 1.00 76.09  ? 12   DT  C N1    1 
ATOM   7202  C  C2    . DT  B 2 12  ? -14.494 14.941  -43.007 1.00 77.08  ? 12   DT  C C2    1 
ATOM   7203  O  O2    . DT  B 2 12  ? -14.953 14.747  -41.896 1.00 80.00  ? 12   DT  C O2    1 
ATOM   7204  N  N3    . DT  B 2 12  ? -15.291 14.919  -44.124 1.00 75.41  ? 12   DT  C N3    1 
ATOM   7205  C  C4    . DT  B 2 12  ? -14.906 15.123  -45.433 1.00 76.92  ? 12   DT  C C4    1 
ATOM   7206  O  O4    . DT  B 2 12  ? -15.707 15.080  -46.363 1.00 78.14  ? 12   DT  C O4    1 
ATOM   7207  C  C5    . DT  B 2 12  ? -13.500 15.384  -45.618 1.00 77.21  ? 12   DT  C C5    1 
ATOM   7208  C  C7    . DT  B 2 12  ? -12.941 15.619  -46.989 1.00 78.96  ? 12   DT  C C7    1 
ATOM   7209  C  C6    . DT  B 2 12  ? -12.712 15.408  -44.537 1.00 77.47  ? 12   DT  C C6    1 
ATOM   7210  P  P     . DC  B 2 13  ? -8.590  13.537  -40.321 1.00 71.52  ? 13   DC  C P     1 
ATOM   7211  O  OP1   . DC  B 2 13  ? -7.382  13.739  -39.500 1.00 73.27  ? 13   DC  C OP1   1 
ATOM   7212  O  OP2   . DC  B 2 13  ? -8.430  12.995  -41.688 1.00 75.12  ? 13   DC  C OP2   1 
ATOM   7213  O  "O5'" . DC  B 2 13  ? -9.617  12.607  -39.527 1.00 69.48  ? 13   DC  C "O5'" 1 
ATOM   7214  C  "C5'" . DC  B 2 13  ? -11.012 12.817  -39.697 1.00 68.21  ? 13   DC  C "C5'" 1 
ATOM   7215  C  "C4'" . DC  B 2 13  ? -11.813 11.536  -39.549 1.00 68.80  ? 13   DC  C "C4'" 1 
ATOM   7216  O  "O4'" . DC  B 2 13  ? -12.825 11.517  -40.587 1.00 71.26  ? 13   DC  C "O4'" 1 
ATOM   7217  C  "C3'" . DC  B 2 13  ? -11.067 10.229  -39.774 1.00 69.47  ? 13   DC  C "C3'" 1 
ATOM   7218  O  "O3'" . DC  B 2 13  ? -11.907 9.123   -39.415 1.00 70.05  ? 13   DC  C "O3'" 1 
ATOM   7219  C  "C2'" . DC  B 2 13  ? -10.973 10.299  -41.288 1.00 71.02  ? 13   DC  C "C2'" 1 
ATOM   7220  C  "C1'" . DC  B 2 13  ? -12.457 10.534  -41.535 1.00 70.30  ? 13   DC  C "C1'" 1 
ATOM   7221  N  N1    . DC  B 2 13  ? -12.801 11.003  -42.900 1.00 70.71  ? 13   DC  C N1    1 
ATOM   7222  C  C2    . DC  B 2 13  ? -14.143 11.007  -43.292 1.00 70.39  ? 13   DC  C C2    1 
ATOM   7223  O  O2    . DC  B 2 13  ? -15.009 10.627  -42.494 1.00 67.65  ? 13   DC  C O2    1 
ATOM   7224  N  N3    . DC  B 2 13  ? -14.455 11.432  -44.539 1.00 72.24  ? 13   DC  C N3    1 
ATOM   7225  C  C4    . DC  B 2 13  ? -13.489 11.834  -45.366 1.00 72.48  ? 13   DC  C C4    1 
ATOM   7226  N  N4    . DC  B 2 13  ? -13.853 12.243  -46.585 1.00 71.06  ? 13   DC  C N4    1 
ATOM   7227  C  C5    . DC  B 2 13  ? -12.113 11.834  -44.979 1.00 72.59  ? 13   DC  C C5    1 
ATOM   7228  C  C6    . DC  B 2 13  ? -11.815 11.413  -43.747 1.00 71.08  ? 13   DC  C C6    1 
ATOM   7229  P  P     . DC  B 2 14  ? -11.811 8.456   -37.952 1.00 62.70  ? 14   DC  C P     1 
ATOM   7230  O  OP1   . DC  B 2 14  ? -11.443 9.516   -36.984 1.00 62.21  ? 14   DC  C OP1   1 
ATOM   7231  O  OP2   . DC  B 2 14  ? -10.981 7.239   -38.059 1.00 66.41  ? 14   DC  C OP2   1 
ATOM   7232  O  "O5'" . DC  B 2 14  ? -13.301 7.950   -37.676 1.00 61.30  ? 14   DC  C "O5'" 1 
ATOM   7233  C  "C5'" . DC  B 2 14  ? -14.306 8.829   -37.186 1.00 62.54  ? 14   DC  C "C5'" 1 
ATOM   7234  C  "C4'" . DC  B 2 14  ? -15.693 8.237   -37.378 1.00 66.56  ? 14   DC  C "C4'" 1 
ATOM   7235  O  "O4'" . DC  B 2 14  ? -16.054 8.377   -38.774 1.00 66.57  ? 14   DC  C "O4'" 1 
ATOM   7236  C  "C3'" . DC  B 2 14  ? -15.839 6.748   -37.059 1.00 70.46  ? 14   DC  C "C3'" 1 
ATOM   7237  O  "O3'" . DC  B 2 14  ? -17.146 6.444   -36.551 1.00 71.84  ? 14   DC  C "O3'" 1 
ATOM   7238  C  "C2'" . DC  B 2 14  ? -15.596 6.095   -38.416 1.00 68.05  ? 14   DC  C "C2'" 1 
ATOM   7239  C  "C1'" . DC  B 2 14  ? -16.226 7.102   -39.366 1.00 65.07  ? 14   DC  C "C1'" 1 
ATOM   7240  N  N1    . DC  B 2 14  ? -15.570 7.133   -40.697 1.00 63.87  ? 14   DC  C N1    1 
ATOM   7241  C  C2    . DC  B 2 14  ? -16.347 7.128   -41.858 1.00 64.18  ? 14   DC  C C2    1 
ATOM   7242  O  O2    . DC  B 2 14  ? -17.576 7.091   -41.760 1.00 65.13  ? 14   DC  C O2    1 
ATOM   7243  N  N3    . DC  B 2 14  ? -15.731 7.165   -43.059 1.00 64.22  ? 14   DC  C N3    1 
ATOM   7244  C  C4    . DC  B 2 14  ? -14.401 7.208   -43.118 1.00 67.00  ? 14   DC  C C4    1 
ATOM   7245  N  N4    . DC  B 2 14  ? -13.828 7.249   -44.327 1.00 70.87  ? 14   DC  C N4    1 
ATOM   7246  C  C5    . DC  B 2 14  ? -13.591 7.216   -41.946 1.00 65.33  ? 14   DC  C C5    1 
ATOM   7247  C  C6    . DC  B 2 14  ? -14.211 7.175   -40.767 1.00 64.10  ? 14   DC  C C6    1 
ATOM   7248  P  P     . DG  B 2 15  ? -17.483 4.972   -35.985 1.00 74.73  ? 15   DG  C P     1 
ATOM   7249  O  OP1   . DG  B 2 15  ? -18.493 5.121   -34.912 1.00 70.33  ? 15   DG  C OP1   1 
ATOM   7250  O  OP2   . DG  B 2 15  ? -16.201 4.269   -35.720 1.00 66.32  ? 15   DG  C OP2   1 
ATOM   7251  O  "O5'" . DG  B 2 15  ? -18.201 4.257   -37.217 1.00 67.87  ? 15   DG  C "O5'" 1 
ATOM   7252  C  "C5'" . DG  B 2 15  ? -19.451 4.785   -37.618 1.00 68.03  ? 15   DG  C "C5'" 1 
ATOM   7253  C  "C4'" . DG  B 2 15  ? -20.010 4.001   -38.780 1.00 67.70  ? 15   DG  C "C4'" 1 
ATOM   7254  O  "O4'" . DG  B 2 15  ? -19.221 4.246   -39.969 1.00 68.30  ? 15   DG  C "O4'" 1 
ATOM   7255  C  "C3'" . DG  B 2 15  ? -19.981 2.500   -38.569 1.00 73.42  ? 15   DG  C "C3'" 1 
ATOM   7256  O  "O3'" . DG  B 2 15  ? -21.166 1.958   -39.125 1.00 75.46  ? 15   DG  C "O3'" 1 
ATOM   7257  C  "C2'" . DG  B 2 15  ? -18.714 2.072   -39.310 1.00 70.20  ? 15   DG  C "C2'" 1 
ATOM   7258  C  "C1'" . DG  B 2 15  ? -18.771 3.020   -40.497 1.00 67.61  ? 15   DG  C "C1'" 1 
ATOM   7259  N  N9    . DG  B 2 15  ? -17.497 3.273   -41.153 1.00 65.46  ? 15   DG  C N9    1 
ATOM   7260  C  C8    . DG  B 2 15  ? -16.234 3.232   -40.618 1.00 63.53  ? 15   DG  C C8    1 
ATOM   7261  N  N7    . DG  B 2 15  ? -15.302 3.523   -41.486 1.00 64.83  ? 15   DG  C N7    1 
ATOM   7262  C  C5    . DG  B 2 15  ? -15.993 3.779   -42.669 1.00 66.82  ? 15   DG  C C5    1 
ATOM   7263  C  C6    . DG  B 2 15  ? -15.528 4.147   -43.959 1.00 67.87  ? 15   DG  C C6    1 
ATOM   7264  O  O6    . DG  B 2 15  ? -14.366 4.330   -44.349 1.00 66.87  ? 15   DG  C O6    1 
ATOM   7265  N  N1    . DG  B 2 15  ? -16.582 4.301   -44.853 1.00 68.11  ? 15   DG  C N1    1 
ATOM   7266  C  C2    . DG  B 2 15  ? -17.911 4.123   -44.546 1.00 69.82  ? 15   DG  C C2    1 
ATOM   7267  N  N2    . DG  B 2 15  ? -18.788 4.316   -45.540 1.00 74.47  ? 15   DG  C N2    1 
ATOM   7268  N  N3    . DG  B 2 15  ? -18.361 3.780   -43.350 1.00 67.40  ? 15   DG  C N3    1 
ATOM   7269  C  C4    . DG  B 2 15  ? -17.346 3.628   -42.469 1.00 66.56  ? 15   DG  C C4    1 
ATOM   7270  P  P     . DC  B 2 16  ? -21.518 0.407   -38.916 1.00 72.90  ? 16   DC  C P     1 
ATOM   7271  O  OP1   . DC  B 2 16  ? -22.934 0.319   -38.504 1.00 67.45  ? 16   DC  C OP1   1 
ATOM   7272  O  OP2   . DC  B 2 16  ? -20.442 -0.197  -38.091 1.00 68.82  ? 16   DC  C OP2   1 
ATOM   7273  O  "O5'" . DC  B 2 16  ? -21.405 -0.196  -40.389 1.00 74.25  ? 16   DC  C "O5'" 1 
ATOM   7274  C  "C5'" . DC  B 2 16  ? -22.054 0.494   -41.450 1.00 75.33  ? 16   DC  C "C5'" 1 
ATOM   7275  C  "C4'" . DC  B 2 16  ? -21.356 0.194   -42.758 1.00 76.64  ? 16   DC  C "C4'" 1 
ATOM   7276  O  "O4'" . DC  B 2 16  ? -19.991 0.683   -42.727 1.00 74.88  ? 16   DC  C "O4'" 1 
ATOM   7277  C  "C3'" . DC  B 2 16  ? -21.230 -1.296  -43.039 1.00 82.99  ? 16   DC  C "C3'" 1 
ATOM   7278  O  "O3'" . DC  B 2 16  ? -22.154 -1.678  -44.049 1.00 87.03  ? 16   DC  C "O3'" 1 
ATOM   7279  C  "C2'" . DC  B 2 16  ? -19.774 -1.495  -43.474 1.00 81.63  ? 16   DC  C "C2'" 1 
ATOM   7280  C  "C1'" . DC  B 2 16  ? -19.268 -0.074  -43.673 1.00 75.79  ? 16   DC  C "C1'" 1 
ATOM   7281  N  N1    . DC  B 2 16  ? -17.786 0.068   -43.487 1.00 70.66  ? 16   DC  C N1    1 
ATOM   7282  C  C2    . DC  B 2 16  ? -17.017 0.591   -44.530 1.00 73.02  ? 16   DC  C C2    1 
ATOM   7283  O  O2    . DC  B 2 16  ? -17.589 0.932   -45.576 1.00 75.31  ? 16   DC  C O2    1 
ATOM   7284  N  N3    . DC  B 2 16  ? -15.674 0.713   -44.364 1.00 69.52  ? 16   DC  C N3    1 
ATOM   7285  C  C4    . DC  B 2 16  ? -15.103 0.334   -43.221 1.00 65.98  ? 16   DC  C C4    1 
ATOM   7286  N  N4    . DC  B 2 16  ? -13.778 0.470   -43.097 1.00 63.58  ? 16   DC  C N4    1 
ATOM   7287  C  C5    . DC  B 2 16  ? -15.872 -0.205  -42.152 1.00 64.26  ? 16   DC  C C5    1 
ATOM   7288  C  C6    . DC  B 2 16  ? -17.192 -0.321  -42.327 1.00 66.45  ? 16   DC  C C6    1 
ATOM   7289  P  P     . DA  B 2 17  ? -22.422 -3.235  -44.354 1.00 94.88  ? 17   DA  C P     1 
ATOM   7290  O  OP1   . DA  B 2 17  ? -23.733 -3.594  -43.765 1.00 87.39  ? 17   DA  C OP1   1 
ATOM   7291  O  OP2   . DA  B 2 17  ? -21.197 -3.994  -43.991 1.00 84.46  ? 17   DA  C OP2   1 
ATOM   7292  O  "O5'" . DA  B 2 17  ? -22.504 -3.292  -45.953 1.00 99.56  ? 17   DA  C "O5'" 1 
ATOM   7293  C  "C5'" . DA  B 2 17  ? -22.887 -2.143  -46.712 1.00 99.43  ? 17   DA  C "C5'" 1 
ATOM   7294  C  "C4'" . DA  B 2 17  ? -22.093 -2.092  -48.006 1.00 101.50 ? 17   DA  C "C4'" 1 
ATOM   7295  O  "O4'" . DA  B 2 17  ? -20.910 -1.269  -47.814 1.00 98.15  ? 17   DA  C "O4'" 1 
ATOM   7296  C  "C3'" . DA  B 2 17  ? -21.567 -3.443  -48.485 1.00 103.07 ? 17   DA  C "C3'" 1 
ATOM   7297  O  "O3'" . DA  B 2 17  ? -22.555 -4.142  -49.284 1.00 111.63 ? 17   DA  C "O3'" 1 
ATOM   7298  C  "C2'" . DA  B 2 17  ? -20.303 -3.052  -49.247 1.00 102.33 ? 17   DA  C "C2'" 1 
ATOM   7299  C  "C1'" . DA  B 2 17  ? -19.789 -1.852  -48.461 1.00 98.40  ? 17   DA  C "C1'" 1 
ATOM   7300  N  N9    . DA  B 2 17  ? -18.786 -2.250  -47.479 1.00 95.20  ? 17   DA  C N9    1 
ATOM   7301  C  C8    . DA  B 2 17  ? -19.009 -2.840  -46.261 1.00 94.08  ? 17   DA  C C8    1 
ATOM   7302  N  N7    . DA  B 2 17  ? -17.915 -3.098  -45.582 1.00 88.97  ? 17   DA  C N7    1 
ATOM   7303  C  C5    . DA  B 2 17  ? -16.906 -2.650  -46.423 1.00 89.60  ? 17   DA  C C5    1 
ATOM   7304  C  C6    . DA  B 2 17  ? -15.508 -2.639  -46.286 1.00 87.20  ? 17   DA  C C6    1 
ATOM   7305  N  N6    . DA  B 2 17  ? -14.889 -3.113  -45.199 1.00 83.18  ? 17   DA  C N6    1 
ATOM   7306  N  N1    . DA  B 2 17  ? -14.782 -2.124  -47.308 1.00 89.90  ? 17   DA  C N1    1 
ATOM   7307  C  C2    . DA  B 2 17  ? -15.418 -1.653  -48.392 1.00 88.59  ? 17   DA  C C2    1 
ATOM   7308  N  N3    . DA  B 2 17  ? -16.728 -1.608  -48.633 1.00 89.84  ? 17   DA  C N3    1 
ATOM   7309  C  C4    . DA  B 2 17  ? -17.420 -2.127  -47.599 1.00 92.63  ? 17   DA  C C4    1 
ATOM   7310  P  P     . DG  B 2 18  ? -22.670 -3.887  -50.875 1.00 121.43 ? 18   DG  C P     1 
ATOM   7311  O  OP1   . DG  B 2 18  ? -22.743 -2.421  -51.108 1.00 109.19 ? 18   DG  C OP1   1 
ATOM   7312  O  OP2   . DG  B 2 18  ? -23.747 -4.763  -51.396 1.00 119.88 ? 18   DG  C OP2   1 
ATOM   7313  O  "O5'" . DG  B 2 18  ? -21.291 -4.461  -51.451 1.00 114.76 ? 18   DG  C "O5'" 1 
ATOM   7314  C  "C5'" . DG  B 2 18  ? -20.462 -3.708  -52.330 1.00 113.75 ? 18   DG  C "C5'" 1 
ATOM   7315  C  "C4'" . DG  B 2 18  ? -19.166 -4.482  -52.489 1.00 114.93 ? 18   DG  C "C4'" 1 
ATOM   7316  O  "O4'" . DG  B 2 18  ? -18.272 -4.291  -51.354 1.00 111.48 ? 18   DG  C "O4'" 1 
ATOM   7317  C  "C3'" . DG  B 2 18  ? -19.389 -5.989  -52.624 1.00 118.02 ? 18   DG  C "C3'" 1 
ATOM   7318  O  "O3'" . DG  B 2 18  ? -18.973 -6.359  -53.959 1.00 125.17 ? 18   DG  C "O3'" 1 
ATOM   7319  C  "C2'" . DG  B 2 18  ? -18.601 -6.586  -51.456 1.00 114.78 ? 18   DG  C "C2'" 1 
ATOM   7320  C  "C1'" . DG  B 2 18  ? -17.569 -5.506  -51.172 1.00 110.96 ? 18   DG  C "C1'" 1 
ATOM   7321  N  N9    . DG  B 2 18  ? -16.987 -5.642  -49.836 1.00 105.05 ? 18   DG  C N9    1 
ATOM   7322  C  C8    . DG  B 2 18  ? -17.613 -6.052  -48.681 1.00 102.63 ? 18   DG  C C8    1 
ATOM   7323  N  N7    . DG  B 2 18  ? -16.820 -6.092  -47.643 1.00 99.78  ? 18   DG  C N7    1 
ATOM   7324  C  C5    . DG  B 2 18  ? -15.585 -5.693  -48.143 1.00 100.41 ? 18   DG  C C5    1 
ATOM   7325  C  C6    . DG  B 2 18  ? -14.333 -5.541  -47.491 1.00 98.84  ? 18   DG  C C6    1 
ATOM   7326  O  O6    . DG  B 2 18  ? -14.051 -5.738  -46.297 1.00 96.88  ? 18   DG  C O6    1 
ATOM   7327  N  N1    . DG  B 2 18  ? -13.346 -5.115  -48.379 1.00 98.12  ? 18   DG  C N1    1 
ATOM   7328  C  C2    . DG  B 2 18  ? -13.541 -4.867  -49.718 1.00 99.30  ? 18   DG  C C2    1 
ATOM   7329  N  N2    . DG  B 2 18  ? -12.472 -4.463  -50.418 1.00 99.53  ? 18   DG  C N2    1 
ATOM   7330  N  N3    . DG  B 2 18  ? -14.704 -5.004  -50.338 1.00 100.09 ? 18   DG  C N3    1 
ATOM   7331  C  C4    . DG  B 2 18  ? -15.674 -5.418  -49.492 1.00 101.23 ? 18   DG  C C4    1 
ATOM   7332  P  P     . DG  B 2 19  ? -18.414 -7.839  -54.284 1.00 134.56 ? 19   DG  C P     1 
ATOM   7333  O  OP1   . DG  B 2 19  ? -19.077 -8.312  -55.522 1.00 126.58 ? 19   DG  C OP1   1 
ATOM   7334  O  OP2   . DG  B 2 19  ? -18.512 -8.661  -53.050 1.00 125.11 ? 19   DG  C OP2   1 
ATOM   7335  O  "O5'" . DG  B 2 19  ? -16.861 -7.586  -54.599 1.00 121.95 ? 19   DG  C "O5'" 1 
ATOM   7336  C  "C5'" . DG  B 2 19  ? -16.445 -6.384  -55.258 1.00 118.88 ? 19   DG  C "C5'" 1 
ATOM   7337  C  "C4'" . DG  B 2 19  ? -14.929 -6.317  -55.344 1.00 120.82 ? 19   DG  C "C4'" 1 
ATOM   7338  O  "O4'" . DG  B 2 19  ? -14.365 -6.174  -54.010 1.00 119.37 ? 19   DG  C "O4'" 1 
ATOM   7339  C  "C3'" . DG  B 2 19  ? -14.283 -7.560  -55.952 1.00 121.18 ? 19   DG  C "C3'" 1 
ATOM   7340  O  "O3'" . DG  B 2 19  ? -13.163 -7.202  -56.767 1.00 123.01 ? 19   DG  C "O3'" 1 
ATOM   7341  C  "C2'" . DG  B 2 19  ? -13.875 -8.388  -54.732 1.00 118.21 ? 19   DG  C "C2'" 1 
ATOM   7342  C  "C1'" . DG  B 2 19  ? -13.602 -7.324  -53.665 1.00 117.89 ? 19   DG  C "C1'" 1 
ATOM   7343  N  N9    . DG  B 2 19  ? -13.898 -7.751  -52.286 1.00 112.69 ? 19   DG  C N9    1 
ATOM   7344  C  C8    . DG  B 2 19  ? -15.109 -8.135  -51.747 1.00 108.77 ? 19   DG  C C8    1 
ATOM   7345  N  N7    . DG  B 2 19  ? -15.041 -8.458  -50.481 1.00 105.36 ? 19   DG  C N7    1 
ATOM   7346  C  C5    . DG  B 2 19  ? -13.697 -8.281  -50.150 1.00 106.83 ? 19   DG  C C5    1 
ATOM   7347  C  C6    . DG  B 2 19  ? -13.007 -8.474  -48.918 1.00 104.56 ? 19   DG  C C6    1 
ATOM   7348  O  O6    . DG  B 2 19  ? -13.462 -8.857  -47.823 1.00 101.03 ? 19   DG  C O6    1 
ATOM   7349  N  N1    . DG  B 2 19  ? -11.645 -8.172  -49.038 1.00 103.78 ? 19   DG  C N1    1 
ATOM   7350  C  C2    . DG  B 2 19  ? -11.022 -7.740  -50.192 1.00 103.95 ? 19   DG  C C2    1 
ATOM   7351  N  N2    . DG  B 2 19  ? -9.700  -7.496  -50.124 1.00 101.63 ? 19   DG  C N2    1 
ATOM   7352  N  N3    . DG  B 2 19  ? -11.658 -7.559  -51.344 1.00 106.20 ? 19   DG  C N3    1 
ATOM   7353  C  C4    . DG  B 2 19  ? -12.984 -7.847  -51.252 1.00 108.83 ? 19   DG  C C4    1 
ATOM   7354  O  "O5'" . DC  C 3 1   ? -4.923  -5.739  -41.742 1.00 102.96 ? 20   DC  I "O5'" 1 
ATOM   7355  C  "C5'" . DC  C 3 1   ? -5.786  -6.705  -42.345 1.00 108.64 ? 20   DC  I "C5'" 1 
ATOM   7356  C  "C4'" . DC  C 3 1   ? -5.268  -7.128  -43.713 1.00 111.16 ? 20   DC  I "C4'" 1 
ATOM   7357  O  "O4'" . DC  C 3 1   ? -5.922  -8.363  -44.121 1.00 109.84 ? 20   DC  I "O4'" 1 
ATOM   7358  C  "C3'" . DC  C 3 1   ? -5.478  -6.129  -44.854 1.00 110.18 ? 20   DC  I "C3'" 1 
ATOM   7359  O  "O3'" . DC  C 3 1   ? -4.329  -5.259  -44.969 1.00 113.18 ? 20   DC  I "O3'" 1 
ATOM   7360  C  "C2'" . DC  C 3 1   ? -5.627  -7.056  -46.064 1.00 107.52 ? 20   DC  I "C2'" 1 
ATOM   7361  C  "C1'" . DC  C 3 1   ? -6.307  -8.297  -45.483 1.00 106.45 ? 20   DC  I "C1'" 1 
ATOM   7362  N  N1    . DC  C 3 1   ? -7.805  -8.280  -45.555 1.00 101.63 ? 20   DC  I N1    1 
ATOM   7363  C  C2    . DC  C 3 1   ? -8.458  -8.522  -46.773 1.00 99.23  ? 20   DC  I C2    1 
ATOM   7364  O  O2    . DC  C 3 1   ? -7.789  -8.752  -47.788 1.00 98.26  ? 20   DC  I O2    1 
ATOM   7365  N  N3    . DC  C 3 1   ? -9.816  -8.494  -46.805 1.00 98.74  ? 20   DC  I N3    1 
ATOM   7366  C  C4    . DC  C 3 1   ? -10.513 -8.244  -45.694 1.00 96.94  ? 20   DC  I C4    1 
ATOM   7367  N  N4    . DC  C 3 1   ? -11.850 -8.230  -45.779 1.00 95.54  ? 20   DC  I N4    1 
ATOM   7368  C  C5    . DC  C 3 1   ? -9.866  -7.997  -44.447 1.00 97.96  ? 20   DC  I C5    1 
ATOM   7369  C  C6    . DC  C 3 1   ? -8.529  -8.023  -44.423 1.00 99.78  ? 20   DC  I C6    1 
ATOM   7370  P  P     . DC  C 3 2   ? -4.504  -3.713  -45.412 1.00 123.35 ? 21   DC  I P     1 
ATOM   7371  O  OP1   . DC  C 3 2   ? -3.567  -2.894  -44.603 1.00 118.29 ? 21   DC  I OP1   1 
ATOM   7372  O  OP2   . DC  C 3 2   ? -5.952  -3.384  -45.399 1.00 112.95 ? 21   DC  I OP2   1 
ATOM   7373  O  "O5'" . DC  C 3 2   ? -3.928  -3.680  -46.910 1.00 117.48 ? 21   DC  I "O5'" 1 
ATOM   7374  C  "C5'" . DC  C 3 2   ? -4.051  -4.801  -47.788 1.00 113.93 ? 21   DC  I "C5'" 1 
ATOM   7375  C  "C4'" . DC  C 3 2   ? -5.065  -4.508  -48.877 1.00 110.21 ? 21   DC  I "C4'" 1 
ATOM   7376  O  "O4'" . DC  C 3 2   ? -6.249  -5.320  -48.667 1.00 107.04 ? 21   DC  I "O4'" 1 
ATOM   7377  C  "C3'" . DC  C 3 2   ? -5.543  -3.065  -48.879 1.00 109.95 ? 21   DC  I "C3'" 1 
ATOM   7378  O  "O3'" . DC  C 3 2   ? -4.709  -2.291  -49.756 1.00 117.41 ? 21   DC  I "O3'" 1 
ATOM   7379  C  "C2'" . DC  C 3 2   ? -6.992  -3.181  -49.350 1.00 106.03 ? 21   DC  I "C2'" 1 
ATOM   7380  C  "C1'" . DC  C 3 2   ? -7.407  -4.621  -49.079 1.00 104.87 ? 21   DC  I "C1'" 1 
ATOM   7381  N  N1    . DC  C 3 2   ? -8.457  -4.668  -48.021 1.00 103.59 ? 21   DC  I N1    1 
ATOM   7382  C  C2    . DC  C 3 2   ? -9.806  -4.752  -48.386 1.00 101.19 ? 21   DC  I C2    1 
ATOM   7383  O  O2    . DC  C 3 2   ? -10.101 -4.805  -49.588 1.00 100.49 ? 21   DC  I O2    1 
ATOM   7384  N  N3    . DC  C 3 2   ? -10.746 -4.782  -47.401 1.00 100.30 ? 21   DC  I N3    1 
ATOM   7385  C  C4    . DC  C 3 2   ? -10.385 -4.723  -46.113 1.00 99.58  ? 21   DC  I C4    1 
ATOM   7386  N  N4    . DC  C 3 2   ? -11.345 -4.757  -45.179 1.00 97.68  ? 21   DC  I N4    1 
ATOM   7387  C  C5    . DC  C 3 2   ? -9.015  -4.629  -45.728 1.00 99.81  ? 21   DC  I C5    1 
ATOM   7388  C  C6    . DC  C 3 2   ? -8.100  -4.601  -46.704 1.00 102.66 ? 21   DC  I C6    1 
ATOM   7389  P  P     . DT  C 3 3   ? -5.339  -1.107  -50.647 1.00 122.49 ? 22   DT  I P     1 
ATOM   7390  O  OP1   . DT  C 3 3   ? -4.355  -0.755  -51.700 1.00 113.19 ? 22   DT  I OP1   1 
ATOM   7391  O  OP2   . DT  C 3 3   ? -5.825  -0.051  -49.723 1.00 108.97 ? 22   DT  I OP2   1 
ATOM   7392  O  "O5'" . DT  C 3 3   ? -6.630  -1.790  -51.312 1.00 111.29 ? 22   DT  I "O5'" 1 
ATOM   7393  C  "C5'" . DT  C 3 3   ? -6.849  -1.982  -52.696 1.00 105.82 ? 22   DT  I "C5'" 1 
ATOM   7394  C  "C4'" . DT  C 3 3   ? -8.166  -1.308  -53.020 1.00 105.12 ? 22   DT  I "C4'" 1 
ATOM   7395  O  "O4'" . DT  C 3 3   ? -9.208  -1.739  -52.107 1.00 102.19 ? 22   DT  I "O4'" 1 
ATOM   7396  C  "C3'" . DT  C 3 3   ? -8.073  0.204   -52.896 1.00 105.50 ? 22   DT  I "C3'" 1 
ATOM   7397  O  "O3'" . DT  C 3 3   ? -8.320  0.739   -54.192 1.00 110.15 ? 22   DT  I "O3'" 1 
ATOM   7398  C  "C2'" . DT  C 3 3   ? -9.104  0.603   -51.834 1.00 100.24 ? 22   DT  I "C2'" 1 
ATOM   7399  C  "C1'" . DT  C 3 3   ? -9.990  -0.632  -51.705 1.00 98.95  ? 22   DT  I "C1'" 1 
ATOM   7400  N  N1    . DT  C 3 3   ? -10.504 -0.891  -50.318 1.00 96.49  ? 22   DT  I N1    1 
ATOM   7401  C  C2    . DT  C 3 3   ? -11.861 -1.069  -50.134 1.00 93.19  ? 22   DT  I C2    1 
ATOM   7402  O  O2    . DT  C 3 3   ? -12.662 -1.019  -51.051 1.00 91.06  ? 22   DT  I O2    1 
ATOM   7403  N  N3    . DT  C 3 3   ? -12.248 -1.304  -48.833 1.00 91.24  ? 22   DT  I N3    1 
ATOM   7404  C  C4    . DT  C 3 3   ? -11.429 -1.378  -47.716 1.00 91.89  ? 22   DT  I C4    1 
ATOM   7405  O  O4    . DT  C 3 3   ? -11.861 -1.592  -46.582 1.00 87.34  ? 22   DT  I O4    1 
ATOM   7406  C  C5    . DT  C 3 3   ? -10.022 -1.183  -47.984 1.00 95.46  ? 22   DT  I C5    1 
ATOM   7407  C  C7    . DT  C 3 3   ? -9.040  -1.245  -46.851 1.00 96.29  ? 22   DT  I C7    1 
ATOM   7408  C  C6    . DT  C 3 3   ? -9.629  -0.953  -49.249 1.00 96.80  ? 22   DT  I C6    1 
ATOM   7409  P  P     . DG  C 3 4   ? -8.429  2.327   -54.409 1.00 119.98 ? 23   DG  I P     1 
ATOM   7410  O  OP1   . DG  C 3 4   ? -8.134  2.614   -55.834 1.00 116.32 ? 23   DG  I OP1   1 
ATOM   7411  O  OP2   . DG  C 3 4   ? -7.637  2.991   -53.344 1.00 112.30 ? 23   DG  I OP2   1 
ATOM   7412  O  "O5'" . DG  C 3 4   ? -9.975  2.632   -54.127 1.00 109.46 ? 23   DG  I "O5'" 1 
ATOM   7413  C  "C5'" . DG  C 3 4   ? -10.992 1.724   -54.553 1.00 102.20 ? 23   DG  I "C5'" 1 
ATOM   7414  C  "C4'" . DG  C 3 4   ? -12.288 2.108   -53.876 1.00 96.65  ? 23   DG  I "C4'" 1 
ATOM   7415  O  "O4'" . DG  C 3 4   ? -12.290 1.616   -52.511 1.00 95.31  ? 23   DG  I "O4'" 1 
ATOM   7416  C  "C3'" . DG  C 3 4   ? -12.488 3.618   -53.802 1.00 94.78  ? 23   DG  I "C3'" 1 
ATOM   7417  O  "O3'" . DG  C 3 4   ? -13.752 3.959   -54.348 1.00 94.47  ? 23   DG  I "O3'" 1 
ATOM   7418  C  "C2'" . DG  C 3 4   ? -12.396 3.939   -52.310 1.00 94.28  ? 23   DG  I "C2'" 1 
ATOM   7419  C  "C1'" . DG  C 3 4   ? -12.843 2.622   -51.684 1.00 93.29  ? 23   DG  I "C1'" 1 
ATOM   7420  N  N9    . DG  C 3 4   ? -12.407 2.410   -50.302 1.00 89.67  ? 23   DG  I N9    1 
ATOM   7421  C  C8    . DG  C 3 4   ? -11.125 2.446   -49.809 1.00 89.79  ? 23   DG  I C8    1 
ATOM   7422  N  N7    . DG  C 3 4   ? -11.057 2.208   -48.527 1.00 89.28  ? 23   DG  I N7    1 
ATOM   7423  C  C5    . DG  C 3 4   ? -12.376 1.997   -48.143 1.00 84.77  ? 23   DG  I C5    1 
ATOM   7424  C  C6    . DG  C 3 4   ? -12.928 1.694   -46.875 1.00 81.14  ? 23   DG  I C6    1 
ATOM   7425  O  O6    . DG  C 3 4   ? -12.339 1.544   -45.795 1.00 79.02  ? 23   DG  I O6    1 
ATOM   7426  N  N1    . DG  C 3 4   ? -14.313 1.561   -46.934 1.00 79.71  ? 23   DG  I N1    1 
ATOM   7427  C  C2    . DG  C 3 4   ? -15.071 1.703   -48.074 1.00 81.86  ? 23   DG  I C2    1 
ATOM   7428  N  N2    . DG  C 3 4   ? -16.398 1.538   -47.948 1.00 80.52  ? 23   DG  I N2    1 
ATOM   7429  N  N3    . DG  C 3 4   ? -14.561 1.985   -49.263 1.00 84.04  ? 23   DG  I N3    1 
ATOM   7430  C  C4    . DG  C 3 4   ? -13.216 2.118   -49.224 1.00 85.48  ? 23   DG  I C4    1 
ATOM   7431  P  P     . DC  C 3 5   ? -13.964 5.374   -55.087 1.00 100.49 ? 24   DC  I P     1 
ATOM   7432  O  OP1   . DC  C 3 5   ? -13.955 5.132   -56.548 1.00 104.22 ? 24   DC  I OP1   1 
ATOM   7433  O  OP2   . DC  C 3 5   ? -12.999 6.342   -54.514 1.00 94.24  ? 24   DC  I OP2   1 
ATOM   7434  O  "O5'" . DC  C 3 5   ? -15.444 5.798   -54.653 1.00 90.57  ? 24   DC  I "O5'" 1 
ATOM   7435  C  "C5'" . DC  C 3 5   ? -16.460 4.809   -54.625 1.00 87.46  ? 24   DC  I "C5'" 1 
ATOM   7436  C  "C4'" . DC  C 3 5   ? -17.249 4.939   -53.343 1.00 85.74  ? 24   DC  I "C4'" 1 
ATOM   7437  O  "O4'" . DC  C 3 5   ? -16.396 4.688   -52.205 1.00 86.25  ? 24   DC  I "O4'" 1 
ATOM   7438  C  "C3'" . DC  C 3 5   ? -17.796 6.338   -53.116 1.00 86.03  ? 24   DC  I "C3'" 1 
ATOM   7439  O  "O3'" . DC  C 3 5   ? -19.185 6.314   -53.338 1.00 85.84  ? 24   DC  I "O3'" 1 
ATOM   7440  C  "C2'" . DC  C 3 5   ? -17.455 6.686   -51.665 1.00 85.23  ? 24   DC  I "C2'" 1 
ATOM   7441  C  "C1'" . DC  C 3 5   ? -16.972 5.358   -51.104 1.00 85.32  ? 24   DC  I "C1'" 1 
ATOM   7442  N  N1    . DC  C 3 5   ? -15.962 5.460   -50.008 1.00 82.49  ? 24   DC  I N1    1 
ATOM   7443  C  C2    . DC  C 3 5   ? -16.376 5.292   -48.681 1.00 78.65  ? 24   DC  I C2    1 
ATOM   7444  O  O2    . DC  C 3 5   ? -17.570 5.074   -48.441 1.00 79.13  ? 24   DC  I O2    1 
ATOM   7445  N  N3    . DC  C 3 5   ? -15.459 5.371   -47.690 1.00 75.73  ? 24   DC  I N3    1 
ATOM   7446  C  C4    . DC  C 3 5   ? -14.184 5.605   -47.987 1.00 78.59  ? 24   DC  I C4    1 
ATOM   7447  N  N4    . DC  C 3 5   ? -13.319 5.676   -46.973 1.00 78.97  ? 24   DC  I N4    1 
ATOM   7448  C  C5    . DC  C 3 5   ? -13.739 5.778   -49.332 1.00 82.33  ? 24   DC  I C5    1 
ATOM   7449  C  C6    . DC  C 3 5   ? -14.653 5.698   -50.305 1.00 82.41  ? 24   DC  I C6    1 
ATOM   7450  P  P     . DG  C 3 6   ? -19.912 7.578   -54.009 1.00 94.01  ? 25   DG  I P     1 
ATOM   7451  O  OP1   . DG  C 3 6   ? -20.558 7.120   -55.262 1.00 102.81 ? 25   DG  I OP1   1 
ATOM   7452  O  OP2   . DG  C 3 6   ? -18.947 8.700   -54.033 1.00 91.93  ? 25   DG  I OP2   1 
ATOM   7453  O  "O5'" . DG  C 3 6   ? -21.027 7.961   -52.949 1.00 85.12  ? 25   DG  I "O5'" 1 
ATOM   7454  C  "C5'" . DG  C 3 6   ? -20.662 7.742   -51.620 1.00 86.67  ? 25   DG  I "C5'" 1 
ATOM   7455  C  "C4'" . DG  C 3 6   ? -21.866 7.328   -50.817 1.00 91.03  ? 25   DG  I "C4'" 1 
ATOM   7456  O  "O4'" . DG  C 3 6   ? -21.428 6.819   -49.539 1.00 89.06  ? 25   DG  I "O4'" 1 
ATOM   7457  C  "C3'" . DG  C 3 6   ? -22.748 8.500   -50.451 1.00 93.06  ? 25   DG  I "C3'" 1 
ATOM   7458  O  "O3'" . DG  C 3 6   ? -24.021 8.020   -50.068 1.00 96.48  ? 25   DG  I "O3'" 1 
ATOM   7459  C  "C2'" . DG  C 3 6   ? -21.974 9.111   -49.282 1.00 90.13  ? 25   DG  I "C2'" 1 
ATOM   7460  C  "C1'" . DG  C 3 6   ? -21.299 7.900   -48.631 1.00 86.83  ? 25   DG  I "C1'" 1 
ATOM   7461  N  N9    . DG  C 3 6   ? -19.873 8.053   -48.318 1.00 81.88  ? 25   DG  I N9    1 
ATOM   7462  C  C8    . DG  C 3 6   ? -18.848 8.360   -49.182 1.00 81.27  ? 25   DG  I C8    1 
ATOM   7463  N  N7    . DG  C 3 6   ? -17.676 8.414   -48.614 1.00 77.99  ? 25   DG  I N7    1 
ATOM   7464  C  C5    . DG  C 3 6   ? -17.937 8.119   -47.286 1.00 75.59  ? 25   DG  I C5    1 
ATOM   7465  C  C6    . DG  C 3 6   ? -17.054 8.030   -46.189 1.00 73.80  ? 25   DG  I C6    1 
ATOM   7466  O  O6    . DG  C 3 6   ? -15.828 8.203   -46.188 1.00 72.87  ? 25   DG  I O6    1 
ATOM   7467  N  N1    . DG  C 3 6   ? -17.725 7.706   -45.009 1.00 74.27  ? 25   DG  I N1    1 
ATOM   7468  C  C2    . DG  C 3 6   ? -19.084 7.494   -44.906 1.00 75.69  ? 25   DG  I C2    1 
ATOM   7469  N  N2    . DG  C 3 6   ? -19.566 7.191   -43.689 1.00 69.64  ? 25   DG  I N2    1 
ATOM   7470  N  N3    . DG  C 3 6   ? -19.920 7.577   -45.933 1.00 78.26  ? 25   DG  I N3    1 
ATOM   7471  C  C4    . DG  C 3 6   ? -19.279 7.892   -47.086 1.00 78.28  ? 25   DG  I C4    1 
ATOM   7472  P  P     . DG  C 3 7   ? -25.276 9.020   -50.017 1.00 106.17 ? 26   DG  I P     1 
ATOM   7473  O  OP1   . DG  C 3 7   ? -26.512 8.202   -50.107 1.00 102.71 ? 26   DG  I OP1   1 
ATOM   7474  O  OP2   . DG  C 3 7   ? -25.037 10.100  -51.006 1.00 100.33 ? 26   DG  I OP2   1 
ATOM   7475  O  "O5'" . DG  C 3 7   ? -25.163 9.681   -48.560 1.00 94.65  ? 26   DG  I "O5'" 1 
ATOM   7476  C  "C5'" . DG  C 3 7   ? -24.992 8.848   -47.422 1.00 91.66  ? 26   DG  I "C5'" 1 
ATOM   7477  C  "C4'" . DG  C 3 7   ? -24.258 9.558   -46.296 1.00 91.60  ? 26   DG  I "C4'" 1 
ATOM   7478  O  "O4'" . DG  C 3 7   ? -22.850 9.726   -46.590 1.00 88.90  ? 26   DG  I "O4'" 1 
ATOM   7479  C  "C3'" . DG  C 3 7   ? -24.775 10.949  -45.950 1.00 93.39  ? 26   DG  I "C3'" 1 
ATOM   7480  O  "O3'" . DG  C 3 7   ? -25.320 10.869  -44.645 1.00 94.64  ? 26   DG  I "O3'" 1 
ATOM   7481  C  "C2'" . DG  C 3 7   ? -23.546 11.864  -46.029 1.00 90.22  ? 26   DG  I "C2'" 1 
ATOM   7482  C  "C1'" . DG  C 3 7   ? -22.398 10.873  -45.892 1.00 89.17  ? 26   DG  I "C1'" 1 
ATOM   7483  N  N9    . DG  C 3 7   ? -21.124 11.298  -46.475 1.00 83.98  ? 26   DG  I N9    1 
ATOM   7484  C  C8    . DG  C 3 7   ? -20.934 11.850  -47.719 1.00 82.74  ? 26   DG  I C8    1 
ATOM   7485  N  N7    . DG  C 3 7   ? -19.683 12.115  -47.984 1.00 81.88  ? 26   DG  I N7    1 
ATOM   7486  C  C5    . DG  C 3 7   ? -18.995 11.714  -46.845 1.00 79.41  ? 26   DG  I C5    1 
ATOM   7487  C  C6    . DG  C 3 7   ? -17.609 11.761  -46.552 1.00 75.87  ? 26   DG  I C6    1 
ATOM   7488  O  O6    . DG  C 3 7   ? -16.685 12.180  -47.263 1.00 73.49  ? 26   DG  I O6    1 
ATOM   7489  N  N1    . DG  C 3 7   ? -17.330 11.256  -45.287 1.00 74.19  ? 26   DG  I N1    1 
ATOM   7490  C  C2    . DG  C 3 7   ? -18.269 10.766  -44.415 1.00 73.87  ? 26   DG  I C2    1 
ATOM   7491  N  N2    . DG  C 3 7   ? -17.796 10.321  -43.243 1.00 71.04  ? 26   DG  I N2    1 
ATOM   7492  N  N3    . DG  C 3 7   ? -19.571 10.717  -44.673 1.00 76.20  ? 26   DG  I N3    1 
ATOM   7493  C  C4    . DG  C 3 7   ? -19.866 11.206  -45.905 1.00 79.72  ? 26   DG  I C4    1 
ATOM   7494  P  P     . DA  C 3 8   ? -25.813 12.198  -43.887 1.00 105.55 ? 27   DA  I P     1 
ATOM   7495  O  OP1   . DA  C 3 8   ? -27.128 11.906  -43.265 1.00 104.23 ? 27   DA  I OP1   1 
ATOM   7496  O  OP2   . DA  C 3 8   ? -25.665 13.343  -44.819 1.00 97.35  ? 27   DA  I OP2   1 
ATOM   7497  O  "O5'" . DA  C 3 8   ? -24.748 12.371  -42.715 1.00 94.91  ? 27   DA  I "O5'" 1 
ATOM   7498  C  "C5'" . DA  C 3 8   ? -24.893 11.601  -41.536 1.00 93.52  ? 27   DA  I "C5'" 1 
ATOM   7499  C  "C4'" . DA  C 3 8   ? -23.936 12.137  -40.498 1.00 95.32  ? 27   DA  I "C4'" 1 
ATOM   7500  O  "O4'" . DA  C 3 8   ? -22.639 12.305  -41.128 1.00 95.52  ? 27   DA  I "O4'" 1 
ATOM   7501  C  "C3'" . DA  C 3 8   ? -24.286 13.519  -39.967 1.00 98.92  ? 27   DA  I "C3'" 1 
ATOM   7502  O  "O3'" . DA  C 3 8   ? -23.602 13.754  -38.743 1.00 101.45 ? 27   DA  I "O3'" 1 
ATOM   7503  C  "C2'" . DA  C 3 8   ? -23.681 14.394  -41.057 1.00 96.34  ? 27   DA  I "C2'" 1 
ATOM   7504  C  "C1'" . DA  C 3 8   ? -22.332 13.687  -41.176 1.00 94.79  ? 27   DA  I "C1'" 1 
ATOM   7505  N  N9    . DA  C 3 8   ? -21.573 13.985  -42.392 1.00 89.85  ? 27   DA  I N9    1 
ATOM   7506  C  C8    . DA  C 3 8   ? -22.075 14.341  -43.613 1.00 89.39  ? 27   DA  I C8    1 
ATOM   7507  N  N7    . DA  C 3 8   ? -21.155 14.549  -44.526 1.00 85.41  ? 27   DA  I N7    1 
ATOM   7508  C  C5    . DA  C 3 8   ? -19.969 14.310  -43.857 1.00 83.33  ? 27   DA  I C5    1 
ATOM   7509  C  C6    . DA  C 3 8   ? -18.627 14.361  -44.277 1.00 81.05  ? 27   DA  I C6    1 
ATOM   7510  N  N6    . DA  C 3 8   ? -18.258 14.685  -45.522 1.00 77.87  ? 27   DA  I N6    1 
ATOM   7511  N  N1    . DA  C 3 8   ? -17.684 14.066  -43.358 1.00 79.43  ? 27   DA  I N1    1 
ATOM   7512  C  C2    . DA  C 3 8   ? -18.061 13.745  -42.113 1.00 79.43  ? 27   DA  I C2    1 
ATOM   7513  N  N3    . DA  C 3 8   ? -19.287 13.663  -41.604 1.00 79.08  ? 27   DA  I N3    1 
ATOM   7514  C  C4    . DA  C 3 8   ? -20.205 13.961  -42.539 1.00 83.73  ? 27   DA  I C4    1 
ATOM   7515  P  P     . DG  C 3 9   ? -24.098 13.055  -37.380 1.00 104.83 ? 28   DG  I P     1 
ATOM   7516  O  OP1   . DG  C 3 9   ? -24.438 11.644  -37.680 1.00 94.84  ? 28   DG  I OP1   1 
ATOM   7517  O  OP2   . DG  C 3 9   ? -25.120 13.935  -36.765 1.00 102.77 ? 28   DG  I OP2   1 
ATOM   7518  O  "O5'" . DG  C 3 9   ? -22.789 13.084  -36.452 1.00 93.73  ? 28   DG  I "O5'" 1 
ATOM   7519  C  "C5'" . DG  C 3 9   ? -22.390 14.310  -35.862 1.00 92.33  ? 28   DG  I "C5'" 1 
ATOM   7520  C  "C4'" . DG  C 3 9   ? -21.087 14.861  -36.418 1.00 95.73  ? 28   DG  I "C4'" 1 
ATOM   7521  O  "O4'" . DG  C 3 9   ? -21.067 14.917  -37.869 1.00 95.61  ? 28   DG  I "O4'" 1 
ATOM   7522  C  "C3'" . DG  C 3 9   ? -20.833 16.301  -35.983 1.00 100.00 ? 28   DG  I "C3'" 1 
ATOM   7523  O  "O3'" . DG  C 3 9   ? -19.816 16.347  -35.007 1.00 101.76 ? 28   DG  I "O3'" 1 
ATOM   7524  C  "C2'" . DG  C 3 9   ? -20.386 17.044  -37.239 1.00 95.93  ? 28   DG  I "C2'" 1 
ATOM   7525  C  "C1'" . DG  C 3 9   ? -20.119 15.911  -38.213 1.00 94.32  ? 28   DG  I "C1'" 1 
ATOM   7526  N  N9    . DG  C 3 9   ? -20.282 16.359  -39.593 1.00 93.63  ? 28   DG  I N9    1 
ATOM   7527  C  C8    . DG  C 3 9   ? -21.457 16.477  -40.297 1.00 92.79  ? 28   DG  I C8    1 
ATOM   7528  N  N7    . DG  C 3 9   ? -21.295 16.910  -41.519 1.00 90.50  ? 28   DG  I N7    1 
ATOM   7529  C  C5    . DG  C 3 9   ? -19.923 17.106  -41.628 1.00 88.26  ? 28   DG  I C5    1 
ATOM   7530  C  C6    . DG  C 3 9   ? -19.156 17.570  -42.722 1.00 86.06  ? 28   DG  I C6    1 
ATOM   7531  O  O6    . DG  C 3 9   ? -19.558 17.911  -43.844 1.00 86.33  ? 28   DG  I O6    1 
ATOM   7532  N  N1    . DG  C 3 9   ? -17.795 17.619  -42.419 1.00 83.56  ? 28   DG  I N1    1 
ATOM   7533  C  C2    . DG  C 3 9   ? -17.247 17.264  -41.209 1.00 84.98  ? 28   DG  I C2    1 
ATOM   7534  N  N2    . DG  C 3 9   ? -15.914 17.385  -41.108 1.00 82.17  ? 28   DG  I N2    1 
ATOM   7535  N  N3    . DG  C 3 9   ? -17.956 16.828  -40.172 1.00 87.67  ? 28   DG  I N3    1 
ATOM   7536  C  C4    . DG  C 3 9   ? -19.284 16.775  -40.452 1.00 89.69  ? 28   DG  I C4    1 
ATOM   7537  P  P     . DG  C 3 10  ? -19.513 17.717  -34.225 1.00 100.86 ? 29   DG  I P     1 
ATOM   7538  O  OP1   . DG  C 3 10  ? -19.247 17.382  -32.807 1.00 104.46 ? 29   DG  I OP1   1 
ATOM   7539  O  OP2   . DG  C 3 10  ? -20.582 18.684  -34.570 1.00 95.27  ? 29   DG  I OP2   1 
ATOM   7540  O  "O5'" . DG  C 3 10  ? -18.150 18.230  -34.882 1.00 98.21  ? 29   DG  I "O5'" 1 
ATOM   7541  C  "C5'" . DG  C 3 10  ? -16.966 17.464  -34.735 1.00 98.45  ? 29   DG  I "C5'" 1 
ATOM   7542  C  "C4'" . DG  C 3 10  ? -15.890 18.051  -35.624 1.00 102.33 ? 29   DG  I "C4'" 1 
ATOM   7543  O  "O4'" . DG  C 3 10  ? -16.372 18.029  -36.994 1.00 98.28  ? 29   DG  I "O4'" 1 
ATOM   7544  C  "C3'" . DG  C 3 10  ? -15.528 19.498  -35.287 1.00 103.49 ? 29   DG  I "C3'" 1 
ATOM   7545  O  "O3'" . DG  C 3 10  ? -14.116 19.653  -35.107 1.00 103.45 ? 29   DG  I "O3'" 1 
ATOM   7546  C  "C2'" . DG  C 3 10  ? -16.046 20.312  -36.470 1.00 101.67 ? 29   DG  I "C2'" 1 
ATOM   7547  C  "C1'" . DG  C 3 10  ? -16.177 19.294  -37.599 1.00 99.45  ? 29   DG  I "C1'" 1 
ATOM   7548  N  N9    . DG  C 3 10  ? -17.305 19.587  -38.487 1.00 96.83  ? 29   DG  I N9    1 
ATOM   7549  C  C8    . DG  C 3 10  ? -18.647 19.438  -38.211 1.00 93.74  ? 29   DG  I C8    1 
ATOM   7550  N  N7    . DG  C 3 10  ? -19.428 19.786  -39.198 1.00 90.23  ? 29   DG  I N7    1 
ATOM   7551  C  C5    . DG  C 3 10  ? -18.550 20.198  -40.194 1.00 90.24  ? 29   DG  I C5    1 
ATOM   7552  C  C6    . DG  C 3 10  ? -18.811 20.683  -41.496 1.00 87.76  ? 29   DG  I C6    1 
ATOM   7553  O  O6    . DG  C 3 10  ? -19.908 20.852  -42.045 1.00 89.62  ? 29   DG  I O6    1 
ATOM   7554  N  N1    . DG  C 3 10  ? -17.638 20.987  -42.182 1.00 85.28  ? 29   DG  I N1    1 
ATOM   7555  C  C2    . DG  C 3 10  ? -16.370 20.840  -41.672 1.00 86.94  ? 29   DG  I C2    1 
ATOM   7556  N  N2    . DG  C 3 10  ? -15.363 21.186  -42.485 1.00 87.29  ? 29   DG  I N2    1 
ATOM   7557  N  N3    . DG  C 3 10  ? -16.107 20.385  -40.454 1.00 88.72  ? 29   DG  I N3    1 
ATOM   7558  C  C4    . DG  C 3 10  ? -17.241 20.085  -39.773 1.00 92.60  ? 29   DG  I C4    1 
ATOM   7559  P  P     . DC  C 3 11  ? -13.537 20.894  -34.257 1.00 112.49 ? 30   DC  I P     1 
ATOM   7560  O  OP1   . DC  C 3 11  ? -12.712 20.351  -33.154 1.00 112.21 ? 30   DC  I OP1   1 
ATOM   7561  O  OP2   . DC  C 3 11  ? -14.666 21.804  -33.944 1.00 105.21 ? 30   DC  I OP2   1 
ATOM   7562  O  "O5'" . DC  C 3 11  ? -12.581 21.643  -35.298 1.00 109.28 ? 30   DC  I "O5'" 1 
