data_3PWH
# 
_entry.id   3PWH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PWH         
RCSB  RCSB062896   
WWPDB D_1000062896 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PWH 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dore, A.S.'     1  
'Robertson, N.'  2  
'Errey, J.C.'    3  
'Ng, I.'         4  
'Tehan, B.'      5  
'Hurrell, E.'    6  
'Magnani, F.'    7  
'Tate, C.G.'     8  
'Weir, M.'       9  
'Marshall, F.H.' 10 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the adenosine A(2A) receptor in complex with ZM241385 and the xanthines XAC and caffeine' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            19 
_citation.page_first                1283 
_citation.page_last                 1293 
_citation.year                      2011 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21885291 
_citation.pdbx_database_id_DOI      10.1016/j.str.2011.06.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dore, A.S.'      1  
primary 'Robertson, N.'   2  
primary 'Errey, J.C.'     3  
primary 'Ng, I.'          4  
primary 'Hollenstein, K.' 5  
primary 'Tehan, B.'       6  
primary 'Hurrell, E.'     7  
primary 'Bennett, K.'     8  
primary 'Congreve, M.'    9  
primary 'Magnani, F.'     10 
primary 'Tate, C.G.'      11 
primary 'Weir, M.'        12 
primary 'Marshall, F.H.'  13 
# 
_cell.entry_id           3PWH 
_cell.length_a           111.935 
_cell.length_b           112.551 
_cell.length_c           125.678 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PWH 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adenosine receptor A2a'                                                                  36479.102 1 ? 
'A54L T88A K122A V239A R107A L202A L235A S277A' 'residues 1-317' ? 
2 non-polymer syn '4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethyl}phenol' 337.336   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAH
HHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAH
HHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ILE n 
1 4   MET n 
1 5   GLY n 
1 6   SER n 
1 7   SER n 
1 8   VAL n 
1 9   TYR n 
1 10  ILE n 
1 11  THR n 
1 12  VAL n 
1 13  GLU n 
1 14  LEU n 
1 15  ALA n 
1 16  ILE n 
1 17  ALA n 
1 18  VAL n 
1 19  LEU n 
1 20  ALA n 
1 21  ILE n 
1 22  LEU n 
1 23  GLY n 
1 24  ASN n 
1 25  VAL n 
1 26  LEU n 
1 27  VAL n 
1 28  CYS n 
1 29  TRP n 
1 30  ALA n 
1 31  VAL n 
1 32  TRP n 
1 33  LEU n 
1 34  ASN n 
1 35  SER n 
1 36  ASN n 
1 37  LEU n 
1 38  GLN n 
1 39  ASN n 
1 40  VAL n 
1 41  THR n 
1 42  ASN n 
1 43  TYR n 
1 44  PHE n 
1 45  VAL n 
1 46  VAL n 
1 47  SER n 
1 48  LEU n 
1 49  ALA n 
1 50  ALA n 
1 51  ALA n 
1 52  ASP n 
1 53  ILE n 
1 54  LEU n 
1 55  VAL n 
1 56  GLY n 
1 57  VAL n 
1 58  LEU n 
1 59  ALA n 
1 60  ILE n 
1 61  PRO n 
1 62  PHE n 
1 63  ALA n 
1 64  ILE n 
1 65  THR n 
1 66  ILE n 
1 67  SER n 
1 68  THR n 
1 69  GLY n 
1 70  PHE n 
1 71  CYS n 
1 72  ALA n 
1 73  ALA n 
1 74  CYS n 
1 75  HIS n 
1 76  GLY n 
1 77  CYS n 
1 78  LEU n 
1 79  PHE n 
1 80  ILE n 
1 81  ALA n 
1 82  CYS n 
1 83  PHE n 
1 84  VAL n 
1 85  LEU n 
1 86  VAL n 
1 87  LEU n 
1 88  ALA n 
1 89  GLN n 
1 90  SER n 
1 91  SER n 
1 92  ILE n 
1 93  PHE n 
1 94  SER n 
1 95  LEU n 
1 96  LEU n 
1 97  ALA n 
1 98  ILE n 
1 99  ALA n 
1 100 ILE n 
1 101 ASP n 
1 102 ARG n 
1 103 TYR n 
1 104 ILE n 
1 105 ALA n 
1 106 ILE n 
1 107 ALA n 
1 108 ILE n 
1 109 PRO n 
1 110 LEU n 
1 111 ARG n 
1 112 TYR n 
1 113 ASN n 
1 114 GLY n 
1 115 LEU n 
1 116 VAL n 
1 117 THR n 
1 118 GLY n 
1 119 THR n 
1 120 ARG n 
1 121 ALA n 
1 122 ALA n 
1 123 GLY n 
1 124 ILE n 
1 125 ILE n 
1 126 ALA n 
1 127 ILE n 
1 128 CYS n 
1 129 TRP n 
1 130 VAL n 
1 131 LEU n 
1 132 SER n 
1 133 PHE n 
1 134 ALA n 
1 135 ILE n 
1 136 GLY n 
1 137 LEU n 
1 138 THR n 
1 139 PRO n 
1 140 MET n 
1 141 LEU n 
1 142 GLY n 
1 143 TRP n 
1 144 ASN n 
1 145 ASN n 
1 146 CYS n 
1 147 GLY n 
1 148 GLN n 
1 149 PRO n 
1 150 LYS n 
1 151 GLU n 
1 152 GLY n 
1 153 LYS n 
1 154 ASN n 
1 155 HIS n 
1 156 SER n 
1 157 GLN n 
1 158 GLY n 
1 159 CYS n 
1 160 GLY n 
1 161 GLU n 
1 162 GLY n 
1 163 GLN n 
1 164 VAL n 
1 165 ALA n 
1 166 CYS n 
1 167 LEU n 
1 168 PHE n 
1 169 GLU n 
1 170 ASP n 
1 171 VAL n 
1 172 VAL n 
1 173 PRO n 
1 174 MET n 
1 175 ASN n 
1 176 TYR n 
1 177 MET n 
1 178 VAL n 
1 179 TYR n 
1 180 PHE n 
1 181 ASN n 
1 182 PHE n 
1 183 PHE n 
1 184 ALA n 
1 185 CYS n 
1 186 VAL n 
1 187 LEU n 
1 188 VAL n 
1 189 PRO n 
1 190 LEU n 
1 191 LEU n 
1 192 LEU n 
1 193 MET n 
1 194 LEU n 
1 195 GLY n 
1 196 VAL n 
1 197 TYR n 
1 198 LEU n 
1 199 ARG n 
1 200 ILE n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 ALA n 
1 205 ARG n 
1 206 ARG n 
1 207 GLN n 
1 208 LEU n 
1 209 LYS n 
1 210 GLN n 
1 211 MET n 
1 212 GLU n 
1 213 SER n 
1 214 GLN n 
1 215 PRO n 
1 216 LEU n 
1 217 PRO n 
1 218 GLY n 
1 219 GLU n 
1 220 ARG n 
1 221 ALA n 
1 222 ARG n 
1 223 SER n 
1 224 THR n 
1 225 LEU n 
1 226 GLN n 
1 227 LYS n 
1 228 GLU n 
1 229 VAL n 
1 230 HIS n 
1 231 ALA n 
1 232 ALA n 
1 233 LYS n 
1 234 SER n 
1 235 ALA n 
1 236 ALA n 
1 237 ILE n 
1 238 ILE n 
1 239 ALA n 
1 240 GLY n 
1 241 LEU n 
1 242 PHE n 
1 243 ALA n 
1 244 LEU n 
1 245 CYS n 
1 246 TRP n 
1 247 LEU n 
1 248 PRO n 
1 249 LEU n 
1 250 HIS n 
1 251 ILE n 
1 252 ILE n 
1 253 ASN n 
1 254 CYS n 
1 255 PHE n 
1 256 THR n 
1 257 PHE n 
1 258 PHE n 
1 259 CYS n 
1 260 PRO n 
1 261 ASP n 
1 262 CYS n 
1 263 SER n 
1 264 HIS n 
1 265 ALA n 
1 266 PRO n 
1 267 LEU n 
1 268 TRP n 
1 269 LEU n 
1 270 MET n 
1 271 TYR n 
1 272 LEU n 
1 273 ALA n 
1 274 ILE n 
1 275 VAL n 
1 276 LEU n 
1 277 ALA n 
1 278 HIS n 
1 279 THR n 
1 280 ASN n 
1 281 SER n 
1 282 VAL n 
1 283 VAL n 
1 284 ASN n 
1 285 PRO n 
1 286 PHE n 
1 287 ILE n 
1 288 TYR n 
1 289 ALA n 
1 290 TYR n 
1 291 ARG n 
1 292 ILE n 
1 293 ARG n 
1 294 GLU n 
1 295 PHE n 
1 296 ARG n 
1 297 GLN n 
1 298 THR n 
1 299 PHE n 
1 300 ARG n 
1 301 LYS n 
1 302 ILE n 
1 303 ILE n 
1 304 ARG n 
1 305 SER n 
1 306 HIS n 
1 307 VAL n 
1 308 LEU n 
1 309 ARG n 
1 310 GLN n 
1 311 GLN n 
1 312 GLU n 
1 313 PRO n 
1 314 PHE n 
1 315 LYS n 
1 316 ALA n 
1 317 ALA n 
1 318 ALA n 
1 319 ALA n 
1 320 HIS n 
1 321 HIS n 
1 322 HIS n 
1 323 HIS n 
1 324 HIS n 
1 325 HIS n 
1 326 HIS n 
1 327 HIS n 
1 328 HIS n 
1 329 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ADORA2A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AA2AR_HUMAN 
_struct_ref.pdbx_db_accession          P29274 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3PWH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 317 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29274 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  317 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       317 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3PWH LEU A 54  ? UNP P29274 ALA 54  'ENGINEERED MUTATION' 54  1  
1 3PWH ALA A 88  ? UNP P29274 THR 88  'ENGINEERED MUTATION' 88  2  
1 3PWH ALA A 107 ? UNP P29274 ARG 107 'ENGINEERED MUTATION' 107 3  
1 3PWH ALA A 122 ? UNP P29274 LYS 122 'ENGINEERED MUTATION' 122 4  
1 3PWH ALA A 202 ? UNP P29274 LEU 202 'ENGINEERED MUTATION' 202 5  
1 3PWH ALA A 235 ? UNP P29274 LEU 235 'ENGINEERED MUTATION' 235 6  
1 3PWH ALA A 239 ? UNP P29274 VAL 239 'ENGINEERED MUTATION' 239 7  
1 3PWH ALA A 277 ? UNP P29274 SER 277 'ENGINEERED MUTATION' 277 8  
1 3PWH ALA A 318 ? UNP P29274 ?   ?   'EXPRESSION TAG'      318 9  
1 3PWH ALA A 319 ? UNP P29274 ?   ?   'EXPRESSION TAG'      319 10 
1 3PWH HIS A 320 ? UNP P29274 ?   ?   'EXPRESSION TAG'      320 11 
1 3PWH HIS A 321 ? UNP P29274 ?   ?   'EXPRESSION TAG'      321 12 
1 3PWH HIS A 322 ? UNP P29274 ?   ?   'EXPRESSION TAG'      322 13 
1 3PWH HIS A 323 ? UNP P29274 ?   ?   'EXPRESSION TAG'      323 14 
1 3PWH HIS A 324 ? UNP P29274 ?   ?   'EXPRESSION TAG'      324 15 
1 3PWH HIS A 325 ? UNP P29274 ?   ?   'EXPRESSION TAG'      325 16 
1 3PWH HIS A 326 ? UNP P29274 ?   ?   'EXPRESSION TAG'      326 17 
1 3PWH HIS A 327 ? UNP P29274 ?   ?   'EXPRESSION TAG'      327 18 
1 3PWH HIS A 328 ? UNP P29274 ?   ?   'EXPRESSION TAG'      328 19 
1 3PWH HIS A 329 ? UNP P29274 ?   ?   'EXPRESSION TAG'      329 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                   ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                  ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ? 
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                    ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                    ? 
'C5 H11 N O2'    117.146 
ZMA non-polymer         . '4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethyl}phenol' ? 
'C16 H15 N7 O2'  337.336 
# 
_exptl.entry_id          3PWH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.425463 
_exptl_crystal.density_percent_sol   77.329124 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.1 
_exptl_crystal_grow.pdbx_details    
'32-42% PEG1000, 0.25M MgCl2, 0.3% NG, 0.1%(w/v) 1-Butanol, 0.05% CYMAL-6, pH 8.1, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ACCEL Fixed exit Double Crystal Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9777 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9777 
# 
_reflns.entry_id                     3PWH 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             83.844 
_reflns.d_resolution_high            3.296 
_reflns.number_obs                   12191 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.119 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.3 
_reflns.B_iso_Wilson_estimate        96.1 
_reflns.pdbx_redundancy              10.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3PWH 
_refine.ls_number_reflns_obs                     12010 
_refine.ls_number_reflns_all                     12010 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.842 
_refine.ls_d_res_high                            3.296 
_refine.ls_percent_reflns_obs                    98.06 
_refine.ls_R_factor_obs                          0.2779 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2761 
_refine.ls_R_factor_R_free                       0.3156 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_number_reflns_R_free                  576 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               139.5179 
_refine.aniso_B[1][1]                            -60.7636 
_refine.aniso_B[2][2]                            18.4504 
_refine.aniso_B[3][3]                            42.3132 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.233 
_refine.solvent_model_param_bsol                 72.895 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3EML 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.54 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_number_reflns_R_work                  11434 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                430.580 
_refine.B_iso_min                                64.980 
_refine.pdbx_overall_phase_error                 40.6000 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.ls_wR_factor_R_work                      ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2250 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2275 
_refine_hist.d_res_high                       3.296 
_refine_hist.d_res_low                        19.842 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           2338 0.001  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          3187 0.388  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     377  0.027  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      390  0.002  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 791  10.444 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
3.2962 3.6261  4 95.0000 2743 . 0.3971 0.4875 . 134 . 2877 . 'X-RAY DIFFRACTION' . 
3.6261 4.1467  4 99.0000 2820 . 0.2828 0.2981 . 151 . 2971 . 'X-RAY DIFFRACTION' . 
4.1467 5.2087  4 99.0000 2878 . 0.2295 0.2680 . 144 . 3022 . 'X-RAY DIFFRACTION' . 
5.2087 19.8421 4 99.0000 2993 . 0.2638 0.3165 . 147 . 3140 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3PWH 
_struct.title                     'Thermostabilised Adenosine A2A Receptor' 
_struct.pdbx_descriptor           'Adenosine receptor A2a' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PWH 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            '7TM, GPCR, inverse agonist, G-protein, Membrane Protein, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 9   ? ASN A 34  ? TYR A 9   ASN A 34  1 ? 26 
HELX_P HELX_P2  2  ASN A 39  ? LEU A 58  ? ASN A 39  LEU A 58  1 ? 20 
HELX_P HELX_P3  3  LEU A 58  ? ILE A 64  ? LEU A 58  ILE A 64  1 ? 7  
HELX_P HELX_P4  4  ILE A 64  ? GLY A 69  ? ILE A 64  GLY A 69  1 ? 6  
HELX_P HELX_P5  5  ALA A 73  ? ILE A 108 ? ALA A 73  ILE A 108 1 ? 36 
HELX_P HELX_P6  6  ILE A 108 ? VAL A 116 ? ILE A 108 VAL A 116 1 ? 9  
HELX_P HELX_P7  7  THR A 117 ? LEU A 137 ? THR A 117 LEU A 137 1 ? 21 
HELX_P HELX_P8  8  THR A 138 ? GLY A 142 ? THR A 138 GLY A 142 5 ? 5  
HELX_P HELX_P9  9  LEU A 167 ? VAL A 172 ? LEU A 167 VAL A 172 1 ? 6  
HELX_P HELX_P10 10 PRO A 173 ? PHE A 180 ? PRO A 173 PHE A 180 1 ? 8  
HELX_P HELX_P11 11 PHE A 180 ? VAL A 186 ? PHE A 180 VAL A 186 1 ? 7  
HELX_P HELX_P12 12 VAL A 186 ? MET A 211 ? VAL A 186 MET A 211 1 ? 26 
HELX_P HELX_P13 13 GLY A 218 ? CYS A 245 ? GLY A 218 CYS A 245 1 ? 28 
HELX_P HELX_P14 14 TRP A 246 ? CYS A 259 ? TRP A 246 CYS A 259 1 ? 14 
HELX_P HELX_P15 15 PRO A 266 ? ASN A 280 ? PRO A 266 ASN A 280 1 ? 15 
HELX_P HELX_P16 16 VAL A 282 ? ILE A 292 ? VAL A 282 ILE A 292 1 ? 11 
HELX_P HELX_P17 17 ILE A 292 ? SER A 305 ? ILE A 292 SER A 305 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 159 SG ? ? A CYS 71  A CYS 159 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 146 SG ? ? A CYS 74  A CYS 146 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? A CYS 77  SG ? ? ? 1_555 A CYS 166 SG ? ? A CYS 77  A CYS 166 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4 disulf ? ? A CYS 259 SG ? ? ? 1_555 A CYS 262 SG ? ? A CYS 259 A CYS 262 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 70  ? ALA A 72  ? PHE A 70  ALA A 72  
A 2 VAL A 164 ? CYS A 166 ? VAL A 164 CYS A 166 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    72 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     72 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    164 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     164 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'BINDING SITE FOR RESIDUE ZMA A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 ALA A 63  ? ALA A 63  . ? 1_555 ? 
2 AC1 9 SER A 67  ? SER A 67  . ? 1_555 ? 
3 AC1 9 PHE A 168 ? PHE A 168 . ? 1_555 ? 
4 AC1 9 GLU A 169 ? GLU A 169 . ? 1_555 ? 
5 AC1 9 MET A 177 ? MET A 177 . ? 1_555 ? 
6 AC1 9 LEU A 249 ? LEU A 249 . ? 1_555 ? 
7 AC1 9 ASN A 253 ? ASN A 253 . ? 1_555 ? 
8 AC1 9 TYR A 271 ? TYR A 271 . ? 1_555 ? 
9 AC1 9 ILE A 274 ? ILE A 274 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3PWH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PWH 
_atom_sites.fract_transf_matrix[1][1]   0.008934 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008885 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007957 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 7   ? 49.660 21.343 50.146 1.00 188.27 ? 7   SER A N   1 
ATOM   2    C CA  . SER A 1 7   ? 48.298 20.958 50.496 1.00 187.27 ? 7   SER A CA  1 
ATOM   3    C C   . SER A 1 7   ? 47.402 22.184 50.645 1.00 188.36 ? 7   SER A C   1 
ATOM   4    O O   . SER A 1 7   ? 46.188 22.062 50.812 1.00 186.57 ? 7   SER A O   1 
ATOM   5    C CB  . SER A 1 7   ? 48.288 20.136 51.787 1.00 187.15 ? 7   SER A CB  1 
ATOM   6    O OG  . SER A 1 7   ? 46.976 19.716 52.116 1.00 185.04 ? 7   SER A OG  1 
ATOM   7    N N   . VAL A 1 8   ? 48.009 23.364 50.582 1.00 191.17 ? 8   VAL A N   1 
ATOM   8    C CA  . VAL A 1 8   ? 47.271 24.616 50.706 1.00 192.13 ? 8   VAL A CA  1 
ATOM   9    C C   . VAL A 1 8   ? 46.356 24.846 49.506 1.00 184.25 ? 8   VAL A C   1 
ATOM   10   O O   . VAL A 1 8   ? 45.235 25.331 49.652 1.00 181.28 ? 8   VAL A O   1 
ATOM   11   C CB  . VAL A 1 8   ? 48.223 25.820 50.868 1.00 196.87 ? 8   VAL A CB  1 
ATOM   12   C CG1 . VAL A 1 8   ? 49.308 25.792 49.801 1.00 194.61 ? 8   VAL A CG1 1 
ATOM   13   C CG2 . VAL A 1 8   ? 47.445 27.128 50.818 1.00 197.68 ? 8   VAL A CG2 1 
ATOM   14   N N   . TYR A 1 9   ? 46.841 24.491 48.320 1.00 180.88 ? 9   TYR A N   1 
ATOM   15   C CA  . TYR A 1 9   ? 46.067 24.661 47.097 1.00 178.83 ? 9   TYR A CA  1 
ATOM   16   C C   . TYR A 1 9   ? 45.325 23.385 46.722 1.00 169.88 ? 9   TYR A C   1 
ATOM   17   O O   . TYR A 1 9   ? 44.326 23.428 46.005 1.00 169.86 ? 9   TYR A O   1 
ATOM   18   C CB  . TYR A 1 9   ? 46.973 25.093 45.944 1.00 189.55 ? 9   TYR A CB  1 
ATOM   19   C CG  . TYR A 1 9   ? 47.555 26.478 46.104 1.00 203.06 ? 9   TYR A CG  1 
ATOM   20   C CD1 . TYR A 1 9   ? 46.798 27.607 45.817 1.00 207.54 ? 9   TYR A CD1 1 
ATOM   21   C CD2 . TYR A 1 9   ? 48.863 26.658 46.533 1.00 208.53 ? 9   TYR A CD2 1 
ATOM   22   C CE1 . TYR A 1 9   ? 47.326 28.876 45.959 1.00 210.63 ? 9   TYR A CE1 1 
ATOM   23   C CE2 . TYR A 1 9   ? 49.399 27.924 46.678 1.00 211.45 ? 9   TYR A CE2 1 
ATOM   24   C CZ  . TYR A 1 9   ? 48.626 29.029 46.389 1.00 212.32 ? 9   TYR A CZ  1 
ATOM   25   O OH  . TYR A 1 9   ? 49.156 30.291 46.531 1.00 212.68 ? 9   TYR A OH  1 
ATOM   26   N N   . ILE A 1 10  ? 45.821 22.252 47.207 1.00 164.51 ? 10  ILE A N   1 
ATOM   27   C CA  . ILE A 1 10  ? 45.199 20.963 46.928 1.00 159.11 ? 10  ILE A CA  1 
ATOM   28   C C   . ILE A 1 10  ? 43.713 20.986 47.268 1.00 149.21 ? 10  ILE A C   1 
ATOM   29   O O   . ILE A 1 10  ? 42.878 20.550 46.476 1.00 148.39 ? 10  ILE A O   1 
ATOM   30   C CB  . ILE A 1 10  ? 45.878 19.827 47.715 1.00 165.21 ? 10  ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 10  ? 47.327 19.655 47.256 1.00 168.50 ? 10  ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 10  ? 45.108 18.527 47.545 1.00 164.87 ? 10  ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 10  ? 48.051 18.514 47.938 1.00 172.72 ? 10  ILE A CD1 1 
ATOM   34   N N   . THR A 1 11  ? 43.393 21.500 48.451 1.00 137.99 ? 11  THR A N   1 
ATOM   35   C CA  . THR A 1 11  ? 42.011 21.578 48.909 1.00 120.68 ? 11  THR A CA  1 
ATOM   36   C C   . THR A 1 11  ? 41.142 22.371 47.938 1.00 99.45  ? 11  THR A C   1 
ATOM   37   O O   . THR A 1 11  ? 40.036 21.951 47.600 1.00 94.87  ? 11  THR A O   1 
ATOM   38   C CB  . THR A 1 11  ? 41.918 22.215 50.309 1.00 122.93 ? 11  THR A CB  1 
ATOM   39   O OG1 . THR A 1 11  ? 42.623 21.400 51.254 1.00 122.26 ? 11  THR A OG1 1 
ATOM   40   C CG2 . THR A 1 11  ? 40.466 22.340 50.741 1.00 127.58 ? 11  THR A CG2 1 
ATOM   41   N N   . VAL A 1 12  ? 41.650 23.515 47.491 1.00 87.83  ? 12  VAL A N   1 
ATOM   42   C CA  . VAL A 1 12  ? 40.920 24.366 46.557 1.00 88.66  ? 12  VAL A CA  1 
ATOM   43   C C   . VAL A 1 12  ? 40.456 23.595 45.324 1.00 99.64  ? 12  VAL A C   1 
ATOM   44   O O   . VAL A 1 12  ? 39.308 23.721 44.900 1.00 107.74 ? 12  VAL A O   1 
ATOM   45   C CB  . VAL A 1 12  ? 41.767 25.574 46.115 1.00 79.95  ? 12  VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 12  ? 41.113 26.281 44.936 1.00 68.47  ? 12  VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 12  ? 41.970 26.530 47.281 1.00 82.03  ? 12  VAL A CG2 1 
ATOM   48   N N   . GLU A 1 13  ? 41.351 22.795 44.754 1.00 100.05 ? 13  GLU A N   1 
ATOM   49   C CA  . GLU A 1 13  ? 41.011 21.991 43.586 1.00 102.81 ? 13  GLU A CA  1 
ATOM   50   C C   . GLU A 1 13  ? 39.916 20.974 43.895 1.00 103.48 ? 13  GLU A C   1 
ATOM   51   O O   . GLU A 1 13  ? 39.037 20.729 43.069 1.00 100.79 ? 13  GLU A O   1 
ATOM   52   C CB  . GLU A 1 13  ? 42.251 21.292 43.029 1.00 104.29 ? 13  GLU A CB  1 
ATOM   53   C CG  . GLU A 1 13  ? 43.065 22.159 42.085 1.00 102.21 ? 13  GLU A CG  1 
ATOM   54   C CD  . GLU A 1 13  ? 42.307 22.504 40.815 1.00 97.51  ? 13  GLU A CD  1 
ATOM   55   O OE1 . GLU A 1 13  ? 41.396 21.738 40.437 1.00 92.11  ? 13  GLU A OE1 1 
ATOM   56   O OE2 . GLU A 1 13  ? 42.626 23.538 40.191 1.00 96.84  ? 13  GLU A OE2 1 
ATOM   57   N N   . LEU A 1 14  ? 39.972 20.387 45.085 1.00 104.36 ? 14  LEU A N   1 
ATOM   58   C CA  . LEU A 1 14  ? 38.955 19.431 45.510 1.00 108.54 ? 14  LEU A CA  1 
ATOM   59   C C   . LEU A 1 14  ? 37.629 20.130 45.795 1.00 115.81 ? 14  LEU A C   1 
ATOM   60   O O   . LEU A 1 14  ? 36.562 19.628 45.440 1.00 118.96 ? 14  LEU A O   1 
ATOM   61   C CB  . LEU A 1 14  ? 39.421 18.660 46.745 1.00 104.66 ? 14  LEU A CB  1 
ATOM   62   C CG  . LEU A 1 14  ? 40.662 17.787 46.562 1.00 97.63  ? 14  LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 14  ? 40.956 17.005 47.834 1.00 93.45  ? 14  LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 14  ? 40.481 16.846 45.381 1.00 94.53  ? 14  LEU A CD2 1 
ATOM   65   N N   . ALA A 1 15  ? 37.704 21.289 46.442 1.00 113.44 ? 15  ALA A N   1 
ATOM   66   C CA  . ALA A 1 15  ? 36.514 22.072 46.746 1.00 105.84 ? 15  ALA A CA  1 
ATOM   67   C C   . ALA A 1 15  ? 35.765 22.411 45.463 1.00 101.23 ? 15  ALA A C   1 
ATOM   68   O O   . ALA A 1 15  ? 34.547 22.255 45.386 1.00 108.03 ? 15  ALA A O   1 
ATOM   69   C CB  . ALA A 1 15  ? 36.887 23.338 47.499 1.00 101.17 ? 15  ALA A CB  1 
ATOM   70   N N   . ILE A 1 16  ? 36.501 22.871 44.457 1.00 92.66  ? 16  ILE A N   1 
ATOM   71   C CA  . ILE A 1 16  ? 35.911 23.180 43.161 1.00 94.33  ? 16  ILE A CA  1 
ATOM   72   C C   . ILE A 1 16  ? 35.304 21.933 42.525 1.00 107.42 ? 16  ILE A C   1 
ATOM   73   O O   . ILE A 1 16  ? 34.238 21.995 41.913 1.00 112.20 ? 16  ILE A O   1 
ATOM   74   C CB  . ILE A 1 16  ? 36.945 23.793 42.197 1.00 87.17  ? 16  ILE A CB  1 
ATOM   75   C CG1 . ILE A 1 16  ? 37.371 25.178 42.687 1.00 91.33  ? 16  ILE A CG1 1 
ATOM   76   C CG2 . ILE A 1 16  ? 36.376 23.887 40.791 1.00 76.52  ? 16  ILE A CG2 1 
ATOM   77   C CD1 . ILE A 1 16  ? 38.262 25.923 41.715 1.00 89.99  ? 16  ILE A CD1 1 
ATOM   78   N N   . ALA A 1 17  ? 35.985 20.802 42.677 1.00 112.78 ? 17  ALA A N   1 
ATOM   79   C CA  . ALA A 1 17  ? 35.505 19.541 42.123 1.00 117.54 ? 17  ALA A CA  1 
ATOM   80   C C   . ALA A 1 17  ? 34.117 19.204 42.657 1.00 119.49 ? 17  ALA A C   1 
ATOM   81   O O   . ALA A 1 17  ? 33.221 18.838 41.897 1.00 120.96 ? 17  ALA A O   1 
ATOM   82   C CB  . ALA A 1 17  ? 36.482 18.417 42.432 1.00 120.31 ? 17  ALA A CB  1 
ATOM   83   N N   . VAL A 1 18  ? 33.947 19.333 43.968 1.00 117.33 ? 18  VAL A N   1 
ATOM   84   C CA  . VAL A 1 18  ? 32.669 19.051 44.609 1.00 115.61 ? 18  VAL A CA  1 
ATOM   85   C C   . VAL A 1 18  ? 31.563 19.947 44.059 1.00 112.07 ? 18  VAL A C   1 
ATOM   86   O O   . VAL A 1 18  ? 30.555 19.461 43.548 1.00 109.84 ? 18  VAL A O   1 
ATOM   87   C CB  . VAL A 1 18  ? 32.755 19.239 46.134 1.00 115.88 ? 18  VAL A CB  1 
ATOM   88   C CG1 . VAL A 1 18  ? 31.405 18.971 46.778 1.00 122.39 ? 18  VAL A CG1 1 
ATOM   89   C CG2 . VAL A 1 18  ? 33.821 18.328 46.719 1.00 113.73 ? 18  VAL A CG2 1 
ATOM   90   N N   . LEU A 1 19  ? 31.761 21.257 44.165 1.00 111.51 ? 19  LEU A N   1 
ATOM   91   C CA  . LEU A 1 19  ? 30.771 22.222 43.703 1.00 116.87 ? 19  LEU A CA  1 
ATOM   92   C C   . LEU A 1 19  ? 30.430 22.017 42.231 1.00 119.70 ? 19  LEU A C   1 
ATOM   93   O O   . LEU A 1 19  ? 29.287 22.209 41.817 1.00 127.58 ? 19  LEU A O   1 
ATOM   94   C CB  . LEU A 1 19  ? 31.267 23.650 43.934 1.00 119.57 ? 19  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 19  ? 31.668 23.999 45.369 1.00 126.03 ? 19  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 19  ? 32.060 25.464 45.471 1.00 126.88 ? 19  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 19  ? 30.541 23.675 46.336 1.00 129.76 ? 19  LEU A CD2 1 
ATOM   98   N N   . ALA A 1 20  ? 31.426 21.627 41.442 1.00 115.70 ? 20  ALA A N   1 
ATOM   99   C CA  . ALA A 1 20  ? 31.224 21.394 40.017 1.00 113.99 ? 20  ALA A CA  1 
ATOM   100  C C   . ALA A 1 20  ? 30.296 20.208 39.782 1.00 105.06 ? 20  ALA A C   1 
ATOM   101  O O   . ALA A 1 20  ? 29.454 20.232 38.884 1.00 98.07  ? 20  ALA A O   1 
ATOM   102  C CB  . ALA A 1 20  ? 32.558 21.172 39.322 1.00 116.79 ? 20  ALA A CB  1 
ATOM   103  N N   . ILE A 1 21  ? 30.457 19.170 40.596 1.00 103.53 ? 21  ILE A N   1 
ATOM   104  C CA  . ILE A 1 21  ? 29.630 17.976 40.488 1.00 111.04 ? 21  ILE A CA  1 
ATOM   105  C C   . ILE A 1 21  ? 28.199 18.261 40.933 1.00 111.35 ? 21  ILE A C   1 
ATOM   106  O O   . ILE A 1 21  ? 27.249 18.024 40.186 1.00 114.37 ? 21  ILE A O   1 
ATOM   107  C CB  . ILE A 1 21  ? 30.201 16.817 41.326 1.00 118.76 ? 21  ILE A CB  1 
ATOM   108  C CG1 . ILE A 1 21  ? 31.602 16.443 40.836 1.00 115.70 ? 21  ILE A CG1 1 
ATOM   109  C CG2 . ILE A 1 21  ? 29.276 15.611 41.269 1.00 121.94 ? 21  ILE A CG2 1 
ATOM   110  C CD1 . ILE A 1 21  ? 32.258 15.343 41.642 1.00 114.06 ? 21  ILE A CD1 1 
ATOM   111  N N   . LEU A 1 22  ? 28.054 18.775 42.150 1.00 102.16 ? 22  LEU A N   1 
ATOM   112  C CA  . LEU A 1 22  ? 26.741 19.085 42.707 1.00 88.90  ? 22  LEU A CA  1 
ATOM   113  C C   . LEU A 1 22  ? 25.976 20.071 41.830 1.00 85.02  ? 22  LEU A C   1 
ATOM   114  O O   . LEU A 1 22  ? 24.859 19.795 41.397 1.00 87.64  ? 22  LEU A O   1 
ATOM   115  C CB  . LEU A 1 22  ? 26.882 19.650 44.121 1.00 81.74  ? 22  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 22  ? 27.624 18.769 45.126 1.00 86.50  ? 22  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 22  ? 27.704 19.454 46.483 1.00 89.09  ? 22  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 22  ? 26.951 17.412 45.244 1.00 88.75  ? 22  LEU A CD2 1 
ATOM   119  N N   . GLY A 1 23  ? 26.586 21.222 41.574 1.00 84.09  ? 23  GLY A N   1 
ATOM   120  C CA  . GLY A 1 23  ? 25.959 22.260 40.778 1.00 89.41  ? 23  GLY A CA  1 
ATOM   121  C C   . GLY A 1 23  ? 25.348 21.753 39.486 1.00 97.57  ? 23  GLY A C   1 
ATOM   122  O O   . GLY A 1 23  ? 24.203 22.072 39.169 1.00 99.00  ? 23  GLY A O   1 
ATOM   123  N N   . ASN A 1 24  ? 26.108 20.958 38.739 1.00 105.77 ? 24  ASN A N   1 
ATOM   124  C CA  . ASN A 1 24  ? 25.650 20.472 37.440 1.00 114.49 ? 24  ASN A CA  1 
ATOM   125  C C   . ASN A 1 24  ? 24.729 19.258 37.510 1.00 113.10 ? 24  ASN A C   1 
ATOM   126  O O   . ASN A 1 24  ? 23.789 19.146 36.725 1.00 114.78 ? 24  ASN A O   1 
ATOM   127  C CB  . ASN A 1 24  ? 26.835 20.187 36.517 1.00 124.99 ? 24  ASN A CB  1 
ATOM   128  C CG  . ASN A 1 24  ? 27.355 21.436 35.838 1.00 132.04 ? 24  ASN A CG  1 
ATOM   129  O OD1 . ASN A 1 24  ? 26.873 22.540 36.088 1.00 131.24 ? 24  ASN A OD1 1 
ATOM   130  N ND2 . ASN A 1 24  ? 28.340 21.268 34.967 1.00 136.42 ? 24  ASN A ND2 1 
ATOM   131  N N   . VAL A 1 25  ? 24.998 18.347 38.439 1.00 108.99 ? 25  VAL A N   1 
ATOM   132  C CA  . VAL A 1 25  ? 24.124 17.196 38.623 1.00 108.25 ? 25  VAL A CA  1 
ATOM   133  C C   . VAL A 1 25  ? 22.748 17.702 39.035 1.00 117.09 ? 25  VAL A C   1 
ATOM   134  O O   . VAL A 1 25  ? 21.730 17.059 38.778 1.00 127.83 ? 25  VAL A O   1 
ATOM   135  C CB  . VAL A 1 25  ? 24.665 16.217 39.685 1.00 105.96 ? 25  VAL A CB  1 
ATOM   136  C CG1 . VAL A 1 25  ? 24.466 16.779 41.083 1.00 107.62 ? 25  VAL A CG1 1 
ATOM   137  C CG2 . VAL A 1 25  ? 23.983 14.864 39.556 1.00 103.58 ? 25  VAL A CG2 1 
ATOM   138  N N   . LEU A 1 26  ? 22.732 18.869 39.669 1.00 113.24 ? 26  LEU A N   1 
ATOM   139  C CA  . LEU A 1 26  ? 21.491 19.524 40.052 1.00 106.35 ? 26  LEU A CA  1 
ATOM   140  C C   . LEU A 1 26  ? 20.821 20.097 38.811 1.00 90.74  ? 26  LEU A C   1 
ATOM   141  O O   . LEU A 1 26  ? 19.611 19.975 38.636 1.00 98.47  ? 26  LEU A O   1 
ATOM   142  C CB  . LEU A 1 26  ? 21.770 20.638 41.061 1.00 113.68 ? 26  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 26  ? 20.558 21.285 41.731 1.00 120.87 ? 26  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 26  ? 19.780 20.254 42.532 1.00 125.30 ? 26  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 26  ? 20.995 22.438 42.620 1.00 122.37 ? 26  LEU A CD2 1 
ATOM   146  N N   . VAL A 1 27  ? 21.619 20.720 37.951 1.00 80.86  ? 27  VAL A N   1 
ATOM   147  C CA  . VAL A 1 27  ? 21.122 21.264 36.693 1.00 89.38  ? 27  VAL A CA  1 
ATOM   148  C C   . VAL A 1 27  ? 20.558 20.158 35.806 1.00 96.75  ? 27  VAL A C   1 
ATOM   149  O O   . VAL A 1 27  ? 19.627 20.383 35.034 1.00 94.34  ? 27  VAL A O   1 
ATOM   150  C CB  . VAL A 1 27  ? 22.231 22.010 35.922 1.00 94.93  ? 27  VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 27  ? 21.726 22.465 34.559 1.00 90.11  ? 27  VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 27  ? 22.738 23.194 36.729 1.00 99.68  ? 27  VAL A CG2 1 
ATOM   153  N N   . CYS A 1 28  ? 21.125 18.962 35.923 1.00 108.67 ? 28  CYS A N   1 
ATOM   154  C CA  . CYS A 1 28  ? 20.686 17.829 35.118 1.00 116.61 ? 28  CYS A CA  1 
ATOM   155  C C   . CYS A 1 28  ? 19.415 17.199 35.682 1.00 116.37 ? 28  CYS A C   1 
ATOM   156  O O   . CYS A 1 28  ? 18.512 16.822 34.932 1.00 109.49 ? 28  CYS A O   1 
ATOM   157  C CB  . CYS A 1 28  ? 21.798 16.782 35.015 1.00 118.64 ? 28  CYS A CB  1 
ATOM   158  S SG  . CYS A 1 28  ? 23.282 17.359 34.159 1.00 147.31 ? 28  CYS A SG  1 
ATOM   159  N N   . TRP A 1 29  ? 19.351 17.090 37.005 1.00 120.17 ? 29  TRP A N   1 
ATOM   160  C CA  . TRP A 1 29  ? 18.193 16.512 37.676 1.00 127.64 ? 29  TRP A CA  1 
ATOM   161  C C   . TRP A 1 29  ? 16.990 17.446 37.589 1.00 125.67 ? 29  TRP A C   1 
ATOM   162  O O   . TRP A 1 29  ? 15.843 17.000 37.566 1.00 124.94 ? 29  TRP A O   1 
ATOM   163  C CB  . TRP A 1 29  ? 18.524 16.215 39.140 1.00 133.50 ? 29  TRP A CB  1 
ATOM   164  C CG  . TRP A 1 29  ? 17.447 15.469 39.862 1.00 144.29 ? 29  TRP A CG  1 
ATOM   165  C CD1 . TRP A 1 29  ? 16.389 14.813 39.304 1.00 145.01 ? 29  TRP A CD1 1 
ATOM   166  C CD2 . TRP A 1 29  ? 17.331 15.287 41.278 1.00 157.02 ? 29  TRP A CD2 1 
ATOM   167  N NE1 . TRP A 1 29  ? 15.616 14.241 40.285 1.00 152.93 ? 29  TRP A NE1 1 
ATOM   168  C CE2 . TRP A 1 29  ? 16.173 14.517 41.506 1.00 160.70 ? 29  TRP A CE2 1 
ATOM   169  C CE3 . TRP A 1 29  ? 18.091 15.704 42.375 1.00 162.98 ? 29  TRP A CE3 1 
ATOM   170  C CZ2 . TRP A 1 29  ? 15.757 14.154 42.786 1.00 168.95 ? 29  TRP A CZ2 1 
ATOM   171  C CZ3 . TRP A 1 29  ? 17.677 15.342 43.645 1.00 169.67 ? 29  TRP A CZ3 1 
ATOM   172  C CH2 . TRP A 1 29  ? 16.521 14.576 43.839 1.00 173.26 ? 29  TRP A CH2 1 
ATOM   173  N N   . ALA A 1 30  ? 17.263 18.745 37.538 1.00 119.18 ? 30  ALA A N   1 
ATOM   174  C CA  . ALA A 1 30  ? 16.211 19.747 37.438 1.00 109.24 ? 30  ALA A CA  1 
ATOM   175  C C   . ALA A 1 30  ? 15.535 19.689 36.074 1.00 113.40 ? 30  ALA A C   1 
ATOM   176  O O   . ALA A 1 30  ? 14.342 19.958 35.951 1.00 127.72 ? 30  ALA A O   1 
ATOM   177  C CB  . ALA A 1 30  ? 16.775 21.134 37.692 1.00 100.27 ? 30  ALA A CB  1 
ATOM   178  N N   . VAL A 1 31  ? 16.305 19.337 35.050 1.00 106.66 ? 31  VAL A N   1 
ATOM   179  C CA  . VAL A 1 31  ? 15.766 19.215 33.702 1.00 111.40 ? 31  VAL A CA  1 
ATOM   180  C C   . VAL A 1 31  ? 15.105 17.854 33.517 1.00 111.25 ? 31  VAL A C   1 
ATOM   181  O O   . VAL A 1 31  ? 14.449 17.601 32.509 1.00 109.81 ? 31  VAL A O   1 
ATOM   182  C CB  . VAL A 1 31  ? 16.860 19.410 32.634 1.00 119.45 ? 31  VAL A CB  1 
ATOM   183  C CG1 . VAL A 1 31  ? 16.263 19.349 31.235 1.00 118.43 ? 31  VAL A CG1 1 
ATOM   184  C CG2 . VAL A 1 31  ? 17.572 20.735 32.846 1.00 124.31 ? 31  VAL A CG2 1 
ATOM   185  N N   . TRP A 1 32  ? 15.277 16.977 34.499 1.00 112.38 ? 32  TRP A N   1 
ATOM   186  C CA  . TRP A 1 32  ? 14.664 15.657 34.437 1.00 118.94 ? 32  TRP A CA  1 
ATOM   187  C C   . TRP A 1 32  ? 13.353 15.629 35.218 1.00 129.36 ? 32  TRP A C   1 
ATOM   188  O O   . TRP A 1 32  ? 12.538 14.725 35.043 1.00 144.94 ? 32  TRP A O   1 
ATOM   189  C CB  . TRP A 1 32  ? 15.629 14.588 34.952 1.00 122.34 ? 32  TRP A CB  1 
ATOM   190  C CG  . TRP A 1 32  ? 15.142 13.185 34.743 1.00 121.59 ? 32  TRP A CG  1 
ATOM   191  C CD1 . TRP A 1 32  ? 14.847 12.588 33.552 1.00 113.60 ? 32  TRP A CD1 1 
ATOM   192  C CD2 . TRP A 1 32  ? 14.910 12.197 35.754 1.00 128.27 ? 32  TRP A CD2 1 
ATOM   193  N NE1 . TRP A 1 32  ? 14.438 11.293 33.760 1.00 113.79 ? 32  TRP A NE1 1 
ATOM   194  C CE2 . TRP A 1 32  ? 14.468 11.028 35.104 1.00 126.68 ? 32  TRP A CE2 1 
ATOM   195  C CE3 . TRP A 1 32  ? 15.030 12.190 37.147 1.00 136.92 ? 32  TRP A CE3 1 
ATOM   196  C CZ2 . TRP A 1 32  ? 14.147 9.863  35.798 1.00 139.72 ? 32  TRP A CZ2 1 
ATOM   197  C CZ3 . TRP A 1 32  ? 14.711 11.033 37.834 1.00 143.91 ? 32  TRP A CZ3 1 
ATOM   198  C CH2 . TRP A 1 32  ? 14.274 9.886  37.160 1.00 145.80 ? 32  TRP A CH2 1 
ATOM   199  N N   . LEU A 1 33  ? 13.151 16.628 36.072 1.00 122.03 ? 33  LEU A N   1 
ATOM   200  C CA  . LEU A 1 33  ? 11.916 16.736 36.842 1.00 118.64 ? 33  LEU A CA  1 
ATOM   201  C C   . LEU A 1 33  ? 10.953 17.735 36.210 1.00 122.08 ? 33  LEU A C   1 
ATOM   202  O O   . LEU A 1 33  ? 9.753  17.480 36.110 1.00 128.24 ? 33  LEU A O   1 
ATOM   203  C CB  . LEU A 1 33  ? 12.212 17.152 38.283 1.00 105.09 ? 33  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 33  ? 13.070 16.191 39.101 1.00 98.28  ? 33  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 33  ? 13.180 16.673 40.539 1.00 103.89 ? 33  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 33  ? 12.489 14.791 39.046 1.00 93.67  ? 33  LEU A CD2 1 
ATOM   207  N N   . ASN A 1 34  ? 11.492 18.873 35.789 1.00 151.17 ? 34  ASN A N   1 
ATOM   208  C CA  . ASN A 1 34  ? 10.683 19.946 35.228 1.00 148.06 ? 34  ASN A CA  1 
ATOM   209  C C   . ASN A 1 34  ? 10.656 19.902 33.704 1.00 144.77 ? 34  ASN A C   1 
ATOM   210  O O   . ASN A 1 34  ? 11.622 20.282 33.044 1.00 152.90 ? 34  ASN A O   1 
ATOM   211  C CB  . ASN A 1 34  ? 11.196 21.301 35.721 1.00 151.13 ? 34  ASN A CB  1 
ATOM   212  C CG  . ASN A 1 34  ? 10.213 22.425 35.471 1.00 153.77 ? 34  ASN A CG  1 
ATOM   213  O OD1 . ASN A 1 34  ? 9.572  22.482 34.424 1.00 156.39 ? 34  ASN A OD1 1 
ATOM   214  N ND2 . ASN A 1 34  ? 10.093 23.331 36.435 1.00 154.35 ? 34  ASN A ND2 1 
ATOM   215  N N   . SER A 1 35  ? 9.540  19.436 33.153 1.00 139.48 ? 35  SER A N   1 
ATOM   216  C CA  . SER A 1 35  ? 9.396  19.275 31.709 1.00 138.25 ? 35  SER A CA  1 
ATOM   217  C C   . SER A 1 35  ? 9.342  20.612 30.975 1.00 136.66 ? 35  SER A C   1 
ATOM   218  O O   . SER A 1 35  ? 9.377  20.655 29.745 1.00 114.52 ? 35  SER A O   1 
ATOM   219  C CB  . SER A 1 35  ? 8.143  18.460 31.393 1.00 114.80 ? 35  SER A CB  1 
ATOM   220  O OG  . SER A 1 35  ? 7.001  19.059 31.974 1.00 131.75 ? 35  SER A OG  1 
ATOM   221  N N   . ASN A 1 36  ? 9.249  21.699 31.733 1.00 136.48 ? 36  ASN A N   1 
ATOM   222  C CA  . ASN A 1 36  ? 9.229  23.034 31.150 1.00 136.06 ? 36  ASN A CA  1 
ATOM   223  C C   . ASN A 1 36  ? 10.638 23.491 30.801 1.00 143.55 ? 36  ASN A C   1 
ATOM   224  O O   . ASN A 1 36  ? 10.842 24.605 30.318 1.00 152.30 ? 36  ASN A O   1 
ATOM   225  C CB  . ASN A 1 36  ? 8.569  24.027 32.106 1.00 130.26 ? 36  ASN A CB  1 
ATOM   226  C CG  . ASN A 1 36  ? 7.186  23.582 32.542 1.00 126.55 ? 36  ASN A CG  1 
ATOM   227  O OD1 . ASN A 1 36  ? 6.566  22.731 31.906 1.00 113.83 ? 36  ASN A OD1 1 
ATOM   228  N ND2 . ASN A 1 36  ? 6.697  24.157 33.633 1.00 123.54 ? 36  ASN A ND2 1 
ATOM   229  N N   . LEU A 1 37  ? 11.606 22.616 31.054 1.00 141.93 ? 37  LEU A N   1 
ATOM   230  C CA  . LEU A 1 37  ? 13.002 22.880 30.734 1.00 138.10 ? 37  LEU A CA  1 
ATOM   231  C C   . LEU A 1 37  ? 13.486 21.889 29.684 1.00 140.61 ? 37  LEU A C   1 
ATOM   232  O O   . LEU A 1 37  ? 14.569 22.042 29.123 1.00 146.69 ? 37  LEU A O   1 
ATOM   233  C CB  . LEU A 1 37  ? 13.868 22.757 31.989 1.00 132.15 ? 37  LEU A CB  1 
ATOM   234  C CG  . LEU A 1 37  ? 13.617 23.758 33.118 1.00 132.66 ? 37  LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 37  ? 14.274 23.295 34.411 1.00 114.15 ? 37  LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 37  ? 14.106 25.142 32.724 1.00 133.45 ? 37  LEU A CD2 1 
ATOM   237  N N   . GLN A 1 38  ? 12.669 20.875 29.421 1.00 142.31 ? 38  GLN A N   1 
ATOM   238  C CA  . GLN A 1 38  ? 13.050 19.787 28.528 1.00 141.39 ? 38  GLN A CA  1 
ATOM   239  C C   . GLN A 1 38  ? 12.804 20.124 27.060 1.00 139.14 ? 38  GLN A C   1 
ATOM   240  O O   . GLN A 1 38  ? 12.204 19.339 26.325 1.00 135.33 ? 38  GLN A O   1 
ATOM   241  C CB  . GLN A 1 38  ? 12.307 18.507 28.911 1.00 140.53 ? 38  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 38  ? 12.480 18.123 30.371 1.00 140.31 ? 38  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 38  ? 11.666 16.907 30.762 1.00 138.55 ? 38  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 38  ? 11.080 16.239 29.912 1.00 144.11 ? 38  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 38  ? 11.626 16.615 32.057 1.00 132.41 ? 38  GLN A NE2 1 
ATOM   246  N N   . ASN A 1 39  ? 13.275 21.293 26.639 1.00 141.57 ? 39  ASN A N   1 
ATOM   247  C CA  . ASN A 1 39  ? 13.173 21.700 25.243 1.00 146.63 ? 39  ASN A CA  1 
ATOM   248  C C   . ASN A 1 39  ? 14.470 21.439 24.483 1.00 152.89 ? 39  ASN A C   1 
ATOM   249  O O   . ASN A 1 39  ? 15.476 21.045 25.074 1.00 150.37 ? 39  ASN A O   1 
ATOM   250  C CB  . ASN A 1 39  ? 12.771 23.174 25.132 1.00 144.65 ? 39  ASN A CB  1 
ATOM   251  C CG  . ASN A 1 39  ? 13.704 24.095 25.896 1.00 141.37 ? 39  ASN A CG  1 
ATOM   252  O OD1 . ASN A 1 39  ? 14.415 24.906 25.304 1.00 134.04 ? 39  ASN A OD1 1 
ATOM   253  N ND2 . ASN A 1 39  ? 13.703 23.975 27.219 1.00 141.28 ? 39  ASN A ND2 1 
ATOM   254  N N   . VAL A 1 40  ? 14.441 21.657 23.173 1.00 157.67 ? 40  VAL A N   1 
ATOM   255  C CA  . VAL A 1 40  ? 15.599 21.392 22.326 1.00 160.18 ? 40  VAL A CA  1 
ATOM   256  C C   . VAL A 1 40  ? 16.825 22.177 22.784 1.00 171.26 ? 40  VAL A C   1 
ATOM   257  O O   . VAL A 1 40  ? 17.947 21.672 22.744 1.00 175.59 ? 40  VAL A O   1 
ATOM   258  C CB  . VAL A 1 40  ? 15.307 21.724 20.851 1.00 158.28 ? 40  VAL A CB  1 
ATOM   259  C CG1 . VAL A 1 40  ? 16.497 21.356 19.982 1.00 159.94 ? 40  VAL A CG1 1 
ATOM   260  C CG2 . VAL A 1 40  ? 14.060 20.994 20.382 1.00 159.48 ? 40  VAL A CG2 1 
ATOM   261  N N   . THR A 1 41  ? 16.602 23.412 23.222 1.00 147.52 ? 41  THR A N   1 
ATOM   262  C CA  . THR A 1 41  ? 17.689 24.278 23.668 1.00 146.31 ? 41  THR A CA  1 
ATOM   263  C C   . THR A 1 41  ? 18.481 23.649 24.808 1.00 133.20 ? 41  THR A C   1 
ATOM   264  O O   . THR A 1 41  ? 19.706 23.561 24.749 1.00 128.63 ? 41  THR A O   1 
ATOM   265  C CB  . THR A 1 41  ? 17.164 25.650 24.134 1.00 151.06 ? 41  THR A CB  1 
ATOM   266  O OG1 . THR A 1 41  ? 16.488 26.303 23.052 1.00 155.70 ? 41  THR A OG1 1 
ATOM   267  C CG2 . THR A 1 41  ? 18.313 26.526 24.615 1.00 146.48 ? 41  THR A CG2 1 
ATOM   268  N N   . ASN A 1 42  ? 17.774 23.212 25.844 1.00 125.97 ? 42  ASN A N   1 
ATOM   269  C CA  . ASN A 1 42  ? 18.422 22.657 27.026 1.00 123.20 ? 42  ASN A CA  1 
ATOM   270  C C   . ASN A 1 42  ? 19.060 21.293 26.792 1.00 128.04 ? 42  ASN A C   1 
ATOM   271  O O   . ASN A 1 42  ? 19.774 20.782 27.654 1.00 131.69 ? 42  ASN A O   1 
ATOM   272  C CB  . ASN A 1 42  ? 17.449 22.597 28.205 1.00 124.25 ? 42  ASN A CB  1 
ATOM   273  C CG  . ASN A 1 42  ? 17.148 23.966 28.782 1.00 131.39 ? 42  ASN A CG  1 
ATOM   274  O OD1 . ASN A 1 42  ? 16.560 24.084 29.857 1.00 133.82 ? 42  ASN A OD1 1 
ATOM   275  N ND2 . ASN A 1 42  ? 17.557 25.011 28.072 1.00 134.03 ? 42  ASN A ND2 1 
ATOM   276  N N   . TYR A 1 43  ? 18.804 20.702 25.630 1.00 127.55 ? 43  TYR A N   1 
ATOM   277  C CA  . TYR A 1 43  ? 19.464 19.452 25.275 1.00 126.74 ? 43  TYR A CA  1 
ATOM   278  C C   . TYR A 1 43  ? 20.972 19.658 25.198 1.00 118.00 ? 43  TYR A C   1 
ATOM   279  O O   . TYR A 1 43  ? 21.747 18.795 25.608 1.00 106.90 ? 43  TYR A O   1 
ATOM   280  C CB  . TYR A 1 43  ? 18.929 18.894 23.955 1.00 127.45 ? 43  TYR A CB  1 
ATOM   281  C CG  . TYR A 1 43  ? 17.707 18.021 24.118 1.00 123.16 ? 43  TYR A CG  1 
ATOM   282  C CD1 . TYR A 1 43  ? 17.720 16.932 24.979 1.00 123.92 ? 43  TYR A CD1 1 
ATOM   283  C CD2 . TYR A 1 43  ? 16.546 18.275 23.403 1.00 126.72 ? 43  TYR A CD2 1 
ATOM   284  C CE1 . TYR A 1 43  ? 16.610 16.128 25.132 1.00 129.85 ? 43  TYR A CE1 1 
ATOM   285  C CE2 . TYR A 1 43  ? 15.429 17.475 23.548 1.00 137.07 ? 43  TYR A CE2 1 
ATOM   286  C CZ  . TYR A 1 43  ? 15.467 16.403 24.414 1.00 139.38 ? 43  TYR A CZ  1 
ATOM   287  O OH  . TYR A 1 43  ? 14.357 15.601 24.563 1.00 142.90 ? 43  TYR A OH  1 
ATOM   288  N N   . PHE A 1 44  ? 21.377 20.812 24.676 1.00 123.49 ? 44  PHE A N   1 
ATOM   289  C CA  . PHE A 1 44  ? 22.787 21.172 24.603 1.00 130.12 ? 44  PHE A CA  1 
ATOM   290  C C   . PHE A 1 44  ? 23.316 21.574 25.974 1.00 130.25 ? 44  PHE A C   1 
ATOM   291  O O   . PHE A 1 44  ? 24.463 21.285 26.315 1.00 133.26 ? 44  PHE A O   1 
ATOM   292  C CB  . PHE A 1 44  ? 23.002 22.315 23.609 1.00 136.51 ? 44  PHE A CB  1 
ATOM   293  C CG  . PHE A 1 44  ? 22.705 21.946 22.184 1.00 144.59 ? 44  PHE A CG  1 
ATOM   294  C CD1 . PHE A 1 44  ? 21.484 22.260 21.613 1.00 149.16 ? 44  PHE A CD1 1 
ATOM   295  C CD2 . PHE A 1 44  ? 23.649 21.286 21.415 1.00 147.79 ? 44  PHE A CD2 1 
ATOM   296  C CE1 . PHE A 1 44  ? 21.209 21.923 20.301 1.00 153.53 ? 44  PHE A CE1 1 
ATOM   297  C CE2 . PHE A 1 44  ? 23.381 20.946 20.103 1.00 151.14 ? 44  PHE A CE2 1 
ATOM   298  C CZ  . PHE A 1 44  ? 22.159 21.265 19.546 1.00 154.69 ? 44  PHE A CZ  1 
ATOM   299  N N   . VAL A 1 45  ? 22.476 22.247 26.754 1.00 123.98 ? 45  VAL A N   1 
ATOM   300  C CA  . VAL A 1 45  ? 22.850 22.664 28.101 1.00 118.89 ? 45  VAL A CA  1 
ATOM   301  C C   . VAL A 1 45  ? 23.311 21.466 28.923 1.00 122.83 ? 45  VAL A C   1 
ATOM   302  O O   . VAL A 1 45  ? 24.255 21.564 29.707 1.00 128.60 ? 45  VAL A O   1 
ATOM   303  C CB  . VAL A 1 45  ? 21.683 23.363 28.824 1.00 107.40 ? 45  VAL A CB  1 
ATOM   304  C CG1 . VAL A 1 45  ? 22.030 23.612 30.284 1.00 100.77 ? 45  VAL A CG1 1 
ATOM   305  C CG2 . VAL A 1 45  ? 21.331 24.665 28.123 1.00 105.37 ? 45  VAL A CG2 1 
ATOM   306  N N   . VAL A 1 46  ? 22.640 20.335 28.736 1.00 117.91 ? 46  VAL A N   1 
ATOM   307  C CA  . VAL A 1 46  ? 23.013 19.106 29.422 1.00 114.19 ? 46  VAL A CA  1 
ATOM   308  C C   . VAL A 1 46  ? 24.393 18.636 28.969 1.00 109.62 ? 46  VAL A C   1 
ATOM   309  O O   . VAL A 1 46  ? 25.185 18.145 29.771 1.00 105.39 ? 46  VAL A O   1 
ATOM   310  C CB  . VAL A 1 46  ? 21.984 17.988 29.175 1.00 102.47 ? 46  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 46  ? 22.354 16.744 29.967 1.00 97.70  ? 46  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 46  ? 20.592 18.464 29.547 1.00 98.31  ? 46  VAL A CG2 1 
ATOM   313  N N   . SER A 1 47  ? 24.674 18.791 27.679 1.00 112.39 ? 47  SER A N   1 
ATOM   314  C CA  . SER A 1 47  ? 25.974 18.426 27.130 1.00 125.93 ? 47  SER A CA  1 
ATOM   315  C C   . SER A 1 47  ? 27.075 19.258 27.777 1.00 135.02 ? 47  SER A C   1 
ATOM   316  O O   . SER A 1 47  ? 28.177 18.768 28.023 1.00 134.58 ? 47  SER A O   1 
ATOM   317  C CB  . SER A 1 47  ? 25.989 18.617 25.612 1.00 133.19 ? 47  SER A CB  1 
ATOM   318  O OG  . SER A 1 47  ? 27.267 18.327 25.072 1.00 145.21 ? 47  SER A OG  1 
ATOM   319  N N   . LEU A 1 48  ? 26.766 20.522 28.048 1.00 135.47 ? 48  LEU A N   1 
ATOM   320  C CA  . LEU A 1 48  ? 27.697 21.413 28.728 1.00 132.46 ? 48  LEU A CA  1 
ATOM   321  C C   . LEU A 1 48  ? 27.811 21.038 30.201 1.00 127.07 ? 48  LEU A C   1 
ATOM   322  O O   . LEU A 1 48  ? 28.900 21.057 30.774 1.00 123.62 ? 48  LEU A O   1 
ATOM   323  C CB  . LEU A 1 48  ? 27.240 22.866 28.592 1.00 138.17 ? 48  LEU A CB  1 
ATOM   324  C CG  . LEU A 1 48  ? 28.057 23.911 29.352 1.00 147.28 ? 48  LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 48  ? 29.506 23.903 28.893 1.00 152.02 ? 48  LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 48  ? 27.446 25.293 29.183 1.00 150.17 ? 48  LEU A CD2 1 
ATOM   327  N N   . ALA A 1 49  ? 26.679 20.697 30.807 1.00 127.29 ? 49  ALA A N   1 
ATOM   328  C CA  . ALA A 1 49  ? 26.652 20.286 32.205 1.00 123.94 ? 49  ALA A CA  1 
ATOM   329  C C   . ALA A 1 49  ? 27.438 18.996 32.401 1.00 128.47 ? 49  ALA A C   1 
ATOM   330  O O   . ALA A 1 49  ? 28.414 18.963 33.148 1.00 134.09 ? 49  ALA A O   1 
ATOM   331  C CB  . ALA A 1 49  ? 25.218 20.112 32.680 1.00 114.21 ? 49  ALA A CB  1 
ATOM   332  N N   . ALA A 1 50  ? 27.006 17.938 31.721 1.00 127.42 ? 50  ALA A N   1 
ATOM   333  C CA  . ALA A 1 50  ? 27.670 16.642 31.801 1.00 128.55 ? 50  ALA A CA  1 
ATOM   334  C C   . ALA A 1 50  ? 29.170 16.781 31.584 1.00 127.80 ? 50  ALA A C   1 
ATOM   335  O O   . ALA A 1 50  ? 29.963 16.069 32.200 1.00 130.11 ? 50  ALA A O   1 
ATOM   336  C CB  . ALA A 1 50  ? 27.074 15.679 30.788 1.00 132.56 ? 50  ALA A CB  1 
ATOM   337  N N   . ALA A 1 51  ? 29.553 17.699 30.704 1.00 126.24 ? 51  ALA A N   1 
ATOM   338  C CA  . ALA A 1 51  ? 30.961 17.972 30.454 1.00 127.96 ? 51  ALA A CA  1 
ATOM   339  C C   . ALA A 1 51  ? 31.617 18.536 31.708 1.00 128.18 ? 51  ALA A C   1 
ATOM   340  O O   . ALA A 1 51  ? 32.586 17.977 32.219 1.00 132.39 ? 51  ALA A O   1 
ATOM   341  C CB  . ALA A 1 51  ? 31.117 18.938 29.290 1.00 127.68 ? 51  ALA A CB  1 
ATOM   342  N N   . ASP A 1 52  ? 31.075 19.643 32.206 1.00 126.05 ? 52  ASP A N   1 
ATOM   343  C CA  . ASP A 1 52  ? 31.617 20.292 33.394 1.00 127.44 ? 52  ASP A CA  1 
ATOM   344  C C   . ASP A 1 52  ? 31.491 19.412 34.638 1.00 122.04 ? 52  ASP A C   1 
ATOM   345  O O   . ASP A 1 52  ? 32.048 19.728 35.689 1.00 125.28 ? 52  ASP A O   1 
ATOM   346  C CB  . ASP A 1 52  ? 30.948 21.650 33.620 1.00 134.14 ? 52  ASP A CB  1 
ATOM   347  C CG  . ASP A 1 52  ? 31.363 22.685 32.590 1.00 136.84 ? 52  ASP A CG  1 
ATOM   348  O OD1 . ASP A 1 52  ? 32.180 22.352 31.705 1.00 139.16 ? 52  ASP A OD1 1 
ATOM   349  O OD2 . ASP A 1 52  ? 30.875 23.833 32.668 1.00 130.97 ? 52  ASP A OD2 1 
ATOM   350  N N   . ILE A 1 53  ? 30.758 18.311 34.513 1.00 116.48 ? 53  ILE A N   1 
ATOM   351  C CA  . ILE A 1 53  ? 30.663 17.329 35.587 1.00 117.89 ? 53  ILE A CA  1 
ATOM   352  C C   . ILE A 1 53  ? 31.902 16.444 35.580 1.00 120.97 ? 53  ILE A C   1 
ATOM   353  O O   . ILE A 1 53  ? 32.529 16.222 36.616 1.00 119.49 ? 53  ILE A O   1 
ATOM   354  C CB  . ILE A 1 53  ? 29.415 16.437 35.437 1.00 110.47 ? 53  ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 53  ? 28.143 17.272 35.561 1.00 105.13 ? 53  ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 53  ? 29.416 15.333 36.482 1.00 107.05 ? 53  ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 53  ? 26.877 16.465 35.426 1.00 106.66 ? 53  ILE A CD1 1 
ATOM   358  N N   . LEU A 1 54  ? 32.251 15.945 34.398 1.00 120.51 ? 54  LEU A N   1 
ATOM   359  C CA  . LEU A 1 54  ? 33.425 15.099 34.234 1.00 119.95 ? 54  LEU A CA  1 
ATOM   360  C C   . LEU A 1 54  ? 34.700 15.846 34.609 1.00 121.87 ? 54  LEU A C   1 
ATOM   361  O O   . LEU A 1 54  ? 35.753 15.238 34.797 1.00 123.13 ? 54  LEU A O   1 
ATOM   362  C CB  . LEU A 1 54  ? 33.521 14.590 32.795 1.00 115.14 ? 54  LEU A CB  1 
ATOM   363  C CG  . LEU A 1 54  ? 32.417 13.635 32.341 1.00 102.89 ? 54  LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 54  ? 32.550 13.323 30.858 1.00 96.59  ? 54  LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 54  ? 32.443 12.359 33.169 1.00 101.06 ? 54  LEU A CD2 1 
ATOM   366  N N   . VAL A 1 55  ? 34.602 17.167 34.710 1.00 117.38 ? 55  VAL A N   1 
ATOM   367  C CA  . VAL A 1 55  ? 35.738 17.973 35.134 1.00 118.45 ? 55  VAL A CA  1 
ATOM   368  C C   . VAL A 1 55  ? 36.093 17.662 36.583 1.00 126.18 ? 55  VAL A C   1 
ATOM   369  O O   . VAL A 1 55  ? 37.193 17.195 36.873 1.00 134.42 ? 55  VAL A O   1 
ATOM   370  C CB  . VAL A 1 55  ? 35.463 19.479 34.980 1.00 113.90 ? 55  VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 55  ? 36.585 20.289 35.612 1.00 110.76 ? 55  VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 55  ? 35.302 19.840 33.511 1.00 112.97 ? 55  VAL A CG2 1 
ATOM   373  N N   . GLY A 1 56  ? 35.155 17.912 37.489 1.00 124.00 ? 56  GLY A N   1 
ATOM   374  C CA  . GLY A 1 56  ? 35.375 17.642 38.898 1.00 121.27 ? 56  GLY A CA  1 
ATOM   375  C C   . GLY A 1 56  ? 35.510 16.161 39.191 1.00 117.39 ? 56  GLY A C   1 
ATOM   376  O O   . GLY A 1 56  ? 36.049 15.769 40.227 1.00 114.26 ? 56  GLY A O   1 
ATOM   377  N N   . VAL A 1 57  ? 35.024 15.333 38.272 1.00 115.66 ? 57  VAL A N   1 
ATOM   378  C CA  . VAL A 1 57  ? 35.049 13.887 38.457 1.00 116.41 ? 57  VAL A CA  1 
ATOM   379  C C   . VAL A 1 57  ? 36.326 13.260 37.899 1.00 109.85 ? 57  VAL A C   1 
ATOM   380  O O   . VAL A 1 57  ? 36.854 12.303 38.464 1.00 104.45 ? 57  VAL A O   1 
ATOM   381  C CB  . VAL A 1 57  ? 33.822 13.212 37.805 1.00 114.26 ? 57  VAL A CB  1 
ATOM   382  C CG1 . VAL A 1 57  ? 33.874 11.703 38.004 1.00 108.69 ? 57  VAL A CG1 1 
ATOM   383  C CG2 . VAL A 1 57  ? 32.535 13.782 38.380 1.00 108.56 ? 57  VAL A CG2 1 
ATOM   384  N N   . LEU A 1 58  ? 36.820 13.807 36.793 1.00 110.65 ? 58  LEU A N   1 
ATOM   385  C CA  . LEU A 1 58  ? 37.990 13.246 36.125 1.00 114.47 ? 58  LEU A CA  1 
ATOM   386  C C   . LEU A 1 58  ? 39.096 14.274 35.895 1.00 110.23 ? 58  LEU A C   1 
ATOM   387  O O   . LEU A 1 58  ? 40.241 14.060 36.289 1.00 110.43 ? 58  LEU A O   1 
ATOM   388  C CB  . LEU A 1 58  ? 37.590 12.603 34.796 1.00 116.35 ? 58  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 58  ? 36.645 11.405 34.893 1.00 118.37 ? 58  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 58  ? 36.331 10.861 33.510 1.00 120.52 ? 58  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 58  ? 37.248 10.323 35.775 1.00 119.13 ? 58  LEU A CD2 1 
ATOM   392  N N   . ALA A 1 59  ? 38.750 15.385 35.253 1.00 106.97 ? 59  ALA A N   1 
ATOM   393  C CA  . ALA A 1 59  ? 39.732 16.413 34.921 1.00 108.56 ? 59  ALA A CA  1 
ATOM   394  C C   . ALA A 1 59  ? 40.526 16.864 36.142 1.00 111.92 ? 59  ALA A C   1 
ATOM   395  O O   . ALA A 1 59  ? 41.749 16.750 36.168 1.00 113.16 ? 59  ALA A O   1 
ATOM   396  C CB  . ALA A 1 59  ? 39.061 17.602 34.253 1.00 96.97  ? 59  ALA A CB  1 
ATOM   397  N N   . ILE A 1 60  ? 39.829 17.377 37.149 1.00 113.93 ? 60  ILE A N   1 
ATOM   398  C CA  . ILE A 1 60  ? 40.480 17.849 38.367 1.00 116.15 ? 60  ILE A CA  1 
ATOM   399  C C   . ILE A 1 60  ? 41.297 16.754 39.055 1.00 114.44 ? 60  ILE A C   1 
ATOM   400  O O   . ILE A 1 60  ? 42.442 16.986 39.441 1.00 118.51 ? 60  ILE A O   1 
ATOM   401  C CB  . ILE A 1 60  ? 39.472 18.464 39.359 1.00 122.21 ? 60  ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 60  ? 38.871 19.745 38.775 1.00 120.62 ? 60  ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 60  ? 40.142 18.747 40.694 1.00 123.92 ? 60  ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 60  ? 37.937 20.471 39.717 1.00 113.82 ? 60  ILE A CD1 1 
ATOM   405  N N   . PRO A 1 61  ? 40.712 15.556 39.217 1.00 113.52 ? 61  PRO A N   1 
ATOM   406  C CA  . PRO A 1 61  ? 41.486 14.441 39.774 1.00 116.10 ? 61  PRO A CA  1 
ATOM   407  C C   . PRO A 1 61  ? 42.743 14.158 38.955 1.00 115.50 ? 61  PRO A C   1 
ATOM   408  O O   . PRO A 1 61  ? 43.780 13.818 39.523 1.00 112.36 ? 61  PRO A O   1 
ATOM   409  C CB  . PRO A 1 61  ? 40.516 13.262 39.674 1.00 117.29 ? 61  PRO A CB  1 
ATOM   410  C CG  . PRO A 1 61  ? 39.169 13.887 39.730 1.00 120.02 ? 61  PRO A CG  1 
ATOM   411  C CD  . PRO A 1 61  ? 39.298 15.197 39.010 1.00 115.84 ? 61  PRO A CD  1 
ATOM   412  N N   . PHE A 1 62  ? 42.647 14.298 37.637 1.00 116.53 ? 62  PHE A N   1 
ATOM   413  C CA  . PHE A 1 62  ? 43.794 14.094 36.758 1.00 112.69 ? 62  PHE A CA  1 
ATOM   414  C C   . PHE A 1 62  ? 44.755 15.274 36.827 1.00 111.72 ? 62  PHE A C   1 
ATOM   415  O O   . PHE A 1 62  ? 45.964 15.096 36.961 1.00 103.67 ? 62  PHE A O   1 
ATOM   416  C CB  . PHE A 1 62  ? 43.340 13.892 35.311 1.00 114.29 ? 62  PHE A CB  1 
ATOM   417  C CG  . PHE A 1 62  ? 42.657 12.579 35.063 1.00 113.29 ? 62  PHE A CG  1 
ATOM   418  C CD1 . PHE A 1 62  ? 42.921 11.483 35.867 1.00 110.02 ? 62  PHE A CD1 1 
ATOM   419  C CD2 . PHE A 1 62  ? 41.764 12.436 34.014 1.00 101.50 ? 62  PHE A CD2 1 
ATOM   420  C CE1 . PHE A 1 62  ? 42.297 10.273 35.637 1.00 112.20 ? 62  PHE A CE1 1 
ATOM   421  C CE2 . PHE A 1 62  ? 41.138 11.228 33.779 1.00 115.81 ? 62  PHE A CE2 1 
ATOM   422  C CZ  . PHE A 1 62  ? 41.405 10.145 34.591 1.00 114.44 ? 62  PHE A CZ  1 
ATOM   423  N N   . ALA A 1 63  ? 44.205 16.479 36.726 1.00 101.50 ? 63  ALA A N   1 
ATOM   424  C CA  . ALA A 1 63  ? 45.000 17.699 36.740 1.00 125.74 ? 63  ALA A CA  1 
ATOM   425  C C   . ALA A 1 63  ? 45.858 17.799 37.997 1.00 124.79 ? 63  ALA A C   1 
ATOM   426  O O   . ALA A 1 63  ? 46.988 18.285 37.951 1.00 125.30 ? 63  ALA A O   1 
ATOM   427  C CB  . ALA A 1 63  ? 44.098 18.919 36.613 1.00 100.43 ? 63  ALA A CB  1 
ATOM   428  N N   . ILE A 1 64  ? 45.315 17.337 39.117 1.00 125.91 ? 64  ILE A N   1 
ATOM   429  C CA  . ILE A 1 64  ? 46.028 17.393 40.387 1.00 132.56 ? 64  ILE A CA  1 
ATOM   430  C C   . ILE A 1 64  ? 47.053 16.267 40.491 1.00 136.74 ? 64  ILE A C   1 
ATOM   431  O O   . ILE A 1 64  ? 47.963 16.317 41.317 1.00 139.84 ? 64  ILE A O   1 
ATOM   432  C CB  . ILE A 1 64  ? 45.058 17.322 41.584 1.00 136.68 ? 64  ILE A CB  1 
ATOM   433  C CG1 . ILE A 1 64  ? 45.762 17.755 42.871 1.00 142.05 ? 64  ILE A CG1 1 
ATOM   434  C CG2 . ILE A 1 64  ? 44.477 15.922 41.722 1.00 135.26 ? 64  ILE A CG2 1 
ATOM   435  C CD1 . ILE A 1 64  ? 44.859 17.768 44.083 1.00 143.36 ? 64  ILE A CD1 1 
ATOM   436  N N   . THR A 1 65  ? 46.901 15.254 39.643 1.00 137.94 ? 65  THR A N   1 
ATOM   437  C CA  . THR A 1 65  ? 47.825 14.125 39.621 1.00 141.29 ? 65  THR A CA  1 
ATOM   438  C C   . THR A 1 65  ? 49.060 14.435 38.782 1.00 145.57 ? 65  THR A C   1 
ATOM   439  O O   . THR A 1 65  ? 50.190 14.291 39.247 1.00 147.47 ? 65  THR A O   1 
ATOM   440  C CB  . THR A 1 65  ? 47.149 12.853 39.077 1.00 139.37 ? 65  THR A CB  1 
ATOM   441  O OG1 . THR A 1 65  ? 46.130 12.425 39.988 1.00 145.66 ? 65  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 65  ? 48.167 11.738 38.909 1.00 135.13 ? 65  THR A CG2 1 
ATOM   443  N N   . ILE A 1 66  ? 48.836 14.864 37.544 1.00 146.66 ? 66  ILE A N   1 
ATOM   444  C CA  . ILE A 1 66  ? 49.930 15.196 36.638 1.00 148.91 ? 66  ILE A CA  1 
ATOM   445  C C   . ILE A 1 66  ? 50.686 16.429 37.127 1.00 154.75 ? 66  ILE A C   1 
ATOM   446  O O   . ILE A 1 66  ? 51.742 16.775 36.597 1.00 160.23 ? 66  ILE A O   1 
ATOM   447  C CB  . ILE A 1 66  ? 49.422 15.436 35.203 1.00 146.68 ? 66  ILE A CB  1 
ATOM   448  C CG1 . ILE A 1 66  ? 50.586 15.410 34.209 1.00 145.36 ? 66  ILE A CG1 1 
ATOM   449  C CG2 . ILE A 1 66  ? 48.655 16.749 35.119 1.00 148.68 ? 66  ILE A CG2 1 
ATOM   450  C CD1 . ILE A 1 66  ? 50.167 15.595 32.770 1.00 142.00 ? 66  ILE A CD1 1 
ATOM   451  N N   . SER A 1 67  ? 50.135 17.090 38.140 1.00 153.18 ? 67  SER A N   1 
ATOM   452  C CA  . SER A 1 67  ? 50.786 18.247 38.743 1.00 151.44 ? 67  SER A CA  1 
ATOM   453  C C   . SER A 1 67  ? 52.139 17.851 39.319 1.00 148.29 ? 67  SER A C   1 
ATOM   454  O O   . SER A 1 67  ? 53.158 18.473 39.021 1.00 151.52 ? 67  SER A O   1 
ATOM   455  C CB  . SER A 1 67  ? 49.907 18.846 39.842 1.00 152.34 ? 67  SER A CB  1 
ATOM   456  O OG  . SER A 1 67  ? 50.552 19.940 40.469 1.00 154.43 ? 67  SER A OG  1 
ATOM   457  N N   . THR A 1 68  ? 52.140 16.810 40.145 1.00 140.72 ? 68  THR A N   1 
ATOM   458  C CA  . THR A 1 68  ? 53.370 16.313 40.745 1.00 141.35 ? 68  THR A CA  1 
ATOM   459  C C   . THR A 1 68  ? 54.101 15.375 39.790 1.00 146.49 ? 68  THR A C   1 
ATOM   460  O O   . THR A 1 68  ? 55.255 15.017 40.019 1.00 156.40 ? 68  THR A O   1 
ATOM   461  C CB  . THR A 1 68  ? 53.096 15.579 42.070 1.00 136.92 ? 68  THR A CB  1 
ATOM   462  O OG1 . THR A 1 68  ? 52.243 14.454 41.828 1.00 137.10 ? 68  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 68  ? 52.427 16.512 43.067 1.00 132.35 ? 68  THR A CG2 1 
ATOM   464  N N   . GLY A 1 69  ? 53.421 14.983 38.717 1.00 169.11 ? 69  GLY A N   1 
ATOM   465  C CA  . GLY A 1 69  ? 53.999 14.093 37.727 1.00 161.23 ? 69  GLY A CA  1 
ATOM   466  C C   . GLY A 1 69  ? 54.066 12.658 38.208 1.00 155.73 ? 69  GLY A C   1 
ATOM   467  O O   . GLY A 1 69  ? 54.130 12.399 39.409 1.00 151.95 ? 69  GLY A O   1 
ATOM   468  N N   . PHE A 1 70  ? 54.049 11.721 37.267 1.00 157.04 ? 70  PHE A N   1 
ATOM   469  C CA  . PHE A 1 70  ? 54.116 10.301 37.596 1.00 159.73 ? 70  PHE A CA  1 
ATOM   470  C C   . PHE A 1 70  ? 54.787 9.514  36.476 1.00 162.19 ? 70  PHE A C   1 
ATOM   471  O O   . PHE A 1 70  ? 55.312 10.095 35.527 1.00 164.94 ? 70  PHE A O   1 
ATOM   472  C CB  . PHE A 1 70  ? 52.717 9.745  37.867 1.00 160.72 ? 70  PHE A CB  1 
ATOM   473  C CG  . PHE A 1 70  ? 51.781 9.862  36.698 1.00 158.63 ? 70  PHE A CG  1 
ATOM   474  C CD1 . PHE A 1 70  ? 51.028 11.009 36.509 1.00 157.77 ? 70  PHE A CD1 1 
ATOM   475  C CD2 . PHE A 1 70  ? 51.653 8.826  35.789 1.00 158.58 ? 70  PHE A CD2 1 
ATOM   476  C CE1 . PHE A 1 70  ? 50.168 11.120 35.436 1.00 160.35 ? 70  PHE A CE1 1 
ATOM   477  C CE2 . PHE A 1 70  ? 50.794 8.931  34.713 1.00 159.33 ? 70  PHE A CE2 1 
ATOM   478  C CZ  . PHE A 1 70  ? 50.050 10.079 34.537 1.00 161.28 ? 70  PHE A CZ  1 
ATOM   479  N N   . CYS A 1 71  ? 54.767 8.190  36.592 1.00 163.60 ? 71  CYS A N   1 
ATOM   480  C CA  . CYS A 1 71  ? 55.386 7.329  35.591 1.00 169.13 ? 71  CYS A CA  1 
ATOM   481  C C   . CYS A 1 71  ? 54.378 6.369  34.969 1.00 172.34 ? 71  CYS A C   1 
ATOM   482  O O   . CYS A 1 71  ? 53.793 5.535  35.659 1.00 175.95 ? 71  CYS A O   1 
ATOM   483  C CB  . CYS A 1 71  ? 56.550 6.545  36.202 1.00 170.09 ? 71  CYS A CB  1 
ATOM   484  S SG  . CYS A 1 71  ? 57.948 7.565  36.730 1.00 187.69 ? 71  CYS A SG  1 
ATOM   485  N N   . ALA A 1 72  ? 54.182 6.495  33.661 1.00 173.23 ? 72  ALA A N   1 
ATOM   486  C CA  . ALA A 1 72  ? 53.261 5.630  32.932 1.00 173.98 ? 72  ALA A CA  1 
ATOM   487  C C   . ALA A 1 72  ? 53.519 5.706  31.431 1.00 177.67 ? 72  ALA A C   1 
ATOM   488  O O   . ALA A 1 72  ? 54.249 6.579  30.963 1.00 177.37 ? 72  ALA A O   1 
ATOM   489  C CB  . ALA A 1 72  ? 51.821 6.003  33.244 1.00 169.06 ? 72  ALA A CB  1 
ATOM   490  N N   . ALA A 1 73  ? 52.913 4.791  30.681 1.00 179.93 ? 73  ALA A N   1 
ATOM   491  C CA  . ALA A 1 73  ? 53.096 4.739  29.234 1.00 182.67 ? 73  ALA A CA  1 
ATOM   492  C C   . ALA A 1 73  ? 52.677 6.044  28.564 1.00 185.35 ? 73  ALA A C   1 
ATOM   493  O O   . ALA A 1 73  ? 52.171 6.954  29.219 1.00 184.32 ? 73  ALA A O   1 
ATOM   494  C CB  . ALA A 1 73  ? 52.327 3.567  28.644 1.00 183.45 ? 73  ALA A CB  1 
ATOM   495  N N   . CYS A 1 74  ? 52.890 6.128  27.255 1.00 188.60 ? 74  CYS A N   1 
ATOM   496  C CA  . CYS A 1 74  ? 52.564 7.336  26.505 1.00 193.16 ? 74  CYS A CA  1 
ATOM   497  C C   . CYS A 1 74  ? 51.054 7.517  26.367 1.00 198.31 ? 74  CYS A C   1 
ATOM   498  O O   . CYS A 1 74  ? 50.529 8.607  26.593 1.00 199.08 ? 74  CYS A O   1 
ATOM   499  C CB  . CYS A 1 74  ? 53.226 7.310  25.126 1.00 192.77 ? 74  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 74  ? 53.168 8.886  24.240 1.00 181.80 ? 74  CYS A SG  1 
ATOM   501  N N   . HIS A 1 75  ? 50.362 6.445  25.993 1.00 200.92 ? 75  HIS A N   1 
ATOM   502  C CA  . HIS A 1 75  ? 48.908 6.480  25.879 1.00 200.94 ? 75  HIS A CA  1 
ATOM   503  C C   . HIS A 1 75  ? 48.269 6.902  27.196 1.00 195.09 ? 75  HIS A C   1 