ATOM   7563  C  "C5'" . DC  C 3 11  ? -12.177 20.990  -36.500 1.00 105.97 ? 30   DC  I "C5'" 1 
ATOM   7564  C  "C4'" . DC  C 3 11  ? -11.994 22.013  -37.612 1.00 106.14 ? 30   DC  I "C4'" 1 
ATOM   7565  O  "O4'" . DC  C 3 11  ? -13.203 22.097  -38.421 1.00 103.28 ? 30   DC  I "O4'" 1 
ATOM   7566  C  "C3'" . DC  C 3 11  ? -11.676 23.441  -37.156 1.00 103.78 ? 30   DC  I "C3'" 1 
ATOM   7567  O  "O3'" . DC  C 3 11  ? -10.563 23.915  -37.929 1.00 104.87 ? 30   DC  I "O3'" 1 
ATOM   7568  C  "C2'" . DC  C 3 11  ? -12.987 24.188  -37.419 1.00 100.27 ? 30   DC  I "C2'" 1 
ATOM   7569  C  "C1'" . DC  C 3 11  ? -13.534 23.457  -38.637 1.00 99.30  ? 30   DC  I "C1'" 1 
ATOM   7570  N  N1    . DC  C 3 11  ? -15.017 23.557  -38.814 1.00 94.35  ? 30   DC  I N1    1 
ATOM   7571  C  C2    . DC  C 3 11  ? -15.560 23.933  -40.047 1.00 92.22  ? 30   DC  I C2    1 
ATOM   7572  O  O2    . DC  C 3 11  ? -14.798 24.190  -40.991 1.00 91.96  ? 30   DC  I O2    1 
ATOM   7573  N  N3    . DC  C 3 11  ? -16.913 24.007  -40.169 1.00 89.98  ? 30   DC  I N3    1 
ATOM   7574  C  C4    . DC  C 3 11  ? -17.705 23.726  -39.133 1.00 90.15  ? 30   DC  I C4    1 
ATOM   7575  N  N4    . DC  C 3 11  ? -19.032 23.813  -39.296 1.00 88.37  ? 30   DC  I N4    1 
ATOM   7576  C  C5    . DC  C 3 11  ? -17.167 23.342  -37.873 1.00 92.82  ? 30   DC  I C5    1 
ATOM   7577  C  C6    . DC  C 3 11  ? -15.836 23.274  -37.763 1.00 95.58  ? 30   DC  I C6    1 
ATOM   7578  P  P     . DT  C 3 12  ? -10.228 25.490  -38.020 1.00 108.80 ? 31   DT  I P     1 
ATOM   7579  O  OP1   . DT  C 3 12  ? -8.827  25.683  -37.583 1.00 104.66 ? 31   DT  I OP1   1 
ATOM   7580  O  OP2   . DT  C 3 12  ? -11.320 26.239  -37.353 1.00 102.20 ? 31   DT  I OP2   1 
ATOM   7581  O  "O5'" . DT  C 3 12  ? -10.268 25.794  -39.596 1.00 104.49 ? 31   DT  I "O5'" 1 
ATOM   7582  C  "C5'" . DT  C 3 12  ? -11.480 25.827  -40.358 1.00 101.15 ? 31   DT  I "C5'" 1 
ATOM   7583  C  "C4'" . DT  C 3 12  ? -11.303 26.649  -41.631 1.00 101.91 ? 31   DT  I "C4'" 1 
ATOM   7584  O  "O4'" . DT  C 3 12  ? -12.593 26.988  -42.201 1.00 100.37 ? 31   DT  I "O4'" 1 
ATOM   7585  C  "C3'" . DT  C 3 12  ? -10.672 28.018  -41.449 1.00 101.65 ? 31   DT  I "C3'" 1 
ATOM   7586  O  "O3'" . DT  C 3 12  ? -10.268 28.512  -42.734 1.00 104.47 ? 31   DT  I "O3'" 1 
ATOM   7587  C  "C2'" . DT  C 3 12  ? -11.857 28.791  -40.871 1.00 98.54  ? 31   DT  I "C2'" 1 
ATOM   7588  C  "C1'" . DT  C 3 12  ? -13.036 28.218  -41.656 1.00 95.85  ? 31   DT  I "C1'" 1 
ATOM   7589  N  N1    . DT  C 3 12  ? -14.262 27.943  -40.842 1.00 92.32  ? 31   DT  I N1    1 
ATOM   7590  C  C2    . DT  C 3 12  ? -15.505 28.053  -41.427 1.00 90.03  ? 31   DT  I C2    1 
ATOM   7591  O  O2    . DT  C 3 12  ? -15.661 28.375  -42.589 1.00 89.69  ? 31   DT  I O2    1 
ATOM   7592  N  N3    . DT  C 3 12  ? -16.564 27.773  -40.596 1.00 91.30  ? 31   DT  I N3    1 
ATOM   7593  C  C4    . DT  C 3 12  ? -16.513 27.397  -39.261 1.00 92.43  ? 31   DT  I C4    1 
ATOM   7594  O  O4    . DT  C 3 12  ? -17.519 27.160  -38.587 1.00 89.57  ? 31   DT  I O4    1 
ATOM   7595  C  C5    . DT  C 3 12  ? -15.181 27.297  -38.716 1.00 94.21  ? 31   DT  I C5    1 
ATOM   7596  C  C7    . DT  C 3 12  ? -15.001 26.898  -37.282 1.00 93.42  ? 31   DT  I C7    1 
ATOM   7597  C  C6    . DT  C 3 12  ? -14.137 27.572  -39.516 1.00 95.54  ? 31   DT  I C6    1 
ATOM   7598  P  P     . DC  C 3 13  ? -9.313  29.808  -42.853 1.00 115.38 ? 32   DC  I P     1 
ATOM   7599  O  OP1   . DC  C 3 13  ? -8.270  29.518  -43.868 1.00 107.29 ? 32   DC  I OP1   1 
ATOM   7600  O  OP2   . DC  C 3 13  ? -8.918  30.223  -41.482 1.00 108.10 ? 32   DC  I OP2   1 
ATOM   7601  O  "O5'" . DC  C 3 13  ? -10.283 30.935  -43.441 1.00 103.28 ? 32   DC  I "O5'" 1 
ATOM   7602  C  "C5'" . DC  C 3 13  ? -10.872 30.729  -44.717 1.00 102.39 ? 32   DC  I "C5'" 1 
ATOM   7603  C  "C4'" . DC  C 3 13  ? -11.932 31.776  -44.945 1.00 102.33 ? 32   DC  I "C4'" 1 
ATOM   7604  O  "O4'" . DC  C 3 13  ? -13.098 31.451  -44.154 1.00 96.85  ? 32   DC  I "O4'" 1 
ATOM   7605  C  "C3'" . DC  C 3 13  ? -11.477 33.177  -44.556 1.00 102.78 ? 32   DC  I "C3'" 1 
ATOM   7606  O  "O3'" . DC  C 3 13  ? -11.218 33.922  -45.757 1.00 103.45 ? 32   DC  I "O3'" 1 
ATOM   7607  C  "C2'" . DC  C 3 13  ? -12.614 33.750  -43.709 1.00 100.15 ? 32   DC  I "C2'" 1 
ATOM   7608  C  "C1'" . DC  C 3 13  ? -13.587 32.592  -43.474 1.00 98.77  ? 32   DC  I "C1'" 1 
ATOM   7609  N  N1    . DC  C 3 13  ? -13.768 32.222  -42.040 1.00 94.57  ? 32   DC  I N1    1 
ATOM   7610  C  C2    . DC  C 3 13  ? -15.066 32.048  -41.551 1.00 91.67  ? 32   DC  I C2    1 
ATOM   7611  O  O2    . DC  C 3 13  ? -16.025 32.206  -42.317 1.00 91.00  ? 32   DC  I O2    1 
ATOM   7612  N  N3    . DC  C 3 13  ? -15.240 31.707  -40.250 1.00 90.96  ? 32   DC  I N3    1 
ATOM   7613  C  C4    . DC  C 3 13  ? -14.178 31.541  -39.456 1.00 90.47  ? 32   DC  I C4    1 
ATOM   7614  N  N4    . DC  C 3 13  ? -14.388 31.202  -38.178 1.00 87.00  ? 32   DC  I N4    1 
ATOM   7615  C  C5    . DC  C 3 13  ? -12.847 31.718  -39.941 1.00 93.93  ? 32   DC  I C5    1 
ATOM   7616  C  C6    . DC  C 3 13  ? -12.685 32.053  -41.227 1.00 95.20  ? 32   DC  I C6    1 
ATOM   7617  P  P     . DA  C 3 14  ? -11.468 35.511  -45.807 1.00 108.24 ? 33   DA  I P     1 
ATOM   7618  O  OP1   . DA  C 3 14  ? -10.817 36.030  -47.028 1.00 106.92 ? 33   DA  I OP1   1 
ATOM   7619  O  OP2   . DA  C 3 14  ? -11.105 36.080  -44.491 1.00 102.20 ? 33   DA  I OP2   1 
ATOM   7620  O  "O5'" . DA  C 3 14  ? -13.045 35.636  -46.012 1.00 103.07 ? 33   DA  I "O5'" 1 
ATOM   7621  C  "C5'" . DA  C 3 14  ? -13.611 35.267  -47.270 1.00 101.58 ? 33   DA  I "C5'" 1 
ATOM   7622  C  "C4'" . DA  C 3 14  ? -15.088 35.582  -47.262 1.00 103.26 ? 33   DA  I "C4'" 1 
ATOM   7623  O  "O4'" . DA  C 3 14  ? -15.657 35.187  -45.991 1.00 105.20 ? 33   DA  I "O4'" 1 
ATOM   7624  C  "C3'" . DA  C 3 14  ? -15.430 37.057  -47.366 1.00 101.89 ? 33   DA  I "C3'" 1 
ATOM   7625  O  "O3'" . DA  C 3 14  ? -16.766 37.180  -47.820 1.00 104.50 ? 33   DA  I "O3'" 1 
ATOM   7626  C  "C2'" . DA  C 3 14  ? -15.320 37.504  -45.917 1.00 100.23 ? 33   DA  I "C2'" 1 
ATOM   7627  C  "C1'" . DA  C 3 14  ? -16.050 36.340  -45.265 1.00 99.95  ? 33   DA  I "C1'" 1 
ATOM   7628  N  N9    . DA  C 3 14  ? -15.702 36.104  -43.875 1.00 96.04  ? 33   DA  I N9    1 
ATOM   7629  C  C8    . DA  C 3 14  ? -14.470 36.220  -43.305 1.00 96.11  ? 33   DA  I C8    1 
ATOM   7630  N  N7    . DA  C 3 14  ? -14.458 35.921  -42.028 1.00 96.48  ? 33   DA  I N7    1 
ATOM   7631  C  C5    . DA  C 3 14  ? -15.773 35.585  -41.746 1.00 94.65  ? 33   DA  I C5    1 
ATOM   7632  C  C6    . DA  C 3 14  ? -16.421 35.175  -40.563 1.00 91.77  ? 33   DA  I C6    1 
ATOM   7633  N  N6    . DA  C 3 14  ? -15.794 35.031  -39.392 1.00 88.87  ? 33   DA  I N6    1 
ATOM   7634  N  N1    . DA  C 3 14  ? -17.742 34.920  -40.631 1.00 92.96  ? 33   DA  I N1    1 
ATOM   7635  C  C2    . DA  C 3 14  ? -18.370 35.067  -41.803 1.00 94.16  ? 33   DA  I C2    1 
ATOM   7636  N  N3    . DA  C 3 14  ? -17.871 35.443  -42.980 1.00 94.25  ? 33   DA  I N3    1 
ATOM   7637  C  C4    . DA  C 3 14  ? -16.554 35.690  -42.880 1.00 95.01  ? 33   DA  I C4    1 
ATOM   7638  P  P     . DC  C 3 15  ? -17.346 38.614  -48.270 1.00 110.27 ? 34   DC  I P     1 
ATOM   7639  O  OP1   . DC  C 3 15  ? -17.936 38.463  -49.623 1.00 110.48 ? 34   DC  I OP1   1 
ATOM   7640  O  OP2   . DC  C 3 15  ? -16.286 39.630  -48.063 1.00 108.30 ? 34   DC  I OP2   1 
ATOM   7641  O  "O5'" . DC  C 3 15  ? -18.501 38.905  -47.201 1.00 103.04 ? 34   DC  I "O5'" 1 
ATOM   7642  C  "C5'" . DC  C 3 15  ? -19.614 38.049  -47.124 1.00 102.41 ? 34   DC  I "C5'" 1 
ATOM   7643  C  "C4'" . DC  C 3 15  ? -20.438 38.471  -45.923 1.00 104.87 ? 34   DC  I "C4'" 1 
ATOM   7644  O  "O4'" . DC  C 3 15  ? -19.700 38.052  -44.748 1.00 102.87 ? 34   DC  I "O4'" 1 
ATOM   7645  C  "C3'" . DC  C 3 15  ? -20.655 39.978  -45.792 1.00 107.05 ? 34   DC  I "C3'" 1 
ATOM   7646  O  "O3'" . DC  C 3 15  ? -22.052 40.293  -45.923 1.00 111.27 ? 34   DC  I "O3'" 1 
ATOM   7647  C  "C2'" . DC  C 3 15  ? -20.073 40.329  -44.425 1.00 104.27 ? 34   DC  I "C2'" 1 
ATOM   7648  C  "C1'" . DC  C 3 15  ? -19.957 38.981  -43.728 1.00 101.29 ? 34   DC  I "C1'" 1 
ATOM   7649  N  N1    . DC  C 3 15  ? -18.858 38.977  -42.731 1.00 100.09 ? 34   DC  I N1    1 
ATOM   7650  C  C2    . DC  C 3 15  ? -19.088 38.528  -41.419 1.00 99.01  ? 34   DC  I C2    1 
ATOM   7651  O  O2    . DC  C 3 15  ? -20.211 38.108  -41.095 1.00 97.13  ? 34   DC  I O2    1 
ATOM   7652  N  N3    . DC  C 3 15  ? -18.052 38.559  -40.539 1.00 96.78  ? 34   DC  I N3    1 
ATOM   7653  C  C4    . DC  C 3 15  ? -16.853 39.016  -40.921 1.00 95.31  ? 34   DC  I C4    1 
ATOM   7654  N  N4    . DC  C 3 15  ? -15.860 39.031  -40.028 1.00 90.72  ? 34   DC  I N4    1 
ATOM   7655  C  C5    . DC  C 3 15  ? -16.611 39.482  -42.245 1.00 98.43  ? 34   DC  I C5    1 
ATOM   7656  C  C6    . DC  C 3 15  ? -17.632 39.449  -43.107 1.00 100.05 ? 34   DC  I C6    1 
ATOM   7657  P  P     . DG  C 3 16  ? -22.616 41.747  -45.490 1.00 120.44 ? 35   DG  I P     1 
ATOM   7658  O  OP1   . DG  C 3 16  ? -23.821 42.035  -46.307 1.00 119.59 ? 35   DG  I OP1   1 
ATOM   7659  O  OP2   . DG  C 3 16  ? -21.486 42.711  -45.501 1.00 108.48 ? 35   DG  I OP2   1 
ATOM   7660  O  "O5'" . DG  C 3 16  ? -23.107 41.529  -43.978 1.00 113.00 ? 35   DG  I "O5'" 1 
ATOM   7661  C  "C5'" . DG  C 3 16  ? -24.010 40.451  -43.707 1.00 114.79 ? 35   DG  I "C5'" 1 
ATOM   7662  C  "C4'" . DG  C 3 16  ? -24.655 40.553  -42.330 1.00 120.64 ? 35   DG  I "C4'" 1 
ATOM   7663  O  "O4'" . DG  C 3 16  ? -23.692 40.273  -41.277 1.00 116.72 ? 35   DG  I "O4'" 1 
ATOM   7664  C  "C3'" . DG  C 3 16  ? -25.252 41.904  -41.959 1.00 122.40 ? 35   DG  I "C3'" 1 
ATOM   7665  O  "O3'" . DG  C 3 16  ? -26.343 41.662  -41.069 1.00 127.82 ? 35   DG  I "O3'" 1 
ATOM   7666  C  "C2'" . DG  C 3 16  ? -24.067 42.604  -41.292 1.00 113.86 ? 35   DG  I "C2'" 1 
ATOM   7667  C  "C1'" . DG  C 3 16  ? -23.458 41.443  -40.506 1.00 112.21 ? 35   DG  I "C1'" 1 
ATOM   7668  N  N9    . DG  C 3 16  ? -22.017 41.533  -40.269 1.00 106.91 ? 35   DG  I N9    1 
ATOM   7669  C  C8    . DG  C 3 16  ? -21.040 41.931  -41.154 1.00 103.80 ? 35   DG  I C8    1 
ATOM   7670  N  N7    . DG  C 3 16  ? -19.835 41.894  -40.653 1.00 100.94 ? 35   DG  I N7    1 
ATOM   7671  C  C5    . DG  C 3 16  ? -20.022 41.435  -39.354 1.00 102.81 ? 35   DG  I C5    1 
ATOM   7672  C  C6    . DG  C 3 16  ? -19.080 41.191  -38.323 1.00 102.11 ? 35   DG  I C6    1 
ATOM   7673  O  O6    . DG  C 3 16  ? -17.847 41.339  -38.359 1.00 102.50 ? 35   DG  I O6    1 
ATOM   7674  N  N1    . DG  C 3 16  ? -19.694 40.728  -37.157 1.00 100.83 ? 35   DG  I N1    1 
ATOM   7675  C  C2    . DG  C 3 16  ? -21.046 40.526  -36.997 1.00 100.86 ? 35   DG  I C2    1 
ATOM   7676  N  N2    . DG  C 3 16  ? -21.443 40.075  -35.793 1.00 98.59  ? 35   DG  I N2    1 
ATOM   7677  N  N3    . DG  C 3 16  ? -21.937 40.753  -37.958 1.00 103.70 ? 35   DG  I N3    1 
ATOM   7678  C  C4    . DG  C 3 16  ? -21.358 41.204  -39.102 1.00 104.72 ? 35   DG  I C4    1 
ATOM   7679  P  P     . DG  C 3 17  ? -27.535 42.730  -40.940 1.00 133.50 ? 36   DG  I P     1 
ATOM   7680  O  OP1   . DG  C 3 17  ? -28.601 42.128  -40.097 1.00 124.64 ? 36   DG  I OP1   1 
ATOM   7681  O  OP2   . DG  C 3 17  ? -27.851 43.227  -42.300 1.00 122.45 ? 36   DG  I OP2   1 
ATOM   7682  O  "O5'" . DG  C 3 17  ? -26.858 43.938  -40.146 1.00 123.21 ? 36   DG  I "O5'" 1 
ATOM   7683  C  "C5'" . DG  C 3 17  ? -27.618 44.597  -39.163 1.00 121.51 ? 36   DG  I "C5'" 1 
ATOM   7684  C  "C4'" . DG  C 3 17  ? -27.263 44.100  -37.775 1.00 121.32 ? 36   DG  I "C4'" 1 
ATOM   7685  O  "O4'" . DG  C 3 17  ? -25.901 43.564  -37.714 1.00 119.02 ? 36   DG  I "O4'" 1 
ATOM   7686  C  "C3'" . DG  C 3 17  ? -27.292 45.237  -36.772 1.00 123.22 ? 36   DG  I "C3'" 1 
ATOM   7687  O  "O3'" . DG  C 3 17  ? -27.369 44.719  -35.457 1.00 126.16 ? 36   DG  I "O3'" 1 
ATOM   7688  C  "C2'" . DG  C 3 17  ? -25.895 45.758  -37.067 1.00 119.34 ? 36   DG  I "C2'" 1 
ATOM   7689  C  "C1'" . DG  C 3 17  ? -25.137 44.440  -36.901 1.00 116.79 ? 36   DG  I "C1'" 1 
ATOM   7690  N  N9    . DG  C 3 17  ? -23.717 44.498  -37.276 1.00 112.27 ? 36   DG  I N9    1 
ATOM   7691  C  C8    . DG  C 3 17  ? -23.192 44.986  -38.453 1.00 111.69 ? 36   DG  I C8    1 
ATOM   7692  N  N7    . DG  C 3 17  ? -21.890 44.928  -38.517 1.00 108.41 ? 36   DG  I N7    1 
ATOM   7693  C  C5    . DG  C 3 17  ? -21.520 44.367  -37.299 1.00 107.59 ? 36   DG  I C5    1 
ATOM   7694  C  C6    . DG  C 3 17  ? -20.230 44.063  -36.800 1.00 103.91 ? 36   DG  I C6    1 
ATOM   7695  O  O6    . DG  C 3 17  ? -19.134 44.232  -37.352 1.00 101.27 ? 36   DG  I O6    1 
ATOM   7696  N  N1    . DG  C 3 17  ? -20.291 43.504  -35.524 1.00 103.62 ? 36   DG  I N1    1 
ATOM   7697  C  C2    . DG  C 3 17  ? -21.444 43.268  -34.812 1.00 104.77 ? 36   DG  I C2    1 
ATOM   7698  N  N2    . DG  C 3 17  ? -21.273 42.721  -33.596 1.00 100.26 ? 36   DG  I N2    1 
ATOM   7699  N  N3    . DG  C 3 17  ? -22.664 43.550  -35.268 1.00 107.01 ? 36   DG  I N3    1 
ATOM   7700  C  C4    . DG  C 3 17  ? -22.629 44.097  -36.516 1.00 109.18 ? 36   DG  I C4    1 
ATOM   7701  P  P     . DG  C 3 18  ? -28.686 44.953  -34.563 1.00 131.84 ? 37   DG  I P     1 
ATOM   7702  O  OP1   . DG  C 3 18  ? -29.757 44.066  -35.086 1.00 125.30 ? 37   DG  I OP1   1 
ATOM   7703  O  OP2   . DG  C 3 18  ? -28.919 46.417  -34.467 1.00 120.55 ? 37   DG  I OP2   1 
ATOM   7704  O  "O5'" . DG  C 3 18  ? -28.238 44.438  -33.109 1.00 125.38 ? 37   DG  I "O5'" 1 
ATOM   7705  C  "C5'" . DG  C 3 18  ? -27.254 43.393  -32.970 1.00 118.02 ? 37   DG  I "C5'" 1 
ATOM   7706  C  "C4'" . DG  C 3 18  ? -26.232 43.789  -31.917 1.00 121.56 ? 37   DG  I "C4'" 1 
ATOM   7707  O  "O4'" . DG  C 3 18  ? -25.015 44.225  -32.566 1.00 121.03 ? 37   DG  I "O4'" 1 
ATOM   7708  C  "C3'" . DG  C 3 18  ? -26.625 44.954  -31.009 1.00 124.86 ? 37   DG  I "C3'" 1 
ATOM   7709  O  "O3'" . DG  C 3 18  ? -26.087 44.740  -29.708 1.00 127.08 ? 37   DG  I "O3'" 1 
ATOM   7710  C  "C2'" . DG  C 3 18  ? -26.014 46.165  -31.729 1.00 118.54 ? 37   DG  I "C2'" 1 
ATOM   7711  C  "C1'" . DG  C 3 18  ? -24.689 45.553  -32.180 1.00 117.89 ? 37   DG  I "C1'" 1 
ATOM   7712  N  N9    . DG  C 3 18  ? -24.029 46.154  -33.345 1.00 114.85 ? 37   DG  I N9    1 
ATOM   7713  C  C8    . DG  C 3 18  ? -24.636 46.608  -34.491 1.00 113.45 ? 37   DG  I C8    1 
ATOM   7714  N  N7    . DG  C 3 18  ? -23.806 47.070  -35.387 1.00 108.82 ? 37   DG  I N7    1 
ATOM   7715  C  C5    . DG  C 3 18  ? -22.555 46.908  -34.810 1.00 106.51 ? 37   DG  I C5    1 
ATOM   7716  C  C6    . DG  C 3 18  ? -21.274 47.233  -35.319 1.00 103.39 ? 37   DG  I C6    1 
ATOM   7717  O  O6    . DG  C 3 18  ? -20.996 47.741  -36.413 1.00 102.75 ? 37   DG  I O6    1 
ATOM   7718  N  N1    . DG  C 3 18  ? -20.262 46.912  -34.421 1.00 103.25 ? 37   DG  I N1    1 
ATOM   7719  C  C2    . DG  C 3 18  ? -20.464 46.345  -33.183 1.00 105.28 ? 37   DG  I C2    1 
ATOM   7720  N  N2    . DG  C 3 18  ? -19.365 46.102  -32.449 1.00 103.11 ? 37   DG  I N2    1 
ATOM   7721  N  N3    . DG  C 3 18  ? -21.663 46.036  -32.695 1.00 107.58 ? 37   DG  I N3    1 
ATOM   7722  C  C4    . DG  C 3 18  ? -22.670 46.342  -33.556 1.00 109.55 ? 37   DG  I C4    1 
ATOM   7723  P  P     . DA  C 3 19  ? -26.701 45.514  -28.428 1.00 133.47 ? 38   DA  I P     1 
ATOM   7724  O  OP1   . DA  C 3 19  ? -25.596 45.747  -27.447 1.00 128.77 ? 38   DA  I OP1   1 
ATOM   7725  O  OP2   . DA  C 3 19  ? -27.911 44.775  -27.981 1.00 121.94 ? 38   DA  I OP2   1 
ATOM   7726  O  "O5'" . DA  C 3 19  ? -27.113 46.949  -29.019 1.00 123.54 ? 38   DA  I "O5'" 1 
ATOM   7727  C  "C5'" . DA  C 3 19  ? -26.756 48.178  -28.372 1.00 120.41 ? 38   DA  I "C5'" 1 
ATOM   7728  C  "C4'" . DA  C 3 19  ? -25.258 48.451  -28.396 1.00 120.58 ? 38   DA  I "C4'" 1 
ATOM   7729  O  "O4'" . DA  C 3 19  ? -24.756 48.250  -29.742 1.00 120.01 ? 38   DA  I "O4'" 1 
ATOM   7730  C  "C3'" . DA  C 3 19  ? -24.832 49.859  -27.969 1.00 119.74 ? 38   DA  I "C3'" 1 
ATOM   7731  O  "O3'" . DA  C 3 19  ? -23.899 49.807  -26.886 1.00 115.74 ? 38   DA  I "O3'" 1 
ATOM   7732  C  "C2'" . DA  C 3 19  ? -24.194 50.465  -29.223 1.00 117.28 ? 38   DA  I "C2'" 1 
ATOM   7733  C  "C1'" . DA  C 3 19  ? -23.776 49.230  -30.021 1.00 117.79 ? 38   DA  I "C1'" 1 
ATOM   7734  N  N9    . DA  C 3 19  ? -23.703 49.459  -31.468 1.00 114.64 ? 38   DA  I N9    1 
ATOM   7735  C  C8    . DA  C 3 19  ? -24.735 49.437  -32.371 1.00 113.00 ? 38   DA  I C8    1 
ATOM   7736  N  N7    . DA  C 3 19  ? -24.364 49.685  -33.608 1.00 110.20 ? 38   DA  I N7    1 
ATOM   7737  C  C5    . DA  C 3 19  ? -22.994 49.883  -33.512 1.00 108.23 ? 38   DA  I C5    1 
ATOM   7738  C  C6    . DA  C 3 19  ? -22.005 50.186  -34.472 1.00 105.39 ? 38   DA  I C6    1 
ATOM   7739  N  N6    . DA  C 3 19  ? -22.261 50.346  -35.775 1.00 104.38 ? 38   DA  I N6    1 
ATOM   7740  N  N1    . DA  C 3 19  ? -20.733 50.316  -34.039 1.00 104.39 ? 38   DA  I N1    1 
ATOM   7741  C  C2    . DA  C 3 19  ? -20.469 50.157  -32.737 1.00 103.26 ? 38   DA  I C2    1 
ATOM   7742  N  N3    . DA  C 3 19  ? -21.311 49.875  -31.743 1.00 104.46 ? 38   DA  I N3    1 
ATOM   7743  C  C4    . DA  C 3 19  ? -22.569 49.748  -32.201 1.00 109.35 ? 38   DA  I C4    1 
ATOM   7744  O  "O5'" . DT  D 2 1   ? -18.295 -64.640 0.987   1.00 98.25  ? 1    DT  D "O5'" 1 
ATOM   7745  C  "C5'" . DT  D 2 1   ? -19.562 -64.374 0.371   1.00 110.15 ? 1    DT  D "C5'" 1 
ATOM   7746  C  "C4'" . DT  D 2 1   ? -20.015 -62.940 0.604   1.00 111.96 ? 1    DT  D "C4'" 1 
ATOM   7747  O  "O4'" . DT  D 2 1   ? -21.317 -62.706 0.002   1.00 113.09 ? 1    DT  D "O4'" 1 
ATOM   7748  C  "C3'" . DT  D 2 1   ? -20.214 -62.565 2.071   1.00 111.76 ? 1    DT  D "C3'" 1 
ATOM   7749  O  "O3'" . DT  D 2 1   ? -18.949 -62.182 2.694   1.00 105.57 ? 1    DT  D "O3'" 1 
ATOM   7750  C  "C2'" . DT  D 2 1   ? -21.319 -61.492 2.046   1.00 112.15 ? 1    DT  D "C2'" 1 
ATOM   7751  C  "C1'" . DT  D 2 1   ? -21.885 -61.555 0.615   1.00 113.70 ? 1    DT  D "C1'" 1 
ATOM   7752  N  N1    . DT  D 2 1   ? -23.406 -61.560 0.499   1.00 115.12 ? 1    DT  D N1    1 
ATOM   7753  C  C2    . DT  D 2 1   ? -24.015 -61.618 -0.751  1.00 114.04 ? 1    DT  D C2    1 
ATOM   7754  O  O2    . DT  D 2 1   ? -23.405 -61.673 -1.812  1.00 110.57 ? 1    DT  D O2    1 
ATOM   7755  N  N3    . DT  D 2 1   ? -25.392 -61.612 -0.724  1.00 114.19 ? 1    DT  D N3    1 
ATOM   7756  C  C4    . DT  D 2 1   ? -26.214 -61.553 0.390   1.00 114.78 ? 1    DT  D C4    1 
ATOM   7757  O  O4    . DT  D 2 1   ? -27.442 -61.554 0.300   1.00 112.20 ? 1    DT  D O4    1 
ATOM   7758  C  C5    . DT  D 2 1   ? -25.519 -61.490 1.658   1.00 116.44 ? 1    DT  D C5    1 
ATOM   7759  C  C7    . DT  D 2 1   ? -26.293 -61.422 2.943   1.00 110.46 ? 1    DT  D C7    1 
ATOM   7760  C  C6    . DT  D 2 1   ? -24.174 -61.495 1.651   1.00 115.17 ? 1    DT  D C6    1 
ATOM   7761  P  P     . DC  D 2 2   ? -18.344 -60.699 2.502   1.00 107.49 ? 2    DC  D P     1 
ATOM   7762  O  OP1   . DC  D 2 2   ? -16.875 -60.791 2.604   1.00 92.60  ? 2    DC  D OP1   1 
ATOM   7763  O  OP2   . DC  D 2 2   ? -19.078 -59.780 3.407   1.00 104.31 ? 2    DC  D OP2   1 
ATOM   7764  O  "O5'" . DC  D 2 2   ? -18.699 -60.333 0.986   1.00 104.89 ? 2    DC  D "O5'" 1 
ATOM   7765  C  "C5'" . DC  D 2 2   ? -19.476 -59.170 0.736   1.00 105.80 ? 2    DC  D "C5'" 1 
ATOM   7766  C  "C4'" . DC  D 2 2   ? -19.410 -58.768 -0.721  1.00 105.97 ? 2    DC  D "C4'" 1 
ATOM   7767  O  "O4'" . DC  D 2 2   ? -20.679 -59.028 -1.373  1.00 104.53 ? 2    DC  D "O4'" 1 
ATOM   7768  C  "C3'" . DC  D 2 2   ? -19.174 -57.283 -0.923  1.00 108.13 ? 2    DC  D "C3'" 1 
ATOM   7769  O  "O3'" . DC  D 2 2   ? -18.638 -57.080 -2.222  1.00 113.54 ? 2    DC  D "O3'" 1 
ATOM   7770  C  "C2'" . DC  D 2 2   ? -20.596 -56.753 -0.795  1.00 106.88 ? 2    DC  D "C2'" 1 
ATOM   7771  C  "C1'" . DC  D 2 2   ? -21.356 -57.805 -1.594  1.00 105.16 ? 2    DC  D "C1'" 1 
ATOM   7772  N  N1    . DC  D 2 2   ? -22.774 -57.962 -1.175  1.00 106.17 ? 2    DC  D N1    1 
ATOM   7773  C  C2    . DC  D 2 2   ? -23.793 -57.847 -2.131  1.00 105.88 ? 2    DC  D C2    1 
ATOM   7774  O  O2    . DC  D 2 2   ? -23.501 -57.616 -3.315  1.00 103.29 ? 2    DC  D O2    1 
ATOM   7775  N  N3    . DC  D 2 2   ? -25.079 -57.994 -1.727  1.00 106.64 ? 2    DC  D N3    1 
ATOM   7776  C  C4    . DC  D 2 2   ? -25.355 -58.244 -0.444  1.00 106.72 ? 2    DC  D C4    1 
ATOM   7777  N  N4    . DC  D 2 2   ? -26.640 -58.382 -0.098  1.00 106.84 ? 2    DC  D N4    1 
ATOM   7778  C  C5    . DC  D 2 2   ? -24.329 -58.361 0.541   1.00 105.50 ? 2    DC  D C5    1 
ATOM   7779  C  C6    . DC  D 2 2   ? -23.065 -58.214 0.136   1.00 104.99 ? 2    DC  D C6    1 
ATOM   7780  P  P     . DC  D 2 3   ? -17.815 -55.739 -2.564  1.00 114.83 ? 3    DC  D P     1 
ATOM   7781  O  OP1   . DC  D 2 3   ? -16.507 -56.140 -3.137  1.00 106.96 ? 3    DC  D OP1   1 
ATOM   7782  O  OP2   . DC  D 2 3   ? -17.869 -54.852 -1.374  1.00 105.47 ? 3    DC  D OP2   1 
ATOM   7783  O  "O5'" . DC  D 2 3   ? -18.687 -55.054 -3.719  1.00 109.51 ? 3    DC  D "O5'" 1 
ATOM   7784  C  "C5'" . DC  D 2 3   ? -19.193 -55.835 -4.801  1.00 107.86 ? 3    DC  D "C5'" 1 
ATOM   7785  C  "C4'" . DC  D 2 3   ? -19.974 -54.934 -5.743  1.00 109.57 ? 3    DC  D "C4'" 1 
ATOM   7786  O  "O4'" . DC  D 2 3   ? -21.401 -55.034 -5.471  1.00 109.88 ? 3    DC  D "O4'" 1 
ATOM   7787  C  "C3'" . DC  D 2 3   ? -19.625 -53.456 -5.590  1.00 110.84 ? 3    DC  D "C3'" 1 
ATOM   7788  O  "O3'" . DC  D 2 3   ? -19.893 -52.808 -6.830  1.00 115.06 ? 3    DC  D "O3'" 1 
ATOM   7789  C  "C2'" . DC  D 2 3   ? -20.609 -53.015 -4.517  1.00 106.70 ? 3    DC  D "C2'" 1 
ATOM   7790  C  "C1'" . DC  D 2 3   ? -21.848 -53.814 -4.896  1.00 108.10 ? 3    DC  D "C1'" 1 
ATOM   7791  N  N1    . DC  D 2 3   ? -22.716 -54.067 -3.711  1.00 106.65 ? 3    DC  D N1    1 
ATOM   7792  C  C2    . DC  D 2 3   ? -24.105 -54.198 -3.873  1.00 104.58 ? 3    DC  D C2    1 
ATOM   7793  O  O2    . DC  D 2 3   ? -24.600 -54.113 -5.012  1.00 101.62 ? 3    DC  D O2    1 
ATOM   7794  N  N3    . DC  D 2 3   ? -24.854 -54.421 -2.758  1.00 103.94 ? 3    DC  D N3    1 
ATOM   7795  C  C4    . DC  D 2 3   ? -24.275 -54.504 -1.552  1.00 101.77 ? 3    DC  D C4    1 
ATOM   7796  N  N4    . DC  D 2 3   ? -25.048 -54.724 -0.486  1.00 99.54  ? 3    DC  D N4    1 
ATOM   7797  C  C5    . DC  D 2 3   ? -22.868 -54.365 -1.374  1.00 101.13 ? 3    DC  D C5    1 
ATOM   7798  C  C6    . DC  D 2 3   ? -22.137 -54.146 -2.471  1.00 104.92 ? 3    DC  D C6    1 
ATOM   7799  P  P     . DC  D 2 4   ? -19.752 -51.208 -6.978  1.00 115.71 ? 4    DC  D P     1 
ATOM   7800  O  OP1   . DC  D 2 4   ? -18.404 -50.917 -7.518  1.00 108.47 ? 4    DC  D OP1   1 
ATOM   7801  O  OP2   . DC  D 2 4   ? -20.192 -50.577 -5.706  1.00 114.30 ? 4    DC  D OP2   1 
ATOM   7802  O  "O5'" . DC  D 2 4   ? -20.853 -50.847 -8.086  1.00 113.18 ? 4    DC  D "O5'" 1 
ATOM   7803  C  "C5'" . DC  D 2 4   ? -22.109 -51.551 -8.111  1.00 110.32 ? 4    DC  D "C5'" 1 
ATOM   7804  C  "C4'" . DC  D 2 4   ? -23.287 -50.642 -7.791  1.00 109.85 ? 4    DC  D "C4'" 1 
ATOM   7805  O  "O4'" . DC  D 2 4   ? -23.983 -51.099 -6.600  1.00 108.45 ? 4    DC  D "O4'" 1 
ATOM   7806  C  "C3'" . DC  D 2 4   ? -22.954 -49.174 -7.533  1.00 112.81 ? 4    DC  D "C3'" 1 
ATOM   7807  O  "O3'" . DC  D 2 4   ? -23.907 -48.377 -8.227  1.00 119.74 ? 4    DC  D "O3'" 1 
ATOM   7808  C  "C2'" . DC  D 2 4   ? -23.113 -49.048 -6.020  1.00 106.95 ? 4    DC  D "C2'" 1 
ATOM   7809  C  "C1'" . DC  D 2 4   ? -24.307 -49.968 -5.818  1.00 105.82 ? 4    DC  D "C1'" 1 
ATOM   7810  N  N1    . DC  D 2 4   ? -24.513 -50.369 -4.399  1.00 104.48 ? 4    DC  D N1    1 
ATOM   7811  C  C2    . DC  D 2 4   ? -25.783 -50.775 -3.959  1.00 101.33 ? 4    DC  D C2    1 
ATOM   7812  O  O2    . DC  D 2 4   ? -26.734 -50.803 -4.757  1.00 100.27 ? 4    DC  D O2    1 
ATOM   7813  N  N3    . DC  D 2 4   ? -25.933 -51.132 -2.656  1.00 100.04 ? 4    DC  D N3    1 
ATOM   7814  C  C4    . DC  D 2 4   ? -24.891 -51.092 -1.820  1.00 98.92  ? 4    DC  D C4    1 
ATOM   7815  N  N4    . DC  D 2 4   ? -25.088 -51.451 -0.547  1.00 98.36  ? 4    DC  D N4    1 
ATOM   7816  C  C5    . DC  D 2 4   ? -23.597 -50.678 -2.254  1.00 99.80  ? 4    DC  D C5    1 
ATOM   7817  C  C6    . DC  D 2 4   ? -23.455 -50.327 -3.537  1.00 102.99 ? 4    DC  D C6    1 
ATOM   7818  P  P     . DG  D 2 5   ? -23.696 -46.787 -8.366  1.00 124.33 ? 5    DG  D P     1 
ATOM   7819  O  OP1   . DG  D 2 5   ? -23.367 -46.495 -9.784  1.00 113.94 ? 5    DG  D OP1   1 
ATOM   7820  O  OP2   . DG  D 2 5   ? -22.763 -46.353 -7.297  1.00 113.30 ? 5    DG  D OP2   1 
ATOM   7821  O  "O5'" . DG  D 2 5   ? -25.141 -46.189 -7.992  1.00 111.26 ? 5    DG  D "O5'" 1 
ATOM   7822  C  "C5'" . DG  D 2 5   ? -26.317 -47.002 -8.078  1.00 105.62 ? 5    DG  D "C5'" 1 
ATOM   7823  C  "C4'" . DG  D 2 5   ? -27.297 -46.647 -6.972  1.00 104.53 ? 5    DG  D "C4'" 1 
ATOM   7824  O  "O4'" . DG  D 2 5   ? -26.958 -47.352 -5.747  1.00 105.25 ? 5    DG  D "O4'" 1 
ATOM   7825  C  "C3'" . DG  D 2 5   ? -27.336 -45.161 -6.611  1.00 105.75 ? 5    DG  D "C3'" 1 
ATOM   7826  O  "O3'" . DG  D 2 5   ? -28.686 -44.692 -6.552  1.00 103.32 ? 5    DG  D "O3'" 1 
ATOM   7827  C  "C2'" . DG  D 2 5   ? -26.672 -45.104 -5.237  1.00 102.28 ? 5    DG  D "C2'" 1 
ATOM   7828  C  "C1'" . DG  D 2 5   ? -27.106 -46.448 -4.668  1.00 101.14 ? 5    DG  D "C1'" 1 
ATOM   7829  N  N9    . DG  D 2 5   ? -26.306 -46.852 -3.511  1.00 98.79  ? 5    DG  D N9    1 
ATOM   7830  C  C8    . DG  D 2 5   ? -24.936 -46.815 -3.399  1.00 98.08  ? 5    DG  D C8    1 
ATOM   7831  N  N7    . DG  D 2 5   ? -24.498 -47.231 -2.243  1.00 97.38  ? 5    DG  D N7    1 
ATOM   7832  C  C5    . DG  D 2 5   ? -25.650 -47.563 -1.533  1.00 97.05  ? 5    DG  D C5    1 
ATOM   7833  C  C6    . DG  D 2 5   ? -25.802 -48.073 -0.215  1.00 94.54  ? 5    DG  D C6    1 
ATOM   7834  O  O6    . DG  D 2 5   ? -24.920 -48.341 0.617   1.00 91.26  ? 5    DG  D O6    1 
ATOM   7835  N  N1    . DG  D 2 5   ? -27.147 -48.270 0.106   1.00 95.36  ? 5    DG  D N1    1 
ATOM   7836  C  C2    . DG  D 2 5   ? -28.207 -48.007 -0.738  1.00 97.10  ? 5    DG  D C2    1 
ATOM   7837  N  N2    . DG  D 2 5   ? -29.436 -48.257 -0.256  1.00 97.40  ? 5    DG  D N2    1 
ATOM   7838  N  N3    . DG  D 2 5   ? -28.074 -47.533 -1.974  1.00 95.99  ? 5    DG  D N3    1 
ATOM   7839  C  C4    . DG  D 2 5   ? -26.773 -47.333 -2.304  1.00 97.09  ? 5    DG  D C4    1 
ATOM   7840  P  P     . DT  D 2 6   ? -29.054 -43.208 -7.056  1.00 103.70 ? 6    DT  D P     1 
ATOM   7841  O  OP1   . DT  D 2 6   ? -30.532 -43.112 -7.142  1.00 95.77  ? 6    DT  D OP1   1 
ATOM   7842  O  OP2   . DT  D 2 6   ? -28.232 -42.916 -8.254  1.00 99.91  ? 6    DT  D OP2   1 
ATOM   7843  O  "O5'" . DT  D 2 6   ? -28.521 -42.262 -5.871  1.00 97.23  ? 6    DT  D "O5'" 1 
ATOM   7844  C  "C5'" . DT  D 2 6   ? -29.402 -41.854 -4.825  1.00 98.61  ? 6    DT  D "C5'" 1 
ATOM   7845  C  "C4'" . DT  D 2 6   ? -30.109 -43.048 -4.199  1.00 98.86  ? 6    DT  D "C4'" 1 
ATOM   7846  O  "O4'" . DT  D 2 6   ? -29.141 -43.873 -3.506  1.00 96.60  ? 6    DT  D "O4'" 1 
ATOM   7847  C  "C3'" . DT  D 2 6   ? -31.199 -42.728 -3.179  1.00 94.34  ? 6    DT  D "C3'" 1 
ATOM   7848  O  "O3'" . DT  D 2 6   ? -32.271 -43.641 -3.354  1.00 97.99  ? 6    DT  D "O3'" 1 
ATOM   7849  C  "C2'" . DT  D 2 6   ? -30.500 -42.946 -1.841  1.00 92.65  ? 6    DT  D "C2'" 1 
ATOM   7850  C  "C1'" . DT  D 2 6   ? -29.593 -44.116 -2.190  1.00 95.11  ? 6    DT  D "C1'" 1 
ATOM   7851  N  N1    . DT  D 2 6   ? -28.374 -44.280 -1.349  1.00 94.70  ? 6    DT  D N1    1 
ATOM   7852  C  C2    . DT  D 2 6   ? -28.481 -44.749 -0.052  1.00 93.40  ? 6    DT  D C2    1 
ATOM   7853  O  O2    . DT  D 2 6   ? -29.541 -45.035 0.485   1.00 92.14  ? 6    DT  D O2    1 
ATOM   7854  N  N3    . DT  D 2 6   ? -27.277 -44.865 0.600   1.00 92.52  ? 6    DT  D N3    1 
ATOM   7855  C  C4    . DT  D 2 6   ? -26.019 -44.572 0.089   1.00 93.39  ? 6    DT  D C4    1 
ATOM   7856  O  O4    . DT  D 2 6   ? -24.993 -44.706 0.750   1.00 93.62  ? 6    DT  D O4    1 
ATOM   7857  C  C5    . DT  D 2 6   ? -25.985 -44.096 -1.273  1.00 90.52  ? 6    DT  D C5    1 
ATOM   7858  C  C7    . DT  D 2 6   ? -24.677 -43.749 -1.921  1.00 86.47  ? 6    DT  D C7    1 
ATOM   7859  C  C6    . DT  D 2 6   ? -27.150 -43.977 -1.920  1.00 92.33  ? 6    DT  D C6    1 
ATOM   7860  P  P     . DG  D 2 7   ? -33.740 -43.279 -2.812  1.00 103.73 ? 7    DG  D P     1 
ATOM   7861  O  OP1   . DG  D 2 7   ? -34.439 -44.551 -2.490  1.00 97.74  ? 7    DG  D OP1   1 
ATOM   7862  O  OP2   . DG  D 2 7   ? -34.353 -42.324 -3.765  1.00 96.72  ? 7    DG  D OP2   1 
ATOM   7863  O  "O5'" . DG  D 2 7   ? -33.446 -42.494 -1.449  1.00 101.41 ? 7    DG  D "O5'" 1 
ATOM   7864  C  "C5'" . DG  D 2 7   ? -34.507 -42.006 -0.637  1.00 99.19  ? 7    DG  D "C5'" 1 
ATOM   7865  C  "C4'" . DG  D 2 7   ? -33.954 -41.470 0.671   1.00 95.78  ? 7    DG  D "C4'" 1 
ATOM   7866  O  "O4'" . DG  D 2 7   ? -32.537 -41.762 0.767   1.00 94.44  ? 7    DG  D "O4'" 1 
ATOM   7867  C  "C3'" . DG  D 2 7   ? -34.084 -39.958 0.828   1.00 95.58  ? 7    DG  D "C3'" 1 
ATOM   7868  O  "O3'" . DG  D 2 7   ? -34.533 -39.653 2.135   1.00 97.34  ? 7    DG  D "O3'" 1 
ATOM   7869  C  "C2'" . DG  D 2 7   ? -32.667 -39.454 0.598   1.00 94.10  ? 7    DG  D "C2'" 1 
ATOM   7870  C  "C1'" . DG  D 2 7   ? -31.907 -40.598 1.247   1.00 91.62  ? 7    DG  D "C1'" 1 
ATOM   7871  N  N9    . DG  D 2 7   ? -30.483 -40.646 0.931   1.00 91.36  ? 7    DG  D N9    1 
ATOM   7872  C  C8    . DG  D 2 7   ? -29.855 -40.229 -0.219  1.00 91.42  ? 7    DG  D C8    1 
ATOM   7873  N  N7    . DG  D 2 7   ? -28.559 -40.402 -0.198  1.00 91.58  ? 7    DG  D N7    1 
ATOM   7874  C  C5    . DG  D 2 7   ? -28.304 -40.970 1.046   1.00 89.68  ? 7    DG  D C5    1 
ATOM   7875  C  C6    . DG  D 2 7   ? -27.080 -41.379 1.636   1.00 86.12  ? 7    DG  D C6    1 
ATOM   7876  O  O6    . DG  D 2 7   ? -25.936 -41.318 1.156   1.00 83.69  ? 7    DG  D O6    1 
ATOM   7877  N  N1    . DG  D 2 7   ? -27.279 -41.901 2.914   1.00 86.89  ? 7    DG  D N1    1 
ATOM   7878  C  C2    . DG  D 2 7   ? -28.505 -42.013 3.541   1.00 90.21  ? 7    DG  D C2    1 
ATOM   7879  N  N2    . DG  D 2 7   ? -28.518 -42.542 4.780   1.00 90.28  ? 7    DG  D N2    1 
ATOM   7880  N  N3    . DG  D 2 7   ? -29.654 -41.634 2.991   1.00 88.77  ? 7    DG  D N3    1 
ATOM   7881  C  C4    . DG  D 2 7   ? -29.481 -41.123 1.749   1.00 90.04  ? 7    DG  D C4    1 
ATOM   7882  P  P     . DA  D 2 8   ? -36.050 -39.979 2.567   1.00 103.68 ? 8    DA  D P     1 
ATOM   7883  O  OP1   . DA  D 2 8   ? -36.354 -41.373 2.156   1.00 103.86 ? 8    DA  D OP1   1 
ATOM   7884  O  OP2   . DA  D 2 8   ? -36.918 -38.897 2.039   1.00 97.92  ? 8    DA  D OP2   1 
ATOM   7885  O  "O5'" . DA  D 2 8   ? -36.010 -39.899 4.175   1.00 101.08 ? 8    DA  D "O5'" 1 
ATOM   7886  C  "C5'" . DA  D 2 8   ? -35.837 -41.075 4.955   1.00 98.90  ? 8    DA  D "C5'" 1 
ATOM   7887  C  "C4'" . DA  D 2 8   ? -35.095 -40.801 6.252   1.00 98.32  ? 8    DA  D "C4'" 1 
ATOM   7888  O  "O4'" . DA  D 2 8   ? -33.686 -40.593 5.978   1.00 95.54  ? 8    DA  D "O4'" 1 
ATOM   7889  C  "C3'" . DA  D 2 8   ? -35.539 -39.576 7.045   1.00 98.88  ? 8    DA  D "C3'" 1 
ATOM   7890  O  "O3'" . DA  D 2 8   ? -35.383 -39.807 8.460   1.00 100.14 ? 8    DA  D "O3'" 1 
ATOM   7891  C  "C2'" . DA  D 2 8   ? -34.602 -38.490 6.516   1.00 94.21  ? 8    DA  D "C2'" 1 
ATOM   7892  C  "C1'" . DA  D 2 8   ? -33.310 -39.269 6.309   1.00 90.82  ? 8    DA  D "C1'" 1 
ATOM   7893  N  N9    . DA  D 2 8   ? -32.462 -38.773 5.229   1.00 88.69  ? 8    DA  D N9    1 
ATOM   7894  C  C8    . DA  D 2 8   ? -32.846 -38.208 4.043   1.00 87.85  ? 8    DA  D C8    1 
ATOM   7895  N  N7    . DA  D 2 8   ? -31.842 -37.871 3.267   1.00 84.24  ? 8    DA  D N7    1 
ATOM   7896  C  C5    . DA  D 2 8   ? -30.722 -38.245 3.994   1.00 85.83  ? 8    DA  D C5    1 
ATOM   7897  C  C6    . DA  D 2 8   ? -29.340 -38.162 3.727   1.00 86.26  ? 8    DA  D C6    1 
ATOM   7898  N  N6    . DA  D 2 8   ? -28.834 -37.646 2.598   1.00 87.19  ? 8    DA  D N6    1 
ATOM   7899  N  N1    . DA  D 2 8   ? -28.493 -38.632 4.669   1.00 84.62  ? 8    DA  D N1    1 
ATOM   7900  C  C2    . DA  D 2 8   ? -28.997 -39.145 5.797   1.00 86.14  ? 8    DA  D C2    1 
ATOM   7901  N  N3    . DA  D 2 8   ? -30.271 -39.278 6.160   1.00 86.64  ? 8    DA  D N3    1 
ATOM   7902  C  C4    . DA  D 2 8   ? -31.088 -38.804 5.205   1.00 87.13  ? 8    DA  D C4    1 
ATOM   7903  P  P     . DG  D 2 9   ? -35.553 -38.595 9.510   1.00 101.45 ? 9    DG  D P     1 
ATOM   7904  O  OP1   . DG  D 2 9   ? -35.963 -39.171 10.814  1.00 96.11  ? 9    DG  D OP1   1 
ATOM   7905  O  OP2   . DG  D 2 9   ? -36.383 -37.547 8.869   1.00 98.84  ? 9    DG  D OP2   1 
ATOM   7906  O  "O5'" . DG  D 2 9   ? -34.064 -38.030 9.674   1.00 95.14  ? 9    DG  D "O5'" 1 
ATOM   7907  C  "C5'" . DG  D 2 9   ? -33.053 -38.899 10.181  1.00 95.43  ? 9    DG  D "C5'" 1 
ATOM   7908  C  "C4'" . DG  D 2 9   ? -31.697 -38.219 10.241  1.00 95.03  ? 9    DG  D "C4'" 1 
ATOM   7909  O  "O4'" . DG  D 2 9   ? -31.235 -37.918 8.900   1.00 96.24  ? 9    DG  D "O4'" 1 
ATOM   7910  C  "C3'" . DG  D 2 9   ? -31.663 -36.906 11.018  1.00 94.31  ? 9    DG  D "C3'" 1 
ATOM   7911  O  "O3'" . DG  D 2 9   ? -30.590 -36.944 11.948  1.00 96.36  ? 9    DG  D "O3'" 1 
ATOM   7912  C  "C2'" . DG  D 2 9   ? -31.461 -35.838 9.944   1.00 91.75  ? 9    DG  D "C2'" 1 
ATOM   7913  C  "C1'" . DG  D 2 9   ? -30.700 -36.612 8.878   1.00 90.89  ? 9    DG  D "C1'" 1 
ATOM   7914  N  N9    . DG  D 2 9   ? -30.847 -36.064 7.535   1.00 86.79  ? 9    DG  D N9    1 
ATOM   7915  C  C8    . DG  D 2 9   ? -32.005 -35.706 6.889   1.00 85.86  ? 9    DG  D C8    1 
ATOM   7916  N  N7    . DG  D 2 9   ? -31.799 -35.247 5.684   1.00 84.40  ? 9    DG  D N7    1 
ATOM   7917  C  C5    . DG  D 2 9   ? -30.420 -35.307 5.524   1.00 83.23  ? 9    DG  D C5    1 
ATOM   7918  C  C6    . DG  D 2 9   ? -29.606 -34.943 4.426   1.00 82.62  ? 9    DG  D C6    1 
ATOM   7919  O  O6    . DG  D 2 9   ? -29.960 -34.475 3.331   1.00 80.15  ? 9    DG  D O6    1 
ATOM   7920  N  N1    . DG  D 2 9   ? -28.256 -35.171 4.700   1.00 81.67  ? 9    DG  D N1    1 
ATOM   7921  C  C2    . DG  D 2 9   ? -27.761 -35.683 5.879   1.00 81.26  ? 9    DG  D C2    1 
ATOM   7922  N  N2    . DG  D 2 9   ? -26.435 -35.835 5.975   1.00 81.44  ? 9    DG  D N2    1 
ATOM   7923  N  N3    . DG  D 2 9   ? -28.513 -36.027 6.909   1.00 82.37  ? 9    DG  D N3    1 