ATOM   504  O O   . HIS A 1 75  ? 47.533 7.886  27.253 1.00 192.11 ? 75  HIS A O   1 
ATOM   505  C CB  . HIS A 1 75  ? 48.365 5.116  25.448 1.00 207.47 ? 75  HIS A CB  1 
ATOM   506  C CG  . HIS A 1 75  ? 48.534 4.829  23.988 1.00 216.03 ? 75  HIS A CG  1 
ATOM   507  N ND1 . HIS A 1 75  ? 49.680 4.267  23.467 1.00 221.65 ? 75  HIS A ND1 1 
ATOM   508  C CD2 . HIS A 1 75  ? 47.700 5.023  22.940 1.00 217.65 ? 75  HIS A CD2 1 
ATOM   509  C CE1 . HIS A 1 75  ? 49.545 4.129  22.160 1.00 223.78 ? 75  HIS A CE1 1 
ATOM   510  N NE2 . HIS A 1 75  ? 48.352 4.580  21.815 1.00 221.56 ? 75  HIS A NE2 1 
ATOM   511  N N   . GLY A 1 76  ? 48.560 6.151  28.253 1.00 191.62 ? 76  GLY A N   1 
ATOM   512  C CA  . GLY A 1 76  ? 48.015 6.436  29.567 1.00 193.91 ? 76  GLY A CA  1 
ATOM   513  C C   . GLY A 1 76  ? 48.318 7.844  30.041 1.00 202.39 ? 76  GLY A C   1 
ATOM   514  O O   . GLY A 1 76  ? 47.471 8.496  30.650 1.00 198.48 ? 76  GLY A O   1 
ATOM   515  N N   . CYS A 1 77  ? 49.528 8.316  29.758 1.00 113.24 ? 77  CYS A N   1 
ATOM   516  C CA  . CYS A 1 77  ? 49.946 9.647  30.187 1.00 122.90 ? 77  CYS A CA  1 
ATOM   517  C C   . CYS A 1 77  ? 49.241 10.747 29.397 1.00 129.51 ? 77  CYS A C   1 
ATOM   518  O O   . CYS A 1 77  ? 48.693 11.684 29.978 1.00 132.84 ? 77  CYS A O   1 
ATOM   519  C CB  . CYS A 1 77  ? 51.464 9.803  30.064 1.00 121.00 ? 77  CYS A CB  1 
ATOM   520  S SG  . CYS A 1 77  ? 52.092 11.404 30.619 1.00 147.52 ? 77  CYS A SG  1 
ATOM   521  N N   . LEU A 1 78  ? 49.261 10.630 28.073 1.00 129.17 ? 78  LEU A N   1 
ATOM   522  C CA  . LEU A 1 78  ? 48.625 11.620 27.210 1.00 128.31 ? 78  LEU A CA  1 
ATOM   523  C C   . LEU A 1 78  ? 47.134 11.753 27.503 1.00 130.54 ? 78  LEU A C   1 
ATOM   524  O O   . LEU A 1 78  ? 46.575 12.846 27.424 1.00 124.93 ? 78  LEU A O   1 
ATOM   525  C CB  . LEU A 1 78  ? 48.844 11.278 25.736 1.00 124.72 ? 78  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 78  ? 50.252 11.502 25.185 1.00 120.45 ? 78  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 78  ? 50.320 11.101 23.721 1.00 120.95 ? 78  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 78  ? 50.669 12.953 25.365 1.00 117.52 ? 78  LEU A CD2 1 
ATOM   529  N N   . PHE A 1 79  ? 46.495 10.637 27.838 1.00 133.40 ? 79  PHE A N   1 
ATOM   530  C CA  . PHE A 1 79  ? 45.078 10.647 28.177 1.00 130.00 ? 79  PHE A CA  1 
ATOM   531  C C   . PHE A 1 79  ? 44.826 11.488 29.423 1.00 124.93 ? 79  PHE A C   1 
ATOM   532  O O   . PHE A 1 79  ? 43.982 12.382 29.419 1.00 135.49 ? 79  PHE A O   1 
ATOM   533  C CB  . PHE A 1 79  ? 44.563 9.224  28.394 1.00 134.56 ? 79  PHE A CB  1 
ATOM   534  C CG  . PHE A 1 79  ? 43.158 9.166  28.920 1.00 144.25 ? 79  PHE A CG  1 
ATOM   535  C CD1 . PHE A 1 79  ? 42.078 9.292  28.063 1.00 146.82 ? 79  PHE A CD1 1 
ATOM   536  C CD2 . PHE A 1 79  ? 42.917 8.988  30.273 1.00 146.62 ? 79  PHE A CD2 1 
ATOM   537  C CE1 . PHE A 1 79  ? 40.783 9.241  28.544 1.00 146.09 ? 79  PHE A CE1 1 
ATOM   538  C CE2 . PHE A 1 79  ? 41.624 8.936  30.760 1.00 146.66 ? 79  PHE A CE2 1 
ATOM   539  C CZ  . PHE A 1 79  ? 40.556 9.062  29.894 1.00 146.23 ? 79  PHE A CZ  1 
ATOM   540  N N   . ILE A 1 80  ? 45.566 11.193 30.485 1.00 111.46 ? 80  ILE A N   1 
ATOM   541  C CA  . ILE A 1 80  ? 45.433 11.916 31.744 1.00 107.41 ? 80  ILE A CA  1 
ATOM   542  C C   . ILE A 1 80  ? 45.878 13.371 31.592 1.00 105.83 ? 80  ILE A C   1 
ATOM   543  O O   . ILE A 1 80  ? 45.698 14.187 32.497 1.00 105.73 ? 80  ILE A O   1 
ATOM   544  C CB  . ILE A 1 80  ? 46.251 11.236 32.862 1.00 105.51 ? 80  ILE A CB  1 
ATOM   545  C CG1 . ILE A 1 80  ? 45.904 9.750  32.946 1.00 107.47 ? 80  ILE A CG1 1 
ATOM   546  C CG2 . ILE A 1 80  ? 46.008 11.911 34.203 1.00 104.77 ? 80  ILE A CG2 1 
ATOM   547  C CD1 . ILE A 1 80  ? 46.665 9.005  34.022 1.00 108.27 ? 80  ILE A CD1 1 
ATOM   548  N N   . ALA A 1 81  ? 46.449 13.693 30.437 1.00 104.43 ? 81  ALA A N   1 
ATOM   549  C CA  . ALA A 1 81  ? 46.975 15.032 30.198 1.00 108.54 ? 81  ALA A CA  1 
ATOM   550  C C   . ALA A 1 81  ? 46.165 15.800 29.158 1.00 106.35 ? 81  ALA A C   1 
ATOM   551  O O   . ALA A 1 81  ? 46.179 17.030 29.137 1.00 103.98 ? 81  ALA A O   1 
ATOM   552  C CB  . ALA A 1 81  ? 48.436 14.957 29.780 1.00 115.93 ? 81  ALA A CB  1 
ATOM   553  N N   . CYS A 1 82  ? 45.461 15.071 28.298 1.00 111.69 ? 82  CYS A N   1 
ATOM   554  C CA  . CYS A 1 82  ? 44.704 15.693 27.216 1.00 125.15 ? 82  CYS A CA  1 
ATOM   555  C C   . CYS A 1 82  ? 43.197 15.512 27.379 1.00 136.19 ? 82  CYS A C   1 
ATOM   556  O O   . CYS A 1 82  ? 42.417 15.978 26.548 1.00 140.06 ? 82  CYS A O   1 
ATOM   557  C CB  . CYS A 1 82  ? 45.154 15.143 25.860 1.00 124.48 ? 82  CYS A CB  1 
ATOM   558  S SG  . CYS A 1 82  ? 46.893 15.441 25.476 1.00 162.87 ? 82  CYS A SG  1 
ATOM   559  N N   . PHE A 1 83  ? 42.792 14.834 28.448 1.00 136.05 ? 83  PHE A N   1 
ATOM   560  C CA  . PHE A 1 83  ? 41.375 14.612 28.707 1.00 134.10 ? 83  PHE A CA  1 
ATOM   561  C C   . PHE A 1 83  ? 40.655 15.930 28.969 1.00 130.98 ? 83  PHE A C   1 
ATOM   562  O O   . PHE A 1 83  ? 39.519 16.124 28.536 1.00 132.44 ? 83  PHE A O   1 
ATOM   563  C CB  . PHE A 1 83  ? 41.178 13.660 29.889 1.00 138.67 ? 83  PHE A CB  1 
ATOM   564  C CG  . PHE A 1 83  ? 39.736 13.385 30.209 1.00 151.88 ? 83  PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 83  ? 39.005 12.483 29.454 1.00 155.00 ? 83  PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 83  ? 39.111 14.030 31.263 1.00 156.30 ? 83  PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 83  ? 37.678 12.229 29.744 1.00 153.56 ? 83  PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 83  ? 37.783 13.779 31.558 1.00 155.32 ? 83  PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 83  ? 37.067 12.878 30.797 1.00 153.33 ? 83  PHE A CZ  1 
ATOM   570  N N   . VAL A 1 84  ? 41.323 16.833 29.678 1.00 127.15 ? 84  VAL A N   1 
ATOM   571  C CA  . VAL A 1 84  ? 40.752 18.139 29.983 1.00 123.77 ? 84  VAL A CA  1 
ATOM   572  C C   . VAL A 1 84  ? 40.543 18.949 28.707 1.00 117.60 ? 84  VAL A C   1 
ATOM   573  O O   . VAL A 1 84  ? 39.662 19.805 28.640 1.00 115.42 ? 84  VAL A O   1 
ATOM   574  C CB  . VAL A 1 84  ? 41.644 18.934 30.957 1.00 125.31 ? 84  VAL A CB  1 
ATOM   575  C CG1 . VAL A 1 84  ? 43.007 19.199 30.336 1.00 122.24 ? 84  VAL A CG1 1 
ATOM   576  C CG2 . VAL A 1 84  ? 40.968 20.238 31.356 1.00 127.96 ? 84  VAL A CG2 1 
ATOM   577  N N   . LEU A 1 85  ? 41.358 18.670 27.695 1.00 116.84 ? 85  LEU A N   1 
ATOM   578  C CA  . LEU A 1 85  ? 41.236 19.346 26.411 1.00 120.22 ? 85  LEU A CA  1 
ATOM   579  C C   . LEU A 1 85  ? 39.953 18.923 25.708 1.00 116.62 ? 85  LEU A C   1 
ATOM   580  O O   . LEU A 1 85  ? 39.381 19.682 24.926 1.00 112.73 ? 85  LEU A O   1 
ATOM   581  C CB  . LEU A 1 85  ? 42.446 19.043 25.525 1.00 124.31 ? 85  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 85  ? 43.810 19.495 26.051 1.00 121.50 ? 85  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 85  ? 44.921 19.055 25.109 1.00 124.23 ? 85  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 85  ? 43.837 21.003 26.252 1.00 116.26 ? 85  LEU A CD2 1 
ATOM   585  N N   . VAL A 1 86  ? 39.506 17.705 25.997 1.00 117.78 ? 86  VAL A N   1 
ATOM   586  C CA  . VAL A 1 86  ? 38.282 17.173 25.412 1.00 121.25 ? 86  VAL A CA  1 
ATOM   587  C C   . VAL A 1 86  ? 37.054 17.874 25.983 1.00 117.04 ? 86  VAL A C   1 
ATOM   588  O O   . VAL A 1 86  ? 36.279 18.484 25.246 1.00 119.31 ? 86  VAL A O   1 
ATOM   589  C CB  . VAL A 1 86  ? 38.160 15.655 25.649 1.00 127.85 ? 86  VAL A CB  1 
ATOM   590  C CG1 . VAL A 1 86  ? 36.846 15.132 25.090 1.00 133.18 ? 86  VAL A CG1 1 
ATOM   591  C CG2 . VAL A 1 86  ? 39.340 14.925 25.026 1.00 128.22 ? 86  VAL A CG2 1 
ATOM   592  N N   . LEU A 1 87  ? 36.883 17.785 27.299 1.00 106.27 ? 87  LEU A N   1 
ATOM   593  C CA  . LEU A 1 87  ? 35.755 18.418 27.974 1.00 93.58  ? 87  LEU A CA  1 
ATOM   594  C C   . LEU A 1 87  ? 35.629 19.886 27.584 1.00 97.58  ? 87  LEU A C   1 
ATOM   595  O O   . LEU A 1 87  ? 34.531 20.377 27.321 1.00 109.59 ? 87  LEU A O   1 
ATOM   596  C CB  . LEU A 1 87  ? 35.899 18.295 29.493 1.00 82.30  ? 87  LEU A CB  1 
ATOM   597  C CG  . LEU A 1 87  ? 36.045 16.878 30.048 1.00 84.30  ? 87  LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 87  ? 36.044 16.898 31.568 1.00 81.87  ? 87  LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 87  ? 34.936 15.982 29.523 1.00 91.55  ? 87  LEU A CD2 1 
ATOM   600  N N   . ALA A 1 88  ? 36.759 20.583 27.548 1.00 94.10  ? 88  ALA A N   1 
ATOM   601  C CA  . ALA A 1 88  ? 36.778 21.992 27.178 1.00 100.66 ? 88  ALA A CA  1 
ATOM   602  C C   . ALA A 1 88  ? 36.391 22.185 25.714 1.00 107.06 ? 88  ALA A C   1 
ATOM   603  O O   . ALA A 1 88  ? 35.710 23.149 25.366 1.00 108.33 ? 88  ALA A O   1 
ATOM   604  C CB  . ALA A 1 88  ? 38.148 22.594 27.452 1.00 101.22 ? 88  ALA A CB  1 
ATOM   605  N N   . GLN A 1 89  ? 36.828 21.264 24.861 1.00 110.50 ? 89  GLN A N   1 
ATOM   606  C CA  . GLN A 1 89  ? 36.525 21.342 23.437 1.00 114.29 ? 89  GLN A CA  1 
ATOM   607  C C   . GLN A 1 89  ? 35.057 21.040 23.167 1.00 121.18 ? 89  GLN A C   1 
ATOM   608  O O   . GLN A 1 89  ? 34.436 21.657 22.302 1.00 128.61 ? 89  GLN A O   1 
ATOM   609  C CB  . GLN A 1 89  ? 37.412 20.384 22.640 1.00 114.79 ? 89  GLN A CB  1 
ATOM   610  C CG  . GLN A 1 89  ? 37.187 20.440 21.137 1.00 113.86 ? 89  GLN A CG  1 
ATOM   611  C CD  . GLN A 1 89  ? 37.536 21.791 20.541 1.00 109.98 ? 89  GLN A CD  1 
ATOM   612  O OE1 . GLN A 1 89  ? 37.989 22.696 21.242 1.00 108.41 ? 89  GLN A OE1 1 
ATOM   613  N NE2 . GLN A 1 89  ? 37.329 21.931 19.237 1.00 110.39 ? 89  GLN A NE2 1 
ATOM   614  N N   . SER A 1 90  ? 34.507 20.083 23.905 1.00 118.57 ? 90  SER A N   1 
ATOM   615  C CA  . SER A 1 90  ? 33.091 19.762 23.794 1.00 116.18 ? 90  SER A CA  1 
ATOM   616  C C   . SER A 1 90  ? 32.266 20.997 24.126 1.00 107.55 ? 90  SER A C   1 
ATOM   617  O O   . SER A 1 90  ? 31.338 21.352 23.400 1.00 106.58 ? 90  SER A O   1 
ATOM   618  C CB  . SER A 1 90  ? 32.724 18.614 24.735 1.00 118.27 ? 90  SER A CB  1 
ATOM   619  O OG  . SER A 1 90  ? 31.340 18.319 24.664 1.00 121.55 ? 90  SER A OG  1 
ATOM   620  N N   . SER A 1 91  ? 32.622 21.652 25.227 1.00 100.08 ? 91  SER A N   1 
ATOM   621  C CA  . SER A 1 91  ? 31.945 22.869 25.656 1.00 94.72  ? 91  SER A CA  1 
ATOM   622  C C   . SER A 1 91  ? 31.993 23.936 24.569 1.00 95.60  ? 91  SER A C   1 
ATOM   623  O O   . SER A 1 91  ? 31.089 24.762 24.458 1.00 104.12 ? 91  SER A O   1 
ATOM   624  C CB  . SER A 1 91  ? 32.569 23.404 26.947 1.00 86.60  ? 91  SER A CB  1 
ATOM   625  O OG  . SER A 1 91  ? 32.421 22.476 28.007 1.00 79.86  ? 91  SER A OG  1 
ATOM   626  N N   . ILE A 1 92  ? 33.053 23.915 23.768 1.00 95.87  ? 92  ILE A N   1 
ATOM   627  C CA  . ILE A 1 92  ? 33.182 24.847 22.655 1.00 112.09 ? 92  ILE A CA  1 
ATOM   628  C C   . ILE A 1 92  ? 32.062 24.626 21.646 1.00 116.88 ? 92  ILE A C   1 
ATOM   629  O O   . ILE A 1 92  ? 31.483 25.579 21.125 1.00 118.46 ? 92  ILE A O   1 
ATOM   630  C CB  . ILE A 1 92  ? 34.536 24.693 21.942 1.00 126.59 ? 92  ILE A CB  1 
ATOM   631  C CG1 . ILE A 1 92  ? 35.675 25.135 22.861 1.00 128.62 ? 92  ILE A CG1 1 
ATOM   632  C CG2 . ILE A 1 92  ? 34.556 25.504 20.657 1.00 131.13 ? 92  ILE A CG2 1 
ATOM   633  C CD1 . ILE A 1 92  ? 35.658 26.612 23.174 1.00 129.17 ? 92  ILE A CD1 1 
ATOM   634  N N   . PHE A 1 93  ? 31.762 23.359 21.379 1.00 119.86 ? 93  PHE A N   1 
ATOM   635  C CA  . PHE A 1 93  ? 30.701 23.003 20.445 1.00 123.96 ? 93  PHE A CA  1 
ATOM   636  C C   . PHE A 1 93  ? 29.326 23.361 21.003 1.00 111.84 ? 93  PHE A C   1 
ATOM   637  O O   . PHE A 1 93  ? 28.486 23.923 20.299 1.00 108.89 ? 93  PHE A O   1 
ATOM   638  C CB  . PHE A 1 93  ? 30.755 21.510 20.117 1.00 126.96 ? 93  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 93  ? 32.019 21.084 19.430 1.00 122.55 ? 93  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 93  ? 32.927 20.258 20.071 1.00 119.43 ? 93  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 93  ? 32.300 21.509 18.142 1.00 118.99 ? 93  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 93  ? 34.090 19.862 19.439 1.00 119.50 ? 93  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 93  ? 33.461 21.118 17.505 1.00 116.58 ? 93  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 93  ? 34.357 20.293 18.154 1.00 119.43 ? 93  PHE A CZ  1 
ATOM   645  N N   . SER A 1 94  ? 29.105 23.029 22.270 1.00 97.12  ? 94  SER A N   1 
ATOM   646  C CA  . SER A 1 94  ? 27.839 23.317 22.932 1.00 88.43  ? 94  SER A CA  1 
ATOM   647  C C   . SER A 1 94  ? 27.547 24.814 22.955 1.00 97.47  ? 94  SER A C   1 
ATOM   648  O O   . SER A 1 94  ? 26.498 25.256 22.488 1.00 101.29 ? 94  SER A O   1 
ATOM   649  C CB  . SER A 1 94  ? 27.843 22.760 24.356 1.00 76.88  ? 94  SER A CB  1 
ATOM   650  O OG  . SER A 1 94  ? 28.003 21.352 24.348 1.00 76.71  ? 94  SER A OG  1 
ATOM   651  N N   . LEU A 1 95  ? 28.480 25.590 23.500 1.00 97.37  ? 95  LEU A N   1 
ATOM   652  C CA  . LEU A 1 95  ? 28.309 27.036 23.597 1.00 94.25  ? 95  LEU A CA  1 
ATOM   653  C C   . LEU A 1 95  ? 28.071 27.662 22.228 1.00 93.88  ? 95  LEU A C   1 
ATOM   654  O O   . LEU A 1 95  ? 27.321 28.630 22.100 1.00 91.37  ? 95  LEU A O   1 
ATOM   655  C CB  . LEU A 1 95  ? 29.520 27.684 24.271 1.00 91.26  ? 95  LEU A CB  1 
ATOM   656  C CG  . LEU A 1 95  ? 29.790 27.287 25.723 1.00 95.57  ? 95  LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 95  ? 30.969 28.068 26.275 1.00 100.17 ? 95  LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 95  ? 28.558 27.507 26.581 1.00 99.09  ? 95  LEU A CD2 1 
ATOM   659  N N   . LEU A 1 96  ? 28.714 27.104 21.207 1.00 97.23  ? 96  LEU A N   1 
ATOM   660  C CA  . LEU A 1 96  ? 28.544 27.592 19.845 1.00 109.12 ? 96  LEU A CA  1 
ATOM   661  C C   . LEU A 1 96  ? 27.153 27.225 19.341 1.00 118.12 ? 96  LEU A C   1 
ATOM   662  O O   . LEU A 1 96  ? 26.506 28.007 18.645 1.00 118.34 ? 96  LEU A O   1 
ATOM   663  C CB  . LEU A 1 96  ? 29.616 27.004 18.926 1.00 111.57 ? 96  LEU A CB  1 
ATOM   664  C CG  . LEU A 1 96  ? 30.064 27.854 17.732 1.00 116.02 ? 96  LEU A CG  1 
ATOM   665  C CD1 . LEU A 1 96  ? 31.207 27.174 16.994 1.00 119.57 ? 96  LEU A CD1 1 
ATOM   666  C CD2 . LEU A 1 96  ? 28.911 28.146 16.783 1.00 116.28 ? 96  LEU A CD2 1 
ATOM   667  N N   . ALA A 1 97  ? 26.699 26.029 19.702 1.00 121.56 ? 97  ALA A N   1 
ATOM   668  C CA  . ALA A 1 97  ? 25.368 25.568 19.328 1.00 121.26 ? 97  ALA A CA  1 
ATOM   669  C C   . ALA A 1 97  ? 24.300 26.477 19.925 1.00 118.65 ? 97  ALA A C   1 
ATOM   670  O O   . ALA A 1 97  ? 23.448 27.003 19.210 1.00 122.49 ? 97  ALA A O   1 
ATOM   671  C CB  . ALA A 1 97  ? 25.158 24.131 19.778 1.00 118.32 ? 97  ALA A CB  1 
ATOM   672  N N   . ILE A 1 98  ? 24.355 26.656 21.242 1.00 105.99 ? 98  ILE A N   1 
ATOM   673  C CA  . ILE A 1 98  ? 23.417 27.528 21.941 1.00 96.04  ? 98  ILE A CA  1 
ATOM   674  C C   . ILE A 1 98  ? 23.390 28.915 21.311 1.00 100.25 ? 98  ILE A C   1 
ATOM   675  O O   . ILE A 1 98  ? 22.332 29.530 21.185 1.00 101.84 ? 98  ILE A O   1 
ATOM   676  C CB  . ILE A 1 98  ? 23.782 27.665 23.428 1.00 83.84  ? 98  ILE A CB  1 
ATOM   677  C CG1 . ILE A 1 98  ? 23.835 26.290 24.094 1.00 86.30  ? 98  ILE A CG1 1 
ATOM   678  C CG2 . ILE A 1 98  ? 22.789 28.570 24.140 1.00 78.07  ? 98  ILE A CG2 1 
ATOM   679  C CD1 . ILE A 1 98  ? 24.198 26.337 25.563 1.00 86.78  ? 98  ILE A CD1 1 
ATOM   680  N N   . ALA A 1 99  ? 24.562 29.404 20.920 1.00 109.46 ? 99  ALA A N   1 
ATOM   681  C CA  . ALA A 1 99  ? 24.667 30.704 20.273 1.00 122.88 ? 99  ALA A CA  1 
ATOM   682  C C   . ALA A 1 99  ? 23.830 30.737 18.999 1.00 135.58 ? 99  ALA A C   1 
ATOM   683  O O   . ALA A 1 99  ? 23.030 31.649 18.793 1.00 139.81 ? 99  ALA A O   1 
ATOM   684  C CB  . ALA A 1 99  ? 26.121 31.027 19.965 1.00 120.97 ? 99  ALA A CB  1 
ATOM   685  N N   . ILE A 1 100 ? 24.018 29.732 18.150 1.00 140.08 ? 100 ILE A N   1 
ATOM   686  C CA  . ILE A 1 100 ? 23.266 29.631 16.906 1.00 145.22 ? 100 ILE A CA  1 
ATOM   687  C C   . ILE A 1 100 ? 21.790 29.387 17.193 1.00 143.41 ? 100 ILE A C   1 
ATOM   688  O O   . ILE A 1 100 ? 20.916 29.910 16.502 1.00 150.06 ? 100 ILE A O   1 
ATOM   689  C CB  . ILE A 1 100 ? 23.800 28.496 16.013 1.00 151.44 ? 100 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 100 ? 25.295 28.686 15.745 1.00 154.63 ? 100 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 100 ? 23.022 28.433 14.706 1.00 152.50 ? 100 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 100 ? 25.905 27.598 14.887 1.00 154.78 ? 100 ILE A CD1 1 
ATOM   693  N N   . ASP A 1 101 ? 21.522 28.590 18.222 1.00 134.43 ? 101 ASP A N   1 
ATOM   694  C CA  . ASP A 1 101 ? 20.158 28.271 18.623 1.00 128.34 ? 101 ASP A CA  1 
ATOM   695  C C   . ASP A 1 101 ? 19.339 29.530 18.881 1.00 126.01 ? 101 ASP A C   1 
ATOM   696  O O   . ASP A 1 101 ? 18.352 29.792 18.194 1.00 126.27 ? 101 ASP A O   1 
ATOM   697  C CB  . ASP A 1 101 ? 20.167 27.397 19.877 1.00 122.74 ? 101 ASP A CB  1 
ATOM   698  C CG  . ASP A 1 101 ? 18.776 27.119 20.403 1.00 118.79 ? 101 ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 101 ? 17.853 26.938 19.581 1.00 123.10 ? 101 ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 101 ? 18.605 27.081 21.639 1.00 111.26 ? 101 ASP A OD2 1 
ATOM   701  N N   . ARG A 1 102 ? 19.756 30.305 19.878 1.00 124.56 ? 102 ARG A N   1 
ATOM   702  C CA  . ARG A 1 102 ? 19.066 31.539 20.233 1.00 125.58 ? 102 ARG A CA  1 
ATOM   703  C C   . ARG A 1 102 ? 18.971 32.480 19.038 1.00 125.86 ? 102 ARG A C   1 
ATOM   704  O O   . ARG A 1 102 ? 18.066 33.311 18.962 1.00 127.61 ? 102 ARG A O   1 
ATOM   705  C CB  . ARG A 1 102 ? 19.770 32.231 21.402 1.00 126.66 ? 102 ARG A CB  1 
ATOM   706  C CG  . ARG A 1 102 ? 19.782 31.421 22.693 1.00 132.87 ? 102 ARG A CG  1 
ATOM   707  C CD  . ARG A 1 102 ? 18.407 31.372 23.349 1.00 145.11 ? 102 ARG A CD  1 
ATOM   708  N NE  . ARG A 1 102 ? 17.420 30.663 22.537 1.00 153.21 ? 102 ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 102 ? 16.158 30.464 22.901 1.00 155.65 ? 102 ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 102 ? 15.723 30.918 24.068 1.00 155.83 ? 102 ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 102 ? 15.329 29.809 22.099 1.00 157.58 ? 102 ARG A NH2 1 
ATOM   712  N N   . TYR A 1 103 ? 19.907 32.344 18.106 1.00 126.76 ? 103 TYR A N   1 
ATOM   713  C CA  . TYR A 1 103 ? 19.891 33.148 16.892 1.00 131.68 ? 103 TYR A CA  1 
ATOM   714  C C   . TYR A 1 103 ? 18.737 32.735 15.986 1.00 137.72 ? 103 TYR A C   1 
ATOM   715  O O   . TYR A 1 103 ? 17.977 33.578 15.512 1.00 140.66 ? 103 TYR A O   1 
ATOM   716  C CB  . TYR A 1 103 ? 21.218 33.026 16.142 1.00 129.25 ? 103 TYR A CB  1 
ATOM   717  C CG  . TYR A 1 103 ? 21.244 33.778 14.832 1.00 129.57 ? 103 TYR A CG  1 
ATOM   718  C CD1 . TYR A 1 103 ? 21.518 35.139 14.795 1.00 129.26 ? 103 TYR A CD1 1 
ATOM   719  C CD2 . TYR A 1 103 ? 20.992 33.128 13.631 1.00 131.38 ? 103 TYR A CD2 1 
ATOM   720  C CE1 . TYR A 1 103 ? 21.541 35.832 13.600 1.00 132.20 ? 103 TYR A CE1 1 
ATOM   721  C CE2 . TYR A 1 103 ? 21.014 33.813 12.430 1.00 134.32 ? 103 TYR A CE2 1 
ATOM   722  C CZ  . TYR A 1 103 ? 21.289 35.164 12.421 1.00 134.91 ? 103 TYR A CZ  1 
ATOM   723  O OH  . TYR A 1 103 ? 21.312 35.852 11.229 1.00 136.60 ? 103 TYR A OH  1 
ATOM   724  N N   . ILE A 1 104 ? 18.610 31.433 15.751 1.00 141.69 ? 104 ILE A N   1 
ATOM   725  C CA  . ILE A 1 104 ? 17.548 30.904 14.903 1.00 149.19 ? 104 ILE A CA  1 
ATOM   726  C C   . ILE A 1 104 ? 16.172 31.258 15.457 1.00 147.81 ? 104 ILE A C   1 
ATOM   727  O O   . ILE A 1 104 ? 15.249 31.567 14.703 1.00 152.54 ? 104 ILE A O   1 
ATOM   728  C CB  . ILE A 1 104 ? 17.655 29.374 14.755 1.00 154.89 ? 104 ILE A CB  1 
ATOM   729  C CG1 . ILE A 1 104 ? 19.034 28.986 14.220 1.00 156.00 ? 104 ILE A CG1 1 
ATOM   730  C CG2 . ILE A 1 104 ? 16.559 28.846 13.842 1.00 159.90 ? 104 ILE A CG2 1 
ATOM   731  C CD1 . ILE A 1 104 ? 19.233 27.495 14.071 1.00 157.80 ? 104 ILE A CD1 1 
ATOM   732  N N   . ALA A 1 105 ? 16.044 31.214 16.779 1.00 171.76 ? 105 ALA A N   1 
ATOM   733  C CA  . ALA A 1 105 ? 14.781 31.521 17.439 1.00 159.47 ? 105 ALA A CA  1 
ATOM   734  C C   . ALA A 1 105 ? 14.380 32.979 17.234 1.00 158.91 ? 105 ALA A C   1 
ATOM   735  O O   . ALA A 1 105 ? 13.260 33.270 16.815 1.00 162.68 ? 105 ALA A O   1 
ATOM   736  C CB  . ALA A 1 105 ? 14.867 31.198 18.924 1.00 152.38 ? 105 ALA A CB  1 
ATOM   737  N N   . ILE A 1 106 ? 15.301 33.890 17.530 1.00 155.57 ? 106 ILE A N   1 
ATOM   738  C CA  . ILE A 1 106 ? 15.028 35.318 17.411 1.00 151.53 ? 106 ILE A CA  1 
ATOM   739  C C   . ILE A 1 106 ? 14.948 35.765 15.953 1.00 160.72 ? 106 ILE A C   1 
ATOM   740  O O   . ILE A 1 106 ? 14.110 36.593 15.595 1.00 167.22 ? 106 ILE A O   1 
ATOM   741  C CB  . ILE A 1 106 ? 16.085 36.158 18.154 1.00 136.96 ? 106 ILE A CB  1 
ATOM   742  C CG1 . ILE A 1 106 ? 16.043 35.855 19.653 1.00 129.23 ? 106 ILE A CG1 1 
ATOM   743  C CG2 . ILE A 1 106 ? 15.860 37.641 17.906 1.00 136.22 ? 106 ILE A CG2 1 
ATOM   744  C CD1 . ILE A 1 106 ? 16.959 36.726 20.478 1.00 124.43 ? 106 ILE A CD1 1 
ATOM   745  N N   . ALA A 1 107 ? 15.819 35.213 15.116 1.00 161.37 ? 107 ALA A N   1 
ATOM   746  C CA  . ALA A 1 107 ? 15.845 35.568 13.702 1.00 163.55 ? 107 ALA A CA  1 
ATOM   747  C C   . ALA A 1 107 ? 14.659 34.969 12.953 1.00 165.59 ? 107 ALA A C   1 
ATOM   748  O O   . ALA A 1 107 ? 13.846 35.694 12.382 1.00 170.76 ? 107 ALA A O   1 
ATOM   749  C CB  . ALA A 1 107 ? 17.153 35.129 13.064 1.00 163.56 ? 107 ALA A CB  1 
ATOM   750  N N   . ILE A 1 108 ? 14.565 33.644 12.959 1.00 164.66 ? 108 ILE A N   1 
ATOM   751  C CA  . ILE A 1 108 ? 13.486 32.958 12.258 1.00 173.59 ? 108 ILE A CA  1 
ATOM   752  C C   . ILE A 1 108 ? 12.668 32.094 13.213 1.00 176.46 ? 108 ILE A C   1 
ATOM   753  O O   . ILE A 1 108 ? 12.874 30.883 13.294 1.00 179.64 ? 108 ILE A O   1 
ATOM   754  C CB  . ILE A 1 108 ? 14.027 32.075 11.120 1.00 174.11 ? 108 ILE A CB  1 
ATOM   755  C CG1 . ILE A 1 108 ? 15.212 32.756 10.432 1.00 167.50 ? 108 ILE A CG1 1 
ATOM   756  C CG2 . ILE A 1 108 ? 12.923 31.761 10.123 1.00 178.00 ? 108 ILE A CG2 1 
ATOM   757  C CD1 . ILE A 1 108 ? 15.836 31.928 9.331  1.00 164.10 ? 108 ILE A CD1 1 
ATOM   758  N N   . PRO A 1 109 ? 11.730 32.721 13.939 1.00 169.35 ? 109 PRO A N   1 
ATOM   759  C CA  . PRO A 1 109 ? 10.904 32.037 14.940 1.00 162.39 ? 109 PRO A CA  1 
ATOM   760  C C   . PRO A 1 109 ? 10.086 30.895 14.343 1.00 162.58 ? 109 PRO A C   1 
ATOM   761  O O   . PRO A 1 109 ? 9.904  29.867 14.994 1.00 160.75 ? 109 PRO A O   1 
ATOM   762  C CB  . PRO A 1 109 ? 9.971  33.145 15.440 1.00 161.14 ? 109 PRO A CB  1 
ATOM   763  C CG  . PRO A 1 109 ? 10.691 34.417 15.136 1.00 162.94 ? 109 PRO A CG  1 
ATOM   764  C CD  . PRO A 1 109 ? 11.418 34.157 13.855 1.00 166.55 ? 109 PRO A CD  1 
ATOM   765  N N   . LEU A 1 110 ? 9.602  31.078 13.119 1.00 167.74 ? 110 LEU A N   1 
ATOM   766  C CA  . LEU A 1 110 ? 8.765  30.073 12.470 1.00 172.39 ? 110 LEU A CA  1 
ATOM   767  C C   . LEU A 1 110 ? 9.560  28.832 12.071 1.00 175.09 ? 110 LEU A C   1 
ATOM   768  O O   . LEU A 1 110 ? 9.161  27.707 12.372 1.00 172.04 ? 110 LEU A O   1 
ATOM   769  C CB  . LEU A 1 110 ? 8.054  30.662 11.249 1.00 174.58 ? 110 LEU A CB  1 
ATOM   770  C CG  . LEU A 1 110 ? 6.858  31.584 11.510 1.00 175.18 ? 110 LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 110 ? 7.275  32.832 12.275 1.00 174.80 ? 110 LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 110 ? 6.179  31.961 10.202 1.00 175.49 ? 110 LEU A CD2 1 
ATOM   773  N N   . ARG A 1 111 ? 10.684 29.043 11.393 1.00 180.53 ? 111 ARG A N   1 
ATOM   774  C CA  . ARG A 1 111 ? 11.527 27.937 10.952 1.00 181.76 ? 111 ARG A CA  1 
ATOM   775  C C   . ARG A 1 111 ? 12.309 27.330 12.111 1.00 170.75 ? 111 ARG A C   1 
ATOM   776  O O   . ARG A 1 111 ? 12.919 26.271 11.971 1.00 169.16 ? 111 ARG A O   1 
ATOM   777  C CB  . ARG A 1 111 ? 12.488 28.394 9.853  1.00 191.75 ? 111 ARG A CB  1 
ATOM   778  C CG  . ARG A 1 111 ? 11.807 28.786 8.552  1.00 202.75 ? 111 ARG A CG  1 
ATOM   779  C CD  . ARG A 1 111 ? 11.049 27.613 7.953  1.00 211.01 ? 111 ARG A CD  1 
ATOM   780  N NE  . ARG A 1 111 ? 11.901 26.438 7.793  1.00 216.45 ? 111 ARG A NE  1 
ATOM   781  C CZ  . ARG A 1 111 ? 12.682 26.219 6.740  1.00 219.72 ? 111 ARG A CZ  1 
ATOM   782  N NH1 . ARG A 1 111 ? 12.724 27.098 5.748  1.00 222.76 ? 111 ARG A NH1 1 
ATOM   783  N NH2 . ARG A 1 111 ? 13.424 25.121 6.679  1.00 218.10 ? 111 ARG A NH2 1 
ATOM   784  N N   . TYR A 1 112 ? 12.287 28.006 13.255 1.00 162.97 ? 112 TYR A N   1 
ATOM   785  C CA  . TYR A 1 112 ? 12.986 27.525 14.441 1.00 157.10 ? 112 TYR A CA  1 
ATOM   786  C C   . TYR A 1 112 ? 12.553 26.112 14.815 1.00 154.92 ? 112 TYR A C   1 
ATOM   787  O O   . TYR A 1 112 ? 13.382 25.266 15.144 1.00 151.16 ? 112 TYR A O   1 
ATOM   788  C CB  . TYR A 1 112 ? 12.758 28.470 15.622 1.00 156.56 ? 112 TYR A CB  1 
ATOM   789  C CG  . TYR A 1 112 ? 13.237 27.916 16.944 1.00 155.55 ? 112 TYR A CG  1 
ATOM   790  C CD1 . TYR A 1 112 ? 12.375 27.218 17.780 1.00 156.42 ? 112 TYR A CD1 1 
ATOM   791  C CD2 . TYR A 1 112 ? 14.552 28.086 17.355 1.00 153.80 ? 112 TYR A CD2 1 
ATOM   792  C CE1 . TYR A 1 112 ? 12.809 26.707 18.988 1.00 154.92 ? 112 TYR A CE1 1 
ATOM   793  C CE2 . TYR A 1 112 ? 14.995 27.580 18.562 1.00 152.75 ? 112 TYR A CE2 1 
ATOM   794  C CZ  . TYR A 1 112 ? 14.119 26.891 19.374 1.00 151.62 ? 112 TYR A CZ  1 
ATOM   795  O OH  . TYR A 1 112 ? 14.555 26.385 20.577 1.00 147.54 ? 112 TYR A OH  1 
ATOM   796  N N   . ASN A 1 113 ? 11.250 25.861 14.766 1.00 160.38 ? 113 ASN A N   1 
ATOM   797  C CA  . ASN A 1 113 ? 10.713 24.558 15.138 1.00 162.81 ? 113 ASN A CA  1 
ATOM   798  C C   . ASN A 1 113 ? 10.946 23.503 14.062 1.00 165.20 ? 113 ASN A C   1 
ATOM   799  O O   . ASN A 1 113 ? 11.160 22.330 14.366 1.00 162.97 ? 113 ASN A O   1 
ATOM   800  C CB  . ASN A 1 113 ? 9.222  24.670 15.459 1.00 163.13 ? 113 ASN A CB  1 
ATOM   801  C CG  . ASN A 1 113 ? 8.937  25.696 16.539 1.00 163.06 ? 113 ASN A CG  1 
ATOM   802  O OD1 . ASN A 1 113 ? 8.905  25.372 17.726 1.00 161.42 ? 113 ASN A OD1 1 
ATOM   803  N ND2 . ASN A 1 113 ? 8.733  26.943 16.130 1.00 164.65 ? 113 ASN A ND2 1 
ATOM   804  N N   . GLY A 1 114 ? 10.908 23.930 12.804 1.00 168.24 ? 114 GLY A N   1 
ATOM   805  C CA  . GLY A 1 114 ? 11.106 23.028 11.685 1.00 167.49 ? 114 GLY A CA  1 
ATOM   806  C C   . GLY A 1 114 ? 12.567 22.696 11.448 1.00 163.69 ? 114 GLY A C   1 
ATOM   807  O O   . GLY A 1 114 ? 12.888 21.753 10.724 1.00 160.06 ? 114 GLY A O   1 
ATOM   808  N N   . LEU A 1 115 ? 13.454 23.473 12.060 1.00 165.57 ? 115 LEU A N   1 
ATOM   809  C CA  . LEU A 1 115 ? 14.890 23.260 11.914 1.00 170.33 ? 115 LEU A CA  1 
ATOM   810  C C   . LEU A 1 115 ? 15.507 22.763 13.218 1.00 170.09 ? 115 LEU A C   1 
ATOM   811  O O   . LEU A 1 115 ? 16.081 21.675 13.269 1.00 170.02 ? 115 LEU A O   1 
ATOM   812  C CB  . LEU A 1 115 ? 15.580 24.548 11.460 1.00 172.00 ? 115 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 115 ? 15.171 25.089 10.088 1.00 174.43 ? 115 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 115 ? 15.792 26.454 9.837  1.00 174.72 ? 115 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 115 ? 15.552 24.110 8.987  1.00 175.96 ? 115 LEU A CD2 1 
ATOM   816  N N   . VAL A 1 116 ? 15.384 23.567 14.268 1.00 167.30 ? 116 VAL A N   1 
ATOM   817  C CA  . VAL A 1 116 ? 15.904 23.202 15.580 1.00 160.36 ? 116 VAL A CA  1 
ATOM   818  C C   . VAL A 1 116 ? 15.009 22.155 16.238 1.00 167.03 ? 116 VAL A C   1 
ATOM   819  O O   . VAL A 1 116 ? 14.145 22.484 17.050 1.00 169.78 ? 116 VAL A O   1 
ATOM   820  C CB  . VAL A 1 116 ? 16.008 24.432 16.502 1.00 148.29 ? 116 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 116 ? 16.680 24.059 17.813 1.00 142.63 ? 116 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 116 ? 16.770 25.549 15.808 1.00 144.44 ? 116 VAL A CG2 1 
ATOM   823  N N   . THR A 1 117 ? 15.219 20.893 15.878 1.00 168.58 ? 117 THR A N   1 
ATOM   824  C CA  . THR A 1 117 ? 14.416 19.799 16.412 1.00 166.63 ? 117 THR A CA  1 
ATOM   825  C C   . THR A 1 117 ? 15.168 19.043 17.502 1.00 164.64 ? 117 THR A C   1 
ATOM   826  O O   . THR A 1 117 ? 16.395 19.104 17.579 1.00 160.52 ? 117 THR A O   1 
ATOM   827  C CB  . THR A 1 117 ? 14.008 18.808 15.306 1.00 165.15 ? 117 THR A CB  1 
ATOM   828  O OG1 . THR A 1 117 ? 15.175 18.156 14.790 1.00 169.03 ? 117 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 117 ? 13.296 19.534 14.176 1.00 163.45 ? 117 THR A CG2 1 
ATOM   830  N N   . GLY A 1 118 ? 14.425 18.329 18.340 1.00 167.45 ? 118 GLY A N   1 
ATOM   831  C CA  . GLY A 1 118 ? 15.015 17.574 19.430 1.00 168.73 ? 118 GLY A CA  1 
ATOM   832  C C   . GLY A 1 118 ? 15.893 16.434 18.953 1.00 168.23 ? 118 GLY A C   1 
ATOM   833  O O   . GLY A 1 118 ? 16.750 15.949 19.692 1.00 161.21 ? 118 GLY A O   1 
ATOM   834  N N   . THR A 1 119 ? 15.677 16.004 17.714 1.00 143.31 ? 119 THR A N   1 
ATOM   835  C CA  . THR A 1 119 ? 16.459 14.920 17.131 1.00 146.10 ? 119 THR A CA  1 
ATOM   836  C C   . THR A 1 119 ? 17.804 15.434 16.627 1.00 146.62 ? 119 THR A C   1 
ATOM   837  O O   . THR A 1 119 ? 18.853 14.883 16.960 1.00 144.98 ? 119 THR A O   1 
ATOM   838  C CB  . THR A 1 119 ? 15.707 14.241 15.973 1.00 149.15 ? 119 THR A CB  1 
ATOM   839  O OG1 . THR A 1 119 ? 14.452 13.735 16.446 1.00 147.51 ? 119 THR A OG1 1 
ATOM   840  C CG2 . THR A 1 119 ? 16.528 13.095 15.403 1.00 149.89 ? 119 THR A CG2 1 
ATOM   841  N N   . ARG A 1 120 ? 17.765 16.492 15.824 1.00 144.60 ? 120 ARG A N   1 
ATOM   842  C CA  . ARG A 1 120 ? 18.983 17.112 15.321 1.00 145.21 ? 120 ARG A CA  1 
ATOM   843  C C   . ARG A 1 120 ? 19.868 17.569 16.475 1.00 141.73 ? 120 ARG A C   1 
ATOM   844  O O   . ARG A 1 120 ? 21.093 17.587 16.361 1.00 143.42 ? 120 ARG A O   1 
ATOM   845  C CB  . ARG A 1 120 ? 18.652 18.295 14.410 1.00 146.83 ? 120 ARG A CB  1 
ATOM   846  C CG  . ARG A 1 120 ? 17.981 17.905 13.104 1.00 149.41 ? 120 ARG A CG  1 
ATOM   847  C CD  . ARG A 1 120 ? 17.793 19.116 12.204 1.00 154.24 ? 120 ARG A CD  1 
ATOM   848  N NE  . ARG A 1 120 ? 17.242 18.755 10.901 1.00 159.49 ? 120 ARG A NE  1 
ATOM   849  C CZ  . ARG A 1 120 ? 17.023 19.621 9.918  1.00 163.34 ? 120 ARG A CZ  1 
ATOM   850  N NH1 . ARG A 1 120 ? 16.520 19.205 8.764  1.00 164.46 ? 120 ARG A NH1 1 
ATOM   851  N NH2 . ARG A 1 120 ? 17.309 20.906 10.087 1.00 164.36 ? 120 ARG A NH2 1 
ATOM   852  N N   . ALA A 1 121 ? 19.239 17.940 17.585 1.00 136.33 ? 121 ALA A N   1 
ATOM   853  C CA  . ALA A 1 121 ? 19.970 18.342 18.778 1.00 130.46 ? 121 ALA A CA  1 
ATOM   854  C C   . ALA A 1 121 ? 20.830 17.190 19.283 1.00 129.62 ? 121 ALA A C   1 
ATOM   855  O O   . ALA A 1 121 ? 22.018 17.363 19.553 1.00 138.46 ? 121 ALA A O   1 
ATOM   856  C CB  . ALA A 1 121 ? 19.010 18.803 19.861 1.00 125.38 ? 121 ALA A CB  1 
ATOM   857  N N   . ALA A 1 122 ? 20.224 16.014 19.403 1.00 121.33 ? 122 ALA A N   1 
ATOM   858  C CA  . ALA A 1 122 ? 20.942 14.827 19.851 1.00 126.62 ? 122 ALA A CA  1 
ATOM   859  C C   . ALA A 1 122 ? 22.057 14.464 18.877 1.00 139.59 ? 122 ALA A C   1 
ATOM   860  O O   . ALA A 1 122 ? 23.176 14.155 19.288 1.00 144.94 ? 122 ALA A O   1 
ATOM   861  C CB  . ALA A 1 122 ? 19.983 13.660 20.021 1.00 123.95 ? 122 ALA A CB  1 
ATOM   862  N N   . GLY A 1 123 ? 21.745 14.504 17.585 1.00 140.63 ? 123 GLY A N   1 
ATOM   863  C CA  . GLY A 1 123 ? 22.715 14.187 16.554 1.00 139.95 ? 123 GLY A CA  1 
ATOM   864  C C   . GLY A 1 123 ? 23.942 15.075 16.623 1.00 133.68 ? 123 GLY A C   1 
ATOM   865  O O   . GLY A 1 123 ? 25.073 14.590 16.639 1.00 136.21 ? 123 GLY A O   1 
ATOM   866  N N   . ILE A 1 124 ? 23.715 16.384 16.665 1.00 124.57 ? 124 ILE A N   1 
ATOM   867  C CA  . ILE A 1 124 ? 24.803 17.347 16.766 1.00 119.76 ? 124 ILE A CA  1 
ATOM   868  C C   . ILE A 1 124 ? 25.648 17.092 18.008 1.00 123.19 ? 124 ILE A C   1 
ATOM   869  O O   . ILE A 1 124 ? 26.872 17.012 17.928 1.00 128.46 ? 124 ILE A O   1 
ATOM   870  C CB  . ILE A 1 124 ? 24.276 18.793 16.794 1.00 114.85 ? 124 ILE A CB  1 
ATOM   871  C CG1 . ILE A 1 124 ? 23.693 19.170 15.431 1.00 115.91 ? 124 ILE A CG1 1 
ATOM   872  C CG2 . ILE A 1 124 ? 25.384 19.758 17.179 1.00 94.26  ? 124 ILE A CG2 1 
ATOM   873  C CD1 . ILE A 1 124 ? 23.205 20.599 15.349 1.00 115.67 ? 124 ILE A CD1 1 
ATOM   874  N N   . ILE A 1 125 ? 24.987 16.962 19.154 1.00 121.80 ? 125 ILE A N   1 
ATOM   875  C CA  . ILE A 1 125 ? 25.677 16.699 20.412 1.00 126.37 ? 125 ILE A CA  1 
ATOM   876  C C   . ILE A 1 125 ? 26.612 15.498 20.299 1.00 129.83 ? 125 ILE A C   1 
ATOM   877  O O   . ILE A 1 125 ? 27.754 15.543 20.759 1.00 133.04 ? 125 ILE A O   1 
ATOM   878  C CB  . ILE A 1 125 ? 24.683 16.469 21.565 1.00 125.08 ? 125 ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 125 ? 23.912 17.756 21.861 1.00 128.59 ? 125 ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 125 ? 25.410 15.994 22.812 1.00 121.52 ? 125 ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 125 ? 22.869 17.607 22.945 1.00 128.59 ? 125 ILE A CD1 1 
ATOM   882  N N   . ALA A 1 126 ? 26.125 14.427 19.681 1.00 126.37 ? 126 ALA A N   1 
ATOM   883  C CA  . ALA A 1 126 ? 26.930 13.228 19.482 1.00 125.60 ? 126 ALA A CA  1 
ATOM   884  C C   . ALA A 1 126 ? 28.184 13.542 18.675 1.00 127.21 ? 126 ALA A C   1 
ATOM   885  O O   . ALA A 1 126 ? 29.298 13.215 19.086 1.00 124.94 ? 126 ALA A O   1 
ATOM   886  C CB  . ALA A 1 126 ? 26.111 12.147 18.795 1.00 125.90 ? 126 ALA A CB  1 
ATOM   887  N N   . ILE A 1 127 ? 27.996 14.179 17.524 1.00 129.07 ? 127 ILE A N   1 
ATOM   888  C CA  . ILE A 1 127 ? 29.111 14.564 16.668 1.00 130.00 ? 127 ILE A CA  1 
ATOM   889  C C   . ILE A 1 127 ? 30.076 15.483 17.406 1.00 129.27 ? 127 ILE A C   1 
ATOM   890  O O   . ILE A 1 127 ? 31.292 15.373 17.255 1.00 133.94 ? 127 ILE A O   1 
ATOM   891  C CB  . ILE A 1 127 ? 28.623 15.268 15.389 1.00 131.06 ? 127 ILE A CB  1 
ATOM   892  C CG1 . ILE A 1 127 ? 27.769 14.317 14.550 1.00 130.26 ? 127 ILE A CG1 1 
ATOM   893  C CG2 . ILE A 1 127 ? 29.802 15.775 14.576 1.00 135.94 ? 127 ILE A CG2 1 
ATOM   894  C CD1 . ILE A 1 127 ? 27.310 14.910 13.237 1.00 132.53 ? 127 ILE A CD1 1 
ATOM   895  N N   . CYS A 1 128 ? 29.525 16.389 18.207 1.00 124.63 ? 128 CYS A N   1 
ATOM   896  C CA  . CYS A 1 128 ? 30.338 17.325 18.974 1.00 124.61 ? 128 CYS A CA  1 
ATOM   897  C C   . CYS A 1 128 ? 31.328 16.596 19.875 1.00 130.61 ? 128 CYS A C   1 
ATOM   898  O O   . CYS A 1 128 ? 32.501 16.960 19.941 1.00 135.79 ? 128 CYS A O   1 
ATOM   899  C CB  . CYS A 1 128 ? 29.452 18.256 19.801 1.00 117.46 ? 128 CYS A CB  1 
ATOM   900  S SG  . CYS A 1 128 ? 28.493 19.425 18.812 1.00 140.42 ? 128 CYS A SG  1 
ATOM   901  N N   . TRP A 1 129 ? 30.852 15.563 20.564 1.00 128.34 ? 129 TRP A N   1 
ATOM   902  C CA  . TRP A 1 129 ? 31.709 14.775 21.443 1.00 129.68 ? 129 TRP A CA  1 
ATOM   903  C C   . TRP A 1 129 ? 32.711 13.938 20.654 1.00 133.63 ? 129 TRP A C   1 
ATOM   904  O O   . TRP A 1 129 ? 33.878 13.838 21.030 1.00 134.39 ? 129 TRP A O   1 
ATOM   905  C CB  . TRP A 1 129 ? 30.872 13.883 22.361 1.00 127.57 ? 129 TRP A CB  1 
ATOM   906  C CG  . TRP A 1 129 ? 30.227 14.631 23.485 1.00 124.08 ? 129 TRP A CG  1 
ATOM   907  C CD1 . TRP A 1 129 ? 28.979 15.183 23.493 1.00 117.48 ? 129 TRP A CD1 1 
ATOM   908  C CD2 . TRP A 1 129 ? 30.800 14.916 24.766 1.00 124.28 ? 129 TRP A CD2 1 
ATOM   909  N NE1 . TRP A 1 129 ? 28.739 15.791 24.702 1.00 114.79 ? 129 TRP A NE1 1 
ATOM   910  C CE2 . TRP A 1 129 ? 29.842 15.641 25.501 1.00 121.49 ? 129 TRP A CE2 1 
ATOM   911  C CE3 . TRP A 1 129 ? 32.031 14.626 25.364 1.00 120.27 ? 129 TRP A CE3 1 
ATOM   912  C CZ2 . TRP A 1 129 ? 30.075 16.081 26.803 1.00 121.53 ? 129 TRP A CZ2 1 
ATOM   913  C CZ3 . TRP A 1 129 ? 32.261 15.063 26.657 1.00 116.09 ? 129 TRP A CZ3 1 
ATOM   914  C CH2 . TRP A 1 129 ? 31.288 15.783 27.362 1.00 117.82 ? 129 TRP A CH2 1 
ATOM   915  N N   . VAL A 1 130 ? 32.250 13.337 19.562 1.00 135.06 ? 130 VAL A N   1 
ATOM   916  C CA  . VAL A 1 130 ? 33.127 12.561 18.694 1.00 135.53 ? 130 VAL A CA  1 
ATOM   917  C C   . VAL A 1 130 ? 34.282 13.422 18.198 1.00 139.63 ? 130 VAL A C   1 
ATOM   918  O O   . VAL A 1 130 ? 35.444 13.027 18.279 1.00 146.20 ? 130 VAL A O   1 
ATOM   919  C CB  . VAL A 1 130 ? 32.367 11.990 17.484 1.00 136.56 ? 130 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 130 ? 33.339 11.376 16.488 1.00 135.52 ? 130 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 130 ? 31.339 10.966 17.938 1.00 137.84 ? 130 VAL A CG2 1 
ATOM   922  N N   . LEU A 1 131 ? 33.953 14.604 17.685 1.00 139.49 ? 131 LEU A N   1 
ATOM   923  C CA  . LEU A 1 131 ? 34.965 15.541 17.216 1.00 143.89 ? 131 LEU A CA  1 
ATOM   924  C C   . LEU A 1 131 ? 35.745 16.117 18.392 1.00 145.41 ? 131 LEU A C   1 
ATOM   925  O O   . LEU A 1 131 ? 36.875 16.578 18.234 1.00 146.96 ? 131 LEU A O   1 
ATOM   926  C CB  . LEU A 1 131 ? 34.322 16.669 16.407 1.00 140.84 ? 131 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 131 ? 33.519 16.258 15.172 1.00 140.02 ? 131 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 131 ? 33.004 17.487 14.440 1.00 137.94 ? 131 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 131 ? 34.357 15.392 14.246 1.00 143.54 ? 131 LEU A CD2 1 
ATOM   930  N N   . SER A 1 132 ? 35.132 16.086 19.571 1.00 142.95 ? 132 SER A N   1 
ATOM   931  C CA  . SER A 1 132 ? 35.767 16.597 20.779 1.00 142.93 ? 132 SER A CA  1 
ATOM   932  C C   . SER A 1 132 ? 36.941 15.717 21.197 1.00 140.72 ? 132 SER A C   1 
ATOM   933  O O   . SER A 1 132 ? 37.959 16.213 21.681 1.00 139.33 ? 132 SER A O   1 
ATOM   934  C CB  . SER A 1 132 ? 34.750 16.699 21.917 1.00 142.84 ? 132 SER A CB  1 
ATOM   935  O OG  . SER A 1 132 ? 35.334 17.267 23.075 1.00 146.66 ? 132 SER A OG  1 
ATOM   936  N N   . PHE A 1 133 ? 36.792 14.409 21.010 1.00 137.22 ? 133 PHE A N   1 
ATOM   937  C CA  . PHE A 1 133 ? 37.865 13.468 21.314 1.00 136.07 ? 133 PHE A CA  1 
ATOM   938  C C   . PHE A 1 133 ? 38.922 13.477 20.216 1.00 144.99 ? 133 PHE A C   1 
ATOM   939  O O   . PHE A 1 133 ? 40.116 13.339 20.487 1.00 143.78 ? 133 PHE A O   1 
ATOM   940  C CB  . PHE A 1 133 ? 37.310 12.055 21.501 1.00 128.76 ? 133 PHE A CB  1 
ATOM   941  C CG  . PHE A 1 133 ? 36.630 11.840 22.822 1.00 122.73 ? 133 PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 133 ? 37.336 11.352 23.908 1.00 119.59 ? 133 PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 133 ? 35.285 12.125 22.980 1.00 124.42 ? 133 PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 133 ? 36.715 11.152 25.126 1.00 112.87 ? 133 PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 133 ? 34.658 11.929 24.195 1.00 121.33 ? 133 PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 133 ? 35.375 11.441 25.269 1.00 114.15 ? 133 PHE A CZ  1 
ATOM   947  N N   . ALA A 1 134 ? 38.475 13.639 18.975 1.00 150.00 ? 134 ALA A N   1 
ATOM   948  C CA  . ALA A 1 134 ? 39.381 13.681 17.833 1.00 154.81 ? 134 ALA A CA  1 
ATOM   949  C C   . ALA A 1 134 ? 40.359 14.844 17.956 1.00 153.28 ? 134 ALA A C   1 
ATOM   950  O O   . ALA A 1 134 ? 41.534 14.720 17.611 1.00 156.31 ? 134 ALA A O   1 
ATOM   951  C CB  . ALA A 1 134 ? 38.595 13.779 16.535 1.00 155.49 ? 134 ALA A CB  1 
ATOM   952  N N   . ILE A 1 135 ? 39.865 15.973 18.453 1.00 148.60 ? 135 ILE A N   1 
ATOM   953  C CA  . ILE A 1 135 ? 40.687 17.167 18.610 1.00 146.07 ? 135 ILE A CA  1 
ATOM   954  C C   . ILE A 1 135 ? 41.403 17.188 19.957 1.00 143.40 ? 135 ILE A C   1 
ATOM   955  O O   . ILE A 1 135 ? 42.617 17.377 20.023 1.00 144.65 ? 135 ILE A O   1 
ATOM   956  C CB  . ILE A 1 135 ? 39.847 18.450 18.470 1.00 141.06 ? 135 ILE A CB  1 
ATOM   957  C CG1 . ILE A 1 135 ? 39.265 18.554 17.059 1.00 139.10 ? 135 ILE A CG1 1 
ATOM   958  C CG2 . ILE A 1 135 ? 40.688 19.674 18.792 1.00 141.66 ? 135 ILE A CG2 1 
ATOM   959  C CD1 . ILE A 1 135 ? 38.440 19.802 16.829 1.00 134.03 ? 135 ILE A CD1 1 
ATOM   960  N N   . GLY A 1 136 ? 40.642 16.992 21.029 1.00 138.67 ? 136 GLY A N   1 
ATOM   961  C CA  . GLY A 1 136 ? 41.188 17.031 22.373 1.00 134.58 ? 136 GLY A CA  1 
ATOM   962  C C   . GLY A 1 136 ? 42.288 16.015 22.613 1.00 132.25 ? 136 GLY A C   1 
ATOM   963  O O   . GLY A 1 136 ? 43.160 16.222 23.456 1.00 128.64 ? 136 GLY A O   1 
ATOM   964  N N   . LEU A 1 137 ? 42.248 14.913 21.870 1.00 133.39 ? 137 LEU A N   1 
ATOM   965  C CA  . LEU A 1 137 ? 43.236 13.852 22.027 1.00 132.59 ? 137 LEU A CA  1 
ATOM   966  C C   . LEU A 1 137 ? 44.146 13.733 20.806 1.00 132.12 ? 137 LEU A C   1 
ATOM   967  O O   . LEU A 1 137 ? 44.703 12.669 20.537 1.00 126.86 ? 137 LEU A O   1 
ATOM   968  C CB  . LEU A 1 137 ? 42.549 12.513 22.307 1.00 129.56 ? 137 LEU A CB  1 
ATOM   969  C CG  . LEU A 1 137 ? 41.689 12.440 23.570 1.00 120.57 ? 137 LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 137 ? 41.049 11.067 23.706 1.00 120.01 ? 137 LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 137 ? 42.512 12.775 24.805 1.00 111.68 ? 137 LEU A CD2 1 
ATOM   972  N N   . THR A 1 138 ? 44.292 14.832 20.072 1.00 134.17 ? 138 THR A N   1 
ATOM   973  C CA  . THR A 1 138 ? 45.172 14.865 18.907 1.00 139.64 ? 138 THR A CA  1 
ATOM   974  C C   . THR A 1 138 ? 46.624 14.526 19.257 1.00 146.40 ? 138 THR A C   1 
ATOM   975  O O   . THR A 1 138 ? 47.294 13.822 18.501 1.00 150.49 ? 138 THR A O   1 
ATOM   976  C CB  . THR A 1 138 ? 45.120 16.230 18.188 1.00 139.71 ? 138 THR A CB  1 
ATOM   977  O OG1 . THR A 1 138 ? 43.791 16.470 17.708 1.00 134.42 ? 138 THR A OG1 1 
ATOM   978  C CG2 . THR A 1 138 ? 46.086 16.254 17.014 1.00 146.31 ? 138 THR A CG2 1 
ATOM   979  N N   . PRO A 1 139 ? 47.119 15.029 20.401 1.00 145.68 ? 139 PRO A N   1 
ATOM   980  C CA  . PRO A 1 139 ? 48.481 14.680 20.820 1.00 145.89 ? 139 PRO A CA  1 
ATOM   981  C C   . PRO A 1 139 ? 48.681 13.172 20.947 1.00 146.49 ? 139 PRO A C   1 
ATOM   982  O O   . PRO A 1 139 ? 49.814 12.699 20.881 1.00 149.12 ? 139 PRO A O   1 
ATOM   983  C CB  . PRO A 1 139 ? 48.603 15.343 22.193 1.00 144.07 ? 139 PRO A CB  1 
ATOM   984  C CG  . PRO A 1 139 ? 47.664 16.489 22.135 1.00 143.50 ? 139 PRO A CG  1 
ATOM   985  C CD  . PRO A 1 139 ? 46.507 16.023 21.302 1.00 143.26 ? 139 PRO A CD  1 
ATOM   986  N N   . MET A 1 140 ? 47.594 12.431 21.129 1.00 148.19 ? 140 MET A N   1 
ATOM   987  C CA  . MET A 1 140 ? 47.673 10.979 21.238 1.00 149.72 ? 140 MET A CA  1 
ATOM   988  C C   . MET A 1 140 ? 47.771 10.329 19.862 1.00 152.00 ? 140 MET A C   1 
ATOM   989  O O   . MET A 1 140 ? 48.220 9.190  19.733 1.00 152.18 ? 140 MET A O   1 
ATOM   990  C CB  . MET A 1 140 ? 46.465 10.427 21.997 1.00 148.10 ? 140 MET A CB  1 
ATOM   991  C CG  . MET A 1 140 ? 46.327 10.961 23.412 1.00 146.74 ? 140 MET A CG  1 
ATOM   992  S SD  . MET A 1 140 ? 45.051 10.111 24.358 1.00 151.34 ? 140 MET A SD  1 
ATOM   993  C CE  . MET A 1 140 ? 45.664 8.429  24.314 1.00 125.30 ? 140 MET A CE  1 
ATOM   994  N N   . LEU A 1 141 ? 47.349 11.062 18.837 1.00 153.83 ? 141 LEU A N   1 
ATOM   995  C CA  . LEU A 1 141 ? 47.376 10.557 17.469 1.00 156.03 ? 141 LEU A CA  1 
ATOM   996  C C   . LEU A 1 141 ? 48.806 10.421 16.959 1.00 161.73 ? 141 LEU A C   1 
ATOM   997  O O   . LEU A 1 141 ? 49.053 9.783  15.937 1.00 167.43 ? 141 LEU A O   1 
ATOM   998  C CB  . LEU A 1 141 ? 46.575 11.475 16.543 1.00 153.98 ? 141 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 141 ? 45.108 11.707 16.913 1.00 144.45 ? 141 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 141 ? 44.465 12.708 15.964 1.00 142.28 ? 141 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 141 ? 44.339 10.395 16.917 1.00 141.39 ? 141 LEU A CD2 1 
ATOM   1002 N N   . GLY A 1 142 ? 49.745 11.026 17.680 1.00 172.50 ? 142 GLY A N   1 
ATOM   1003 C CA  . GLY A 1 142 ? 51.146 10.982 17.303 1.00 170.86 ? 142 GLY A CA  1 
ATOM   1004 C C   . GLY A 1 142 ? 51.818 12.331 17.457 1.00 167.26 ? 142 GLY A C   1 
ATOM   1005 O O   . GLY A 1 142 ? 53.042 12.421 17.547 1.00 169.51 ? 142 GLY A O   1 
ATOM   1006 N N   . TRP A 1 143 ? 51.008 13.385 17.487 1.00 164.33 ? 143 TRP A N   1 
ATOM   1007 C CA  . TRP A 1 143 ? 51.512 14.744 17.643 1.00 160.70 ? 143 TRP A CA  1 
ATOM   1008 C C   . TRP A 1 143 ? 51.867 15.014 19.102 1.00 157.75 ? 143 TRP A C   1 
ATOM   1009 O O   . TRP A 1 143 ? 51.248 15.854 19.755 1.00 150.97 ? 143 TRP A O   1 
ATOM   1010 C CB  . TRP A 1 143 ? 50.462 15.751 17.161 1.00 159.52 ? 143 TRP A CB  1 
ATOM   1011 C CG  . TRP A 1 143 ? 50.970 17.156 17.017 1.00 156.08 ? 143 TRP A CG  1 
ATOM   1012 C CD1 . TRP A 1 143 ? 52.079 17.693 17.603 1.00 151.37 ? 143 TRP A CD1 1 
ATOM   1013 C CD2 . TRP A 1 143 ? 50.378 18.207 16.243 1.00 162.14 ? 143 TRP A CD2 1 
ATOM   1014 N NE1 . TRP A 1 143 ? 52.217 19.010 17.238 1.00 154.80 ? 143 TRP A NE1 1 
ATOM   1015 C CE2 . TRP A 1 143 ? 51.185 19.351 16.403 1.00 159.86 ? 143 TRP A CE2 1 
ATOM   1016 C CE3 . TRP A 1 143 ? 49.244 18.292 15.428 1.00 166.56 ? 143 TRP A CE3 1 
ATOM   1017 C CZ2 . TRP A 1 143 ? 50.896 20.563 15.780 1.00 162.10 ? 143 TRP A CZ2 1 
ATOM   1018 C CZ3 . TRP A 1 143 ? 48.958 19.497 14.810 1.00 167.09 ? 143 TRP A CZ3 1 
ATOM   1019 C CH2 . TRP A 1 143 ? 49.781 20.616 14.989 1.00 166.09 ? 143 TRP A CH2 1 
ATOM   1020 N N   . ASN A 1 144 ? 52.866 14.297 19.610 1.00 162.85 ? 144 ASN A N   1 
ATOM   1021 C CA  . ASN A 1 144 ? 53.270 14.426 21.007 1.00 161.77 ? 144 ASN A CA  1 
ATOM   1022 C C   . ASN A 1 144 ? 54.785 14.471 21.193 1.00 159.88 ? 144 ASN A C   1 
ATOM   1023 O O   . ASN A 1 144 ? 55.546 14.352 20.232 1.00 161.11 ? 144 ASN A O   1 
ATOM   1024 C CB  . ASN A 1 144 ? 52.674 13.290 21.841 1.00 161.06 ? 144 ASN A CB  1 
ATOM   1025 C CG  . ASN A 1 144 ? 53.156 11.923 21.395 1.00 161.34 ? 144 ASN A CG  1 
ATOM   1026 O OD1 . ASN A 1 144 ? 54.343 11.609 21.488 1.00 164.44 ? 144 ASN A OD1 1 
ATOM   1027 N ND2 . ASN A 1 144 ? 52.234 11.099 20.909 1.00 156.93 ? 144 ASN A ND2 1 
ATOM   1028 N N   . ASN A 1 145 ? 55.215 14.643 22.440 1.00 154.62 ? 145 ASN A N   1 
ATOM   1029 C CA  . ASN A 1 145 ? 56.635 14.696 22.766 1.00 150.20 ? 145 ASN A CA  1 
ATOM   1030 C C   . ASN A 1 145 ? 57.038 13.608 23.753 1.00 157.03 ? 145 ASN A C   1 
ATOM   1031 O O   . ASN A 1 145 ? 57.669 13.885 24.774 1.00 158.30 ? 145 ASN A O   1 
ATOM   1032 C CB  . ASN A 1 145 ? 57.008 16.070 23.325 1.00 135.74 ? 145 ASN A CB  1 
ATOM   1033 C CG  . ASN A 1 145 ? 56.824 17.180 22.312 1.00 132.88 ? 145 ASN A CG  1 
ATOM   1034 O OD1 . ASN A 1 145 ? 56.615 16.925 21.126 1.00 133.51 ? 145 ASN A OD1 1 
ATOM   1035 N ND2 . ASN A 1 145 ? 56.904 18.422 22.775 1.00 130.99 ? 145 ASN A ND2 1 
ATOM   1036 N N   . CYS A 1 146 ? 56.668 12.369 23.446 1.00 159.27 ? 146 CYS A N   1 
ATOM   1037 C CA  . CYS A 1 146 ? 57.016 11.237 24.294 1.00 157.08 ? 146 CYS A CA  1 
ATOM   1038 C C   . CYS A 1 146 ? 58.424 10.741 23.984 1.00 156.93 ? 146 CYS A C   1 
ATOM   1039 O O   . CYS A 1 146 ? 58.624 9.955  23.058 1.00 162.67 ? 146 CYS A O   1 
ATOM   1040 C CB  . CYS A 1 146 ? 56.007 10.102 24.116 1.00 158.42 ? 146 CYS A CB  1 
ATOM   1041 S SG  . CYS A 1 146 ? 54.310 10.536 24.557 1.00 202.75 ? 146 CYS A SG  1 
ATOM   1042 N N   . GLY A 1 147 ? 59.396 11.205 24.761 1.00 148.97 ? 147 GLY A N   1 
ATOM   1043 C CA  . GLY A 1 147 ? 60.778 10.806 24.571 1.00 143.18 ? 147 GLY A CA  1 
ATOM   1044 C C   . GLY A 1 147 ? 61.565 11.810 23.753 1.00 143.87 ? 147 GLY A C   1 
ATOM   1045 O O   . GLY A 1 147 ? 62.448 11.440 22.979 1.00 144.89 ? 147 GLY A O   1 
ATOM   1046 N N   . GLN A 1 148 ? 61.243 13.088 23.923 1.00 146.84 ? 148 GLN A N   1 
ATOM   1047 C CA  . GLN A 1 148 ? 61.945 14.151 23.215 1.00 155.66 ? 148 GLN A CA  1 
ATOM   1048 C C   . GLN A 1 148 ? 62.717 15.038 24.185 1.00 159.20 ? 148 GLN A C   1 
ATOM   1049 O O   . GLN A 1 148 ? 62.170 16.003 24.721 1.00 160.85 ? 148 GLN A O   1 
ATOM   1050 C CB  . GLN A 1 148 ? 60.966 14.990 22.391 1.00 157.41 ? 148 GLN A CB  1 
ATOM   1051 C CG  . GLN A 1 148 ? 60.245 14.214 21.299 1.00 164.79 ? 148 GLN A CG  1 
ATOM   1052 C CD  . GLN A 1 148 ? 61.187 13.683 20.234 1.00 171.18 ? 148 GLN A CD  1 
ATOM   1053 O OE1 . GLN A 1 148 ? 62.378 13.993 20.230 1.00 175.57 ? 148 GLN A OE1 1 
ATOM   1054 N NE2 . GLN A 1 148 ? 60.654 12.880 19.321 1.00 174.45 ? 148 GLN A NE2 1 
ATOM   1055 N N   . PRO A 1 149 ? 63.997 14.705 24.415 1.00 152.79 ? 149 PRO A N   1 
ATOM   1056 C CA  . PRO A 1 149 ? 64.879 15.450 25.320 1.00 137.09 ? 149 PRO A CA  1 
ATOM   1057 C C   . PRO A 1 149 ? 65.073 16.892 24.868 1.00 130.60 ? 149 PRO A C   1 
ATOM   1058 O O   . PRO A 1 149 ? 65.669 17.672 25.611 1.00 127.66 ? 149 PRO A O   1 
ATOM   1059 C CB  . PRO A 1 149 ? 66.204 14.689 25.221 1.00 136.58 ? 149 PRO A CB  1 
ATOM   1060 C CG  . PRO A 1 149 ? 65.828 13.324 24.755 1.00 144.26 ? 149 PRO A CG  1 
ATOM   1061 C CD  . PRO A 1 149 ? 64.668 13.530 23.836 1.00 151.11 ? 149 PRO A CD  1 
ATOM   1062 N N   . GLY A 1 158 ? 65.079 6.711  35.576 1.00 221.82 ? 158 GLY A N   1 
ATOM   1063 C CA  . GLY A 1 158 ? 63.944 7.519  35.982 1.00 219.41 ? 158 GLY A CA  1 
ATOM   1064 C C   . GLY A 1 158 ? 62.683 6.698  36.169 1.00 218.58 ? 158 GLY A C   1 
ATOM   1065 O O   . GLY A 1 158 ? 62.260 6.442  37.297 1.00 218.85 ? 158 GLY A O   1 
ATOM   1066 N N   . CYS A 1 159 ? 62.080 6.285  35.059 1.00 216.88 ? 159 CYS A N   1 
ATOM   1067 C CA  . CYS A 1 159 ? 60.855 5.496  35.100 1.00 213.74 ? 159 CYS A CA  1 
ATOM   1068 C C   . CYS A 1 159 ? 61.030 4.163  34.379 1.00 214.80 ? 159 CYS A C   1 
ATOM   1069 O O   . CYS A 1 159 ? 60.118 3.336  34.354 1.00 213.86 ? 159 CYS A O   1 
ATOM   1070 C CB  . CYS A 1 159 ? 59.694 6.277  34.481 1.00 211.79 ? 159 CYS A CB  1 
ATOM   1071 S SG  . CYS A 1 159 ? 59.342 7.859  35.283 1.00 233.24 ? 159 CYS A SG  1 
ATOM   1072 N N   . GLY A 1 160 ? 62.206 3.961  33.794 1.00 216.16 ? 160 GLY A N   1 
ATOM   1073 C CA  . GLY A 1 160 ? 62.493 2.743  33.059 1.00 217.18 ? 160 GLY A CA  1 
ATOM   1074 C C   . GLY A 1 160 ? 61.866 2.749  31.679 1.00 215.69 ? 160 GLY A C   1 
ATOM   1075 O O   . GLY A 1 160 ? 60.981 3.557  31.395 1.00 214.72 ? 160 GLY A O   1 
ATOM   1076 N N   . GLU A 1 161 ? 62.326 1.848  30.818 1.00 216.30 ? 161 GLU A N   1 
ATOM   1077 C CA  . GLU A 1 161 ? 61.804 1.755  29.459 1.00 214.65 ? 161 GLU A CA  1 
ATOM   1078 C C   . GLU A 1 161 ? 60.306 1.468  29.466 1.00 207.40 ? 161 GLU A C   1 
ATOM   1079 O O   . GLU A 1 161 ? 59.807 0.742  30.326 1.00 204.82 ? 161 GLU A O   1 
ATOM   1080 C CB  . GLU A 1 161 ? 62.550 0.681  28.663 1.00 221.08 ? 161 GLU A CB  1 
ATOM   1081 C CG  . GLU A 1 161 ? 62.438 -0.720 29.244 1.00 224.57 ? 161 GLU A CG  1 
ATOM   1082 C CD  . GLU A 1 161 ? 63.185 -1.752 28.421 1.00 229.02 ? 161 GLU A CD  1 
ATOM   1083 O OE1 . GLU A 1 161 ? 63.131 -2.949 28.775 1.00 229.77 ? 161 GLU A OE1 1 
ATOM   1084 O OE2 . GLU A 1 161 ? 63.826 -1.367 27.421 1.00 231.68 ? 161 GLU A OE2 1 
ATOM   1085 N N   . GLY A 1 162 ? 59.594 2.045  28.504 1.00 203.25 ? 162 GLY A N   1 
ATOM   1086 C CA  . GLY A 1 162 ? 58.155 1.887  28.422 1.00 198.46 ? 162 GLY A CA  1 
ATOM   1087 C C   . GLY A 1 162 ? 57.419 3.064  29.033 1.00 195.07 ? 162 GLY A C   1 
ATOM   1088 O O   . GLY A 1 162 ? 56.662 3.755  28.351 1.00 195.30 ? 162 GLY A O   1 
ATOM   1089 N N   . GLN A 1 163 ? 57.644 3.293  30.323 1.00 191.75 ? 163 GLN A N   1 
ATOM   1090 C CA  . GLN A 1 163 ? 56.999 4.395  31.029 1.00 187.19 ? 163 GLN A CA  1 
ATOM   1091 C C   . GLN A 1 163 ? 57.705 5.723  30.769 1.00 180.95 ? 163 GLN A C   1 
ATOM   1092 O O   . GLN A 1 163 ? 58.910 5.760  30.520 1.00 178.39 ? 163 GLN A O   1 
ATOM   1093 C CB  . GLN A 1 163 ? 56.936 4.113  32.533 1.00 188.30 ? 163 GLN A CB  1 
ATOM   1094 C CG  . GLN A 1 163 ? 56.031 2.950  32.911 1.00 188.97 ? 163 GLN A CG  1 
ATOM   1095 C CD  . GLN A 1 163 ? 55.886 2.785  34.413 1.00 189.08 ? 163 GLN A CD  1 
ATOM   1096 O OE1 . GLN A 1 163 ? 56.579 3.442  35.191 1.00 191.09 ? 163 GLN A OE1 1 
ATOM   1097 N NE2 . GLN A 1 163 ? 54.981 1.906  34.828 1.00 187.05 ? 163 GLN A NE2 1 
ATOM   1098 N N   . VAL A 1 164 ? 56.943 6.810  30.828 1.00 175.31 ? 164 VAL A N   1 
ATOM   1099 C CA  . VAL A 1 164 ? 57.478 8.143  30.578 1.00 167.85 ? 164 VAL A CA  1 
ATOM   1100 C C   . VAL A 1 164 ? 57.173 9.075  31.744 1.00 160.37 ? 164 VAL A C   1 
ATOM   1101 O O   . VAL A 1 164 ? 56.087 9.023  32.320 1.00 158.68 ? 164 VAL A O   1 
ATOM   1102 C CB  . VAL A 1 164 ? 56.891 8.747  29.285 1.00 164.15 ? 164 VAL A CB  1 
ATOM   1103 C CG1 . VAL A 1 164 ? 57.393 10.169 29.080 1.00 161.13 ? 164 VAL A CG1 1 
ATOM   1104 C CG2 . VAL A 1 164 ? 57.234 7.875  28.087 1.00 166.60 ? 164 VAL A CG2 1 
ATOM   1105 N N   . ALA A 1 165 ? 58.139 9.919  32.096 1.00 157.52 ? 165 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 165 ? 57.932 10.918 33.136 1.00 152.30 ? 165 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 165 ? 56.787 11.835 32.728 1.00 145.22 ? 165 ALA A C   1 
ATOM   1108 O O   . ALA A 1 165 ? 56.991 12.819 32.017 1.00 144.90 ? 165 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 165 ? 59.202 11.719 33.367 1.00 155.78 ? 165 ALA A CB  1 
ATOM   1110 N N   . CYS A 1 166 ? 55.583 11.501 33.178 1.00 143.46 ? 166 CYS A N   1 
ATOM   1111 C CA  . CYS A 1 166 ? 54.383 12.218 32.764 1.00 140.27 ? 166 CYS A CA  1 
ATOM   1112 C C   . CYS A 1 166 ? 54.359 13.648 33.291 1.00 135.30 ? 166 CYS A C   1 
ATOM   1113 O O   . CYS A 1 166 ? 53.876 13.911 34.393 1.00 129.63 ? 166 CYS A O   1 
ATOM   1114 C CB  . CYS A 1 166 ? 53.126 11.466 33.206 1.00 135.29 ? 166 CYS A CB  1 
ATOM   1115 S SG  . CYS A 1 166 ? 51.599 12.087 32.467 1.00 166.60 ? 166 CYS A SG  1 
ATOM   1116 N N   . LEU A 1 167 ? 54.890 14.566 32.492 1.00 134.18 ? 167 LEU A N   1 
ATOM   1117 C CA  . LEU A 1 167 ? 54.882 15.980 32.830 1.00 133.21 ? 167 LEU A CA  1 
ATOM   1118 C C   . LEU A 1 167 ? 54.275 16.757 31.672 1.00 127.13 ? 167 LEU A C   1 
ATOM   1119 O O   . LEU A 1 167 ? 54.737 16.655 30.537 1.00 125.56 ? 167 LEU A O   1 
ATOM   1120 C CB  . LEU A 1 167 ? 56.300 16.475 33.114 1.00 141.26 ? 167 LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 167 ? 57.104 15.694 34.156 1.00 143.54 ? 167 LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 167 ? 58.485 16.302 34.319 1.00 144.66 ? 167 LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 167 ? 56.373 15.651 35.490 1.00 142.92 ? 167 LEU A CD2 1 
ATOM   1124 N N   . PHE A 1 168 ? 53.234 17.529 31.966 1.00 124.33 ? 168 PHE A N   1 
ATOM   1125 C CA  . PHE A 1 168 ? 52.495 18.254 30.938 1.00 128.05 ? 168 PHE A CA  1 
ATOM   1126 C C   . PHE A 1 168 ? 53.413 18.903 29.903 1.00 133.90 ? 168 PHE A C   1 
ATOM   1127 O O   . PHE A 1 168 ? 53.371 18.560 28.722 1.00 137.91 ? 168 PHE A O   1 
ATOM   1128 C CB  . PHE A 1 168 ? 51.593 19.310 31.579 1.00 127.85 ? 168 PHE A CB  1 
ATOM   1129 C CG  . PHE A 1 168 ? 50.652 19.971 30.614 1.00 133.58 ? 168 PHE A CG  1 
ATOM   1130 C CD1 . PHE A 1 168 ? 51.049 21.081 29.887 1.00 136.52 ? 168 PHE A CD1 1 
ATOM   1131 C CD2 . PHE A 1 168 ? 49.369 19.482 30.434 1.00 138.70 ? 168 PHE A CD2 1 
ATOM   1132 C CE1 . PHE A 1 168 ? 50.184 21.690 28.998 1.00 139.79 ? 168 PHE A CE1 1 
ATOM   1133 C CE2 . PHE A 1 168 ? 48.500 20.087 29.547 1.00 140.28 ? 168 PHE A CE2 1 
ATOM   1134 C CZ  . PHE A 1 168 ? 48.908 21.192 28.829 1.00 141.18 ? 168 PHE A CZ  1 
ATOM   1135 N N   . GLU A 1 169 ? 54.245 19.836 30.356 1.00 132.20 ? 169 GLU A N   1 
ATOM   1136 C CA  . GLU A 1 169 ? 55.095 20.612 29.458 1.00 130.80 ? 169 GLU A CA  1 
ATOM   1137 C C   . GLU A 1 169 ? 56.006 19.747 28.588 1.00 135.37 ? 169 GLU A C   1 
ATOM   1138 O O   . GLU A 1 169 ? 56.233 20.056 27.418 1.00 126.72 ? 169 GLU A O   1 
ATOM   1139 C CB  . GLU A 1 169 ? 55.928 21.631 30.246 1.00 128.14 ? 169 GLU A CB  1 
ATOM   1140 C CG  . GLU A 1 169 ? 56.886 21.020 31.260 1.00 129.25 ? 169 GLU A CG  1 
ATOM   1141 C CD  . GLU A 1 169 ? 56.181 20.482 32.491 1.00 126.48 ? 169 GLU A CD  1 
ATOM   1142 O OE1 . GLU A 1 169 ? 55.032 20.896 32.750 1.00 123.02 ? 169 GLU A OE1 1 
ATOM   1143 O OE2 . GLU A 1 169 ? 56.779 19.649 33.204 1.00 126.89 ? 169 GLU A OE2 1 
ATOM   1144 N N   . ASP A 1 170 ? 56.519 18.663 29.160 1.00 139.24 ? 170 ASP A N   1 
ATOM   1145 C CA  . ASP A 1 170 ? 57.482 17.814 28.464 1.00 144.64 ? 170 ASP A CA  1 
ATOM   1146 C C   . ASP A 1 170 ? 56.827 16.803 27.526 1.00 144.21 ? 170 ASP A C   1 
ATOM   1147 O O   . ASP A 1 170 ? 57.458 16.325 26.583 1.00 145.43 ? 170 ASP A O   1 
ATOM   1148 C CB  . ASP A 1 170 ? 58.377 17.084 29.468 1.00 152.71 ? 170 ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 170 ? 59.286 18.026 30.232 1.00 163.55 ? 170 ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 170 ? 59.223 19.248 29.982 1.00 165.34 ? 170 ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 170 ? 60.066 17.544 31.080 1.00 169.17 ? 170 ASP A OD2 1 
ATOM   1152 N N   . VAL A 1 171 ? 55.564 16.479 27.785 1.00 140.81 ? 171 VAL A N   1 
ATOM   1153 C CA  . VAL A 1 171 ? 54.876 15.452 27.011 1.00 138.63 ? 171 VAL A CA  1 
ATOM   1154 C C   . VAL A 1 171 ? 53.907 16.035 25.984 1.00 137.30 ? 171 VAL A C   1 
ATOM   1155 O O   . VAL A 1 171 ? 53.646 15.418 24.951 1.00 138.60 ? 171 VAL A O   1 
ATOM   1156 C CB  . VAL A 1 171 ? 54.119 14.466 27.923 1.00 137.82 ? 171 VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 171 ? 55.072 13.838 28.929 1.00 129.36 ? 171 VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 171 ? 52.974 15.167 28.633 1.00 136.40 ? 171 VAL A CG2 1 
ATOM   1159 N N   . VAL A 1 172 ? 53.379 17.220 26.268 1.00 135.99 ? 172 VAL A N   1 
ATOM   1160 C CA  . VAL A 1 172 ? 52.409 17.852 25.378 1.00 136.89 ? 172 VAL A CA  1 
ATOM   1161 C C   . VAL A 1 172 ? 53.031 19.000 24.589 1.00 139.11 ? 172 VAL A C   1 
ATOM   1162 O O   . VAL A 1 172 ? 53.531 19.961 25.172 1.00 142.13 ? 172 VAL A O   1 
ATOM   1163 C CB  . VAL A 1 172 ? 51.178 18.366 26.151 1.00 131.30 ? 172 VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 172 ? 50.204 19.046 25.204 1.00 129.52 ? 172 VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 172 ? 50.499 17.220 26.885 1.00 128.65 ? 172 VAL A CG2 1 
ATOM   1166 N N   . PRO A 1 173 ? 52.998 18.897 23.252 1.00 138.74 ? 173 PRO A N   1 
ATOM   1167 C CA  . PRO A 1 173 ? 53.571 19.894 22.341 1.00 142.54 ? 173 PRO A CA  1 
ATOM   1168 C C   . PRO A 1 173 ? 53.010 21.293 22.573 1.00 148.57 ? 173 PRO A C   1 
ATOM   1169 O O   . PRO A 1 173 ? 51.887 21.437 23.052 1.00 147.44 ? 173 PRO A O   1 
ATOM   1170 C CB  . PRO A 1 173 ? 53.145 19.389 20.960 1.00 137.68 ? 173 PRO A CB  1 
ATOM   1171 C CG  . PRO A 1 173 ? 52.955 17.929 21.137 1.00 135.69 ? 173 PRO A CG  1 
ATOM   1172 C CD  . PRO A 1 173 ? 52.417 17.756 22.524 1.00 135.98 ? 173 PRO A CD  1 
ATOM   1173 N N   . MET A 1 174 ? 53.795 22.309 22.231 1.00 159.33 ? 174 MET A N   1 
ATOM   1174 C CA  . MET A 1 174 ? 53.356 23.695 22.344 1.00 168.83 ? 174 MET A CA  1 
ATOM   1175 C C   . MET A 1 174 ? 52.835 24.209 21.008 1.00 177.97 ? 174 MET A C   1 
ATOM   1176 O O   . MET A 1 174 ? 51.854 24.951 20.958 1.00 180.19 ? 174 MET A O   1 
ATOM   1177 C CB  . MET A 1 174 ? 54.497 24.582 22.841 1.00 175.48 ? 174 MET A CB  1 
ATOM   1178 C CG  . MET A 1 174 ? 54.782 24.448 24.326 1.00 178.63 ? 174 MET A CG  1 
ATOM   1179 S SD  . MET A 1 174 ? 53.396 25.011 25.329 1.00 120.35 ? 174 MET A SD  1 