ATOM   7924  C  C4    . DG  D 2 9   ? -29.824 -35.811 6.657   1.00 84.11  ? 9    DG  D C4    1 
ATOM   7925  P  P     . DC  D 2 10  ? -30.432 -35.785 13.053  1.00 106.31 ? 10   DC  D P     1 
ATOM   7926  O  OP1   . DC  D 2 10  ? -30.572 -36.411 14.395  1.00 101.05 ? 10   DC  D OP1   1 
ATOM   7927  O  OP2   . DC  D 2 10  ? -31.319 -34.659 12.667  1.00 96.98  ? 10   DC  D OP2   1 
ATOM   7928  O  "O5'" . DC  D 2 10  ? -28.915 -35.304 12.867  1.00 96.79  ? 10   DC  D "O5'" 1 
ATOM   7929  C  "C5'" . DC  D 2 10  ? -27.915 -36.304 12.662  1.00 95.02  ? 10   DC  D "C5'" 1 
ATOM   7930  C  "C4'" . DC  D 2 10  ? -26.719 -35.756 11.903  1.00 93.28  ? 10   DC  D "C4'" 1 
ATOM   7931  O  "O4'" . DC  D 2 10  ? -27.071 -35.423 10.531  1.00 92.80  ? 10   DC  D "O4'" 1 
ATOM   7932  C  "C3'" . DC  D 2 10  ? -26.113 -34.493 12.494  1.00 93.20  ? 10   DC  D "C3'" 1 
ATOM   7933  O  "O3'" . DC  D 2 10  ? -24.710 -34.596 12.359  1.00 93.99  ? 10   DC  D "O3'" 1 
ATOM   7934  C  "C2'" . DC  D 2 10  ? -26.687 -33.386 11.615  1.00 91.07  ? 10   DC  D "C2'" 1 
ATOM   7935  C  "C1'" . DC  D 2 10  ? -26.690 -34.085 10.261  1.00 90.25  ? 10   DC  D "C1'" 1 
ATOM   7936  N  N1    . DC  D 2 10  ? -27.625 -33.477 9.257   1.00 86.76  ? 10   DC  D N1    1 
ATOM   7937  C  C2    . DC  D 2 10  ? -27.106 -32.964 8.062   1.00 84.82  ? 10   DC  D C2    1 
ATOM   7938  O  O2    . DC  D 2 10  ? -25.887 -33.028 7.862   1.00 84.94  ? 10   DC  D O2    1 
ATOM   7939  N  N3    . DC  D 2 10  ? -27.952 -32.411 7.157   1.00 83.32  ? 10   DC  D N3    1 
ATOM   7940  C  C4    . DC  D 2 10  ? -29.262 -32.362 7.411   1.00 83.21  ? 10   DC  D C4    1 
ATOM   7941  N  N4    . DC  D 2 10  ? -30.058 -31.809 6.489   1.00 81.98  ? 10   DC  D N4    1 
ATOM   7942  C  C5    . DC  D 2 10  ? -29.812 -32.876 8.623   1.00 84.68  ? 10   DC  D C5    1 
ATOM   7943  C  C6    . DC  D 2 10  ? -28.966 -33.416 9.509   1.00 86.95  ? 10   DC  D C6    1 
ATOM   7944  P  P     . DC  D 2 11  ? -23.741 -33.712 13.286  1.00 100.63 ? 11   DC  D P     1 
ATOM   7945  O  OP1   . DC  D 2 11  ? -22.881 -34.638 14.061  1.00 99.66  ? 11   DC  D OP1   1 
ATOM   7946  O  OP2   . DC  D 2 11  ? -24.578 -32.727 14.013  1.00 90.97  ? 11   DC  D OP2   1 
ATOM   7947  O  "O5'" . DC  D 2 11  ? -22.826 -32.936 12.226  1.00 96.99  ? 11   DC  D "O5'" 1 
ATOM   7948  C  "C5'" . DC  D 2 11  ? -22.104 -33.680 11.245  1.00 92.29  ? 11   DC  D "C5'" 1 
ATOM   7949  C  "C4'" . DC  D 2 11  ? -21.785 -32.808 10.038  1.00 88.97  ? 11   DC  D "C4'" 1 
ATOM   7950  O  "O4'" . DC  D 2 11  ? -23.027 -32.491 9.357   1.00 85.15  ? 11   DC  D "O4'" 1 
ATOM   7951  C  "C3'" . DC  D 2 11  ? -21.092 -31.480 10.359  1.00 89.00  ? 11   DC  D "C3'" 1 
ATOM   7952  O  "O3'" . DC  D 2 11  ? -19.807 -31.421 9.726   1.00 87.20  ? 11   DC  D "O3'" 1 
ATOM   7953  C  "C2'" . DC  D 2 11  ? -22.064 -30.407 9.861   1.00 87.24  ? 11   DC  D "C2'" 1 
ATOM   7954  C  "C1'" . DC  D 2 11  ? -22.960 -31.164 8.884   1.00 87.00  ? 11   DC  D "C1'" 1 
ATOM   7955  N  N1    . DC  D 2 11  ? -24.344 -30.593 8.763   1.00 84.69  ? 11   DC  D N1    1 
ATOM   7956  C  C2    . DC  D 2 11  ? -24.715 -29.936 7.584   1.00 83.63  ? 11   DC  D C2    1 
ATOM   7957  O  O2    . DC  D 2 11  ? -23.894 -29.843 6.659   1.00 83.49  ? 11   DC  D O2    1 
ATOM   7958  N  N3    . DC  D 2 11  ? -25.967 -29.422 7.484   1.00 82.01  ? 11   DC  D N3    1 
ATOM   7959  C  C4    . DC  D 2 11  ? -26.827 -29.536 8.494   1.00 80.65  ? 11   DC  D C4    1 
ATOM   7960  N  N4    . DC  D 2 11  ? -28.048 -29.010 8.343   1.00 79.43  ? 11   DC  D N4    1 
ATOM   7961  C  C5    . DC  D 2 11  ? -26.465 -30.197 9.703   1.00 83.34  ? 11   DC  D C5    1 
ATOM   7962  C  C6    . DC  D 2 11  ? -25.229 -30.704 9.795   1.00 85.13  ? 11   DC  D C6    1 
ATOM   7963  P  P     . DT  D 2 12  ? -18.801 -30.195 10.027  1.00 89.97  ? 12   DT  D P     1 
ATOM   7964  O  OP1   . DT  D 2 12  ? -17.408 -30.688 9.862   1.00 83.73  ? 12   DT  D OP1   1 
ATOM   7965  O  OP2   . DT  D 2 12  ? -19.201 -29.575 11.311  1.00 85.66  ? 12   DT  D OP2   1 
ATOM   7966  O  "O5'" . DT  D 2 12  ? -19.141 -29.139 8.872   1.00 88.22  ? 12   DT  D "O5'" 1 
ATOM   7967  C  "C5'" . DT  D 2 12  ? -19.234 -29.572 7.518   1.00 83.73  ? 12   DT  D "C5'" 1 
ATOM   7968  C  "C4'" . DT  D 2 12  ? -19.503 -28.389 6.609   1.00 82.45  ? 12   DT  D "C4'" 1 
ATOM   7969  O  "O4'" . DT  D 2 12  ? -20.926 -28.117 6.546   1.00 82.41  ? 12   DT  D "O4'" 1 
ATOM   7970  C  "C3'" . DT  D 2 12  ? -18.834 -27.089 7.047   1.00 84.52  ? 12   DT  D "C3'" 1 
ATOM   7971  O  "O3'" . DT  D 2 12  ? -18.239 -26.481 5.899   1.00 86.93  ? 12   DT  D "O3'" 1 
ATOM   7972  C  "C2'" . DT  D 2 12  ? -19.986 -26.273 7.644   1.00 80.22  ? 12   DT  D "C2'" 1 
ATOM   7973  C  "C1'" . DT  D 2 12  ? -21.169 -26.745 6.803   1.00 80.21  ? 12   DT  D "C1'" 1 
ATOM   7974  N  N1    . DT  D 2 12  ? -22.516 -26.640 7.454   1.00 80.04  ? 12   DT  D N1    1 
ATOM   7975  C  C2    . DT  D 2 12  ? -23.608 -26.202 6.725   1.00 77.26  ? 12   DT  D C2    1 
ATOM   7976  O  O2    . DT  D 2 12  ? -23.551 -25.871 5.558   1.00 78.02  ? 12   DT  D O2    1 
ATOM   7977  N  N3    . DT  D 2 12  ? -24.793 -26.161 7.413   1.00 77.37  ? 12   DT  D N3    1 
ATOM   7978  C  C4    . DT  D 2 12  ? -24.994 -26.509 8.735   1.00 79.70  ? 12   DT  D C4    1 
ATOM   7979  O  O4    . DT  D 2 12  ? -26.094 -26.439 9.276   1.00 81.49  ? 12   DT  D O4    1 
ATOM   7980  C  C5    . DT  D 2 12  ? -23.818 -26.961 9.439   1.00 80.04  ? 12   DT  D C5    1 
ATOM   7981  C  C7    . DT  D 2 12  ? -23.926 -27.360 10.878  1.00 78.33  ? 12   DT  D C7    1 
ATOM   7982  C  C6    . DT  D 2 12  ? -22.651 -27.007 8.779   1.00 82.15  ? 12   DT  D C6    1 
ATOM   7983  P  P     . DC  D 2 13  ? -17.373 -25.136 6.046   1.00 82.93  ? 13   DC  D P     1 
ATOM   7984  O  OP1   . DC  D 2 13  ? -16.248 -25.214 5.094   1.00 85.89  ? 13   DC  D OP1   1 
ATOM   7985  O  OP2   . DC  D 2 13  ? -17.092 -24.924 7.484   1.00 83.27  ? 13   DC  D OP2   1 
ATOM   7986  O  "O5'" . DC  D 2 13  ? -18.380 -23.996 5.571   1.00 79.09  ? 13   DC  D "O5'" 1 
ATOM   7987  C  "C5'" . DC  D 2 13  ? -19.294 -24.214 4.500   1.00 76.10  ? 13   DC  D "C5'" 1 
ATOM   7988  C  "C4'" . DC  D 2 13  ? -20.162 -22.975 4.346   1.00 78.48  ? 13   DC  D "C4'" 1 
ATOM   7989  O  "O4'" . DC  D 2 13  ? -21.416 -23.140 5.061   1.00 75.52  ? 13   DC  D "O4'" 1 
ATOM   7990  C  "C3'" . DC  D 2 13  ? -19.536 -21.697 4.903   1.00 78.80  ? 13   DC  D "C3'" 1 
ATOM   7991  O  "O3'" . DC  D 2 13  ? -20.037 -20.564 4.207   1.00 77.71  ? 13   DC  D "O3'" 1 
ATOM   7992  C  "C2'" . DC  D 2 13  ? -20.081 -21.711 6.322   1.00 77.09  ? 13   DC  D "C2'" 1 
ATOM   7993  C  "C1'" . DC  D 2 13  ? -21.519 -22.100 6.010   1.00 74.83  ? 13   DC  D "C1'" 1 
ATOM   7994  N  N1    . DC  D 2 13  ? -22.281 -22.544 7.203   1.00 74.14  ? 13   DC  D N1    1 
ATOM   7995  C  C2    . DC  D 2 13  ? -23.667 -22.369 7.199   1.00 76.35  ? 13   DC  D C2    1 
ATOM   7996  O  O2    . DC  D 2 13  ? -24.210 -21.866 6.205   1.00 73.90  ? 13   DC  D O2    1 
ATOM   7997  N  N3    . DC  D 2 13  ? -24.371 -22.761 8.286   1.00 78.28  ? 13   DC  D N3    1 
ATOM   7998  C  C4    . DC  D 2 13  ? -23.740 -23.293 9.334   1.00 77.45  ? 13   DC  D C4    1 
ATOM   7999  N  N4    . DC  D 2 13  ? -24.492 -23.656 10.379  1.00 76.20  ? 13   DC  D N4    1 
ATOM   8000  C  C5    . DC  D 2 13  ? -22.322 -23.473 9.355   1.00 74.88  ? 13   DC  D C5    1 
ATOM   8001  C  C6    . DC  D 2 13  ? -21.636 -23.085 8.277   1.00 72.94  ? 13   DC  D C6    1 
ATOM   8002  P  P     . DC  D 2 14  ? -19.215 -19.932 2.978   1.00 75.98  ? 14   DC  D P     1 
ATOM   8003  O  OP1   . DC  D 2 14  ? -18.671 -21.048 2.168   1.00 73.90  ? 14   DC  D OP1   1 
ATOM   8004  O  OP2   . DC  D 2 14  ? -18.311 -18.889 3.521   1.00 73.23  ? 14   DC  D OP2   1 
ATOM   8005  O  "O5'" . DC  D 2 14  ? -20.350 -19.231 2.104   1.00 72.72  ? 14   DC  D "O5'" 1 
ATOM   8006  C  "C5'" . DC  D 2 14  ? -21.216 -20.088 1.382   1.00 73.12  ? 14   DC  D "C5'" 1 
ATOM   8007  C  "C4'" . DC  D 2 14  ? -22.581 -19.457 1.211   1.00 73.05  ? 14   DC  D "C4'" 1 
ATOM   8008  O  "O4'" . DC  D 2 14  ? -23.364 -19.609 2.422   1.00 75.15  ? 14   DC  D "O4'" 1 
ATOM   8009  C  "C3'" . DC  D 2 14  ? -22.554 -17.971 0.914   1.00 73.89  ? 14   DC  D "C3'" 1 
ATOM   8010  O  "O3'" . DC  D 2 14  ? -23.585 -17.701 -0.015  1.00 74.79  ? 14   DC  D "O3'" 1 
ATOM   8011  C  "C2'" . DC  D 2 14  ? -22.820 -17.353 2.283   1.00 75.38  ? 14   DC  D "C2'" 1 
ATOM   8012  C  "C1'" . DC  D 2 14  ? -23.796 -18.348 2.891   1.00 75.00  ? 14   DC  D "C1'" 1 
ATOM   8013  N  N1    . DC  D 2 14  ? -23.765 -18.393 4.381   1.00 74.29  ? 14   DC  D N1    1 
ATOM   8014  C  C2    . DC  D 2 14  ? -24.950 -18.386 5.123   1.00 73.00  ? 14   DC  D C2    1 
ATOM   8015  O  O2    . DC  D 2 14  ? -26.039 -18.333 4.542   1.00 72.62  ? 14   DC  D O2    1 
ATOM   8016  N  N3    . DC  D 2 14  ? -24.866 -18.437 6.471   1.00 73.22  ? 14   DC  D N3    1 
ATOM   8017  C  C4    . DC  D 2 14  ? -23.679 -18.494 7.073   1.00 74.06  ? 14   DC  D C4    1 
ATOM   8018  N  N4    . DC  D 2 14  ? -23.647 -18.544 8.408   1.00 77.36  ? 14   DC  D N4    1 
ATOM   8019  C  C5    . DC  D 2 14  ? -22.465 -18.502 6.336   1.00 73.84  ? 14   DC  D C5    1 
ATOM   8020  C  C6    . DC  D 2 14  ? -22.557 -18.453 5.006   1.00 75.09  ? 14   DC  D C6    1 
ATOM   8021  P  P     . DG  D 2 15  ? -23.790 -16.216 -0.583  1.00 78.68  ? 15   DG  D P     1 
ATOM   8022  O  OP1   . DG  D 2 15  ? -24.354 -16.325 -1.946  1.00 76.06  ? 15   DG  D OP1   1 
ATOM   8023  O  OP2   . DG  D 2 15  ? -22.543 -15.447 -0.326  1.00 73.66  ? 15   DG  D OP2   1 
ATOM   8024  O  "O5'" . DG  D 2 15  ? -24.905 -15.606 0.378   1.00 76.56  ? 15   DG  D "O5'" 1 
ATOM   8025  C  "C5'" . DG  D 2 15  ? -26.221 -16.120 0.331   1.00 76.34  ? 15   DG  D "C5'" 1 
ATOM   8026  C  "C4'" . DG  D 2 15  ? -27.132 -15.213 1.139   1.00 75.32  ? 15   DG  D "C4'" 1 
ATOM   8027  O  "O4'" . DG  D 2 15  ? -26.856 -15.370 2.557   1.00 77.46  ? 15   DG  D "O4'" 1 
ATOM   8028  C  "C3'" . DG  D 2 15  ? -26.973 -13.730 0.842   1.00 71.28  ? 15   DG  D "C3'" 1 
ATOM   8029  O  "O3'" . DG  D 2 15  ? -28.262 -13.135 0.890   1.00 69.82  ? 15   DG  D "O3'" 1 
ATOM   8030  C  "C2'" . DG  D 2 15  ? -26.028 -13.254 1.944   1.00 72.45  ? 15   DG  D "C2'" 1 
ATOM   8031  C  "C1'" . DG  D 2 15  ? -26.421 -14.147 3.114   1.00 73.42  ? 15   DG  D "C1'" 1 
ATOM   8032  N  N9    . DG  D 2 15  ? -25.346 -14.425 4.070   1.00 74.69  ? 15   DG  D N9    1 
ATOM   8033  C  C8    . DG  D 2 15  ? -23.986 -14.429 3.855   1.00 73.11  ? 15   DG  D C8    1 
ATOM   8034  N  N7    . DG  D 2 15  ? -23.291 -14.716 4.923   1.00 73.55  ? 15   DG  D N7    1 
ATOM   8035  C  C5    . DG  D 2 15  ? -24.250 -14.917 5.913   1.00 75.39  ? 15   DG  D C5    1 
ATOM   8036  C  C6    . DG  D 2 15  ? -24.110 -15.256 7.284   1.00 76.07  ? 15   DG  D C6    1 
ATOM   8037  O  O6    . DG  D 2 15  ? -23.067 -15.456 7.925   1.00 76.57  ? 15   DG  D O6    1 
ATOM   8038  N  N1    . DG  D 2 15  ? -25.346 -15.359 7.924   1.00 75.52  ? 15   DG  D N1    1 
ATOM   8039  C  C2    . DG  D 2 15  ? -26.567 -15.162 7.321   1.00 75.86  ? 15   DG  D C2    1 
ATOM   8040  N  N2    . DG  D 2 15  ? -27.656 -15.304 8.095   1.00 76.76  ? 15   DG  D N2    1 
ATOM   8041  N  N3    . DG  D 2 15  ? -26.711 -14.846 6.040   1.00 73.94  ? 15   DG  D N3    1 
ATOM   8042  C  C4    . DG  D 2 15  ? -25.518 -14.741 5.401   1.00 75.06  ? 15   DG  D C4    1 
ATOM   8043  P  P     . DC  D 2 16  ? -28.418 -11.537 0.929   1.00 70.57  ? 16   DC  D P     1 
ATOM   8044  O  OP1   . DC  D 2 16  ? -29.759 -11.199 0.399   1.00 62.44  ? 16   DC  D OP1   1 
ATOM   8045  O  OP2   . DC  D 2 16  ? -27.191 -10.940 0.345   1.00 66.03  ? 16   DC  D OP2   1 
ATOM   8046  O  "O5'" . DC  D 2 16  ? -28.391 -11.201 2.489   1.00 73.03  ? 16   DC  D "O5'" 1 
ATOM   8047  C  "C5'" . DC  D 2 16  ? -29.396 -11.726 3.339   1.00 72.77  ? 16   DC  D "C5'" 1 
ATOM   8048  C  "C4'" . DC  D 2 16  ? -29.044 -11.389 4.768   1.00 73.12  ? 16   DC  D "C4'" 1 
ATOM   8049  O  "O4'" . DC  D 2 16  ? -27.734 -11.900 5.080   1.00 71.36  ? 16   DC  D "O4'" 1 
ATOM   8050  C  "C3'" . DC  D 2 16  ? -28.925 -9.901  5.048   1.00 77.78  ? 16   DC  D "C3'" 1 
ATOM   8051  O  "O3'" . DC  D 2 16  ? -30.159 -9.491  5.590   1.00 83.30  ? 16   DC  D "O3'" 1 
ATOM   8052  C  "C2'" . DC  D 2 16  ? -27.784 -9.802  6.063   1.00 78.68  ? 16   DC  D "C2'" 1 
ATOM   8053  C  "C1'" . DC  D 2 16  ? -27.386 -11.257 6.275   1.00 74.36  ? 16   DC  D "C1'" 1 
ATOM   8054  N  N1    . DC  D 2 16  ? -25.946 -11.459 6.528   1.00 73.30  ? 16   DC  D N1    1 
ATOM   8055  C  C2    . DC  D 2 16  ? -25.552 -11.909 7.788   1.00 78.82  ? 16   DC  D C2    1 
ATOM   8056  O  O2    . DC  D 2 16  ? -26.423 -12.125 8.643   1.00 80.82  ? 16   DC  D O2    1 
ATOM   8057  N  N3    . DC  D 2 16  ? -24.230 -12.095 8.030   1.00 78.69  ? 16   DC  D N3    1 
ATOM   8058  C  C4    . DC  D 2 16  ? -23.334 -11.850 7.072   1.00 75.44  ? 16   DC  D C4    1 
ATOM   8059  N  N4    . DC  D 2 16  ? -22.041 -12.047 7.356   1.00 74.41  ? 16   DC  D N4    1 
ATOM   8060  C  C5    . DC  D 2 16  ? -23.724 -11.391 5.781   1.00 71.74  ? 16   DC  D C5    1 
ATOM   8061  C  C6    . DC  D 2 16  ? -25.029 -11.211 5.555   1.00 70.56  ? 16   DC  D C6    1 
ATOM   8062  P  P     . DA  D 2 17  ? -30.540 -7.930  5.667   1.00 87.58  ? 17   DA  D P     1 
ATOM   8063  O  OP1   . DA  D 2 17  ? -31.661 -7.688  4.729   1.00 82.35  ? 17   DA  D OP1   1 
ATOM   8064  O  OP2   . DA  D 2 17  ? -29.291 -7.143  5.531   1.00 84.64  ? 17   DA  D OP2   1 
ATOM   8065  O  "O5'" . DA  D 2 17  ? -31.045 -7.750  7.176   1.00 92.31  ? 17   DA  D "O5'" 1 
ATOM   8066  C  "C5'" . DA  D 2 17  ? -31.762 -8.813  7.813   1.00 95.98  ? 17   DA  D "C5'" 1 
ATOM   8067  C  "C4'" . DA  D 2 17  ? -31.520 -8.766  9.305   1.00 99.46  ? 17   DA  D "C4'" 1 
ATOM   8068  O  "O4'" . DA  D 2 17  ? -30.329 -9.540  9.595   1.00 96.88  ? 17   DA  D "O4'" 1 
ATOM   8069  C  "C3'" . DA  D 2 17  ? -31.261 -7.365  9.853   1.00 101.42 ? 17   DA  D "C3'" 1 
ATOM   8070  O  "O3'" . DA  D 2 17  ? -32.491 -6.734  10.294  1.00 109.61 ? 17   DA  D "O3'" 1 
ATOM   8071  C  "C2'" . DA  D 2 17  ? -30.258 -7.607  10.977  1.00 102.77 ? 17   DA  D "C2'" 1 
ATOM   8072  C  "C1'" . DA  D 2 17  ? -29.528 -8.883  10.567  1.00 98.98  ? 17   DA  D "C1'" 1 
ATOM   8073  N  N9    . DA  D 2 17  ? -28.184 -8.620  10.049  1.00 96.26  ? 17   DA  D N9    1 
ATOM   8074  C  C8    . DA  D 2 17  ? -27.837 -7.964  8.896   1.00 93.54  ? 17   DA  D C8    1 
ATOM   8075  N  N7    . DA  D 2 17  ? -26.541 -7.885  8.699   1.00 90.89  ? 17   DA  D N7    1 
ATOM   8076  C  C5    . DA  D 2 17  ? -25.999 -8.529  9.799   1.00 93.34  ? 17   DA  D C5    1 
ATOM   8077  C  C6    . DA  D 2 17  ? -24.663 -8.783  10.180  1.00 93.63  ? 17   DA  D C6    1 
ATOM   8078  N  N6    . DA  D 2 17  ? -23.603 -8.398  9.457   1.00 92.94  ? 17   DA  D N6    1 
ATOM   8079  N  N1    . DA  D 2 17  ? -24.461 -9.446  11.337  1.00 94.04  ? 17   DA  D N1    1 
ATOM   8080  C  C2    . DA  D 2 17  ? -25.528 -9.827  12.054  1.00 94.12  ? 17   DA  D C2    1 
ATOM   8081  N  N3    . DA  D 2 17  ? -26.826 -9.649  11.800  1.00 94.41  ? 17   DA  D N3    1 
ATOM   8082  C  C4    . DA  D 2 17  ? -26.997 -8.985  10.644  1.00 94.66  ? 17   DA  D C4    1 
ATOM   8083  P  P     . DG  D 2 18  ? -32.991 -6.865  11.825  1.00 117.38 ? 18   DG  D P     1 
ATOM   8084  O  OP1   . DG  D 2 18  ? -32.873 -8.285  12.231  1.00 114.69 ? 18   DG  D OP1   1 
ATOM   8085  O  OP2   . DG  D 2 18  ? -34.322 -6.215  11.922  1.00 114.60 ? 18   DG  D OP2   1 
ATOM   8086  O  "O5'" . DG  D 2 18  ? -31.934 -5.974  12.651  1.00 111.18 ? 18   DG  D "O5'" 1 
ATOM   8087  C  "C5'" . DG  D 2 18  ? -31.786 -6.106  14.074  1.00 112.05 ? 18   DG  D "C5'" 1 
ATOM   8088  C  "C4'" . DG  D 2 18  ? -30.343 -5.912  14.539  1.00 115.26 ? 18   DG  D "C4'" 1 
ATOM   8089  O  "O4'" . DG  D 2 18  ? -29.395 -6.285  13.503  1.00 112.73 ? 18   DG  D "O4'" 1 
ATOM   8090  C  "C3'" . DG  D 2 18  ? -29.931 -4.500  14.978  1.00 121.22 ? 18   DG  D "C3'" 1 
ATOM   8091  O  "O3'" . DG  D 2 18  ? -29.955 -4.394  16.423  1.00 127.40 ? 18   DG  D "O3'" 1 
ATOM   8092  C  "C2'" . DG  D 2 18  ? -28.514 -4.335  14.421  1.00 114.84 ? 18   DG  D "C2'" 1 
ATOM   8093  C  "C1'" . DG  D 2 18  ? -28.156 -5.715  13.871  1.00 111.28 ? 18   DG  D "C1'" 1 
ATOM   8094  N  N9    . DG  D 2 18  ? -27.212 -5.592  12.754  1.00 107.59 ? 18   DG  D N9    1 
ATOM   8095  C  C8    . DG  D 2 18  ? -27.453 -5.135  11.476  1.00 105.60 ? 18   DG  D C8    1 
ATOM   8096  N  N7    . DG  D 2 18  ? -26.390 -5.118  10.714  1.00 102.44 ? 18   DG  D N7    1 
ATOM   8097  C  C5    . DG  D 2 18  ? -25.370 -5.583  11.538  1.00 102.72 ? 18   DG  D C5    1 
ATOM   8098  C  C6    . DG  D 2 18  ? -23.988 -5.785  11.265  1.00 102.26 ? 18   DG  D C6    1 
ATOM   8099  O  O6    . DG  D 2 18  ? -23.361 -5.586  10.206  1.00 97.96  ? 18   DG  D O6    1 
ATOM   8100  N  N1    . DG  D 2 18  ? -23.319 -6.273  12.390  1.00 102.17 ? 18   DG  D N1    1 
ATOM   8101  C  C2    . DG  D 2 18  ? -23.904 -6.529  13.612  1.00 102.00 ? 18   DG  D C2    1 
ATOM   8102  N  N2    . DG  D 2 18  ? -23.096 -6.994  14.577  1.00 103.05 ? 18   DG  D N2    1 
ATOM   8103  N  N3    . DG  D 2 18  ? -25.192 -6.344  13.877  1.00 101.35 ? 18   DG  D N3    1 
ATOM   8104  C  C4    . DG  D 2 18  ? -25.862 -5.872  12.797  1.00 103.18 ? 18   DG  D C4    1 
ATOM   8105  P  P     . DG  D 2 19  ? -29.588 -3.000  17.156  1.00 130.79 ? 19   DG  D P     1 
ATOM   8106  O  OP1   . DG  D 2 19  ? -30.738 -2.618  18.011  1.00 121.69 ? 19   DG  D OP1   1 
ATOM   8107  O  OP2   . DG  D 2 19  ? -29.088 -2.051  16.128  1.00 120.86 ? 19   DG  D OP2   1 
ATOM   8108  O  "O5'" . DG  D 2 19  ? -28.346 -3.384  18.103  1.00 118.45 ? 19   DG  D "O5'" 1 
ATOM   8109  C  "C5'" . DG  D 2 19  ? -27.192 -4.005  17.542  1.00 114.88 ? 19   DG  D "C5'" 1 
ATOM   8110  C  "C4'" . DG  D 2 19  ? -25.937 -3.853  18.388  1.00 115.00 ? 19   DG  D "C4'" 1 
ATOM   8111  O  "O4'" . DG  D 2 19  ? -24.871 -4.585  17.725  1.00 115.18 ? 19   DG  D "O4'" 1 
ATOM   8112  C  "C3'" . DG  D 2 19  ? -25.426 -2.422  18.586  1.00 114.49 ? 19   DG  D "C3'" 1 
ATOM   8113  O  "O3'" . DG  D 2 19  ? -25.542 -2.024  19.955  1.00 108.93 ? 19   DG  D "O3'" 1 
ATOM   8114  C  "C2'" . DG  D 2 19  ? -23.957 -2.463  18.162  1.00 113.41 ? 19   DG  D "C2'" 1 
ATOM   8115  C  "C1'" . DG  D 2 19  ? -23.878 -3.689  17.257  1.00 111.60 ? 19   DG  D "C1'" 1 
ATOM   8116  N  N9    . DG  D 2 19  ? -24.076 -3.382  15.836  1.00 107.29 ? 19   DG  D N9    1 
ATOM   8117  C  C8    . DG  D 2 19  ? -25.257 -3.099  15.184  1.00 106.86 ? 19   DG  D C8    1 
ATOM   8118  N  N7    . DG  D 2 19  ? -25.115 -2.862  13.910  1.00 103.23 ? 19   DG  D N7    1 
ATOM   8119  C  C5    . DG  D 2 19  ? -23.748 -2.992  13.701  1.00 103.56 ? 19   DG  D C5    1 
ATOM   8120  C  C6    . DG  D 2 19  ? -22.990 -2.845  12.513  1.00 104.74 ? 19   DG  D C6    1 
ATOM   8121  O  O6    . DG  D 2 19  ? -23.392 -2.563  11.369  1.00 104.08 ? 19   DG  D O6    1 
ATOM   8122  N  N1    . DG  D 2 19  ? -21.630 -3.064  12.748  1.00 104.33 ? 19   DG  D N1    1 
ATOM   8123  C  C2    . DG  D 2 19  ? -21.069 -3.382  13.965  1.00 104.69 ? 19   DG  D C2    1 
ATOM   8124  N  N2    . DG  D 2 19  ? -19.736 -3.555  13.981  1.00 104.14 ? 19   DG  D N2    1 
ATOM   8125  N  N3    . DG  D 2 19  ? -21.771 -3.518  15.084  1.00 104.80 ? 19   DG  D N3    1 
ATOM   8126  C  C4    . DG  D 2 19  ? -23.096 -3.309  14.875  1.00 104.26 ? 19   DG  D C4    1 
ATOM   8127  O  "O5'" . DC  E 3 1   ? -12.983 -6.006  7.948   1.00 114.50 ? 20   DC  J "O5'" 1 
ATOM   8128  C  "C5'" . DC  E 3 1   ? -13.181 -4.640  8.342   1.00 118.54 ? 20   DC  J "C5'" 1 
ATOM   8129  C  "C4'" . DC  E 3 1   ? -13.456 -4.498  9.833   1.00 118.08 ? 20   DC  J "C4'" 1 
ATOM   8130  O  "O4'" . DC  E 3 1   ? -14.489 -3.491  10.028  1.00 116.25 ? 20   DC  J "O4'" 1 
ATOM   8131  C  "C3'" . DC  E 3 1   ? -13.975 -5.778  10.486  1.00 120.13 ? 20   DC  J "C3'" 1 
ATOM   8132  O  "O3'" . DC  E 3 1   ? -13.027 -6.333  11.416  1.00 125.88 ? 20   DC  J "O3'" 1 
ATOM   8133  C  "C2'" . DC  E 3 1   ? -15.273 -5.365  11.173  1.00 113.56 ? 20   DC  J "C2'" 1 
ATOM   8134  C  "C1'" . DC  E 3 1   ? -15.313 -3.849  11.118  1.00 112.96 ? 20   DC  J "C1'" 1 
ATOM   8135  N  N1    . DC  E 3 1   ? -16.721 -3.428  10.891  1.00 109.22 ? 20   DC  J N1    1 
ATOM   8136  C  C2    . DC  E 3 1   ? -17.443 -2.761  11.893  1.00 109.11 ? 20   DC  J C2    1 
ATOM   8137  O  O2    . DC  E 3 1   ? -16.898 -2.493  12.975  1.00 108.86 ? 20   DC  J O2    1 
ATOM   8138  N  N3    . DC  E 3 1   ? -18.734 -2.417  11.637  1.00 107.44 ? 20   DC  J N3    1 
ATOM   8139  C  C4    . DC  E 3 1   ? -19.299 -2.719  10.461  1.00 103.14 ? 20   DC  J C4    1 
ATOM   8140  N  N4    . DC  E 3 1   ? -20.573 -2.364  10.242  1.00 102.37 ? 20   DC  J N4    1 
ATOM   8141  C  C5    . DC  E 3 1   ? -18.577 -3.406  9.442   1.00 100.45 ? 20   DC  J C5    1 
ATOM   8142  C  C6    . DC  E 3 1   ? -17.310 -3.740  9.699   1.00 105.69 ? 20   DC  J C6    1 
ATOM   8143  P  P     . DC  E 3 2   ? -13.527 -7.300  12.606  1.00 125.16 ? 21   DC  J P     1 
ATOM   8144  O  OP1   . DC  E 3 2   ? -12.353 -7.624  13.456  1.00 115.20 ? 21   DC  J OP1   1 
ATOM   8145  O  OP2   . DC  E 3 2   ? -14.300 -8.413  11.995  1.00 117.44 ? 21   DC  J OP2   1 
ATOM   8146  O  "O5'" . DC  E 3 2   ? -14.523 -6.361  13.453  1.00 119.74 ? 21   DC  J "O5'" 1 
ATOM   8147  C  "C5'" . DC  E 3 2   ? -14.380 -6.116  14.851  1.00 118.02 ? 21   DC  J "C5'" 1 
ATOM   8148  C  "C4'" . DC  E 3 2   ? -15.492 -6.806  15.619  1.00 114.50 ? 21   DC  J "C4'" 1 
ATOM   8149  O  "O4'" . DC  E 3 2   ? -16.784 -6.407  15.083  1.00 112.12 ? 21   DC  J "O4'" 1 
ATOM   8150  C  "C3'" . DC  E 3 2   ? -15.445 -8.327  15.533  1.00 115.32 ? 21   DC  J "C3'" 1 
ATOM   8151  O  "O3'" . DC  E 3 2   ? -15.737 -8.905  16.808  1.00 118.86 ? 21   DC  J "O3'" 1 
ATOM   8152  C  "C2'" . DC  E 3 2   ? -16.481 -8.655  14.456  1.00 113.31 ? 21   DC  J "C2'" 1 
ATOM   8153  C  "C1'" . DC  E 3 2   ? -17.509 -7.542  14.638  1.00 111.62 ? 21   DC  J "C1'" 1 
ATOM   8154  N  N1    . DC  E 3 2   ? -18.291 -7.200  13.394  1.00 111.49 ? 21   DC  J N1    1 
ATOM   8155  C  C2    . DC  E 3 2   ? -19.689 -7.101  13.466  1.00 107.90 ? 21   DC  J C2    1 
ATOM   8156  O  O2    . DC  E 3 2   ? -20.252 -7.295  14.554  1.00 107.19 ? 21   DC  J O2    1 
ATOM   8157  N  N3    . DC  E 3 2   ? -20.389 -6.792  12.343  1.00 103.73 ? 21   DC  J N3    1 
ATOM   8158  C  C4    . DC  E 3 2   ? -19.750 -6.590  11.188  1.00 104.41 ? 21   DC  J C4    1 
ATOM   8159  N  N4    . DC  E 3 2   ? -20.490 -6.289  10.114  1.00 103.88 ? 21   DC  J N4    1 
ATOM   8160  C  C5    . DC  E 3 2   ? -18.329 -6.690  11.090  1.00 106.52 ? 21   DC  J C5    1 
ATOM   8161  C  C6    . DC  E 3 2   ? -17.651 -6.995  12.204  1.00 109.82 ? 21   DC  J C6    1 
ATOM   8162  P  P     . DT  E 3 3   ? -16.081 -10.474 16.933  1.00 119.03 ? 22   DT  J P     1 
ATOM   8163  O  OP1   . DT  E 3 3   ? -15.634 -10.934 18.269  1.00 115.10 ? 22   DT  J OP1   1 
ATOM   8164  O  OP2   . DT  E 3 3   ? -15.562 -11.156 15.722  1.00 107.37 ? 22   DT  J OP2   1 
ATOM   8165  O  "O5'" . DT  E 3 3   ? -17.681 -10.505 16.894  1.00 111.39 ? 22   DT  J "O5'" 1 
ATOM   8166  C  "C5'" . DT  E 3 3   ? -18.415 -9.815  17.905  1.00 106.97 ? 22   DT  J "C5'" 1 
ATOM   8167  C  "C4'" . DT  E 3 3   ? -19.816 -10.384 18.003  1.00 107.59 ? 22   DT  J "C4'" 1 
ATOM   8168  O  "O4'" . DT  E 3 3   ? -20.586 -9.944  16.856  1.00 105.13 ? 22   DT  J "O4'" 1 
ATOM   8169  C  "C3'" . DT  E 3 3   ? -19.891 -11.912 18.017  1.00 109.55 ? 22   DT  J "C3'" 1 
ATOM   8170  O  "O3'" . DT  E 3 3   ? -20.964 -12.383 18.865  1.00 111.33 ? 22   DT  J "O3'" 1 
ATOM   8171  C  "C2'" . DT  E 3 3   ? -20.143 -12.234 16.550  1.00 105.93 ? 22   DT  J "C2'" 1 
ATOM   8172  C  "C1'" . DT  E 3 3   ? -21.049 -11.077 16.145  1.00 103.75 ? 22   DT  J "C1'" 1 
ATOM   8173  N  N1    . DT  E 3 3   ? -21.032 -10.819 14.673  1.00 101.85 ? 22   DT  J N1    1 
ATOM   8174  C  C2    . DT  E 3 3   ? -22.212 -10.503 14.034  1.00 100.38 ? 22   DT  J C2    1 
ATOM   8175  O  O2    . DT  E 3 3   ? -23.285 -10.409 14.614  1.00 99.15  ? 22   DT  J O2    1 
ATOM   8176  N  N3    . DT  E 3 3   ? -22.077 -10.293 12.680  1.00 99.96  ? 22   DT  J N3    1 
ATOM   8177  C  C4    . DT  E 3 3   ? -20.912 -10.373 11.927  1.00 99.40  ? 22   DT  J C4    1 
ATOM   8178  O  O4    . DT  E 3 3   ? -20.889 -10.171 10.715  1.00 95.83  ? 22   DT  J O4    1 
ATOM   8179  C  C5    . DT  E 3 3   ? -19.721 -10.713 12.665  1.00 102.00 ? 22   DT  J C5    1 
ATOM   8180  C  C7    . DT  E 3 3   ? -18.402 -10.826 11.957  1.00 100.77 ? 22   DT  J C7    1 
ATOM   8181  C  C6    . DT  E 3 3   ? -19.839 -10.920 13.983  1.00 101.90 ? 22   DT  J C6    1 
ATOM   8182  P  P     . DG  E 3 4   ? -21.083 -13.952 19.260  1.00 120.80 ? 23   DG  J P     1 
ATOM   8183  O  OP1   . DG  E 3 4   ? -20.120 -14.230 20.350  1.00 114.82 ? 23   DG  J OP1   1 
ATOM   8184  O  OP2   . DG  E 3 4   ? -21.030 -14.757 18.011  1.00 108.63 ? 23   DG  J OP2   1 
ATOM   8185  O  "O5'" . DG  E 3 4   ? -22.556 -14.075 19.891  1.00 108.70 ? 23   DG  J "O5'" 1 
ATOM   8186  C  "C5'" . DG  E 3 4   ? -23.591 -13.180 19.503  1.00 104.39 ? 23   DG  J "C5'" 1 
ATOM   8187  C  "C4'" . DG  E 3 4   ? -24.281 -13.631 18.220  1.00 103.16 ? 23   DG  J "C4'" 1 
ATOM   8188  O  "O4'" . DG  E 3 4   ? -23.574 -13.218 17.015  1.00 100.22 ? 23   DG  J "O4'" 1 
ATOM   8189  C  "C3'" . DG  E 3 4   ? -24.497 -15.139 18.081  1.00 99.59  ? 23   DG  J "C3'" 1 
ATOM   8190  O  "O3'" . DG  E 3 4   ? -25.890 -15.399 18.245  1.00 96.72  ? 23   DG  J "O3'" 1 
ATOM   8191  C  "C2'" . DG  E 3 4   ? -24.008 -15.441 16.661  1.00 98.98  ? 23   DG  J "C2'" 1 
ATOM   8192  C  "C1'" . DG  E 3 4   ? -24.062 -14.069 15.999  1.00 97.39  ? 23   DG  J "C1'" 1 
ATOM   8193  N  N9    . DG  E 3 4   ? -23.289 -13.936 14.756  1.00 96.80  ? 23   DG  J N9    1 
ATOM   8194  C  C8    . DG  E 3 4   ? -21.932 -14.102 14.580  1.00 97.26  ? 23   DG  J C8    1 
ATOM   8195  N  N7    . DG  E 3 4   ? -21.524 -13.912 13.354  1.00 92.12  ? 23   DG  J N7    1 
ATOM   8196  C  C5    . DG  E 3 4   ? -22.684 -13.599 12.660  1.00 91.88  ? 23   DG  J C5    1 
ATOM   8197  C  C6    . DG  E 3 4   ? -22.868 -13.293 11.291  1.00 88.25  ? 23   DG  J C6    1 
ATOM   8198  O  O6    . DG  E 3 4   ? -22.010 -13.239 10.399  1.00 87.94  ? 23   DG  J O6    1 
ATOM   8199  N  N1    . DG  E 3 4   ? -24.203 -13.034 10.991  1.00 86.86  ? 23   DG  J N1    1 
ATOM   8200  C  C2    . DG  E 3 4   ? -25.235 -13.066 11.902  1.00 90.60  ? 23   DG  J C2    1 
ATOM   8201  N  N2    . DG  E 3 4   ? -26.462 -12.787 11.429  1.00 88.55  ? 23   DG  J N2    1 
ATOM   8202  N  N3    . DG  E 3 4   ? -25.074 -13.353 13.191  1.00 94.18  ? 23   DG  J N3    1 
ATOM   8203  C  C4    . DG  E 3 4   ? -23.777 -13.610 13.503  1.00 94.74  ? 23   DG  J C4    1 
ATOM   8204  P  P     . DC  E 3 5   ? -26.429 -16.908 18.399  1.00 102.96 ? 24   DC  J P     1 
ATOM   8205  O  OP1   . DC  E 3 5   ? -26.761 -17.134 19.827  1.00 99.87  ? 24   DC  J OP1   1 
ATOM   8206  O  OP2   . DC  E 3 5   ? -25.459 -17.814 17.737  1.00 101.01 ? 24   DC  J OP2   1 
ATOM   8207  O  "O5'" . DC  E 3 5   ? -27.777 -16.909 17.524  1.00 95.45  ? 24   DC  J "O5'" 1 
ATOM   8208  C  "C5'" . DC  E 3 5   ? -28.329 -15.679 17.032  1.00 91.60  ? 24   DC  J "C5'" 1 
ATOM   8209  C  "C4'" . DC  E 3 5   ? -29.087 -15.886 15.726  1.00 94.72  ? 24   DC  J "C4'" 1 
ATOM   8210  O  "O4'" . DC  E 3 5   ? -28.244 -15.586 14.578  1.00 96.01  ? 24   DC  J "O4'" 1 
ATOM   8211  C  "C3'" . DC  E 3 5   ? -29.630 -17.290 15.478  1.00 93.74  ? 24   DC  J "C3'" 1 
ATOM   8212  O  "O3'" . DC  E 3 5   ? -30.919 -17.208 14.870  1.00 96.85  ? 24   DC  J "O3'" 1 
ATOM   8213  C  "C2'" . DC  E 3 5   ? -28.600 -17.889 14.520  1.00 89.71  ? 24   DC  J "C2'" 1 
ATOM   8214  C  "C1'" . DC  E 3 5   ? -28.275 -16.669 13.662  1.00 91.72  ? 24   DC  J "C1'" 1 
ATOM   8215  N  N1    . DC  E 3 5   ? -26.961 -16.730 12.928  1.00 89.54  ? 24   DC  J N1    1 
ATOM   8216  C  C2    . DC  E 3 5   ? -26.910 -16.481 11.548  1.00 84.73  ? 24   DC  J C2    1 
ATOM   8217  O  O2    . DC  E 3 5   ? -27.952 -16.216 10.933  1.00 83.89  ? 24   DC  J O2    1 
ATOM   8218  N  N3    . DC  E 3 5   ? -25.711 -16.539 10.919  1.00 81.77  ? 24   DC  J N3    1 
ATOM   8219  C  C4    . DC  E 3 5   ? -24.605 -16.823 11.606  1.00 82.43  ? 24   DC  J C4    1 
ATOM   8220  N  N4    . DC  E 3 5   ? -23.449 -16.869 10.941  1.00 83.85  ? 24   DC  J N4    1 
ATOM   8221  C  C5    . DC  E 3 5   ? -24.632 -17.075 13.005  1.00 85.33  ? 24   DC  J C5    1 
ATOM   8222  C  C6    . DC  E 3 5   ? -25.817 -17.018 13.616  1.00 89.72  ? 24   DC  J C6    1 
ATOM   8223  P  P     . DG  E 3 6   ? -31.906 -18.480 14.891  1.00 105.08 ? 25   DG  J P     1 
ATOM   8224  O  OP1   . DG  E 3 6   ? -33.026 -18.174 15.815  1.00 106.79 ? 25   DG  J OP1   1 
ATOM   8225  O  OP2   . DG  E 3 6   ? -31.081 -19.699 15.079  1.00 95.00  ? 25   DG  J OP2   1 
ATOM   8226  O  "O5'" . DG  E 3 6   ? -32.479 -18.538 13.403  1.00 92.98  ? 25   DG  J "O5'" 1 
ATOM   8227  C  "C5'" . DG  E 3 6   ? -33.121 -17.403 12.867  1.00 94.24  ? 25   DG  J "C5'" 1 
ATOM   8228  C  "C4'" . DG  E 3 6   ? -33.312 -17.606 11.380  1.00 95.72  ? 25   DG  J "C4'" 1 
ATOM   8229  O  "O4'" . DG  E 3 6   ? -32.034 -17.578 10.695  1.00 92.47  ? 25   DG  J "O4'" 1 
ATOM   8230  C  "C3'" . DG  E 3 6   ? -33.949 -18.937 11.012  1.00 97.69  ? 25   DG  J "C3'" 1 
ATOM   8231  O  "O3'" . DG  E 3 6   ? -34.850 -18.712 9.945   1.00 98.89  ? 25   DG  J "O3'" 1 
ATOM   8232  C  "C2'" . DG  E 3 6   ? -32.765 -19.807 10.592  1.00 93.60  ? 25   DG  J "C2'" 1 
ATOM   8233  C  "C1'" . DG  E 3 6   ? -31.828 -18.777 9.972   1.00 90.05  ? 25   DG  J "C1'" 1 
ATOM   8234  N  N9    . DG  E 3 6   ? -30.413 -19.087 10.114  1.00 84.94  ? 25   DG  J N9    1 
ATOM   8235  C  C8    . DG  E 3 6   ? -29.795 -19.597 11.229  1.00 86.69  ? 25   DG  J C8    1 
ATOM   8236  N  N7    . DG  E 3 6   ? -28.510 -19.762 11.088  1.00 83.72  ? 25   DG  J N7    1 
ATOM   8237  C  C5    . DG  E 3 6   ? -28.259 -19.323 9.795   1.00 83.54  ? 25   DG  J C5    1 
ATOM   8238  C  C6    . DG  E 3 6   ? -27.040 -19.262 9.085   1.00 79.69  ? 25   DG  J C6    1 
ATOM   8239  O  O6    . DG  E 3 6   ? -25.914 -19.595 9.482   1.00 78.03  ? 25   DG  J O6    1 
ATOM   8240  N  N1    . DG  E 3 6   ? -27.222 -18.754 7.796   1.00 78.68  ? 25   DG  J N1    1 
ATOM   8241  C  C2    . DG  E 3 6   ? -28.428 -18.353 7.261   1.00 78.54  ? 25   DG  J C2    1 
ATOM   8242  N  N2    . DG  E 3 6   ? -28.399 -17.894 6.000   1.00 73.38  ? 25   DG  J N2    1 
ATOM   8243  N  N3    . DG  E 3 6   ? -29.581 -18.405 7.921   1.00 81.99  ? 25   DG  J N3    1 
ATOM   8244  C  C4    . DG  E 3 6   ? -29.420 -18.899 9.178   1.00 84.66  ? 25   DG  J C4    1 
ATOM   8245  P  P     . DG  E 3 7   ? -36.100 -19.694 9.724   1.00 107.35 ? 26   DG  J P     1 
ATOM   8246  O  OP1   . DG  E 3 7   ? -37.291 -18.858 9.438   1.00 107.63 ? 26   DG  J OP1   1 
ATOM   8247  O  OP2   . DG  E 3 7   ? -36.119 -20.663 10.847  1.00 102.98 ? 26   DG  J OP2   1 
ATOM   8248  O  "O5'" . DG  E 3 7   ? -35.710 -20.503 8.401   1.00 98.35  ? 26   DG  J "O5'" 1 
ATOM   8249  C  "C5'" . DG  E 3 7   ? -35.360 -19.790 7.233   1.00 95.65  ? 26   DG  J "C5'" 1 
ATOM   8250  C  "C4'" . DG  E 3 7   ? -34.139 -20.408 6.575   1.00 93.49  ? 26   DG  J "C4'" 1 
ATOM   8251  O  "O4'" . DG  E 3 7   ? -33.061 -20.617 7.524   1.00 91.09  ? 26   DG  J "O4'" 1 
ATOM   8252  C  "C3'" . DG  E 3 7   ? -34.372 -21.761 5.914   1.00 92.90  ? 26   DG  J "C3'" 1 
ATOM   8253  O  "O3'" . DG  E 3 7   ? -34.493 -21.507 4.515   1.00 95.52  ? 26   DG  J "O3'" 1 
ATOM   8254  C  "C2'" . DG  E 3 7   ? -33.129 -22.581 6.280   1.00 92.06  ? 26   DG  J "C2'" 1 
ATOM   8255  C  "C1'" . DG  E 3 7   ? -32.194 -21.558 6.925   1.00 90.13  ? 26   DG  J "C1'" 1 
ATOM   8256  N  N9    . DG  E 3 7   ? -31.255 -22.122 7.905   1.00 86.09  ? 26   DG  J N9    1 
ATOM   8257  C  C8    . DG  E 3 7   ? -31.566 -22.755 9.084   1.00 85.31  ? 26   DG  J C8    1 
ATOM   8258  N  N7    . DG  E 3 7   ? -30.521 -23.158 9.753   1.00 84.33  ? 26   DG  J N7    1 
ATOM   8259  C  C5    . DG  E 3 7   ? -29.441 -22.775 8.971   1.00 81.50  ? 26   DG  J C5    1 
ATOM   8260  C  C6    . DG  E 3 7   ? -28.052 -22.947 9.187   1.00 80.14  ? 26   DG  J C6    1 
ATOM   8261  O  O6    . DG  E 3 7   ? -27.481 -23.488 10.144  1.00 78.46  ? 26   DG  J O6    1 
ATOM   8262  N  N1    . DG  E 3 7   ? -27.296 -22.412 8.146   1.00 79.13  ? 26   DG  J N1    1 
ATOM   8263  C  C2    . DG  E 3 7   ? -27.816 -21.789 7.038   1.00 78.34  ? 26   DG  J C2    1 
ATOM   8264  N  N2    . DG  E 3 7   ? -26.925 -21.339 6.144   1.00 75.77  ? 26   DG  J N2    1 
ATOM   8265  N  N3    . DG  E 3 7   ? -29.116 -21.621 6.825   1.00 81.82  ? 26   DG  J N3    1 
ATOM   8266  C  C4    . DG  E 3 7   ? -29.873 -22.136 7.829   1.00 83.12  ? 26   DG  J C4    1 
ATOM   8267  P  P     . DA  E 3 8   ? -34.796 -22.706 3.486   1.00 102.84 ? 27   DA  J P     1 
ATOM   8268  O  OP1   . DA  E 3 8   ? -36.142 -22.482 2.910   1.00 102.50 ? 27   DA  J OP1   1 
ATOM   8269  O  OP2   . DA  E 3 8   ? -34.491 -23.988 4.166   1.00 96.68  ? 27   DA  J OP2   1 
ATOM   8270  O  "O5'" . DA  E 3 8   ? -33.716 -22.481 2.332   1.00 93.32  ? 27   DA  J "O5'" 1 
ATOM   8271  C  "C5'" . DA  E 3 8   ? -32.432 -22.000 2.683   1.00 91.70  ? 27   DA  J "C5'" 1 
ATOM   8272  C  "C4'" . DA  E 3 8   ? -31.490 -22.140 1.508   1.00 94.00  ? 27   DA  J "C4'" 1 
ATOM   8273  O  "O4'" . DA  E 3 8   ? -30.216 -22.635 1.979   1.00 94.23  ? 27   DA  J "O4'" 1 
ATOM   8274  C  "C3'" . DA  E 3 8   ? -31.892 -23.187 0.486   1.00 96.13  ? 27   DA  J "C3'" 1 
ATOM   8275  O  "O3'" . DA  E 3 8   ? -31.073 -22.984 -0.671  1.00 99.66  ? 27   DA  J "O3'" 1 
ATOM   8276  C  "C2'" . DA  E 3 8   ? -31.551 -24.461 1.256   1.00 94.77  ? 27   DA  J "C2'" 1 
ATOM   8277  C  "C1'" . DA  E 3 8   ? -30.272 -24.051 1.997   1.00 94.05  ? 27   DA  J "C1'" 1 
ATOM   8278  N  N9    . DA  E 3 8   ? -30.198 -24.444 3.405   1.00 88.41  ? 27   DA  J N9    1 
ATOM   8279  C  C8    . DA  E 3 8   ? -31.237 -24.668 4.265   1.00 87.02  ? 27   DA  J C8    1 
ATOM   8280  N  N7    . DA  E 3 8   ? -30.859 -24.997 5.476   1.00 84.08  ? 27   DA  J N7    1 
ATOM   8281  C  C5    . DA  E 3 8   ? -29.478 -24.979 5.409   1.00 81.48  ? 27   DA  J C5    1 
ATOM   8282  C  C6    . DA  E 3 8   ? -28.482 -25.236 6.369   1.00 80.71  ? 27   DA  J C6    1 
ATOM   8283  N  N6    . DA  E 3 8   ? -28.746 -25.577 7.635   1.00 80.04  ? 27   DA  J N6    1 
ATOM   8284  N  N1    . DA  E 3 8   ? -27.196 -25.130 5.976   1.00 81.22  ? 27   DA  J N1    1 