ATOM   1180 C CE  . MET A 1 174 ? 53.233 26.699 24.756 1.00 119.17 ? 174 MET A CE  1 
ATOM   1181 N N   . ASN A 1 175 ? 53.498 23.810 19.927 1.00 185.71 ? 175 ASN A N   1 
ATOM   1182 C CA  . ASN A 1 175 ? 53.063 24.182 18.586 1.00 191.55 ? 175 ASN A CA  1 
ATOM   1183 C C   . ASN A 1 175 ? 51.658 23.665 18.300 1.00 198.49 ? 175 ASN A C   1 
ATOM   1184 O O   . ASN A 1 175 ? 50.965 24.164 17.413 1.00 196.40 ? 175 ASN A O   1 
ATOM   1185 C CB  . ASN A 1 175 ? 54.048 23.665 17.533 1.00 188.84 ? 175 ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 175 ? 54.187 22.154 17.554 1.00 185.92 ? 175 ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 175 ? 53.691 21.484 18.460 1.00 183.71 ? 175 ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 175 ? 54.868 21.609 16.552 1.00 185.78 ? 175 ASN A ND2 1 
ATOM   1189 N N   . TYR A 1 176 ? 51.245 22.659 19.064 1.00 147.20 ? 176 TYR A N   1 
ATOM   1190 C CA  . TYR A 1 176 ? 49.905 22.103 18.947 1.00 148.18 ? 176 TYR A CA  1 
ATOM   1191 C C   . TYR A 1 176 ? 48.892 22.941 19.717 1.00 143.82 ? 176 TYR A C   1 
ATOM   1192 O O   . TYR A 1 176 ? 47.949 23.478 19.138 1.00 150.35 ? 176 TYR A O   1 
ATOM   1193 C CB  . TYR A 1 176 ? 49.878 20.658 19.450 1.00 154.35 ? 176 TYR A CB  1 
ATOM   1194 C CG  . TYR A 1 176 ? 48.499 20.176 19.841 1.00 159.92 ? 176 TYR A CG  1 
ATOM   1195 C CD1 . TYR A 1 176 ? 47.609 19.705 18.886 1.00 160.26 ? 176 TYR A CD1 1 
ATOM   1196 C CD2 . TYR A 1 176 ? 48.087 20.193 21.167 1.00 163.92 ? 176 TYR A CD2 1 
ATOM   1197 C CE1 . TYR A 1 176 ? 46.348 19.267 19.240 1.00 162.60 ? 176 TYR A CE1 1 
ATOM   1198 C CE2 . TYR A 1 176 ? 46.828 19.758 21.531 1.00 165.63 ? 176 TYR A CE2 1 
ATOM   1199 C CZ  . TYR A 1 176 ? 45.963 19.296 20.564 1.00 166.54 ? 176 TYR A CZ  1 
ATOM   1200 O OH  . TYR A 1 176 ? 44.708 18.860 20.920 1.00 169.44 ? 176 TYR A OH  1 
ATOM   1201 N N   . MET A 1 177 ? 49.096 23.052 21.026 1.00 127.67 ? 177 MET A N   1 
ATOM   1202 C CA  . MET A 1 177 ? 48.153 23.751 21.893 1.00 116.48 ? 177 MET A CA  1 
ATOM   1203 C C   . MET A 1 177 ? 48.002 25.225 21.539 1.00 122.01 ? 177 MET A C   1 
ATOM   1204 O O   . MET A 1 177 ? 47.084 25.893 22.015 1.00 133.70 ? 177 MET A O   1 
ATOM   1205 C CB  . MET A 1 177 ? 48.554 23.601 23.360 1.00 101.75 ? 177 MET A CB  1 
ATOM   1206 C CG  . MET A 1 177 ? 48.346 22.204 23.913 1.00 93.64  ? 177 MET A CG  1 
ATOM   1207 S SD  . MET A 1 177 ? 48.494 22.164 25.707 1.00 172.60 ? 177 MET A SD  1 
ATOM   1208 C CE  . MET A 1 177 ? 47.235 23.353 26.165 1.00 95.99  ? 177 MET A CE  1 
ATOM   1209 N N   . VAL A 1 178 ? 48.902 25.730 20.705 1.00 111.01 ? 178 VAL A N   1 
ATOM   1210 C CA  . VAL A 1 178 ? 48.844 27.124 20.291 1.00 109.45 ? 178 VAL A CA  1 
ATOM   1211 C C   . VAL A 1 178 ? 48.232 27.266 18.901 1.00 121.62 ? 178 VAL A C   1 
ATOM   1212 O O   . VAL A 1 178 ? 47.123 27.779 18.752 1.00 122.27 ? 178 VAL A O   1 
ATOM   1213 C CB  . VAL A 1 178 ? 50.234 27.783 20.322 1.00 98.25  ? 178 VAL A CB  1 
ATOM   1214 C CG1 . VAL A 1 178 ? 50.185 29.150 19.670 1.00 88.13  ? 178 VAL A CG1 1 
ATOM   1215 C CG2 . VAL A 1 178 ? 50.733 27.890 21.754 1.00 102.30 ? 178 VAL A CG2 1 
ATOM   1216 N N   . TYR A 1 179 ? 48.957 26.805 17.887 1.00 132.71 ? 179 TYR A N   1 
ATOM   1217 C CA  . TYR A 1 179 ? 48.488 26.896 16.508 1.00 142.32 ? 179 TYR A CA  1 
ATOM   1218 C C   . TYR A 1 179 ? 47.188 26.127 16.291 1.00 138.05 ? 179 TYR A C   1 
ATOM   1219 O O   . TYR A 1 179 ? 46.243 26.644 15.696 1.00 137.53 ? 179 TYR A O   1 
ATOM   1220 C CB  . TYR A 1 179 ? 49.558 26.387 15.540 1.00 148.27 ? 179 TYR A CB  1 
ATOM   1221 C CG  . TYR A 1 179 ? 50.738 27.317 15.380 1.00 152.70 ? 179 TYR A CG  1 
ATOM   1222 C CD1 . TYR A 1 179 ? 51.835 27.230 16.226 1.00 156.31 ? 179 TYR A CD1 1 
ATOM   1223 C CD2 . TYR A 1 179 ? 50.756 28.280 14.381 1.00 152.50 ? 179 TYR A CD2 1 
ATOM   1224 C CE1 . TYR A 1 179 ? 52.917 28.077 16.082 1.00 159.77 ? 179 TYR A CE1 1 
ATOM   1225 C CE2 . TYR A 1 179 ? 51.833 29.133 14.229 1.00 155.55 ? 179 TYR A CE2 1 
ATOM   1226 C CZ  . TYR A 1 179 ? 52.910 29.027 15.082 1.00 160.08 ? 179 TYR A CZ  1 
ATOM   1227 O OH  . TYR A 1 179 ? 53.987 29.872 14.937 1.00 162.50 ? 179 TYR A OH  1 
ATOM   1228 N N   . PHE A 1 180 ? 47.148 24.890 16.775 1.00 135.72 ? 180 PHE A N   1 
ATOM   1229 C CA  . PHE A 1 180 ? 45.998 24.021 16.557 1.00 132.10 ? 180 PHE A CA  1 
ATOM   1230 C C   . PHE A 1 180 ? 44.902 24.243 17.596 1.00 125.03 ? 180 PHE A C   1 
ATOM   1231 O O   . PHE A 1 180 ? 43.849 24.802 17.289 1.00 125.04 ? 180 PHE A O   1 
ATOM   1232 C CB  . PHE A 1 180 ? 46.434 22.554 16.551 1.00 137.10 ? 180 PHE A CB  1 
ATOM   1233 C CG  . PHE A 1 180 ? 45.339 21.596 16.176 1.00 140.57 ? 180 PHE A CG  1 
ATOM   1234 C CD1 . PHE A 1 180 ? 45.045 21.348 14.846 1.00 139.69 ? 180 PHE A CD1 1 
ATOM   1235 C CD2 . PHE A 1 180 ? 44.609 20.940 17.152 1.00 141.95 ? 180 PHE A CD2 1 
ATOM   1236 C CE1 . PHE A 1 180 ? 44.040 20.466 14.496 1.00 137.60 ? 180 PHE A CE1 1 
ATOM   1237 C CE2 . PHE A 1 180 ? 43.603 20.056 16.809 1.00 140.67 ? 180 PHE A CE2 1 
ATOM   1238 C CZ  . PHE A 1 180 ? 43.319 19.819 15.479 1.00 138.29 ? 180 PHE A CZ  1 
ATOM   1239 N N   . ASN A 1 181 ? 45.157 23.803 18.824 1.00 114.27 ? 181 ASN A N   1 
ATOM   1240 C CA  . ASN A 1 181 ? 44.172 23.891 19.898 1.00 107.05 ? 181 ASN A CA  1 
ATOM   1241 C C   . ASN A 1 181 ? 43.600 25.295 20.094 1.00 112.61 ? 181 ASN A C   1 
ATOM   1242 O O   . ASN A 1 181 ? 42.470 25.571 19.696 1.00 119.31 ? 181 ASN A O   1 
ATOM   1243 C CB  . ASN A 1 181 ? 44.763 23.369 21.210 1.00 98.29  ? 181 ASN A CB  1 
ATOM   1244 C CG  . ASN A 1 181 ? 43.789 23.463 22.370 1.00 95.14  ? 181 ASN A CG  1 
ATOM   1245 O OD1 . ASN A 1 181 ? 43.414 24.556 22.795 1.00 94.12  ? 181 ASN A OD1 1 
ATOM   1246 N ND2 . ASN A 1 181 ? 43.381 22.313 22.895 1.00 92.60  ? 181 ASN A ND2 1 
ATOM   1247 N N   . PHE A 1 182 ? 44.381 26.177 20.708 1.00 111.94 ? 182 PHE A N   1 
ATOM   1248 C CA  . PHE A 1 182 ? 43.906 27.521 21.031 1.00 112.74 ? 182 PHE A CA  1 
ATOM   1249 C C   . PHE A 1 182 ? 43.419 28.303 19.812 1.00 108.47 ? 182 PHE A C   1 
ATOM   1250 O O   . PHE A 1 182 ? 42.219 28.512 19.641 1.00 94.45  ? 182 PHE A O   1 
ATOM   1251 C CB  . PHE A 1 182 ? 44.983 28.317 21.771 1.00 115.20 ? 182 PHE A CB  1 
ATOM   1252 C CG  . PHE A 1 182 ? 44.650 29.773 21.938 1.00 122.69 ? 182 PHE A CG  1 
ATOM   1253 C CD1 . PHE A 1 182 ? 43.572 30.167 22.712 1.00 127.72 ? 182 PHE A CD1 1 
ATOM   1254 C CD2 . PHE A 1 182 ? 45.417 30.748 21.323 1.00 123.40 ? 182 PHE A CD2 1 
ATOM   1255 C CE1 . PHE A 1 182 ? 43.262 31.505 22.869 1.00 128.80 ? 182 PHE A CE1 1 
ATOM   1256 C CE2 . PHE A 1 182 ? 45.113 32.089 21.476 1.00 126.02 ? 182 PHE A CE2 1 
ATOM   1257 C CZ  . PHE A 1 182 ? 44.035 32.467 22.250 1.00 127.78 ? 182 PHE A CZ  1 
ATOM   1258 N N   . PHE A 1 183 ? 44.354 28.732 18.970 1.00 117.51 ? 183 PHE A N   1 
ATOM   1259 C CA  . PHE A 1 183 ? 44.032 29.602 17.839 1.00 121.47 ? 183 PHE A CA  1 
ATOM   1260 C C   . PHE A 1 183 ? 42.851 29.130 16.993 1.00 118.00 ? 183 PHE A C   1 
ATOM   1261 O O   . PHE A 1 183 ? 41.991 29.928 16.623 1.00 118.93 ? 183 PHE A O   1 
ATOM   1262 C CB  . PHE A 1 183 ? 45.259 29.813 16.947 1.00 122.49 ? 183 PHE A CB  1 
ATOM   1263 C CG  . PHE A 1 183 ? 46.204 30.864 17.454 1.00 125.13 ? 183 PHE A CG  1 
ATOM   1264 C CD1 . PHE A 1 183 ? 45.788 32.177 17.590 1.00 130.09 ? 183 PHE A CD1 1 
ATOM   1265 C CD2 . PHE A 1 183 ? 47.509 30.544 17.783 1.00 124.98 ? 183 PHE A CD2 1 
ATOM   1266 C CE1 . PHE A 1 183 ? 46.652 33.150 18.054 1.00 131.02 ? 183 PHE A CE1 1 
ATOM   1267 C CE2 . PHE A 1 183 ? 48.378 31.512 18.246 1.00 127.27 ? 183 PHE A CE2 1 
ATOM   1268 C CZ  . PHE A 1 183 ? 47.949 32.816 18.382 1.00 129.30 ? 183 PHE A CZ  1 
ATOM   1269 N N   . ALA A 1 184 ? 42.811 27.837 16.688 1.00 115.32 ? 184 ALA A N   1 
ATOM   1270 C CA  . ALA A 1 184 ? 41.812 27.310 15.762 1.00 114.99 ? 184 ALA A CA  1 
ATOM   1271 C C   . ALA A 1 184 ? 40.589 26.715 16.455 1.00 113.50 ? 184 ALA A C   1 
ATOM   1272 O O   . ALA A 1 184 ? 39.452 27.018 16.091 1.00 114.68 ? 184 ALA A O   1 
ATOM   1273 C CB  . ALA A 1 184 ? 42.445 26.282 14.833 1.00 115.28 ? 184 ALA A CB  1 
ATOM   1274 N N   . CYS A 1 185 ? 40.826 25.869 17.450 1.00 110.36 ? 185 CYS A N   1 
ATOM   1275 C CA  . CYS A 1 185 ? 39.748 25.121 18.089 1.00 107.77 ? 185 CYS A CA  1 
ATOM   1276 C C   . CYS A 1 185 ? 39.145 25.837 19.295 1.00 112.11 ? 185 CYS A C   1 
ATOM   1277 O O   . CYS A 1 185 ? 38.263 25.298 19.962 1.00 119.85 ? 185 CYS A O   1 
ATOM   1278 C CB  . CYS A 1 185 ? 40.238 23.729 18.494 1.00 105.88 ? 185 CYS A CB  1 
ATOM   1279 S SG  . CYS A 1 185 ? 40.867 22.740 17.118 1.00 156.90 ? 185 CYS A SG  1 
ATOM   1280 N N   . VAL A 1 186 ? 39.619 27.047 19.574 1.00 107.07 ? 186 VAL A N   1 
ATOM   1281 C CA  . VAL A 1 186 ? 39.092 27.822 20.694 1.00 103.47 ? 186 VAL A CA  1 
ATOM   1282 C C   . VAL A 1 186 ? 38.904 29.294 20.336 1.00 106.51 ? 186 VAL A C   1 
ATOM   1283 O O   . VAL A 1 186 ? 37.823 29.852 20.519 1.00 101.34 ? 186 VAL A O   1 
ATOM   1284 C CB  . VAL A 1 186 ? 39.989 27.707 21.944 1.00 92.27  ? 186 VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 186 ? 39.531 28.683 23.016 1.00 91.56  ? 186 VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 186 ? 39.984 26.280 22.475 1.00 83.14  ? 186 VAL A CG2 1 
ATOM   1287 N N   . LEU A 1 187 ? 39.957 29.917 19.821 1.00 113.73 ? 187 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 187 ? 39.904 31.329 19.462 1.00 116.55 ? 187 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 187 ? 38.920 31.578 18.322 1.00 111.45 ? 187 LEU A C   1 
ATOM   1290 O O   . LEU A 1 187 ? 38.074 32.465 18.407 1.00 110.91 ? 187 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 187 ? 41.295 31.843 19.083 1.00 116.07 ? 187 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 187 ? 41.406 33.351 18.856 1.00 116.96 ? 187 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 187 ? 41.036 34.109 20.122 1.00 118.57 ? 187 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 187 ? 42.805 33.721 18.396 1.00 116.29 ? 187 LEU A CD2 1 
ATOM   1295 N N   . VAL A 1 188 ? 39.035 30.791 17.257 1.00 110.40 ? 188 VAL A N   1 
ATOM   1296 C CA  . VAL A 1 188 ? 38.140 30.926 16.111 1.00 117.74 ? 188 VAL A CA  1 
ATOM   1297 C C   . VAL A 1 188 ? 36.672 30.756 16.505 1.00 131.34 ? 188 VAL A C   1 
ATOM   1298 O O   . VAL A 1 188 ? 35.834 31.582 16.140 1.00 139.08 ? 188 VAL A O   1 
ATOM   1299 C CB  . VAL A 1 188 ? 38.499 29.938 14.980 1.00 114.38 ? 188 VAL A CB  1 
ATOM   1300 C CG1 . VAL A 1 188 ? 37.429 29.956 13.899 1.00 114.78 ? 188 VAL A CG1 1 
ATOM   1301 C CG2 . VAL A 1 188 ? 39.860 30.275 14.394 1.00 113.96 ? 188 VAL A CG2 1 
ATOM   1302 N N   . PRO A 1 189 ? 36.353 29.684 17.251 1.00 126.42 ? 189 PRO A N   1 
ATOM   1303 C CA  . PRO A 1 189 ? 34.972 29.498 17.709 1.00 120.05 ? 189 PRO A CA  1 
ATOM   1304 C C   . PRO A 1 189 ? 34.460 30.707 18.488 1.00 112.41 ? 189 PRO A C   1 
ATOM   1305 O O   . PRO A 1 189 ? 33.378 31.207 18.187 1.00 112.48 ? 189 PRO A O   1 
ATOM   1306 C CB  . PRO A 1 189 ? 35.073 28.279 18.628 1.00 120.25 ? 189 PRO A CB  1 
ATOM   1307 C CG  . PRO A 1 189 ? 36.238 27.518 18.105 1.00 118.56 ? 189 PRO A CG  1 
ATOM   1308 C CD  . PRO A 1 189 ? 37.217 28.555 17.639 1.00 120.47 ? 189 PRO A CD  1 
ATOM   1309 N N   . LEU A 1 190 ? 35.229 31.166 19.470 1.00 103.64 ? 190 LEU A N   1 
ATOM   1310 C CA  . LEU A 1 190 ? 34.848 32.335 20.258 1.00 98.73  ? 190 LEU A CA  1 
ATOM   1311 C C   . LEU A 1 190 ? 34.588 33.546 19.371 1.00 106.29 ? 190 LEU A C   1 
ATOM   1312 O O   . LEU A 1 190 ? 33.716 34.364 19.662 1.00 111.50 ? 190 LEU A O   1 
ATOM   1313 C CB  . LEU A 1 190 ? 35.925 32.663 21.292 1.00 97.00  ? 190 LEU A CB  1 
ATOM   1314 C CG  . LEU A 1 190 ? 36.041 31.704 22.477 1.00 102.23 ? 190 LEU A CG  1 
ATOM   1315 C CD1 . LEU A 1 190 ? 37.373 31.885 23.189 1.00 113.50 ? 190 LEU A CD1 1 
ATOM   1316 C CD2 . LEU A 1 190 ? 34.882 31.897 23.440 1.00 94.79  ? 190 LEU A CD2 1 
ATOM   1317 N N   . LEU A 1 191 ? 35.351 33.658 18.289 1.00 110.89 ? 191 LEU A N   1 
ATOM   1318 C CA  . LEU A 1 191 ? 35.161 34.745 17.336 1.00 116.12 ? 191 LEU A CA  1 
ATOM   1319 C C   . LEU A 1 191 ? 33.871 34.545 16.548 1.00 110.43 ? 191 LEU A C   1 
ATOM   1320 O O   . LEU A 1 191 ? 33.220 35.511 16.150 1.00 106.43 ? 191 LEU A O   1 
ATOM   1321 C CB  . LEU A 1 191 ? 36.362 34.858 16.392 1.00 117.01 ? 191 LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 191 ? 37.508 35.774 16.836 1.00 113.30 ? 191 LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 191 ? 37.084 37.235 16.776 1.00 115.01 ? 191 LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 191 ? 38.003 35.416 18.229 1.00 109.68 ? 191 LEU A CD2 1 
ATOM   1325 N N   . LEU A 1 192 ? 33.507 33.286 16.328 1.00 110.20 ? 192 LEU A N   1 
ATOM   1326 C CA  . LEU A 1 192 ? 32.247 32.955 15.673 1.00 116.38 ? 192 LEU A CA  1 
ATOM   1327 C C   . LEU A 1 192 ? 31.080 33.205 16.620 1.00 113.40 ? 192 LEU A C   1 
ATOM   1328 O O   . LEU A 1 192 ? 30.105 33.864 16.259 1.00 111.88 ? 192 LEU A O   1 
ATOM   1329 C CB  . LEU A 1 192 ? 32.246 31.495 15.214 1.00 122.17 ? 192 LEU A CB  1 
ATOM   1330 C CG  . LEU A 1 192 ? 33.209 31.133 14.083 1.00 124.72 ? 192 LEU A CG  1 
ATOM   1331 C CD1 . LEU A 1 192 ? 33.232 29.628 13.858 1.00 122.67 ? 192 LEU A CD1 1 
ATOM   1332 C CD2 . LEU A 1 192 ? 32.830 31.866 12.804 1.00 124.42 ? 192 LEU A CD2 1 
ATOM   1333 N N   . MET A 1 193 ? 31.189 32.674 17.833 1.00 108.99 ? 193 MET A N   1 
ATOM   1334 C CA  . MET A 1 193 ? 30.174 32.878 18.859 1.00 105.56 ? 193 MET A CA  1 
ATOM   1335 C C   . MET A 1 193 ? 29.918 34.363 19.080 1.00 115.46 ? 193 MET A C   1 
ATOM   1336 O O   . MET A 1 193 ? 28.769 34.804 19.129 1.00 118.34 ? 193 MET A O   1 
ATOM   1337 C CB  . MET A 1 193 ? 30.591 32.208 20.169 1.00 90.79  ? 193 MET A CB  1 
ATOM   1338 C CG  . MET A 1 193 ? 30.469 30.694 20.148 1.00 85.78  ? 193 MET A CG  1 
ATOM   1339 S SD  . MET A 1 193 ? 30.935 29.919 21.708 1.00 119.50 ? 193 MET A SD  1 
ATOM   1340 C CE  . MET A 1 193 ? 32.720 29.944 21.581 1.00 405.84 ? 193 MET A CE  1 
ATOM   1341 N N   . LEU A 1 194 ? 30.993 35.131 19.214 1.00 116.40 ? 194 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 194 ? 30.878 36.576 19.348 1.00 119.25 ? 194 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 194 ? 30.140 37.149 18.144 1.00 115.55 ? 194 LEU A C   1 
ATOM   1344 O O   . LEU A 1 194 ? 29.229 37.963 18.290 1.00 108.00 ? 194 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 194 ? 32.261 37.216 19.471 1.00 118.44 ? 194 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 194 ? 32.287 38.741 19.595 1.00 122.63 ? 194 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 194 ? 31.523 39.192 20.830 1.00 128.64 ? 194 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 194 ? 33.717 39.252 19.632 1.00 122.17 ? 194 LEU A CD2 1 
ATOM   1349 N N   . GLY A 1 195 ? 30.538 36.710 16.954 1.00 115.28 ? 195 GLY A N   1 
ATOM   1350 C CA  . GLY A 1 195 ? 29.930 37.173 15.721 1.00 114.06 ? 195 GLY A CA  1 
ATOM   1351 C C   . GLY A 1 195 ? 28.445 36.879 15.655 1.00 115.22 ? 195 GLY A C   1 
ATOM   1352 O O   . GLY A 1 195 ? 27.677 37.654 15.085 1.00 117.44 ? 195 GLY A O   1 
ATOM   1353 N N   . VAL A 1 196 ? 28.042 35.753 16.236 1.00 114.29 ? 196 VAL A N   1 
ATOM   1354 C CA  . VAL A 1 196 ? 26.634 35.372 16.270 1.00 109.54 ? 196 VAL A CA  1 
ATOM   1355 C C   . VAL A 1 196 ? 25.835 36.325 17.150 1.00 107.92 ? 196 VAL A C   1 
ATOM   1356 O O   . VAL A 1 196 ? 24.893 36.967 16.686 1.00 102.86 ? 196 VAL A O   1 
ATOM   1357 C CB  . VAL A 1 196 ? 26.447 33.930 16.780 1.00 104.87 ? 196 VAL A CB  1 
ATOM   1358 C CG1 . VAL A 1 196 ? 24.983 33.663 17.088 1.00 103.94 ? 196 VAL A CG1 1 
ATOM   1359 C CG2 . VAL A 1 196 ? 26.972 32.934 15.759 1.00 101.67 ? 196 VAL A CG2 1 
ATOM   1360 N N   . TYR A 1 197 ? 26.218 36.417 18.420 1.00 113.70 ? 197 TYR A N   1 
ATOM   1361 C CA  . TYR A 1 197 ? 25.554 37.318 19.356 1.00 121.22 ? 197 TYR A CA  1 
ATOM   1362 C C   . TYR A 1 197 ? 25.529 38.752 18.836 1.00 122.95 ? 197 TYR A C   1 
ATOM   1363 O O   . TYR A 1 197 ? 24.717 39.566 19.274 1.00 122.93 ? 197 TYR A O   1 
ATOM   1364 C CB  . TYR A 1 197 ? 26.230 37.267 20.728 1.00 128.52 ? 197 TYR A CB  1 
ATOM   1365 C CG  . TYR A 1 197 ? 25.959 35.996 21.501 1.00 130.79 ? 197 TYR A CG  1 
ATOM   1366 C CD1 . TYR A 1 197 ? 24.789 35.843 22.233 1.00 133.71 ? 197 TYR A CD1 1 
ATOM   1367 C CD2 . TYR A 1 197 ? 26.874 34.951 21.503 1.00 127.78 ? 197 TYR A CD2 1 
ATOM   1368 C CE1 . TYR A 1 197 ? 24.536 34.684 22.942 1.00 134.08 ? 197 TYR A CE1 1 
ATOM   1369 C CE2 . TYR A 1 197 ? 26.629 33.788 22.211 1.00 128.16 ? 197 TYR A CE2 1 
ATOM   1370 C CZ  . TYR A 1 197 ? 25.459 33.661 22.929 1.00 131.84 ? 197 TYR A CZ  1 
ATOM   1371 O OH  . TYR A 1 197 ? 25.210 32.507 23.635 1.00 132.06 ? 197 TYR A OH  1 
ATOM   1372 N N   . LEU A 1 198 ? 26.425 39.057 17.903 1.00 126.15 ? 198 LEU A N   1 
ATOM   1373 C CA  . LEU A 1 198 ? 26.453 40.373 17.277 1.00 128.91 ? 198 LEU A CA  1 
ATOM   1374 C C   . LEU A 1 198 ? 25.199 40.598 16.445 1.00 124.83 ? 198 LEU A C   1 
ATOM   1375 O O   . LEU A 1 198 ? 24.552 41.639 16.549 1.00 122.02 ? 198 LEU A O   1 
ATOM   1376 C CB  . LEU A 1 198 ? 27.696 40.530 16.399 1.00 127.23 ? 198 LEU A CB  1 
ATOM   1377 C CG  . LEU A 1 198 ? 29.025 40.733 17.125 1.00 124.42 ? 198 LEU A CG  1 
ATOM   1378 C CD1 . LEU A 1 198 ? 30.175 40.760 16.132 1.00 127.32 ? 198 LEU A CD1 1 
ATOM   1379 C CD2 . LEU A 1 198 ? 28.991 42.009 17.951 1.00 120.73 ? 198 LEU A CD2 1 
ATOM   1380 N N   . ARG A 1 199 ? 24.862 39.613 15.618 1.00 125.56 ? 199 ARG A N   1 
ATOM   1381 C CA  . ARG A 1 199 ? 23.680 39.693 14.770 1.00 133.36 ? 199 ARG A CA  1 
ATOM   1382 C C   . ARG A 1 199 ? 22.409 39.526 15.597 1.00 131.06 ? 199 ARG A C   1 
ATOM   1383 O O   . ARG A 1 199 ? 21.412 40.210 15.367 1.00 131.49 ? 199 ARG A O   1 
ATOM   1384 C CB  . ARG A 1 199 ? 23.734 38.627 13.673 1.00 141.17 ? 199 ARG A CB  1 
ATOM   1385 C CG  . ARG A 1 199 ? 25.021 38.624 12.863 1.00 150.25 ? 199 ARG A CG  1 
ATOM   1386 C CD  . ARG A 1 199 ? 25.281 39.976 12.217 1.00 162.64 ? 199 ARG A CD  1 
ATOM   1387 N NE  . ARG A 1 199 ? 26.432 39.939 11.316 1.00 170.44 ? 199 ARG A NE  1 
ATOM   1388 C CZ  . ARG A 1 199 ? 27.692 40.106 11.703 1.00 174.25 ? 199 ARG A CZ  1 
ATOM   1389 N NH1 . ARG A 1 199 ? 27.974 40.322 12.981 1.00 177.73 ? 199 ARG A NH1 1 
ATOM   1390 N NH2 . ARG A 1 199 ? 28.673 40.057 10.812 1.00 172.73 ? 199 ARG A NH2 1 
ATOM   1391 N N   . ILE A 1 200 ? 22.454 38.610 16.560 1.00 124.76 ? 200 ILE A N   1 
ATOM   1392 C CA  . ILE A 1 200 ? 21.321 38.362 17.444 1.00 120.83 ? 200 ILE A CA  1 
ATOM   1393 C C   . ILE A 1 200 ? 20.798 39.656 18.056 1.00 130.42 ? 200 ILE A C   1 
ATOM   1394 O O   . ILE A 1 200 ? 19.662 40.058 17.805 1.00 140.75 ? 200 ILE A O   1 
ATOM   1395 C CB  . ILE A 1 200 ? 21.689 37.385 18.577 1.00 114.16 ? 200 ILE A CB  1 
ATOM   1396 C CG1 . ILE A 1 200 ? 21.936 35.986 18.014 1.00 113.35 ? 200 ILE A CG1 1 
ATOM   1397 C CG2 . ILE A 1 200 ? 20.589 37.342 19.626 1.00 111.78 ? 200 ILE A CG2 1 
ATOM   1398 C CD1 . ILE A 1 200 ? 22.220 34.943 19.074 1.00 116.56 ? 200 ILE A CD1 1 
ATOM   1399 N N   . PHE A 1 201 ? 21.635 40.309 18.854 1.00 129.36 ? 201 PHE A N   1 
ATOM   1400 C CA  . PHE A 1 201 ? 21.238 41.537 19.533 1.00 140.29 ? 201 PHE A CA  1 
ATOM   1401 C C   . PHE A 1 201 ? 21.114 42.714 18.570 1.00 145.37 ? 201 PHE A C   1 
ATOM   1402 O O   . PHE A 1 201 ? 20.586 43.766 18.929 1.00 147.91 ? 201 PHE A O   1 
ATOM   1403 C CB  . PHE A 1 201 ? 22.218 41.866 20.660 1.00 147.34 ? 201 PHE A CB  1 
ATOM   1404 C CG  . PHE A 1 201 ? 22.166 40.896 21.805 1.00 153.10 ? 201 PHE A CG  1 
ATOM   1405 C CD1 . PHE A 1 201 ? 21.509 41.226 22.979 1.00 157.41 ? 201 PHE A CD1 1 
ATOM   1406 C CD2 . PHE A 1 201 ? 22.762 39.651 21.704 1.00 154.56 ? 201 PHE A CD2 1 
ATOM   1407 C CE1 . PHE A 1 201 ? 21.456 40.334 24.034 1.00 159.20 ? 201 PHE A CE1 1 
ATOM   1408 C CE2 . PHE A 1 201 ? 22.711 38.755 22.755 1.00 157.15 ? 201 PHE A CE2 1 
ATOM   1409 C CZ  . PHE A 1 201 ? 22.057 39.097 23.921 1.00 159.08 ? 201 PHE A CZ  1 
ATOM   1410 N N   . ALA A 1 202 ? 21.598 42.532 17.346 1.00 147.27 ? 202 ALA A N   1 
ATOM   1411 C CA  . ALA A 1 202 ? 21.482 43.566 16.324 1.00 151.00 ? 202 ALA A CA  1 
ATOM   1412 C C   . ALA A 1 202 ? 20.087 43.558 15.713 1.00 151.36 ? 202 ALA A C   1 
ATOM   1413 O O   . ALA A 1 202 ? 19.437 44.598 15.611 1.00 156.45 ? 202 ALA A O   1 
ATOM   1414 C CB  . ALA A 1 202 ? 22.534 43.373 15.245 1.00 150.09 ? 202 ALA A CB  1 
ATOM   1415 N N   . ALA A 1 203 ? 19.631 42.374 15.315 1.00 147.93 ? 203 ALA A N   1 
ATOM   1416 C CA  . ALA A 1 203 ? 18.314 42.221 14.710 1.00 149.21 ? 203 ALA A CA  1 
ATOM   1417 C C   . ALA A 1 203 ? 17.208 42.264 15.760 1.00 154.69 ? 203 ALA A C   1 
ATOM   1418 O O   . ALA A 1 203 ? 16.088 42.685 15.475 1.00 156.74 ? 203 ALA A O   1 
ATOM   1419 C CB  . ALA A 1 203 ? 18.243 40.924 13.916 1.00 143.12 ? 203 ALA A CB  1 
ATOM   1420 N N   . ALA A 1 204 ? 17.529 41.827 16.973 1.00 157.18 ? 204 ALA A N   1 
ATOM   1421 C CA  . ALA A 1 204 ? 16.558 41.808 18.062 1.00 162.55 ? 204 ALA A CA  1 
ATOM   1422 C C   . ALA A 1 204 ? 16.002 43.202 18.326 1.00 169.14 ? 204 ALA A C   1 
ATOM   1423 O O   . ALA A 1 204 ? 14.797 43.377 18.507 1.00 170.30 ? 204 ALA A O   1 
ATOM   1424 C CB  . ALA A 1 204 ? 17.186 41.237 19.324 1.00 163.06 ? 204 ALA A CB  1 
ATOM   1425 N N   . ARG A 1 205 ? 16.889 44.192 18.348 1.00 172.99 ? 205 ARG A N   1 
ATOM   1426 C CA  . ARG A 1 205 ? 16.486 45.574 18.574 1.00 178.01 ? 205 ARG A CA  1 
ATOM   1427 C C   . ARG A 1 205 ? 15.798 46.152 17.341 1.00 175.93 ? 205 ARG A C   1 
ATOM   1428 O O   . ARG A 1 205 ? 15.050 47.125 17.435 1.00 176.67 ? 205 ARG A O   1 
ATOM   1429 C CB  . ARG A 1 205 ? 17.689 46.431 18.976 1.00 183.51 ? 205 ARG A CB  1 
ATOM   1430 C CG  . ARG A 1 205 ? 18.094 46.298 20.442 1.00 191.35 ? 205 ARG A CG  1 
ATOM   1431 C CD  . ARG A 1 205 ? 18.368 44.850 20.825 1.00 195.83 ? 205 ARG A CD  1 
ATOM   1432 N NE  . ARG A 1 205 ? 18.738 44.706 22.231 1.00 202.02 ? 205 ARG A NE  1 
ATOM   1433 C CZ  . ARG A 1 205 ? 19.990 44.657 22.674 1.00 204.21 ? 205 ARG A CZ  1 
ATOM   1434 N NH1 . ARG A 1 205 ? 21.002 44.742 21.820 1.00 202.25 ? 205 ARG A NH1 1 
ATOM   1435 N NH2 . ARG A 1 205 ? 20.233 44.523 23.971 1.00 206.89 ? 205 ARG A NH2 1 
ATOM   1436 N N   . ARG A 1 206 ? 16.055 45.547 16.185 1.00 173.56 ? 206 ARG A N   1 
ATOM   1437 C CA  . ARG A 1 206 ? 15.382 45.940 14.954 1.00 175.65 ? 206 ARG A CA  1 
ATOM   1438 C C   . ARG A 1 206 ? 13.920 45.520 15.019 1.00 174.15 ? 206 ARG A C   1 
ATOM   1439 O O   . ARG A 1 206 ? 13.035 46.235 14.549 1.00 175.90 ? 206 ARG A O   1 
ATOM   1440 C CB  . ARG A 1 206 ? 16.057 45.302 13.740 1.00 176.81 ? 206 ARG A CB  1 
ATOM   1441 C CG  . ARG A 1 206 ? 17.511 45.699 13.557 1.00 184.11 ? 206 ARG A CG  1 
ATOM   1442 C CD  . ARG A 1 206 ? 18.150 44.931 12.412 1.00 188.77 ? 206 ARG A CD  1 
ATOM   1443 N NE  . ARG A 1 206 ? 19.583 45.187 12.311 1.00 193.08 ? 206 ARG A NE  1 
ATOM   1444 C CZ  . ARG A 1 206 ? 20.392 44.578 11.450 1.00 193.03 ? 206 ARG A CZ  1 
ATOM   1445 N NH1 . ARG A 1 206 ? 19.908 43.672 10.611 1.00 191.92 ? 206 ARG A NH1 1 
ATOM   1446 N NH2 . ARG A 1 206 ? 21.684 44.873 11.428 1.00 193.95 ? 206 ARG A NH2 1 
ATOM   1447 N N   . GLN A 1 207 ? 13.676 44.353 15.606 1.00 170.30 ? 207 GLN A N   1 
ATOM   1448 C CA  . GLN A 1 207 ? 12.321 43.856 15.796 1.00 168.83 ? 207 GLN A CA  1 
ATOM   1449 C C   . GLN A 1 207 ? 11.530 44.827 16.662 1.00 172.15 ? 207 GLN A C   1 
ATOM   1450 O O   . GLN A 1 207 ? 10.414 45.213 16.319 1.00 176.61 ? 207 GLN A O   1 
ATOM   1451 C CB  . GLN A 1 207 ? 12.346 42.475 16.453 1.00 169.91 ? 207 GLN A CB  1 
ATOM   1452 C CG  . GLN A 1 207 ? 13.207 41.451 15.729 1.00 170.28 ? 207 GLN A CG  1 
ATOM   1453 C CD  . GLN A 1 207 ? 12.657 41.081 14.366 1.00 171.84 ? 207 GLN A CD  1 
ATOM   1454 O OE1 . GLN A 1 207 ? 11.535 41.448 14.015 1.00 179.46 ? 207 GLN A OE1 1 
ATOM   1455 N NE2 . GLN A 1 207 ? 13.445 40.346 13.591 1.00 164.15 ? 207 GLN A NE2 1 
ATOM   1456 N N   . LEU A 1 208 ? 12.120 45.222 17.786 1.00 174.80 ? 208 LEU A N   1 
ATOM   1457 C CA  . LEU A 1 208 ? 11.490 46.172 18.694 1.00 182.18 ? 208 LEU A CA  1 
ATOM   1458 C C   . LEU A 1 208 ? 11.230 47.500 17.993 1.00 185.89 ? 208 LEU A C   1 
ATOM   1459 O O   . LEU A 1 208 ? 10.327 48.247 18.370 1.00 187.68 ? 208 LEU A O   1 
ATOM   1460 C CB  . LEU A 1 208 ? 12.368 46.398 19.926 1.00 186.50 ? 208 LEU A CB  1 
ATOM   1461 C CG  . LEU A 1 208 ? 12.718 45.160 20.754 1.00 186.61 ? 208 LEU A CG  1 
ATOM   1462 C CD1 . LEU A 1 208 ? 13.696 45.516 21.864 1.00 187.21 ? 208 LEU A CD1 1 
ATOM   1463 C CD2 . LEU A 1 208 ? 11.462 44.523 21.326 1.00 189.57 ? 208 LEU A CD2 1 
ATOM   1464 N N   . LYS A 1 209 ? 12.029 47.789 16.971 1.00 188.36 ? 209 LYS A N   1 
ATOM   1465 C CA  . LYS A 1 209 ? 11.887 49.025 16.212 1.00 192.33 ? 209 LYS A CA  1 
ATOM   1466 C C   . LYS A 1 209 ? 10.730 48.926 15.222 1.00 190.40 ? 209 LYS A C   1 
ATOM   1467 O O   . LYS A 1 209 ? 10.027 49.906 14.974 1.00 188.25 ? 209 LYS A O   1 
ATOM   1468 C CB  . LYS A 1 209 ? 13.188 49.356 15.478 1.00 191.63 ? 209 LYS A CB  1 
ATOM   1469 C CG  . LYS A 1 209 ? 13.168 50.692 14.754 1.00 194.63 ? 209 LYS A CG  1 
ATOM   1470 C CD  . LYS A 1 209 ? 14.512 50.994 14.113 1.00 193.83 ? 209 LYS A CD  1 
ATOM   1471 C CE  . LYS A 1 209 ? 14.502 52.351 13.428 1.00 196.53 ? 209 LYS A CE  1 
ATOM   1472 N NZ  . LYS A 1 209 ? 15.819 52.677 12.816 1.00 195.78 ? 209 LYS A NZ  1 
ATOM   1473 N N   . GLN A 1 210 ? 10.538 47.737 14.660 1.00 191.00 ? 210 GLN A N   1 
ATOM   1474 C CA  . GLN A 1 210 ? 9.443  47.501 13.728 1.00 196.31 ? 210 GLN A CA  1 
ATOM   1475 C C   . GLN A 1 210 ? 8.114  47.402 14.468 1.00 204.70 ? 210 GLN A C   1 
ATOM   1476 O O   . GLN A 1 210 ? 7.066  47.767 13.935 1.00 209.38 ? 210 GLN A O   1 
ATOM   1477 C CB  . GLN A 1 210 ? 9.689  46.228 12.917 1.00 194.46 ? 210 GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 210 ? 10.912 46.290 12.018 1.00 195.38 ? 210 GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 210 ? 11.104 45.022 11.210 1.00 194.16 ? 210 GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 210 ? 10.340 44.065 11.343 1.00 193.67 ? 210 GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 210 ? 12.128 45.008 10.365 1.00 192.93 ? 210 GLN A NE2 1 
ATOM   1482 N N   . MET A 1 211 ? 8.165  46.904 15.699 1.00 206.76 ? 211 MET A N   1 
ATOM   1483 C CA  . MET A 1 211 ? 6.971  46.776 16.524 1.00 209.87 ? 211 MET A CA  1 
ATOM   1484 C C   . MET A 1 211 ? 6.695  48.070 17.278 1.00 217.96 ? 211 MET A C   1 
ATOM   1485 O O   . MET A 1 211 ? 5.833  48.119 18.154 1.00 223.13 ? 211 MET A O   1 
ATOM   1486 C CB  . MET A 1 211 ? 7.121  45.621 17.514 1.00 205.74 ? 211 MET A CB  1 
ATOM   1487 C CG  . MET A 1 211 ? 7.369  44.273 16.864 1.00 200.54 ? 211 MET A CG  1 
ATOM   1488 S SD  . MET A 1 211 ? 7.443  42.948 18.081 1.00 153.49 ? 211 MET A SD  1 
ATOM   1489 C CE  . MET A 1 211 ? 8.758  43.541 19.141 1.00 430.58 ? 211 MET A CE  1 
ATOM   1490 N N   . GLU A 1 212 ? 7.437  49.116 16.934 1.00 225.09 ? 212 GLU A N   1 
ATOM   1491 C CA  . GLU A 1 212 ? 7.258  50.418 17.561 1.00 226.17 ? 212 GLU A CA  1 
ATOM   1492 C C   . GLU A 1 212 ? 6.362  51.302 16.701 1.00 223.44 ? 212 GLU A C   1 
ATOM   1493 O O   . GLU A 1 212 ? 5.692  52.204 17.205 1.00 222.52 ? 212 GLU A O   1 
ATOM   1494 C CB  . GLU A 1 212 ? 8.612  51.092 17.786 1.00 231.50 ? 212 GLU A CB  1 
ATOM   1495 C CG  . GLU A 1 212 ? 8.529  52.435 18.489 1.00 233.15 ? 212 GLU A CG  1 
ATOM   1496 C CD  . GLU A 1 212 ? 9.895  53.031 18.765 1.00 234.30 ? 212 GLU A CD  1 
ATOM   1497 O OE1 . GLU A 1 212 ? 10.907 52.359 18.476 1.00 234.39 ? 212 GLU A OE1 1 
ATOM   1498 O OE2 . GLU A 1 212 ? 9.956  54.171 19.271 1.00 234.92 ? 212 GLU A OE2 1 
ATOM   1499 N N   . SER A 1 213 ? 6.353  51.033 15.400 1.00 222.86 ? 213 SER A N   1 
ATOM   1500 C CA  . SER A 1 213 ? 5.515  51.777 14.468 1.00 222.37 ? 213 SER A CA  1 
ATOM   1501 C C   . SER A 1 213 ? 4.343  50.923 13.996 1.00 223.23 ? 213 SER A C   1 
ATOM   1502 O O   . SER A 1 213 ? 3.983  50.942 12.820 1.00 227.17 ? 213 SER A O   1 
ATOM   1503 C CB  . SER A 1 213 ? 6.337  52.248 13.267 1.00 222.83 ? 213 SER A CB  1 
ATOM   1504 O OG  . SER A 1 213 ? 7.403  53.087 13.675 1.00 225.58 ? 213 SER A OG  1 
ATOM   1505 N N   . GLN A 1 214 ? 3.752  50.176 14.923 1.00 219.67 ? 214 GLN A N   1 
ATOM   1506 C CA  . GLN A 1 214 ? 2.635  49.296 14.600 1.00 216.90 ? 214 GLN A CA  1 
ATOM   1507 C C   . GLN A 1 214 ? 1.309  49.874 15.085 1.00 219.03 ? 214 GLN A C   1 
ATOM   1508 O O   . GLN A 1 214 ? 1.203  50.327 16.225 1.00 222.58 ? 214 GLN A O   1 
ATOM   1509 C CB  . GLN A 1 214 ? 2.857  47.908 15.204 1.00 212.96 ? 214 GLN A CB  1 
ATOM   1510 C CG  . GLN A 1 214 ? 3.087  47.917 16.706 1.00 210.04 ? 214 GLN A CG  1 
ATOM   1511 C CD  . GLN A 1 214 ? 3.293  46.527 17.274 1.00 209.13 ? 214 GLN A CD  1 
ATOM   1512 O OE1 . GLN A 1 214 ? 3.252  45.535 16.547 1.00 211.87 ? 214 GLN A OE1 1 
ATOM   1513 N NE2 . GLN A 1 214 ? 3.515  46.449 18.581 1.00 205.95 ? 214 GLN A NE2 1 
ATOM   1514 N N   . PRO A 1 215 ? 0.292  49.864 14.210 1.00 214.93 ? 215 PRO A N   1 
ATOM   1515 C CA  . PRO A 1 215 ? -1.052 50.364 14.520 1.00 208.32 ? 215 PRO A CA  1 
ATOM   1516 C C   . PRO A 1 215 ? -1.809 49.450 15.481 1.00 207.31 ? 215 PRO A C   1 
ATOM   1517 O O   . PRO A 1 215 ? -3.039 49.467 15.496 1.00 211.18 ? 215 PRO A O   1 
ATOM   1518 C CB  . PRO A 1 215 ? -1.750 50.367 13.153 1.00 206.96 ? 215 PRO A CB  1 
ATOM   1519 C CG  . PRO A 1 215 ? -0.648 50.294 12.143 1.00 210.90 ? 215 PRO A CG  1 