ATOM   8285  C  C2    . DA  E 3 8   ? -26.932 -24.789 4.710   1.00 81.97  ? 27   DA  J C2    1 
ATOM   8286  N  N3    . DA  E 3 8   ? -27.783 -24.523 3.720   1.00 82.03  ? 27   DA  J N3    1 
ATOM   8287  C  C4    . DA  E 3 8   ? -29.052 -24.637 4.141   1.00 82.86  ? 27   DA  J C4    1 
ATOM   8288  P  P     . DG  E 3 9   ? -31.377 -23.770 -2.043  1.00 103.18 ? 28   DG  J P     1 
ATOM   8289  O  OP1   . DG  E 3 9   ? -31.490 -22.766 -3.128  1.00 101.61 ? 28   DG  J OP1   1 
ATOM   8290  O  OP2   . DG  E 3 9   ? -32.487 -24.722 -1.790  1.00 96.78  ? 28   DG  J OP2   1 
ATOM   8291  O  "O5'" . DG  E 3 9   ? -30.039 -24.617 -2.287  1.00 98.25  ? 28   DG  J "O5'" 1 
ATOM   8292  C  "C5'" . DG  E 3 9   ? -29.529 -25.390 -1.210  1.00 96.33  ? 28   DG  J "C5'" 1 
ATOM   8293  C  "C4'" . DG  E 3 9   ? -28.107 -25.851 -1.448  1.00 97.93  ? 28   DG  J "C4'" 1 
ATOM   8294  O  "O4'" . DG  E 3 9   ? -27.498 -26.073 -0.154  1.00 96.78  ? 28   DG  J "O4'" 1 
ATOM   8295  C  "C3'" . DG  E 3 9   ? -27.976 -27.193 -2.148  1.00 98.61  ? 28   DG  J "C3'" 1 
ATOM   8296  O  "O3'" . DG  E 3 9   ? -26.641 -27.368 -2.623  1.00 98.16  ? 28   DG  J "O3'" 1 
ATOM   8297  C  "C2'" . DG  E 3 9   ? -28.307 -28.136 -0.994  1.00 97.48  ? 28   DG  J "C2'" 1 
ATOM   8298  C  "C1'" . DG  E 3 9   ? -27.627 -27.443 0.188   1.00 95.83  ? 28   DG  J "C1'" 1 
ATOM   8299  N  N9    . DG  E 3 9   ? -28.358 -27.580 1.453   1.00 92.08  ? 28   DG  J N9    1 
ATOM   8300  C  C8    . DG  E 3 9   ? -29.708 -27.428 1.668   1.00 90.46  ? 28   DG  J C8    1 
ATOM   8301  N  N7    . DG  E 3 9   ? -30.061 -27.620 2.911   1.00 87.64  ? 28   DG  J N7    1 
ATOM   8302  C  C5    . DG  E 3 9   ? -28.871 -27.922 3.565   1.00 87.03  ? 28   DG  J C5    1 
ATOM   8303  C  C6    . DG  E 3 9   ? -28.617 -28.224 4.928   1.00 85.62  ? 28   DG  J C6    1 
ATOM   8304  O  O6    . DG  E 3 9   ? -29.426 -28.289 5.871   1.00 83.12  ? 28   DG  J O6    1 
ATOM   8305  N  N1    . DG  E 3 9   ? -27.261 -28.461 5.156   1.00 83.32  ? 28   DG  J N1    1 
ATOM   8306  C  C2    . DG  E 3 9   ? -26.278 -28.416 4.196   1.00 84.17  ? 28   DG  J C2    1 
ATOM   8307  N  N2    . DG  E 3 9   ? -25.024 -28.673 4.597   1.00 84.61  ? 28   DG  J N2    1 
ATOM   8308  N  N3    . DG  E 3 9   ? -26.504 -28.136 2.923   1.00 86.92  ? 28   DG  J N3    1 
ATOM   8309  C  C4    . DG  E 3 9   ? -27.816 -27.901 2.679   1.00 87.90  ? 28   DG  J C4    1 
ATOM   8310  P  P     . DG  E 3 10  ? -26.181 -28.772 -3.263  1.00 103.07 ? 29   DG  J P     1 
ATOM   8311  O  OP1   . DG  E 3 10  ? -25.482 -28.485 -4.534  1.00 104.65 ? 29   DG  J OP1   1 
ATOM   8312  O  OP2   . DG  E 3 10  ? -27.347 -29.685 -3.265  1.00 98.67  ? 29   DG  J OP2   1 
ATOM   8313  O  "O5'" . DG  E 3 10  ? -25.111 -29.328 -2.211  1.00 100.11 ? 29   DG  J "O5'" 1 
ATOM   8314  C  "C5'" . DG  E 3 10  ? -24.088 -28.449 -1.742  1.00 98.61  ? 29   DG  J "C5'" 1 
ATOM   8315  C  "C4'" . DG  E 3 10  ? -23.072 -29.169 -0.870  1.00 99.72  ? 29   DG  J "C4'" 1 
ATOM   8316  O  "O4'" . DG  E 3 10  ? -23.614 -29.359 0.463   1.00 96.17  ? 29   DG  J "O4'" 1 
ATOM   8317  C  "C3'" . DG  E 3 10  ? -22.653 -30.559 -1.343  1.00 101.67 ? 29   DG  J "C3'" 1 
ATOM   8318  O  "O3'" . DG  E 3 10  ? -21.315 -30.836 -0.903  1.00 103.86 ? 29   DG  J "O3'" 1 
ATOM   8319  C  "C2'" . DG  E 3 10  ? -23.693 -31.450 -0.666  1.00 98.07  ? 29   DG  J "C2'" 1 
ATOM   8320  C  "C1'" . DG  E 3 10  ? -23.935 -30.724 0.659   1.00 94.25  ? 29   DG  J "C1'" 1 
ATOM   8321  N  N9    . DG  E 3 10  ? -25.313 -30.809 1.137   1.00 90.76  ? 29   DG  J N9    1 
ATOM   8322  C  C8    . DG  E 3 10  ? -26.468 -30.536 0.439   1.00 90.38  ? 29   DG  J C8    1 
ATOM   8323  N  N7    . DG  E 3 10  ? -27.554 -30.703 1.147   1.00 88.54  ? 29   DG  J N7    1 
ATOM   8324  C  C5    . DG  E 3 10  ? -27.089 -31.117 2.393   1.00 88.31  ? 29   DG  J C5    1 
ATOM   8325  C  C6    . DG  E 3 10  ? -27.792 -31.456 3.577   1.00 84.06  ? 29   DG  J C6    1 
ATOM   8326  O  O6    . DG  E 3 10  ? -29.015 -31.458 3.771   1.00 83.37  ? 29   DG  J O6    1 
ATOM   8327  N  N1    . DG  E 3 10  ? -26.928 -31.822 4.608   1.00 81.27  ? 29   DG  J N1    1 
ATOM   8328  C  C2    . DG  E 3 10  ? -25.558 -31.858 4.509   1.00 82.79  ? 29   DG  J C2    1 
ATOM   8329  N  N2    . DG  E 3 10  ? -24.883 -32.235 5.601   1.00 82.15  ? 29   DG  J N2    1 
ATOM   8330  N  N3    . DG  E 3 10  ? -24.887 -31.544 3.412   1.00 85.91  ? 29   DG  J N3    1 
ATOM   8331  C  C4    . DG  E 3 10  ? -25.713 -31.186 2.399   1.00 88.73  ? 29   DG  J C4    1 
ATOM   8332  P  P     . DC  E 3 11  ? -20.525 -32.130 -1.450  1.00 106.32 ? 30   DC  J P     1 
ATOM   8333  O  OP1   . DC  E 3 11  ? -19.225 -31.674 -2.002  1.00 103.08 ? 30   DC  J OP1   1 
ATOM   8334  O  OP2   . DC  E 3 11  ? -21.462 -32.919 -2.288  1.00 99.55  ? 30   DC  J OP2   1 
ATOM   8335  O  "O5'" . DC  E 3 11  ? -20.245 -32.978 -0.128  1.00 98.71  ? 30   DC  J "O5'" 1 
ATOM   8336  C  "C5'" . DC  E 3 11  ? -20.058 -32.300 1.106   1.00 97.47  ? 30   DC  J "C5'" 1 
ATOM   8337  C  "C4'" . DC  E 3 11  ? -20.538 -33.190 2.238   1.00 97.73  ? 30   DC  J "C4'" 1 
ATOM   8338  O  "O4'" . DC  E 3 11  ? -21.983 -33.102 2.357   1.00 93.03  ? 30   DC  J "O4'" 1 
ATOM   8339  C  "C3'" . DC  E 3 11  ? -20.198 -34.672 2.062   1.00 98.78  ? 30   DC  J "C3'" 1 
ATOM   8340  O  "O3'" . DC  E 3 11  ? -19.406 -35.102 3.170   1.00 100.45 ? 30   DC  J "O3'" 1 
ATOM   8341  C  "C2'" . DC  E 3 11  ? -21.559 -35.362 1.999   1.00 94.27  ? 30   DC  J "C2'" 1 
ATOM   8342  C  "C1'" . DC  E 3 11  ? -22.464 -34.375 2.718   1.00 91.07  ? 30   DC  J "C1'" 1 
ATOM   8343  N  N1    . DC  E 3 11  ? -23.889 -34.509 2.320   1.00 87.75  ? 30   DC  J N1    1 
ATOM   8344  C  C2    . DC  E 3 11  ? -24.812 -34.915 3.285   1.00 87.74  ? 30   DC  J C2    1 
ATOM   8345  O  O2    . DC  E 3 11  ? -24.401 -35.138 4.433   1.00 88.19  ? 30   DC  J O2    1 
ATOM   8346  N  N3    . DC  E 3 11  ? -26.117 -35.044 2.930   1.00 84.80  ? 30   DC  J N3    1 
ATOM   8347  C  C4    . DC  E 3 11  ? -26.502 -34.790 1.679   1.00 83.62  ? 30   DC  J C4    1 
ATOM   8348  N  N4    . DC  E 3 11  ? -27.797 -34.930 1.374   1.00 81.30  ? 30   DC  J N4    1 
ATOM   8349  C  C5    . DC  E 3 11  ? -25.571 -34.378 0.682   1.00 85.95  ? 30   DC  J C5    1 
ATOM   8350  C  C6    . DC  E 3 11  ? -24.288 -34.255 1.042   1.00 88.68  ? 30   DC  J C6    1 
ATOM   8351  P  P     . DT  E 3 12  ? -18.881 -36.625 3.267   1.00 105.62 ? 31   DT  J P     1 
ATOM   8352  O  OP1   . DT  E 3 12  ? -17.409 -36.613 3.108   1.00 103.91 ? 31   DT  J OP1   1 
ATOM   8353  O  OP2   . DT  E 3 12  ? -19.710 -37.464 2.364   1.00 97.14  ? 31   DT  J OP2   1 
ATOM   8354  O  "O5'" . DT  E 3 12  ? -19.219 -37.037 4.780   1.00 102.00 ? 31   DT  J "O5'" 1 
ATOM   8355  C  "C5'" . DT  E 3 12  ? -20.480 -36.638 5.322   1.00 99.21  ? 31   DT  J "C5'" 1 
ATOM   8356  C  "C4'" . DT  E 3 12  ? -20.992 -37.579 6.387   1.00 97.86  ? 31   DT  J "C4'" 1 
ATOM   8357  O  "O4'" . DT  E 3 12  ? -22.406 -37.796 6.160   1.00 97.19  ? 31   DT  J "O4'" 1 
ATOM   8358  C  "C3'" . DT  E 3 12  ? -20.434 -38.989 6.383   1.00 99.27  ? 31   DT  J "C3'" 1 
ATOM   8359  O  "O3'" . DT  E 3 12  ? -20.802 -39.595 7.625   1.00 100.26 ? 31   DT  J "O3'" 1 
ATOM   8360  C  "C2'" . DT  E 3 12  ? -21.201 -39.591 5.209   1.00 94.57  ? 31   DT  J "C2'" 1 
ATOM   8361  C  "C1'" . DT  E 3 12  ? -22.601 -39.048 5.514   1.00 92.45  ? 31   DT  J "C1'" 1 
ATOM   8362  N  N1    . DT  E 3 12  ? -23.491 -38.819 4.334   1.00 87.56  ? 31   DT  J N1    1 
ATOM   8363  C  C2    . DT  E 3 12  ? -24.857 -38.916 4.501   1.00 85.16  ? 31   DT  J C2    1 
ATOM   8364  O  O2    . DT  E 3 12  ? -25.379 -39.192 5.565   1.00 85.35  ? 31   DT  J O2    1 
ATOM   8365  N  N3    . DT  E 3 12  ? -25.602 -38.682 3.372   1.00 85.27  ? 31   DT  J N3    1 
ATOM   8366  C  C4    . DT  E 3 12  ? -25.119 -38.363 2.115   1.00 85.90  ? 31   DT  J C4    1 
ATOM   8367  O  O4    . DT  E 3 12  ? -25.856 -38.167 1.150   1.00 84.62  ? 31   DT  J O4    1 
ATOM   8368  C  C5    . DT  E 3 12  ? -23.684 -38.276 2.014   1.00 87.01  ? 31   DT  J C5    1 
ATOM   8369  C  C7    . DT  E 3 12  ? -23.069 -37.934 0.694   1.00 86.74  ? 31   DT  J C7    1 
ATOM   8370  C  C6    . DT  E 3 12  ? -22.941 -38.503 3.108   1.00 89.79  ? 31   DT  J C6    1 
ATOM   8371  P  P     . DC  E 3 13  ? -19.779 -40.567 8.400   1.00 101.60 ? 32   DC  J P     1 
ATOM   8372  O  OP1   . DC  E 3 13  ? -19.113 -39.779 9.469   1.00 93.97  ? 32   DC  J OP1   1 
ATOM   8373  O  OP2   . DC  E 3 13  ? -18.985 -41.302 7.382   1.00 97.44  ? 32   DC  J OP2   1 
ATOM   8374  O  "O5'" . DC  E 3 13  ? -20.745 -41.612 9.125   1.00 96.00  ? 32   DC  J "O5'" 1 
ATOM   8375  C  "C5'" . DC  E 3 13  ? -21.943 -41.122 9.713   1.00 97.04  ? 32   DC  J "C5'" 1 
ATOM   8376  C  "C4'" . DC  E 3 13  ? -23.045 -42.151 9.549   1.00 99.51  ? 32   DC  J "C4'" 1 
ATOM   8377  O  "O4'" . DC  E 3 13  ? -23.718 -42.004 8.266   1.00 95.33  ? 32   DC  J "O4'" 1 
ATOM   8378  C  "C3'" . DC  E 3 13  ? -22.550 -43.595 9.594   1.00 99.62  ? 32   DC  J "C3'" 1 
ATOM   8379  O  "O3'" . DC  E 3 13  ? -23.521 -44.382 10.267  1.00 100.98 ? 32   DC  J "O3'" 1 
ATOM   8380  C  "C2'" . DC  E 3 13  ? -22.440 -43.940 8.113   1.00 93.76  ? 32   DC  J "C2'" 1 
ATOM   8381  C  "C1'" . DC  E 3 13  ? -23.686 -43.247 7.589   1.00 93.07  ? 32   DC  J "C1'" 1 
ATOM   8382  N  N1    . DC  E 3 13  ? -23.630 -43.013 6.130   1.00 91.21  ? 32   DC  J N1    1 
ATOM   8383  C  C2    . DC  E 3 13  ? -24.823 -42.884 5.407   1.00 89.65  ? 32   DC  J C2    1 
ATOM   8384  O  O2    . DC  E 3 13  ? -25.907 -42.964 6.012   1.00 88.15  ? 32   DC  J O2    1 
ATOM   8385  N  N3    . DC  E 3 13  ? -24.743 -42.668 4.065   1.00 88.51  ? 32   DC  J N3    1 
ATOM   8386  C  C4    . DC  E 3 13  ? -23.548 -42.590 3.465   1.00 89.62  ? 32   DC  J C4    1 
ATOM   8387  N  N4    . DC  E 3 13  ? -23.516 -42.376 2.141   1.00 87.55  ? 32   DC  J N4    1 
ATOM   8388  C  C5    . DC  E 3 13  ? -22.328 -42.727 4.196   1.00 89.90  ? 32   DC  J C5    1 
ATOM   8389  C  C6    . DC  E 3 13  ? -22.414 -42.936 5.514   1.00 90.66  ? 32   DC  J C6    1 
ATOM   8390  P  P     . DA  E 3 14  ? -23.367 -45.980 10.345  1.00 97.49  ? 33   DA  J P     1 
ATOM   8391  O  OP1   . DA  E 3 14  ? -22.927 -46.328 11.717  1.00 99.22  ? 33   DA  J OP1   1 
ATOM   8392  O  OP2   . DA  E 3 14  ? -22.544 -46.424 9.195   1.00 92.38  ? 33   DA  J OP2   1 
ATOM   8393  O  "O5'" . DA  E 3 14  ? -24.866 -46.498 10.131  1.00 95.91  ? 33   DA  J "O5'" 1 
ATOM   8394  C  "C5'" . DA  E 3 14  ? -25.908 -45.834 10.843  1.00 96.27  ? 33   DA  J "C5'" 1 
ATOM   8395  C  "C4'" . DA  E 3 14  ? -27.288 -46.301 10.420  1.00 99.34  ? 33   DA  J "C4'" 1 
ATOM   8396  O  "O4'" . DA  E 3 14  ? -27.477 -46.048 9.009   1.00 99.37  ? 33   DA  J "O4'" 1 
ATOM   8397  C  "C3'" . DA  E 3 14  ? -27.562 -47.787 10.587  1.00 100.03 ? 33   DA  J "C3'" 1 
ATOM   8398  O  "O3'" . DA  E 3 14  ? -28.957 -47.983 10.757  1.00 104.82 ? 33   DA  J "O3'" 1 
ATOM   8399  C  "C2'" . DA  E 3 14  ? -27.065 -48.370 9.268   1.00 97.01  ? 33   DA  J "C2'" 1 
ATOM   8400  C  "C1'" . DA  E 3 14  ? -27.375 -47.254 8.277   1.00 96.80  ? 33   DA  J "C1'" 1 
ATOM   8401  N  N9    . DA  E 3 14  ? -26.341 -47.080 7.259   1.00 94.86  ? 33   DA  J N9    1 
ATOM   8402  C  C8    . DA  E 3 14  ? -25.004 -47.340 7.384   1.00 93.16  ? 33   DA  J C8    1 
ATOM   8403  N  N7    . DA  E 3 14  ? -24.310 -47.085 6.300   1.00 90.04  ? 33   DA  J N7    1 
ATOM   8404  C  C5    . DA  E 3 14  ? -25.260 -46.625 5.405   1.00 89.05  ? 33   DA  J C5    1 
ATOM   8405  C  C6    . DA  E 3 14  ? -25.167 -46.188 4.074   1.00 89.57  ? 33   DA  J C6    1 
ATOM   8406  N  N6    . DA  E 3 14  ? -24.013 -46.149 3.399   1.00 89.29  ? 33   DA  J N6    1 
ATOM   8407  N  N1    . DA  E 3 14  ? -26.306 -45.793 3.467   1.00 89.76  ? 33   DA  J N1    1 
ATOM   8408  C  C2    . DA  E 3 14  ? -27.458 -45.834 4.146   1.00 89.53  ? 33   DA  J C2    1 
ATOM   8409  N  N3    . DA  E 3 14  ? -27.668 -46.224 5.401   1.00 90.65  ? 33   DA  J N3    1 
ATOM   8410  C  C4    . DA  E 3 14  ? -26.517 -46.611 5.977   1.00 92.03  ? 33   DA  J C4    1 
ATOM   8411  P  P     . DC  E 3 15  ? -29.562 -49.469 10.853  1.00 113.83 ? 34   DC  J P     1 
ATOM   8412  O  OP1   . DC  E 3 15  ? -30.791 -49.410 11.686  1.00 104.86 ? 34   DC  J OP1   1 
ATOM   8413  O  OP2   . DC  E 3 15  ? -28.459 -50.390 11.219  1.00 108.02 ? 34   DC  J OP2   1 
ATOM   8414  O  "O5'" . DC  E 3 15  ? -29.985 -49.796 9.348   1.00 105.28 ? 34   DC  J "O5'" 1 
ATOM   8415  C  "C5'" . DC  E 3 15  ? -31.061 -49.070 8.781   1.00 102.96 ? 34   DC  J "C5'" 1 
ATOM   8416  C  "C4'" . DC  E 3 15  ? -31.178 -49.398 7.308   1.00 102.69 ? 34   DC  J "C4'" 1 
ATOM   8417  O  "O4'" . DC  E 3 15  ? -29.970 -49.012 6.610   1.00 98.61  ? 34   DC  J "O4'" 1 
ATOM   8418  C  "C3'" . DC  E 3 15  ? -31.384 -50.879 7.005   1.00 103.24 ? 34   DC  J "C3'" 1 
ATOM   8419  O  "O3'" . DC  E 3 15  ? -32.699 -51.028 6.484   1.00 105.20 ? 34   DC  J "O3'" 1 
ATOM   8420  C  "C2'" . DC  E 3 15  ? -30.293 -51.217 5.987   1.00 100.80 ? 34   DC  J "C2'" 1 
ATOM   8421  C  "C1'" . DC  E 3 15  ? -29.896 -49.838 5.472   1.00 100.40 ? 34   DC  J "C1'" 1 
ATOM   8422  N  N1    . DC  E 3 15  ? -28.523 -49.769 4.884   1.00 100.10 ? 34   DC  J N1    1 
ATOM   8423  C  C2    . DC  E 3 15  ? -28.369 -49.376 3.543   1.00 97.28  ? 34   DC  J C2    1 
ATOM   8424  O  O2    . DC  E 3 15  ? -29.373 -49.091 2.873   1.00 97.50  ? 34   DC  J O2    1 
ATOM   8425  N  N3    . DC  E 3 15  ? -27.118 -49.317 3.017   1.00 93.78  ? 34   DC  J N3    1 
ATOM   8426  C  C4    . DC  E 3 15  ? -26.061 -49.632 3.769   1.00 92.51  ? 34   DC  J C4    1 
ATOM   8427  N  N4    . DC  E 3 15  ? -24.851 -49.558 3.204   1.00 90.96  ? 34   DC  J N4    1 
ATOM   8428  C  C5    . DC  E 3 15  ? -26.198 -50.035 5.133   1.00 94.31  ? 34   DC  J C5    1 
ATOM   8429  C  C6    . DC  E 3 15  ? -27.434 -50.091 5.647   1.00 97.08  ? 34   DC  J C6    1 
ATOM   8430  P  P     . DG  E 3 16  ? -33.188 -52.442 5.897   1.00 106.56 ? 35   DG  J P     1 
ATOM   8431  O  OP1   . DG  E 3 16  ? -34.526 -52.729 6.460   1.00 105.18 ? 35   DG  J OP1   1 
ATOM   8432  O  OP2   . DG  E 3 16  ? -32.088 -53.420 6.076   1.00 100.92 ? 35   DG  J OP2   1 
ATOM   8433  O  "O5'" . DG  E 3 16  ? -33.343 -52.160 4.327   1.00 108.64 ? 35   DG  J "O5'" 1 
ATOM   8434  C  "C5'" . DG  E 3 16  ? -34.175 -51.088 3.867   1.00 109.53 ? 35   DG  J "C5'" 1 
ATOM   8435  C  "C4'" . DG  E 3 16  ? -34.541 -51.243 2.394   1.00 112.99 ? 35   DG  J "C4'" 1 
ATOM   8436  O  "O4'" . DG  E 3 16  ? -33.434 -50.794 1.563   1.00 109.93 ? 35   DG  J "O4'" 1 
ATOM   8437  C  "C3'" . DG  E 3 16  ? -34.887 -52.668 1.947   1.00 114.51 ? 35   DG  J "C3'" 1 
ATOM   8438  O  "O3'" . DG  E 3 16  ? -35.968 -52.675 0.983   1.00 118.07 ? 35   DG  J "O3'" 1 
ATOM   8439  C  "C2'" . DG  E 3 16  ? -33.567 -53.167 1.368   1.00 111.06 ? 35   DG  J "C2'" 1 
ATOM   8440  C  "C1'" . DG  E 3 16  ? -32.851 -51.901 0.901   1.00 109.48 ? 35   DG  J "C1'" 1 
ATOM   8441  N  N9    . DG  E 3 16  ? -31.432 -52.015 1.222   1.00 106.17 ? 35   DG  J N9    1 
ATOM   8442  C  C8    . DG  E 3 16  ? -30.897 -52.386 2.433   1.00 104.08 ? 35   DG  J C8    1 
ATOM   8443  N  N7    . DG  E 3 16  ? -29.596 -52.429 2.437   1.00 100.53 ? 35   DG  J N7    1 
ATOM   8444  C  C5    . DG  E 3 16  ? -29.248 -52.073 1.141   1.00 100.86 ? 35   DG  J C5    1 
ATOM   8445  C  C6    . DG  E 3 16  ? -27.971 -51.947 0.553   1.00 98.97  ? 35   DG  J C6    1 
ATOM   8446  O  O6    . DG  E 3 16  ? -26.870 -52.133 1.089   1.00 96.70  ? 35   DG  J O6    1 
ATOM   8447  N  N1    . DG  E 3 16  ? -28.058 -51.564 -0.784  1.00 99.45  ? 35   DG  J N1    1 
ATOM   8448  C  C2    . DG  E 3 16  ? -29.231 -51.331 -1.469  1.00 101.50 ? 35   DG  J C2    1 
ATOM   8449  N  N2    . DG  E 3 16  ? -29.121 -50.968 -2.760  1.00 102.09 ? 35   DG  J N2    1 
ATOM   8450  N  N3    . DG  E 3 16  ? -30.436 -51.449 -0.923  1.00 101.65 ? 35   DG  J N3    1 
ATOM   8451  C  C4    . DG  E 3 16  ? -30.365 -51.819 0.378   1.00 102.34 ? 35   DG  J C4    1 
ATOM   8452  P  P     . DG  E 3 17  ? -36.403 -54.042 0.241   1.00 121.70 ? 36   DG  J P     1 
ATOM   8453  O  OP1   . DG  E 3 17  ? -37.874 -54.184 0.367   1.00 118.26 ? 36   DG  J OP1   1 
ATOM   8454  O  OP2   . DG  E 3 17  ? -35.524 -55.132 0.726   1.00 114.86 ? 36   DG  J OP2   1 
ATOM   8455  O  "O5'" . DG  E 3 17  ? -36.016 -53.774 -1.291  1.00 114.58 ? 36   DG  J "O5'" 1 
ATOM   8456  C  "C5'" . DG  E 3 17  ? -34.661 -53.455 -1.547  1.00 113.26 ? 36   DG  J "C5'" 1 
ATOM   8457  C  "C4'" . DG  E 3 17  ? -34.345 -53.180 -2.995  1.00 115.69 ? 36   DG  J "C4'" 1 
ATOM   8458  O  "O4'" . DG  E 3 17  ? -32.901 -53.086 -3.055  1.00 112.60 ? 36   DG  J "O4'" 1 
ATOM   8459  C  "C3'" . DG  E 3 17  ? -34.611 -54.318 -3.958  1.00 119.27 ? 36   DG  J "C3'" 1 
ATOM   8460  O  "O3'" . DG  E 3 17  ? -34.196 -53.846 -5.243  1.00 122.17 ? 36   DG  J "O3'" 1 
ATOM   8461  C  "C2'" . DG  E 3 17  ? -33.619 -55.314 -3.364  1.00 116.43 ? 36   DG  J "C2'" 1 
ATOM   8462  C  "C1'" . DG  E 3 17  ? -32.390 -54.402 -3.240  1.00 112.11 ? 36   DG  J "C1'" 1 
ATOM   8463  N  N9    . DG  E 3 17  ? -31.436 -54.747 -2.173  1.00 108.16 ? 36   DG  J N9    1 
ATOM   8464  C  C8    . DG  E 3 17  ? -31.705 -55.252 -0.919  1.00 108.00 ? 36   DG  J C8    1 
ATOM   8465  N  N7    . DG  E 3 17  ? -30.637 -55.461 -0.194  1.00 105.77 ? 36   DG  J N7    1 
ATOM   8466  C  C5    . DG  E 3 17  ? -29.584 -55.069 -1.013  1.00 104.64 ? 36   DG  J C5    1 
ATOM   8467  C  C6    . DG  E 3 17  ? -28.185 -55.065 -0.772  1.00 104.00 ? 36   DG  J C6    1 
ATOM   8468  O  O6    . DG  E 3 17  ? -27.579 -55.419 0.251   1.00 105.82 ? 36   DG  J O6    1 
ATOM   8469  N  N1    . DG  E 3 17  ? -27.471 -54.589 -1.872  1.00 101.31 ? 36   DG  J N1    1 
ATOM   8470  C  C2    . DG  E 3 17  ? -28.040 -54.172 -3.052  1.00 102.05 ? 36   DG  J C2    1 
ATOM   8471  N  N2    . DG  E 3 17  ? -27.200 -53.744 -4.007  1.00 100.27 ? 36   DG  J N2    1 
ATOM   8472  N  N3    . DG  E 3 17  ? -29.347 -54.172 -3.287  1.00 105.11 ? 36   DG  J N3    1 
ATOM   8473  C  C4    . DG  E 3 17  ? -30.061 -54.632 -2.230  1.00 105.62 ? 36   DG  J C4    1 
ATOM   8474  P  P     . DG  E 3 18  ? -34.341 -54.775 -6.553  1.00 129.18 ? 37   DG  J P     1 
ATOM   8475  O  OP1   . DG  E 3 18  ? -35.746 -54.680 -7.027  1.00 119.41 ? 37   DG  J OP1   1 
ATOM   8476  O  OP2   . DG  E 3 18  ? -33.738 -56.101 -6.252  1.00 119.88 ? 37   DG  J OP2   1 
ATOM   8477  O  "O5'" . DG  E 3 18  ? -33.385 -54.055 -7.622  1.00 120.39 ? 37   DG  J "O5'" 1 
ATOM   8478  C  "C5'" . DG  E 3 18  ? -32.965 -54.748 -8.792  1.00 119.23 ? 37   DG  J "C5'" 1 
ATOM   8479  C  "C4'" . DG  E 3 18  ? -31.635 -55.454 -8.577  1.00 118.64 ? 37   DG  J "C4'" 1 
ATOM   8480  O  "O4'" . DG  E 3 18  ? -31.353 -55.656 -7.169  1.00 113.92 ? 37   DG  J "O4'" 1 
ATOM   8481  C  "C3'" . DG  E 3 18  ? -31.551 -56.828 -9.230  1.00 120.57 ? 37   DG  J "C3'" 1 
ATOM   8482  O  "O3'" . DG  E 3 18  ? -30.664 -56.707 -10.339 1.00 125.14 ? 37   DG  J "O3'" 1 
ATOM   8483  C  "C2'" . DG  E 3 18  ? -31.042 -57.765 -8.128  1.00 115.09 ? 37   DG  J "C2'" 1 
ATOM   8484  C  "C1'" . DG  E 3 18  ? -30.547 -56.809 -7.047  1.00 114.04 ? 37   DG  J "C1'" 1 
ATOM   8485  N  N9    . DG  E 3 18  ? -30.634 -57.308 -5.669  1.00 111.81 ? 37   DG  J N9    1 
ATOM   8486  C  C8    . DG  E 3 18  ? -31.758 -57.720 -4.986  1.00 109.25 ? 37   DG  J C8    1 
ATOM   8487  N  N7    . DG  E 3 18  ? -31.515 -58.103 -3.761  1.00 105.58 ? 37   DG  J N7    1 
ATOM   8488  C  C5    . DG  E 3 18  ? -30.142 -57.932 -3.615  1.00 107.85 ? 37   DG  J C5    1 
ATOM   8489  C  C6    . DG  E 3 18  ? -29.295 -58.180 -2.502  1.00 107.17 ? 37   DG  J C6    1 
ATOM   8490  O  O6    . DG  E 3 18  ? -29.606 -58.618 -1.382  1.00 106.99 ? 37   DG  J O6    1 
ATOM   8491  N  N1    . DG  E 3 18  ? -27.959 -57.871 -2.782  1.00 105.65 ? 37   DG  J N1    1 
ATOM   8492  C  C2    . DG  E 3 18  ? -27.493 -57.382 -3.984  1.00 105.36 ? 37   DG  J C2    1 
ATOM   8493  N  N2    . DG  E 3 18  ? -26.173 -57.139 -4.076  1.00 101.97 ? 37   DG  J N2    1 
ATOM   8494  N  N3    . DG  E 3 18  ? -28.281 -57.149 -5.030  1.00 107.86 ? 37   DG  J N3    1 
ATOM   8495  C  C4    . DG  E 3 18  ? -29.585 -57.443 -4.779  1.00 109.24 ? 37   DG  J C4    1 
ATOM   8496  P  P     . DA  E 3 19  ? -30.408 -57.958 -11.320 1.00 139.26 ? 38   DA  J P     1 
ATOM   8497  O  OP1   . DA  E 3 19  ? -30.026 -57.423 -12.650 1.00 134.30 ? 38   DA  J OP1   1 
ATOM   8498  O  OP2   . DA  E 3 19  ? -31.573 -58.873 -11.213 1.00 129.09 ? 38   DA  J OP2   1 
ATOM   8499  O  "O5'" . DA  E 3 19  ? -29.137 -58.691 -10.669 1.00 123.88 ? 38   DA  J "O5'" 1 
ATOM   8500  C  "C5'" . DA  E 3 19  ? -27.930 -57.958 -10.443 1.00 120.63 ? 38   DA  J "C5'" 1 
ATOM   8501  C  "C4'" . DA  E 3 19  ? -27.039 -58.653 -9.427  1.00 118.86 ? 38   DA  J "C4'" 1 
ATOM   8502  O  "O4'" . DA  E 3 19  ? -27.636 -58.585 -8.106  1.00 116.49 ? 38   DA  J "O4'" 1 
ATOM   8503  C  "C3'" . DA  E 3 19  ? -26.806 -60.139 -9.673  1.00 119.48 ? 38   DA  J "C3'" 1 
ATOM   8504  O  "O3'" . DA  E 3 19  ? -25.723 -60.328 -10.582 1.00 119.07 ? 38   DA  J "O3'" 1 
ATOM   8505  C  "C2'" . DA  E 3 19  ? -26.462 -60.646 -8.274  1.00 116.98 ? 38   DA  J "C2'" 1 
ATOM   8506  C  "C1'" . DA  E 3 19  ? -27.309 -59.753 -7.368  1.00 114.97 ? 38   DA  J "C1'" 1 
ATOM   8507  N  N9    . DA  E 3 19  ? -28.556 -60.365 -6.910  1.00 113.75 ? 38   DA  J N9    1 
ATOM   8508  C  C8    . DA  E 3 19  ? -29.652 -60.665 -7.675  1.00 114.66 ? 38   DA  J C8    1 
ATOM   8509  N  N7    . DA  E 3 19  ? -30.639 -61.205 -6.999  1.00 113.67 ? 38   DA  J N7    1 
ATOM   8510  C  C5    . DA  E 3 19  ? -30.163 -61.263 -5.697  1.00 112.45 ? 38   DA  J C5    1 
ATOM   8511  C  C6    . DA  E 3 19  ? -30.737 -61.734 -4.492  1.00 109.98 ? 38   DA  J C6    1 
ATOM   8512  N  N6    . DA  E 3 19  ? -31.969 -62.257 -4.411  1.00 103.53 ? 38   DA  J N6    1 
ATOM   8513  N  N1    . DA  E 3 19  ? -29.988 -61.646 -3.370  1.00 108.81 ? 38   DA  J N1    1 
ATOM   8514  C  C2    . DA  E 3 19  ? -28.755 -61.124 -3.455  1.00 108.70 ? 38   DA  J C2    1 
ATOM   8515  N  N3    . DA  E 3 19  ? -28.112 -60.650 -4.524  1.00 108.15 ? 38   DA  J N3    1 
ATOM   8516  C  C4    . DA  E 3 19  ? -28.878 -60.748 -5.624  1.00 111.31 ? 38   DA  J C4    1 
ATOM   8517  N  N     . ALA F 1 2   ? -32.039 -14.559 -3.977  1.00 97.16  ? 650  ALA B N     1 
ATOM   8518  C  CA    . ALA F 1 2   ? -33.253 -15.372 -3.971  1.00 101.29 ? 650  ALA B CA    1 
ATOM   8519  C  C     . ALA F 1 2   ? -32.928 -16.865 -4.014  1.00 102.48 ? 650  ALA B C     1 
ATOM   8520  O  O     . ALA F 1 2   ? -33.833 -17.704 -4.075  1.00 102.31 ? 650  ALA B O     1 
ATOM   8521  C  CB    . ALA F 1 2   ? -34.168 -14.987 -5.138  1.00 94.98  ? 650  ALA B CB    1 
ATOM   8522  N  N     . MET F 1 3   ? -31.636 -17.186 -3.978  1.00 98.86  ? 651  MET B N     1 
ATOM   8523  C  CA    . MET F 1 3   ? -31.164 -18.568 -4.040  1.00 95.81  ? 651  MET B CA    1 
ATOM   8524  C  C     . MET F 1 3   ? -29.680 -18.618 -3.678  1.00 95.69  ? 651  MET B C     1 
ATOM   8525  O  O     . MET F 1 3   ? -28.847 -18.030 -4.367  1.00 93.27  ? 651  MET B O     1 
ATOM   8526  C  CB    . MET F 1 3   ? -31.414 -19.157 -5.435  1.00 94.70  ? 651  MET B CB    1 
ATOM   8527  C  CG    . MET F 1 3   ? -31.097 -18.189 -6.581  1.00 93.74  ? 651  MET B CG    1 
ATOM   8528  S  SD    . MET F 1 3   ? -31.780 -18.651 -8.198  1.00 87.88  ? 651  MET B SD    1 
ATOM   8529  C  CE    . MET F 1 3   ? -30.854 -20.142 -8.594  1.00 81.80  ? 651  MET B CE    1 
ATOM   8530  N  N     . LYS F 1 4   ? -29.355 -19.313 -2.589  1.00 95.36  ? 652  LYS B N     1 
ATOM   8531  C  CA    . LYS F 1 4   ? -27.982 -19.355 -2.075  1.00 88.97  ? 652  LYS B CA    1 
ATOM   8532  C  C     . LYS F 1 4   ? -27.021 -20.133 -2.984  1.00 89.03  ? 652  LYS B C     1 
ATOM   8533  O  O     . LYS F 1 4   ? -27.393 -21.143 -3.592  1.00 90.36  ? 652  LYS B O     1 
ATOM   8534  C  CB    . LYS F 1 4   ? -27.953 -19.930 -0.656  1.00 85.99  ? 652  LYS B CB    1 
ATOM   8535  N  N     . ARG F 1 5   ? -25.784 -19.655 -3.070  1.00 83.57  ? 653  ARG B N     1 
ATOM   8536  C  CA    . ARG F 1 5   ? -24.765 -20.305 -3.888  1.00 82.09  ? 653  ARG B CA    1 
ATOM   8537  C  C     . ARG F 1 5   ? -23.704 -20.963 -3.017  1.00 79.82  ? 653  ARG B C     1 
ATOM   8538  O  O     . ARG F 1 5   ? -23.327 -20.431 -1.977  1.00 79.58  ? 653  ARG B O     1 
ATOM   8539  C  CB    . ARG F 1 5   ? -24.115 -19.291 -4.831  1.00 84.10  ? 653  ARG B CB    1 
ATOM   8540  C  CG    . ARG F 1 5   ? -23.554 -18.068 -4.129  1.00 82.91  ? 653  ARG B CG    1 
ATOM   8541  C  CD    . ARG F 1 5   ? -23.098 -17.010 -5.124  1.00 84.28  ? 653  ARG B CD    1 
ATOM   8542  N  NE    . ARG F 1 5   ? -23.064 -15.675 -4.527  1.00 83.48  ? 653  ARG B NE    1 
ATOM   8543  C  CZ    . ARG F 1 5   ? -21.959 -15.047 -4.134  1.00 82.34  ? 653  ARG B CZ    1 
ATOM   8544  N  NH1   . ARG F 1 5   ? -20.770 -15.621 -4.277  1.00 80.52  ? 653  ARG B NH1   1 
ATOM   8545  N  NH2   . ARG F 1 5   ? -22.045 -13.836 -3.602  1.00 84.76  ? 653  ARG B NH2   1 
ATOM   8546  N  N     . ARG F 1 6   ? -23.219 -22.122 -3.446  1.00 83.16  ? 654  ARG B N     1 
ATOM   8547  C  CA    . ARG F 1 6   ? -22.263 -22.882 -2.647  1.00 84.47  ? 654  ARG B CA    1 
ATOM   8548  C  C     . ARG F 1 6   ? -20.845 -22.831 -3.207  1.00 82.72  ? 654  ARG B C     1 
ATOM   8549  O  O     . ARG F 1 6   ? -20.611 -22.306 -4.294  1.00 84.47  ? 654  ARG B O     1 
ATOM   8550  C  CB    . ARG F 1 6   ? -22.720 -24.337 -2.500  1.00 86.90  ? 654  ARG B CB    1 
ATOM   8551  C  CG    . ARG F 1 6   ? -22.700 -25.156 -3.785  1.00 90.62  ? 654  ARG B CG    1 
ATOM   8552  C  CD    . ARG F 1 6   ? -21.792 -26.372 -3.625  1.00 94.56  ? 654  ARG B CD    1 
ATOM   8553  N  NE    . ARG F 1 6   ? -22.296 -27.559 -4.313  1.00 100.64 ? 654  ARG B NE    1 
ATOM   8554  C  CZ    . ARG F 1 6   ? -21.755 -28.770 -4.203  1.00 101.77 ? 654  ARG B CZ    1 
ATOM   8555  N  NH1   . ARG F 1 6   ? -20.690 -28.949 -3.433  1.00 99.43  ? 654  ARG B NH1   1 
ATOM   8556  N  NH2   . ARG F 1 6   ? -22.277 -29.803 -4.858  1.00 103.21 ? 654  ARG B NH2   1 
ATOM   8557  N  N     . ARG F 1 7   ? -19.901 -23.377 -2.452  1.00 80.06  ? 655  ARG B N     1 
ATOM   8558  C  CA    . ARG F 1 7   ? -18.522 -23.461 -2.899  1.00 81.57  ? 655  ARG B CA    1 
ATOM   8559  C  C     . ARG F 1 7   ? -18.393 -24.576 -3.925  1.00 85.28  ? 655  ARG B C     1 
ATOM   8560  O  O     . ARG F 1 7   ? -19.120 -25.567 -3.865  1.00 87.19  ? 655  ARG B O     1 
ATOM   8561  C  CB    . ARG F 1 7   ? -17.617 -23.772 -1.718  1.00 83.19  ? 655  ARG B CB    1 
ATOM   8562  C  CG    . ARG F 1 7   ? -17.720 -25.217 -1.265  1.00 86.49  ? 655  ARG B CG    1 
ATOM   8563  C  CD    . ARG F 1 7   ? -17.099 -25.402 0.093   1.00 85.01  ? 655  ARG B CD    1 
ATOM   8564  N  NE    . ARG F 1 7   ? -15.880 -24.617 0.223   1.00 85.24  ? 655  ARG B NE    1 
ATOM   8565  C  CZ    . ARG F 1 7   ? -15.123 -24.608 1.310   1.00 87.53  ? 655  ARG B CZ    1 
ATOM   8566  N  NH1   . ARG F 1 7   ? -15.465 -25.351 2.354   1.00 87.44  ? 655  ARG B NH1   1 
ATOM   8567  N  NH2   . ARG F 1 7   ? -14.028 -23.864 1.350   1.00 89.64  ? 655  ARG B NH2   1 
ATOM   8568  N  N     . CYS F 1 8   ? -17.471 -24.418 -4.869  1.00 84.34  ? 656  CYS B N     1 
ATOM   8569  C  CA    . CYS F 1 8   ? -17.198 -25.477 -5.833  1.00 83.09  ? 656  CYS B CA    1 
ATOM   8570  C  C     . CYS F 1 8   ? -16.425 -26.579 -5.124  1.00 83.35  ? 656  CYS B C     1 
ATOM   8571  O  O     . CYS F 1 8   ? -15.970 -26.397 -3.999  1.00 84.73  ? 656  CYS B O     1 
ATOM   8572  C  CB    . CYS F 1 8   ? -16.393 -24.946 -7.026  1.00 80.03  ? 656  CYS B CB    1 
ATOM   8573  S  SG    . CYS F 1 8   ? -14.682 -24.440 -6.656  1.00 75.32  ? 656  CYS B SG    1 
ATOM   8574  N  N     . GLY F 1 9   ? -16.281 -27.725 -5.772  1.00 79.93  ? 657  GLY B N     1 
ATOM   8575  C  CA    . GLY F 1 9   ? -15.495 -28.796 -5.195  1.00 81.88  ? 657  GLY B CA    1 
ATOM   8576  C  C     . GLY F 1 9   ? -14.052 -28.712 -5.634  1.00 82.26  ? 657  GLY B C     1 
ATOM   8577  O  O     . GLY F 1 9   ? -13.132 -28.759 -4.822  1.00 85.16  ? 657  GLY B O     1 
ATOM   8578  N  N     . VAL F 1 10  ? -13.874 -28.546 -6.939  1.00 80.33  ? 658  VAL B N     1 
ATOM   8579  C  CA    . VAL F 1 10  ? -12.582 -28.674 -7.611  1.00 76.91  ? 658  VAL B CA    1 
ATOM   8580  C  C     . VAL F 1 10  ? -11.464 -27.728 -7.146  1.00 81.46  ? 658  VAL B C     1 
ATOM   8581  O  O     . VAL F 1 10  ? -10.304 -28.141 -7.006  1.00 78.48  ? 658  VAL B O     1 
ATOM   8582  C  CB    . VAL F 1 10  ? -12.765 -28.471 -9.123  1.00 71.29  ? 658  VAL B CB    1 
ATOM   8583  N  N     . CYS F 1 11  ? -11.815 -26.468 -6.907  1.00 81.78  ? 659  CYS B N     1 
ATOM   8584  C  CA    . CYS F 1 11  ? -10.816 -25.420 -6.709  1.00 81.61  ? 659  CYS B CA    1 
ATOM   8585  C  C     . CYS F 1 11  ? -9.781  -25.731 -5.618  1.00 85.94  ? 659  CYS B C     1 
ATOM   8586  O  O     . CYS F 1 11  ? -9.929  -26.685 -4.857  1.00 84.49  ? 659  CYS B O     1 
ATOM   8587  C  CB    . CYS F 1 11  ? -11.497 -24.073 -6.466  1.00 82.30  ? 659  CYS B CB    1 
ATOM   8588  S  SG    . CYS F 1 11  ? -11.484 -23.510 -4.755  1.00 89.93  ? 659  CYS B SG    1 
ATOM   8589  N  N     . GLU F 1 12  ? -8.734  -24.911 -5.555  1.00 87.87  ? 660  GLU B N     1 
ATOM   8590  C  CA    . GLU F 1 12  ? -7.582  -25.171 -4.694  1.00 89.82  ? 660  GLU B CA    1 
ATOM   8591  C  C     . GLU F 1 12  ? -7.801  -24.727 -3.256  1.00 92.94  ? 660  GLU B C     1 
ATOM   8592  O  O     . GLU F 1 12  ? -7.318  -25.371 -2.324  1.00 95.93  ? 660  GLU B O     1 
ATOM   8593  C  CB    . GLU F 1 12  ? -6.335  -24.471 -5.240  1.00 86.65  ? 660  GLU B CB    1 
ATOM   8594  C  CG    . GLU F 1 12  ? -6.126  -24.637 -6.736  1.00 87.90  ? 660  GLU B CG    1 
ATOM   8595  C  CD    . GLU F 1 12  ? -5.867  -26.079 -7.141  1.00 86.00  ? 660  GLU B CD    1 
ATOM   8596  O  OE1   . GLU F 1 12  ? -5.180  -26.799 -6.379  1.00 83.78  ? 660  GLU B OE1   1 
ATOM   8597  O  OE2   . GLU F 1 12  ? -6.354  -26.491 -8.221  1.00 82.53  ? 660  GLU B OE2   1 
ATOM   8598  N  N     . VAL F 1 13  ? -8.509  -23.615 -3.077  1.00 91.52  ? 661  VAL B N     1 
ATOM   8599  C  CA    . VAL F 1 13  ? -8.761  -23.097 -1.736  1.00 95.23  ? 661  VAL B CA    1 
ATOM   8600  C  C     . VAL F 1 13  ? -9.774  -23.978 -1.011  1.00 95.18  ? 661  VAL B C     1 
ATOM   8601  O  O     . VAL F 1 13  ? -9.750  -24.091 0.219   1.00 94.31  ? 661  VAL B O     1 
ATOM   8602  C  CB    . VAL F 1 13  ? -9.263  -21.650 -1.761  1.00 91.17  ? 661  VAL B CB    1 
ATOM   8603  C  CG1   . VAL F 1 13  ? -10.682 -21.600 -2.274  1.00 89.08  ? 661  VAL B CG1   1 
ATOM   8604  C  CG2   . VAL F 1 13  ? -9.184  -21.052 -0.367  1.00 92.02  ? 661  VAL B CG2   1 
ATOM   8605  N  N     . CYS F 1 14  ? -10.662 -24.596 -1.786  1.00 91.95  ? 662  CYS B N     1 
ATOM   8606  C  CA    . CYS F 1 14  ? -11.593 -25.586 -1.264  1.00 90.71  ? 662  CYS B CA    1 
ATOM   8607  C  C     . CYS F 1 14  ? -10.827 -26.751 -0.650  1.00 95.23  ? 662  CYS B C     1 
ATOM   8608  O  O     . CYS F 1 14  ? -11.260 -27.339 0.342   1.00 96.52  ? 662  CYS B O     1 
ATOM   8609  C  CB    . CYS F 1 14  ? -12.507 -26.114 -2.378  1.00 88.53  ? 662  CYS B CB    1 
ATOM   8610  S  SG    . CYS F 1 14  ? -13.978 -25.113 -2.721  1.00 86.13  ? 662  CYS B SG    1 
ATOM   8611  N  N     . GLN F 1 15  ? -9.684  -27.078 -1.245  1.00 96.41  ? 663  GLN B N     1 
ATOM   8612  C  CA    . GLN F 1 15  ? -8.940  -28.280 -0.873  1.00 97.26  ? 663  GLN B CA    1 
ATOM   8613  C  C     . GLN F 1 15  ? -8.094  -28.093 0.388   1.00 99.33  ? 663  GLN B C     1 
ATOM   8614  O  O     . GLN F 1 15  ? -8.069  -28.970 1.252   1.00 99.08  ? 663  GLN B O     1 
ATOM   8615  C  CB    . GLN F 1 15  ? -8.083  -28.761 -2.047  1.00 93.67  ? 663  GLN B CB    1 
ATOM   8616  C  CG    . GLN F 1 15  ? -8.825  -28.718 -3.375  1.00 93.45  ? 663  GLN B CG    1 
ATOM   8617  C  CD    . GLN F 1 15  ? -8.147  -29.522 -4.474  1.00 94.95  ? 663  GLN B CD    1 
ATOM   8618  O  OE1   . GLN F 1 15  ? -7.323  -28.998 -5.233  1.00 91.78  ? 663  GLN B OE1   1 
ATOM   8619  N  NE2   . GLN F 1 15  ? -8.504  -30.804 -4.574  1.00 87.86  ? 663  GLN B NE2   1 
ATOM   8620  N  N     . GLN F 1 16  ? -7.407  -26.956 0.483   1.00 100.17 ? 664  GLN B N     1 
ATOM   8621  C  CA    . GLN F 1 16  ? -6.633  -26.601 1.672   1.00 101.50 ? 664  GLN B CA    1 
ATOM   8622  C  C     . GLN F 1 16  ? -7.436  -26.868 2.938   1.00 104.04 ? 664  GLN B C     1 
ATOM   8623  O  O     . GLN F 1 16  ? -8.438  -26.199 3.172   1.00 106.03 ? 664  GLN B O     1 
ATOM   8624  C  CB    . GLN F 1 16  ? -6.262  -25.117 1.631   1.00 102.32 ? 664  GLN B CB    1 
ATOM   8625  C  CG    . GLN F 1 16  ? -5.348  -24.729 0.484   1.00 104.52 ? 664  GLN B CG    1 
ATOM   8626  C  CD    . GLN F 1 16  ? -5.126  -23.231 0.406   1.00 107.85 ? 664  GLN B CD    1 
ATOM   8627  O  OE1   . GLN F 1 16  ? -5.991  -22.436 0.794   1.00 103.89 ? 664  GLN B OE1   1 
ATOM   8628  N  NE2   . GLN F 1 16  ? -3.959  -22.835 -0.094  1.00 111.30 ? 664  GLN B NE2   1 
ATOM   8629  N  N     . PRO F 1 17  ? -7.005  -27.845 3.758   1.00 102.86 ? 665  PRO B N     1 
ATOM   8630  C  CA    . PRO F 1 17  ? -7.684  -28.150 5.025   1.00 102.27 ? 665  PRO B CA    1 
ATOM   8631  C  C     . PRO F 1 17  ? -7.527  -26.992 5.992   1.00 103.17 ? 665  PRO B C     1 
ATOM   8632  O  O     . PRO F 1 17  ? -6.554  -26.245 5.876   1.00 105.27 ? 665  PRO B O     1 
ATOM   8633  C  CB    . PRO F 1 17  ? -6.921  -29.369 5.552   1.00 103.02 ? 665  PRO B CB    1 
ATOM   8634  C  CG    . PRO F 1 17  ? -6.225  -29.939 4.356   1.00 99.32  ? 665  PRO B CG    1 
ATOM   8635  C  CD    . PRO F 1 17  ? -5.875  -28.754 3.514   1.00 100.32 ? 665  PRO B CD    1 
ATOM   8636  N  N     . GLU F 1 18  ? -8.458  -26.840 6.928   1.00 104.47 ? 666  GLU B N     1 
ATOM   8637  C  CA    . GLU F 1 18  ? -8.412  -25.693 7.833   1.00 110.97 ? 666  GLU B CA    1 
ATOM   8638  C  C     . GLU F 1 18  ? -7.295  -25.813 8.870   1.00 109.67 ? 666  GLU B C     1 
ATOM   8639  O  O     . GLU F 1 18  ? -7.075  -26.875 9.453   1.00 105.15 ? 666  GLU B O     1 
ATOM   8640  C  CB    . GLU F 1 18  ? -9.775  -25.433 8.495   1.00 109.15 ? 666  GLU B CB    1 
ATOM   8641  C  CG    . GLU F 1 18  ? -10.320 -26.573 9.341   1.00 109.19 ? 666  GLU B CG    1 
ATOM   8642  C  CD    . GLU F 1 18  ? -11.836 -26.530 9.465   1.00 107.47 ? 666  GLU B CD    1 
ATOM   8643  O  OE1   . GLU F 1 18  ? -12.353 -26.764 10.579  1.00 107.08 ? 666  GLU B OE1   1 
ATOM   8644  O  OE2   . GLU F 1 18  ? -12.512 -26.269 8.445   1.00 102.55 ? 666  GLU B OE2   1 
ATOM   8645  N  N     . CYS F 1 19  ? -6.590  -24.705 9.069   1.00 109.54 ? 667  CYS B N     1 
ATOM   8646  C  CA    . CYS F 1 19  ? -5.478  -24.613 10.006  1.00 111.28 ? 667  CYS B CA    1 
ATOM   8647  C  C     . CYS F 1 19  ? -5.851  -25.036 11.426  1.00 109.14 ? 667  CYS B C     1 
ATOM   8648  O  O     . CYS F 1 19  ? -5.342  -26.027 11.953  1.00 107.22 ? 667  CYS B O     1 
ATOM   8649  C  CB    . CYS F 1 19  ? -4.981  -23.168 10.035  1.00 112.29 ? 667  CYS B CB    1 
ATOM   8650  S  SG    . CYS F 1 19  ? -6.337  -21.952 10.168  1.00 121.58 ? 667  CYS B SG    1 
ATOM   8651  N  N     . GLY F 1 20  ? -6.742  -24.266 12.040  1.00 106.68 ? 668  GLY B N     1 
ATOM   8652  C  CA    . GLY F 1 20  ? -7.070  -24.445 13.438  1.00 107.25 ? 668  GLY B CA    1 
ATOM   8653  C  C     . GLY F 1 20  ? -6.613  -23.233 14.222  1.00 105.54 ? 668  GLY B C     1 
ATOM   8654  O  O     . GLY F 1 20  ? -6.657  -23.215 15.450  1.00 106.53 ? 668  GLY B O     1 
ATOM   8655  N  N     . LYS F 1 21  ? -6.171  -22.211 13.500  1.00 103.36 ? 669  LYS B N     1 
ATOM   8656  C  CA    . LYS F 1 21  ? -5.737  -20.971 14.126  1.00 103.83 ? 669  LYS B CA    1 
ATOM   8657  C  C     . LYS F 1 21  ? -6.696  -19.816 13.830  1.00 103.33 ? 669  LYS B C     1 
ATOM   8658  O  O     . LYS F 1 21  ? -6.627  -18.772 14.475  1.00 102.65 ? 669  LYS B O     1 
ATOM   8659  C  CB    . LYS F 1 21  ? -4.322  -20.612 13.681  1.00 105.18 ? 669  LYS B CB    1 
ATOM   8660  N  N     . CYS F 1 22  ? -7.586  -20.010 12.858  1.00 103.83 ? 670  CYS B N     1 
ATOM   8661  C  CA    . CYS F 1 22  ? -8.530  -18.970 12.440  1.00 104.45 ? 670  CYS B CA    1 
ATOM   8662  C  C     . CYS F 1 22  ? -9.407  -18.449 13.573  1.00 101.75 ? 670  CYS B C     1 
ATOM   8663  O  O     . CYS F 1 22  ? -9.813  -19.208 14.449  1.00 102.81 ? 670  CYS B O     1 
ATOM   8664  C  CB    . CYS F 1 22  ? -9.440  -19.491 11.326  1.00 106.46 ? 670  CYS B CB    1 
ATOM   8665  S  SG    . CYS F 1 22  ? -8.816  -19.262 9.655   1.00 111.27 ? 670  CYS B SG    1 
ATOM   8666  N  N     . LYS F 1 23  ? -9.702  -17.153 13.546  1.00 99.27  ? 671  LYS B N     1 
ATOM   8667  C  CA    . LYS F 1 23  ? -10.727 -16.596 14.418  1.00 101.18 ? 671  LYS B CA    1 
ATOM   8668  C  C     . LYS F 1 23  ? -11.970 -17.445 14.209  1.00 103.40 ? 671  LYS B C     1 
ATOM   8669  O  O     . LYS F 1 23  ? -12.766 -17.658 15.129  1.00 103.63 ? 671  LYS B O     1 
ATOM   8670  C  CB    . LYS F 1 23  ? -11.020 -15.140 14.045  1.00 100.69 ? 671  LYS B CB    1 
ATOM   8671  C  CG    . LYS F 1 23  ? -12.218 -14.533 14.769  1.00 101.58 ? 671  LYS B CG    1 
ATOM   8672  C  CD    . LYS F 1 23  ? -12.636 -13.186 14.168  1.00 103.01 ? 671  LYS B CD    1 
ATOM   8673  C  CE    . LYS F 1 23  ? -13.160 -13.336 12.739  1.00 98.88  ? 671  LYS B CE    1 
ATOM   8674  N  NZ    . LYS F 1 23  ? -13.797 -12.087 12.223  1.00 92.55  ? 671  LYS B NZ    1 
ATOM   8675  N  N     . ALA F 1 24  ? -12.108 -17.937 12.979  1.00 102.08 ? 672  ALA B N     1 
ATOM   8676  C  CA    . ALA F 1 24  ? -13.222 -18.786 12.578  1.00 101.90 ? 672  ALA B CA    1 
ATOM   8677  C  C     . ALA F 1 24  ? -13.038 -20.232 13.050  1.00 104.15 ? 672  ALA B C     1 
ATOM   8678  O  O     . ALA F 1 24  ? -13.990 -20.871 13.512  1.00 102.98 ? 672  ALA B O     1 
ATOM   8679  C  CB    . ALA F 1 24  ? -13.398 -18.736 11.061  1.00 95.73  ? 672  ALA B CB    1 
ATOM   8680  N  N     . CYS F 1 25  ? -11.812 -20.740 12.933  1.00 104.54 ? 673  CYS B N     1 
ATOM   8681  C  CA    . CYS F 1 25  ? -11.502 -22.113 13.328  1.00 105.08 ? 673  CYS B CA    1 
ATOM   8682  C  C     . CYS F 1 25  ? -11.649 -22.332 14.825  1.00 105.86 ? 673  CYS B C     1 
ATOM   8683  O  O     . CYS F 1 25  ? -12.100 -23.391 15.263  1.00 106.86 ? 673  CYS B O     1 
ATOM   8684  C  CB    . CYS F 1 25  ? -10.091 -22.501 12.894  1.00 104.47 ? 673  CYS B CB    1 
ATOM   8685  S  SG    . CYS F 1 25  ? -9.943  -22.806 11.133  1.00 107.04 ? 673  CYS B SG    1 
ATOM   8686  N  N     . LYS F 1 26  ? -11.259 -21.332 15.607  1.00 104.36 ? 674  LYS B N     1 
ATOM   8687  C  CA    . LYS F 1 26  ? -11.379 -21.423 17.053  1.00 103.46 ? 674  LYS B CA    1 
ATOM   8688  C  C     . LYS F 1 26  ? -12.809 -21.773 17.446  1.00 104.42 ? 674  LYS B C     1 
ATOM   8689  O  O     . LYS F 1 26  ? -13.036 -22.639 18.294  1.00 105.94 ? 674  LYS B O     1 
ATOM   8690  C  CB    . LYS F 1 26  ? -10.942 -20.114 17.721  1.00 103.63 ? 674  LYS B CB    1 
ATOM   8691  C  CG    . LYS F 1 26  ? -9.468  -20.076 18.126  1.00 102.12 ? 674  LYS B CG    1 
ATOM   8692  C  CD    . LYS F 1 26  ? -8.548  -20.264 16.928  1.00 101.06 ? 674  LYS B CD    1 
ATOM   8693  C  CE    . LYS F 1 26  ? -7.097  -20.411 17.353  1.00 99.74  ? 674  LYS B CE    1 
ATOM   8694  N  NZ    . LYS F 1 26  ? -6.878  -21.638 18.169  1.00 98.56  ? 674  LYS B NZ    1 
ATOM   8695  N  N     . ASP F 1 27  ? -13.771 -21.118 16.804  1.00 101.16 ? 675  ASP B N     1 
ATOM   8696  C  CA    . ASP F 1 27  ? -15.167 -21.244 17.206  1.00 102.17 ? 675  ASP B CA    1 
ATOM   8697  C  C     . ASP F 1 27  ? -15.843 -22.567 16.813  1.00 103.28 ? 675  ASP B C     1 
ATOM   8698  O  O     . ASP F 1 27  ? -16.972 -22.833 17.231  1.00 103.57 ? 675  ASP B O     1 
ATOM   8699  C  CB    . ASP F 1 27  ? -15.981 -20.058 16.685  1.00 100.57 ? 675  ASP B CB    1 
ATOM   8700  C  CG    . ASP F 1 27  ? -17.377 -20.012 17.275  1.00 101.95 ? 675  ASP B CG    1 
ATOM   8701  O  OD1   . ASP F 1 27  ? -18.340 -19.845 16.502  1.00 99.80  ? 675  ASP B OD1   1 
ATOM   8702  O  OD2   . ASP F 1 27  ? -17.511 -20.151 18.512  1.00 104.23 ? 675  ASP B OD2   1 
ATOM   8703  N  N     . MET F 1 28  ? -15.167 -23.395 16.022  1.00 102.97 ? 676  MET B N     1 
ATOM   8704  C  CA    . MET F 1 28  ? -15.756 -24.670 15.605  1.00 103.62 ? 676  MET B CA    1 
ATOM   8705  C  C     . MET F 1 28  ? -15.765 -25.687 16.745  1.00 102.10 ? 676  MET B C     1 
ATOM   8706  O  O     . MET F 1 28  ? -14.788 -25.810 17.485  1.00 100.64 ? 676  MET B O     1 
ATOM   8707  C  CB    . MET F 1 28  ? -15.023 -25.243 14.389  1.00 102.30 ? 676  MET B CB    1 
ATOM   8708  C  CG    . MET F 1 28  ? -14.818 -24.243 13.265  1.00 102.75 ? 676  MET B CG    1 
ATOM   8709  S  SD    . MET F 1 28  ? -14.364 -25.028 11.706  1.00 106.78 ? 676  MET B SD    1 
ATOM   8710  C  CE    . MET F 1 28  ? -15.910 -25.827 11.261  1.00 98.71  ? 676  MET B CE    1 
ATOM   8711  N  N     . VAL F 1 29  ? -16.872 -26.410 16.889  1.00 102.88 ? 677  VAL B N     1 
ATOM   8712  C  CA    . VAL F 1 29  ? -16.968 -27.448 17.914  1.00 104.78 ? 677  VAL B CA    1 
ATOM   8713  C  C     . VAL F 1 29  ? -15.819 -28.446 17.763  1.00 103.25 ? 677  VAL B C     1 
ATOM   8714  O  O     . VAL F 1 29  ? -15.425 -29.107 18.725  1.00 101.14 ? 677  VAL B O     1 
ATOM   8715  C  CB    . VAL F 1 29  ? -18.329 -28.195 17.866  1.00 102.52 ? 677  VAL B CB    1 
ATOM   8716  C  CG1   . VAL F 1 29  ? -19.448 -27.246 17.440  1.00 100.61 ? 677  VAL B CG1   1 
ATOM   8717  C  CG2   . VAL F 1 29  ? -18.255 -29.425 16.954  1.00 96.69  ? 677  VAL B CG2   1 
ATOM   8718  N  N     . LYS F 1 30  ? -15.285 -28.532 16.544  1.00 103.25 ? 678  LYS B N     1 
ATOM   8719  C  CA    . LYS F 1 30  ? -14.179 -29.427 16.215  1.00 101.99 ? 678  LYS B CA    1 
ATOM   8720  C  C     . LYS F 1 30  ? -12.912 -29.012 16.947  1.00 101.71 ? 678  LYS B C     1 
ATOM   8721  O  O     . LYS F 1 30  ? -12.130 -29.852 17.391  1.00 100.40 ? 678  LYS B O     1 
ATOM   8722  C  CB    . LYS F 1 30  ? -13.910 -29.399 14.708  1.00 102.99 ? 678  LYS B CB    1 
ATOM   8723  C  CG    . LYS F 1 30  ? -15.155 -29.498 13.838  1.00 102.48 ? 678  LYS B CG    1 
ATOM   8724  C  CD    . LYS F 1 30  ? -14.816 -29.272 12.370  1.00 102.45 ? 678  LYS B CD    1 
ATOM   8725  C  CE    . LYS F 1 30  ? -13.721 -30.223 11.902  1.00 103.28 ? 678  LYS B CE    1 
ATOM   8726  N  NZ    . LYS F 1 30  ? -13.363 -30.020 10.469  1.00 102.94 ? 678  LYS B NZ    1 
ATOM   8727  N  N     . PHE F 1 31  ? -12.710 -27.704 17.051  1.00 103.41 ? 679  PHE B N     1 
ATOM   8728  C  CA    . PHE F 1 31  ? -11.553 -27.161 17.747  1.00 103.55 ? 679  PHE B CA    1 
ATOM   8729  C  C     . PHE F 1 31  ? -11.965 -26.687 19.137  1.00 103.99 ? 679  PHE B C     1 
ATOM   8730  O  O     . PHE F 1 31  ? -11.238 -25.941 19.793  1.00 104.81 ? 679  PHE B O     1 
ATOM   8731  C  CB    . PHE F 1 31  ? -10.926 -26.019 16.940  1.00 104.17 ? 679  PHE B CB    1 
ATOM   8732  C  CG    . PHE F 1 31  ? -10.480 -26.424 15.555  1.00 106.29 ? 679  PHE B CG    1 
ATOM   8733  C  CD1   . PHE F 1 31  ? -9.224  -26.976 15.349  1.00 103.97 ? 679  PHE B CD1   1 
ATOM   8734  C  CD2   . PHE F 1 31  ? -11.318 -26.255 14.462  1.00 106.30 ? 679  PHE B CD2   1 
ATOM   8735  C  CE1   . PHE F 1 31  ? -8.810  -27.351 14.082  1.00 101.74 ? 679  PHE B CE1   1 
ATOM   8736  C  CE2   . PHE F 1 31  ? -10.909 -26.628 13.192  1.00 107.66 ? 679  PHE B CE2   1 
ATOM   8737  C  CZ    . PHE F 1 31  ? -9.652  -27.177 13.003  1.00 106.04 ? 679  PHE B CZ    1 
ATOM   8738  N  N     . GLY F 1 32  ? -13.142 -27.123 19.575  1.00 103.71 ? 680  GLY B N     1 
ATOM   8739  C  CA    . GLY F 1 32  ? -13.622 -26.814 20.908  1.00 103.69 ? 680  GLY B CA    1 
ATOM   8740  C  C     . GLY F 1 32  ? -14.710 -25.756 20.972  1.00 104.89 ? 680  GLY B C     1 
ATOM   8741  O  O     . GLY F 1 32  ? -15.565 -25.803 21.856  1.00 106.80 ? 680  GLY B O     1 
ATOM   8742  N  N     . GLY F 1 33  ? -14.682 -24.803 20.043  1.00 103.96 ? 681  GLY B N     1 
ATOM   8743  C  CA    . GLY F 1 33  ? -15.624 -23.694 20.042  1.00 103.44 ? 681  GLY B CA    1 
ATOM   8744  C  C     . GLY F 1 33  ? -17.094 -24.071 20.167  1.00 104.14 ? 681  GLY B C     1 
ATOM   8745  O  O     . GLY F 1 33  ? -17.489 -25.209 19.887  1.00 103.02 ? 681  GLY B O     1 
ATOM   8746  N  N     . THR F 1 34  ? -17.909 -23.100 20.580  1.00 103.30 ? 682  THR B N     1 
ATOM   8747  C  CA    . THR F 1 34  ? -19.344 -23.310 20.797  1.00 102.93 ? 682  THR B CA    1 
ATOM   8748  C  C     . THR F 1 34  ? -20.151 -23.442 19.504  1.00 103.25 ? 682  THR B C     1 
ATOM   8749  O  O     . THR F 1 34  ? -21.227 -24.049 19.499  1.00 97.25  ? 682  THR B O     1 
ATOM   8750  C  CB    . THR F 1 34  ? -19.961 -22.176 21.642  1.00 102.76 ? 682  THR B CB    1 
ATOM   8751  O  OG1   . THR F 1 34  ? -19.589 -20.906 21.087  1.00 102.36 ? 682  THR B OG1   1 
ATOM   8752  C  CG2   . THR F 1 34  ? -19.484 -22.261 23.089  1.00 100.24 ? 682  THR B CG2   1 
ATOM   8753  N  N     . GLY F 1 35  ? -19.640 -22.847 18.425  1.00 104.94 ? 683  GLY B N     1 
ATOM   8754  C  CA    . GLY F 1 35  ? -20.225 -22.988 17.099  1.00 105.22 ? 683  GLY B CA    1 
ATOM   8755  C  C     . GLY F 1 35  ? -21.257 -21.938 16.720  1.00 100.38 ? 683  GLY B C     1 
ATOM   8756  O  O     . GLY F 1 35  ? -22.172 -22.203 15.935  1.00 98.21  ? 683  GLY B O     1 
ATOM   8757  N  N     . ARG F 1 36  ? -21.106 -20.738 17.265  1.00 96.59  ? 684  ARG B N     1 
ATOM   8758  C  CA    . ARG F 1 36  ? -22.094 -19.689 17.055  1.00 97.58  ? 684  ARG B CA    1 
ATOM   8759  C  C     . ARG F 1 36  ? -21.701 -18.739 15.921  1.00 96.03  ? 684  ARG B C     1 
ATOM   8760  O  O     . ARG F 1 36  ? -22.539 -17.999 15.404  1.00 95.25  ? 684  ARG B O     1 
ATOM   8761  C  CB    . ARG F 1 36  ? -22.324 -18.919 18.358  1.00 100.89 ? 684  ARG B CB    1 
ATOM   8762  C  CG    . ARG F 1 36  ? -22.287 -19.807 19.601  1.00 101.04 ? 684  ARG B CG    1 
ATOM   8763  C  CD    . ARG F 1 36  ? -23.098 -19.218 20.746  1.00 99.37  ? 684  ARG B CD    1 
ATOM   8764  N  NE    . ARG F 1 36  ? -24.534 -19.316 20.499  1.00 96.94  ? 684  ARG B NE    1 
ATOM   8765  C  CZ    . ARG F 1 36  ? -25.273 -20.375 20.815  1.00 94.32  ? 684  ARG B CZ    1 
ATOM   8766  N  NH1   . ARG F 1 36  ? -24.706 -21.427 21.393  1.00 91.49  ? 684  ARG B NH1   1 
ATOM   8767  N  NH2   . ARG F 1 36  ? -26.576 -20.383 20.555  1.00 90.43  ? 684  ARG B NH2   1 
ATOM   8768  N  N     . SER F 1 37  ? -20.428 -18.767 15.535  1.00 95.77  ? 685  SER B N     1 
ATOM   8769  C  CA    . SER F 1 37  ? -19.934 -17.928 14.447  1.00 92.36  ? 685  SER B CA    1 
ATOM   8770  C  C     . SER F 1 37  ? -20.419 -18.452 13.099  1.00 87.62  ? 685  SER B C     1 
ATOM   8771  O  O     . SER F 1 37  ? -20.731 -17.676 12.198  1.00 85.74  ? 685  SER B O     1 
ATOM   8772  C  CB    . SER F 1 37  ? -18.404 -17.852 14.471  1.00 91.47  ? 685  SER B CB    1 
ATOM   8773  O  OG    . SER F 1 37  ? -17.912 -16.996 13.454  1.00 88.45  ? 685  SER B OG    1 
ATOM   8774  N  N     . LYS F 1 38  ? -20.478 -19.774 12.968  1.00 88.26  ? 686  LYS B N     1 
ATOM   8775  C  CA    . LYS F 1 38  ? -20.999 -20.411 11.759  1.00 86.90  ? 686  LYS B CA    1 
ATOM   8776  C  C     . LYS F 1 38  ? -20.371 -19.899 10.455  1.00 81.82  ? 686  LYS B C     1 
ATOM   8777  O  O     . LYS F 1 38  ? -21.072 -19.668 9.470   1.00 78.13  ? 686  LYS B O     1 
ATOM   8778  C  CB    . LYS F 1 38  ? -22.523 -20.267 11.695  1.00 85.31  ? 686  LYS B CB    1 
ATOM   8779  C  CG    . LYS F 1 38  ? -23.277 -21.096 12.717  1.00 83.46  ? 686  LYS B CG    1 
ATOM   8780  C  CD    . LYS F 1 38  ? -24.772 -20.969 12.499  1.00 81.22  ? 686  LYS B CD    1 
ATOM   8781  C  CE    . LYS F 1 38  ? -25.536 -21.984 13.324  1.00 83.99  ? 686  LYS B CE    1 
ATOM   8782  N  NZ    . LYS F 1 38  ? -26.989 -21.970 13.004  1.00 85.54  ? 686  LYS B NZ    1 
ATOM   8783  N  N     . GLN F 1 39  ? -19.053 -19.726 10.458  1.00 81.88  ? 687  GLN B N     1 
ATOM   8784  C  CA    . GLN F 1 39  ? -18.319 -19.352 9.255   1.00 81.86  ? 687  GLN B CA    1 
ATOM   8785  C  C     . GLN F 1 39  ? -17.273 -20.425 8.952   1.00 85.41  ? 687  GLN B C     1 
ATOM   8786  O  O     . GLN F 1 39  ? -17.024 -21.300 9.782   1.00 87.18  ? 687  GLN B O     1 
ATOM   8787  C  CB    . GLN F 1 39  ? -17.654 -17.986 9.432   1.00 79.85  ? 687  GLN B CB    1 
ATOM   8788  C  CG    . GLN F 1 39  ? -18.616 -16.866 9.802   1.00 78.88  ? 687  GLN B CG    1 
ATOM   8789  C  CD    . GLN F 1 39  ? -19.684 -16.620 8.745   1.00 77.09  ? 687  GLN B CD    1 
ATOM   8790  O  OE1   . GLN F 1 39  ? -19.437 -16.755 7.547   1.00 77.28  ? 687  GLN B OE1   1 
ATOM   8791  N  NE2   . GLN F 1 39  ? -20.879 -16.256 9.191   1.00 76.91  ? 687  GLN B NE2   1 
ATOM   8792  N  N     . ALA F 1 40  ? -16.666 -20.370 7.770   1.00 82.96  ? 688  ALA B N     1 
ATOM   8793  C  CA    . ALA F 1 40  ? -15.658 -21.362 7.409   1.00 83.04  ? 688  ALA B CA    1 
ATOM   8794  C  C     . ALA F 1 40  ? -14.244 -20.857 7.696   1.00 87.71  ? 688  ALA B C     1 
ATOM   8795  O  O     . ALA F 1 40  ? -14.061 -19.767 8.237   1.00 87.86  ? 688  ALA B O     1 
ATOM   8796  C  CB    . ALA F 1 40  ? -15.804 -21.762 5.958   1.00 82.44  ? 688  ALA B CB    1 
ATOM   8797  N  N     . CYS F 1 41  ? -13.249 -21.665 7.343   1.00 92.83  ? 689  CYS B N     1 
ATOM   8798  C  CA    . CYS F 1 41  ? -11.847 -21.289 7.511   1.00 96.62  ? 689  CYS B CA    1 
ATOM   8799  C  C     . CYS F 1 41  ? -11.477 -20.166 6.543   1.00 95.07  ? 689  CYS B C     1 
ATOM   8800  O  O     . CYS F 1 41  ? -11.817 -20.220 5.360   1.00 94.08  ? 689  CYS B O     1 
ATOM   8801  C  CB    . CYS F 1 41  ? -10.946 -22.506 7.274   1.00 100.24 ? 689  CYS B CB    1 
ATOM   8802  S  SG    . CYS F 1 41  ? -9.174  -22.242 7.559   1.00 110.23 ? 689  CYS B SG    1 
ATOM   8803  N  N     . LEU F 1 42  ? -10.785 -19.146 7.043   1.00 95.91  ? 690  LEU B N     1 
ATOM   8804  C  CA    . LEU F 1 42  ? -10.352 -18.036 6.193   1.00 95.56  ? 690  LEU B CA    1 
ATOM   8805  C  C     . LEU F 1 42  ? -9.506  -18.524 5.008   1.00 96.80  ? 690  LEU B C     1 
ATOM   8806  O  O     . LEU F 1 42  ? -9.493  -17.903 3.941   1.00 92.41  ? 690  LEU B O     1 
ATOM   8807  C  CB    . LEU F 1 42  ? -9.596  -16.986 7.009   1.00 89.03  ? 690  LEU B CB    1 
ATOM   8808  N  N     . LYS F 1 43  ? -8.812  -19.644 5.204   1.00 96.94  ? 691  LYS B N     1 
ATOM   8809  C  CA    . LYS F 1 43  ? -7.981  -20.245 4.162   1.00 93.93  ? 691  LYS B CA    1 
ATOM   8810  C  C     . LYS F 1 43  ? -8.815  -21.158 3.262   1.00 96.20  ? 691  LYS B C     1 
ATOM   8811  O  O     . LYS F 1 43  ? -8.293  -21.804 2.346   1.00 97.86  ? 691  LYS B O     1 
ATOM   8812  C  CB    . LYS F 1 43  ? -6.819  -21.023 4.784   1.00 89.45  ? 691  LYS B CB    1 
ATOM   8813  N  N     . ARG F 1 44  ? -10.114 -21.206 3.535   1.00 93.60  ? 692  ARG B N     1 
ATOM   8814  C  CA    . ARG F 1 44  ? -11.035 -22.006 2.745   1.00 92.47  ? 692  ARG B CA    1 
ATOM   8815  C  C     . ARG F 1 44  ? -12.167 -21.129 2.237   1.00 92.34  ? 692  ARG B C     1 
ATOM   8816  O  O     . ARG F 1 44  ? -13.330 -21.531 2.253   1.00 91.01  ? 692  ARG B O     1 
ATOM   8817  C  CB    . ARG F 1 44  ? -11.613 -23.146 3.579   1.00 92.83  ? 692  ARG B CB    1 
ATOM   8818  C  CG    . ARG F 1 44  ? -10.587 -24.091 4.176   1.00 95.09  ? 692  ARG B CG    1 
ATOM   8819  C  CD    . ARG F 1 44  ? -10.951 -25.545 3.888   1.00 95.16  ? 692  ARG B CD    1 
ATOM   8820  N  NE    . ARG F 1 44  ? -12.315 -25.887 4.279   1.00 90.46  ? 692  ARG B NE    1 
ATOM   8821  C  CZ    . ARG F 1 44  ? -13.066 -26.786 3.649   1.00 88.62  ? 692  ARG B CZ    1 
ATOM   8822  N  NH1   . ARG F 1 44  ? -14.298 -27.040 4.069   1.00 89.19  ? 692  ARG B NH1   1 
ATOM   8823  N  NH2   . ARG F 1 44  ? -12.585 -27.432 2.596   1.00 87.35  ? 692  ARG B NH2   1 
ATOM   8824  N  N     . ARG F 1 45  ? -11.829 -19.920 1.807   1.00 92.38  ? 693  ARG B N     1 
ATOM   8825  C  CA    . ARG F 1 45  ? -12.820 -19.030 1.221   1.00 90.68  ? 693  ARG B CA    1 
ATOM   8826  C  C     . ARG F 1 45  ? -12.806 -19.163 -0.293  1.00 88.56  ? 693  ARG B C     1 
ATOM   8827  O  O     . ARG F 1 45  ? -12.007 -18.529 -0.985  1.00 85.87  ? 693  ARG B O     1 
ATOM   8828  C  CB    . ARG F 1 45  ? -12.568 -17.586 1.635   1.00 91.47  ? 693  ARG B CB    1 
ATOM   8829  C  CG    . ARG F 1 45  ? -12.835 -17.323 3.097   1.00 89.77  ? 693  ARG B CG    1 
ATOM   8830  C  CD    . ARG F 1 45  ? -14.275 -17.628 3.455   1.00 86.25  ? 693  ARG B CD    1 
ATOM   8831  N  NE    . ARG F 1 45  ? -14.703 -16.842 4.608   1.00 88.35  ? 693  ARG B NE    1 
ATOM   8832  C  CZ    . ARG F 1 45  ? -14.267 -17.038 5.849   1.00 90.02  ? 693  ARG B CZ    1 
ATOM   8833  N  NH1   . ARG F 1 45  ? -13.388 -17.999 6.101   1.00 91.31  ? 693  ARG B NH1   1 
ATOM   8834  N  NH2   . ARG F 1 45  ? -14.708 -16.272 6.840   1.00 85.85  ? 693  ARG B NH2   1 
ATOM   8835  N  N     . CYS F 1 46  ? -13.701 -20.002 -0.794  1.00 87.24  ? 694  CYS B N     1 
ATOM   8836  C  CA    . CYS F 1 46  ? -13.768 -20.300 -2.213  1.00 86.42  ? 694  CYS B CA    1 
ATOM   8837  C  C     . CYS F 1 46  ? -14.175 -19.086 -3.046  1.00 87.31  ? 694  CYS B C     1 
ATOM   8838  O  O     . CYS F 1 46  ? -15.297 -18.594 -2.928  1.00 86.39  ? 694  CYS B O     1 
ATOM   8839  C  CB    . CYS F 1 46  ? -14.743 -21.451 -2.453  1.00 85.51  ? 694  CYS B CB    1 
ATOM   8840  S  SG    . CYS F 1 46  ? -14.985 -21.846 -4.186  1.00 85.29  ? 694  CYS B SG    1 
ATOM   8841  N  N     . PRO F 1 47  ? -13.251 -18.591 -3.887  1.00 87.16  ? 695  PRO B N     1 
ATOM   8842  C  CA    . PRO F 1 47  ? -13.560 -17.531 -4.851  1.00 84.39  ? 695  PRO B CA    1 
ATOM   8843  C  C     . PRO F 1 47  ? -14.570 -18.028 -5.879  1.00 81.18  ? 695  PRO B C     1 
ATOM   8844  O  O     . PRO F 1 47  ? -15.516 -17.317 -6.228  1.00 75.86  ? 695  PRO B O     1 
ATOM   8845  C  CB    . PRO F 1 47  ? -12.210 -17.276 -5.525  1.00 85.80  ? 695  PRO B CB    1 
ATOM   8846  C  CG    . PRO F 1 47  ? -11.195 -17.723 -4.518  1.00 86.98  ? 695  PRO B CG    1 
ATOM   8847  C  CD    . PRO F 1 47  ? -11.816 -18.920 -3.873  1.00 88.18  ? 695  PRO B CD    1 
ATOM   8848  N  N     . ASN F 1 48  ? -14.359 -19.255 -6.350  1.00 80.55  ? 696  ASN B N     1 
ATOM   8849  C  CA    . ASN F 1 48  ? -15.284 -19.907 -7.275  1.00 80.37  ? 696  ASN B CA    1 
ATOM   8850  C  C     . ASN F 1 48  ? -16.698 -20.010 -6.724  1.00 79.60  ? 696  ASN B C     1 
ATOM   8851  O  O     . ASN F 1 48  ? -17.614 -20.448 -7.425  1.00 76.88  ? 696  ASN B O     1 
ATOM   8852  C  CB    . ASN F 1 48  ? -14.787 -21.304 -7.639  1.00 78.66  ? 696  ASN B CB    1 
ATOM   8853  C  CG    . ASN F 1 48  ? -13.796 -21.288 -8.771  1.00 73.67  ? 696  ASN B CG    1 
ATOM   8854  O  OD1   . ASN F 1 48  ? -13.482 -20.230 -9.314  1.00 73.52  ? 696  ASN B OD1   1 
ATOM   8855  N  ND2   . ASN F 1 48  ? -13.287 -22.464 -9.134  1.00 71.16  ? 696  ASN B ND2   1 
ATOM   8856  N  N     . LEU F 1 49  ? -16.861 -19.624 -5.463  1.00 81.44  ? 697  LEU B N     1 
ATOM   8857  C  CA    . LEU F 1 49  ? -18.167 -19.620 -4.821  1.00 83.43  ? 697  LEU B CA    1 
ATOM   8858  C  C     . LEU F 1 49  ? -19.240 -19.126 -5.782  1.00 81.71  ? 697  LEU B C     1 
ATOM   8859  O  O     . LEU F 1 49  ? -19.352 -17.929 -6.037  1.00 79.65  ? 697  LEU B O     1 
ATOM   8860  C  CB    . LEU F 1 49  ? -18.142 -18.756 -3.553  1.00 82.80  ? 697  LEU B CB    1 
ATOM   8861  C  CG    . LEU F 1 49  ? -19.491 -18.327 -2.962  1.00 81.10  ? 697  LEU B CG    1 
ATOM   8862  C  CD1   . LEU F 1 49  ? -20.427 -19.513 -2.774  1.00 80.71  ? 697  LEU B CD1   1 
ATOM   8863  C  CD2   . LEU F 1 49  ? -19.284 -17.593 -1.650  1.00 78.63  ? 697  LEU B CD2   1 
ATOM   8864  N  N     . ALA F 1 50  ? -20.010 -20.064 -6.323  1.00 80.59  ? 698  ALA B N     1 
ATOM   8865  C  CA    . ALA F 1 50  ? -21.124 -19.748 -7.207  1.00 81.96  ? 698  ALA B CA    1 
ATOM   8866  C  C     . ALA F 1 50  ? -22.168 -20.840 -7.059  1.00 82.24  ? 698  ALA B C     1 
ATOM   8867  O  O     . ALA F 1 50  ? -21.906 -21.862 -6.430  1.00 83.00  ? 698  ALA B O     1 
ATOM   8868  C  CB    . ALA F 1 50  ? -20.651 -19.655 -8.651  1.00 79.43  ? 698  ALA B CB    1 
ATOM   8869  N  N     . VAL F 1 51  ? -23.348 -20.629 -7.632  1.00 81.00  ? 699  VAL B N     1 
ATOM   8870  C  CA    . VAL F 1 51  ? -24.399 -21.639 -7.586  1.00 82.64  ? 699  VAL B CA    1 
ATOM   8871  C  C     . VAL F 1 51  ? -23.946 -22.919 -8.286  1.00 86.30  ? 699  VAL B C     1 
ATOM   8872  O  O     . VAL F 1 51  ? -23.946 -22.986 -9.511  1.00 85.49  ? 699  VAL B O     1 
ATOM   8873  C  CB    . VAL F 1 51  ? -25.686 -21.145 -8.279  1.00 83.44  ? 699  VAL B CB    1 
ATOM   8874  C  CG1   . VAL F 1 51  ? -26.794 -22.174 -8.125  1.00 85.87  ? 699  VAL B CG1   1 
ATOM   8875  C  CG2   . VAL F 1 51  ? -26.115 -19.788 -7.726  1.00 79.98  ? 699  VAL B CG2   1 
ATOM   8876  N  N     . LYS F 1 52  ? -23.548 -23.930 -7.517  1.00 91.24  ? 700  LYS B N     1 
ATOM   8877  C  CA    . LYS F 1 52  ? -23.190 -25.225 -8.097  1.00 92.75  ? 700  LYS B CA    1 
ATOM   8878  C  C     . LYS F 1 52  ? -24.358 -26.199 -7.937  1.00 102.89 ? 700  LYS B C     1 
ATOM   8879  O  O     . LYS F 1 52  ? -24.171 -27.420 -7.907  1.00 103.91 ? 700  LYS B O     1 
ATOM   8880  C  CB    . LYS F 1 52  ? -21.920 -25.789 -7.457  1.00 90.05  ? 700  LYS B CB    1 
ATOM   8881  N  N     . GLU F 1 53  ? -25.564 -25.640 -7.838  1.00 101.26 ? 701  GLU B N     1 
ATOM   8882  C  CA    . GLU F 1 53  ? -26.782 -26.425 -7.632  1.00 102.89 ? 701  GLU B CA    1 
ATOM   8883  C  C     . GLU F 1 53  ? -27.043 -27.434 -8.764  1.00 104.62 ? 701  GLU B C     1 
ATOM   8884  O  O     . GLU F 1 53  ? -27.495 -28.556 -8.512  1.00 103.38 ? 701  GLU B O     1 
ATOM   8885  C  CB    . GLU F 1 53  ? -27.987 -25.500 -7.430  1.00 91.38  ? 701  GLU B CB    1 
ATOM   8886  N  N     . ALA F 1 54  ? -26.753 -27.037 -10.001 1.00 101.27 ? 702  ALA B N     1 
ATOM   8887  C  CA    . ALA F 1 54  ? -26.944 -27.917 -11.153 1.00 103.31 ? 702  ALA B CA    1 
ATOM   8888  C  C     . ALA F 1 54  ? -26.342 -29.309 -10.924 1.00 105.86 ? 702  ALA B C     1 
ATOM   8889  O  O     . ALA F 1 54  ? -25.290 -29.439 -10.295 1.00 108.45 ? 702  ALA B O     1 
ATOM   8890  C  CB    . ALA F 1 54  ? -26.359 -27.279 -12.412 1.00 102.68 ? 702  ALA B CB    1 
ATOM   8891  N  N     . ASP F 1 55  ? -27.015 -30.340 -11.433 1.00 105.64 ? 703  ASP B N     1 
ATOM   8892  C  CA    . ASP F 1 55  ? -26.543 -31.723 -11.319 1.00 107.02 ? 703  ASP B CA    1 
ATOM   8893  C  C     . ASP F 1 55  ? -26.171 -32.275 -12.705 1.00 108.63 ? 703  ASP B C     1 
ATOM   8894  O  O     . ASP F 1 55  ? -26.843 -31.987 -13.699 1.00 104.51 ? 703  ASP B O     1 
ATOM   8895  C  CB    . ASP F 1 55  ? -27.611 -32.599 -10.644 1.00 103.71 ? 703  ASP B CB    1 
ATOM   8896  C  CG    . ASP F 1 55  ? -27.039 -33.884 -10.048 1.00 105.04 ? 703  ASP B CG    1 
ATOM   8897  O  OD1   . ASP F 1 55  ? -27.810 -34.857 -9.886  1.00 98.83  ? 703  ASP B OD1   1 
ATOM   8898  O  OD2   . ASP F 1 55  ? -25.828 -33.924 -9.734  1.00 106.33 ? 703  ASP B OD2   1 
ATOM   8899  N  N     . ASP F 1 56  ? -25.101 -33.067 -12.764 1.00 108.67 ? 704  ASP B N     1 
ATOM   8900  C  CA    . ASP F 1 56  ? -24.563 -33.550 -14.037 1.00 106.50 ? 704  ASP B CA    1 
ATOM   8901  C  C     . ASP F 1 56  ? -25.069 -34.941 -14.451 1.00 105.14 ? 704  ASP B C     1 
ATOM   8902  O  O     . ASP F 1 56  ? -25.446 -35.765 -13.610 1.00 102.57 ? 704  ASP B O     1 
ATOM   8903  C  CB    . ASP F 1 56  ? -23.030 -33.530 -14.009 1.00 101.43 ? 704  ASP B CB    1 
ATOM   8904  N  N     . ASP F 1 57  ? -25.073 -35.184 -15.760 1.00 103.33 ? 705  ASP B N     1 
ATOM   8905  C  CA    . ASP F 1 57  ? -25.426 -36.489 -16.315 1.00 100.47 ? 705  ASP B CA    1 
ATOM   8906  C  C     . ASP F 1 57  ? -24.329 -37.516 -16.048 1.00 102.01 ? 705  ASP B C     1 
ATOM   8907  O  O     . ASP F 1 57  ? -23.239 -37.176 -15.584 1.00 103.69 ? 705  ASP B O     1 
ATOM   8908  C  CB    . ASP F 1 57  ? -25.658 -36.384 -17.829 1.00 95.44  ? 705  ASP B CB    1 
ATOM   8909  C  CG    . ASP F 1 57  ? -27.128 -36.483 -18.207 1.00 79.10  ? 705  ASP B CG    1 
ATOM   8910  O  OD1   . ASP F 1 57  ? -27.433 -36.513 -19.423 1.00 71.07  ? 705  ASP B OD1   1 
ATOM   8911  O  OD2   . ASP F 1 57  ? -27.975 -36.534 -17.285 1.00 75.09  ? 705  ASP B OD2   1 
ATOM   8912  N  N     . GLU F 1 58  ? -24.632 -38.774 -16.353 1.00 102.20 ? 706  GLU B N     1 
ATOM   8913  C  CA    . GLU F 1 58  ? -23.655 -39.854 -16.274 1.00 108.15 ? 706  GLU B CA    1 
ATOM   8914  C  C     . GLU F 1 58  ? -23.438 -40.459 -17.665 1.00 111.59 ? 706  GLU B C     1 
ATOM   8915  O  O     . GLU F 1 58  ? -24.340 -40.442 -18.506 1.00 107.87 ? 706  GLU B O     1 
ATOM   8916  C  CB    . GLU F 1 58  ? -24.111 -40.928 -15.285 1.00 104.07 ? 706  GLU B CB    1 
ATOM   8917  N  N     . GLU F 1 59  ? -22.238 -40.984 -17.905 1.00 112.23 ? 707  GLU B N     1 
ATOM   8918  C  CA    . GLU F 1 59  ? -21.899 -41.587 -19.196 1.00 110.57 ? 707  GLU B CA    1 
ATOM   8919  C  C     . GLU F 1 59  ? -22.396 -43.031 -19.290 1.00 112.79 ? 707  GLU B C     1 
ATOM   8920  O  O     . GLU F 1 59  ? -22.090 -43.744 -20.256 1.00 109.30 ? 707  GLU B O     1 
ATOM   8921  C  CB    . GLU F 1 59  ? -20.391 -41.537 -19.434 1.00 105.85 ? 707  GLU B CB    1 
ATOM   8922  N  N     . ALA F 1 60  ? -23.167 -43.451 -18.287 1.00 112.40 ? 708  ALA B N     1 
ATOM   8923  C  CA    . ALA F 1 60  ? -23.638 -44.832 -18.183 1.00 108.82 ? 708  ALA B CA    1 
ATOM   8924  C  C     . ALA F 1 60  ? -24.797 -45.141 -19.129 1.00 103.55 ? 708  ALA B C     1 
ATOM   8925  O  O     . ALA F 1 60  ? -25.876 -44.557 -19.018 1.00 101.73 ? 708  ALA B O     1 
ATOM   8926  C  CB    . ALA F 1 60  ? -24.022 -45.153 -16.741 1.00 107.30 ? 708  ALA B CB    1 
ATOM   8927  N  N     . ASP F 1 61  ? -24.558 -46.068 -20.052 1.00 101.70 ? 709  ASP B N     1 
ATOM   8928  C  CA    . ASP F 1 61  ? -25.566 -46.500 -21.015 1.00 100.05 ? 709  ASP B CA    1 
ATOM   8929  C  C     . ASP F 1 61  ? -25.335 -47.964 -21.367 1.00 102.68 ? 709  ASP B C     1 
ATOM   8930  O  O     . ASP F 1 61  ? -24.284 -48.522 -21.050 1.00 105.54 ? 709  ASP B O     1 
ATOM   8931  C  CB    . ASP F 1 61  ? -25.500 -45.643 -22.283 1.00 96.23  ? 709  ASP B CB    1 
ATOM   8932  C  CG    . ASP F 1 61  ? -26.695 -44.710 -22.428 1.00 84.65  ? 709  ASP B CG    1 
ATOM   8933  O  OD1   . ASP F 1 61  ? -26.698 -43.639 -21.780 1.00 82.97  ? 709  ASP B OD1   1 
ATOM   8934  O  OD2   . ASP F 1 61  ? -27.623 -45.042 -23.199 1.00 80.19  ? 709  ASP B OD2   1 
ATOM   8935  N  N     . ASP F 1 62  ? -26.312 -48.586 -22.023 1.00 102.87 ? 710  ASP B N     1 
ATOM   8936  C  CA    . ASP F 1 62  ? -26.194 -49.993 -22.415 1.00 105.71 ? 710  ASP B CA    1 
ATOM   8937  C  C     . ASP F 1 62  ? -25.689 -50.117 -23.852 1.00 103.63 ? 710  ASP B C     1 
ATOM   8938  O  O     . ASP F 1 62  ? -25.629 -49.117 -24.581 1.00 98.94  ? 710  ASP B O     1 
ATOM   8939  C  CB    . ASP F 1 62  ? -27.539 -50.710 -22.267 1.00 106.07 ? 710  ASP B CB    1 
ATOM   8940  C  CG    . ASP F 1 62  ? -27.389 -52.140 -21.769 1.00 104.28 ? 710  ASP B CG    1 
ATOM   8941  O  OD1   . ASP F 1 62  ? -27.383 -52.333 -20.532 1.00 101.29 ? 710  ASP B OD1   1 
ATOM   8942  O  OD2   . ASP F 1 62  ? -27.278 -53.068 -22.608 1.00 102.47 ? 710  ASP B OD2   1 
ATOM   8943  N  N     . ASP F 1 63  ? -25.325 -51.336 -24.251 1.00 104.13 ? 711  ASP B N     1 
ATOM   8944  C  CA    . ASP F 1 63  ? -24.928 -51.606 -25.627 1.00 103.00 ? 711  ASP B CA    1 
ATOM   8945  C  C     . ASP F 1 63  ? -26.013 -51.103 -26.573 1.00 102.23 ? 711  ASP B C     1 
ATOM   8946  O  O     . ASP F 1 63  ? -25.719 -50.579 -27.651 1.00 100.19 ? 711  ASP B O     1 
ATOM   8947  C  CB    . ASP F 1 63  ? -24.681 -53.111 -25.839 1.00 95.27  ? 711  ASP B CB    1 
ATOM   8948  N  N     . VAL F 1 64  ? -27.267 -51.255 -26.148 1.00 98.84  ? 712  VAL B N     1 
ATOM   8949  C  CA    . VAL F 1 64  ? -28.427 -50.858 -26.947 1.00 93.69  ? 712  VAL B CA    1 
ATOM   8950  C  C     . VAL F 1 64  ? -28.506 -51.641 -28.258 1.00 91.02  ? 712  VAL B C     1 
ATOM   8951  O  O     . VAL F 1 64  ? -29.325 -51.337 -29.126 1.00 85.20  ? 712  VAL B O     1 
ATOM   8952  C  CB    . VAL F 1 64  ? -28.448 -49.342 -27.234 1.00 90.34  ? 712  VAL B CB    1 
ATOM   8953  N  N     . SER F 1 65  ? -27.641 -52.645 -28.393 1.00 92.31  ? 713  SER B N     1 
ATOM   8954  C  CA    . SER F 1 65  ? -27.743 -53.617 -29.475 1.00 92.16  ? 713  SER B CA    1 
ATOM   8955  C  C     . SER F 1 65  ? -28.935 -54.529 -29.184 1.00 91.05  ? 713  SER B C     1 
ATOM   8956  O  O     . SER F 1 65  ? -28.784 -55.746 -29.066 1.00 87.36  ? 713  SER B O     1 
ATOM   8957  C  CB    . SER F 1 65  ? -26.460 -54.442 -29.575 1.00 90.80  ? 713  SER B CB    1 
ATOM   8958  N  N     . GLU F 1 66  ? -30.117 -53.919 -29.080 1.00 90.86  ? 714  GLU B N     1 
ATOM   8959  C  CA    . GLU F 1 66  ? -31.322 -54.575 -28.580 1.00 84.31  ? 714  GLU B CA    1 
ATOM   8960  C  C     . GLU F 1 66  ? -32.407 -54.666 -29.658 1.00 82.40  ? 714  GLU B C     1 
ATOM   8961  O  O     . GLU F 1 66  ? -32.811 -53.656 -30.230 1.00 78.95  ? 714  GLU B O     1 
ATOM   8962  C  CB    . GLU F 1 66  ? -31.858 -53.782 -27.386 1.00 77.74  ? 714  GLU B CB    1 
ATOM   8963  C  CG    . GLU F 1 66  ? -32.458 -54.612 -26.284 1.00 74.73  ? 714  GLU B CG    1 
ATOM   8964  C  CD    . GLU F 1 66  ? -33.719 -53.989 -25.731 1.00 71.73  ? 714  GLU B CD    1 
ATOM   8965  O  OE1   . GLU F 1 66  ? -34.809 -54.283 -26.270 1.00 71.34  ? 714  GLU B OE1   1 
ATOM   8966  O  OE2   . GLU F 1 66  ? -33.622 -53.203 -24.765 1.00 66.04  ? 714  GLU B OE2   1 
ATOM   8967  N  N     . MET F 1 67  ? -32.880 -55.878 -29.930 1.00 84.00  ? 715  MET B N     1 
ATOM   8968  C  CA    . MET F 1 67  ? -33.952 -56.080 -30.902 1.00 85.19  ? 715  MET B CA    1 
ATOM   8969  C  C     . MET F 1 67  ? -35.103 -55.106 -30.640 1.00 88.55  ? 715  MET B C     1 
ATOM   8970  O  O     . MET F 1 67  ? -35.556 -54.975 -29.500 1.00 83.68  ? 715  MET B O     1 
ATOM   8971  C  CB    . MET F 1 67  ? -34.457 -57.520 -30.838 1.00 85.54  ? 715  MET B CB    1 
ATOM   8972  N  N     . PRO F 1 68  ? -35.582 -54.417 -31.695 1.00 93.82  ? 716  PRO B N     1 
ATOM   8973  C  CA    . PRO F 1 68  ? -36.699 -53.475 -31.521 1.00 89.21  ? 716  PRO B CA    1 
ATOM   8974  C  C     . PRO F 1 68  ? -37.971 -54.216 -31.144 1.00 90.57  ? 716  PRO B C     1 
ATOM   8975  O  O     . PRO F 1 68  ? -38.269 -55.254 -31.737 1.00 91.10  ? 716  PRO B O     1 
ATOM   8976  C  CB    . PRO F 1 68  ? -36.858 -52.854 -32.912 1.00 89.27  ? 716  PRO B CB    1 
ATOM   8977  C  CG    . PRO F 1 68  ? -36.334 -53.893 -33.849 1.00 92.10  ? 716  PRO B CG    1 
ATOM   8978  C  CD    . PRO F 1 68  ? -35.181 -54.541 -33.110 1.00 92.54  ? 716  PRO B CD    1 
ATOM   8979  N  N     . SER F 1 69  ? -38.714 -53.701 -30.173 1.00 87.72  ? 717  SER B N     1 
ATOM   8980  C  CA    . SER F 1 69  ? -39.933 -54.380 -29.756 1.00 93.68  ? 717  SER B CA    1 
ATOM   8981  C  C     . SER F 1 69  ? -40.698 -54.896 -30.983 1.00 94.34  ? 717  SER B C     1 
ATOM   8982  O  O     . SER F 1 69  ? -40.666 -54.272 -32.052 1.00 93.09  ? 717  SER B O     1 
ATOM   8983  C  CB    . SER F 1 69  ? -40.806 -53.460 -28.899 1.00 85.99  ? 717  SER B CB    1 
ATOM   8984  N  N     . PRO F 1 70  ? -41.362 -56.057 -30.842 1.00 94.74  ? 718  PRO B N     1 
ATOM   8985  C  CA    . PRO F 1 70  ? -42.180 -56.620 -31.917 1.00 93.38  ? 718  PRO B CA    1 
ATOM   8986  C  C     . PRO F 1 70  ? -43.657 -56.290 -31.717 1.00 89.63  ? 718  PRO B C     1 
ATOM   8987  O  O     . PRO F 1 70  ? -44.064 -55.917 -30.613 1.00 86.07  ? 718  PRO B O     1 
ATOM   8988  C  CB    . PRO F 1 70  ? -41.959 -58.127 -31.754 1.00 92.62  ? 718  PRO B CB    1 
ATOM   8989  C  CG    . PRO F 1 70  ? -41.643 -58.315 -30.266 1.00 94.31  ? 718  PRO B CG    1 
ATOM   8990  C  CD    . PRO F 1 70  ? -41.347 -56.944 -29.666 1.00 94.73  ? 718  PRO B CD    1 
ATOM   8991  N  N     . LYS F 1 71  ? -44.444 -56.430 -32.778 1.00 89.51  ? 719  LYS B N     1 
ATOM   8992  C  CA    . LYS F 1 71  ? -45.877 -56.170 -32.724 1.00 89.98  ? 719  LYS B CA    1 
ATOM   8993  C  C     . LYS F 1 71  ? -46.488 -56.652 -31.402 1.00 90.19  ? 719  LYS B C     1 
ATOM   8994  O  O     . LYS F 1 71  ? -46.173 -57.739 -30.921 1.00 91.84  ? 719  LYS B O     1 
ATOM   8995  C  CB    . LYS F 1 71  ? -46.572 -56.818 -33.923 1.00 91.39  ? 719  LYS B CB    1 
ATOM   8996  C  CG    . LYS F 1 71  ? -46.038 -56.334 -35.273 1.00 91.09  ? 719  LYS B CG    1 
ATOM   8997  C  CD    . LYS F 1 71  ? -46.396 -54.871 -35.508 1.00 90.94  ? 719  LYS B CD    1 
ATOM   8998  C  CE    . LYS F 1 71  ? -45.443 -54.192 -36.486 1.00 90.34  ? 719  LYS B CE    1 
ATOM   8999  N  NZ    . LYS F 1 71  ? -45.840 -52.773 -36.762 1.00 80.13  ? 719  LYS B NZ    1 
ATOM   9000  N  N     . LYS F 1 72  ? -47.354 -55.827 -30.817 1.00 87.14  ? 720  LYS B N     1 
ATOM   9001  C  CA    . LYS F 1 72  ? -47.864 -56.062 -29.467 1.00 85.76  ? 720  LYS B CA    1 
ATOM   9002  C  C     . LYS F 1 72  ? -48.792 -57.265 -29.378 1.00 88.39  ? 720  LYS B C     1 
ATOM   9003  O  O     . LYS F 1 72  ? -48.900 -57.893 -28.324 1.00 93.09  ? 720  LYS B O     1 
ATOM   9004  C  CB    . LYS F 1 72  ? -48.571 -54.818 -28.931 1.00 82.86  ? 720  LYS B CB    1 
ATOM   9005  N  N     . LEU F 1 73  ? -49.466 -57.585 -30.477 1.00 88.55  ? 721  LEU B N     1 
ATOM   9006  C  CA    . LEU F 1 73  ? -50.426 -58.685 -30.470 1.00 90.91  ? 721  LEU B CA    1 