ATOM   1520 C CD  . PRO A 1 215 ? 0.421  49.484 12.795 1.00 214.72 ? 215 PRO A CD  1 
ATOM   1521 N N   . LEU A 1 216 ? -1.082 48.664 16.268 1.00 204.20 ? 216 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 216 ? -1.706 47.754 17.223 1.00 201.81 ? 216 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 216 ? -0.766 47.418 18.378 1.00 201.81 ? 216 LEU A C   1 
ATOM   1524 O O   . LEU A 1 216 ? 0.453  47.427 18.214 1.00 207.79 ? 216 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 216 ? -2.182 46.477 16.520 1.00 201.70 ? 216 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 216 ? -1.189 45.716 15.636 1.00 205.10 ? 216 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 216 ? -0.161 44.965 16.471 1.00 205.03 ? 216 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 216 ? -1.931 44.753 14.723 1.00 205.61 ? 216 LEU A CD2 1 
ATOM   1529 N N   . PRO A 1 217 ? -1.337 47.128 19.557 1.00 193.88 ? 217 PRO A N   1 
ATOM   1530 C CA  . PRO A 1 217 ? -0.558 46.781 20.751 1.00 191.62 ? 217 PRO A CA  1 
ATOM   1531 C C   . PRO A 1 217 ? 0.352  45.579 20.516 1.00 186.90 ? 217 PRO A C   1 
ATOM   1532 O O   . PRO A 1 217 ? 1.572  45.734 20.447 1.00 188.02 ? 217 PRO A O   1 
ATOM   1533 C CB  . PRO A 1 217 ? -1.637 46.430 21.778 1.00 190.12 ? 217 PRO A CB  1 
ATOM   1534 C CG  . PRO A 1 217 ? -2.841 47.176 21.330 1.00 188.06 ? 217 PRO A CG  1 
ATOM   1535 C CD  . PRO A 1 217 ? -2.783 47.168 19.833 1.00 188.66 ? 217 PRO A CD  1 
ATOM   1536 N N   . GLY A 1 218 ? -0.241 44.395 20.397 1.00 179.06 ? 218 GLY A N   1 
ATOM   1537 C CA  . GLY A 1 218 ? 0.514  43.179 20.161 1.00 171.83 ? 218 GLY A CA  1 
ATOM   1538 C C   . GLY A 1 218 ? 1.642  42.978 21.154 1.00 165.82 ? 218 GLY A C   1 
ATOM   1539 O O   . GLY A 1 218 ? 2.794  42.785 20.767 1.00 165.40 ? 218 GLY A O   1 
ATOM   1540 N N   . GLU A 1 219 ? 1.309  43.025 22.439 1.00 163.72 ? 219 GLU A N   1 
ATOM   1541 C CA  . GLU A 1 219 ? 2.300  42.842 23.493 1.00 166.39 ? 219 GLU A CA  1 
ATOM   1542 C C   . GLU A 1 219 ? 2.783  41.398 23.561 1.00 167.83 ? 219 GLU A C   1 
ATOM   1543 O O   . GLU A 1 219 ? 3.802  41.105 24.186 1.00 170.98 ? 219 GLU A O   1 
ATOM   1544 C CB  . GLU A 1 219 ? 1.738  43.279 24.846 1.00 166.93 ? 219 GLU A CB  1 
ATOM   1545 C CG  . GLU A 1 219 ? 1.425  44.761 24.921 1.00 169.71 ? 219 GLU A CG  1 
ATOM   1546 C CD  . GLU A 1 219 ? 2.630  45.622 24.603 1.00 173.72 ? 219 GLU A CD  1 
ATOM   1547 O OE1 . GLU A 1 219 ? 2.460  46.659 23.927 1.00 174.87 ? 219 GLU A OE1 1 
ATOM   1548 O OE2 . GLU A 1 219 ? 3.749  45.259 25.023 1.00 174.87 ? 219 GLU A OE2 1 
ATOM   1549 N N   . ARG A 1 220 ? 2.046  40.500 22.916 1.00 163.01 ? 220 ARG A N   1 
ATOM   1550 C CA  . ARG A 1 220 ? 2.446  39.101 22.844 1.00 159.26 ? 220 ARG A CA  1 
ATOM   1551 C C   . ARG A 1 220 ? 3.797  38.960 22.152 1.00 163.96 ? 220 ARG A C   1 
ATOM   1552 O O   . ARG A 1 220 ? 4.664  38.215 22.608 1.00 160.42 ? 220 ARG A O   1 
ATOM   1553 C CB  . ARG A 1 220 ? 1.384  38.274 22.117 1.00 146.91 ? 220 ARG A CB  1 
ATOM   1554 C CG  . ARG A 1 220 ? 0.311  37.718 23.035 1.00 137.71 ? 220 ARG A CG  1 
ATOM   1555 C CD  . ARG A 1 220 ? 0.882  36.637 23.938 1.00 132.64 ? 220 ARG A CD  1 
ATOM   1556 N NE  . ARG A 1 220 ? -0.027 36.286 25.024 1.00 127.41 ? 220 ARG A NE  1 
ATOM   1557 C CZ  . ARG A 1 220 ? 0.040  36.802 26.247 1.00 123.99 ? 220 ARG A CZ  1 
ATOM   1558 N NH1 . ARG A 1 220 ? 0.977  37.692 26.540 1.00 123.32 ? 220 ARG A NH1 1 
ATOM   1559 N NH2 . ARG A 1 220 ? -0.827 36.428 27.177 1.00 122.50 ? 220 ARG A NH2 1 
ATOM   1560 N N   . ALA A 1 221 ? 3.972  39.685 21.053 1.00 163.83 ? 221 ALA A N   1 
ATOM   1561 C CA  . ALA A 1 221 ? 5.225  39.657 20.310 1.00 162.49 ? 221 ALA A CA  1 
ATOM   1562 C C   . ALA A 1 221 ? 6.352  40.272 21.129 1.00 167.25 ? 221 ALA A C   1 
ATOM   1563 O O   . ALA A 1 221 ? 7.435  39.699 21.238 1.00 166.48 ? 221 ALA A O   1 
ATOM   1564 C CB  . ALA A 1 221 ? 5.072  40.383 18.984 1.00 167.78 ? 221 ALA A CB  1 
ATOM   1565 N N   . ARG A 1 222 ? 6.091  41.441 21.706 1.00 176.39 ? 222 ARG A N   1 
ATOM   1566 C CA  . ARG A 1 222 ? 7.087  42.131 22.517 1.00 181.95 ? 222 ARG A CA  1 
ATOM   1567 C C   . ARG A 1 222 ? 7.524  41.290 23.713 1.00 176.52 ? 222 ARG A C   1 
ATOM   1568 O O   . ARG A 1 222 ? 8.710  41.015 23.887 1.00 174.70 ? 222 ARG A O   1 
ATOM   1569 C CB  . ARG A 1 222 ? 6.557  43.484 22.994 1.00 193.71 ? 222 ARG A CB  1 
ATOM   1570 C CG  . ARG A 1 222 ? 6.485  44.545 21.910 1.00 210.33 ? 222 ARG A CG  1 
ATOM   1571 C CD  . ARG A 1 222 ? 6.047  45.881 22.486 1.00 223.54 ? 222 ARG A CD  1 
ATOM   1572 N NE  . ARG A 1 222 ? 6.092  46.953 21.496 1.00 238.15 ? 222 ARG A NE  1 
ATOM   1573 C CZ  . ARG A 1 222 ? 5.757  48.214 21.747 1.00 247.03 ? 222 ARG A CZ  1 
ATOM   1574 N NH1 . ARG A 1 222 ? 5.350  48.565 22.959 1.00 246.37 ? 222 ARG A NH1 1 
ATOM   1575 N NH2 . ARG A 1 222 ? 5.829  49.126 20.787 1.00 254.90 ? 222 ARG A NH2 1 
ATOM   1576 N N   . SER A 1 223 ? 6.560  40.885 24.533 1.00 174.66 ? 223 SER A N   1 
ATOM   1577 C CA  . SER A 1 223 ? 6.852  40.108 25.732 1.00 167.85 ? 223 SER A CA  1 
ATOM   1578 C C   . SER A 1 223 ? 7.616  38.829 25.404 1.00 164.33 ? 223 SER A C   1 
ATOM   1579 O O   . SER A 1 223 ? 8.616  38.513 26.047 1.00 165.34 ? 223 SER A O   1 
ATOM   1580 C CB  . SER A 1 223 ? 5.562  39.779 26.484 1.00 168.23 ? 223 SER A CB  1 
ATOM   1581 O OG  . SER A 1 223 ? 4.904  40.964 26.896 1.00 174.16 ? 223 SER A OG  1 
ATOM   1582 N N   . THR A 1 224 ? 7.141  38.098 24.401 1.00 162.23 ? 224 THR A N   1 
ATOM   1583 C CA  . THR A 1 224 ? 7.799  36.869 23.972 1.00 155.62 ? 224 THR A CA  1 
ATOM   1584 C C   . THR A 1 224 ? 9.215  37.147 23.479 1.00 147.51 ? 224 THR A C   1 
ATOM   1585 O O   . THR A 1 224 ? 10.165 36.468 23.872 1.00 141.92 ? 224 THR A O   1 
ATOM   1586 C CB  . THR A 1 224 ? 7.005  36.161 22.858 1.00 159.38 ? 224 THR A CB  1 
ATOM   1587 O OG1 . THR A 1 224 ? 5.713  35.787 23.352 1.00 156.93 ? 224 THR A OG1 1 
ATOM   1588 C CG2 . THR A 1 224 ? 7.741  34.916 22.386 1.00 157.75 ? 224 THR A CG2 1 
ATOM   1589 N N   . LEU A 1 225 ? 9.350  38.152 22.620 1.00 143.06 ? 225 LEU A N   1 
ATOM   1590 C CA  . LEU A 1 225 ? 10.649 38.526 22.072 1.00 131.04 ? 225 LEU A CA  1 
ATOM   1591 C C   . LEU A 1 225 ? 11.624 38.903 23.180 1.00 124.06 ? 225 LEU A C   1 
ATOM   1592 O O   . LEU A 1 225 ? 12.736 38.384 23.239 1.00 122.48 ? 225 LEU A O   1 
ATOM   1593 C CB  . LEU A 1 225 ? 10.503 39.689 21.091 1.00 130.74 ? 225 LEU A CB  1 
ATOM   1594 C CG  . LEU A 1 225 ? 11.761 40.082 20.317 1.00 125.65 ? 225 LEU A CG  1 
ATOM   1595 C CD1 . LEU A 1 225 ? 12.153 38.974 19.354 1.00 122.76 ? 225 LEU A CD1 1 
ATOM   1596 C CD2 . LEU A 1 225 ? 11.542 41.386 19.573 1.00 107.68 ? 225 LEU A CD2 1 
ATOM   1597 N N   . GLN A 1 226 ? 11.199 39.807 24.056 1.00 129.78 ? 226 GLN A N   1 
ATOM   1598 C CA  . GLN A 1 226 ? 12.039 40.269 25.155 1.00 140.95 ? 226 GLN A CA  1 
ATOM   1599 C C   . GLN A 1 226 ? 12.513 39.119 26.036 1.00 154.01 ? 226 GLN A C   1 
ATOM   1600 O O   . GLN A 1 226 ? 13.527 39.233 26.726 1.00 154.17 ? 226 GLN A O   1 
ATOM   1601 C CB  . GLN A 1 226 ? 11.301 41.309 26.000 1.00 144.41 ? 226 GLN A CB  1 
ATOM   1602 C CG  . GLN A 1 226 ? 10.981 42.596 25.258 1.00 155.20 ? 226 GLN A CG  1 
ATOM   1603 C CD  . GLN A 1 226 ? 10.358 43.647 26.158 1.00 164.55 ? 226 GLN A CD  1 
ATOM   1604 O OE1 . GLN A 1 226 ? 10.316 43.491 27.378 1.00 165.19 ? 226 GLN A OE1 1 
ATOM   1605 N NE2 . GLN A 1 226 ? 9.870  44.728 25.557 1.00 172.08 ? 226 GLN A NE2 1 
ATOM   1606 N N   . LYS A 1 227 ? 11.779 38.012 26.010 1.00 168.21 ? 227 LYS A N   1 
ATOM   1607 C CA  . LYS A 1 227 ? 12.162 36.835 26.780 1.00 174.98 ? 227 LYS A CA  1 
ATOM   1608 C C   . LYS A 1 227 ? 13.091 35.929 25.977 1.00 175.11 ? 227 LYS A C   1 
ATOM   1609 O O   . LYS A 1 227 ? 13.980 35.285 26.535 1.00 171.41 ? 227 LYS A O   1 
ATOM   1610 C CB  . LYS A 1 227 ? 10.926 36.075 27.265 1.00 179.76 ? 227 LYS A CB  1 
ATOM   1611 C CG  . LYS A 1 227 ? 10.153 36.813 28.347 1.00 186.62 ? 227 LYS A CG  1 
ATOM   1612 C CD  . LYS A 1 227 ? 11.081 37.226 29.482 1.00 189.26 ? 227 LYS A CD  1 
ATOM   1613 C CE  . LYS A 1 227 ? 10.359 38.060 30.528 1.00 191.10 ? 227 LYS A CE  1 
ATOM   1614 N NZ  . LYS A 1 227 ? 11.291 38.527 31.592 1.00 185.02 ? 227 LYS A NZ  1 
ATOM   1615 N N   . GLU A 1 228 ? 12.883 35.887 24.664 1.00 171.88 ? 228 GLU A N   1 
ATOM   1616 C CA  . GLU A 1 228 ? 13.795 35.184 23.772 1.00 162.82 ? 228 GLU A CA  1 
ATOM   1617 C C   . GLU A 1 228 ? 15.152 35.875 23.804 1.00 151.15 ? 228 GLU A C   1 
ATOM   1618 O O   . GLU A 1 228 ? 16.198 35.229 23.722 1.00 147.12 ? 228 GLU A O   1 
ATOM   1619 C CB  . GLU A 1 228 ? 13.246 35.165 22.345 1.00 169.22 ? 228 GLU A CB  1 
ATOM   1620 C CG  . GLU A 1 228 ? 11.966 34.361 22.180 1.00 174.07 ? 228 GLU A CG  1 
ATOM   1621 C CD  . GLU A 1 228 ? 12.185 32.871 22.358 1.00 173.02 ? 228 GLU A CD  1 
ATOM   1622 O OE1 . GLU A 1 228 ? 13.357 32.443 22.420 1.00 168.35 ? 228 GLU A OE1 1 
ATOM   1623 O OE2 . GLU A 1 228 ? 11.185 32.126 22.431 1.00 176.90 ? 228 GLU A OE2 1 
ATOM   1624 N N   . VAL A 1 229 ? 15.119 37.198 23.928 1.00 144.12 ? 229 VAL A N   1 
ATOM   1625 C CA  . VAL A 1 229 ? 16.330 37.994 24.062 1.00 137.69 ? 229 VAL A CA  1 
ATOM   1626 C C   . VAL A 1 229 ? 16.944 37.793 25.442 1.00 141.43 ? 229 VAL A C   1 
ATOM   1627 O O   . VAL A 1 229 ? 18.163 37.697 25.581 1.00 141.77 ? 229 VAL A O   1 
ATOM   1628 C CB  . VAL A 1 229 ? 16.040 39.493 23.852 1.00 131.29 ? 229 VAL A CB  1 
ATOM   1629 C CG1 . VAL A 1 229 ? 17.252 40.330 24.227 1.00 128.76 ? 229 VAL A CG1 1 
ATOM   1630 C CG2 . VAL A 1 229 ? 15.624 39.756 22.414 1.00 134.64 ? 229 VAL A CG2 1 
ATOM   1631 N N   . HIS A 1 230 ? 16.094 37.728 26.461 1.00 144.44 ? 230 HIS A N   1 
ATOM   1632 C CA  . HIS A 1 230 ? 16.557 37.510 27.826 1.00 145.85 ? 230 HIS A CA  1 
ATOM   1633 C C   . HIS A 1 230 ? 17.308 36.187 27.931 1.00 139.73 ? 230 HIS A C   1 
ATOM   1634 O O   . HIS A 1 230 ? 18.304 36.083 28.646 1.00 135.25 ? 230 HIS A O   1 
ATOM   1635 C CB  . HIS A 1 230 ? 15.381 37.532 28.805 1.00 152.62 ? 230 HIS A CB  1 
ATOM   1636 C CG  . HIS A 1 230 ? 15.781 37.339 30.235 1.00 155.25 ? 230 HIS A CG  1 
ATOM   1637 N ND1 . HIS A 1 230 ? 16.059 38.392 31.080 1.00 157.07 ? 230 HIS A ND1 1 
ATOM   1638 C CD2 . HIS A 1 230 ? 15.949 36.214 30.969 1.00 153.68 ? 230 HIS A CD2 1 
ATOM   1639 C CE1 . HIS A 1 230 ? 16.381 37.924 32.273 1.00 153.26 ? 230 HIS A CE1 1 
ATOM   1640 N NE2 . HIS A 1 230 ? 16.322 36.605 32.232 1.00 151.18 ? 230 HIS A NE2 1 
ATOM   1641 N N   . ALA A 1 231 ? 16.828 35.179 27.210 1.00 138.05 ? 231 ALA A N   1 
ATOM   1642 C CA  . ALA A 1 231 ? 17.479 33.875 27.192 1.00 131.21 ? 231 ALA A CA  1 
ATOM   1643 C C   . ALA A 1 231 ? 18.760 33.917 26.367 1.00 129.24 ? 231 ALA A C   1 
ATOM   1644 O O   . ALA A 1 231 ? 19.742 33.250 26.696 1.00 129.95 ? 231 ALA A O   1 
ATOM   1645 C CB  . ALA A 1 231 ? 16.533 32.814 26.653 1.00 134.68 ? 231 ALA A CB  1 
ATOM   1646 N N   . ALA A 1 232 ? 18.746 34.702 25.294 1.00 128.18 ? 232 ALA A N   1 
ATOM   1647 C CA  . ALA A 1 232 ? 19.928 34.868 24.457 1.00 123.61 ? 232 ALA A CA  1 
ATOM   1648 C C   . ALA A 1 232 ? 21.022 35.605 25.221 1.00 117.47 ? 232 ALA A C   1 
ATOM   1649 O O   . ALA A 1 232 ? 22.195 35.239 25.151 1.00 112.44 ? 232 ALA A O   1 
ATOM   1650 C CB  . ALA A 1 232 ? 19.576 35.613 23.178 1.00 125.81 ? 232 ALA A CB  1 
ATOM   1651 N N   . LYS A 1 233 ? 20.629 36.644 25.951 1.00 117.01 ? 233 LYS A N   1 
ATOM   1652 C CA  . LYS A 1 233 ? 21.565 37.406 26.766 1.00 115.07 ? 233 LYS A CA  1 
ATOM   1653 C C   . LYS A 1 233 ? 22.147 36.527 27.865 1.00 112.31 ? 233 LYS A C   1 
ATOM   1654 O O   . LYS A 1 233 ? 23.355 36.525 28.096 1.00 109.43 ? 233 LYS A O   1 
ATOM   1655 C CB  . LYS A 1 233 ? 20.878 38.628 27.377 1.00 115.78 ? 233 LYS A CB  1 
ATOM   1656 C CG  . LYS A 1 233 ? 21.779 39.457 28.278 1.00 117.24 ? 233 LYS A CG  1 
ATOM   1657 C CD  . LYS A 1 233 ? 21.041 40.656 28.851 1.00 126.77 ? 233 LYS A CD  1 
ATOM   1658 C CE  . LYS A 1 233 ? 21.943 41.478 29.758 1.00 133.25 ? 233 LYS A CE  1 
ATOM   1659 N NZ  . LYS A 1 233 ? 21.241 42.670 30.310 1.00 141.07 ? 233 LYS A NZ  1 
ATOM   1660 N N   . SER A 1 234 ? 21.279 35.782 28.541 1.00 114.29 ? 234 SER A N   1 
ATOM   1661 C CA  . SER A 1 234 ? 21.717 34.854 29.574 1.00 115.97 ? 234 SER A CA  1 
ATOM   1662 C C   . SER A 1 234 ? 22.692 33.843 28.986 1.00 111.08 ? 234 SER A C   1 
ATOM   1663 O O   . SER A 1 234 ? 23.635 33.417 29.651 1.00 118.61 ? 234 SER A O   1 
ATOM   1664 C CB  . SER A 1 234 ? 20.518 34.140 30.202 1.00 126.18 ? 234 SER A CB  1 
ATOM   1665 O OG  . SER A 1 234 ? 19.645 35.065 30.827 1.00 134.99 ? 234 SER A OG  1 
ATOM   1666 N N   . ALA A 1 235 ? 22.467 33.469 27.730 1.00 100.61 ? 235 ALA A N   1 
ATOM   1667 C CA  . ALA A 1 235 ? 23.359 32.548 27.036 1.00 96.31  ? 235 ALA A CA  1 
ATOM   1668 C C   . ALA A 1 235 ? 24.697 33.214 26.730 1.00 95.92  ? 235 ALA A C   1 
ATOM   1669 O O   . ALA A 1 235 ? 25.750 32.582 26.818 1.00 97.33  ? 235 ALA A O   1 
ATOM   1670 C CB  . ALA A 1 235 ? 22.712 32.042 25.757 1.00 98.46  ? 235 ALA A CB  1 
ATOM   1671 N N   . ALA A 1 236 ? 24.649 34.493 26.374 1.00 93.84  ? 236 ALA A N   1 
ATOM   1672 C CA  . ALA A 1 236 ? 25.860 35.254 26.097 1.00 91.17  ? 236 ALA A CA  1 
ATOM   1673 C C   . ALA A 1 236 ? 26.725 35.368 27.346 1.00 96.01  ? 236 ALA A C   1 
ATOM   1674 O O   . ALA A 1 236 ? 27.953 35.342 27.266 1.00 95.99  ? 236 ALA A O   1 
ATOM   1675 C CB  . ALA A 1 236 ? 25.511 36.635 25.565 1.00 89.85  ? 236 ALA A CB  1 
ATOM   1676 N N   . ILE A 1 237 ? 26.079 35.490 28.501 1.00 102.57 ? 237 ILE A N   1 
ATOM   1677 C CA  . ILE A 1 237 ? 26.796 35.609 29.765 1.00 107.77 ? 237 ILE A CA  1 
ATOM   1678 C C   . ILE A 1 237 ? 27.478 34.294 30.128 1.00 105.75 ? 237 ILE A C   1 
ATOM   1679 O O   . ILE A 1 237 ? 28.471 34.278 30.853 1.00 103.30 ? 237 ILE A O   1 
ATOM   1680 C CB  . ILE A 1 237 ? 25.861 36.037 30.913 1.00 113.49 ? 237 ILE A CB  1 
ATOM   1681 C CG1 . ILE A 1 237 ? 25.073 37.289 30.522 1.00 116.95 ? 237 ILE A CG1 1 
ATOM   1682 C CG2 . ILE A 1 237 ? 26.656 36.287 32.185 1.00 112.19 ? 237 ILE A CG2 1 
ATOM   1683 C CD1 . ILE A 1 237 ? 24.117 37.772 31.594 1.00 112.64 ? 237 ILE A CD1 1 
ATOM   1684 N N   . ILE A 1 238 ? 26.938 33.191 29.618 1.00 108.43 ? 238 ILE A N   1 
ATOM   1685 C CA  . ILE A 1 238 ? 27.521 31.876 29.854 1.00 114.75 ? 238 ILE A CA  1 
ATOM   1686 C C   . ILE A 1 238 ? 28.788 31.694 29.026 1.00 117.57 ? 238 ILE A C   1 
ATOM   1687 O O   . ILE A 1 238 ? 29.837 31.317 29.550 1.00 115.65 ? 238 ILE A O   1 
ATOM   1688 C CB  . ILE A 1 238 ? 26.532 30.752 29.503 1.00 120.55 ? 238 ILE A CB  1 
ATOM   1689 C CG1 . ILE A 1 238 ? 25.235 30.919 30.294 1.00 130.07 ? 238 ILE A CG1 1 
ATOM   1690 C CG2 . ILE A 1 238 ? 27.151 29.391 29.778 1.00 120.00 ? 238 ILE A CG2 1 
ATOM   1691 C CD1 . ILE A 1 238 ? 24.160 29.926 29.914 1.00 136.04 ? 238 ILE A CD1 1 
ATOM   1692 N N   . ALA A 1 239 ? 28.681 31.962 27.729 1.00 120.63 ? 239 ALA A N   1 
ATOM   1693 C CA  . ALA A 1 239 ? 29.818 31.843 26.824 1.00 120.58 ? 239 ALA A CA  1 
ATOM   1694 C C   . ALA A 1 239 ? 30.904 32.850 27.183 1.00 117.50 ? 239 ALA A C   1 
ATOM   1695 O O   . ALA A 1 239 ? 32.093 32.585 27.008 1.00 117.48 ? 239 ALA A O   1 
ATOM   1696 C CB  . ALA A 1 239 ? 29.372 32.033 25.384 1.00 126.08 ? 239 ALA A CB  1 
ATOM   1697 N N   . GLY A 1 240 ? 30.486 34.006 27.685 1.00 117.90 ? 240 GLY A N   1 
ATOM   1698 C CA  . GLY A 1 240 ? 31.415 35.050 28.075 1.00 117.64 ? 240 GLY A CA  1 
ATOM   1699 C C   . GLY A 1 240 ? 32.326 34.624 29.209 1.00 114.69 ? 240 GLY A C   1 
ATOM   1700 O O   . GLY A 1 240 ? 33.522 34.910 29.194 1.00 115.28 ? 240 GLY A O   1 
ATOM   1701 N N   . LEU A 1 241 ? 31.758 33.939 30.197 1.00 113.72 ? 241 LEU A N   1 
ATOM   1702 C CA  . LEU A 1 241 ? 32.530 33.473 31.342 1.00 114.52 ? 241 LEU A CA  1 
ATOM   1703 C C   . LEU A 1 241 ? 33.541 32.407 30.938 1.00 117.74 ? 241 LEU A C   1 
ATOM   1704 O O   . LEU A 1 241 ? 34.612 32.300 31.534 1.00 123.25 ? 241 LEU A O   1 
ATOM   1705 C CB  . LEU A 1 241 ? 31.607 32.938 32.437 1.00 115.42 ? 241 LEU A CB  1 
ATOM   1706 C CG  . LEU A 1 241 ? 30.715 33.975 33.121 1.00 124.25 ? 241 LEU A CG  1 
ATOM   1707 C CD1 . LEU A 1 241 ? 29.851 33.320 34.188 1.00 129.25 ? 241 LEU A CD1 1 
ATOM   1708 C CD2 . LEU A 1 241 ? 31.554 35.094 33.719 1.00 121.82 ? 241 LEU A CD2 1 
ATOM   1709 N N   . PHE A 1 242 ? 33.197 31.618 29.925 1.00 112.76 ? 242 PHE A N   1 
ATOM   1710 C CA  . PHE A 1 242 ? 34.102 30.592 29.423 1.00 105.49 ? 242 PHE A CA  1 
ATOM   1711 C C   . PHE A 1 242 ? 35.411 31.222 28.957 1.00 101.10 ? 242 PHE A C   1 
ATOM   1712 O O   . PHE A 1 242 ? 36.478 30.927 29.494 1.00 100.62 ? 242 PHE A O   1 
ATOM   1713 C CB  . PHE A 1 242 ? 33.452 29.814 28.277 1.00 104.25 ? 242 PHE A CB  1 
ATOM   1714 C CG  . PHE A 1 242 ? 34.319 28.724 27.716 1.00 103.70 ? 242 PHE A CG  1 
ATOM   1715 C CD1 . PHE A 1 242 ? 34.256 27.438 28.227 1.00 105.74 ? 242 PHE A CD1 1 
ATOM   1716 C CD2 . PHE A 1 242 ? 35.197 28.983 26.678 1.00 103.23 ? 242 PHE A CD2 1 
ATOM   1717 C CE1 . PHE A 1 242 ? 35.053 26.431 27.715 1.00 105.08 ? 242 PHE A CE1 1 
ATOM   1718 C CE2 . PHE A 1 242 ? 35.997 27.982 26.162 1.00 105.92 ? 242 PHE A CE2 1 
ATOM   1719 C CZ  . PHE A 1 242 ? 35.923 26.704 26.680 1.00 105.07 ? 242 PHE A CZ  1 
ATOM   1720 N N   . ALA A 1 243 ? 35.319 32.093 27.958 1.00 95.60  ? 243 ALA A N   1 
ATOM   1721 C CA  . ALA A 1 243 ? 36.486 32.795 27.440 1.00 92.12  ? 243 ALA A CA  1 
ATOM   1722 C C   . ALA A 1 243 ? 37.230 33.515 28.561 1.00 104.59 ? 243 ALA A C   1 
ATOM   1723 O O   . ALA A 1 243 ? 38.460 33.516 28.605 1.00 109.97 ? 243 ALA A O   1 
ATOM   1724 C CB  . ALA A 1 243 ? 36.073 33.782 26.359 1.00 80.99  ? 243 ALA A CB  1 
ATOM   1725 N N   . LEU A 1 244 ? 36.473 34.120 29.469 1.00 107.10 ? 244 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 244 ? 37.052 34.869 30.577 1.00 109.16 ? 244 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 244 ? 37.801 33.954 31.543 1.00 103.14 ? 244 LEU A C   1 
ATOM   1728 O O   . LEU A 1 244 ? 38.656 34.407 32.304 1.00 94.25  ? 244 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 244 ? 35.960 35.643 31.320 1.00 111.39 ? 244 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 244 ? 36.408 36.584 32.440 1.00 111.14 ? 244 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 244 ? 37.418 37.592 31.918 1.00 118.35 ? 244 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 244 ? 35.213 37.290 33.061 1.00 103.70 ? 244 LEU A CD2 1 
ATOM   1733 N N   . CYS A 1 245 ? 37.479 32.664 31.504 1.00 107.09 ? 245 CYS A N   1 
ATOM   1734 C CA  . CYS A 1 245 ? 38.080 31.695 32.415 1.00 111.04 ? 245 CYS A CA  1 
ATOM   1735 C C   . CYS A 1 245 ? 39.042 30.745 31.705 1.00 110.28 ? 245 CYS A C   1 
ATOM   1736 O O   . CYS A 1 245 ? 39.406 29.703 32.250 1.00 107.85 ? 245 CYS A O   1 
ATOM   1737 C CB  . CYS A 1 245 ? 36.994 30.888 33.133 1.00 114.47 ? 245 CYS A CB  1 
ATOM   1738 S SG  . CYS A 1 245 ? 35.919 31.852 34.221 1.00 140.21 ? 245 CYS A SG  1 
ATOM   1739 N N   . TRP A 1 246 ? 39.450 31.102 30.492 1.00 114.85 ? 246 TRP A N   1 
ATOM   1740 C CA  . TRP A 1 246 ? 40.367 30.263 29.726 1.00 117.49 ? 246 TRP A CA  1 
ATOM   1741 C C   . TRP A 1 246 ? 41.433 31.075 28.994 1.00 113.37 ? 246 TRP A C   1 
ATOM   1742 O O   . TRP A 1 246 ? 42.571 30.629 28.851 1.00 107.57 ? 246 TRP A O   1 
ATOM   1743 C CB  . TRP A 1 246 ? 39.598 29.379 28.740 1.00 119.62 ? 246 TRP A CB  1 
ATOM   1744 C CG  . TRP A 1 246 ? 38.844 28.262 29.397 1.00 125.07 ? 246 TRP A CG  1 
ATOM   1745 C CD1 . TRP A 1 246 ? 37.580 28.315 29.908 1.00 130.32 ? 246 TRP A CD1 1 
ATOM   1746 C CD2 . TRP A 1 246 ? 39.308 26.923 29.615 1.00 129.38 ? 246 TRP A CD2 1 
ATOM   1747 N NE1 . TRP A 1 246 ? 37.227 27.094 30.430 1.00 132.29 ? 246 TRP A NE1 1 
ATOM   1748 C CE2 . TRP A 1 246 ? 38.271 26.222 30.262 1.00 133.02 ? 246 TRP A CE2 1 
ATOM   1749 C CE3 . TRP A 1 246 ? 40.499 26.250 29.325 1.00 127.21 ? 246 TRP A CE3 1 
ATOM   1750 C CZ2 . TRP A 1 246 ? 38.388 24.881 30.625 1.00 132.78 ? 246 TRP A CZ2 1 
ATOM   1751 C CZ3 . TRP A 1 246 ? 40.613 24.919 29.686 1.00 126.91 ? 246 TRP A CZ3 1 
ATOM   1752 C CH2 . TRP A 1 246 ? 39.564 24.249 30.328 1.00 129.74 ? 246 TRP A CH2 1 
ATOM   1753 N N   . LEU A 1 247 ? 41.060 32.265 28.533 1.00 113.88 ? 247 LEU A N   1 
ATOM   1754 C CA  . LEU A 1 247 ? 41.999 33.139 27.835 1.00 117.52 ? 247 LEU A CA  1 
ATOM   1755 C C   . LEU A 1 247 ? 43.310 33.345 28.597 1.00 117.65 ? 247 LEU A C   1 
ATOM   1756 O O   . LEU A 1 247 ? 44.384 33.264 28.004 1.00 119.68 ? 247 LEU A O   1 
ATOM   1757 C CB  . LEU A 1 247 ? 41.355 34.491 27.509 1.00 118.66 ? 247 LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 247 ? 40.329 34.510 26.375 1.00 114.35 ? 247 LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 247 ? 39.875 35.933 26.102 1.00 114.94 ? 247 LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 247 ? 40.907 33.883 25.116 1.00 113.38 ? 247 LEU A CD2 1 
ATOM   1761 N N   . PRO A 1 248 ? 43.229 33.616 29.911 1.00 116.33 ? 248 PRO A N   1 
ATOM   1762 C CA  . PRO A 1 248 ? 44.453 33.810 30.696 1.00 117.32 ? 248 PRO A CA  1 
ATOM   1763 C C   . PRO A 1 248 ? 45.454 32.677 30.494 1.00 123.00 ? 248 PRO A C   1 
ATOM   1764 O O   . PRO A 1 248 ? 46.624 32.934 30.212 1.00 128.58 ? 248 PRO A O   1 
ATOM   1765 C CB  . PRO A 1 248 ? 43.942 33.804 32.137 1.00 113.33 ? 248 PRO A CB  1 
ATOM   1766 C CG  . PRO A 1 248 ? 42.556 34.315 32.036 1.00 114.66 ? 248 PRO A CG  1 
ATOM   1767 C CD  . PRO A 1 248 ? 42.018 33.791 30.734 1.00 116.30 ? 248 PRO A CD  1 
ATOM   1768 N N   . LEU A 1 249 ? 44.993 31.439 30.634 1.00 118.21 ? 249 LEU A N   1 
ATOM   1769 C CA  . LEU A 1 249 ? 45.865 30.277 30.501 1.00 108.30 ? 249 LEU A CA  1 
ATOM   1770 C C   . LEU A 1 249 ? 46.408 30.138 29.082 1.00 108.01 ? 249 LEU A C   1 
ATOM   1771 O O   . LEU A 1 249 ? 47.549 29.726 28.883 1.00 108.38 ? 249 LEU A O   1 
ATOM   1772 C CB  . LEU A 1 249 ? 45.125 29.003 30.909 1.00 99.36  ? 249 LEU A CB  1 
ATOM   1773 C CG  . LEU A 1 249 ? 45.957 27.721 30.955 1.00 89.91  ? 249 LEU A CG  1 
ATOM   1774 C CD1 . LEU A 1 249 ? 47.189 27.922 31.820 1.00 93.59  ? 249 LEU A CD1 1 
ATOM   1775 C CD2 . LEU A 1 249 ? 45.122 26.562 31.468 1.00 86.17  ? 249 LEU A CD2 1 
ATOM   1776 N N   . HIS A 1 250 ? 45.584 30.485 28.099 1.00 112.23 ? 250 HIS A N   1 
ATOM   1777 C CA  . HIS A 1 250 ? 45.990 30.407 26.700 1.00 111.49 ? 250 HIS A CA  1 
ATOM   1778 C C   . HIS A 1 250 ? 46.986 31.504 26.342 1.00 101.52 ? 250 HIS A C   1 
ATOM   1779 O O   . HIS A 1 250 ? 47.963 31.259 25.636 1.00 96.04  ? 250 HIS A O   1 
ATOM   1780 C CB  . HIS A 1 250 ? 44.771 30.482 25.781 1.00 119.93 ? 250 HIS A CB  1 
ATOM   1781 C CG  . HIS A 1 250 ? 43.926 29.247 25.796 1.00 120.18 ? 250 HIS A CG  1 
ATOM   1782 N ND1 . HIS A 1 250 ? 44.188 28.157 24.995 1.00 121.79 ? 250 HIS A ND1 1 
ATOM   1783 C CD2 . HIS A 1 250 ? 42.823 28.930 26.513 1.00 119.51 ? 250 HIS A CD2 1 
ATOM   1784 C CE1 . HIS A 1 250 ? 43.284 27.221 25.218 1.00 122.32 ? 250 HIS A CE1 1 
ATOM   1785 N NE2 . HIS A 1 250 ? 42.444 27.664 26.136 1.00 121.84 ? 250 HIS A NE2 1 
ATOM   1786 N N   . ILE A 1 251 ? 46.728 32.714 26.825 1.00 99.79  ? 251 ILE A N   1 
ATOM   1787 C CA  . ILE A 1 251 ? 47.632 33.836 26.602 1.00 104.06 ? 251 ILE A CA  1 
ATOM   1788 C C   . ILE A 1 251 ? 49.011 33.514 27.160 1.00 111.86 ? 251 ILE A C   1 
ATOM   1789 O O   . ILE A 1 251 ? 50.031 33.845 26.555 1.00 118.68 ? 251 ILE A O   1 
ATOM   1790 C CB  . ILE A 1 251 ? 47.104 35.124 27.259 1.00 104.78 ? 251 ILE A CB  1 
ATOM   1791 C CG1 . ILE A 1 251 ? 45.808 35.571 26.581 1.00 104.34 ? 251 ILE A CG1 1 
ATOM   1792 C CG2 . ILE A 1 251 ? 48.149 36.227 27.188 1.00 108.08 ? 251 ILE A CG2 1 
ATOM   1793 C CD1 . ILE A 1 251 ? 45.222 36.837 27.162 1.00 109.50 ? 251 ILE A CD1 1 
ATOM   1794 N N   . ILE A 1 252 ? 49.034 32.865 28.318 1.00 110.80 ? 252 ILE A N   1 
ATOM   1795 C CA  . ILE A 1 252 ? 50.284 32.433 28.928 1.00 110.64 ? 252 ILE A CA  1 
ATOM   1796 C C   . ILE A 1 252 ? 51.047 31.506 27.989 1.00 115.44 ? 252 ILE A C   1 
ATOM   1797 O O   . ILE A 1 252 ? 52.253 31.656 27.799 1.00 125.42 ? 252 ILE A O   1 
ATOM   1798 C CB  . ILE A 1 252 ? 50.039 31.721 30.268 1.00 107.99 ? 252 ILE A CB  1 
ATOM   1799 C CG1 . ILE A 1 252 ? 49.579 32.728 31.323 1.00 107.74 ? 252 ILE A CG1 1 
ATOM   1800 C CG2 . ILE A 1 252 ? 51.298 31.010 30.728 1.00 110.84 ? 252 ILE A CG2 1 
ATOM   1801 C CD1 . ILE A 1 252 ? 49.373 32.127 32.695 1.00 107.77 ? 252 ILE A CD1 1 
ATOM   1802 N N   . ASN A 1 253 ? 50.336 30.549 27.401 1.00 112.31 ? 253 ASN A N   1 
ATOM   1803 C CA  . ASN A 1 253 ? 50.938 29.638 26.436 1.00 118.17 ? 253 ASN A CA  1 
ATOM   1804 C C   . ASN A 1 253 ? 51.509 30.387 25.239 1.00 122.65 ? 253 ASN A C   1 
ATOM   1805 O O   . ASN A 1 253 ? 52.486 29.952 24.632 1.00 129.65 ? 253 ASN A O   1 
ATOM   1806 C CB  . ASN A 1 253 ? 49.922 28.596 25.968 1.00 126.31 ? 253 ASN A CB  1 
ATOM   1807 C CG  . ASN A 1 253 ? 49.478 27.673 27.084 1.00 134.61 ? 253 ASN A CG  1 
ATOM   1808 O OD1 . ASN A 1 253 ? 50.067 27.658 28.165 1.00 134.39 ? 253 ASN A OD1 1 
ATOM   1809 N ND2 . ASN A 1 253 ? 48.435 26.892 26.827 1.00 141.60 ? 253 ASN A ND2 1 
ATOM   1810 N N   . CYS A 1 254 ? 50.893 31.515 24.903 1.00 123.50 ? 254 CYS A N   1 
ATOM   1811 C CA  . CYS A 1 254 ? 51.366 32.343 23.801 1.00 127.19 ? 254 CYS A CA  1 
ATOM   1812 C C   . CYS A 1 254 ? 52.595 33.143 24.217 1.00 126.08 ? 254 CYS A C   1 
ATOM   1813 O O   . CYS A 1 254 ? 53.432 33.492 23.385 1.00 131.27 ? 254 CYS A O   1 
ATOM   1814 C CB  . CYS A 1 254 ? 50.257 33.280 23.319 1.00 134.64 ? 254 CYS A CB  1 
ATOM   1815 S SG  . CYS A 1 254 ? 48.790 32.431 22.689 1.00 110.72 ? 254 CYS A SG  1 
ATOM   1816 N N   . PHE A 1 255 ? 52.695 33.433 25.510 1.00 126.14 ? 255 PHE A N   1 
ATOM   1817 C CA  . PHE A 1 255 ? 53.857 34.121 26.061 1.00 133.07 ? 255 PHE A CA  1 
ATOM   1818 C C   . PHE A 1 255 ? 55.075 33.203 26.062 1.00 130.95 ? 255 PHE A C   1 
ATOM   1819 O O   . PHE A 1 255 ? 56.144 33.565 25.569 1.00 131.61 ? 255 PHE A O   1 
ATOM   1820 C CB  . PHE A 1 255 ? 53.566 34.600 27.485 1.00 135.61 ? 255 PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 255 ? 53.091 36.022 27.564 1.00 139.04 ? 255 PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 255 ? 52.257 36.545 26.591 1.00 142.95 ? 255 PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 255 ? 53.472 36.833 28.619 1.00 139.14 ? 255 PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 255 ? 51.819 37.854 26.664 1.00 144.23 ? 255 PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 255 ? 53.036 38.142 28.700 1.00 140.25 ? 255 PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 255 ? 52.208 38.653 27.721 1.00 141.91 ? 255 PHE A CZ  1 
ATOM   1827 N N   . THR A 1 256 ? 54.902 32.012 26.623 1.00 120.92 ? 256 THR A N   1 
ATOM   1828 C CA  . THR A 1 256 ? 55.974 31.029 26.695 1.00 115.48 ? 256 THR A CA  1 
ATOM   1829 C C   . THR A 1 256 ? 56.425 30.598 25.302 1.00 123.55 ? 256 THR A C   1 
ATOM   1830 O O   . THR A 1 256 ? 57.613 30.375 25.065 1.00 138.29 ? 256 THR A O   1 
ATOM   1831 C CB  . THR A 1 256 ? 55.536 29.788 27.496 1.00 101.50 ? 256 THR A CB  1 
ATOM   1832 O OG1 . THR A 1 256 ? 55.251 30.168 28.848 1.00 96.10  ? 256 THR A OG1 1 
ATOM   1833 C CG2 . THR A 1 256 ? 56.630 28.731 27.491 1.00 100.75 ? 256 THR A CG2 1 
ATOM   1834 N N   . PHE A 1 257 ? 55.472 30.493 24.383 1.00 114.00 ? 257 PHE A N   1 
ATOM   1835 C CA  . PHE A 1 257 ? 55.754 30.024 23.031 1.00 111.78 ? 257 PHE A CA  1 
ATOM   1836 C C   . PHE A 1 257 ? 56.388 31.106 22.162 1.00 114.34 ? 257 PHE A C   1 
ATOM   1837 O O   . PHE A 1 257 ? 57.563 31.022 21.809 1.00 123.96 ? 257 PHE A O   1 
ATOM   1838 C CB  . PHE A 1 257 ? 54.470 29.512 22.372 1.00 111.58 ? 257 PHE A CB  1 
ATOM   1839 C CG  . PHE A 1 257 ? 54.688 28.868 21.032 1.00 109.90 ? 257 PHE A CG  1 
ATOM   1840 C CD1 . PHE A 1 257 ? 54.730 29.632 19.877 1.00 110.74 ? 257 PHE A CD1 1 
ATOM   1841 C CD2 . PHE A 1 257 ? 54.840 27.495 20.926 1.00 106.82 ? 257 PHE A CD2 1 
ATOM   1842 C CE1 . PHE A 1 257 ? 54.927 29.040 18.644 1.00 112.71 ? 257 PHE A CE1 1 
ATOM   1843 C CE2 . PHE A 1 257 ? 55.036 26.897 19.696 1.00 108.83 ? 257 PHE A CE2 1 
ATOM   1844 C CZ  . PHE A 1 257 ? 55.080 27.670 18.554 1.00 113.00 ? 257 PHE A CZ  1 
ATOM   1845 N N   . PHE A 1 258 ? 55.601 32.120 21.819 1.00 113.55 ? 258 PHE A N   1 
ATOM   1846 C CA  . PHE A 1 258 ? 56.040 33.158 20.892 1.00 122.18 ? 258 PHE A CA  1 
ATOM   1847 C C   . PHE A 1 258 ? 57.171 34.017 21.448 1.00 122.90 ? 258 PHE A C   1 
ATOM   1848 O O   . PHE A 1 258 ? 57.907 34.649 20.690 1.00 128.74 ? 258 PHE A O   1 
ATOM   1849 C CB  . PHE A 1 258 ? 54.861 34.045 20.484 1.00 135.80 ? 258 PHE A CB  1 
ATOM   1850 C CG  . PHE A 1 258 ? 53.782 33.314 19.737 1.00 140.20 ? 258 PHE A CG  1 
ATOM   1851 C CD1 . PHE A 1 258 ? 52.722 32.735 20.414 1.00 136.89 ? 258 PHE A CD1 1 
ATOM   1852 C CD2 . PHE A 1 258 ? 53.830 33.204 18.357 1.00 143.12 ? 258 PHE A CD2 1 
ATOM   1853 C CE1 . PHE A 1 258 ? 51.731 32.063 19.728 1.00 137.34 ? 258 PHE A CE1 1 
ATOM   1854 C CE2 . PHE A 1 258 ? 52.841 32.532 17.666 1.00 140.72 ? 258 PHE A CE2 1 
ATOM   1855 C CZ  . PHE A 1 258 ? 51.791 31.961 18.353 1.00 139.60 ? 258 PHE A CZ  1 
ATOM   1856 N N   . CYS A 1 259 ? 57.307 34.042 22.769 1.00 130.37 ? 259 CYS A N   1 
ATOM   1857 C CA  . CYS A 1 259 ? 58.360 34.828 23.403 1.00 135.50 ? 259 CYS A CA  1 
ATOM   1858 C C   . CYS A 1 259 ? 59.235 33.966 24.310 1.00 140.44 ? 259 CYS A C   1 
ATOM   1859 O O   . CYS A 1 259 ? 59.028 33.920 25.523 1.00 143.72 ? 259 CYS A O   1 