ATOM   9007  C  C     . LEU F 1 73  ? -50.092 -59.745 -31.527 1.00 97.54  ? 721  LEU B C     1 
ATOM   9008  O  O     . LEU F 1 73  ? -50.893 -60.643 -31.787 1.00 96.73  ? 721  LEU B O     1 
ATOM   9009  C  CB    . LEU F 1 73  ? -51.859 -58.154 -30.645 1.00 87.22  ? 721  LEU B CB    1 
ATOM   9010  C  CG    . LEU F 1 73  ? -52.291 -56.988 -29.736 1.00 84.65  ? 721  LEU B CG    1 
ATOM   9011  C  CD1   . LEU F 1 73  ? -52.206 -55.652 -30.466 1.00 77.16  ? 721  LEU B CD1   1 
ATOM   9012  C  CD2   . LEU F 1 73  ? -53.692 -57.188 -29.171 1.00 77.24  ? 721  LEU B CD2   1 
ATOM   9013  N  N     . HIS F 1 74  ? -48.902 -59.638 -32.121 1.00 100.25 ? 722  HIS B N     1 
ATOM   9014  C  CA    . HIS F 1 74  ? -48.463 -60.564 -33.167 1.00 100.79 ? 722  HIS B CA    1 
ATOM   9015  C  C     . HIS F 1 74  ? -48.068 -61.926 -32.616 1.00 103.92 ? 722  HIS B C     1 
ATOM   9016  O  O     . HIS F 1 74  ? -48.373 -62.953 -33.231 1.00 106.18 ? 722  HIS B O     1 
ATOM   9017  C  CB    . HIS F 1 74  ? -47.292 -59.985 -33.970 1.00 103.22 ? 722  HIS B CB    1 
ATOM   9018  C  CG    . HIS F 1 74  ? -46.642 -60.974 -34.892 1.00 109.04 ? 722  HIS B CG    1 
ATOM   9019  N  ND1   . HIS F 1 74  ? -46.662 -60.836 -36.266 1.00 110.46 ? 722  HIS B ND1   1 
ATOM   9020  C  CD2   . HIS F 1 74  ? -45.955 -62.113 -34.640 1.00 108.40 ? 722  HIS B CD2   1 
ATOM   9021  C  CE1   . HIS F 1 74  ? -46.018 -61.849 -36.816 1.00 112.71 ? 722  HIS B CE1   1 
ATOM   9022  N  NE2   . HIS F 1 74  ? -45.579 -62.641 -35.853 1.00 109.70 ? 722  HIS B NE2   1 
ATOM   9023  N  N     . GLN F 1 75  ? -47.369 -61.935 -31.479 1.00 104.47 ? 723  GLN B N     1 
ATOM   9024  C  CA    . GLN F 1 75  ? -47.010 -63.192 -30.822 1.00 107.24 ? 723  GLN B CA    1 
ATOM   9025  C  C     . GLN F 1 75  ? -48.183 -64.148 -30.993 1.00 108.42 ? 723  GLN B C     1 
ATOM   9026  O  O     . GLN F 1 75  ? -48.019 -65.291 -31.439 1.00 104.15 ? 723  GLN B O     1 
ATOM   9027  C  CB    . GLN F 1 75  ? -46.703 -62.977 -29.332 1.00 104.38 ? 723  GLN B CB    1 
ATOM   9028  C  CG    . GLN F 1 75  ? -45.215 -62.829 -28.999 1.00 103.96 ? 723  GLN B CG    1 
ATOM   9029  C  CD    . GLN F 1 75  ? -44.676 -63.973 -28.144 1.00 100.64 ? 723  GLN B CD    1 
ATOM   9030  O  OE1   . GLN F 1 75  ? -44.983 -65.141 -28.385 1.00 98.51  ? 723  GLN B OE1   1 
ATOM   9031  N  NE2   . GLN F 1 75  ? -43.870 -63.637 -27.138 1.00 95.80  ? 723  GLN B NE2   1 
ATOM   9032  N  N     . GLY F 1 76  ? -49.372 -63.652 -30.656 1.00 105.87 ? 724  GLY B N     1 
ATOM   9033  C  CA    . GLY F 1 76  ? -50.601 -64.386 -30.872 1.00 100.70 ? 724  GLY B CA    1 
ATOM   9034  C  C     . GLY F 1 76  ? -50.793 -65.515 -29.884 1.00 100.71 ? 724  GLY B C     1 
ATOM   9035  O  O     . GLY F 1 76  ? -50.881 -65.293 -28.673 1.00 97.11  ? 724  GLY B O     1 
ATOM   9036  N  N     . LYS F 1 77  ? -50.847 -66.736 -30.406 1.00 99.80  ? 725  LYS B N     1 
ATOM   9037  C  CA    . LYS F 1 77  ? -51.196 -67.889 -29.591 1.00 95.75  ? 725  LYS B CA    1 
ATOM   9038  C  C     . LYS F 1 77  ? -52.560 -67.635 -28.956 1.00 94.51  ? 725  LYS B C     1 
ATOM   9039  O  O     . LYS F 1 77  ? -52.903 -68.212 -27.929 1.00 95.22  ? 725  LYS B O     1 
ATOM   9040  C  CB    . LYS F 1 77  ? -50.132 -68.154 -28.531 1.00 91.75  ? 725  LYS B CB    1 
ATOM   9041  N  N     . LYS F 1 78  ? -53.332 -66.752 -29.583 1.00 93.45  ? 726  LYS B N     1 
ATOM   9042  C  CA    . LYS F 1 78  ? -54.706 -66.492 -29.174 1.00 90.70  ? 726  LYS B CA    1 
ATOM   9043  C  C     . LYS F 1 78  ? -55.498 -67.790 -29.253 1.00 89.53  ? 726  LYS B C     1 
ATOM   9044  O  O     . LYS F 1 78  ? -55.519 -68.449 -30.294 1.00 87.62  ? 726  LYS B O     1 
ATOM   9045  C  CB    . LYS F 1 78  ? -55.337 -65.435 -30.076 1.00 88.67  ? 726  LYS B CB    1 
ATOM   9046  N  N     . LYS F 1 79  ? -56.147 -68.154 -28.151 1.00 88.71  ? 727  LYS B N     1 
ATOM   9047  C  CA    . LYS F 1 79  ? -56.870 -69.418 -28.084 1.00 89.16  ? 727  LYS B CA    1 
ATOM   9048  C  C     . LYS F 1 79  ? -58.284 -69.329 -28.663 1.00 90.94  ? 727  LYS B C     1 
ATOM   9049  O  O     . LYS F 1 79  ? -59.088 -68.477 -28.265 1.00 86.58  ? 727  LYS B O     1 
ATOM   9050  C  CB    . LYS F 1 79  ? -56.895 -69.960 -26.650 1.00 88.94  ? 727  LYS B CB    1 
ATOM   9051  C  CG    . LYS F 1 79  ? -57.918 -69.316 -25.727 1.00 88.53  ? 727  LYS B CG    1 
ATOM   9052  C  CD    . LYS F 1 79  ? -58.027 -70.110 -24.429 1.00 91.87  ? 727  LYS B CD    1 
ATOM   9053  C  CE    . LYS F 1 79  ? -59.097 -69.553 -23.499 1.00 90.32  ? 727  LYS B CE    1 
ATOM   9054  N  NZ    . LYS F 1 79  ? -58.961 -70.091 -22.111 1.00 89.05  ? 727  LYS B NZ    1 
ATOM   9055  N  N     . LYS F 1 80  ? -58.570 -70.215 -29.615 1.00 93.59  ? 728  LYS B N     1 
ATOM   9056  C  CA    . LYS F 1 80  ? -59.898 -70.306 -30.214 1.00 90.54  ? 728  LYS B CA    1 
ATOM   9057  C  C     . LYS F 1 80  ? -60.935 -70.755 -29.188 1.00 87.12  ? 728  LYS B C     1 
ATOM   9058  O  O     . LYS F 1 80  ? -60.624 -71.484 -28.247 1.00 85.80  ? 728  LYS B O     1 
ATOM   9059  C  CB    . LYS F 1 80  ? -59.896 -71.250 -31.424 1.00 89.42  ? 728  LYS B CB    1 
ATOM   9060  C  CG    . LYS F 1 80  ? -61.288 -71.671 -31.877 1.00 89.07  ? 728  LYS B CG    1 
ATOM   9061  C  CD    . LYS F 1 80  ? -61.269 -72.418 -33.206 1.00 88.73  ? 728  LYS B CD    1 
ATOM   9062  C  CE    . LYS F 1 80  ? -62.649 -73.004 -33.513 1.00 87.59  ? 728  LYS B CE    1 
ATOM   9063  N  NZ    . LYS F 1 80  ? -62.777 -73.515 -34.908 1.00 83.27  ? 728  LYS B NZ    1 
ATOM   9064  N  N     . GLN F 1 81  ? -62.165 -70.299 -29.383 1.00 86.73  ? 729  GLN B N     1 
ATOM   9065  C  CA    . GLN F 1 81  ? -63.266 -70.616 -28.493 1.00 88.38  ? 729  GLN B CA    1 
ATOM   9066  C  C     . GLN F 1 81  ? -64.264 -71.530 -29.191 1.00 90.35  ? 729  GLN B C     1 
ATOM   9067  O  O     . GLN F 1 81  ? -64.589 -71.329 -30.362 1.00 91.33  ? 729  GLN B O     1 
ATOM   9068  C  CB    . GLN F 1 81  ? -63.972 -69.329 -28.065 1.00 85.00  ? 729  GLN B CB    1 
ATOM   9069  C  CG    . GLN F 1 81  ? -63.236 -68.534 -27.023 1.00 78.03  ? 729  GLN B CG    1 
ATOM   9070  C  CD    . GLN F 1 81  ? -63.565 -69.000 -25.629 1.00 82.67  ? 729  GLN B CD    1 
ATOM   9071  O  OE1   . GLN F 1 81  ? -63.165 -68.380 -24.648 1.00 86.01  ? 729  GLN B OE1   1 
ATOM   9072  N  NE2   . GLN F 1 81  ? -64.311 -70.098 -25.529 1.00 85.39  ? 729  GLN B NE2   1 
ATOM   9073  N  N     . ASN F 1 82  ? -64.749 -72.536 -28.471 1.00 92.92  ? 730  ASN B N     1 
ATOM   9074  C  CA    . ASN F 1 82  ? -65.843 -73.359 -28.973 1.00 95.34  ? 730  ASN B CA    1 
ATOM   9075  C  C     . ASN F 1 82  ? -67.171 -72.635 -28.756 1.00 95.61  ? 730  ASN B C     1 
ATOM   9076  O  O     . ASN F 1 82  ? -67.550 -72.337 -27.619 1.00 92.98  ? 730  ASN B O     1 
ATOM   9077  C  CB    . ASN F 1 82  ? -65.857 -74.736 -28.302 1.00 89.43  ? 730  ASN B CB    1 
ATOM   9078  N  N     . LYS F 1 83  ? -67.863 -72.340 -29.854 1.00 94.39  ? 731  LYS B N     1 
ATOM   9079  C  CA    . LYS F 1 83  ? -69.157 -71.667 -29.797 1.00 94.54  ? 731  LYS B CA    1 
ATOM   9080  C  C     . LYS F 1 83  ? -70.266 -72.581 -30.316 1.00 96.12  ? 731  LYS B C     1 
ATOM   9081  O  O     . LYS F 1 83  ? -70.032 -73.417 -31.193 1.00 96.81  ? 731  LYS B O     1 
ATOM   9082  C  CB    . LYS F 1 83  ? -69.123 -70.368 -30.598 1.00 91.47  ? 731  LYS B CB    1 
ATOM   9083  N  N     . ASP F 1 84  ? -71.470 -72.416 -29.773 1.00 95.84  ? 732  ASP B N     1 
ATOM   9084  C  CA    . ASP F 1 84  ? -72.614 -73.254 -30.139 1.00 94.68  ? 732  ASP B CA    1 
ATOM   9085  C  C     . ASP F 1 84  ? -73.108 -73.035 -31.576 1.00 92.48  ? 732  ASP B C     1 
ATOM   9086  O  O     . ASP F 1 84  ? -72.991 -73.928 -32.420 1.00 90.71  ? 732  ASP B O     1 
ATOM   9087  C  CB    . ASP F 1 84  ? -73.762 -73.064 -29.138 1.00 94.33  ? 732  ASP B CB    1 
ATOM   9088  C  CG    . ASP F 1 84  ? -73.461 -73.677 -27.778 1.00 96.80  ? 732  ASP B CG    1 
ATOM   9089  O  OD1   . ASP F 1 84  ? -72.828 -74.756 -27.735 1.00 92.39  ? 732  ASP B OD1   1 
ATOM   9090  O  OD2   . ASP F 1 84  ? -73.859 -73.081 -26.753 1.00 99.52  ? 732  ASP B OD2   1 
ATOM   9091  N  N     . ARG F 1 85  ? -73.664 -71.857 -31.849 1.00 88.35  ? 733  ARG B N     1 
ATOM   9092  C  CA    . ARG F 1 85  ? -74.205 -71.560 -33.172 1.00 84.41  ? 733  ARG B CA    1 
ATOM   9093  C  C     . ARG F 1 85  ? -73.674 -70.241 -33.723 1.00 81.40  ? 733  ARG B C     1 
ATOM   9094  O  O     . ARG F 1 85  ? -73.753 -69.206 -33.063 1.00 80.80  ? 733  ARG B O     1 
ATOM   9095  C  CB    . ARG F 1 85  ? -75.737 -71.541 -33.140 1.00 80.83  ? 733  ARG B CB    1 
ATOM   9096  N  N     . ILE F 1 86  ? -73.131 -70.292 -34.938 1.00 80.39  ? 734  ILE B N     1 
ATOM   9097  C  CA    . ILE F 1 86  ? -72.630 -69.105 -35.625 1.00 76.96  ? 734  ILE B CA    1 
ATOM   9098  C  C     . ILE F 1 86  ? -73.391 -68.902 -36.926 1.00 74.56  ? 734  ILE B C     1 
ATOM   9099  O  O     . ILE F 1 86  ? -73.049 -69.489 -37.949 1.00 75.23  ? 734  ILE B O     1 
ATOM   9100  C  CB    . ILE F 1 86  ? -71.125 -69.227 -35.964 1.00 76.59  ? 734  ILE B CB    1 
ATOM   9101  C  CG1   . ILE F 1 86  ? -70.309 -69.575 -34.718 1.00 78.40  ? 734  ILE B CG1   1 
ATOM   9102  C  CG2   . ILE F 1 86  ? -70.610 -67.943 -36.595 1.00 73.00  ? 734  ILE B CG2   1 
ATOM   9103  C  CD1   . ILE F 1 86  ? -70.417 -68.551 -33.610 1.00 78.96  ? 734  ILE B CD1   1 
ATOM   9104  N  N     . SER F 1 87  ? -74.423 -68.070 -36.888 1.00 72.94  ? 735  SER B N     1 
ATOM   9105  C  CA    . SER F 1 87  ? -75.244 -67.832 -38.068 1.00 71.37  ? 735  SER B CA    1 
ATOM   9106  C  C     . SER F 1 87  ? -75.109 -66.396 -38.566 1.00 72.28  ? 735  SER B C     1 
ATOM   9107  O  O     . SER F 1 87  ? -75.198 -65.458 -37.777 1.00 70.96  ? 735  SER B O     1 
ATOM   9108  C  CB    . SER F 1 87  ? -76.707 -68.138 -37.756 1.00 67.89  ? 735  SER B CB    1 
ATOM   9109  N  N     . TRP F 1 88  ? -74.888 -66.222 -39.868 1.00 71.77  ? 736  TRP B N     1 
ATOM   9110  C  CA    . TRP F 1 88  ? -74.938 -64.885 -40.462 1.00 72.76  ? 736  TRP B CA    1 
ATOM   9111  C  C     . TRP F 1 88  ? -76.347 -64.318 -40.282 1.00 73.14  ? 736  TRP B C     1 
ATOM   9112  O  O     . TRP F 1 88  ? -77.291 -65.067 -40.056 1.00 76.99  ? 736  TRP B O     1 
ATOM   9113  C  CB    . TRP F 1 88  ? -74.608 -64.922 -41.959 1.00 75.24  ? 736  TRP B CB    1 
ATOM   9114  C  CG    . TRP F 1 88  ? -73.249 -65.453 -42.318 1.00 76.84  ? 736  TRP B CG    1 
ATOM   9115  C  CD1   . TRP F 1 88  ? -72.976 -66.603 -43.000 1.00 77.17  ? 736  TRP B CD1   1 
ATOM   9116  C  CD2   . TRP F 1 88  ? -71.982 -64.848 -42.033 1.00 79.58  ? 736  TRP B CD2   1 
ATOM   9117  N  NE1   . TRP F 1 88  ? -71.621 -66.756 -43.150 1.00 76.56  ? 736  TRP B NE1   1 
ATOM   9118  C  CE2   . TRP F 1 88  ? -70.986 -65.692 -42.564 1.00 78.18  ? 736  TRP B CE2   1 
ATOM   9119  C  CE3   . TRP F 1 88  ? -71.590 -63.676 -41.375 1.00 77.98  ? 736  TRP B CE3   1 
ATOM   9120  C  CZ2   . TRP F 1 88  ? -69.627 -65.405 -42.460 1.00 78.40  ? 736  TRP B CZ2   1 
ATOM   9121  C  CZ3   . TRP F 1 88  ? -70.239 -63.394 -41.271 1.00 76.36  ? 736  TRP B CZ3   1 
ATOM   9122  C  CH2   . TRP F 1 88  ? -69.275 -64.253 -41.811 1.00 77.44  ? 736  TRP B CH2   1 
ATOM   9123  N  N     . LEU F 1 89  ? -76.492 -63.001 -40.382 1.00 71.71  ? 737  LEU B N     1 
ATOM   9124  C  CA    . LEU F 1 89  ? -77.816 -62.379 -40.363 1.00 70.96  ? 737  LEU B CA    1 
ATOM   9125  C  C     . LEU F 1 89  ? -77.989 -61.445 -41.554 1.00 74.92  ? 737  LEU B C     1 
ATOM   9126  O  O     . LEU F 1 89  ? -77.019 -60.878 -42.059 1.00 79.35  ? 737  LEU B O     1 
ATOM   9127  C  CB    . LEU F 1 89  ? -78.060 -61.612 -39.058 1.00 70.63  ? 737  LEU B CB    1 
ATOM   9128  C  CG    . LEU F 1 89  ? -78.413 -62.392 -37.789 1.00 68.83  ? 737  LEU B CG    1 
ATOM   9129  C  CD1   . LEU F 1 89  ? -77.228 -63.181 -37.289 1.00 71.62  ? 737  LEU B CD1   1 
ATOM   9130  C  CD2   . LEU F 1 89  ? -78.894 -61.446 -36.708 1.00 72.52  ? 737  LEU B CD2   1 
ATOM   9131  N  N     . GLY F 1 90  ? -79.229 -61.288 -42.002 1.00 76.69  ? 738  GLY B N     1 
ATOM   9132  C  CA    . GLY F 1 90  ? -79.527 -60.406 -43.117 1.00 79.41  ? 738  GLY B CA    1 
ATOM   9133  C  C     . GLY F 1 90  ? -78.881 -60.838 -44.420 1.00 82.31  ? 738  GLY B C     1 
ATOM   9134  O  O     . GLY F 1 90  ? -78.208 -61.865 -44.486 1.00 80.85  ? 738  GLY B O     1 
ATOM   9135  N  N     . GLN F 1 91  ? -79.095 -60.046 -45.464 1.00 87.57  ? 739  GLN B N     1 
ATOM   9136  C  CA    . GLN F 1 91  ? -78.525 -60.330 -46.774 1.00 87.57  ? 739  GLN B CA    1 
ATOM   9137  C  C     . GLN F 1 91  ? -77.018 -60.118 -46.753 1.00 86.40  ? 739  GLN B C     1 
ATOM   9138  O  O     . GLN F 1 91  ? -76.478 -59.584 -45.784 1.00 85.76  ? 739  GLN B O     1 
ATOM   9139  C  CB    . GLN F 1 91  ? -79.161 -59.429 -47.834 1.00 92.10  ? 739  GLN B CB    1 
ATOM   9140  C  CG    . GLN F 1 91  ? -80.579 -59.824 -48.223 1.00 98.50  ? 739  GLN B CG    1 
ATOM   9141  C  CD    . GLN F 1 91  ? -81.181 -58.891 -49.266 1.00 107.88 ? 739  GLN B CD    1 
ATOM   9142  O  OE1   . GLN F 1 91  ? -80.927 -57.685 -49.259 1.00 105.72 ? 739  GLN B OE1   1 
ATOM   9143  N  NE2   . GLN F 1 91  ? -81.979 -59.451 -50.173 1.00 110.34 ? 739  GLN B NE2   1 
ATOM   9144  N  N     . PRO F 1 92  ? -76.329 -60.559 -47.819 1.00 88.67  ? 740  PRO B N     1 
ATOM   9145  C  CA    . PRO F 1 92  ? -74.901 -60.265 -47.977 1.00 87.65  ? 740  PRO B CA    1 
ATOM   9146  C  C     . PRO F 1 92  ? -74.710 -58.811 -48.387 1.00 84.69  ? 740  PRO B C     1 
ATOM   9147  O  O     . PRO F 1 92  ? -75.553 -58.285 -49.109 1.00 86.86  ? 740  PRO B O     1 
ATOM   9148  C  CB    . PRO F 1 92  ? -74.474 -61.192 -49.128 1.00 89.11  ? 740  PRO B CB    1 
ATOM   9149  C  CG    . PRO F 1 92  ? -75.559 -62.229 -49.235 1.00 85.55  ? 740  PRO B CG    1 
ATOM   9150  C  CD    . PRO F 1 92  ? -76.810 -61.505 -48.840 1.00 90.15  ? 740  PRO B CD    1 
ATOM   9151  N  N     . MET F 1 93  ? -73.640 -58.168 -47.932 1.00 84.20  ? 741  MET B N     1 
ATOM   9152  C  CA    . MET F 1 93  ? -73.353 -56.802 -48.355 1.00 83.86  ? 741  MET B CA    1 
ATOM   9153  C  C     . MET F 1 93  ? -72.688 -56.807 -49.720 1.00 84.22  ? 741  MET B C     1 
ATOM   9154  O  O     . MET F 1 93  ? -73.096 -56.079 -50.623 1.00 81.94  ? 741  MET B O     1 
ATOM   9155  C  CB    . MET F 1 93  ? -72.464 -56.090 -47.345 1.00 82.54  ? 741  MET B CB    1 
ATOM   9156  C  CG    . MET F 1 93  ? -73.167 -55.747 -46.056 1.00 85.24  ? 741  MET B CG    1 
ATOM   9157  S  SD    . MET F 1 93  ? -72.188 -54.589 -45.093 1.00 93.84  ? 741  MET B SD    1 
ATOM   9158  C  CE    . MET F 1 93  ? -70.713 -55.558 -44.802 1.00 88.90  ? 741  MET B CE    1 
ATOM   9159  N  N     . LYS F 1 94  ? -71.657 -57.632 -49.862 1.00 84.96  ? 742  LYS B N     1 
ATOM   9160  C  CA    . LYS F 1 94  ? -71.001 -57.817 -51.149 1.00 85.29  ? 742  LYS B CA    1 
ATOM   9161  C  C     . LYS F 1 94  ? -70.509 -59.255 -51.312 1.00 86.53  ? 742  LYS B C     1 
ATOM   9162  O  O     . LYS F 1 94  ? -70.010 -59.867 -50.366 1.00 83.77  ? 742  LYS B O     1 
ATOM   9163  C  CB    . LYS F 1 94  ? -69.843 -56.828 -51.322 1.00 83.97  ? 742  LYS B CB    1 
ATOM   9164  C  CG    . LYS F 1 94  ? -69.259 -56.799 -52.730 1.00 84.86  ? 742  LYS B CG    1 
ATOM   9165  C  CD    . LYS F 1 94  ? -68.150 -55.765 -52.860 1.00 86.62  ? 742  LYS B CD    1 
ATOM   9166  C  CE    . LYS F 1 94  ? -67.663 -55.654 -54.299 1.00 90.14  ? 742  LYS B CE    1 
ATOM   9167  N  NZ    . LYS F 1 94  ? -66.562 -54.657 -54.443 1.00 89.88  ? 742  LYS B NZ    1 
ATOM   9168  N  N     . ILE F 1 95  ? -70.669 -59.794 -52.517 1.00 86.90  ? 743  ILE B N     1 
ATOM   9169  C  CA    . ILE F 1 95  ? -70.177 -61.127 -52.831 1.00 85.99  ? 743  ILE B CA    1 
ATOM   9170  C  C     . ILE F 1 95  ? -69.025 -61.019 -53.817 1.00 85.81  ? 743  ILE B C     1 
ATOM   9171  O  O     . ILE F 1 95  ? -69.220 -60.628 -54.968 1.00 86.83  ? 743  ILE B O     1 
ATOM   9172  C  CB    . ILE F 1 95  ? -71.278 -62.021 -53.440 1.00 85.46  ? 743  ILE B CB    1 
ATOM   9173  C  CG1   . ILE F 1 95  ? -72.443 -62.183 -52.460 1.00 86.08  ? 743  ILE B CG1   1 
ATOM   9174  C  CG2   . ILE F 1 95  ? -70.712 -63.383 -53.813 1.00 83.26  ? 743  ILE B CG2   1 
ATOM   9175  C  CD1   . ILE F 1 95  ? -73.522 -63.128 -52.944 1.00 80.08  ? 743  ILE B CD1   1 
ATOM   9176  N  N     . GLU F 1 96  ? -67.823 -61.353 -53.361 1.00 85.38  ? 744  GLU B N     1 
ATOM   9177  C  CA    . GLU F 1 96  ? -66.646 -61.287 -54.219 1.00 88.60  ? 744  GLU B CA    1 
ATOM   9178  C  C     . GLU F 1 96  ? -66.238 -62.672 -54.687 1.00 84.90  ? 744  GLU B C     1 
ATOM   9179  O  O     . GLU F 1 96  ? -66.779 -63.672 -54.229 1.00 85.85  ? 744  GLU B O     1 
ATOM   9180  C  CB    . GLU F 1 96  ? -65.481 -60.604 -53.500 1.00 91.29  ? 744  GLU B CB    1 
ATOM   9181  C  CG    . GLU F 1 96  ? -65.646 -59.098 -53.338 1.00 91.14  ? 744  GLU B CG    1 
ATOM   9182  C  CD    . GLU F 1 96  ? -64.492 -58.479 -52.580 1.00 95.56  ? 744  GLU B CD    1 
ATOM   9183  O  OE1   . GLU F 1 96  ? -63.516 -59.211 -52.304 1.00 96.39  ? 744  GLU B OE1   1 
ATOM   9184  O  OE2   . GLU F 1 96  ? -64.564 -57.271 -52.256 1.00 95.66  ? 744  GLU B OE2   1 
ATOM   9185  N  N     . GLU F 1 97  ? -65.277 -62.719 -55.601 1.00 84.72  ? 745  GLU B N     1 
ATOM   9186  C  CA    . GLU F 1 97  ? -64.829 -63.977 -56.188 1.00 87.06  ? 745  GLU B CA    1 
ATOM   9187  C  C     . GLU F 1 97  ? -64.575 -65.081 -55.154 1.00 86.94  ? 745  GLU B C     1 
ATOM   9188  O  O     . GLU F 1 97  ? -64.932 -66.241 -55.374 1.00 87.85  ? 745  GLU B O     1 
ATOM   9189  C  CB    . GLU F 1 97  ? -63.578 -63.754 -57.048 1.00 84.60  ? 745  GLU B CB    1 
ATOM   9190  N  N     . ASN F 1 98  ? -63.973 -64.726 -54.024 1.00 83.36  ? 746  ASN B N     1 
ATOM   9191  C  CA    . ASN F 1 98  ? -63.496 -65.739 -53.089 1.00 83.31  ? 746  ASN B CA    1 
ATOM   9192  C  C     . ASN F 1 98  ? -64.066 -65.618 -51.683 1.00 84.30  ? 746  ASN B C     1 
ATOM   9193  O  O     . ASN F 1 98  ? -63.756 -66.423 -50.804 1.00 82.81  ? 746  ASN B O     1 
ATOM   9194  C  CB    . ASN F 1 98  ? -61.970 -65.713 -53.037 1.00 87.10  ? 746  ASN B CB    1 
ATOM   9195  C  CG    . ASN F 1 98  ? -61.346 -65.601 -54.416 1.00 92.98  ? 746  ASN B CG    1 
ATOM   9196  O  OD1   . ASN F 1 98  ? -61.859 -66.155 -55.390 1.00 90.63  ? 746  ASN B OD1   1 
ATOM   9197  N  ND2   . ASN F 1 98  ? -60.239 -64.873 -54.506 1.00 96.84  ? 746  ASN B ND2   1 
ATOM   9198  N  N     . ARG F 1 99  ? -64.902 -64.610 -51.473 1.00 86.01  ? 747  ARG B N     1 
ATOM   9199  C  CA    . ARG F 1 99  ? -65.505 -64.384 -50.168 1.00 83.00  ? 747  ARG B CA    1 
ATOM   9200  C  C     . ARG F 1 99  ? -66.810 -63.623 -50.328 1.00 81.43  ? 747  ARG B C     1 
ATOM   9201  O  O     . ARG F 1 99  ? -67.005 -62.903 -51.310 1.00 81.25  ? 747  ARG B O     1 
ATOM   9202  C  CB    . ARG F 1 99  ? -64.543 -63.613 -49.259 1.00 83.63  ? 747  ARG B CB    1 
ATOM   9203  C  CG    . ARG F 1 99  ? -63.964 -62.362 -49.905 1.00 87.03  ? 747  ARG B CG    1 
ATOM   9204  C  CD    . ARG F 1 99  ? -62.880 -61.723 -49.049 1.00 89.96  ? 747  ARG B CD    1 
ATOM   9205  N  NE    . ARG F 1 99  ? -61.713 -62.587 -48.870 1.00 90.25  ? 747  ARG B NE    1 
ATOM   9206  C  CZ    . ARG F 1 99  ? -60.548 -62.177 -48.371 1.00 91.80  ? 747  ARG B CZ    1 
ATOM   9207  N  NH1   . ARG F 1 99  ? -60.387 -60.909 -48.004 1.00 89.59  ? 747  ARG B NH1   1 
ATOM   9208  N  NH2   . ARG F 1 99  ? -59.542 -63.034 -48.242 1.00 89.81  ? 747  ARG B NH2   1 
ATOM   9209  N  N     . THR F 1 100 ? -67.705 -63.796 -49.365 1.00 79.23  ? 748  THR B N     1 
ATOM   9210  C  CA    . THR F 1 100 ? -68.978 -63.091 -49.378 1.00 82.77  ? 748  THR B CA    1 
ATOM   9211  C  C     . THR F 1 100 ? -69.193 -62.353 -48.054 1.00 81.52  ? 748  THR B C     1 
ATOM   9212  O  O     . THR F 1 100 ? -69.258 -62.962 -46.987 1.00 80.77  ? 748  THR B O     1 
ATOM   9213  C  CB    . THR F 1 100 ? -70.157 -64.044 -49.692 1.00 81.46  ? 748  THR B CB    1 
ATOM   9214  O  OG1   . THR F 1 100 ? -71.401 -63.355 -49.511 1.00 85.85  ? 748  THR B OG1   1 
ATOM   9215  C  CG2   . THR F 1 100 ? -70.119 -65.268 -48.790 1.00 80.27  ? 748  THR B CG2   1 
ATOM   9216  N  N     . TYR F 1 101 ? -69.293 -61.033 -48.135 1.00 80.54  ? 749  TYR B N     1 
ATOM   9217  C  CA    . TYR F 1 101 ? -69.334 -60.193 -46.945 1.00 82.71  ? 749  TYR B CA    1 
ATOM   9218  C  C     . TYR F 1 101 ? -70.736 -60.036 -46.375 1.00 82.29  ? 749  TYR B C     1 
ATOM   9219  O  O     . TYR F 1 101 ? -71.717 -59.973 -47.111 1.00 84.17  ? 749  TYR B O     1 
ATOM   9220  C  CB    . TYR F 1 101 ? -68.736 -58.812 -47.241 1.00 84.63  ? 749  TYR B CB    1 
ATOM   9221  C  CG    . TYR F 1 101 ? -67.241 -58.830 -47.495 1.00 84.52  ? 749  TYR B CG    1 
ATOM   9222  C  CD1   . TYR F 1 101 ? -66.339 -58.756 -46.441 1.00 82.99  ? 749  TYR B CD1   1 
ATOM   9223  C  CD2   . TYR F 1 101 ? -66.731 -58.924 -48.786 1.00 85.20  ? 749  TYR B CD2   1 
ATOM   9224  C  CE1   . TYR F 1 101 ? -64.973 -58.774 -46.662 1.00 83.97  ? 749  TYR B CE1   1 
ATOM   9225  C  CE2   . TYR F 1 101 ? -65.363 -58.944 -49.018 1.00 86.51  ? 749  TYR B CE2   1 
ATOM   9226  C  CZ    . TYR F 1 101 ? -64.488 -58.867 -47.950 1.00 86.62  ? 749  TYR B CZ    1 
ATOM   9227  O  OH    . TYR F 1 101 ? -63.126 -58.882 -48.162 1.00 87.31  ? 749  TYR B OH    1 
ATOM   9228  N  N     . TYR F 1 102 ? -70.814 -59.969 -45.051 1.00 82.03  ? 750  TYR B N     1 
ATOM   9229  C  CA    . TYR F 1 102 ? -72.072 -59.704 -44.367 1.00 83.97  ? 750  TYR B CA    1 
ATOM   9230  C  C     . TYR F 1 102 ? -71.907 -58.478 -43.479 1.00 81.78  ? 750  TYR B C     1 
ATOM   9231  O  O     . TYR F 1 102 ? -70.803 -57.944 -43.354 1.00 78.90  ? 750  TYR B O     1 
ATOM   9232  C  CB    . TYR F 1 102 ? -72.529 -60.929 -43.560 1.00 79.50  ? 750  TYR B CB    1 
ATOM   9233  C  CG    . TYR F 1 102 ? -72.895 -62.108 -44.439 1.00 81.26  ? 750  TYR B CG    1 
ATOM   9234  C  CD1   . TYR F 1 102 ? -71.921 -62.984 -44.900 1.00 82.46  ? 750  TYR B CD1   1 
ATOM   9235  C  CD2   . TYR F 1 102 ? -74.211 -62.331 -44.829 1.00 82.41  ? 750  TYR B CD2   1 
ATOM   9236  C  CE1   . TYR F 1 102 ? -72.245 -64.056 -45.717 1.00 82.94  ? 750  TYR B CE1   1 
ATOM   9237  C  CE2   . TYR F 1 102 ? -74.547 -63.401 -45.647 1.00 82.91  ? 750  TYR B CE2   1 
ATOM   9238  C  CZ    . TYR F 1 102 ? -73.558 -64.261 -46.088 1.00 83.73  ? 750  TYR B CZ    1 
ATOM   9239  O  OH    . TYR F 1 102 ? -73.874 -65.330 -46.898 1.00 82.74  ? 750  TYR B OH    1 
ATOM   9240  N  N     . GLN F 1 103 ? -73.005 -58.033 -42.876 1.00 83.07  ? 751  GLN B N     1 
ATOM   9241  C  CA    . GLN F 1 103 ? -72.985 -56.860 -42.007 1.00 81.67  ? 751  GLN B CA    1 
ATOM   9242  C  C     . GLN F 1 103 ? -73.453 -57.186 -40.589 1.00 76.60  ? 751  GLN B C     1 
ATOM   9243  O  O     . GLN F 1 103 ? -73.289 -56.386 -39.673 1.00 74.29  ? 751  GLN B O     1 
ATOM   9244  C  CB    . GLN F 1 103 ? -73.856 -55.758 -42.593 1.00 83.40  ? 751  GLN B CB    1 
ATOM   9245  C  CG    . GLN F 1 103 ? -73.922 -54.512 -41.745 1.00 83.83  ? 751  GLN B CG    1 
ATOM   9246  C  CD    . GLN F 1 103 ? -75.248 -53.813 -41.893 1.00 93.33  ? 751  GLN B CD    1 
ATOM   9247  O  OE1   . GLN F 1 103 ? -76.132 -54.292 -42.608 1.00 94.03  ? 751  GLN B OE1   1 
ATOM   9248  N  NE2   . GLN F 1 103 ? -75.405 -52.676 -41.218 1.00 96.01  ? 751  GLN B NE2   1 
ATOM   9249  N  N     . LYS F 1 104 ? -74.043 -58.365 -40.418 1.00 78.87  ? 752  LYS B N     1 
ATOM   9250  C  CA    . LYS F 1 104 ? -74.484 -58.817 -39.102 1.00 76.04  ? 752  LYS B CA    1 
ATOM   9251  C  C     . LYS F 1 104 ? -74.205 -60.307 -38.909 1.00 72.48  ? 752  LYS B C     1 
ATOM   9252  O  O     . LYS F 1 104 ? -74.147 -61.068 -39.875 1.00 72.29  ? 752  LYS B O     1 
ATOM   9253  C  CB    . LYS F 1 104 ? -75.969 -58.520 -38.899 1.00 75.23  ? 752  LYS B CB    1 
ATOM   9254  N  N     . VAL F 1 105 ? -74.026 -60.717 -37.657 1.00 72.49  ? 753  VAL B N     1 
ATOM   9255  C  CA    . VAL F 1 105 ? -73.775 -62.119 -37.341 1.00 72.03  ? 753  VAL B CA    1 
ATOM   9256  C  C     . VAL F 1 105 ? -74.201 -62.433 -35.911 1.00 72.57  ? 753  VAL B C     1 
ATOM   9257  O  O     . VAL F 1 105 ? -74.186 -61.558 -35.044 1.00 73.00  ? 753  VAL B O     1 
ATOM   9258  C  CB    . VAL F 1 105 ? -72.286 -62.485 -37.516 1.00 69.67  ? 753  VAL B CB    1 
ATOM   9259  C  CG1   . VAL F 1 105 ? -71.567 -62.454 -36.177 1.00 69.20  ? 753  VAL B CG1   1 
ATOM   9260  C  CG2   . VAL F 1 105 ? -72.148 -63.853 -38.152 1.00 72.76  ? 753  VAL B CG2   1 
ATOM   9261  N  N     . SER F 1 106 ? -74.588 -63.682 -35.669 1.00 74.33  ? 754  SER B N     1 
ATOM   9262  C  CA    . SER F 1 106 ? -74.955 -64.109 -34.322 1.00 77.37  ? 754  SER B CA    1 
ATOM   9263  C  C     . SER F 1 106 ? -74.073 -65.238 -33.828 1.00 75.86  ? 754  SER B C     1 
ATOM   9264  O  O     . SER F 1 106 ? -74.113 -66.350 -34.349 1.00 78.92  ? 754  SER B O     1 
ATOM   9265  C  CB    . SER F 1 106 ? -76.433 -64.512 -34.227 1.00 77.90  ? 754  SER B CB    1 
ATOM   9266  O  OG    . SER F 1 106 ? -76.656 -65.824 -34.714 1.00 73.81  ? 754  SER B OG    1 
ATOM   9267  N  N     . ILE F 1 107 ? -73.262 -64.938 -32.822 1.00 77.29  ? 755  ILE B N     1 
ATOM   9268  C  CA    . ILE F 1 107 ? -72.478 -65.961 -32.142 1.00 80.96  ? 755  ILE B CA    1 
ATOM   9269  C  C     . ILE F 1 107 ? -73.148 -66.273 -30.807 1.00 86.01  ? 755  ILE B C     1 
ATOM   9270  O  O     . ILE F 1 107 ? -73.269 -65.397 -29.954 1.00 83.70  ? 755  ILE B O     1 
ATOM   9271  C  CB    . ILE F 1 107 ? -71.021 -65.510 -31.907 1.00 75.46  ? 755  ILE B CB    1 
ATOM   9272  N  N     . ASP F 1 108 ? -73.584 -67.519 -30.636 1.00 88.83  ? 756  ASP B N     1 
ATOM   9273  C  CA    . ASP F 1 108 ? -74.346 -67.918 -29.453 1.00 89.38  ? 756  ASP B CA    1 
ATOM   9274  C  C     . ASP F 1 108 ? -75.501 -66.953 -29.194 1.00 89.88  ? 756  ASP B C     1 
ATOM   9275  O  O     . ASP F 1 108 ? -75.663 -66.458 -28.080 1.00 89.53  ? 756  ASP B O     1 
ATOM   9276  C  CB    . ASP F 1 108 ? -73.449 -68.013 -28.212 1.00 89.46  ? 756  ASP B CB    1 
ATOM   9277  C  CG    . ASP F 1 108 ? -72.547 -69.237 -28.231 1.00 93.04  ? 756  ASP B CG    1 
ATOM   9278  O  OD1   . ASP F 1 108 ? -72.372 -69.834 -29.314 1.00 91.96  ? 756  ASP B OD1   1 
ATOM   9279  O  OD2   . ASP F 1 108 ? -72.010 -69.600 -27.161 1.00 95.29  ? 756  ASP B OD2   1 
ATOM   9280  N  N     . GLU F 1 109 ? -76.284 -66.678 -30.235 1.00 89.91  ? 757  GLU B N     1 
ATOM   9281  C  CA    . GLU F 1 109 ? -77.476 -65.834 -30.129 1.00 90.19  ? 757  GLU B CA    1 
ATOM   9282  C  C     . GLU F 1 109 ? -77.188 -64.398 -29.678 1.00 91.63  ? 757  GLU B C     1 
ATOM   9283  O  O     . GLU F 1 109 ? -78.063 -63.726 -29.126 1.00 95.71  ? 757  GLU B O     1 
ATOM   9284  C  CB    . GLU F 1 109 ? -78.520 -66.482 -29.212 1.00 90.82  ? 757  GLU B CB    1 
ATOM   9285  N  N     . GLU F 1 110 ? -75.961 -63.934 -29.905 1.00 92.28  ? 758  GLU B N     1 
ATOM   9286  C  CA    . GLU F 1 110 ? -75.614 -62.528 -29.685 1.00 90.33  ? 758  GLU B CA    1 
ATOM   9287  C  C     . GLU F 1 110 ? -75.418 -61.889 -31.061 1.00 85.63  ? 758  GLU B C     1 
ATOM   9288  O  O     . GLU F 1 110 ? -75.085 -62.583 -32.018 1.00 83.10  ? 758  GLU B O     1 
ATOM   9289  C  CB    . GLU F 1 110 ? -74.328 -62.397 -28.857 1.00 88.00  ? 758  GLU B CB    1 
ATOM   9290  C  CG    . GLU F 1 110 ? -73.960 -63.627 -28.024 1.00 90.46  ? 758  GLU B CG    1 
ATOM   9291  C  CD    . GLU F 1 110 ? -74.646 -63.667 -26.666 1.00 95.94  ? 758  GLU B CD    1 
ATOM   9292  O  OE1   . GLU F 1 110 ? -74.121 -63.037 -25.721 1.00 95.33  ? 758  GLU B OE1   1 
ATOM   9293  O  OE2   . GLU F 1 110 ? -75.699 -64.333 -26.540 1.00 95.44  ? 758  GLU B OE2   1 
ATOM   9294  N  N     . MET F 1 111 ? -75.625 -60.580 -31.176 1.00 82.34  ? 759  MET B N     1 
ATOM   9295  C  CA    . MET F 1 111 ? -75.419 -59.918 -32.464 1.00 79.25  ? 759  MET B CA    1 
ATOM   9296  C  C     . MET F 1 111 ? -74.158 -59.056 -32.482 1.00 77.56  ? 759  MET B C     1 
ATOM   9297  O  O     . MET F 1 111 ? -74.066 -58.066 -31.759 1.00 78.99  ? 759  MET B O     1 
ATOM   9298  C  CB    . MET F 1 111 ? -76.634 -59.071 -32.859 1.00 78.03  ? 759  MET B CB    1 
ATOM   9299  C  CG    . MET F 1 111 ? -76.590 -58.562 -34.302 1.00 79.04  ? 759  MET B CG    1 
ATOM   9300  S  SD    . MET F 1 111 ? -76.896 -56.782 -34.465 1.00 89.64  ? 759  MET B SD    1 
ATOM   9301  C  CE    . MET F 1 111 ? -76.665 -56.528 -36.227 1.00 77.86  ? 759  MET B CE    1 
ATOM   9302  N  N     . LEU F 1 112 ? -73.185 -59.445 -33.303 1.00 75.78  ? 760  LEU B N     1 
ATOM   9303  C  CA    . LEU F 1 112 ? -72.033 -58.591 -33.595 1.00 74.79  ? 760  LEU B CA    1 
ATOM   9304  C  C     . LEU F 1 112 ? -72.216 -57.976 -34.984 1.00 75.45  ? 760  LEU B C     1 
ATOM   9305  O  O     . LEU F 1 112 ? -72.597 -58.665 -35.931 1.00 74.03  ? 760  LEU B O     1 
ATOM   9306  C  CB    . LEU F 1 112 ? -70.716 -59.370 -33.514 1.00 64.14  ? 760  LEU B CB    1 
ATOM   9307  N  N     . GLU F 1 113 ? -71.956 -56.676 -35.094 1.00 74.53  ? 761  GLU B N     1 
ATOM   9308  C  CA    . GLU F 1 113 ? -72.137 -55.946 -36.348 1.00 74.09  ? 761  GLU B CA    1 
ATOM   9309  C  C     . GLU F 1 113 ? -70.849 -55.197 -36.701 1.00 71.46  ? 761  GLU B C     1 
ATOM   9310  O  O     . GLU F 1 113 ? -70.190 -54.653 -35.822 1.00 70.52  ? 761  GLU B O     1 
ATOM   9311  C  CB    . GLU F 1 113 ? -73.320 -54.973 -36.219 1.00 75.07  ? 761  GLU B CB    1 
ATOM   9312  C  CG    . GLU F 1 113 ? -73.706 -54.237 -37.499 1.00 79.23  ? 761  GLU B CG    1 
ATOM   9313  C  CD    . GLU F 1 113 ? -74.897 -53.294 -37.315 1.00 87.94  ? 761  GLU B CD    1 
ATOM   9314  O  OE1   . GLU F 1 113 ? -75.247 -52.974 -36.155 1.00 85.72  ? 761  GLU B OE1   1 
ATOM   9315  O  OE2   . GLU F 1 113 ? -75.485 -52.873 -38.339 1.00 89.39  ? 761  GLU B OE2   1 
ATOM   9316  N  N     . VAL F 1 114 ? -70.477 -55.187 -37.978 1.00 71.47  ? 762  VAL B N     1 
ATOM   9317  C  CA    . VAL F 1 114 ? -69.309 -54.422 -38.422 1.00 70.45  ? 762  VAL B CA    1 
ATOM   9318  C  C     . VAL F 1 114 ? -69.231 -53.090 -37.683 1.00 67.19  ? 762  VAL B C     1 
ATOM   9319  O  O     . VAL F 1 114 ? -70.188 -52.325 -37.682 1.00 69.90  ? 762  VAL B O     1 
ATOM   9320  C  CB    . VAL F 1 114 ? -69.350 -54.153 -39.941 1.00 71.44  ? 762  VAL B CB    1 
ATOM   9321  C  CG1   . VAL F 1 114 ? -68.254 -53.172 -40.348 1.00 69.12  ? 762  VAL B CG1   1 
ATOM   9322  C  CG2   . VAL F 1 114 ? -69.230 -55.461 -40.712 1.00 73.35  ? 762  VAL B CG2   1 
ATOM   9323  N  N     . GLY F 1 115 ? -68.098 -52.823 -37.044 1.00 65.92  ? 763  GLY B N     1 
ATOM   9324  C  CA    . GLY F 1 115 ? -67.937 -51.606 -36.271 1.00 65.43  ? 763  GLY B CA    1 
ATOM   9325  C  C     . GLY F 1 115 ? -68.066 -51.844 -34.781 1.00 65.09  ? 763  GLY B C     1 
ATOM   9326  O  O     . GLY F 1 115 ? -67.591 -51.045 -33.976 1.00 67.30  ? 763  GLY B O     1 
ATOM   9327  N  N     . ASP F 1 116 ? -68.721 -52.940 -34.413 1.00 66.82  ? 764  ASP B N     1 
ATOM   9328  C  CA    . ASP F 1 116 ? -68.806 -53.350 -33.014 1.00 69.50  ? 764  ASP B CA    1 
ATOM   9329  C  C     . ASP F 1 116 ? -67.433 -53.835 -32.547 1.00 66.15  ? 764  ASP B C     1 
ATOM   9330  O  O     . ASP F 1 116 ? -66.511 -53.998 -33.354 1.00 63.47  ? 764  ASP B O     1 
ATOM   9331  C  CB    . ASP F 1 116 ? -69.858 -54.457 -32.819 1.00 71.58  ? 764  ASP B CB    1 
ATOM   9332  C  CG    . ASP F 1 116 ? -71.301 -53.943 -32.910 1.00 75.08  ? 764  ASP B CG    1 
ATOM   9333  O  OD1   . ASP F 1 116 ? -71.525 -52.823 -33.427 1.00 75.83  ? 764  ASP B OD1   1 
ATOM   9334  O  OD2   . ASP F 1 116 ? -72.218 -54.679 -32.472 1.00 73.87  ? 764  ASP B OD2   1 
ATOM   9335  N  N     . CYS F 1 117 ? -67.301 -54.066 -31.245 1.00 62.03  ? 765  CYS B N     1 
ATOM   9336  C  CA    . CYS F 1 117 ? -66.018 -54.448 -30.673 1.00 61.83  ? 765  CYS B CA    1 
ATOM   9337  C  C     . CYS F 1 117 ? -66.109 -55.742 -29.881 1.00 63.65  ? 765  CYS B C     1 
ATOM   9338  O  O     . CYS F 1 117 ? -67.020 -55.933 -29.079 1.00 64.48  ? 765  CYS B O     1 
ATOM   9339  C  CB    . CYS F 1 117 ? -65.457 -53.331 -29.782 1.00 65.49  ? 765  CYS B CB    1 
ATOM   9340  S  SG    . CYS F 1 117 ? -64.855 -51.860 -30.660 1.00 65.07  ? 765  CYS B SG    1 
ATOM   9341  N  N     . VAL F 1 118 ? -65.143 -56.622 -30.113 1.00 65.84  ? 766  VAL B N     1 
ATOM   9342  C  CA    . VAL F 1 118 ? -65.072 -57.904 -29.435 1.00 62.17  ? 766  VAL B CA    1 
ATOM   9343  C  C     . VAL F 1 118 ? -63.727 -58.042 -28.729 1.00 62.16  ? 766  VAL B C     1 
ATOM   9344  O  O     . VAL F 1 118 ? -62.797 -57.292 -29.012 1.00 60.89  ? 766  VAL B O     1 
ATOM   9345  C  CB    . VAL F 1 118 ? -65.224 -59.055 -30.441 1.00 61.03  ? 766  VAL B CB    1 
ATOM   9346  N  N     . SER F 1 119 ? -63.633 -58.990 -27.799 1.00 66.40  ? 767  SER B N     1 
ATOM   9347  C  CA    . SER F 1 119 ? -62.361 -59.324 -27.155 1.00 66.00  ? 767  SER B CA    1 
ATOM   9348  C  C     . SER F 1 119 ? -61.852 -60.693 -27.625 1.00 66.43  ? 767  SER B C     1 
ATOM   9349  O  O     . SER F 1 119 ? -62.518 -61.375 -28.396 1.00 66.25  ? 767  SER B O     1 
ATOM   9350  C  CB    . SER F 1 119 ? -62.485 -59.289 -25.629 1.00 63.47  ? 767  SER B CB    1 
ATOM   9351  O  OG    . SER F 1 119 ? -63.319 -60.326 -25.155 1.00 63.30  ? 767  SER B OG    1 
ATOM   9352  N  N     . VAL F 1 120 ? -60.669 -61.084 -27.165 1.00 67.20  ? 768  VAL B N     1 
ATOM   9353  C  CA    . VAL F 1 120 ? -60.048 -62.332 -27.594 1.00 68.24  ? 768  VAL B CA    1 
ATOM   9354  C  C     . VAL F 1 120 ? -59.082 -62.809 -26.526 1.00 73.95  ? 768  VAL B C     1 
ATOM   9355  O  O     . VAL F 1 120 ? -58.225 -62.050 -26.088 1.00 78.86  ? 768  VAL B O     1 
ATOM   9356  C  CB    . VAL F 1 120 ? -59.249 -62.157 -28.901 1.00 66.71  ? 768  VAL B CB    1 
ATOM   9357  C  CG1   . VAL F 1 120 ? -58.293 -63.316 -29.087 1.00 71.55  ? 768  VAL B CG1   1 
ATOM   9358  C  CG2   . VAL F 1 120 ? -60.175 -62.014 -30.105 1.00 66.46  ? 768  VAL B CG2   1 
ATOM   9359  N  N     . ILE F 1 121 ? -59.216 -64.063 -26.107 1.00 75.97  ? 769  ILE B N     1 
ATOM   9360  C  CA    . ILE F 1 121 ? -58.340 -64.609 -25.076 1.00 78.75  ? 769  ILE B CA    1 
ATOM   9361  C  C     . ILE F 1 121 ? -56.996 -65.021 -25.666 1.00 81.44  ? 769  ILE B C     1 
ATOM   9362  O  O     . ILE F 1 121 ? -56.944 -65.576 -26.765 1.00 82.03  ? 769  ILE B O     1 
ATOM   9363  C  CB    . ILE F 1 121 ? -58.977 -65.822 -24.385 1.00 83.20  ? 769  ILE B CB    1 
ATOM   9364  C  CG1   . ILE F 1 121 ? -60.357 -65.454 -23.839 1.00 79.66  ? 769  ILE B CG1   1 
ATOM   9365  C  CG2   . ILE F 1 121 ? -58.074 -66.334 -23.269 1.00 83.32  ? 769  ILE B CG2   1 
ATOM   9366  C  CD1   . ILE F 1 121 ? -60.325 -64.376 -22.784 1.00 76.59  ? 769  ILE B CD1   1 
ATOM   9367  N  N     . PRO F 1 122 ? -55.901 -64.740 -24.939 1.00 83.20  ? 770  PRO B N     1 