ATOM   1860 C CB  . CYS A 1 259 ? 57.762 35.993 24.193 1.00 129.90 ? 259 CYS A CB  1 
ATOM   1861 S SG  . CYS A 1 259 ? 58.981 37.191 24.770 1.00 213.56 ? 259 CYS A SG  1 
ATOM   1862 N N   . PRO A 1 260 ? 60.222 33.280 23.715 1.00 135.88 ? 260 PRO A N   1 
ATOM   1863 C CA  . PRO A 1 260 ? 61.117 32.367 24.434 1.00 138.62 ? 260 PRO A CA  1 
ATOM   1864 C C   . PRO A 1 260 ? 61.925 33.080 25.512 1.00 142.35 ? 260 PRO A C   1 
ATOM   1865 O O   . PRO A 1 260 ? 62.178 32.503 26.569 1.00 143.81 ? 260 PRO A O   1 
ATOM   1866 C CB  . PRO A 1 260 ? 62.051 31.854 23.333 1.00 140.19 ? 260 PRO A CB  1 
ATOM   1867 C CG  . PRO A 1 260 ? 61.300 32.065 22.061 1.00 138.80 ? 260 PRO A CG  1 
ATOM   1868 C CD  . PRO A 1 260 ? 60.520 33.320 22.274 1.00 135.04 ? 260 PRO A CD  1 
ATOM   1869 N N   . ASP A 1 261 ? 62.327 34.318 25.245 1.00 146.13 ? 261 ASP A N   1 
ATOM   1870 C CA  . ASP A 1 261 ? 63.132 35.076 26.197 1.00 149.64 ? 261 ASP A CA  1 
ATOM   1871 C C   . ASP A 1 261 ? 62.279 35.754 27.266 1.00 149.00 ? 261 ASP A C   1 
ATOM   1872 O O   . ASP A 1 261 ? 62.796 36.197 28.291 1.00 145.87 ? 261 ASP A O   1 
ATOM   1873 C CB  . ASP A 1 261 ? 64.012 36.102 25.477 1.00 154.20 ? 261 ASP A CB  1 
ATOM   1874 C CG  . ASP A 1 261 ? 63.212 37.072 24.630 1.00 163.39 ? 261 ASP A CG  1 
ATOM   1875 O OD1 . ASP A 1 261 ? 61.998 36.847 24.446 1.00 169.33 ? 261 ASP A OD1 1 
ATOM   1876 O OD2 . ASP A 1 261 ? 63.802 38.060 24.143 1.00 163.04 ? 261 ASP A OD2 1 
ATOM   1877 N N   . CYS A 1 262 ? 60.974 35.832 27.021 1.00 150.66 ? 262 CYS A N   1 
ATOM   1878 C CA  . CYS A 1 262 ? 60.044 36.383 28.002 1.00 147.87 ? 262 CYS A CA  1 
ATOM   1879 C C   . CYS A 1 262 ? 59.941 35.469 29.216 1.00 142.87 ? 262 CYS A C   1 
ATOM   1880 O O   . CYS A 1 262 ? 59.877 34.247 29.076 1.00 150.43 ? 262 CYS A O   1 
ATOM   1881 C CB  . CYS A 1 262 ? 58.659 36.592 27.384 1.00 150.26 ? 262 CYS A CB  1 
ATOM   1882 S SG  . CYS A 1 262 ? 58.464 38.147 26.484 1.00 155.59 ? 262 CYS A SG  1 
ATOM   1883 N N   . SER A 1 263 ? 59.925 36.066 30.403 1.00 126.66 ? 263 SER A N   1 
ATOM   1884 C CA  . SER A 1 263 ? 59.882 35.306 31.647 1.00 119.69 ? 263 SER A CA  1 
ATOM   1885 C C   . SER A 1 263 ? 58.856 34.182 31.580 1.00 130.48 ? 263 SER A C   1 
ATOM   1886 O O   . SER A 1 263 ? 57.652 34.434 31.579 1.00 136.37 ? 263 SER A O   1 
ATOM   1887 C CB  . SER A 1 263 ? 59.557 36.227 32.824 1.00 109.42 ? 263 SER A CB  1 
ATOM   1888 O OG  . SER A 1 263 ? 60.407 37.360 32.839 1.00 104.91 ? 263 SER A OG  1 
ATOM   1889 N N   . HIS A 1 264 ? 59.334 32.943 31.517 1.00 134.02 ? 264 HIS A N   1 
ATOM   1890 C CA  . HIS A 1 264 ? 58.439 31.794 31.537 1.00 135.09 ? 264 HIS A CA  1 
ATOM   1891 C C   . HIS A 1 264 ? 57.527 31.889 32.753 1.00 135.64 ? 264 HIS A C   1 
ATOM   1892 O O   . HIS A 1 264 ? 57.999 31.961 33.888 1.00 136.57 ? 264 HIS A O   1 
ATOM   1893 C CB  . HIS A 1 264 ? 59.225 30.481 31.562 1.00 136.02 ? 264 HIS A CB  1 
ATOM   1894 C CG  . HIS A 1 264 ? 59.870 30.134 30.255 1.00 130.53 ? 264 HIS A CG  1 
ATOM   1895 N ND1 . HIS A 1 264 ? 59.183 30.143 29.061 1.00 127.83 ? 264 HIS A ND1 1 
ATOM   1896 C CD2 . HIS A 1 264 ? 61.134 29.749 29.959 1.00 125.19 ? 264 HIS A CD2 1 
ATOM   1897 C CE1 . HIS A 1 264 ? 59.999 29.790 28.083 1.00 122.82 ? 264 HIS A CE1 1 
ATOM   1898 N NE2 . HIS A 1 264 ? 61.189 29.546 28.602 1.00 122.90 ? 264 HIS A NE2 1 
ATOM   1899 N N   . ALA A 1 265 ? 56.221 31.897 32.507 1.00 132.71 ? 265 ALA A N   1 
ATOM   1900 C CA  . ALA A 1 265 ? 55.237 32.066 33.570 1.00 128.96 ? 265 ALA A CA  1 
ATOM   1901 C C   . ALA A 1 265 ? 55.561 31.216 34.795 1.00 121.31 ? 265 ALA A C   1 
ATOM   1902 O O   . ALA A 1 265 ? 55.790 30.012 34.680 1.00 117.79 ? 265 ALA A O   1 
ATOM   1903 C CB  . ALA A 1 265 ? 53.842 31.752 33.055 1.00 128.64 ? 265 ALA A CB  1 
ATOM   1904 N N   . PRO A 1 266 ? 55.583 31.851 35.977 1.00 112.19 ? 266 PRO A N   1 
ATOM   1905 C CA  . PRO A 1 266 ? 55.849 31.183 37.254 1.00 114.42 ? 266 PRO A CA  1 
ATOM   1906 C C   . PRO A 1 266 ? 54.874 30.037 37.491 1.00 128.81 ? 266 PRO A C   1 
ATOM   1907 O O   . PRO A 1 266 ? 53.767 30.060 36.956 1.00 134.79 ? 266 PRO A O   1 
ATOM   1908 C CB  . PRO A 1 266 ? 55.607 32.290 38.283 1.00 107.65 ? 266 PRO A CB  1 
ATOM   1909 C CG  . PRO A 1 266 ? 55.825 33.556 37.538 1.00 100.93 ? 266 PRO A CG  1 
ATOM   1910 C CD  . PRO A 1 266 ? 55.349 33.295 36.145 1.00 102.84 ? 266 PRO A CD  1 
ATOM   1911 N N   . LEU A 1 267 ? 55.279 29.052 38.285 1.00 136.51 ? 267 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 267 ? 54.421 27.908 38.575 1.00 143.77 ? 267 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 267 ? 53.211 28.307 39.414 1.00 154.41 ? 267 LEU A C   1 
ATOM   1914 O O   . LEU A 1 267 ? 52.117 27.774 39.229 1.00 153.24 ? 267 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 267 ? 55.210 26.801 39.278 1.00 142.97 ? 267 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 267 ? 56.253 26.074 38.428 1.00 139.46 ? 267 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 267 ? 56.975 25.017 39.249 1.00 143.61 ? 267 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 267 ? 55.599 25.450 37.204 1.00 134.16 ? 267 LEU A CD2 1 
ATOM   1919 N N   . TRP A 1 268 ? 53.410 29.245 40.334 1.00 128.57 ? 268 TRP A N   1 
ATOM   1920 C CA  . TRP A 1 268 ? 52.323 29.708 41.189 1.00 133.02 ? 268 TRP A CA  1 
ATOM   1921 C C   . TRP A 1 268 ? 51.265 30.438 40.368 1.00 132.04 ? 268 TRP A C   1 
ATOM   1922 O O   . TRP A 1 268 ? 50.068 30.201 40.531 1.00 138.10 ? 268 TRP A O   1 
ATOM   1923 C CB  . TRP A 1 268 ? 52.850 30.612 42.307 1.00 137.76 ? 268 TRP A CB  1 
ATOM   1924 C CG  . TRP A 1 268 ? 53.373 31.933 41.828 1.00 145.76 ? 268 TRP A CG  1 
ATOM   1925 C CD1 . TRP A 1 268 ? 54.660 32.231 41.489 1.00 149.76 ? 268 TRP A CD1 1 
ATOM   1926 C CD2 . TRP A 1 268 ? 52.619 33.137 41.640 1.00 149.97 ? 268 TRP A CD2 1 
ATOM   1927 N NE1 . TRP A 1 268 ? 54.755 33.545 41.099 1.00 152.56 ? 268 TRP A NE1 1 
ATOM   1928 C CE2 . TRP A 1 268 ? 53.515 34.123 41.182 1.00 152.96 ? 268 TRP A CE2 1 
ATOM   1929 C CE3 . TRP A 1 268 ? 51.274 33.476 41.812 1.00 147.95 ? 268 TRP A CE3 1 
ATOM   1930 C CZ2 . TRP A 1 268 ? 53.110 35.425 40.895 1.00 151.52 ? 268 TRP A CZ2 1 
ATOM   1931 C CZ3 . TRP A 1 268 ? 50.873 34.769 41.526 1.00 147.74 ? 268 TRP A CZ3 1 
ATOM   1932 C CH2 . TRP A 1 268 ? 51.788 35.727 41.073 1.00 148.20 ? 268 TRP A CH2 1 
ATOM   1933 N N   . LEU A 1 269 ? 51.713 31.323 39.484 1.00 121.56 ? 269 LEU A N   1 
ATOM   1934 C CA  . LEU A 1 269 ? 50.808 32.047 38.602 1.00 111.62 ? 269 LEU A CA  1 
ATOM   1935 C C   . LEU A 1 269 ? 50.229 31.099 37.560 1.00 104.00 ? 269 LEU A C   1 
ATOM   1936 O O   . LEU A 1 269 ? 49.109 31.289 37.086 1.00 98.39  ? 269 LEU A O   1 
ATOM   1937 C CB  . LEU A 1 269 ? 51.533 33.203 37.914 1.00 106.68 ? 269 LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 269 ? 50.688 34.041 36.954 1.00 105.63 ? 269 LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 269 ? 49.492 34.638 37.677 1.00 111.34 ? 269 LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 269 ? 51.525 35.132 36.307 1.00 107.25 ? 269 LEU A CD2 1 
ATOM   1941 N N   . MET A 1 270 ? 51.003 30.078 37.208 1.00 100.05 ? 270 MET A N   1 
ATOM   1942 C CA  . MET A 1 270 ? 50.551 29.062 36.269 1.00 100.20 ? 270 MET A CA  1 
ATOM   1943 C C   . MET A 1 270 ? 49.431 28.238 36.896 1.00 113.42 ? 270 MET A C   1 
ATOM   1944 O O   . MET A 1 270 ? 48.453 27.892 36.233 1.00 109.48 ? 270 MET A O   1 
ATOM   1945 C CB  . MET A 1 270 ? 51.711 28.151 35.867 1.00 91.89  ? 270 MET A CB  1 
ATOM   1946 C CG  . MET A 1 270 ? 51.350 27.121 34.811 1.00 95.50  ? 270 MET A CG  1 
ATOM   1947 S SD  . MET A 1 270 ? 50.955 27.875 33.223 1.00 141.97 ? 270 MET A SD  1 
ATOM   1948 C CE  . MET A 1 270 ? 52.554 28.526 32.759 1.00 64.98  ? 270 MET A CE  1 
ATOM   1949 N N   . TYR A 1 271 ? 49.585 27.928 38.179 1.00 121.90 ? 271 TYR A N   1 
ATOM   1950 C CA  . TYR A 1 271 ? 48.572 27.184 38.917 1.00 122.70 ? 271 TYR A CA  1 
ATOM   1951 C C   . TYR A 1 271 ? 47.273 27.975 38.969 1.00 116.74 ? 271 TYR A C   1 
ATOM   1952 O O   . TYR A 1 271 ? 46.211 27.468 38.614 1.00 117.17 ? 271 TYR A O   1 
ATOM   1953 C CB  . TYR A 1 271 ? 49.061 26.885 40.335 1.00 132.12 ? 271 TYR A CB  1 
ATOM   1954 C CG  . TYR A 1 271 ? 48.081 26.096 41.173 1.00 138.56 ? 271 TYR A CG  1 
ATOM   1955 C CD1 . TYR A 1 271 ? 47.993 24.715 41.057 1.00 138.71 ? 271 TYR A CD1 1 
ATOM   1956 C CD2 . TYR A 1 271 ? 47.248 26.731 42.085 1.00 141.38 ? 271 TYR A CD2 1 
ATOM   1957 C CE1 . TYR A 1 271 ? 47.101 23.988 41.822 1.00 135.33 ? 271 TYR A CE1 1 
ATOM   1958 C CE2 . TYR A 1 271 ? 46.352 26.012 42.855 1.00 141.55 ? 271 TYR A CE2 1 
ATOM   1959 C CZ  . TYR A 1 271 ? 46.284 24.641 42.719 1.00 137.99 ? 271 TYR A CZ  1 
ATOM   1960 O OH  . TYR A 1 271 ? 45.396 23.919 43.482 1.00 138.46 ? 271 TYR A OH  1 
ATOM   1961 N N   . LEU A 1 272 ? 47.369 29.223 39.416 1.00 110.49 ? 272 LEU A N   1 
ATOM   1962 C CA  . LEU A 1 272 ? 46.216 30.110 39.481 1.00 103.82 ? 272 LEU A CA  1 
ATOM   1963 C C   . LEU A 1 272 ? 45.476 30.128 38.147 1.00 99.58  ? 272 LEU A C   1 
ATOM   1964 O O   . LEU A 1 272 ? 44.258 29.973 38.103 1.00 104.95 ? 272 LEU A O   1 
ATOM   1965 C CB  . LEU A 1 272 ? 46.660 31.524 39.866 1.00 108.47 ? 272 LEU A CB  1 
ATOM   1966 C CG  . LEU A 1 272 ? 45.591 32.599 40.085 1.00 115.65 ? 272 LEU A CG  1 
ATOM   1967 C CD1 . LEU A 1 272 ? 46.154 33.748 40.909 1.00 119.63 ? 272 LEU A CD1 1 
ATOM   1968 C CD2 . LEU A 1 272 ? 45.028 33.110 38.764 1.00 116.68 ? 272 LEU A CD2 1 
ATOM   1969 N N   . ALA A 1 273 ? 46.221 30.315 37.063 1.00 98.63  ? 273 ALA A N   1 
ATOM   1970 C CA  . ALA A 1 273 ? 45.634 30.375 35.728 1.00 99.19  ? 273 ALA A CA  1 
ATOM   1971 C C   . ALA A 1 273 ? 44.938 29.070 35.359 1.00 100.46 ? 273 ALA A C   1 
ATOM   1972 O O   . ALA A 1 273 ? 43.838 29.078 34.806 1.00 103.38 ? 273 ALA A O   1 
ATOM   1973 C CB  . ALA A 1 273 ? 46.697 30.720 34.697 1.00 99.56  ? 273 ALA A CB  1 
ATOM   1974 N N   . ILE A 1 274 ? 45.584 27.949 35.663 1.00 103.59 ? 274 ILE A N   1 
ATOM   1975 C CA  . ILE A 1 274 ? 45.010 26.639 35.379 1.00 110.54 ? 274 ILE A CA  1 
ATOM   1976 C C   . ILE A 1 274 ? 43.770 26.400 36.231 1.00 105.13 ? 274 ILE A C   1 
ATOM   1977 O O   . ILE A 1 274 ? 42.794 25.812 35.770 1.00 110.32 ? 274 ILE A O   1 
ATOM   1978 C CB  . ILE A 1 274 ? 46.023 25.506 35.631 1.00 124.19 ? 274 ILE A CB  1 
ATOM   1979 C CG1 . ILE A 1 274 ? 47.238 25.663 34.715 1.00 124.51 ? 274 ILE A CG1 1 
ATOM   1980 C CG2 . ILE A 1 274 ? 45.370 24.150 35.414 1.00 125.30 ? 274 ILE A CG2 1 
ATOM   1981 C CD1 . ILE A 1 274 ? 48.295 24.601 34.918 1.00 120.83 ? 274 ILE A CD1 1 
ATOM   1982 N N   . VAL A 1 275 ? 43.819 26.861 37.476 1.00 101.48 ? 275 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 275 ? 42.693 26.732 38.393 1.00 99.66  ? 275 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 275 ? 41.463 27.461 37.863 1.00 104.37 ? 275 VAL A C   1 
ATOM   1985 O O   . VAL A 1 275 ? 40.351 26.936 37.915 1.00 110.22 ? 275 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 275 ? 43.040 27.274 39.793 1.00 90.22  ? 275 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 275 ? 41.778 27.501 40.609 1.00 83.76  ? 275 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 275 ? 43.981 26.322 40.508 1.00 89.66  ? 275 VAL A CG2 1 
ATOM   1989 N N   . LEU A 1 276 ? 41.672 28.669 37.351 1.00 99.92  ? 276 LEU A N   1 
ATOM   1990 C CA  . LEU A 1 276 ? 40.582 29.482 36.825 1.00 104.61 ? 276 LEU A CA  1 
ATOM   1991 C C   . LEU A 1 276 ? 39.750 28.709 35.805 1.00 116.20 ? 276 LEU A C   1 
ATOM   1992 O O   . LEU A 1 276 ? 38.530 28.860 35.743 1.00 120.80 ? 276 LEU A O   1 
ATOM   1993 C CB  . LEU A 1 276 ? 41.128 30.762 36.190 1.00 98.15  ? 276 LEU A CB  1 
ATOM   1994 C CG  . LEU A 1 276 ? 40.088 31.814 35.804 1.00 98.22  ? 276 LEU A CG  1 
ATOM   1995 C CD1 . LEU A 1 276 ? 39.394 32.348 37.046 1.00 98.30  ? 276 LEU A CD1 1 
ATOM   1996 C CD2 . LEU A 1 276 ? 40.733 32.945 35.024 1.00 102.89 ? 276 LEU A CD2 1 
ATOM   1997 N N   . ALA A 1 277 ? 40.417 27.880 35.008 1.00 115.76 ? 277 ALA A N   1 
ATOM   1998 C CA  . ALA A 1 277 ? 39.737 27.076 33.999 1.00 113.78 ? 277 ALA A CA  1 
ATOM   1999 C C   . ALA A 1 277 ? 38.831 26.032 34.644 1.00 117.52 ? 277 ALA A C   1 
ATOM   2000 O O   . ALA A 1 277 ? 37.760 25.719 34.123 1.00 117.83 ? 277 ALA A O   1 
ATOM   2001 C CB  . ALA A 1 277 ? 40.749 26.411 33.079 1.00 110.95 ? 277 ALA A CB  1 
ATOM   2002 N N   . HIS A 1 278 ? 39.266 25.496 35.779 1.00 121.13 ? 278 HIS A N   1 
ATOM   2003 C CA  . HIS A 1 278 ? 38.483 24.504 36.506 1.00 125.81 ? 278 HIS A CA  1 
ATOM   2004 C C   . HIS A 1 278 ? 37.287 25.149 37.199 1.00 117.24 ? 278 HIS A C   1 
ATOM   2005 O O   . HIS A 1 278 ? 36.400 24.458 37.697 1.00 113.04 ? 278 HIS A O   1 
ATOM   2006 C CB  . HIS A 1 278 ? 39.350 23.778 37.538 1.00 134.99 ? 278 HIS A CB  1 
ATOM   2007 C CG  . HIS A 1 278 ? 40.477 22.996 36.940 1.00 138.54 ? 278 HIS A CG  1 
ATOM   2008 N ND1 . HIS A 1 278 ? 41.779 23.450 36.935 1.00 139.89 ? 278 HIS A ND1 1 
ATOM   2009 C CD2 . HIS A 1 278 ? 40.499 21.787 36.330 1.00 140.04 ? 278 HIS A CD2 1 
ATOM   2010 C CE1 . HIS A 1 278 ? 42.553 22.556 36.347 1.00 139.58 ? 278 HIS A CE1 1 
ATOM   2011 N NE2 . HIS A 1 278 ? 41.802 21.537 35.971 1.00 140.01 ? 278 HIS A NE2 1 
ATOM   2012 N N   . THR A 1 279 ? 37.273 26.477 37.227 1.00 114.04 ? 279 THR A N   1 
ATOM   2013 C CA  . THR A 1 279 ? 36.202 27.222 37.878 1.00 121.57 ? 279 THR A CA  1 
ATOM   2014 C C   . THR A 1 279 ? 35.016 27.433 36.937 1.00 127.02 ? 279 THR A C   1 
ATOM   2015 O O   . THR A 1 279 ? 33.876 27.584 37.378 1.00 116.43 ? 279 THR A O   1 
ATOM   2016 C CB  . THR A 1 279 ? 36.704 28.586 38.390 1.00 118.51 ? 279 THR A CB  1 
ATOM   2017 O OG1 . THR A 1 279 ? 37.782 28.383 39.313 1.00 105.89 ? 279 THR A OG1 1 
ATOM   2018 C CG2 . THR A 1 279 ? 35.584 29.347 39.086 1.00 126.52 ? 279 THR A CG2 1 
ATOM   2019 N N   . ASN A 1 280 ? 35.294 27.432 35.638 1.00 134.85 ? 280 ASN A N   1 
ATOM   2020 C CA  . ASN A 1 280 ? 34.259 27.624 34.628 1.00 136.57 ? 280 ASN A CA  1 
ATOM   2021 C C   . ASN A 1 280 ? 33.205 26.521 34.666 1.00 138.62 ? 280 ASN A C   1 
ATOM   2022 O O   . ASN A 1 280 ? 32.141 26.642 34.057 1.00 144.45 ? 280 ASN A O   1 
ATOM   2023 C CB  . ASN A 1 280 ? 34.890 27.700 33.237 1.00 138.38 ? 280 ASN A CB  1 
ATOM   2024 C CG  . ASN A 1 280 ? 33.890 28.071 32.162 1.00 142.06 ? 280 ASN A CG  1 
ATOM   2025 O OD1 . ASN A 1 280 ? 33.819 27.426 31.117 1.00 142.10 ? 280 ASN A OD1 1 
ATOM   2026 N ND2 . ASN A 1 280 ? 33.106 29.112 32.415 1.00 146.67 ? 280 ASN A ND2 1 
ATOM   2027 N N   . SER A 1 281 ? 33.507 25.447 35.387 1.00 136.08 ? 281 SER A N   1 
ATOM   2028 C CA  . SER A 1 281 ? 32.599 24.310 35.495 1.00 128.50 ? 281 SER A CA  1 
ATOM   2029 C C   . SER A 1 281 ? 31.735 24.406 36.748 1.00 124.41 ? 281 SER A C   1 
ATOM   2030 O O   . SER A 1 281 ? 31.266 23.393 37.267 1.00 122.93 ? 281 SER A O   1 
ATOM   2031 C CB  . SER A 1 281 ? 33.392 23.000 35.512 1.00 117.23 ? 281 SER A CB  1 
ATOM   2032 O OG  . SER A 1 281 ? 34.173 22.857 34.338 1.00 108.73 ? 281 SER A OG  1 
ATOM   2033 N N   . VAL A 1 282 ? 31.524 25.627 37.231 1.00 121.24 ? 282 VAL A N   1 
ATOM   2034 C CA  . VAL A 1 282 ? 30.789 25.838 38.473 1.00 117.32 ? 282 VAL A CA  1 
ATOM   2035 C C   . VAL A 1 282 ? 29.823 27.021 38.376 1.00 114.91 ? 282 VAL A C   1 
ATOM   2036 O O   . VAL A 1 282 ? 28.784 27.043 39.037 1.00 111.13 ? 282 VAL A O   1 
ATOM   2037 C CB  . VAL A 1 282 ? 31.755 26.052 39.663 1.00 107.43 ? 282 VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 282 ? 30.987 26.373 40.934 1.00 115.41 ? 282 VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 282 ? 32.627 24.824 39.865 1.00 94.29  ? 282 VAL A CG2 1 
ATOM   2040 N N   . VAL A 1 283 ? 30.165 27.995 37.540 1.00 111.83 ? 283 VAL A N   1 
ATOM   2041 C CA  . VAL A 1 283 ? 29.378 29.220 37.429 1.00 112.52 ? 283 VAL A CA  1 
ATOM   2042 C C   . VAL A 1 283 ? 28.044 29.013 36.717 1.00 113.61 ? 283 VAL A C   1 
ATOM   2043 O O   . VAL A 1 283 ? 27.083 29.737 36.971 1.00 117.49 ? 283 VAL A O   1 
ATOM   2044 C CB  . VAL A 1 283 ? 30.163 30.332 36.706 1.00 111.96 ? 283 VAL A CB  1 
ATOM   2045 C CG1 . VAL A 1 283 ? 31.360 30.762 37.537 1.00 111.21 ? 283 VAL A CG1 1 
ATOM   2046 C CG2 . VAL A 1 283 ? 30.598 29.866 35.324 1.00 108.14 ? 283 VAL A CG2 1 
ATOM   2047 N N   . ASN A 1 284 ? 27.989 28.030 35.826 1.00 111.52 ? 284 ASN A N   1 
ATOM   2048 C CA  . ASN A 1 284 ? 26.776 27.773 35.052 1.00 115.30 ? 284 ASN A CA  1 
ATOM   2049 C C   . ASN A 1 284 ? 25.542 27.471 35.907 1.00 112.51 ? 284 ASN A C   1 
ATOM   2050 O O   . ASN A 1 284 ? 24.482 28.057 35.693 1.00 107.50 ? 284 ASN A O   1 
ATOM   2051 C CB  . ASN A 1 284 ? 27.012 26.665 34.023 1.00 120.76 ? 284 ASN A CB  1 
ATOM   2052 C CG  . ASN A 1 284 ? 28.051 27.047 32.988 1.00 129.36 ? 284 ASN A CG  1 
ATOM   2053 O OD1 . ASN A 1 284 ? 28.490 28.196 32.928 1.00 128.13 ? 284 ASN A OD1 1 
ATOM   2054 N ND2 . ASN A 1 284 ? 28.450 26.085 32.166 1.00 135.55 ? 284 ASN A ND2 1 
ATOM   2055 N N   . PRO A 1 285 ? 25.671 26.552 36.877 1.00 117.46 ? 285 PRO A N   1 
ATOM   2056 C CA  . PRO A 1 285 ? 24.531 26.271 37.757 1.00 116.42 ? 285 PRO A CA  1 
ATOM   2057 C C   . PRO A 1 285 ? 24.034 27.535 38.450 1.00 112.00 ? 285 PRO A C   1 
ATOM   2058 O O   . PRO A 1 285 ? 22.831 27.796 38.473 1.00 117.67 ? 285 PRO A O   1 
ATOM   2059 C CB  . PRO A 1 285 ? 25.118 25.308 38.791 1.00 123.09 ? 285 PRO A CB  1 
ATOM   2060 C CG  . PRO A 1 285 ? 26.260 24.659 38.096 1.00 124.41 ? 285 PRO A CG  1 
ATOM   2061 C CD  . PRO A 1 285 ? 26.832 25.700 37.185 1.00 122.24 ? 285 PRO A CD  1 
ATOM   2062 N N   . PHE A 1 286 ? 24.959 28.311 39.002 1.00 106.85 ? 286 PHE A N   1 
ATOM   2063 C CA  . PHE A 1 286 ? 24.613 29.531 39.722 1.00 106.95 ? 286 PHE A CA  1 
ATOM   2064 C C   . PHE A 1 286 ? 24.098 30.621 38.786 1.00 104.90 ? 286 PHE A C   1 
ATOM   2065 O O   . PHE A 1 286 ? 23.363 31.510 39.210 1.00 109.13 ? 286 PHE A O   1 
ATOM   2066 C CB  . PHE A 1 286 ? 25.817 30.049 40.513 1.00 114.40 ? 286 PHE A CB  1 
ATOM   2067 C CG  . PHE A 1 286 ? 26.252 29.137 41.627 1.00 116.46 ? 286 PHE A CG  1 
ATOM   2068 C CD1 . PHE A 1 286 ? 27.052 28.036 41.368 1.00 112.40 ? 286 PHE A CD1 1 
ATOM   2069 C CD2 . PHE A 1 286 ? 25.866 29.385 42.934 1.00 117.28 ? 286 PHE A CD2 1 
ATOM   2070 C CE1 . PHE A 1 286 ? 27.455 27.196 42.390 1.00 108.67 ? 286 PHE A CE1 1 
ATOM   2071 C CE2 . PHE A 1 286 ? 26.267 28.550 43.962 1.00 115.86 ? 286 PHE A CE2 1 
ATOM   2072 C CZ  . PHE A 1 286 ? 27.062 27.454 43.689 1.00 111.61 ? 286 PHE A CZ  1 
ATOM   2073 N N   . ILE A 1 287 ? 24.487 30.553 37.517 1.00 104.44 ? 287 ILE A N   1 
ATOM   2074 C CA  . ILE A 1 287 ? 24.059 31.553 36.544 1.00 114.60 ? 287 ILE A CA  1 
ATOM   2075 C C   . ILE A 1 287 ? 22.650 31.246 36.048 1.00 120.76 ? 287 ILE A C   1 
ATOM   2076 O O   . ILE A 1 287 ? 21.921 32.144 35.626 1.00 123.04 ? 287 ILE A O   1 
ATOM   2077 C CB  . ILE A 1 287 ? 25.025 31.647 35.344 1.00 120.07 ? 287 ILE A CB  1 
ATOM   2078 C CG1 . ILE A 1 287 ? 24.958 33.037 34.709 1.00 123.40 ? 287 ILE A CG1 1 
ATOM   2079 C CG2 . ILE A 1 287 ? 24.714 30.577 34.313 1.00 121.37 ? 287 ILE A CG2 1 
ATOM   2080 C CD1 . ILE A 1 287 ? 25.855 33.193 33.500 1.00 123.79 ? 287 ILE A CD1 1 
ATOM   2081 N N   . TYR A 1 288 ? 22.273 29.973 36.102 1.00 118.68 ? 288 TYR A N   1 
ATOM   2082 C CA  . TYR A 1 288 ? 20.919 29.566 35.749 1.00 107.32 ? 288 TYR A CA  1 
ATOM   2083 C C   . TYR A 1 288 ? 19.966 29.930 36.875 1.00 105.86 ? 288 TYR A C   1 
ATOM   2084 O O   . TYR A 1 288 ? 18.923 30.542 36.649 1.00 111.09 ? 288 TYR A O   1 
ATOM   2085 C CB  . TYR A 1 288 ? 20.855 28.062 35.479 1.00 98.77  ? 288 TYR A CB  1 
ATOM   2086 C CG  . TYR A 1 288 ? 21.671 27.622 34.288 1.00 102.06 ? 288 TYR A CG  1 
ATOM   2087 C CD1 . TYR A 1 288 ? 21.735 28.401 33.141 1.00 101.72 ? 288 TYR A CD1 1 
ATOM   2088 C CD2 . TYR A 1 288 ? 22.366 26.420 34.303 1.00 101.71 ? 288 TYR A CD2 1 
ATOM   2089 C CE1 . TYR A 1 288 ? 22.476 28.002 32.048 1.00 95.52  ? 288 TYR A CE1 1 
ATOM   2090 C CE2 . TYR A 1 288 ? 23.110 26.012 33.214 1.00 99.53  ? 288 TYR A CE2 1 
ATOM   2091 C CZ  . TYR A 1 288 ? 23.161 26.807 32.089 1.00 99.92  ? 288 TYR A CZ  1 
ATOM   2092 O OH  . TYR A 1 288 ? 23.900 26.406 30.999 1.00 105.58 ? 288 TYR A OH  1 
ATOM   2093 N N   . ALA A 1 289 ? 20.337 29.554 38.094 1.00 103.06 ? 289 ALA A N   1 
ATOM   2094 C CA  . ALA A 1 289 ? 19.535 29.858 39.271 1.00 108.21 ? 289 ALA A CA  1 
ATOM   2095 C C   . ALA A 1 289 ? 19.473 31.361 39.532 1.00 122.12 ? 289 ALA A C   1 
ATOM   2096 O O   . ALA A 1 289 ? 18.842 31.806 40.490 1.00 133.75 ? 289 ALA A O   1 
ATOM   2097 C CB  . ALA A 1 289 ? 20.084 29.127 40.487 1.00 98.78  ? 289 ALA A CB  1 
ATOM   2098 N N   . TYR A 1 290 ? 20.128 32.139 38.677 1.00 121.94 ? 290 TYR A N   1 
ATOM   2099 C CA  . TYR A 1 290 ? 20.142 33.590 38.824 1.00 130.01 ? 290 TYR A CA  1 
ATOM   2100 C C   . TYR A 1 290 ? 19.491 34.282 37.630 1.00 130.14 ? 290 TYR A C   1 
ATOM   2101 O O   . TYR A 1 290 ? 18.608 35.124 37.794 1.00 123.78 ? 290 TYR A O   1 
ATOM   2102 C CB  . TYR A 1 290 ? 21.575 34.096 39.004 1.00 138.17 ? 290 TYR A CB  1 
ATOM   2103 C CG  . TYR A 1 290 ? 21.673 35.579 39.283 1.00 153.95 ? 290 TYR A CG  1 
ATOM   2104 C CD1 . TYR A 1 290 ? 21.681 36.061 40.585 1.00 161.13 ? 290 TYR A CD1 1 
ATOM   2105 C CD2 . TYR A 1 290 ? 21.759 36.498 38.244 1.00 159.76 ? 290 TYR A CD2 1 
ATOM   2106 C CE1 . TYR A 1 290 ? 21.771 37.416 40.846 1.00 166.62 ? 290 TYR A CE1 1 
ATOM   2107 C CE2 . TYR A 1 290 ? 21.849 37.855 38.495 1.00 164.26 ? 290 TYR A CE2 1 
ATOM   2108 C CZ  . TYR A 1 290 ? 21.855 38.308 39.797 1.00 167.57 ? 290 TYR A CZ  1 
ATOM   2109 O OH  . TYR A 1 290 ? 21.945 39.657 40.053 1.00 170.89 ? 290 TYR A OH  1 
ATOM   2110 N N   . ARG A 1 291 ? 19.933 33.921 36.429 1.00 133.70 ? 291 ARG A N   1 
ATOM   2111 C CA  . ARG A 1 291 ? 19.432 34.540 35.206 1.00 135.25 ? 291 ARG A CA  1 
ATOM   2112 C C   . ARG A 1 291 ? 18.110 33.934 34.744 1.00 133.74 ? 291 ARG A C   1 
ATOM   2113 O O   . ARG A 1 291 ? 17.360 34.561 33.997 1.00 130.08 ? 291 ARG A O   1 
ATOM   2114 C CB  . ARG A 1 291 ? 20.473 34.436 34.089 1.00 128.25 ? 291 ARG A CB  1 
ATOM   2115 C CG  . ARG A 1 291 ? 21.620 35.422 34.217 1.00 123.95 ? 291 ARG A CG  1 
ATOM   2116 C CD  . ARG A 1 291 ? 21.144 36.844 33.973 1.00 126.18 ? 291 ARG A CD  1 
ATOM   2117 N NE  . ARG A 1 291 ? 20.605 37.012 32.626 1.00 127.57 ? 291 ARG A NE  1 
ATOM   2118 C CZ  . ARG A 1 291 ? 20.102 38.149 32.157 1.00 133.25 ? 291 ARG A CZ  1 
ATOM   2119 N NH1 . ARG A 1 291 ? 20.064 39.228 32.927 1.00 137.62 ? 291 ARG A NH1 1 
ATOM   2120 N NH2 . ARG A 1 291 ? 19.635 38.208 30.917 1.00 132.18 ? 291 ARG A NH2 1 
ATOM   2121 N N   . ILE A 1 292 ? 17.830 32.714 35.189 1.00 132.81 ? 292 ILE A N   1 
ATOM   2122 C CA  . ILE A 1 292 ? 16.614 32.022 34.784 1.00 129.69 ? 292 ILE A CA  1 
ATOM   2123 C C   . ILE A 1 292 ? 15.667 31.825 35.961 1.00 133.84 ? 292 ILE A C   1 
ATOM   2124 O O   . ILE A 1 292 ? 15.972 31.088 36.900 1.00 132.52 ? 292 ILE A O   1 
ATOM   2125 C CB  . ILE A 1 292 ? 16.927 30.655 34.151 1.00 124.79 ? 292 ILE A CB  1 
ATOM   2126 C CG1 . ILE A 1 292 ? 18.000 30.802 33.070 1.00 129.61 ? 292 ILE A CG1 1 
ATOM   2127 C CG2 . ILE A 1 292 ? 15.664 30.031 33.581 1.00 115.09 ? 292 ILE A CG2 1 
ATOM   2128 C CD1 . ILE A 1 292 ? 17.627 31.768 31.967 1.00 132.65 ? 292 ILE A CD1 1 
ATOM   2129 N N   . ARG A 1 293 ? 14.518 32.491 35.903 1.00 175.49 ? 293 ARG A N   1 
ATOM   2130 C CA  . ARG A 1 293 ? 13.514 32.383 36.953 1.00 178.82 ? 293 ARG A CA  1 
ATOM   2131 C C   . ARG A 1 293 ? 12.895 30.990 36.970 1.00 169.56 ? 293 ARG A C   1 
ATOM   2132 O O   . ARG A 1 293 ? 12.530 30.475 38.026 1.00 170.84 ? 293 ARG A O   1 
ATOM   2133 C CB  . ARG A 1 293 ? 12.426 33.442 36.764 1.00 195.16 ? 293 ARG A CB  1 
ATOM   2134 C CG  . ARG A 1 293 ? 11.646 33.308 35.466 1.00 208.82 ? 293 ARG A CG  1 
ATOM   2135 C CD  . ARG A 1 293 ? 10.605 34.409 35.330 1.00 222.58 ? 293 ARG A CD  1 
ATOM   2136 N NE  . ARG A 1 293 ? 9.787  34.243 34.131 1.00 229.58 ? 293 ARG A NE  1 
ATOM   2137 C CZ  . ARG A 1 293 ? 10.109 34.723 32.934 1.00 233.34 ? 293 ARG A CZ  1 
ATOM   2138 N NH1 . ARG A 1 293 ? 11.237 35.401 32.771 1.00 233.00 ? 293 ARG A NH1 1 
ATOM   2139 N NH2 . ARG A 1 293 ? 9.304  34.523 31.900 1.00 236.32 ? 293 ARG A NH2 1 
ATOM   2140 N N   . GLU A 1 294 ? 12.779 30.384 35.793 1.00 159.54 ? 294 GLU A N   1 
ATOM   2141 C CA  . GLU A 1 294 ? 12.224 29.042 35.677 1.00 155.62 ? 294 GLU A CA  1 
ATOM   2142 C C   . GLU A 1 294 ? 13.137 28.016 36.339 1.00 148.28 ? 294 GLU A C   1 
ATOM   2143 O O   . GLU A 1 294 ? 12.667 27.071 36.973 1.00 146.61 ? 294 GLU A O   1 
ATOM   2144 C CB  . GLU A 1 294 ? 12.000 28.681 34.207 1.00 157.67 ? 294 GLU A CB  1 
ATOM   2145 C CG  . GLU A 1 294 ? 11.648 27.220 33.966 1.00 162.78 ? 294 GLU A CG  1 
ATOM   2146 C CD  . GLU A 1 294 ? 10.341 26.811 34.616 1.00 176.65 ? 294 GLU A CD  1 
ATOM   2147 O OE1 . GLU A 1 294 ? 10.124 25.595 34.799 1.00 179.00 ? 294 GLU A OE1 1 
ATOM   2148 O OE2 . GLU A 1 294 ? 9.531  27.703 34.946 1.00 185.40 ? 294 GLU A OE2 1 
ATOM   2149 N N   . PHE A 1 295 ? 14.443 28.214 36.192 1.00 145.05 ? 295 PHE A N   1 
ATOM   2150 C CA  . PHE A 1 295 ? 15.435 27.297 36.743 1.00 135.29 ? 295 PHE A CA  1 
ATOM   2151 C C   . PHE A 1 295 ? 15.506 27.356 38.267 1.00 135.34 ? 295 PHE A C   1 
ATOM   2152 O O   . PHE A 1 295 ? 15.439 26.326 38.937 1.00 116.61 ? 295 PHE A O   1 
ATOM   2153 C CB  . PHE A 1 295 ? 16.816 27.583 36.149 1.00 126.94 ? 295 PHE A CB  1 
ATOM   2154 C CG  . PHE A 1 295 ? 17.229 26.617 35.075 1.00 128.39 ? 295 PHE A CG  1 
ATOM   2155 C CD1 . PHE A 1 295 ? 17.778 25.388 35.404 1.00 124.08 ? 295 PHE A CD1 1 
ATOM   2156 C CD2 . PHE A 1 295 ? 17.081 26.940 33.736 1.00 133.24 ? 295 PHE A CD2 1 
ATOM   2157 C CE1 . PHE A 1 295 ? 18.164 24.497 34.422 1.00 119.29 ? 295 PHE A CE1 1 
ATOM   2158 C CE2 . PHE A 1 295 ? 17.467 26.053 32.748 1.00 130.75 ? 295 PHE A CE2 1 
ATOM   2159 C CZ  . PHE A 1 295 ? 18.009 24.830 33.092 1.00 122.76 ? 295 PHE A CZ  1 
ATOM   2160 N N   . ARG A 1 296 ? 15.645 28.562 38.808 1.00 137.17 ? 296 ARG A N   1 
ATOM   2161 C CA  . ARG A 1 296 ? 15.790 28.741 40.250 1.00 137.48 ? 296 ARG A CA  1 
ATOM   2162 C C   . ARG A 1 296 ? 14.651 28.095 41.034 1.00 141.20 ? 296 ARG A C   1 
ATOM   2163 O O   . ARG A 1 296 ? 14.880 27.450 42.057 1.00 140.62 ? 296 ARG A O   1 
ATOM   2164 C CB  . ARG A 1 296 ? 15.905 30.226 40.609 1.00 139.06 ? 296 ARG A CB  1 
ATOM   2165 C CG  . ARG A 1 296 ? 14.755 31.084 40.113 1.00 150.33 ? 296 ARG A CG  1 
ATOM   2166 C CD  . ARG A 1 296 ? 14.781 32.468 40.745 1.00 158.63 ? 296 ARG A CD  1 
ATOM   2167 N NE  . ARG A 1 296 ? 16.057 33.146 40.538 1.00 159.33 ? 296 ARG A NE  1 
ATOM   2168 C CZ  . ARG A 1 296 ? 16.339 34.363 40.992 1.00 164.35 ? 296 ARG A CZ  1 
ATOM   2169 N NH1 . ARG A 1 296 ? 17.527 34.904 40.757 1.00 162.01 ? 296 ARG A NH1 1 
ATOM   2170 N NH2 . ARG A 1 296 ? 15.431 35.042 41.682 1.00 168.35 ? 296 ARG A NH2 1 
ATOM   2171 N N   . GLN A 1 297 ? 13.426 28.268 40.548 1.00 148.07 ? 297 GLN A N   1 
ATOM   2172 C CA  . GLN A 1 297 ? 12.253 27.715 41.216 1.00 155.96 ? 297 GLN A CA  1 
ATOM   2173 C C   . GLN A 1 297 ? 12.292 26.192 41.230 1.00 156.25 ? 297 GLN A C   1 
ATOM   2174 O O   . GLN A 1 297 ? 11.813 25.557 42.170 1.00 155.24 ? 297 GLN A O   1 
ATOM   2175 C CB  . GLN A 1 297 ? 10.976 28.204 40.535 1.00 161.82 ? 297 GLN A CB  1 
ATOM   2176 C CG  . GLN A 1 297 ? 10.817 29.713 40.550 1.00 166.58 ? 297 GLN A CG  1 
ATOM   2177 C CD  . GLN A 1 297 ? 9.625  30.178 39.741 1.00 176.49 ? 297 GLN A CD  1 
ATOM   2178 O OE1 . GLN A 1 297 ? 8.819  29.369 39.281 1.00 182.58 ? 297 GLN A OE1 1 
ATOM   2179 N NE2 . GLN A 1 297 ? 9.508  31.488 39.561 1.00 179.66 ? 297 GLN A NE2 1 
ATOM   2180 N N   . THR A 1 298 ? 12.866 25.613 40.182 1.00 156.11 ? 298 THR A N   1 
ATOM   2181 C CA  . THR A 1 298 ? 12.999 24.166 40.086 1.00 154.74 ? 298 THR A CA  1 
ATOM   2182 C C   . THR A 1 298 ? 13.989 23.653 41.125 1.00 153.98 ? 298 THR A C   1 
ATOM   2183 O O   . THR A 1 298 ? 13.694 22.714 41.864 1.00 154.30 ? 298 THR A O   1 
ATOM   2184 C CB  . THR A 1 298 ? 13.467 23.735 38.686 1.00 151.54 ? 298 THR A CB  1 
ATOM   2185 O OG1 . THR A 1 298 ? 12.588 24.282 37.696 1.00 158.04 ? 298 THR A OG1 1 
ATOM   2186 C CG2 . THR A 1 298 ? 13.472 22.220 38.572 1.00 150.53 ? 298 THR A CG2 1 
ATOM   2187 N N   . PHE A 1 299 ? 15.164 24.276 41.175 1.00 153.09 ? 299 PHE A N   1 
ATOM   2188 C CA  . PHE A 1 299 ? 16.188 23.904 42.144 1.00 152.00 ? 299 PHE A CA  1 
ATOM   2189 C C   . PHE A 1 299 ? 15.646 24.003 43.565 1.00 156.31 ? 299 PHE A C   1 
ATOM   2190 O O   . PHE A 1 299 ? 15.875 23.121 44.392 1.00 157.31 ? 299 PHE A O   1 
ATOM   2191 C CB  . PHE A 1 299 ? 17.423 24.797 42.003 1.00 155.50 ? 299 PHE A CB  1 
ATOM   2192 C CG  . PHE A 1 299 ? 18.077 24.728 40.652 1.00 160.75 ? 299 PHE A CG  1 
ATOM   2193 C CD1 . PHE A 1 299 ? 18.571 23.529 40.166 1.00 159.86 ? 299 PHE A CD1 1 
ATOM   2194 C CD2 . PHE A 1 299 ? 18.218 25.867 39.877 1.00 163.26 ? 299 PHE A CD2 1 
ATOM   2195 C CE1 . PHE A 1 299 ? 19.179 23.465 38.927 1.00 155.31 ? 299 PHE A CE1 1 
ATOM   2196 C CE2 . PHE A 1 299 ? 18.826 25.809 38.638 1.00 159.33 ? 299 PHE A CE2 1 
ATOM   2197 C CZ  . PHE A 1 299 ? 19.307 24.607 38.163 1.00 154.85 ? 299 PHE A CZ  1 
ATOM   2198 N N   . ARG A 1 300 ? 14.927 25.088 43.837 1.00 160.59 ? 300 ARG A N   1 
ATOM   2199 C CA  . ARG A 1 300 ? 14.347 25.325 45.154 1.00 164.54 ? 300 ARG A CA  1 
ATOM   2200 C C   . ARG A 1 300 ? 13.486 24.144 45.592 1.00 166.99 ? 300 ARG A C   1 