ATOM   9368  C  CA    . PRO F 1 122 ? -54.554 -65.121 -25.376 1.00 87.26  ? 770  PRO B CA    1 
ATOM   9369  C  C     . PRO F 1 122 ? -54.151 -66.505 -24.851 1.00 88.76  ? 770  PRO B C     1 
ATOM   9370  O  O     . PRO F 1 122 ? -54.892 -67.108 -24.069 1.00 86.74  ? 770  PRO B O     1 
ATOM   9371  C  CB    . PRO F 1 122 ? -53.663 -64.030 -24.756 1.00 85.03  ? 770  PRO B CB    1 
ATOM   9372  C  CG    . PRO F 1 122 ? -54.566 -63.237 -23.795 1.00 80.64  ? 770  PRO B CG    1 
ATOM   9373  C  CD    . PRO F 1 122 ? -55.857 -63.985 -23.678 1.00 79.88  ? 770  PRO B CD    1 
ATOM   9374  N  N     . ASP F 1 123 ? -52.995 -67.004 -25.284 1.00 88.67  ? 771  ASP B N     1 
ATOM   9375  C  CA    . ASP F 1 123 ? -52.494 -68.288 -24.796 1.00 88.45  ? 771  ASP B CA    1 
ATOM   9376  C  C     . ASP F 1 123 ? -51.992 -68.132 -23.372 1.00 86.12  ? 771  ASP B C     1 
ATOM   9377  O  O     . ASP F 1 123 ? -52.397 -68.869 -22.465 1.00 79.87  ? 771  ASP B O     1 
ATOM   9378  C  CB    . ASP F 1 123 ? -51.361 -68.805 -25.677 1.00 87.81  ? 771  ASP B CB    1 
ATOM   9379  N  N     . ASP F 1 124 ? -51.092 -67.172 -23.187 1.00 84.76  ? 772  ASP B N     1 
ATOM   9380  C  CA    . ASP F 1 124 ? -50.544 -66.887 -21.871 1.00 84.14  ? 772  ASP B CA    1 
ATOM   9381  C  C     . ASP F 1 124 ? -51.671 -66.435 -20.948 1.00 83.97  ? 772  ASP B C     1 
ATOM   9382  O  O     . ASP F 1 124 ? -52.318 -65.421 -21.195 1.00 85.67  ? 772  ASP B O     1 
ATOM   9383  C  CB    . ASP F 1 124 ? -49.457 -65.814 -21.969 1.00 84.62  ? 772  ASP B CB    1 
ATOM   9384  C  CG    . ASP F 1 124 ? -48.622 -65.708 -20.703 1.00 86.46  ? 772  ASP B CG    1 
ATOM   9385  O  OD1   . ASP F 1 124 ? -47.415 -65.395 -20.813 1.00 84.70  ? 772  ASP B OD1   1 
ATOM   9386  O  OD2   . ASP F 1 124 ? -49.170 -65.939 -19.600 1.00 86.39  ? 772  ASP B OD2   1 
ATOM   9387  N  N     . SER F 1 125 ? -51.911 -67.197 -19.888 1.00 82.71  ? 773  SER B N     1 
ATOM   9388  C  CA    . SER F 1 125 ? -53.002 -66.890 -18.972 1.00 83.91  ? 773  SER B CA    1 
ATOM   9389  C  C     . SER F 1 125 ? -52.699 -65.653 -18.117 1.00 85.25  ? 773  SER B C     1 
ATOM   9390  O  O     . SER F 1 125 ? -53.467 -65.305 -17.216 1.00 80.15  ? 773  SER B O     1 
ATOM   9391  C  CB    . SER F 1 125 ? -53.317 -68.103 -18.089 1.00 79.99  ? 773  SER B CB    1 
ATOM   9392  N  N     . SER F 1 126 ? -51.581 -64.988 -18.406 1.00 86.40  ? 774  SER B N     1 
ATOM   9393  C  CA    . SER F 1 126 ? -51.205 -63.770 -17.686 1.00 85.01  ? 774  SER B CA    1 
ATOM   9394  C  C     . SER F 1 126 ? -51.411 -62.519 -18.542 1.00 87.95  ? 774  SER B C     1 
ATOM   9395  O  O     . SER F 1 126 ? -51.871 -61.488 -18.042 1.00 87.05  ? 774  SER B O     1 
ATOM   9396  C  CB    . SER F 1 126 ? -49.755 -63.841 -17.194 1.00 83.43  ? 774  SER B CB    1 
ATOM   9397  O  OG    . SER F 1 126 ? -48.840 -63.538 -18.233 1.00 85.25  ? 774  SER B OG    1 
ATOM   9398  N  N     . LYS F 1 127 ? -51.066 -62.608 -19.826 1.00 86.08  ? 775  LYS B N     1 
ATOM   9399  C  CA    . LYS F 1 127 ? -51.298 -61.497 -20.746 1.00 86.13  ? 775  LYS B CA    1 
ATOM   9400  C  C     . LYS F 1 127 ? -52.764 -61.073 -20.696 1.00 87.19  ? 775  LYS B C     1 
ATOM   9401  O  O     . LYS F 1 127 ? -53.653 -61.882 -20.967 1.00 86.82  ? 775  LYS B O     1 
ATOM   9402  C  CB    . LYS F 1 127 ? -50.909 -61.871 -22.181 1.00 83.93  ? 775  LYS B CB    1 
ATOM   9403  C  CG    . LYS F 1 127 ? -49.412 -61.991 -22.427 1.00 84.88  ? 775  LYS B CG    1 
ATOM   9404  C  CD    . LYS F 1 127 ? -49.065 -61.789 -23.904 1.00 84.19  ? 775  LYS B CD    1 
ATOM   9405  C  CE    . LYS F 1 127 ? -48.756 -60.322 -24.236 1.00 84.30  ? 775  LYS B CE    1 
ATOM   9406  N  NZ    . LYS F 1 127 ? -49.938 -59.405 -24.234 1.00 80.68  ? 775  LYS B NZ    1 
ATOM   9407  N  N     . PRO F 1 128 ? -53.023 -59.804 -20.333 1.00 87.20  ? 776  PRO B N     1 
ATOM   9408  C  CA    . PRO F 1 128 ? -54.401 -59.303 -20.322 1.00 84.09  ? 776  PRO B CA    1 
ATOM   9409  C  C     . PRO F 1 128 ? -55.063 -59.532 -21.677 1.00 83.06  ? 776  PRO B C     1 
ATOM   9410  O  O     . PRO F 1 128 ? -54.388 -59.513 -22.713 1.00 82.24  ? 776  PRO B O     1 
ATOM   9411  C  CB    . PRO F 1 128 ? -54.226 -57.806 -20.057 1.00 83.07  ? 776  PRO B CB    1 
ATOM   9412  C  CG    . PRO F 1 128 ? -52.941 -57.709 -19.313 1.00 83.38  ? 776  PRO B CG    1 
ATOM   9413  C  CD    . PRO F 1 128 ? -52.060 -58.777 -19.899 1.00 85.78  ? 776  PRO B CD    1 
ATOM   9414  N  N     . LEU F 1 129 ? -56.372 -59.752 -21.661 1.00 79.24  ? 777  LEU B N     1 
ATOM   9415  C  CA    . LEU F 1 129 ? -57.106 -60.099 -22.871 1.00 79.02  ? 777  LEU B CA    1 
ATOM   9416  C  C     . LEU F 1 129 ? -57.004 -59.026 -23.957 1.00 73.29  ? 777  LEU B C     1 
ATOM   9417  O  O     . LEU F 1 129 ? -57.048 -57.831 -23.666 1.00 71.11  ? 777  LEU B O     1 
ATOM   9418  C  CB    . LEU F 1 129 ? -58.569 -60.431 -22.542 1.00 78.92  ? 777  LEU B CB    1 
ATOM   9419  C  CG    . LEU F 1 129 ? -59.460 -59.432 -21.788 1.00 80.39  ? 777  LEU B CG    1 
ATOM   9420  C  CD1   . LEU F 1 129 ? -58.853 -58.958 -20.459 1.00 80.43  ? 777  LEU B CD1   1 
ATOM   9421  C  CD2   . LEU F 1 129 ? -59.826 -58.250 -22.676 1.00 76.80  ? 777  LEU B CD2   1 
ATOM   9422  N  N     . TYR F 1 130 ? -56.847 -59.468 -25.202 1.00 71.16  ? 778  TYR B N     1 
ATOM   9423  C  CA    . TYR F 1 130 ? -56.759 -58.560 -26.340 1.00 70.94  ? 778  TYR B CA    1 
ATOM   9424  C  C     . TYR F 1 130 ? -58.127 -57.982 -26.666 1.00 69.52  ? 778  TYR B C     1 
ATOM   9425  O  O     . TYR F 1 130 ? -59.147 -58.554 -26.293 1.00 71.30  ? 778  TYR B O     1 
ATOM   9426  C  CB    . TYR F 1 130 ? -56.231 -59.285 -27.572 1.00 71.91  ? 778  TYR B CB    1 
ATOM   9427  C  CG    . TYR F 1 130 ? -54.861 -59.899 -27.421 1.00 76.77  ? 778  TYR B CG    1 
ATOM   9428  C  CD1   . TYR F 1 130 ? -54.091 -59.673 -26.291 1.00 78.53  ? 778  TYR B CD1   1 
ATOM   9429  C  CD2   . TYR F 1 130 ? -54.333 -60.701 -28.425 1.00 81.43  ? 778  TYR B CD2   1 
ATOM   9430  C  CE1   . TYR F 1 130 ? -52.834 -60.238 -26.164 1.00 84.76  ? 778  TYR B CE1   1 
ATOM   9431  C  CE2   . TYR F 1 130 ? -53.084 -61.268 -28.310 1.00 87.14  ? 778  TYR B CE2   1 
ATOM   9432  C  CZ    . TYR F 1 130 ? -52.337 -61.038 -27.179 1.00 89.22  ? 778  TYR B CZ    1 
ATOM   9433  O  OH    . TYR F 1 130 ? -51.088 -61.611 -27.070 1.00 93.18  ? 778  TYR B OH    1 
ATOM   9434  N  N     . LEU F 1 131 ? -58.142 -56.854 -27.373 1.00 68.10  ? 779  LEU B N     1 
ATOM   9435  C  CA    . LEU F 1 131 ? -59.384 -56.176 -27.747 1.00 62.00  ? 779  LEU B CA    1 
ATOM   9436  C  C     . LEU F 1 131 ? -59.260 -55.590 -29.149 1.00 60.61  ? 779  LEU B C     1 
ATOM   9437  O  O     . LEU F 1 131 ? -58.211 -55.067 -29.519 1.00 62.68  ? 779  LEU B O     1 
ATOM   9438  C  CB    . LEU F 1 131 ? -59.712 -55.071 -26.743 1.00 58.36  ? 779  LEU B CB    1 
ATOM   9439  C  CG    . LEU F 1 131 ? -59.963 -55.517 -25.301 1.00 60.83  ? 779  LEU B CG    1 
ATOM   9440  C  CD1   . LEU F 1 131 ? -59.064 -54.781 -24.315 1.00 61.95  ? 779  LEU B CD1   1 
ATOM   9441  C  CD2   . LEU F 1 131 ? -61.424 -55.330 -24.941 1.00 62.66  ? 779  LEU B CD2   1 
ATOM   9442  N  N     . ALA F 1 132 ? -60.323 -55.681 -29.937 1.00 59.37  ? 780  ALA B N     1 
ATOM   9443  C  CA    . ALA F 1 132 ? -60.269 -55.183 -31.307 1.00 61.35  ? 780  ALA B CA    1 
ATOM   9444  C  C     . ALA F 1 132 ? -61.600 -54.613 -31.770 1.00 61.40  ? 780  ALA B C     1 
ATOM   9445  O  O     . ALA F 1 132 ? -62.588 -54.621 -31.033 1.00 58.92  ? 780  ALA B O     1 
ATOM   9446  C  CB    . ALA F 1 132 ? -59.805 -56.279 -32.262 1.00 61.91  ? 780  ALA B CB    1 
ATOM   9447  N  N     . ARG F 1 133 ? -61.602 -54.097 -32.992 1.00 61.44  ? 781  ARG B N     1 
ATOM   9448  C  CA    . ARG F 1 133 ? -62.827 -53.695 -33.657 1.00 62.26  ? 781  ARG B CA    1 
ATOM   9449  C  C     . ARG F 1 133 ? -63.056 -54.655 -34.821 1.00 67.18  ? 781  ARG B C     1 
ATOM   9450  O  O     . ARG F 1 133 ? -62.100 -55.222 -35.362 1.00 65.92  ? 781  ARG B O     1 
ATOM   9451  C  CB    . ARG F 1 133 ? -62.726 -52.247 -34.146 1.00 61.90  ? 781  ARG B CB    1 
ATOM   9452  C  CG    . ARG F 1 133 ? -63.901 -51.785 -35.007 1.00 65.64  ? 781  ARG B CG    1 
ATOM   9453  C  CD    . ARG F 1 133 ? -64.043 -50.259 -35.038 1.00 64.47  ? 781  ARG B CD    1 
ATOM   9454  N  NE    . ARG F 1 133 ? -64.613 -49.723 -33.799 1.00 62.89  ? 781  ARG B NE    1 
ATOM   9455  C  CZ    . ARG F 1 133 ? -64.218 -48.593 -33.219 1.00 62.91  ? 781  ARG B CZ    1 
ATOM   9456  N  NH1   . ARG F 1 133 ? -63.244 -47.873 -33.761 1.00 66.32  ? 781  ARG B NH1   1 
ATOM   9457  N  NH2   . ARG F 1 133 ? -64.788 -48.184 -32.091 1.00 63.93  ? 781  ARG B NH2   1 
ATOM   9458  N  N     . VAL F 1 134 ? -64.320 -54.868 -35.179 1.00 67.35  ? 782  VAL B N     1 
ATOM   9459  C  CA    . VAL F 1 134 ? -64.647 -55.670 -36.353 1.00 67.63  ? 782  VAL B CA    1 
ATOM   9460  C  C     . VAL F 1 134 ? -64.848 -54.747 -37.551 1.00 66.46  ? 782  VAL B C     1 
ATOM   9461  O  O     . VAL F 1 134 ? -65.759 -53.929 -37.570 1.00 68.32  ? 782  VAL B O     1 
ATOM   9462  C  CB    . VAL F 1 134 ? -65.909 -56.534 -36.136 1.00 65.38  ? 782  VAL B CB    1 
ATOM   9463  C  CG1   . VAL F 1 134 ? -66.224 -57.331 -37.390 1.00 66.11  ? 782  VAL B CG1   1 
ATOM   9464  C  CG2   . VAL F 1 134 ? -65.725 -57.463 -34.947 1.00 61.96  ? 782  VAL B CG2   1 
ATOM   9465  N  N     . THR F 1 135 ? -63.984 -54.875 -38.547 1.00 66.45  ? 783  THR B N     1 
ATOM   9466  C  CA    . THR F 1 135 ? -64.027 -53.987 -39.696 1.00 69.46  ? 783  THR B CA    1 
ATOM   9467  C  C     . THR F 1 135 ? -64.707 -54.658 -40.876 1.00 70.41  ? 783  THR B C     1 
ATOM   9468  O  O     . THR F 1 135 ? -64.997 -54.011 -41.886 1.00 70.04  ? 783  THR B O     1 
ATOM   9469  C  CB    . THR F 1 135 ? -62.613 -53.575 -40.124 1.00 73.16  ? 783  THR B CB    1 
ATOM   9470  O  OG1   . THR F 1 135 ? -62.046 -54.601 -40.951 1.00 74.09  ? 783  THR B OG1   1 
ATOM   9471  C  CG2   . THR F 1 135 ? -61.727 -53.344 -38.896 1.00 68.27  ? 783  THR B CG2   1 
ATOM   9472  N  N     . ALA F 1 136 ? -64.954 -55.960 -40.738 1.00 72.77  ? 784  ALA B N     1 
ATOM   9473  C  CA    . ALA F 1 136 ? -65.542 -56.764 -41.810 1.00 76.06  ? 784  ALA B CA    1 
ATOM   9474  C  C     . ALA F 1 136 ? -65.944 -58.175 -41.367 1.00 74.33  ? 784  ALA B C     1 
ATOM   9475  O  O     . ALA F 1 136 ? -65.239 -58.833 -40.598 1.00 69.67  ? 784  ALA B O     1 
ATOM   9476  C  CB    . ALA F 1 136 ? -64.590 -56.839 -43.005 1.00 76.78  ? 784  ALA B CB    1 
ATOM   9477  N  N     . LEU F 1 137 ? -67.088 -58.628 -41.870 1.00 76.65  ? 785  LEU B N     1 
ATOM   9478  C  CA    . LEU F 1 137 ? -67.543 -59.995 -41.665 1.00 75.01  ? 785  LEU B CA    1 
ATOM   9479  C  C     . LEU F 1 137 ? -67.684 -60.654 -43.031 1.00 77.48  ? 785  LEU B C     1 
ATOM   9480  O  O     . LEU F 1 137 ? -68.233 -60.049 -43.950 1.00 79.82  ? 785  LEU B O     1 
ATOM   9481  C  CB    . LEU F 1 137 ? -68.892 -60.005 -40.944 1.00 71.79  ? 785  LEU B CB    1 
ATOM   9482  C  CG    . LEU F 1 137 ? -68.978 -59.323 -39.578 1.00 67.65  ? 785  LEU B CG    1 
ATOM   9483  C  CD1   . LEU F 1 137 ? -70.418 -59.258 -39.106 1.00 70.21  ? 785  LEU B CD1   1 
ATOM   9484  C  CD2   . LEU F 1 137 ? -68.125 -60.042 -38.563 1.00 66.85  ? 785  LEU B CD2   1 
ATOM   9485  N  N     . TRP F 1 138 ? -67.181 -61.878 -43.173 1.00 76.39  ? 786  TRP B N     1 
ATOM   9486  C  CA    . TRP F 1 138 ? -67.298 -62.598 -44.443 1.00 80.38  ? 786  TRP B CA    1 
ATOM   9487  C  C     . TRP F 1 138 ? -67.156 -64.118 -44.298 1.00 81.48  ? 786  TRP B C     1 
ATOM   9488  O  O     . TRP F 1 138 ? -66.571 -64.608 -43.332 1.00 82.05  ? 786  TRP B O     1 
ATOM   9489  C  CB    . TRP F 1 138 ? -66.271 -62.079 -45.461 1.00 80.43  ? 786  TRP B CB    1 
ATOM   9490  C  CG    . TRP F 1 138 ? -64.869 -62.619 -45.258 1.00 82.15  ? 786  TRP B CG    1 
ATOM   9491  C  CD1   . TRP F 1 138 ? -64.379 -63.817 -45.694 1.00 81.73  ? 786  TRP B CD1   1 
ATOM   9492  C  CD2   . TRP F 1 138 ? -63.791 -61.966 -44.579 1.00 83.49  ? 786  TRP B CD2   1 
ATOM   9493  N  NE1   . TRP F 1 138 ? -63.065 -63.956 -45.320 1.00 80.74  ? 786  TRP B NE1   1 
ATOM   9494  C  CE2   . TRP F 1 138 ? -62.676 -62.835 -44.636 1.00 82.90  ? 786  TRP B CE2   1 
ATOM   9495  C  CE3   . TRP F 1 138 ? -63.650 -60.738 -43.926 1.00 81.68  ? 786  TRP B CE3   1 
ATOM   9496  C  CZ2   . TRP F 1 138 ? -61.449 -62.511 -44.064 1.00 83.03  ? 786  TRP B CZ2   1 
ATOM   9497  C  CZ3   . TRP F 1 138 ? -62.429 -60.417 -43.359 1.00 79.91  ? 786  TRP B CZ3   1 
ATOM   9498  C  CH2   . TRP F 1 138 ? -61.345 -61.301 -43.433 1.00 82.16  ? 786  TRP B CH2   1 
ATOM   9499  N  N     . GLU F 1 139 ? -67.700 -64.856 -45.263 1.00 80.10  ? 787  GLU B N     1 
ATOM   9500  C  CA    . GLU F 1 139 ? -67.447 -66.290 -45.374 1.00 79.13  ? 787  GLU B CA    1 
ATOM   9501  C  C     . GLU F 1 139 ? -66.443 -66.531 -46.497 1.00 79.21  ? 787  GLU B C     1 
ATOM   9502  O  O     . GLU F 1 139 ? -66.606 -66.023 -47.607 1.00 78.65  ? 787  GLU B O     1 
ATOM   9503  C  CB    . GLU F 1 139 ? -68.741 -67.056 -45.654 1.00 79.64  ? 787  GLU B CB    1 
ATOM   9504  C  CG    . GLU F 1 139 ? -68.545 -68.556 -45.822 1.00 78.46  ? 787  GLU B CG    1 
ATOM   9505  C  CD    . GLU F 1 139 ? -69.312 -69.362 -44.789 1.00 78.99  ? 787  GLU B CD    1 
ATOM   9506  O  OE1   . GLU F 1 139 ? -70.433 -68.947 -44.428 1.00 78.75  ? 787  GLU B OE1   1 
ATOM   9507  O  OE2   . GLU F 1 139 ? -68.795 -70.408 -44.334 1.00 78.53  ? 787  GLU B OE2   1 
ATOM   9508  N  N     . ASP F 1 140 ? -65.404 -67.304 -46.209 1.00 79.74  ? 788  ASP B N     1 
ATOM   9509  C  CA    . ASP F 1 140 ? -64.338 -67.514 -47.180 1.00 83.14  ? 788  ASP B CA    1 
ATOM   9510  C  C     . ASP F 1 140 ? -64.520 -68.808 -47.989 1.00 87.02  ? 788  ASP B C     1 
ATOM   9511  O  O     . ASP F 1 140 ? -65.154 -69.764 -47.529 1.00 83.92  ? 788  ASP B O     1 
ATOM   9512  C  CB    . ASP F 1 140 ? -62.976 -67.497 -46.480 1.00 85.20  ? 788  ASP B CB    1 
ATOM   9513  C  CG    . ASP F 1 140 ? -61.897 -66.809 -47.308 1.00 89.25  ? 788  ASP B CG    1 
ATOM   9514  O  OD1   . ASP F 1 140 ? -61.747 -67.146 -48.503 1.00 87.59  ? 788  ASP B OD1   1 
ATOM   9515  O  OD2   . ASP F 1 140 ? -61.204 -65.920 -46.762 1.00 90.92  ? 788  ASP B OD2   1 
ATOM   9516  N  N     . LYS F 1 141 ? -63.959 -68.823 -49.199 1.00 85.86  ? 789  LYS B N     1 
ATOM   9517  C  CA    . LYS F 1 141 ? -64.054 -69.974 -50.095 1.00 82.43  ? 789  LYS B CA    1 
ATOM   9518  C  C     . LYS F 1 141 ? -63.555 -71.252 -49.426 1.00 82.21  ? 789  LYS B C     1 
ATOM   9519  O  O     . LYS F 1 141 ? -63.744 -72.350 -49.944 1.00 85.20  ? 789  LYS B O     1 
ATOM   9520  C  CB    . LYS F 1 141 ? -63.282 -69.717 -51.393 1.00 76.77  ? 789  LYS B CB    1 
ATOM   9521  N  N     . ASN F 1 142 ? -62.922 -71.104 -48.268 1.00 83.24  ? 790  ASN B N     1 
ATOM   9522  C  CA    . ASN F 1 142 ? -62.442 -72.255 -47.512 1.00 84.56  ? 790  ASN B CA    1 
ATOM   9523  C  C     . ASN F 1 142 ? -63.486 -72.853 -46.561 1.00 83.97  ? 790  ASN B C     1 
ATOM   9524  O  O     . ASN F 1 142 ? -63.164 -73.720 -45.747 1.00 82.55  ? 790  ASN B O     1 
ATOM   9525  C  CB    . ASN F 1 142 ? -61.151 -71.906 -46.757 1.00 87.30  ? 790  ASN B CB    1 
ATOM   9526  C  CG    . ASN F 1 142 ? -61.282 -70.648 -45.898 1.00 89.28  ? 790  ASN B CG    1 
ATOM   9527  O  OD1   . ASN F 1 142 ? -62.386 -70.202 -45.582 1.00 90.54  ? 790  ASN B OD1   1 
ATOM   9528  N  ND2   . ASN F 1 142 ? -60.144 -70.080 -45.510 1.00 86.65  ? 790  ASN B ND2   1 
ATOM   9529  N  N     . GLY F 1 143 ? -64.730 -72.385 -46.670 1.00 84.31  ? 791  GLY B N     1 
ATOM   9530  C  CA    . GLY F 1 143 ? -65.826 -72.891 -45.856 1.00 83.23  ? 791  GLY B CA    1 
ATOM   9531  C  C     . GLY F 1 143 ? -65.820 -72.386 -44.424 1.00 81.81  ? 791  GLY B C     1 
ATOM   9532  O  O     . GLY F 1 143 ? -66.626 -72.816 -43.595 1.00 74.86  ? 791  GLY B O     1 
ATOM   9533  N  N     . GLN F 1 144 ? -64.908 -71.457 -44.142 1.00 87.91  ? 792  GLN B N     1 
ATOM   9534  C  CA    . GLN F 1 144 ? -64.701 -70.928 -42.794 1.00 85.41  ? 792  GLN B CA    1 
ATOM   9535  C  C     . GLN F 1 144 ? -65.226 -69.496 -42.678 1.00 79.16  ? 792  GLN B C     1 
ATOM   9536  O  O     . GLN F 1 144 ? -65.100 -68.699 -43.609 1.00 77.01  ? 792  GLN B O     1 
ATOM   9537  C  CB    . GLN F 1 144 ? -63.210 -70.973 -42.449 1.00 86.28  ? 792  GLN B CB    1 
ATOM   9538  C  CG    . GLN F 1 144 ? -62.881 -70.850 -40.970 1.00 89.08  ? 792  GLN B CG    1 
ATOM   9539  C  CD    . GLN F 1 144 ? -61.379 -70.856 -40.717 1.00 95.52  ? 792  GLN B CD    1 
ATOM   9540  O  OE1   . GLN F 1 144 ? -60.922 -70.683 -39.583 1.00 94.95  ? 792  GLN B OE1   1 
ATOM   9541  N  NE2   . GLN F 1 144 ? -60.603 -71.053 -41.782 1.00 94.09  ? 792  GLN B NE2   1 
ATOM   9542  N  N     . MET F 1 145 ? -65.820 -69.179 -41.532 1.00 77.62  ? 793  MET B N     1 
ATOM   9543  C  CA    . MET F 1 145 ? -66.381 -67.851 -41.306 1.00 78.97  ? 793  MET B CA    1 
ATOM   9544  C  C     . MET F 1 145 ? -65.374 -66.898 -40.667 1.00 78.97  ? 793  MET B C     1 
ATOM   9545  O  O     . MET F 1 145 ? -64.877 -67.138 -39.565 1.00 77.69  ? 793  MET B O     1 
ATOM   9546  C  CB    . MET F 1 145 ? -67.652 -67.935 -40.466 1.00 77.68  ? 793  MET B CB    1 
ATOM   9547  C  CG    . MET F 1 145 ? -68.847 -68.474 -41.233 1.00 79.47  ? 793  MET B CG    1 
ATOM   9548  S  SD    . MET F 1 145 ? -70.297 -68.668 -40.189 1.00 74.99  ? 793  MET B SD    1 
ATOM   9549  C  CE    . MET F 1 145 ? -69.784 -70.066 -39.199 1.00 77.03  ? 793  MET B CE    1 
ATOM   9550  N  N     . MET F 1 146 ? -65.092 -65.808 -41.373 1.00 77.95  ? 794  MET B N     1 
ATOM   9551  C  CA    . MET F 1 146 ? -64.015 -64.899 -41.004 1.00 77.75  ? 794  MET B CA    1 
ATOM   9552  C  C     . MET F 1 146 ? -64.481 -63.491 -40.637 1.00 78.18  ? 794  MET B C     1 
ATOM   9553  O  O     . MET F 1 146 ? -65.533 -63.028 -41.081 1.00 77.09  ? 794  MET B O     1 
ATOM   9554  C  CB    . MET F 1 146 ? -63.019 -64.790 -42.160 1.00 78.59  ? 794  MET B CB    1 
ATOM   9555  C  CG    . MET F 1 146 ? -62.230 -66.045 -42.442 1.00 81.55  ? 794  MET B CG    1 
ATOM   9556  S  SD    . MET F 1 146 ? -61.210 -66.531 -41.041 1.00 87.43  ? 794  MET B SD    1 
ATOM   9557  C  CE    . MET F 1 146 ? -60.067 -67.651 -41.854 1.00 90.06  ? 794  MET B CE    1 
ATOM   9558  N  N     . PHE F 1 147 ? -63.672 -62.816 -39.827 1.00 77.76  ? 795  PHE B N     1 
ATOM   9559  C  CA    . PHE F 1 147 ? -63.783 -61.374 -39.649 1.00 74.04  ? 795  PHE B CA    1 
ATOM   9560  C  C     . PHE F 1 147 ? -62.391 -60.751 -39.659 1.00 73.99  ? 795  PHE B C     1 
ATOM   9561  O  O     . PHE F 1 147 ? -61.399 -61.434 -39.402 1.00 74.15  ? 795  PHE B O     1 
ATOM   9562  C  CB    . PHE F 1 147 ? -64.522 -61.029 -38.356 1.00 71.92  ? 795  PHE B CB    1 
ATOM   9563  C  CG    . PHE F 1 147 ? -63.674 -61.110 -37.116 1.00 69.25  ? 795  PHE B CG    1 
ATOM   9564  C  CD1   . PHE F 1 147 ? -63.235 -59.959 -36.493 1.00 66.79  ? 795  PHE B CD1   1 
ATOM   9565  C  CD2   . PHE F 1 147 ? -63.340 -62.330 -36.558 1.00 73.39  ? 795  PHE B CD2   1 
ATOM   9566  C  CE1   . PHE F 1 147 ? -62.472 -60.021 -35.349 1.00 67.38  ? 795  PHE B CE1   1 
ATOM   9567  C  CE2   . PHE F 1 147 ? -62.573 -62.395 -35.409 1.00 73.14  ? 795  PHE B CE2   1 
ATOM   9568  C  CZ    . PHE F 1 147 ? -62.140 -61.239 -34.805 1.00 69.27  ? 795  PHE B CZ    1 
ATOM   9569  N  N     . HIS F 1 148 ? -62.315 -59.462 -39.976 1.00 73.93  ? 796  HIS B N     1 
ATOM   9570  C  CA    . HIS F 1 148 ? -61.044 -58.745 -39.923 1.00 72.29  ? 796  HIS B CA    1 
ATOM   9571  C  C     . HIS F 1 148 ? -60.938 -57.885 -38.667 1.00 68.95  ? 796  HIS B C     1 
ATOM   9572  O  O     . HIS F 1 148 ? -61.792 -57.045 -38.399 1.00 67.87  ? 796  HIS B O     1 
ATOM   9573  C  CB    . HIS F 1 148 ? -60.844 -57.881 -41.165 1.00 75.53  ? 796  HIS B CB    1 
ATOM   9574  C  CG    . HIS F 1 148 ? -59.530 -57.163 -41.190 1.00 77.54  ? 796  HIS B CG    1 
ATOM   9575  N  ND1   . HIS F 1 148 ? -58.329 -57.814 -41.378 1.00 76.97  ? 796  HIS B ND1   1 
ATOM   9576  C  CD2   . HIS F 1 148 ? -59.227 -55.852 -41.039 1.00 74.62  ? 796  HIS B CD2   1 
ATOM   9577  C  CE1   . HIS F 1 148 ? -57.344 -56.934 -41.349 1.00 75.86  ? 796  HIS B CE1   1 
ATOM   9578  N  NE2   . HIS F 1 148 ? -57.862 -55.736 -41.145 1.00 78.82  ? 796  HIS B NE2   1 
ATOM   9579  N  N     . ALA F 1 149 ? -59.876 -58.100 -37.903 1.00 67.82  ? 797  ALA B N     1 
ATOM   9580  C  CA    . ALA F 1 149 ? -59.718 -57.428 -36.627 1.00 68.28  ? 797  ALA B CA    1 
ATOM   9581  C  C     . ALA F 1 149 ? -58.679 -56.313 -36.683 1.00 71.02  ? 797  ALA B C     1 
ATOM   9582  O  O     . ALA F 1 149 ? -57.521 -56.539 -37.028 1.00 69.65  ? 797  ALA B O     1 
ATOM   9583  C  CB    . ALA F 1 149 ? -59.357 -58.433 -35.552 1.00 69.53  ? 797  ALA B CB    1 
ATOM   9584  N  N     . HIS F 1 150 ? -59.110 -55.103 -36.344 1.00 71.96  ? 798  HIS B N     1 
ATOM   9585  C  CA    . HIS F 1 150 ? -58.206 -53.974 -36.190 1.00 67.32  ? 798  HIS B CA    1 
ATOM   9586  C  C     . HIS F 1 150 ? -57.909 -53.810 -34.701 1.00 66.62  ? 798  HIS B C     1 
ATOM   9587  O  O     . HIS F 1 150 ? -58.765 -53.374 -33.930 1.00 66.53  ? 798  HIS B O     1 
ATOM   9588  C  CB    . HIS F 1 150 ? -58.836 -52.707 -36.764 1.00 64.76  ? 798  HIS B CB    1 
ATOM   9589  C  CG    . HIS F 1 150 ? -58.091 -51.456 -36.420 1.00 68.69  ? 798  HIS B CG    1 
ATOM   9590  N  ND1   . HIS F 1 150 ? -56.735 -51.316 -36.630 1.00 67.88  ? 798  HIS B ND1   1 
ATOM   9591  C  CD2   . HIS F 1 150 ? -58.508 -50.291 -35.872 1.00 68.48  ? 798  HIS B CD2   1 
ATOM   9592  C  CE1   . HIS F 1 150 ? -56.352 -50.117 -36.234 1.00 62.73  ? 798  HIS B CE1   1 
ATOM   9593  N  NE2   . HIS F 1 150 ? -57.408 -49.475 -35.769 1.00 65.64  ? 798  HIS B NE2   1 
ATOM   9594  N  N     . TRP F 1 151 ? -56.696 -54.171 -34.299 1.00 65.04  ? 799  TRP B N     1 
ATOM   9595  C  CA    . TRP F 1 151 ? -56.382 -54.328 -32.883 1.00 64.21  ? 799  TRP B CA    1 
ATOM   9596  C  C     . TRP F 1 151 ? -56.344 -53.035 -32.081 1.00 63.86  ? 799  TRP B C     1 
ATOM   9597  O  O     . TRP F 1 151 ? -55.948 -51.985 -32.584 1.00 65.05  ? 799  TRP B O     1 
ATOM   9598  C  CB    . TRP F 1 151 ? -55.063 -55.075 -32.707 1.00 67.96  ? 799  TRP B CB    1 
ATOM   9599  C  CG    . TRP F 1 151 ? -55.148 -56.528 -33.063 1.00 71.61  ? 799  TRP B CG    1 
ATOM   9600  C  CD1   . TRP F 1 151 ? -54.622 -57.137 -34.167 1.00 72.22  ? 799  TRP B CD1   1 
ATOM   9601  C  CD2   . TRP F 1 151 ? -55.805 -57.556 -32.316 1.00 69.77  ? 799  TRP B CD2   1 
ATOM   9602  N  NE1   . TRP F 1 151 ? -54.907 -58.480 -34.149 1.00 71.91  ? 799  TRP B NE1   1 
ATOM   9603  C  CE2   . TRP F 1 151 ? -55.633 -58.764 -33.023 1.00 70.50  ? 799  TRP B CE2   1 
ATOM   9604  C  CE3   . TRP F 1 151 ? -56.522 -57.573 -31.116 1.00 67.73  ? 799  TRP B CE3   1 
ATOM   9605  C  CZ2   . TRP F 1 151 ? -56.150 -59.974 -32.573 1.00 71.51  ? 799  TRP B CZ2   1 
ATOM   9606  C  CZ3   . TRP F 1 151 ? -57.035 -58.774 -30.669 1.00 68.29  ? 799  TRP B CZ3   1 
ATOM   9607  C  CH2   . TRP F 1 151 ? -56.847 -59.960 -31.396 1.00 71.09  ? 799  TRP B CH2   1 
ATOM   9608  N  N     . PHE F 1 152 ? -56.768 -53.126 -30.825 1.00 61.15  ? 800  PHE B N     1 
ATOM   9609  C  CA    . PHE F 1 152 ? -56.593 -52.038 -29.875 1.00 57.89  ? 800  PHE B CA    1 
ATOM   9610  C  C     . PHE F 1 152 ? -55.327 -52.289 -29.081 1.00 58.33  ? 800  PHE B C     1 
ATOM   9611  O  O     . PHE F 1 152 ? -54.833 -53.411 -29.021 1.00 62.65  ? 800  PHE B O     1 
ATOM   9612  C  CB    . PHE F 1 152 ? -57.780 -51.945 -28.919 1.00 55.06  ? 800  PHE B CB    1 
ATOM   9613  C  CG    . PHE F 1 152 ? -58.921 -51.130 -29.447 1.00 56.33  ? 800  PHE B CG    1 
ATOM   9614  C  CD1   . PHE F 1 152 ? -58.938 -49.760 -29.291 1.00 56.16  ? 800  PHE B CD1   1 
ATOM   9615  C  CD2   . PHE F 1 152 ? -59.977 -51.731 -30.097 1.00 58.70  ? 800  PHE B CD2   1 
ATOM   9616  C  CE1   . PHE F 1 152 ? -59.984 -49.005 -29.779 1.00 54.64  ? 800  PHE B CE1   1 
ATOM   9617  C  CE2   . PHE F 1 152 ? -61.028 -50.978 -30.583 1.00 57.71  ? 800  PHE B CE2   1 
ATOM   9618  C  CZ    . PHE F 1 152 ? -61.029 -49.615 -30.422 1.00 56.19  ? 800  PHE B CZ    1 
ATOM   9619  N  N     . CYS F 1 153 ? -54.804 -51.238 -28.470 1.00 58.13  ? 801  CYS B N     1 
ATOM   9620  C  CA    . CYS F 1 153 ? -53.633 -51.360 -27.618 1.00 56.73  ? 801  CYS B CA    1 
ATOM   9621  C  C     . CYS F 1 153 ? -53.951 -50.823 -26.224 1.00 57.21  ? 801  CYS B C     1 
ATOM   9622  O  O     . CYS F 1 153 ? -54.608 -49.794 -26.078 1.00 57.28  ? 801  CYS B O     1 
ATOM   9623  C  CB    . CYS F 1 153 ? -52.450 -50.610 -28.229 1.00 54.98  ? 801  CYS B CB    1 
ATOM   9624  S  SG    . CYS F 1 153 ? -50.989 -50.598 -27.186 1.00 59.22  ? 801  CYS B SG    1 
ATOM   9625  N  N     . ALA F 1 154 ? -53.495 -51.526 -25.198 1.00 56.39  ? 802  ALA B N     1 
ATOM   9626  C  CA    . ALA F 1 154 ? -53.794 -51.128 -23.831 1.00 58.06  ? 802  ALA B CA    1 
ATOM   9627  C  C     . ALA F 1 154 ? -52.748 -50.166 -23.305 1.00 58.58  ? 802  ALA B C     1 
ATOM   9628  O  O     . ALA F 1 154 ? -51.604 -50.170 -23.763 1.00 58.55  ? 802  ALA B O     1 
ATOM   9629  C  CB    . ALA F 1 154 ? -53.875 -52.344 -22.932 1.00 61.96  ? 802  ALA B CB    1 
ATOM   9630  N  N     . GLY F 1 155 ? -53.142 -49.353 -22.332 1.00 57.62  ? 803  GLY B N     1 
ATOM   9631  C  CA    . GLY F 1 155 ? -52.219 -48.438 -21.694 1.00 58.12  ? 803  GLY B CA    1 
ATOM   9632  C  C     . GLY F 1 155 ? -51.005 -49.139 -21.122 1.00 59.96  ? 803  GLY B C     1 
ATOM   9633  O  O     . GLY F 1 155 ? -49.875 -48.689 -21.301 1.00 58.63  ? 803  GLY B O     1 
ATOM   9634  N  N     . THR F 1 156 ? -51.241 -50.252 -20.435 1.00 61.46  ? 804  THR B N     1 
ATOM   9635  C  CA    . THR F 1 156 ? -50.163 -51.010 -19.803 1.00 61.26  ? 804  THR B CA    1 
ATOM   9636  C  C     . THR F 1 156 ? -49.106 -51.466 -20.812 1.00 58.13  ? 804  THR B C     1 
ATOM   9637  O  O     . THR F 1 156 ? -47.964 -51.742 -20.444 1.00 57.82  ? 804  THR B O     1 
ATOM   9638  C  CB    . THR F 1 156 ? -50.709 -52.241 -19.060 1.00 58.44  ? 804  THR B CB    1 
ATOM   9639  N  N     . ASP F 1 157 ? -49.487 -51.521 -22.085 1.00 56.90  ? 805  ASP B N     1 
ATOM   9640  C  CA    . ASP F 1 157 ? -48.601 -52.027 -23.130 1.00 58.28  ? 805  ASP B CA    1 
ATOM   9641  C  C     . ASP F 1 157 ? -47.804 -50.918 -23.831 1.00 57.85  ? 805  ASP B C     1 
ATOM   9642  O  O     . ASP F 1 157 ? -47.015 -51.186 -24.737 1.00 54.87  ? 805  ASP B O     1 
ATOM   9643  C  CB    . ASP F 1 157 ? -49.396 -52.833 -24.167 1.00 61.25  ? 805  ASP B CB    1 
ATOM   9644  C  CG    . ASP F 1 157 ? -50.213 -53.971 -23.542 1.00 67.10  ? 805  ASP B CG    1 
ATOM   9645  O  OD1   . ASP F 1 157 ? -49.753 -54.573 -22.541 1.00 68.01  ? 805  ASP B OD1   1 
ATOM   9646  O  OD2   . ASP F 1 157 ? -51.316 -54.268 -24.062 1.00 64.12  ? 805  ASP B OD2   1 
ATOM   9647  N  N     . THR F 1 158 ? -48.020 -49.675 -23.413 1.00 60.21  ? 806  THR B N     1 
ATOM   9648  C  CA    . THR F 1 158 ? -47.310 -48.530 -23.979 1.00 56.82  ? 806  THR B CA    1 
ATOM   9649  C  C     . THR F 1 158 ? -46.284 -48.009 -22.997 1.00 54.65  ? 806  THR B C     1 
ATOM   9650  O  O     . THR F 1 158 ? -46.172 -48.505 -21.874 1.00 55.05  ? 806  THR B O     1 
ATOM   9651  C  CB    . THR F 1 158 ? -48.269 -47.367 -24.276 1.00 56.53  ? 806  THR B CB    1 
ATOM   9652  O  OG1   . THR F 1 158 ? -48.940 -46.990 -23.066 1.00 57.44  ? 806  THR B OG1   1 
ATOM   9653  C  CG2   . THR F 1 158 ? -49.317 -47.784 -25.274 1.00 53.35  ? 806  THR B CG2   1 
ATOM   9654  N  N     . VAL F 1 159 ? -45.556 -46.982 -23.413 1.00 52.93  ? 807  VAL B N     1 
ATOM   9655  C  CA    . VAL F 1 159 ? -44.563 -46.378 -22.544 1.00 52.41  ? 807  VAL B CA    1 
ATOM   9656  C  C     . VAL F 1 159 ? -45.166 -45.995 -21.203 1.00 51.77  ? 807  VAL B C     1 
ATOM   9657  O  O     . VAL F 1 159 ? -44.475 -46.003 -20.191 1.00 51.22  ? 807  VAL B O     1 
ATOM   9658  C  CB    . VAL F 1 159 ? -43.951 -45.128 -23.157 1.00 51.13  ? 807  VAL B CB    1 
ATOM   9659  C  CG1   . VAL F 1 159 ? -42.552 -44.947 -22.617 1.00 49.11  ? 807  VAL B CG1   1 
ATOM   9660  C  CG2   . VAL F 1 159 ? -43.936 -45.227 -24.674 1.00 55.02  ? 807  VAL B CG2   1 
ATOM   9661  N  N     . LEU F 1 160 ? -46.451 -45.650 -21.206 1.00 53.25  ? 808  LEU B N     1 
ATOM   9662  C  CA    . LEU F 1 160 ? -47.141 -45.264 -19.982 1.00 55.03  ? 808  LEU B CA    1 
ATOM   9663  C  C     . LEU F 1 160 ? -46.937 -46.328 -18.916 1.00 57.04  ? 808  LEU B C     1 
ATOM   9664  O  O     . LEU F 1 160 ? -46.766 -46.022 -17.735 1.00 57.02  ? 808  LEU B O     1 
ATOM   9665  C  CB    . LEU F 1 160 ? -48.639 -45.062 -20.235 1.00 57.34  ? 808  LEU B CB    1 
ATOM   9666  C  CG    . LEU F 1 160 ? -49.150 -43.728 -20.798 1.00 54.78  ? 808  LEU B CG    1 
ATOM   9667  C  CD1   . LEU F 1 160 ? -48.098 -42.639 -20.677 1.00 50.90  ? 808  LEU B CD1   1 
ATOM   9668  C  CD2   . LEU F 1 160 ? -49.639 -43.869 -22.234 1.00 49.63  ? 808  LEU B CD2   1 
ATOM   9669  N  N     . GLY F 1 161 ? -46.947 -47.584 -19.344 1.00 54.63  ? 809  GLY B N     1 
ATOM   9670  C  CA    . GLY F 1 161 ? -46.796 -48.682 -18.416 1.00 57.67  ? 809  GLY B CA    1 
ATOM   9671  C  C     . GLY F 1 161 ? -47.939 -48.739 -17.423 1.00 60.52  ? 809  GLY B C     1 
ATOM   9672  O  O     . GLY F 1 161 ? -49.109 -48.726 -17.809 1.00 60.93  ? 809  GLY B O     1 
ATOM   9673  N  N     . ALA F 1 162 ? -47.598 -48.793 -16.138 1.00 61.25  ? 810  ALA B N     1 
ATOM   9674  C  CA    . ALA F 1 162 ? -48.593 -48.977 -15.084 1.00 62.41  ? 810  ALA B CA    1 
ATOM   9675  C  C     . ALA F 1 162 ? -49.297 -47.682 -14.694 1.00 63.53  ? 810  ALA B C     1 
ATOM   9676  O  O     . ALA F 1 162 ? -50.368 -47.709 -14.077 1.00 63.42  ? 810  ALA B O     1 
ATOM   9677  C  CB    . ALA F 1 162 ? -47.954 -49.614 -13.867 1.00 63.65  ? 810  ALA B CB    1 
ATOM   9678  N  N     . THR F 1 163 ? -48.687 -46.554 -15.051 1.00 61.44  ? 811  THR B N     1 
ATOM   9679  C  CA    . THR F 1 163 ? -49.257 -45.242 -14.773 1.00 61.04  ? 811  THR B CA    1 
ATOM   9680  C  C     . THR F 1 163 ? -50.500 -45.031 -15.615 1.00 62.37  ? 811  THR B C     1 
ATOM   9681  O  O     . THR F 1 163 ? -51.221 -44.051 -15.441 1.00 64.60  ? 811  THR B O     1 
ATOM   9682  C  CB    . THR F 1 163 ? -48.280 -44.128 -15.143 1.00 58.31  ? 811  THR B CB    1 
ATOM   9683  O  OG1   . THR F 1 163 ? -48.204 -44.025 -16.569 1.00 56.93  ? 811  THR B OG1   1 
ATOM   9684  C  CG2   . THR F 1 163 ? -46.902 -44.422 -14.585 1.00 58.69  ? 811  THR B CG2   1 
ATOM   9685  N  N     . SER F 1 164 ? -50.742 -45.951 -16.537 1.00 61.36  ? 812  SER B N     1 
ATOM   9686  C  CA    . SER F 1 164 ? -51.836 -45.803 -17.481 1.00 63.36  ? 812  SER B CA    1 
ATOM   9687  C  C     . SER F 1 164 ? -53.215 -45.980 -16.845 1.00 68.91  ? 812  SER B C     1 
ATOM   9688  O  O     . SER F 1 164 ? -53.376 -46.711 -15.865 1.00 68.98  ? 812  SER B O     1 
ATOM   9689  C  CB    . SER F 1 164 ? -51.672 -46.784 -18.636 1.00 59.96  ? 812  SER B CB    1 
ATOM   9690  O  OG    . SER F 1 164 ? -52.714 -46.605 -19.574 1.00 61.14  ? 812  SER B OG    1 
ATOM   9691  N  N     . ASP F 1 165 ? -54.202 -45.296 -17.417 1.00 70.21  ? 813  ASP B N     1 
ATOM   9692  C  CA    . ASP F 1 165 ? -55.600 -45.462 -17.033 1.00 71.86  ? 813  ASP B CA    1 
ATOM   9693  C  C     . ASP F 1 165 ? -56.089 -46.840 -17.474 1.00 73.03  ? 813  ASP B C     1 
ATOM   9694  O  O     . ASP F 1 165 ? -56.132 -47.139 -18.669 1.00 74.07  ? 813  ASP B O     1 
ATOM   9695  C  CB    . ASP F 1 165 ? -56.458 -44.363 -17.669 1.00 71.58  ? 813  ASP B CB    1 
ATOM   9696  C  CG    . ASP F 1 165 ? -57.941 -44.536 -17.388 1.00 73.39  ? 813  ASP B CG    1 
ATOM   9697  O  OD1   . ASP F 1 165 ? -58.340 -45.622 -16.914 1.00 74.32  ? 813  ASP B OD1   1 
ATOM   9698  O  OD2   . ASP F 1 165 ? -58.710 -43.586 -17.650 1.00 71.93  ? 813  ASP B OD2   1 
ATOM   9699  N  N     . PRO F 1 166 ? -56.465 -47.683 -16.507 1.00 72.47  ? 814  PRO B N     1 
ATOM   9700  C  CA    . PRO F 1 166 ? -56.824 -49.076 -16.787 1.00 75.45  ? 814  PRO B CA    1 
ATOM   9701  C  C     . PRO F 1 166 ? -57.909 -49.242 -17.852 1.00 76.65  ? 814  PRO B C     1 
ATOM   9702  O  O     . PRO F 1 166 ? -58.049 -50.337 -18.396 1.00 78.27  ? 814  PRO B O     1 
ATOM   9703  C  CB    . PRO F 1 166 ? -57.324 -49.578 -15.430 1.00 76.50  ? 814  PRO B CB    1 
ATOM   9704  C  CG    . PRO F 1 166 ? -56.596 -48.742 -14.438 1.00 73.71  ? 814  PRO B CG    1 
ATOM   9705  C  CD    . PRO F 1 166 ? -56.518 -47.381 -15.067 1.00 73.56  ? 814  PRO B CD    1 
ATOM   9706  N  N     . LEU F 1 167 ? -58.657 -48.185 -18.151 1.00 74.63  ? 815  LEU B N     1 
ATOM   9707  C  CA    . LEU F 1 167 ? -59.768 -48.290 -19.096 1.00 75.48  ? 815  LEU B CA    1 
ATOM   9708  C  C     . LEU F 1 167 ? -59.481 -47.637 -20.445 1.00 72.42  ? 815  LEU B C     1 
ATOM   9709  O  O     . LEU F 1 167 ? -60.358 -47.561 -21.308 1.00 69.57  ? 815  LEU B O     1 
ATOM   9710  C  CB    . LEU F 1 167 ? -61.039 -47.681 -18.498 1.00 76.12  ? 815  LEU B CB    1 
ATOM   9711  C  CG    . LEU F 1 167 ? -61.652 -48.358 -17.271 1.00 86.79  ? 815  LEU B CG    1 
ATOM   9712  C  CD1   . LEU F 1 167 ? -62.851 -47.558 -16.784 1.00 83.49  ? 815  LEU B CD1   1 
ATOM   9713  C  CD2   . LEU F 1 167 ? -62.053 -49.801 -17.572 1.00 78.70  ? 815  LEU B CD2   1 
ATOM   9714  N  N     . GLU F 1 168 ? -58.256 -47.165 -20.629 1.00 69.90  ? 816  GLU B N     1 
ATOM   9715  C  CA    . GLU F 1 168 ? -57.928 -46.420 -21.832 1.00 64.39  ? 816  GLU B CA    1 
ATOM   9716  C  C     . GLU F 1 168 ? -57.200 -47.270 -22.853 1.00 59.72  ? 816  GLU B C     1 
ATOM   9717  O  O     . GLU F 1 168 ? -56.163 -47.857 -22.565 1.00 60.31  ? 816  GLU B O     1 
ATOM   9718  C  CB    . GLU F 1 168 ? -57.101 -45.183 -21.492 1.00 66.05  ? 816  GLU B CB    1 
ATOM   9719  C  CG    . GLU F 1 168 ? -56.793 -44.301 -22.692 1.00 63.13  ? 816  GLU B CG    1 
ATOM   9720  C  CD    . GLU F 1 168 ? -56.318 -42.915 -22.292 1.00 63.05  ? 816  GLU B CD    1 
ATOM   9721  O  OE1   . GLU F 1 168 ? -55.919 -42.734 -21.119 1.00 66.10  ? 816  GLU B OE1   1 
ATOM   9722  O  OE2   . GLU F 1 168 ? -56.353 -42.003 -23.148 1.00 60.21  ? 816  GLU B OE2   1 
ATOM   9723  N  N     . LEU F 1 169 ? -57.757 -47.325 -24.054 1.00 59.38  ? 817  LEU B N     1 
ATOM   9724  C  CA    . LEU F 1 169 ? -57.144 -48.049 -25.155 1.00 57.09  ? 817  LEU B CA    1 
ATOM   9725  C  C     . LEU F 1 169 ? -56.543 -47.060 -26.136 1.00 55.57  ? 817  LEU B C     1 
ATOM   9726  O  O     . LEU F 1 169 ? -56.772 -45.858 -26.032 1.00 56.03  ? 817  LEU B O     1 
ATOM   9727  C  CB    . LEU F 1 169 ? -58.181 -48.914 -25.868 1.00 54.49  ? 817  LEU B CB    1 
ATOM   9728  C  CG    . LEU F 1 169 ? -58.889 -49.920 -24.965 1.00 61.21  ? 817  LEU B CG    1 
ATOM   9729  C  CD1   . LEU F 1 169 ? -59.921 -50.719 -25.749 1.00 60.30  ? 817  LEU B CD1   1 
ATOM   9730  C  CD2   . LEU F 1 169 ? -57.869 -50.833 -24.306 1.00 59.51  ? 817  LEU B CD2   1 
ATOM   9731  N  N     . PHE F 1 170 ? -55.774 -47.574 -27.088 1.00 54.55  ? 818  PHE B N     1 
ATOM   9732  C  CA    . PHE F 1 170 ? -55.160 -46.743 -28.112 1.00 53.06  ? 818  PHE B CA    1 
ATOM   9733  C  C     . PHE F 1 170 ? -55.226 -47.438 -29.456 1.00 52.10  ? 818  PHE B C     1 
ATOM   9734  O  O     . PHE F 1 170 ? -54.864 -48.607 -29.576 1.00 52.79  ? 818  PHE B O     1 
ATOM   9735  C  CB    . PHE F 1 170 ? -53.701 -46.433 -27.757 1.00 51.47  ? 818  PHE B CB    1 
ATOM   9736  C  CG    . PHE F 1 170 ? -53.544 -45.638 -26.495 1.00 50.91  ? 818  PHE B CG    1 
ATOM   9737  C  CD1   . PHE F 1 170 ? -53.467 -46.269 -25.269 1.00 52.09  ? 818  PHE B CD1   1 
ATOM   9738  C  CD2   . PHE F 1 170 ? -53.492 -44.256 -26.533 1.00 52.46  ? 818  PHE B CD2   1 
ATOM   9739  C  CE1   . PHE F 1 170 ? -53.334 -45.539 -24.103 1.00 53.40  ? 818  PHE B CE1   1 
ATOM   9740  C  CE2   . PHE F 1 170 ? -53.358 -43.524 -25.368 1.00 50.90  ? 818  PHE B CE2   1 
ATOM   9741  C  CZ    . PHE F 1 170 ? -53.279 -44.167 -24.154 1.00 50.47  ? 818  PHE B CZ    1 
ATOM   9742  N  N     . LEU F 1 171 ? -55.704 -46.723 -30.465 1.00 51.12  ? 819  LEU B N     1 
ATOM   9743  C  CA    . LEU F 1 171 ? -55.657 -47.233 -31.823 1.00 52.96  ? 819  LEU B CA    1 
ATOM   9744  C  C     . LEU F 1 171 ? -54.212 -47.539 -32.164 1.00 52.68  ? 819  LEU B C     1 
ATOM   9745  O  O     . LEU F 1 171 ? -53.311 -46.828 -31.729 1.00 54.01  ? 819  LEU B O     1 
ATOM   9746  C  CB    . LEU F 1 171 ? -56.210 -46.205 -32.804 1.00 52.72  ? 819  LEU B CB    1 
ATOM   9747  C  CG    . LEU F 1 171 ? -57.667 -45.798 -32.617 1.00 53.76  ? 819  LEU B CG    1 
ATOM   9748  C  CD1   . LEU F 1 171 ? -58.100 -44.910 -33.771 1.00 51.72  ? 819  LEU B CD1   1 
ATOM   9749  C  CD2   . LEU F 1 171 ? -58.557 -47.033 -32.506 1.00 54.16  ? 819  LEU B CD2   1 
ATOM   9750  N  N     . VAL F 1 172 ? -53.989 -48.597 -32.934 1.00 52.04  ? 820  VAL B N     1 
ATOM   9751  C  CA    . VAL F 1 172 ? -52.638 -48.981 -33.314 1.00 52.03  ? 820  VAL B CA    1 
ATOM   9752  C  C     . VAL F 1 172 ? -52.642 -49.687 -34.673 1.00 56.52  ? 820  VAL B C     1 
ATOM   9753  O  O     . VAL F 1 172 ? -53.633 -50.295 -35.067 1.00 59.58  ? 820  VAL B O     1 
ATOM   9754  C  CB    . VAL F 1 172 ? -51.992 -49.863 -32.232 1.00 50.98  ? 820  VAL B CB    1 
ATOM   9755  C  CG1   . VAL F 1 172 ? -52.579 -51.254 -32.268 1.00 59.33  ? 820  VAL B CG1   1 
ATOM   9756  C  CG2   . VAL F 1 172 ? -50.487 -49.915 -32.413 1.00 58.15  ? 820  VAL B CG2   1 
ATOM   9757  N  N     . GLY F 1 173 ? -51.534 -49.595 -35.395 1.00 57.55  ? 821  GLY B N     1 
ATOM   9758  C  CA    . GLY F 1 173 ? -51.472 -50.122 -36.747 1.00 59.86  ? 821  GLY B CA    1 
ATOM   9759  C  C     . GLY F 1 173 ? -51.306 -51.627 -36.858 1.00 63.79  ? 821  GLY B C     1 
ATOM   9760  O  O     . GLY F 1 173 ? -50.589 -52.112 -37.732 1.00 63.36  ? 821  GLY B O     1 
ATOM   9761  N  N     . GLU F 1 174 ? -51.964 -52.368 -35.973 1.00 64.60  ? 822  GLU B N     1 
ATOM   9762  C  CA    . GLU F 1 174 ? -51.975 -53.824 -36.054 1.00 65.17  ? 822  GLU B CA    1 
ATOM   9763  C  C     . GLU F 1 174 ? -53.381 -54.323 -36.365 1.00 69.36  ? 822  GLU B C     1 
ATOM   9764  O  O     . GLU F 1 174 ? -54.354 -53.904 -35.730 1.00 68.91  ? 822  GLU B O     1 
ATOM   9765  C  CB    . GLU F 1 174 ? -51.504 -54.446 -34.746 1.00 66.00  ? 822  GLU B CB    1 
ATOM   9766  C  CG    . GLU F 1 174 ? -50.068 -54.159 -34.367 1.00 71.91  ? 822  GLU B CG    1 
ATOM   9767  C  CD    . GLU F 1 174 ? -49.710 -54.777 -33.022 1.00 84.72  ? 822  GLU B CD    1 
ATOM   9768  O  OE1   . GLU F 1 174 ? -49.960 -55.992 -32.836 1.00 88.06  ? 822  GLU B OE1   1 
ATOM   9769  O  OE2   . GLU F 1 174 ? -49.200 -54.046 -32.143 1.00 86.79  ? 822  GLU B OE2   1 
ATOM   9770  N  N     . CYS F 1 175 ? -53.484 -55.223 -37.339 1.00 71.78  ? 823  CYS B N     1 
ATOM   9771  C  CA    . CYS F 1 175 ? -54.768 -55.799 -37.722 1.00 72.40  ? 823  CYS B CA    1 
ATOM   9772  C  C     . CYS F 1 175 ? -54.571 -57.055 -38.566 1.00 75.59  ? 823  CYS B C     1 
ATOM   9773  O  O     . CYS F 1 175 ? -53.804 -57.047 -39.531 1.00 75.68  ? 823  CYS B O     1 
ATOM   9774  C  CB    . CYS F 1 175 ? -55.594 -54.781 -38.503 1.00 69.74  ? 823  CYS B CB    1 
ATOM   9775  S  SG    . CYS F 1 175 ? -54.924 -54.419 -40.125 1.00 65.79  ? 823  CYS B SG    1 
ATOM   9776  N  N     . GLU F 1 176 ? -55.271 -58.127 -38.200 1.00 74.19  ? 824  GLU B N     1 
ATOM   9777  C  CA    . GLU F 1 176 ? -55.177 -59.399 -38.907 1.00 70.94  ? 824  GLU B CA    1 
ATOM   9778  C  C     . GLU F 1 176 ? -56.557 -60.026 -39.092 1.00 72.73  ? 824  GLU B C     1 
ATOM   9779  O  O     . GLU F 1 176 ? -57.560 -59.464 -38.658 1.00 74.11  ? 824  GLU B O     1 
ATOM   9780  C  CB    . GLU F 1 176 ? -54.279 -60.356 -38.129 1.00 73.21  ? 824  GLU B CB    1 
ATOM   9781  C  CG    . GLU F 1 176 ? -54.832 -60.753 -36.770 1.00 74.57  ? 824  GLU B CG    1 
ATOM   9782  C  CD    . GLU F 1 176 ? -53.944 -61.754 -36.047 1.00 78.24  ? 824  GLU B CD    1 
ATOM   9783  O  OE1   . GLU F 1 176 ? -54.488 -62.664 -35.382 1.00 78.79  ? 824  GLU B OE1   1 
ATOM   9784  O  OE2   . GLU F 1 176 ? -52.702 -61.628 -36.140 1.00 76.64  ? 824  GLU B OE2   1 
ATOM   9785  N  N     . ASN F 1 177 ? -56.605 -61.193 -39.731 1.00 74.86  ? 825  ASN B N     1 
ATOM   9786  C  CA    . ASN F 1 177 ? -57.861 -61.911 -39.926 1.00 71.61  ? 825  ASN B CA    1 
ATOM   9787  C  C     . ASN F 1 177 ? -57.973 -63.093 -38.972 1.00 73.13  ? 825  ASN B C     1 
ATOM   9788  O  O     . ASN F 1 177 ? -56.968 -63.713 -38.625 1.00 70.94  ? 825  ASN B O     1 
ATOM   9789  C  CB    . ASN F 1 177 ? -57.979 -62.398 -41.368 1.00 68.41  ? 825  ASN B CB    1 
ATOM   9790  C  CG    . ASN F 1 177 ? -57.429 -61.402 -42.362 1.00 70.77  ? 825  ASN B CG    1 
ATOM   9791  O  OD1   . ASN F 1 177 ? -58.168 -60.605 -42.941 1.00 69.75  ? 825  ASN B OD1   1 
ATOM   9792  N  ND2   . ASN F 1 177 ? -56.116 -61.435 -42.561 1.00 72.44  ? 825  ASN B ND2   1 
ATOM   9793  N  N     . MET F 1 178 ? -59.193 -63.396 -38.539 1.00 77.13  ? 826  MET B N     1 
ATOM   9794  C  CA    . MET F 1 178 ? -59.427 -64.544 -37.663 1.00 80.06  ? 826  MET B CA    1 
ATOM   9795  C  C     . MET F 1 178 ? -60.752 -65.251 -37.954 1.00 81.33  ? 826  MET B C     1 
ATOM   9796  O  O     . MET F 1 178 ? -61.656 -64.679 -38.565 1.00 81.76  ? 826  MET B O     1 
ATOM   9797  C  CB    . MET F 1 178 ? -59.418 -64.119 -36.196 1.00 77.20  ? 826  MET B CB    1 
ATOM   9798  C  CG    . MET F 1 178 ? -58.263 -63.237 -35.791 1.00 77.70  ? 826  MET B CG    1 
ATOM   9799  S  SD    . MET F 1 178 ? -58.303 -62.940 -34.012 1.00 90.22  ? 826  MET B SD    1 
ATOM   9800  C  CE    . MET F 1 178 ? -57.181 -64.218 -33.437 1.00 86.44  ? 826  MET B CE    1 
ATOM   9801  N  N     . GLN F 1 179 ? -60.864 -66.495 -37.504 1.00 79.81  ? 827  GLN B N     1 
ATOM   9802  C  CA    . GLN F 1 179 ? -62.130 -67.206 -37.563 1.00 81.39  ? 827  GLN B CA    1 
ATOM   9803  C  C     . GLN F 1 179 ? -63.032 -66.666 -36.463 1.00 77.07  ? 827  GLN B C     1 
ATOM   9804  O  O     . GLN F 1 179 ? -62.588 -66.482 -35.330 1.00 75.53  ? 827  GLN B O     1 
ATOM   9805  C  CB    . GLN F 1 179 ? -61.908 -68.706 -37.375 1.00 86.58  ? 827  GLN B CB    1 
ATOM   9806  C  CG    . GLN F 1 179 ? -63.188 -69.536 -37.386 1.00 88.52  ? 827  GLN B CG    1 
ATOM   9807  C  CD    . GLN F 1 179 ? -62.912 -71.026 -37.344 1.00 89.73  ? 827  GLN B CD    1 
ATOM   9808  O  OE1   . GLN F 1 179 ? -61.824 -71.456 -36.957 1.00 91.84  ? 827  GLN B OE1   1 
ATOM   9809  N  NE2   . GLN F 1 179 ? -63.895 -71.824 -37.752 1.00 92.53  ? 827  GLN B NE2   1 
ATOM   9810  N  N     . LEU F 1 180 ? -64.292 -66.404 -36.796 1.00 73.85  ? 828  LEU B N     1 
ATOM   9811  C  CA    . LEU F 1 180 ? -65.208 -65.805 -35.835 1.00 74.83  ? 828  LEU B CA    1 
ATOM   9812  C  C     . LEU F 1 180 ? -65.095 -66.508 -34.493 1.00 76.32  ? 828  LEU B C     1 
ATOM   9813  O  O     . LEU F 1 180 ? -65.202 -65.885 -33.439 1.00 74.99  ? 828  LEU B O     1 
ATOM   9814  C  CB    . LEU F 1 180 ? -66.654 -65.856 -36.336 1.00 71.95  ? 828  LEU B CB    1 
ATOM   9815  C  CG    . LEU F 1 180 ? -66.992 -65.129 -37.640 1.00 71.43  ? 828  LEU B CG    1 
ATOM   9816  C  CD1   . LEU F 1 180 ? -68.477 -65.233 -37.937 1.00 70.10  ? 828  LEU B CD1   1 
ATOM   9817  C  CD2   . LEU F 1 180 ? -66.566 -63.681 -37.577 1.00 69.02  ? 828  LEU B CD2   1 
ATOM   9818  N  N     . SER F 1 181 ? -64.859 -67.813 -34.543 1.00 81.23  ? 829  SER B N     1 
ATOM   9819  C  CA    . SER F 1 181 ? -64.800 -68.633 -33.337 1.00 84.62  ? 829  SER B CA    1 
ATOM   9820  C  C     . SER F 1 181 ? -63.822 -68.101 -32.289 1.00 84.70  ? 829  SER B C     1 
ATOM   9821  O  O     . SER F 1 181 ? -64.002 -68.344 -31.093 1.00 84.52  ? 829  SER B O     1 
ATOM   9822  C  CB    . SER F 1 181 ? -64.441 -70.073 -33.697 1.00 83.51  ? 829  SER B CB    1 
ATOM   9823  O  OG    . SER F 1 181 ? -63.227 -70.116 -34.424 1.00 84.55  ? 829  SER B OG    1 
ATOM   9824  N  N     . TYR F 1 182 ? -62.791 -67.382 -32.733 1.00 82.89  ? 830  TYR B N     1 
ATOM   9825  C  CA    . TYR F 1 182 ? -61.770 -66.866 -31.820 1.00 82.15  ? 830  TYR B CA    1 
ATOM   9826  C  C     . TYR F 1 182 ? -62.331 -65.818 -30.856 1.00 78.21  ? 830  TYR B C     1 
ATOM   9827  O  O     . TYR F 1 182 ? -61.818 -65.644 -29.747 1.00 74.11  ? 830  TYR B O     1 
ATOM   9828  C  CB    . TYR F 1 182 ? -60.584 -66.286 -32.590 1.00 81.90  ? 830  TYR B CB    1 
ATOM   9829  C  CG    . TYR F 1 182 ? -59.603 -67.312 -33.114 1.00 83.89  ? 830  TYR B CG    1 
ATOM   9830  C  CD1   . TYR F 1 182 ? -59.523 -67.593 -34.472 1.00 85.40  ? 830  TYR B CD1   1 
ATOM   9831  C  CD2   . TYR F 1 182 ? -58.747 -67.989 -32.253 1.00 85.35  ? 830  TYR B CD2   1 
ATOM   9832  C  CE1   . TYR F 1 182 ? -58.622 -68.522 -34.960 1.00 88.26  ? 830  TYR B CE1   1 
ATOM   9833  C  CE2   . TYR F 1 182 ? -57.842 -68.924 -32.731 1.00 89.99  ? 830  TYR B CE2   1 
ATOM   9834  C  CZ    . TYR F 1 182 ? -57.784 -69.186 -34.088 1.00 93.49  ? 830  TYR B CZ    1 
ATOM   9835  O  OH    . TYR F 1 182 ? -56.888 -70.114 -34.578 1.00 96.43  ? 830  TYR B OH    1 
ATOM   9836  N  N     . ILE F 1 183 ? -63.383 -65.129 -31.289 1.00 74.39  ? 831  ILE B N     1 
ATOM   9837  C  CA    . ILE F 1 183 ? -64.047 -64.122 -30.467 1.00 72.31  ? 831  ILE B CA    1 
ATOM   9838  C  C     . ILE F 1 183 ? -64.484 -64.702 -29.124 1.00 71.54  ? 831  ILE B C     1 
ATOM   9839  O  O     . ILE F 1 183 ? -64.878 -65.863 -29.045 1.00 75.03  ? 831  ILE B O     1 
ATOM   9840  C  CB    . ILE F 1 183 ? -65.253 -63.520 -31.210 1.00 71.86  ? 831  ILE B CB    1 
ATOM   9841  C  CG1   . ILE F 1 183 ? -64.776 -62.823 -32.487 1.00 71.87  ? 831  ILE B CG1   1 
ATOM   9842  C  CG2   . ILE F 1 183 ? -66.023 -62.559 -30.310 1.00 68.21  ? 831  ILE B CG2   1 
ATOM   9843  C  CD1   . ILE F 1 183 ? -65.877 -62.516 -33.472 1.00 69.68  ? 831  ILE B CD1   1 
ATOM   9844  N  N     . HIS F 1 184 ? -64.400 -63.897 -28.070 1.00 66.78  ? 832  HIS B N     1 
ATOM   9845  C  CA    . HIS F 1 184 ? -64.698 -64.372 -26.724 1.00 69.39  ? 832  HIS B CA    1 
ATOM   9846  C  C     . HIS F 1 184 ? -65.940 -63.725 -26.141 1.00 70.63  ? 832  HIS B C     1 
ATOM   9847  O  O     . HIS F 1 184 ? -66.811 -64.402 -25.596 1.00 74.70  ? 832  HIS B O     1 
ATOM   9848  C  CB    . HIS F 1 184 ? -63.518 -64.120 -25.788 1.00 68.96  ? 832  HIS B CB    1 
ATOM   9849  C  CG    . HIS F 1 184 ? -63.888 -64.141 -24.338 1.00 71.23  ? 832  HIS B CG    1 
ATOM   9850  N  ND1   . HIS F 1 184 ? -63.456 -65.119 -23.472 1.00 75.67  ? 832  HIS B ND1   1 
ATOM   9851  C  CD2   . HIS F 1 184 ? -64.659 -63.302 -23.603 1.00 70.93  ? 832  HIS B CD2   1 
ATOM   9852  C  CE1   . HIS F 1 184 ? -63.940 -64.882 -22.263 1.00 74.97  ? 832  HIS B CE1   1 
ATOM   9853  N  NE2   . HIS F 1 184 ? -64.673 -63.786 -22.318 1.00 71.34  ? 832  HIS B NE2   1 
ATOM   9854  N  N     . SER F 1 185 ? -66.001 -62.404 -26.232 1.00 70.56  ? 833  SER B N     1 
ATOM   9855  C  CA    . SER F 1 185 ? -67.131 -61.645 -25.712 1.00 71.49  ? 833  SER B CA    1 
ATOM   9856  C  C     . SER F 1 185 ? -67.249 -60.352 -26.498 1.00 69.19  ? 833  SER B C     1 
ATOM   9857  O  O     . SER F 1 185 ? -66.312 -59.954 -27.188 1.00 68.98  ? 833  SER B O     1 
ATOM   9858  C  CB    . SER F 1 185 ? -66.952 -61.341 -24.225 1.00 69.97  ? 833  SER B CB    1 
ATOM   9859  N  N     . LYS F 1 186 ? -68.403 -59.702 -26.414 1.00 68.17  ? 834  LYS B N     1 
ATOM   9860  C  CA    . LYS F 1 186 ? -68.555 -58.405 -27.049 1.00 66.78  ? 834  LYS B CA    1 
ATOM   9861  C  C     . LYS F 1 186 ? -68.201 -57.344 -26.020 1.00 67.12  ? 834  LYS B C     1 
ATOM   9862  O  O     . LYS F 1 186 ? -68.458 -57.519 -24.824 1.00 67.34  ? 834  LYS B O     1 
ATOM   9863  C  CB    . LYS F 1 186 ? -69.975 -58.210 -27.592 1.00 67.91  ? 834  LYS B CB    1 
ATOM   9864  C  CG    . LYS F 1 186 ? -70.107 -57.049 -28.575 1.00 67.25  ? 834  LYS B CG    1 
ATOM   9865  C  CD    . LYS F 1 186 ? -71.434 -57.082 -29.328 1.00 69.15  ? 834  LYS B CD    1 
ATOM   9866  C  CE    . LYS F 1 186 ? -72.616 -56.905 -28.390 1.00 71.79  ? 834  LYS B CE    1 
ATOM   9867  N  NZ    . LYS F 1 186 ? -73.913 -57.124 -29.084 1.00 73.27  ? 834  LYS B NZ    1 
ATOM   9868  N  N     . VAL F 1 187 ? -67.584 -56.261 -26.481 1.00 66.06  ? 835  VAL B N     1 
ATOM   9869  C  CA    . VAL F 1 187 ? -67.171 -55.186 -25.591 1.00 65.92  ? 835  VAL B CA    1 
ATOM   9870  C  C     . VAL F 1 187 ? -67.592 -53.827 -26.144 1.00 65.06  ? 835  VAL B C     1 
ATOM   9871  O  O     . VAL F 1 187 ? -67.702 -53.644 -27.362 1.00 60.63  ? 835  VAL B O     1 
ATOM   9872  C  CB    . VAL F 1 187 ? -65.651 -55.205 -25.347 1.00 61.67  ? 835  VAL B CB    1 
ATOM   9873  C  CG1   . VAL F 1 187 ? -65.228 -56.533 -24.750 1.00 60.24  ? 835  VAL B CG1   1 
ATOM   9874  C  CG2   . VAL F 1 187 ? -64.913 -54.952 -26.640 1.00 62.78  ? 835  VAL B CG2   1 
ATOM   9875  N  N     . LYS F 1 188 ? -67.843 -52.889 -25.232 1.00 66.82  ? 836  LYS B N     1 
ATOM   9876  C  CA    . LYS F 1 188 ? -68.212 -51.520 -25.589 1.00 66.91  ? 836  LYS B CA    1 
ATOM   9877  C  C     . LYS F 1 188 ? -67.006 -50.591 -25.474 1.00 66.09  ? 836  LYS B C     1 
ATOM   9878  O  O     . LYS F 1 188 ? -66.386 -50.495 -24.415 1.00 66.43  ? 836  LYS B O     1 
ATOM   9879  C  CB    . LYS F 1 188 ? -69.352 -51.017 -24.699 1.00 65.23  ? 836  LYS B CB    1 
ATOM   9880  N  N     . VAL F 1 189 ? -66.676 -49.912 -26.569 1.00 64.50  ? 837  VAL B N     1 
ATOM   9881  C  CA    . VAL F 1 189 ? -65.523 -49.016 -26.595 1.00 65.28  ? 837  VAL B CA    1 
ATOM   9882  C  C     . VAL F 1 189 ? -65.879 -47.622 -27.122 1.00 65.71  ? 837  VAL B C     1 
ATOM   9883  O  O     . VAL F 1 189 ? -66.074 -47.426 -28.331 1.00 61.14  ? 837  VAL B O     1 
ATOM   9884  C  CB    . VAL F 1 189 ? -64.362 -49.608 -27.423 1.00 63.64  ? 837  VAL B CB    1 
ATOM   9885  C  CG1   . VAL F 1 189 ? -63.108 -48.755 -27.278 1.00 60.08  ? 837  VAL B CG1   1 
ATOM   9886  C  CG2   . VAL F 1 189 ? -64.083 -51.031 -26.988 1.00 64.04  ? 837  VAL B CG2   1 
ATOM   9887  N  N     . ILE F 1 190 ? -65.950 -46.669 -26.192 1.00 66.16  ? 838  ILE B N     1 
ATOM   9888  C  CA    . ILE F 1 190 ? -66.241 -45.264 -26.482 1.00 65.04  ? 838  ILE B CA    1 
ATOM   9889  C  C     . ILE F 1 190 ? -65.060 -44.523 -27.122 1.00 63.91  ? 838  ILE B C     1 
ATOM   9890  O  O     . ILE F 1 190 ? -63.898 -44.752 -26.767 1.00 60.88  ? 838  ILE B O     1 
ATOM   9891  C  CB    . ILE F 1 190 ? -66.589 -44.499 -25.182 1.00 64.83  ? 838  ILE B CB    1 
ATOM   9892  C  CG1   . ILE F 1 190 ? -67.762 -45.148 -24.450 1.00 69.80  ? 838  ILE B CG1   1 
ATOM   9893  C  CG2   . ILE F 1 190 ? -66.890 -43.042 -25.476 1.00 67.99  ? 838  ILE B CG2   1 
ATOM   9894  C  CD1   . ILE F 1 190 ? -68.162 -44.407 -23.178 1.00 72.62  ? 838  ILE B CD1   1 
ATOM   9895  N  N     . TYR F 1 191 ? -65.358 -43.626 -28.058 1.00 60.35  ? 839  TYR B N     1 
ATOM   9896  C  CA    . TYR F 1 191 ? -64.358 -42.676 -28.525 1.00 59.56  ? 839  TYR B CA    1 
ATOM   9897  C  C     . TYR F 1 191 ? -64.511 -41.350 -27.789 1.00 60.75  ? 839  TYR B C     1 
ATOM   9898  O  O     . TYR F 1 191 ? -65.529 -40.676 -27.918 1.00 62.10  ? 839  TYR B O     1 
ATOM   9899  C  CB    . TYR F 1 191 ? -64.473 -42.445 -30.028 1.00 59.81  ? 839  TYR B CB    1 
ATOM   9900  C  CG    . TYR F 1 191 ? -63.689 -41.246 -30.515 1.00 58.38  ? 839  TYR B CG    1 
ATOM   9901  C  CD1   . TYR F 1 191 ? -64.309 -40.238 -31.239 1.00 61.20  ? 839  TYR B CD1   1 
ATOM   9902  C  CD2   . TYR F 1 191 ? -62.333 -41.115 -30.236 1.00 57.73  ? 839  TYR B CD2   1 
ATOM   9903  C  CE1   . TYR F 1 191 ? -63.597 -39.132 -31.690 1.00 65.30  ? 839  TYR B CE1   1 
ATOM   9904  C  CE2   . TYR F 1 191 ? -61.607 -40.012 -30.679 1.00 60.70  ? 839  TYR B CE2   1 
ATOM   9905  C  CZ    . TYR F 1 191 ? -62.246 -39.020 -31.407 1.00 65.24  ? 839  TYR B CZ    1 
ATOM   9906  O  OH    . TYR F 1 191 ? -61.539 -37.920 -31.853 1.00 59.38  ? 839  TYR B OH    1 
ATOM   9907  N  N     . LYS F 1 192 ? -63.494 -40.981 -27.019 1.00 59.07  ? 840  LYS B N     1 
ATOM   9908  C  CA    . LYS F 1 192 ? -63.524 -39.750 -26.240 1.00 58.09  ? 840  LYS B CA    1 
ATOM   9909  C  C     . LYS F 1 192 ? -62.802 -38.609 -26.965 1.00 59.74  ? 840  LYS B C     1 
ATOM   9910  O  O     . LYS F 1 192 ? -61.688 -38.235 -26.606 1.00 60.39  ? 840  LYS B O     1 
ATOM   9911  C  CB    . LYS F 1 192 ? -62.915 -40.000 -24.856 1.00 56.48  ? 840  LYS B CB    1 
ATOM   9912  C  CG    . LYS F 1 192 ? -62.816 -38.787 -23.944 1.00 56.73  ? 840  LYS B CG    1 
ATOM   9913  C  CD    . LYS F 1 192 ? -62.374 -39.218 -22.551 1.00 58.03  ? 840  LYS B CD    1 
ATOM   9914  C  CE    . LYS F 1 192 ? -61.231 -38.364 -22.013 1.00 57.54  ? 840  LYS B CE    1 
ATOM   9915  N  NZ    . LYS F 1 192 ? -61.703 -37.082 -21.421 1.00 55.15  ? 840  LYS B NZ    1 
ATOM   9916  N  N     . ALA F 1 193 ? -63.440 -38.066 -27.998 1.00 57.76  ? 841  ALA B N     1 
ATOM   9917  C  CA    . ALA F 1 193 ? -62.913 -36.898 -28.686 1.00 58.51  ? 841  ALA B CA    1 
ATOM   9918  C  C     . ALA F 1 193 ? -62.732 -35.736 -27.703 1.00 65.68  ? 841  ALA B C     1 
ATOM   9919  O  O     . ALA F 1 193 ? -63.387 -35.694 -26.658 1.00 63.69  ? 841  ALA B O     1 
ATOM   9920  C  CB    . ALA F 1 193 ? -63.841 -36.498 -29.814 1.00 58.82  ? 841  ALA B CB    1 
ATOM   9921  N  N     . PRO F 1 194 ? -61.844 -34.779 -28.039 1.00 69.30  ? 842  PRO B N     1 
ATOM   9922  C  CA    . PRO F 1 194 ? -61.607 -33.627 -27.163 1.00 63.19  ? 842  PRO B CA    1 
ATOM   9923  C  C     . PRO F 1 194 ? -62.840 -32.724 -27.073 1.00 65.72  ? 842  PRO B C     1 
ATOM   9924  O  O     . PRO F 1 194 ? -63.595 -32.599 -28.044 1.00 62.42  ? 842  PRO B O     1 
ATOM   9925  C  CB    . PRO F 1 194 ? -60.475 -32.888 -27.879 1.00 61.17  ? 842  PRO B CB    1 
ATOM   9926  C  CG    . PRO F 1 194 ? -60.689 -33.208 -29.324 1.00 59.12  ? 842  PRO B CG    1 
ATOM   9927  C  CD    . PRO F 1 194 ? -61.108 -34.654 -29.313 1.00 66.77  ? 842  PRO B CD    1 
ATOM   9928  N  N     . SER F 1 195 ? -63.030 -32.100 -25.914 1.00 67.58  ? 843  SER B N     1 
ATOM   9929  C  CA    . SER F 1 195 ? -64.136 -31.167 -25.703 1.00 67.91  ? 843  SER B CA    1 
ATOM   9930  C  C     . SER F 1 195 ? -64.096 -29.990 -26.676 1.00 66.40  ? 843  SER B C     1 
ATOM   9931  O  O     . SER F 1 195 ? -63.026 -29.584 -27.116 1.00 65.96  ? 843  SER B O     1 
ATOM   9932  C  CB    . SER F 1 195 ? -64.110 -30.638 -24.268 1.00 64.93  ? 843  SER B CB    1 
ATOM   9933  O  OG    . SER F 1 195 ? -65.060 -29.605 -24.091 1.00 64.54  ? 843  SER B OG    1 
ATOM   9934  N  N     . GLU F 1 196 ? -65.265 -29.442 -27.001 1.00 69.26  ? 844  GLU B N     1 
ATOM   9935  C  CA    . GLU F 1 196 ? -65.346 -28.242 -27.840 1.00 73.10  ? 844  GLU B CA    1 
ATOM   9936  C  C     . GLU F 1 196 ? -64.602 -27.063 -27.198 1.00 68.68  ? 844  GLU B C     1 
ATOM   9937  O  O     . GLU F 1 196 ? -63.977 -26.252 -27.887 1.00 64.96  ? 844  GLU B O     1 
ATOM   9938  C  CB    . GLU F 1 196 ? -66.801 -27.865 -28.110 1.00 72.16  ? 844  GLU B CB    1 
ATOM   9939  N  N     . ASN F 1 197 ? -64.671 -26.984 -25.874 1.00 66.61  ? 845  ASN B N     1 
ATOM   9940  C  CA    . ASN F 1 197 ? -63.976 -25.945 -25.130 1.00 67.11  ? 845  ASN B CA    1 
ATOM   9941  C  C     . ASN F 1 197 ? -62.679 -26.454 -24.515 1.00 66.28  ? 845  ASN B C     1 
ATOM   9942  O  O     . ASN F 1 197 ? -62.322 -26.062 -23.407 1.00 65.01  ? 845  ASN B O     1 
ATOM   9943  C  CB    . ASN F 1 197 ? -64.879 -25.400 -24.025 1.00 69.47  ? 845  ASN B CB    1 
ATOM   9944  C  CG    . ASN F 1 197 ? -64.807 -23.888 -23.912 1.00 70.96  ? 845  ASN B CG    1 
ATOM   9945  O  OD1   . ASN F 1 197 ? -64.710 -23.185 -24.922 1.00 67.70  ? 845  ASN B OD1   1 
ATOM   9946  N  ND2   . ASN F 1 197 ? -64.849 -23.378 -22.681 1.00 69.30  ? 845  ASN B ND2   1 
ATOM   9947  N  N     . TRP F 1 198 ? -61.976 -27.329 -25.229 1.00 66.77  ? 846  TRP B N     1 
ATOM   9948  C  CA    . TRP F 1 198 ? -60.804 -27.986 -24.656 1.00 64.15  ? 846  TRP B CA    1 
ATOM   9949  C  C     . TRP F 1 198 ? -59.789 -26.981 -24.118 1.00 61.80  ? 846  TRP B C     1 
ATOM   9950  O  O     . TRP F 1 198 ? -59.344 -27.086 -22.972 1.00 60.87  ? 846  TRP B O     1 
ATOM   9951  C  CB    . TRP F 1 198 ? -60.138 -28.941 -25.656 1.00 62.24  ? 846  TRP B CB    1 
ATOM   9952  C  CG    . TRP F 1 198 ? -58.788 -29.411 -25.173 1.00 61.40  ? 846  TRP B CG    1 
ATOM   9953  C  CD1   . TRP F 1 198 ? -58.537 -30.412 -24.277 1.00 58.08  ? 846  TRP B CD1   1 
ATOM   9954  C  CD2   . TRP F 1 198 ? -57.510 -28.871 -25.538 1.00 58.71  ? 846  TRP B CD2   1 
ATOM   9955  N  NE1   . TRP F 1 198 ? -57.185 -30.532 -24.069 1.00 55.11  ? 846  TRP B NE1   1 
ATOM   9956  C  CE2   . TRP F 1 198 ? -56.531 -29.599 -24.832 1.00 54.60  ? 846  TRP B CE2   1 
ATOM   9957  C  CE3   . TRP F 1 198 ? -57.099 -27.845 -26.396 1.00 54.30  ? 846  TRP B CE3   1 
ATOM   9958  C  CZ2   . TRP F 1 198 ? -55.170 -29.336 -24.956 1.00 49.51  ? 846  TRP B CZ2   1 
ATOM   9959  C  CZ3   . TRP F 1 198 ? -55.750 -27.588 -26.520 1.00 51.63  ? 846  TRP B CZ3   1 
ATOM   9960  C  CH2   . TRP F 1 198 ? -54.799 -28.331 -25.804 1.00 48.79  ? 846  TRP B CH2   1 
ATOM   9961  N  N     . ALA F 1 199 ? -59.436 -26.007 -24.950 1.00 61.44  ? 847  ALA B N     1 
ATOM   9962  C  CA    . ALA F 1 199 ? -58.472 -24.970 -24.575 1.00 63.71  ? 847  ALA B CA    1 
ATOM   9963  C  C     . ALA F 1 199 ? -58.819 -24.246 -23.266 1.00 63.12  ? 847  ALA B C     1 
ATOM   9964  O  O     . ALA F 1 199 ? -57.970 -24.070 -22.393 1.00 61.12  ? 847  ALA B O     1 
ATOM   9965  C  CB    . ALA F 1 199 ? -58.324 -23.964 -25.709 1.00 59.76  ? 847  ALA B CB    1 
ATOM   9966  N  N     . MET F 1 200 ? -60.068 -23.824 -23.137 1.00 64.20  ? 848  MET B N     1 
ATOM   9967  C  CA    . MET F 1 200 ? -60.466 -23.000 -22.006 1.00 65.53  ? 848  MET B CA    1 
ATOM   9968  C  C     . MET F 1 200 ? -60.776 -23.789 -20.734 1.00 64.56  ? 848  MET B C     1 
ATOM   9969  O  O     . MET F 1 200 ? -60.994 -23.202 -19.673 1.00 64.73  ? 848  MET B O     1 
ATOM   9970  C  CB    . MET F 1 200 ? -61.653 -22.128 -22.399 1.00 67.10  ? 848  MET B CB    1 
ATOM   9971  C  CG    . MET F 1 200 ? -61.316 -21.134 -23.493 1.00 70.37  ? 848  MET B CG    1 
ATOM   9972  S  SD    . MET F 1 200 ? -60.091 -19.933 -22.940 1.00 74.56  ? 848  MET B SD    1 
ATOM   9973  C  CE    . MET F 1 200 ? -61.083 -18.432 -22.958 1.00 73.30  ? 848  MET B CE    1 
ATOM   9974  N  N     . GLU F 1 201 ? -60.780 -25.112 -20.836 1.00 63.28  ? 849  GLU B N     1 
ATOM   9975  C  CA    . GLU F 1 201 ? -61.148 -25.947 -19.696 1.00 67.74  ? 849  GLU B CA    1 
ATOM   9976  C  C     . GLU F 1 201 ? -59.940 -26.632 -19.062 1.00 65.87  ? 849  GLU B C     1 
ATOM   9977  O  O     . GLU F 1 201 ? -59.768 -27.846 -19.183 1.00 67.11  ? 849  GLU B O     1 
ATOM   9978  C  CB    . GLU F 1 201 ? -62.208 -26.987 -20.099 1.00 70.83  ? 849  GLU B CB    1 
ATOM   9979  C  CG    . GLU F 1 201 ? -61.861 -27.803 -21.339 1.00 67.36  ? 849  GLU B CG    1 
ATOM   9980  C  CD    . GLU F 1 201 ? -62.605 -29.126 -21.403 1.00 69.91  ? 849  GLU B CD    1 
ATOM   9981  O  OE1   . GLU F 1 201 ? -61.944 -30.174 -21.262 1.00 70.29  ? 849  GLU B OE1   1 
ATOM   9982  O  OE2   . GLU F 1 201 ? -63.841 -29.125 -21.597 1.00 70.87  ? 849  GLU B OE2   1 
ATOM   9983  N  N     . GLY F 1 202 ? -59.111 -25.854 -18.374 1.00 62.40  ? 850  GLY B N     1 
ATOM   9984  C  CA    . GLY F 1 202 ? -57.915 -26.398 -17.758 1.00 60.82  ? 850  GLY B CA    1 
ATOM   9985  C  C     . GLY F 1 202 ? -57.523 -25.746 -16.445 1.00 62.81  ? 850  GLY B C     1 
ATOM   9986  O  O     . GLY F 1 202 ? -57.718 -24.544 -16.252 1.00 63.68  ? 850  GLY B O     1 
ATOM   9987  N  N     . GLY F 1 203 ? -56.970 -26.552 -15.541 1.00 64.60  ? 851  GLY B N     1 
ATOM   9988  C  CA    . GLY F 1 203 ? -56.474 -26.084 -14.254 1.00 63.37  ? 851  GLY B CA    1 
ATOM   9989  C  C     . GLY F 1 203 ? -57.172 -24.861 -13.684 1.00 62.48  ? 851  GLY B C     1 
ATOM   9990  O  O     . GLY F 1 203 ? -58.349 -24.911 -13.329 1.00 62.56  ? 851  GLY B O     1 
ATOM   9991  N  N     . ASP F 1 215 ? -64.430 -41.939 -15.404 1.00 91.05  ? 863  ASP B N     1 
ATOM   9992  C  CA    . ASP F 1 215 ? -65.657 -41.394 -15.981 1.00 92.98  ? 863  ASP B CA    1 
ATOM   9993  C  C     . ASP F 1 215 ? -66.747 -42.464 -16.169 1.00 93.24  ? 863  ASP B C     1 
ATOM   9994  O  O     . ASP F 1 215 ? -67.496 -42.762 -15.236 1.00 88.54  ? 863  ASP B O     1 
ATOM   9995  C  CB    . ASP F 1 215 ? -65.354 -40.681 -17.307 1.00 89.54  ? 863  ASP B CB    1 
ATOM   9996  N  N     . GLY F 1 216 ? -66.830 -43.039 -17.368 1.00 92.41  ? 864  GLY B N     1 
ATOM   9997  C  CA    . GLY F 1 216 ? -67.902 -43.967 -17.698 1.00 91.26  ? 864  GLY B CA    1 
ATOM   9998  C  C     . GLY F 1 216 ? -67.770 -45.373 -17.127 1.00 96.88  ? 864  GLY B C     1 
ATOM   9999  O  O     . GLY F 1 216 ? -68.752 -46.119 -17.076 1.00 94.25  ? 864  GLY B O     1 
ATOM   10000 N  N     . LYS F 1 217 ? -66.557 -45.729 -16.699 1.00 97.02  ? 865  LYS B N     1 
ATOM   10001 C  CA    . LYS F 1 217 ? -66.238 -47.069 -16.191 1.00 91.09  ? 865  LYS B CA    1 
ATOM   10002 C  C     . LYS F 1 217 ? -66.237 -48.132 -17.292 1.00 85.47  ? 865  LYS B C     1 
ATOM   10003 O  O     . LYS F 1 217 ? -66.332 -49.326 -17.012 1.00 82.57  ? 865  LYS B O     1 
ATOM   10004 C  CB    . LYS F 1 217 ? -67.170 -47.479 -15.046 1.00 89.14  ? 865  LYS B CB    1 
ATOM   10005 N  N     . THR F 1 218 ? -66.121 -47.686 -18.542 1.00 86.15  ? 866  THR B N     1 
ATOM   10006 C  CA    . THR F 1 218 ? -66.051 -48.589 -19.691 1.00 85.66  ? 866  THR B CA    1 
ATOM   10007 C  C     . THR F 1 218 ? -64.869 -48.223 -20.598 1.00 78.59  ? 866  THR B C     1 
ATOM   10008 O  O     . THR F 1 218 ? -64.315 -47.128 -20.495 1.00 74.20  ? 866  THR B O     1 
ATOM   10009 C  CB    . THR F 1 218 ? -67.363 -48.574 -20.513 1.00 82.56  ? 866  THR B CB    1 
ATOM   10010 O  OG1   . THR F 1 218 ? -67.395 -49.695 -21.409 1.00 76.38  ? 866  THR B OG1   1 
ATOM   10011 C  CG2   . THR F 1 218 ? -67.484 -47.281 -21.305 1.00 79.16  ? 866  THR B CG2   1 
ATOM   10012 N  N     . TYR F 1 219 ? -64.485 -49.147 -21.476 1.00 75.77  ? 867  TYR B N     1 
ATOM   10013 C  CA    . TYR F 1 219 ? -63.368 -48.935 -22.399 1.00 71.31  ? 867  TYR B CA    1 
ATOM   10014 C  C     . TYR F 1 219 ? -63.574 -47.723 -23.303 1.00 67.88  ? 867  TYR B C     1 
ATOM   10015 O  O     . TYR F 1 219 ? -64.664 -47.510 -23.839 1.00 66.05  ? 867  TYR B O     1 
ATOM   10016 C  CB    . TYR F 1 219 ? -63.133 -50.182 -23.264 1.00 71.10  ? 867  TYR B CB    1 
ATOM   10017 C  CG    . TYR F 1 219 ? -62.397 -51.307 -22.566 1.00 70.74  ? 867  TYR B CG    1 
ATOM   10018 C  CD1   . TYR F 1 219 ? -61.283 -51.053 -21.774 1.00 74.35  ? 867  TYR B CD1   1 
ATOM   10019 C  CD2   . TYR F 1 219 ? -62.820 -52.622 -22.695 1.00 68.10  ? 867  TYR B CD2   1 
ATOM   10020 C  CE1   . TYR F 1 219 ? -60.609 -52.082 -21.131 1.00 73.08  ? 867  TYR B CE1   1 
ATOM   10021 C  CE2   . TYR F 1 219 ? -62.154 -53.655 -22.056 1.00 69.29  ? 867  TYR B CE2   1 
ATOM   10022 C  CZ    . TYR F 1 219 ? -61.049 -53.380 -21.277 1.00 70.37  ? 867  TYR B CZ    1 
ATOM   10023 O  OH    . TYR F 1 219 ? -60.383 -54.406 -20.643 1.00 69.88  ? 867  TYR B OH    1 
ATOM   10024 N  N     . PHE F 1 220 ? -62.513 -46.937 -23.474 1.00 67.75  ? 868  PHE B N     1 
ATOM   10025 C  CA    . PHE F 1 220 ? -62.546 -45.755 -24.332 1.00 64.19  ? 868  PHE B CA    1 
ATOM   10026 C  C     . PHE F 1 220 ? -61.169 -45.459 -24.909 1.00 61.57  ? 868  PHE B C     1 
ATOM   10027 O  O     . PHE F 1 220 ? -60.146 -45.757 -24.291 1.00 62.22  ? 868  PHE B O     1 
ATOM   10028 C  CB    . PHE F 1 220 ? -62.995 -44.536 -23.539 1.00 61.77  ? 868  PHE B CB    1 
ATOM   10029 C  CG    . PHE F 1 220 ? -61.905 -43.931 -22.708 1.00 61.87  ? 868  PHE B CG    1 
ATOM   10030 C  CD1   . PHE F 1 220 ? -61.658 -44.393 -21.427 1.00 63.44  ? 868  PHE B CD1   1 
ATOM   10031 C  CD2   . PHE F 1 220 ? -61.115 -42.908 -23.215 1.00 60.22  ? 868  PHE B CD2   1 
ATOM   10032 C  CE1   . PHE F 1 220 ? -60.653 -43.840 -20.658 1.00 66.38  ? 868  PHE B CE1   1 
ATOM   10033 C  CE2   . PHE F 1 220 ? -60.108 -42.350 -22.457 1.00 59.55  ? 868  PHE B CE2   1 
ATOM   10034 C  CZ    . PHE F 1 220 ? -59.875 -42.817 -21.175 1.00 65.49  ? 868  PHE B CZ    1 
ATOM   10035 N  N     . PHE F 1 221 ? -61.148 -44.848 -26.086 1.00 58.44  ? 869  PHE B N     1 
ATOM   10036 C  CA    . PHE F 1 221 ? -59.894 -44.424 -26.684 1.00 57.60  ? 869  PHE B CA    1 
ATOM   10037 C  C     . PHE F 1 221 ? -59.988 -42.976 -27.131 1.00 57.65  ? 869  PHE B C     1 
ATOM   10038 O  O     . PHE F 1 221 ? -61.073 -42.499 -27.466 1.00 57.81  ? 869  PHE B O     1 
ATOM   10039 C  CB    . PHE F 1 221 ? -59.547 -45.308 -27.877 1.00 56.95  ? 869  PHE B CB    1 
ATOM   10040 C  CG    . PHE F 1 221 ? -60.340 -45.001 -29.114 1.00 55.62  ? 869  PHE B CG    1 
ATOM   10041 C  CD1   . PHE F 1 221 ? -59.794 -44.237 -30.127 1.00 55.92  ? 869  PHE B CD1   1 
ATOM   10042 C  CD2   . PHE F 1 221 ? -61.625 -45.484 -29.270 1.00 56.10  ? 869  PHE B CD2   1 
ATOM   10043 C  CE1   . PHE F 1 221 ? -60.519 -43.960 -31.270 1.00 58.85  ? 869  PHE B CE1   1 
ATOM   10044 C  CE2   . PHE F 1 221 ? -62.352 -45.212 -30.411 1.00 55.87  ? 869  PHE B CE2   1 
ATOM   10045 C  CZ    . PHE F 1 221 ? -61.801 -44.450 -31.410 1.00 57.33  ? 869  PHE B CZ    1 
ATOM   10046 N  N     . GLN F 1 222 ? -58.853 -42.278 -27.128 1.00 56.43  ? 870  GLN B N     1 
ATOM   10047 C  CA    . GLN F 1 222 ? -58.793 -40.905 -27.640 1.00 57.50  ? 870  GLN B CA    1 
ATOM   10048 C  C     . GLN F 1 222 ? -57.639 -40.679 -28.629 1.00 54.69  ? 870  GLN B C     1 
ATOM   10049 O  O     . GLN F 1 222 ? -57.733 -39.833 -29.525 1.00 51.48  ? 870  GLN B O     1 
ATOM   10050 C  CB    . GLN F 1 222 ? -58.769 -39.874 -26.497 1.00 54.63  ? 870  GLN B CB    1 
ATOM   10051 C  CG    . GLN F 1 222 ? -57.717 -40.112 -25.431 1.00 55.23  ? 870  GLN B CG    1 
ATOM   10052 C  CD    . GLN F 1 222 ? -57.765 -39.088 -24.307 1.00 57.22  ? 870  GLN B CD    1 
ATOM   10053 O  OE1   . GLN F 1 222 ? -57.140 -39.276 -23.265 1.00 59.85  ? 870  GLN B OE1   1 
ATOM   10054 N  NE2   . GLN F 1 222 ? -58.503 -37.998 -24.514 1.00 54.60  ? 870  GLN B NE2   1 
ATOM   10055 N  N     . LEU F 1 223 ? -56.571 -41.460 -28.484 1.00 54.79  ? 871  LEU B N     1 
ATOM   10056 C  CA    . LEU F 1 223 ? -55.382 -41.289 -29.317 1.00 53.48  ? 871  LEU B CA    1 
ATOM   10057 C  C     . LEU F 1 223 ? -54.894 -42.559 -29.991 1.00 51.38  ? 871  LEU B C     1 
ATOM   10058 O  O     . LEU F 1 223 ? -55.295 -43.664 -29.642 1.00 54.20  ? 871  LEU B O     1 
ATOM   10059 C  CB    . LEU F 1 223 ? -54.242 -40.699 -28.497 1.00 51.40  ? 871  LEU B CB    1 
ATOM   10060 C  CG    . LEU F 1 223 ? -54.339 -39.198 -28.287 1.00 49.47  ? 871  LEU B CG    1 
ATOM   10061 C  CD1   . LEU F 1 223 ? -53.491 -38.812 -27.096 1.00 50.97  ? 871  LEU B CD1   1 
ATOM   10062 C  CD2   . LEU F 1 223 ? -53.914 -38.461 -29.545 1.00 44.98  ? 871  LEU B CD2   1 
ATOM   10063 N  N     . TRP F 1 224 ? -53.997 -42.374 -30.948 1.00 50.09  ? 872  TRP B N     1 
ATOM   10064 C  CA    . TRP F 1 224 ? -53.458 -43.457 -31.748 1.00 49.60  ? 872  TRP B CA    1 
ATOM   10065 C  C     . TRP F 1 224 ? -51.975 -43.633 -31.448 1.00 50.96  ? 872  TRP B C     1 
ATOM   10066 O  O     . TRP F 1 224 ? -51.174 -42.740 -31.722 1.00 50.29  ? 872  TRP B O     1 
ATOM   10067 C  CB    . TRP F 1 224 ? -53.640 -43.114 -33.214 1.00 49.96  ? 872  TRP B CB    1 
ATOM   10068 C  CG    . TRP F 1 224 ? -52.997 -44.064 -34.130 1.00 51.89  ? 872  TRP B CG    1 
ATOM   10069 C  CD1   . TRP F 1 224 ? -51.659 -44.310 -34.258 1.00 52.69  ? 872  TRP B CD1   1 
ATOM   10070 C  CD2   . TRP F 1 224 ? -53.655 -44.898 -35.084 1.00 52.70  ? 872  TRP B CD2   1 
ATOM   10071 N  NE1   . TRP F 1 224 ? -51.448 -45.260 -35.229 1.00 54.29  ? 872  TRP B NE1   1 
ATOM   10072 C  CE2   . TRP F 1 224 ? -52.657 -45.632 -35.752 1.00 53.74  ? 872  TRP B CE2   1 
ATOM   10073 C  CE3   . TRP F 1 224 ? -54.992 -45.094 -35.438 1.00 52.45  ? 872  TRP B CE3   1 
ATOM   10074 C  CZ2   . TRP F 1 224 ? -52.958 -46.548 -36.752 1.00 54.26  ? 872  TRP B CZ2   1 
ATOM   10075 C  CZ3   . TRP F 1 224 ? -55.286 -46.002 -36.427 1.00 53.60  ? 872  TRP B CZ3   1 
ATOM   10076 C  CH2   . TRP F 1 224 ? -54.275 -46.716 -37.076 1.00 55.48  ? 872  TRP B CH2   1 
ATOM   10077 N  N     . TYR F 1 225 ? -51.605 -44.788 -30.905 1.00 50.39  ? 873  TYR B N     1 
ATOM   10078 C  CA    . TYR F 1 225 ? -50.240 -45.001 -30.445 1.00 46.51  ? 873  TYR B CA    1 
ATOM   10079 C  C     . TYR F 1 225 ? -49.351 -45.707 -31.453 1.00 47.65  ? 873  TYR B C     1 
ATOM   10080 O  O     . TYR F 1 225 ? -49.641 -46.815 -31.883 1.00 49.47  ? 873  TYR B O     1 
ATOM   10081 C  CB    . TYR F 1 225 ? -50.258 -45.784 -29.152 1.00 44.42  ? 873  TYR B CB    1 
ATOM   10082 C  CG    . TYR F 1 225 ? -48.903 -46.172 -28.628 1.00 46.81  ? 873  TYR B CG    1 
ATOM   10083 C  CD1   . TYR F 1 225 ? -47.944 -45.220 -28.333 1.00 46.32  ? 873  TYR B CD1   1 
ATOM   10084 C  CD2   . TYR F 1 225 ? -48.598 -47.500 -28.388 1.00 52.55  ? 873  TYR B CD2   1 
ATOM   10085 C  CE1   . TYR F 1 225 ? -46.707 -45.590 -27.825 1.00 48.58  ? 873  TYR B CE1   1 
ATOM   10086 C  CE2   . TYR F 1 225 ? -47.370 -47.881 -27.880 1.00 52.57  ? 873  TYR B CE2   1 
ATOM   10087 C  CZ    . TYR F 1 225 ? -46.432 -46.927 -27.599 1.00 52.01  ? 873  TYR B CZ    1 
ATOM   10088 O  OH    . TYR F 1 225 ? -45.219 -47.332 -27.092 1.00 52.80  ? 873  TYR B OH    1 
ATOM   10089 N  N     . ASN F 1 226 ? -48.262 -45.045 -31.823 1.00 47.27  ? 874  AS