ATOM   2201 O O   . ARG A 1 300 ? 13.553 23.708 46.741 1.00 166.95 ? 300 ARG A O   1 
ATOM   2202 C CB  . ARG A 1 300 ? 13.518 26.611 45.139 1.00 174.35 ? 300 ARG A CB  1 
ATOM   2203 C CG  . ARG A 1 300 ? 13.005 27.048 46.500 1.00 182.83 ? 300 ARG A CG  1 
ATOM   2204 C CD  . ARG A 1 300 ? 12.274 28.378 46.399 1.00 192.31 ? 300 ARG A CD  1 
ATOM   2205 N NE  . ARG A 1 300 ? 13.131 29.431 45.861 1.00 191.55 ? 300 ARG A NE  1 
ATOM   2206 C CZ  . ARG A 1 300 ? 12.724 30.670 45.607 1.00 197.05 ? 300 ARG A CZ  1 
ATOM   2207 N NH1 . ARG A 1 300 ? 11.465 31.018 45.841 1.00 205.61 ? 300 ARG A NH1 1 
ATOM   2208 N NH2 . ARG A 1 300 ? 13.574 31.563 45.118 1.00 192.34 ? 300 ARG A NH2 1 
ATOM   2209 N N   . LYS A 1 301 ? 12.682 23.631 44.666 1.00 168.21 ? 301 LYS A N   1 
ATOM   2210 C CA  . LYS A 1 301 ? 11.842 22.469 44.931 1.00 168.16 ? 301 LYS A CA  1 
ATOM   2211 C C   . LYS A 1 301 ? 12.678 21.273 45.369 1.00 174.14 ? 301 LYS A C   1 
ATOM   2212 O O   . LYS A 1 301 ? 12.400 20.648 46.392 1.00 178.01 ? 301 LYS A O   1 
ATOM   2213 C CB  . LYS A 1 301 ? 11.045 22.095 43.683 1.00 161.69 ? 301 LYS A CB  1 
ATOM   2214 C CG  . LYS A 1 301 ? 10.288 20.784 43.812 1.00 158.41 ? 301 LYS A CG  1 
ATOM   2215 C CD  . LYS A 1 301 ? 10.161 20.086 42.469 1.00 154.72 ? 301 LYS A CD  1 
ATOM   2216 C CE  . LYS A 1 301 ? 9.499  20.982 41.437 1.00 153.05 ? 301 LYS A CE  1 
ATOM   2217 N NZ  . LYS A 1 301 ? 9.426  20.319 40.108 1.00 144.09 ? 301 LYS A NZ  1 
ATOM   2218 N N   . ILE A 1 302 ? 13.700 20.960 44.578 1.00 173.62 ? 302 ILE A N   1 
ATOM   2219 C CA  . ILE A 1 302 ? 14.564 19.815 44.842 1.00 171.73 ? 302 ILE A CA  1 
ATOM   2220 C C   . ILE A 1 302 ? 15.133 19.844 46.257 1.00 173.36 ? 302 ILE A C   1 
ATOM   2221 O O   . ILE A 1 302 ? 14.947 18.903 47.029 1.00 176.83 ? 302 ILE A O   1 
ATOM   2222 C CB  . ILE A 1 302 ? 15.731 19.748 43.836 1.00 165.81 ? 302 ILE A CB  1 
ATOM   2223 C CG1 . ILE A 1 302 ? 15.199 19.621 42.406 1.00 163.04 ? 302 ILE A CG1 1 
ATOM   2224 C CG2 . ILE A 1 302 ? 16.655 18.589 44.167 1.00 162.68 ? 302 ILE A CG2 1 
ATOM   2225 C CD1 . ILE A 1 302 ? 16.286 19.547 41.353 1.00 152.23 ? 302 ILE A CD1 1 
ATOM   2226 N N   . ILE A 1 303 ? 15.824 20.929 46.588 1.00 170.47 ? 303 ILE A N   1 
ATOM   2227 C CA  . ILE A 1 303 ? 16.463 21.069 47.893 1.00 166.33 ? 303 ILE A CA  1 
ATOM   2228 C C   . ILE A 1 303 ? 15.468 20.903 49.037 1.00 176.91 ? 303 ILE A C   1 
ATOM   2229 O O   . ILE A 1 303 ? 15.640 20.041 49.900 1.00 180.65 ? 303 ILE A O   1 
ATOM   2230 C CB  . ILE A 1 303 ? 17.166 22.432 48.031 1.00 155.84 ? 303 ILE A CB  1 
ATOM   2231 C CG1 . ILE A 1 303 ? 18.183 22.622 46.903 1.00 141.10 ? 303 ILE A CG1 1 
ATOM   2232 C CG2 . ILE A 1 303 ? 17.837 22.549 49.390 1.00 152.55 ? 303 ILE A CG2 1 
ATOM   2233 C CD1 . ILE A 1 303 ? 18.897 23.954 46.944 1.00 132.27 ? 303 ILE A CD1 1 
ATOM   2234 N N   . ARG A 1 304 ? 14.430 21.733 49.041 1.00 181.20 ? 304 ARG A N   1 
ATOM   2235 C CA  . ARG A 1 304 ? 13.410 21.679 50.082 1.00 189.08 ? 304 ARG A CA  1 
ATOM   2236 C C   . ARG A 1 304 ? 12.827 20.277 50.217 1.00 189.77 ? 304 ARG A C   1 
ATOM   2237 O O   . ARG A 1 304 ? 12.649 19.774 51.326 1.00 190.54 ? 304 ARG A O   1 
ATOM   2238 C CB  . ARG A 1 304 ? 12.296 22.690 49.798 1.00 200.04 ? 304 ARG A CB  1 
ATOM   2239 C CG  . ARG A 1 304 ? 12.749 24.139 49.847 1.00 204.27 ? 304 ARG A CG  1 
ATOM   2240 C CD  . ARG A 1 304 ? 11.592 25.093 49.599 1.00 210.03 ? 304 ARG A CD  1 
ATOM   2241 N NE  . ARG A 1 304 ? 12.006 26.489 49.713 1.00 210.48 ? 304 ARG A NE  1 
ATOM   2242 C CZ  . ARG A 1 304 ? 11.195 27.527 49.536 1.00 213.39 ? 304 ARG A CZ  1 
ATOM   2243 N NH1 . ARG A 1 304 ? 11.659 28.763 49.661 1.00 212.30 ? 304 ARG A NH1 1 
ATOM   2244 N NH2 . ARG A 1 304 ? 9.919  27.330 49.233 1.00 218.51 ? 304 ARG A NH2 1 
ATOM   2245 N N   . SER A 1 305 ? 12.536 19.650 49.083 1.00 190.83 ? 305 SER A N   1 
ATOM   2246 C CA  . SER A 1 305 ? 11.965 18.309 49.075 1.00 191.85 ? 305 SER A CA  1 
ATOM   2247 C C   . SER A 1 305 ? 13.013 17.265 48.707 1.00 182.72 ? 305 SER A C   1 
ATOM   2248 O O   . SER A 1 305 ? 13.762 16.794 49.563 1.00 179.76 ? 305 SER A O   1 
ATOM   2249 C CB  . SER A 1 305 ? 10.783 18.236 48.105 1.00 198.91 ? 305 SER A CB  1 
ATOM   2250 O OG  . SER A 1 305 ? 10.174 16.957 48.135 1.00 200.63 ? 305 SER A OG  1 
HETATM 2251 C C1  . ZMA B 2 .   ? 50.372 22.867 38.115 1.00 173.71 ? 401 ZMA A C1  1 
HETATM 2252 C C2  . ZMA B 2 .   ? 49.231 22.640 38.888 1.00 177.24 ? 401 ZMA A C2  1 
HETATM 2253 C C3  . ZMA B 2 .   ? 48.337 21.635 38.528 1.00 175.27 ? 401 ZMA A C3  1 
HETATM 2254 O O4  . ZMA B 2 .   ? 47.234 21.447 39.313 1.00 170.79 ? 401 ZMA A O4  1 
HETATM 2255 C C5  . ZMA B 2 .   ? 48.566 20.850 37.404 1.00 175.65 ? 401 ZMA A C5  1 
HETATM 2256 C C6  . ZMA B 2 .   ? 49.707 21.076 36.631 1.00 174.53 ? 401 ZMA A C6  1 
HETATM 2257 C C7  . ZMA B 2 .   ? 50.620 22.085 36.979 1.00 168.98 ? 401 ZMA A C7  1 
HETATM 2258 C C8  . ZMA B 2 .   ? 51.845 22.323 36.134 1.00 157.13 ? 401 ZMA A C8  1 
HETATM 2259 C C9  . ZMA B 2 .   ? 51.726 21.611 34.783 1.00 151.69 ? 401 ZMA A C9  1 
HETATM 2260 N N10 . ZMA B 2 .   ? 52.252 22.424 33.700 1.00 150.44 ? 401 ZMA A N10 1 
HETATM 2261 C C11 . ZMA B 2 .   ? 51.494 23.047 32.750 1.00 152.77 ? 401 ZMA A C11 1 
HETATM 2262 N N12 . ZMA B 2 .   ? 50.169 22.717 32.633 1.00 152.22 ? 401 ZMA A N12 1 
HETATM 2263 N N13 . ZMA B 2 .   ? 52.186 23.963 31.994 1.00 157.25 ? 401 ZMA A N13 1 
HETATM 2264 C C14 . ZMA B 2 .   ? 51.539 24.642 31.018 1.00 158.86 ? 401 ZMA A C14 1 
HETATM 2265 N N15 . ZMA B 2 .   ? 52.126 25.574 30.207 1.00 162.77 ? 401 ZMA A N15 1 
HETATM 2266 N N16 . ZMA B 2 .   ? 50.128 24.310 30.873 1.00 154.23 ? 401 ZMA A N16 1 
HETATM 2267 N N17 . ZMA B 2 .   ? 49.125 24.785 29.992 1.00 151.70 ? 401 ZMA A N17 1 
HETATM 2268 C C18 . ZMA B 2 .   ? 49.501 23.382 31.665 1.00 152.27 ? 401 ZMA A C18 1 
HETATM 2269 N N19 . ZMA B 2 .   ? 48.146 23.256 31.314 1.00 149.00 ? 401 ZMA A N19 1 
HETATM 2270 C C20 . ZMA B 2 .   ? 47.947 24.118 30.299 1.00 146.59 ? 401 ZMA A C20 1 
HETATM 2271 C C21 . ZMA B 2 .   ? 46.671 24.342 29.586 1.00 135.66 ? 401 ZMA A C21 1 
HETATM 2272 C C22 . ZMA B 2 .   ? 45.527 23.578 29.709 1.00 132.56 ? 401 ZMA A C22 1 
HETATM 2273 C C23 . ZMA B 2 .   ? 44.558 24.147 28.845 1.00 131.70 ? 401 ZMA A C23 1 
HETATM 2274 C C24 . ZMA B 2 .   ? 45.166 25.223 28.241 1.00 129.30 ? 401 ZMA A C24 1 
HETATM 2275 O O25 . ZMA B 2 .   ? 46.443 25.348 28.680 1.00 130.08 ? 401 ZMA A O25 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 7   ? 2.6572 2.5803 1.9160 -0.1169 -0.3611 0.6400  7   SER A N   
2    C CA  . SER A 7   ? 2.6378 2.5786 1.8992 -0.1134 -0.3500 0.6587  7   SER A CA  
3    C C   . SER A 7   ? 2.6640 2.6006 1.8921 -0.1038 -0.3288 0.6444  7   SER A C   
4    O O   . SER A 7   ? 2.6362 2.5863 1.8662 -0.0988 -0.3163 0.6566  7   SER A O   
5    C CB  . SER A 7   ? 2.6332 2.5974 1.8802 -0.1197 -0.3597 0.6919  7   SER A CB  
6    O OG  . SER A 7   ? 2.5988 2.5812 1.8508 -0.1163 -0.3492 0.7118  7   SER A OG  
7    N N   . VAL A 8   ? 2.7159 2.6338 1.9138 -0.1012 -0.3247 0.6193  8   VAL A N   
8    C CA  . VAL A 8   ? 2.7424 2.6522 1.9053 -0.0916 -0.3043 0.6035  8   VAL A CA  
9    C C   . VAL A 8   ? 2.6345 2.5376 1.8287 -0.0827 -0.2895 0.5884  8   VAL A C   
10   O O   . VAL A 8   ? 2.5992 2.5083 1.7802 -0.0740 -0.2715 0.5898  8   VAL A O   
11   C CB  . VAL A 8   ? 2.8227 2.7111 1.9464 -0.0920 -0.3049 0.5792  8   VAL A CB  
12   C CG1 . VAL A 8   ? 2.7898 2.6604 1.9441 -0.0955 -0.3162 0.5594  8   VAL A CG1 
13   C CG2 . VAL A 8   ? 2.8479 2.7239 1.9392 -0.0808 -0.2826 0.5602  8   VAL A CG2 
14   N N   . TYR A 9   ? 2.5822 2.4729 1.8175 -0.0847 -0.2968 0.5747  9   TYR A N   
15   C CA  . TYR A 9   ? 2.5484 2.4314 1.8150 -0.0775 -0.2848 0.5595  9   TYR A CA  
16   C C   . TYR A 9   ? 2.4150 2.3146 1.7251 -0.0810 -0.2891 0.5809  9   TYR A C   
17   O O   . TYR A 9   ? 2.4069 2.3086 1.7383 -0.0756 -0.2776 0.5772  9   TYR A O   
18   C CB  . TYR A 9   ? 2.6869 2.5442 1.9708 -0.0771 -0.2887 0.5298  9   TYR A CB  
19   C CG  . TYR A 9   ? 2.8776 2.7158 2.1220 -0.0727 -0.2819 0.5054  9   TYR A CG  
20   C CD1 . TYR A 9   ? 2.9435 2.7721 2.1699 -0.0618 -0.2618 0.4872  9   TYR A CD1 
21   C CD2 . TYR A 9   ? 2.9559 2.7856 2.1815 -0.0797 -0.2957 0.5013  9   TYR A CD2 
22   C CE1 . TYR A 9   ? 3.0015 2.8105 2.1909 -0.0581 -0.2556 0.4649  9   TYR A CE1 
23   C CE2 . TYR A 9   ? 3.0112 2.8226 2.2003 -0.0770 -0.2903 0.4795  9   TYR A CE2 
24   C CZ  . TYR A 9   ? 3.0322 2.8322 2.2028 -0.0663 -0.2702 0.4610  9   TYR A CZ  
25   O OH  . TYR A 9   ? 3.0559 2.8356 2.1893 -0.0639 -0.2649 0.4394  9   TYR A OH  
26   N N   . ILE A 10  ? 2.3388 2.2499 1.6618 -0.0904 -0.3062 0.6037  10  ILE A N   
27   C CA  . ILE A 10  ? 2.2524 2.1779 1.6153 -0.0952 -0.3124 0.6261  10  ILE A CA  
28   C C   . ILE A 10  ? 2.1213 2.0666 1.4815 -0.0900 -0.2973 0.6421  10  ILE A C   
29   O O   . ILE A 10  ? 2.0985 2.0474 1.4924 -0.0894 -0.2933 0.6448  10  ILE A O   
30   C CB  . ILE A 10  ? 2.3239 2.2618 1.6915 -0.1050 -0.3312 0.6524  10  ILE A CB  
31   C CG1 . ILE A 10  ? 2.3680 2.2881 1.7462 -0.1100 -0.3467 0.6392  10  ILE A CG1 
32   C CG2 . ILE A 10  ? 2.3022 2.2554 1.7069 -0.1098 -0.3363 0.6777  10  ILE A CG2 
33   C CD1 . ILE A 10  ? 2.4149 2.3466 1.8010 -0.1190 -0.3655 0.6649  10  ILE A CD1 
34   N N   . THR A 11  ? 1.9887 1.9466 1.3077 -0.0864 -0.2891 0.6532  11  THR A N   
35   C CA  . THR A 11  ? 1.7649 1.7432 1.0770 -0.0803 -0.2735 0.6705  11  THR A CA  
36   C C   . THR A 11  ? 1.4949 1.4658 0.8179 -0.0706 -0.2557 0.6508  11  THR A C   
37   O O   . THR A 11  ? 1.4233 1.4091 0.7722 -0.0689 -0.2488 0.6641  11  THR A O   
38   C CB  . THR A 11  ? 1.8084 1.7959 1.0666 -0.0763 -0.2656 0.6804  11  THR A CB  
39   O OG1 . THR A 11  ? 1.7994 1.7972 1.0488 -0.0857 -0.2823 0.7020  11  THR A OG1 
40   C CG2 . THR A 11  ? 1.8626 1.8709 1.1138 -0.0683 -0.2474 0.6982  11  THR A CG2 
41   N N   . VAL A 12  ? 1.3618 1.3101 0.6654 -0.0645 -0.2487 0.6200  12  VAL A N   
42   C CA  . VAL A 12  ? 1.3725 1.3118 0.6841 -0.0545 -0.2316 0.5990  12  VAL A CA  
43   C C   . VAL A 12  ? 1.4937 1.4340 0.8584 -0.0580 -0.2358 0.5989  12  VAL A C   
44   O O   . VAL A 12  ? 1.5876 1.5384 0.9676 -0.0522 -0.2229 0.6025  12  VAL A O   
45   C CB  . VAL A 12  ? 1.2792 1.1902 0.5681 -0.0494 -0.2274 0.5643  12  VAL A CB  
46   C CG1 . VAL A 12  ? 1.1316 1.0317 0.4381 -0.0401 -0.2125 0.5418  12  VAL A CG1 
47   C CG2 . VAL A 12  ? 1.3256 1.2338 0.5574 -0.0446 -0.2193 0.5627  12  VAL A CG2 
48   N N   . GLU A 13  ? 1.4934 1.4226 0.8854 -0.0674 -0.2539 0.5952  13  GLU A N   
49   C CA  . GLU A 13  ? 1.5133 1.4398 0.9531 -0.0722 -0.2599 0.5947  13  GLU A CA  
50   C C   . GLU A 13  ? 1.5055 1.4583 0.9678 -0.0768 -0.2612 0.6273  13  GLU A C   
51   O O   . GLU A 13  ? 1.4601 1.4171 0.9523 -0.0768 -0.2568 0.6284  13  GLU A O   
52   C CB  . GLU A 13  ? 1.5312 1.4396 0.9916 -0.0810 -0.2791 0.5864  13  GLU A CB  
53   C CG  . GLU A 13  ? 1.5150 1.3951 0.9732 -0.0765 -0.2768 0.5507  13  GLU A CG  
54   C CD  . GLU A 13  ? 1.4504 1.3218 0.9326 -0.0714 -0.2661 0.5326  13  GLU A CD  
55   O OE1 . GLU A 13  ? 1.3683 1.2520 0.8793 -0.0751 -0.2671 0.5478  13  GLU A OE1 
56   O OE2 . GLU A 13  ? 1.4517 1.3041 0.9238 -0.0642 -0.2573 0.5035  13  GLU A OE2 
57   N N   . LEU A 14  ? 1.5156 1.4863 0.9633 -0.0813 -0.2676 0.6544  14  LEU A N   
58   C CA  . LEU A 14  ? 1.5536 1.5505 1.0200 -0.0857 -0.2687 0.6878  14  LEU A CA  
59   C C   . LEU A 14  ? 1.6436 1.6589 1.0977 -0.0757 -0.2477 0.6952  14  LEU A C   
60   O O   . LEU A 14  ? 1.6686 1.7000 1.1512 -0.0772 -0.2442 0.7112  14  LEU A O   
61   C CB  . LEU A 14  ? 1.5047 1.5154 0.9564 -0.0924 -0.2807 0.7145  14  LEU A CB  
62   C CG  . LEU A 14  ? 1.4150 1.4121 0.8824 -0.1024 -0.3022 0.7139  14  LEU A CG  
63   C CD1 . LEU A 14  ? 1.3608 1.3755 0.8145 -0.1084 -0.3127 0.7438  14  LEU A CD1 
64   C CD2 . LEU A 14  ? 1.3625 1.3513 0.8777 -0.1094 -0.3120 0.7139  14  LEU A CD2 
65   N N   . ALA A 15  ? 1.6289 1.6415 1.0397 -0.0655 -0.2337 0.6841  15  ALA A N   
66   C CA  . ALA A 15  ? 1.5332 1.5608 0.9273 -0.0538 -0.2117 0.6894  15  ALA A CA  
67   C C   . ALA A 15  ? 1.4661 1.4896 0.8908 -0.0492 -0.2022 0.6744  15  ALA A C   
68   O O   . ALA A 15  ? 1.5394 1.5842 0.9809 -0.0460 -0.1921 0.6919  15  ALA A O   
69   C CB  . ALA A 15  ? 1.4955 1.5127 0.8358 -0.0437 -0.1991 0.6740  15  ALA A CB  
70   N N   . ILE A 16  ? 1.3639 1.3607 0.7961 -0.0488 -0.2055 0.6427  16  ILE A N   
71   C CA  . ILE A 16  ? 1.3776 1.3677 0.8388 -0.0452 -0.1982 0.6260  16  ILE A CA  
72   C C   . ILE A 16  ? 1.5232 1.5259 1.0323 -0.0560 -0.2095 0.6452  16  ILE A C   
73   O O   . ILE A 16  ? 1.5724 1.5866 1.1039 -0.0533 -0.2005 0.6494  16  ILE A O   
74   C CB  . ILE A 16  ? 1.2979 1.2554 0.7589 -0.0441 -0.2019 0.5888  16  ILE A CB  
75   C CG1 . ILE A 16  ? 1.3705 1.3143 0.7852 -0.0326 -0.1883 0.5680  16  ILE A CG1 
76   C CG2 . ILE A 16  ? 1.1537 1.1045 0.6492 -0.0427 -0.1976 0.5736  16  ILE A CG2 
77   C CD1 . ILE A 16  ? 1.3640 1.2769 0.7783 -0.0298 -0.1891 0.5313  16  ILE A CD1 
78   N N   . ALA A 17  ? 1.5870 1.5872 1.1111 -0.0685 -0.2296 0.6575  17  ALA A N   
79   C CA  . ALA A 17  ? 1.6301 1.6386 1.1972 -0.0802 -0.2425 0.6763  17  ALA A CA  
80   C C   . ALA A 17  ? 1.6408 1.6822 1.2173 -0.0796 -0.2340 0.7087  17  ALA A C   
81   O O   . ALA A 17  ? 1.6456 1.6955 1.2548 -0.0831 -0.2336 0.7160  17  ALA A O   
82   C CB  . ALA A 17  ? 1.6649 1.6664 1.2400 -0.0920 -0.2641 0.6873  17  ALA A CB  
83   N N   . VAL A 18  ? 1.6170 1.6770 1.1641 -0.0753 -0.2275 0.7286  18  VAL A N   
84   C CA  . VAL A 18  ? 1.5825 1.6752 1.1348 -0.0734 -0.2181 0.7612  18  VAL A CA  
85   C C   . VAL A 18  ? 1.5330 1.6351 1.0902 -0.0624 -0.1979 0.7545  18  VAL A C   
86   O O   . VAL A 18  ? 1.4878 1.6067 1.0789 -0.0664 -0.1974 0.7709  18  VAL A O   
87   C CB  . VAL A 18  ? 1.5945 1.7021 1.1064 -0.0682 -0.2118 0.7795  18  VAL A CB  
88   C CG1 . VAL A 18  ? 1.6635 1.8055 1.1813 -0.0652 -0.2004 0.8139  18  VAL A CG1 
89   C CG2 . VAL A 18  ? 1.5707 1.6718 1.0787 -0.0791 -0.2320 0.7886  18  VAL A CG2 
90   N N   . LEU A 19  ? 1.5411 1.6319 1.0640 -0.0487 -0.1816 0.7310  19  LEU A N   
91   C CA  . LEU A 19  ? 1.6063 1.7047 1.1294 -0.0360 -0.1606 0.7233  19  LEU A CA  
92   C C   . LEU A 19  ? 1.6303 1.7215 1.1960 -0.0411 -0.1653 0.7106  19  LEU A C   
93   O O   . LEU A 19  ? 1.7177 1.8270 1.3026 -0.0366 -0.1539 0.7201  19  LEU A O   
94   C CB  . LEU A 19  ? 1.6617 1.7410 1.1402 -0.0215 -0.1450 0.6950  19  LEU A CB  
95   C CG  . LEU A 19  ? 1.7591 1.8408 1.1887 -0.0163 -0.1399 0.7036  19  LEU A CG  
96   C CD1 . LEU A 19  ? 1.7914 1.8517 1.1779 -0.0023 -0.1241 0.6744  19  LEU A CD1 
97   C CD2 . LEU A 19  ? 1.7965 1.9121 1.2217 -0.0124 -0.1293 0.7405  19  LEU A CD2 
98   N N   . ALA A 20  ? 1.5839 1.6486 1.1638 -0.0504 -0.1822 0.6897  20  ALA A N   
99   C CA  . ALA A 20  ? 1.5535 1.6069 1.1708 -0.0562 -0.1884 0.6755  20  ALA A CA  
100  C C   . ALA A 20  ? 1.4198 1.4949 1.0772 -0.0684 -0.1985 0.7062  20  ALA A C   
101  O O   . ALA A 20  ? 1.3199 1.4015 1.0050 -0.0694 -0.1951 0.7062  20  ALA A O   
102  C CB  . ALA A 20  ? 1.5991 1.6187 1.2197 -0.0632 -0.2043 0.6483  20  ALA A CB  
103  N N   . ILE A 21  ? 1.3957 1.4818 1.0560 -0.0781 -0.2114 0.7330  21  ILE A N   
104  C CA  . ILE A 21  ? 1.4721 1.5780 1.1688 -0.0908 -0.2226 0.7646  21  ILE A CA  
105  C C   . ILE A 21  ? 1.4627 1.6043 1.1639 -0.0839 -0.2058 0.7910  21  ILE A C   
106  O O   . ILE A 21  ? 1.4861 1.6398 1.2197 -0.0883 -0.2056 0.8005  21  ILE A O   
107  C CB  . ILE A 21  ? 1.5692 1.6777 1.2655 -0.1019 -0.2400 0.7873  21  ILE A CB  
108  C CG1 . ILE A 21  ? 1.5420 1.6164 1.2377 -0.1087 -0.2572 0.7638  21  ILE A CG1 
109  C CG2 . ILE A 21  ? 1.5903 1.7198 1.3230 -0.1148 -0.2508 0.8218  21  ILE A CG2 
110  C CD1 . ILE A 21  ? 1.5214 1.5968 1.2158 -0.1185 -0.2741 0.7846  21  ILE A CD1 
111  N N   . LEU A 22  ? 1.3519 1.5100 1.0198 -0.0731 -0.1917 0.8033  22  LEU A N   
112  C CA  . LEU A 22  ? 1.1725 1.3650 0.8402 -0.0645 -0.1736 0.8299  22  LEU A CA  
113  C C   . LEU A 22  ? 1.1196 1.3149 0.7960 -0.0538 -0.1566 0.8146  22  LEU A C   
114  O O   . LEU A 22  ? 1.1345 1.3525 0.8428 -0.0566 -0.1538 0.8341  22  LEU A O   
115  C CB  . LEU A 22  ? 1.0938 1.2962 0.7158 -0.0525 -0.1597 0.8388  22  LEU A CB  
116  C CG  . LEU A 22  ? 1.1586 1.3609 0.7673 -0.0614 -0.1746 0.8554  22  LEU A CG  
117  C CD1 . LEU A 22  ? 1.2048 1.4157 0.7645 -0.0487 -0.1592 0.8623  22  LEU A CD1 
118  C CD2 . LEU A 22  ? 1.1670 1.3925 0.8128 -0.0755 -0.1879 0.8923  22  LEU A CD2 
119  N N   . GLY A 23  ? 1.1249 1.2971 0.7731 -0.0417 -0.1457 0.7803  23  GLY A N   
120  C CA  . GLY A 23  ? 1.1910 1.3633 0.8431 -0.0297 -0.1284 0.7631  23  GLY A CA  
121  C C   . GLY A 23  ? 1.2774 1.4528 0.9769 -0.0400 -0.1375 0.7641  23  GLY A C   
122  O O   . GLY A 23  ? 1.2822 1.4804 0.9991 -0.0343 -0.1248 0.7765  23  GLY A O   
123  N N   . ASN A 24  ? 1.3823 1.5345 1.1019 -0.0551 -0.1595 0.7516  24  ASN A N   
124  C CA  . ASN A 24  ? 1.4801 1.6291 1.2410 -0.0660 -0.1701 0.7488  24  ASN A CA  
125  C C   . ASN A 24  ? 1.4416 1.6169 1.2388 -0.0807 -0.1824 0.7873  24  ASN A C   
126  O O   . ASN A 24  ? 1.4481 1.6365 1.2764 -0.0849 -0.1823 0.7961  24  ASN A O   
127  C CB  . ASN A 24  ? 1.6244 1.7345 1.3901 -0.0749 -0.1873 0.7173  24  ASN A CB  
128  C CG  . ASN A 24  ? 1.7280 1.8141 1.4748 -0.0620 -0.1749 0.6774  24  ASN A CG  
129  O OD1 . ASN A 24  ? 1.7205 1.8172 1.4486 -0.0461 -0.1534 0.6723  24  ASN A OD1 
130  N ND2 . ASN A 24  ? 1.7930 1.8459 1.5443 -0.0685 -0.1879 0.6494  24  ASN A ND2 
131  N N   . VAL A 25  ? 1.3883 1.5710 1.1818 -0.0889 -0.1935 0.8110  25  VAL A N   
132  C CA  . VAL A 25  ? 1.3597 1.5679 1.1855 -0.1026 -0.2048 0.8498  25  VAL A CA  
133  C C   . VAL A 25  ? 1.4567 1.7041 1.2880 -0.0927 -0.1848 0.8758  25  VAL A C   
134  O O   . VAL A 25  ? 1.5734 1.8445 1.4390 -0.1022 -0.1900 0.9039  25  VAL A O   
135  C CB  . VAL A 25  ? 1.3329 1.5436 1.1495 -0.1109 -0.2178 0.8714  25  VAL A CB  
136  C CG1 . VAL A 25  ? 1.3577 1.5911 1.1404 -0.0970 -0.1996 0.8872  25  VAL A CG1 
137  C CG2 . VAL A 25  ? 1.2848 1.5110 1.1397 -0.1290 -0.2356 0.9053  25  VAL A CG2 
138  N N   . LEU A 26  ? 1.4176 1.6709 1.2142 -0.0733 -0.1618 0.8664  26  LEU A N   
139  C CA  . LEU A 26  ? 1.3187 1.6066 1.1155 -0.0600 -0.1392 0.8875  26  LEU A CA  
140  C C   . LEU A 26  ? 1.1124 1.4015 0.9340 -0.0571 -0.1327 0.8743  26  LEU A C   
141  O O   . LEU A 26  ? 1.1906 1.5109 1.0400 -0.0579 -0.1269 0.9006  26  LEU A O   
142  C CB  . LEU A 26  ? 1.4282 1.7156 1.1757 -0.0395 -0.1168 0.8780  26  LEU A CB  
143  C CG  . LEU A 26  ? 1.5099 1.8329 1.2497 -0.0234 -0.0914 0.9033  26  LEU A CG  
144  C CD1 . LEU A 26  ? 1.5481 1.9056 1.3069 -0.0321 -0.0964 0.9494  26  LEU A CD1 
145  C CD2 . LEU A 26  ? 1.5503 1.8631 1.2359 -0.0033 -0.0705 0.8874  26  LEU A CD2 
146  N N   . VAL A 27  ? 1.0016 1.2574 0.8134 -0.0539 -0.1338 0.8341  27  VAL A N   
147  C CA  . VAL A 27  ? 1.1033 1.3558 0.9370 -0.0516 -0.1290 0.8175  27  VAL A CA  
148  C C   . VAL A 27  ? 1.1785 1.4379 1.0597 -0.0722 -0.1497 0.8345  27  VAL A C   
149  O O   . VAL A 27  ? 1.1339 1.4088 1.0416 -0.0722 -0.1451 0.8404  27  VAL A O   
150  C CB  . VAL A 27  ? 1.1936 1.4053 1.0080 -0.0464 -0.1293 0.7702  27  VAL A CB  
151  C CG1 . VAL A 27  ? 1.1256 1.3332 0.9649 -0.0457 -0.1264 0.7536  27  VAL A CG1 
152  C CG2 . VAL A 27  ? 1.2724 1.4757 1.0394 -0.0262 -0.1088 0.7524  27  VAL A CG2 
153  N N   . CYS A 28  ? 1.3302 1.5774 1.2213 -0.0897 -0.1730 0.8430  28  CYS A N   
154  C CA  . CYS A 28  ? 1.4167 1.6650 1.3492 -0.1106 -0.1952 0.8588  28  CYS A CA  
155  C C   . CYS A 28  ? 1.3909 1.6816 1.3489 -0.1168 -0.1948 0.9061  28  CYS A C   
156  O O   . CYS A 28  ? 1.2871 1.5921 1.2808 -0.1271 -0.2020 0.9217  28  CYS A O   
157  C CB  . CYS A 28  ? 1.4531 1.6695 1.3852 -0.1261 -0.2201 0.8498  28  CYS A CB  
158  S SG  . CYS A 28  ? 1.8404 2.0064 1.7501 -0.1218 -0.2240 0.7962  28  CYS A SG  
159  N N   . TRP A 29  ? 1.4386 1.7495 1.3779 -0.1106 -0.1866 0.9293  29  TRP A N   
160  C CA  . TRP A 29  ? 1.5122 1.8648 1.4728 -0.1150 -0.1844 0.9757  29  TRP A CA  
161  C C   . TRP A 29  ? 1.4735 1.8592 1.4422 -0.1005 -0.1608 0.9879  29  TRP A C   
162  O O   . TRP A 29  ? 1.4424 1.8617 1.4432 -0.1072 -0.1618 1.0230  29  TRP A O   
163  C CB  . TRP A 29  ? 1.5918 1.9550 1.5257 -0.1106 -0.1805 0.9948  29  TRP A CB  
164  C CG  . TRP A 29  ? 1.7075 2.1111 1.6636 -0.1169 -0.1808 1.0434  29  TRP A CG  
165  C CD1 . TRP A 29  ? 1.6945 2.1209 1.6942 -0.1305 -0.1902 1.0715  29  TRP A CD1 
166  C CD2 . TRP A 29  ? 1.8682 2.2940 1.8039 -0.1104 -0.1717 1.0705  29  TRP A CD2 
167  N NE1 . TRP A 29  ? 1.7798 2.2422 1.7888 -0.1326 -0.1872 1.1149  29  TRP A NE1 
168  C CE2 . TRP A 29  ? 1.8911 2.3538 1.8610 -0.1200 -0.1754 1.1149  29  TRP A CE2 
169  C CE3 . TRP A 29  ? 1.9612 2.3791 1.8523 -0.0977 -0.1613 1.0620  29  TRP A CE3 
170  C CZ2 . TRP A 29  ? 1.9887 2.4806 1.9500 -0.1166 -0.1680 1.1505  29  TRP A CZ2 
171  C CZ3 . TRP A 29  ? 2.0399 2.4858 1.9209 -0.0946 -0.1544 1.0969  29  TRP A CZ3 
172  C CH2 . TRP A 29  ? 2.0615 2.5441 1.9776 -0.1035 -0.1572 1.1405  29  TRP A CH2 
173  N N   . ALA A 30  ? 1.4043 1.7802 1.3438 -0.0805 -0.1398 0.9594  30  ALA A N   
174  C CA  . ALA A 30  ? 1.2678 1.6717 1.2110 -0.0638 -0.1153 0.9673  30  ALA A CA  
175  C C   . ALA A 30  ? 1.3059 1.7135 1.2892 -0.0731 -0.1229 0.9650  30  ALA A C   
176  O O   . ALA A 30  ? 1.4682 1.9105 1.4741 -0.0682 -0.1110 0.9894  30  ALA A O   
177  C CB  . ALA A 30  ? 1.1747 1.5613 1.0739 -0.0405 -0.0924 0.9346  30  ALA A CB  
178  N N   . VAL A 31  ? 1.2297 1.6015 1.2215 -0.0863 -0.1427 0.9363  31  VAL A N   
179  C CA  . VAL A 31  ? 1.2784 1.6486 1.3058 -0.0970 -0.1528 0.9317  31  VAL A CA  
180  C C   . VAL A 31  ? 1.2576 1.6440 1.3252 -0.1209 -0.1763 0.9674  31  VAL A C   
181  O O   . VAL A 31  ? 1.2265 1.6182 1.3275 -0.1325 -0.1866 0.9732  31  VAL A O   
182  C CB  . VAL A 31  ? 1.3991 1.7221 1.4173 -0.1009 -0.1640 0.8856  31  VAL A CB  
183  C CG1 . VAL A 31  ? 1.3753 1.6966 1.4277 -0.1111 -0.1734 0.8805  31  VAL A CG1 
184  C CG2 . VAL A 31  ? 1.4802 1.7854 1.4578 -0.0783 -0.1421 0.8505  31  VAL A CG2 
185  N N   . TRP A 32  ? 1.2707 1.6646 1.3345 -0.1286 -0.1851 0.9917  32  TRP A N   
186  C CA  . TRP A 32  ? 1.3369 1.7458 1.4366 -0.1512 -0.2073 1.0276  32  TRP A CA  
187  C C   . TRP A 32  ? 1.4455 1.9067 1.5629 -0.1469 -0.1940 1.0741  32  TRP A C   
188  O O   . TRP A 32  ? 1.6239 2.1059 1.7773 -0.1643 -0.2089 1.1078  32  TRP A O   
189  C CB  . TRP A 32  ? 1.3916 1.7761 1.4805 -0.1641 -0.2276 1.0280  32  TRP A CB  
190  C CG  . TRP A 32  ? 1.3682 1.7591 1.4925 -0.1888 -0.2535 1.0597  32  TRP A CG  
191  C CD1 . TRP A 32  ? 1.2613 1.6386 1.4163 -0.2073 -0.2746 1.0585  32  TRP A CD1 
192  C CD2 . TRP A 32  ? 1.4443 1.8544 1.5748 -0.1979 -0.2617 1.0971  32  TRP A CD2 
193  N NE1 . TRP A 32  ? 1.2526 1.6387 1.4323 -0.2277 -0.2958 1.0930  32  TRP A NE1 
194  C CE2 . TRP A 32  ? 1.4133 1.8202 1.5796 -0.2222 -0.2881 1.1173  32  TRP A CE2 
195  C CE3 . TRP A 32  ? 1.5550 1.9840 1.6633 -0.1879 -0.2496 1.1156  32  TRP A CE3 
196  C CZ2 . TRP A 32  ? 1.5684 1.9906 1.7498 -0.2366 -0.3022 1.1553  32  TRP A CZ2 
197  C CZ3 . TRP A 32  ? 1.6330 2.0783 1.7567 -0.2018 -0.2632 1.1532  32  TRP A CZ3 
198  C CH2 . TRP A 32  ? 1.6457 2.0877 1.8062 -0.2259 -0.2890 1.1728  32  TRP A CH2 
199  N N   . LEU A 33  ? 1.3547 1.8361 1.4458 -0.1236 -0.1657 1.0761  33  LEU A N   
200  C CA  . LEU A 33  ? 1.2906 1.8220 1.3951 -0.1158 -0.1489 1.1191  33  LEU A CA  
201  C C   . LEU A 33  ? 1.3213 1.8763 1.4409 -0.1028 -0.1297 1.1202  33  LEU A C   
202  O O   . LEU A 33  ? 1.3748 1.9683 1.5295 -0.1079 -0.1285 1.1568  33  LEU A O   
203  C CB  . LEU A 33  ? 1.1292 1.6699 1.1937 -0.0975 -0.1289 1.1256  33  LEU A CB  
204  C CG  . LEU A 33  ? 1.0537 1.5781 1.1023 -0.1083 -0.1451 1.1305  33  LEU A CG  
205  C CD1 . LEU A 33  ? 1.1329 1.6716 1.1427 -0.0894 -0.1234 1.1410  33  LEU A CD1 
206  C CD2 . LEU A 33  ? 0.9762 1.5177 1.0652 -0.1324 -0.1685 1.1682  33  LEU A CD2 
207  N N   . ASN A 34  ? 1.2166 1.6161 2.9109 -0.3439 0.0053  0.0083  34  ASN A N   
208  C CA  . ASN A 34  ? 1.1513 1.5826 2.8917 -0.3515 0.0150  0.0178  34  ASN A CA  
209  C C   . ASN A 34  ? 1.0882 1.5638 2.8488 -0.3397 0.0113  0.0267  34  ASN A C   
210  O O   . ASN A 34  ? 1.1740 1.6840 2.9514 -0.3264 0.0048  0.0364  34  ASN A O   
211  C CB  . ASN A 34  ? 1.1736 1.6208 2.9480 -0.3554 0.0194  0.0268  34  ASN A CB  
212  C CG  . ASN A 34  ? 1.1848 1.6544 3.0035 -0.3673 0.0313  0.0344  34  ASN A CG  
213  O OD1 . ASN A 34  ? 1.2022 1.6992 3.0406 -0.3657 0.0336  0.0394  34  ASN A OD1 
214  N ND2 . ASN A 34  ? 1.1907 1.6486 3.0254 -0.3794 0.0390  0.0352  34  ASN A ND2 
215  N N   . SER A 35  ? 1.0221 1.4965 2.7810 -0.3446 0.0156  0.0233  35  SER A N   
216  C CA  . SER A 35  ? 0.9883 1.5014 2.7631 -0.3342 0.0123  0.0305  35  SER A CA  
217  C C   . SER A 35  ? 0.9344 1.4954 2.7626 -0.3340 0.0176  0.0453  35  SER A C   
218  O O   . SER A 35  ? 0.6353 1.2340 2.4820 -0.3243 0.0146  0.0533  35  SER A O   
219  C CB  . SER A 35  ? 0.7019 1.1989 2.4611 -0.3410 0.0163  0.0225  35  SER A CB  
220  O OG  . SER A 35  ? 0.9158 1.3987 2.6914 -0.3591 0.0287  0.0204  35  SER A OG  
221  N N   . ASN A 36  ? 0.9245 1.4837 2.7773 -0.3449 0.0255  0.0489  36  ASN A N   
222  C CA  . ASN A 36  ? 0.8877 1.4905 2.7916 -0.3456 0.0308  0.0629  36  ASN A CA  
223  C C   . ASN A 36  ? 0.9683 1.6010 2.8848 -0.3307 0.0223  0.0726  36  ASN A C   
224  O O   . ASN A 36  ? 1.0527 1.7233 3.0107 -0.3291 0.0252  0.0848  36  ASN A O   
225  C CB  . ASN A 36  ? 0.8116 1.4006 2.7370 -0.3633 0.0427  0.0629  36  ASN A CB  
226  C CG  . ASN A 36  ? 0.7799 1.3367 2.6916 -0.3787 0.0513  0.0528  36  ASN A CG  
227  O OD1 . ASN A 36  ? 0.6248 1.1790 2.5212 -0.3766 0.0499  0.0483  36  ASN A OD1 
228  N ND2 . ASN A 36  ? 0.7482 1.2803 2.6654 -0.3942 0.0603  0.0492  36  ASN A ND2 
229  N N   . LEU A 37  ? 0.9658 1.5810 2.8460 -0.3198 0.0118  0.0669  37  LEU A N   
230  C CA  . LEU A 37  ? 0.9067 1.5472 2.7932 -0.3045 0.0025  0.0748  37  LEU A CA  
231  C C   . LEU A 37  ? 0.9398 1.5956 2.8070 -0.2879 -0.0084 0.0748  37  LEU A C   
232  O O   . LEU A 37  ? 1.0050 1.6887 2.8798 -0.2734 -0.0166 0.0824  37  LEU A O   
233  C CB  . LEU A 37  ? 0.8511 1.4583 2.7118 -0.3053 -0.0012 0.0686  37  LEU A CB  
234  C CG  . LEU A 37  ? 0.8570 1.4485 2.7351 -0.3203 0.0083  0.0688  37  LEU A CG  
235  C CD1 . LEU A 37  ? 0.6489 1.1977 2.4908 -0.3222 0.0045  0.0591  37  LEU A CD1 
236  C CD2 . LEU A 37  ? 0.8369 1.4711 2.7624 -0.3176 0.0108  0.0835  37  LEU A CD2 
237  N N   . GLN A 38  ? 0.9758 1.6132 2.8182 -0.2901 -0.0083 0.0662  38  GLN A N   
238  C CA  . GLN A 38  ? 0.9694 1.6149 2.7879 -0.2753 -0.0185 0.0641  38  GLN A CA  
239  C C   . GLN A 38  ? 0.9139 1.6079 2.7649 -0.2676 -0.0186 0.0751  38  GLN A C   
240  O O   . GLN A 38  ? 0.8690 1.5648 2.7081 -0.2649 -0.0201 0.0717  38  GLN A O   
241  C CB  . GLN A 38  ? 0.9869 1.5901 2.7626 -0.2808 -0.0188 0.0497  38  GLN A CB  
242  C CG  . GLN A 38  ? 1.0119 1.5653 2.7540 -0.2890 -0.0184 0.0382  38  GLN A CG  
243  C CD  . GLN A 38  ? 1.0170 1.5286 2.7186 -0.2955 -0.0178 0.0240  38  GLN A CD  
244  O OE1 . GLN A 38  ? 1.0871 1.6064 2.7821 -0.2921 -0.0190 0.0223  38  GLN A OE1 
245  N NE2 . GLN A 38  ? 0.9632 1.4302 2.6374 -0.3049 -0.0159 0.0137  38  GLN A NE2 
246  N N   . ASN A 39  ? 0.9179 1.6511 2.8099 -0.2642 -0.0172 0.0881  39  ASN A N   
247  C CA  . ASN A 39  ? 0.9547 1.7368 2.8799 -0.2559 -0.0178 0.0996  39  ASN A CA  
248  C C   . ASN A 39  ? 1.0262 1.8355 2.9474 -0.2363 -0.0300 0.1058  39  ASN A C   
249  O O   . ASN A 39  ? 1.0087 1.8003 2.9042 -0.2295 -0.0376 0.1018  39  ASN A O   
250  C CB  . ASN A 39  ? 0.9030 1.7143 2.8787 -0.2646 -0.0079 0.1108  39  ASN A CB  
251  C CG  . ASN A 39  ? 0.8559 1.6697 2.8458 -0.2648 -0.0081 0.1159  39  ASN A CG  
252  O OD1 . ASN A 39  ? 0.7398 1.5926 2.7605 -0.2563 -0.0105 0.1279  39  ASN A OD1 
253  N ND2 . ASN A 39  ? 0.8761 1.6481 2.8436 -0.2746 -0.0055 0.1069  39  ASN A ND2 
254  N N   . VAL A 40  ? 1.0639 1.9164 3.0106 -0.2274 -0.0319 0.1154  40  VAL A N   
255  C CA  . VAL A 40  ? 1.0867 1.9680 3.0313 -0.2085 -0.0433 0.1216  40  VAL A CA  
256  C C   . VAL A 40  ? 1.2191 2.1115 3.1764 -0.2029 -0.0469 0.1284  40  VAL A C   
257  O O   . VAL A 40  ? 1.2811 2.1733 3.2175 -0.1896 -0.0574 0.1277  40  VAL A O   
258  C CB  . VAL A 40  ? 1.0357 1.9653 3.0129 -0.2013 -0.0432 0.1325  40  VAL A CB  
259  C CG1 . VAL A 40  ? 1.0493 2.0066 3.0212 -0.1816 -0.0554 0.1381  40  VAL A CG1 
260  C CG2 . VAL A 40  ? 1.0578 1.9775 3.0243 -0.2072 -0.0391 0.1262  40  VAL A CG2 
261  N N   . THR A 41  ? 1.1464 1.5481 2.9107 -0.0173 0.1654  0.3638  41  THR A N   
262  C CA  . THR A 41  ? 1.1448 1.5281 2.8863 -0.0243 0.1487  0.3882  41  THR A CA  
263  C C   . THR A 41  ? 1.0100 1.3246 2.7263 -0.0235 0.1377  0.3845  41  THR A C   
264  O O   . THR A 41  ? 0.9438 1.2800 2.6634 -0.0232 0.1200  0.3871  41  THR A O   
265  C CB  . THR A 41  ? 1.2290 1.5707 2.9400 -0.0341 0.1555  0.4173  41  THR A CB  
266  O OG1 . THR A 41  ? 1.2576 1.6663 2.9919 -0.0344 0.1653  0.4230  41  THR A OG1 
267  C CG2 . THR A 41  ? 1.1861 1.5074 2.8721 -0.0426 0.1385  0.4417  41  THR A CG2 
268  N N   . ASN A 42  ? 0.9541 1.1869 2.6454 -0.0231 0.1482  0.3787  42  ASN A N   
269  C CA  . ASN A 42  ? 0.9523 1.1125 2.6164 -0.0225 0.1392  0.3766  42  ASN A CA  
270  C C   . ASN A 42  ? 0.9972 1.1832 2.6843 -0.0119 0.1322  0.3504  42  ASN A C   
271  O O   . ASN A 42  ? 1.0659 1.2032 2.7345 -0.0101 0.1227  0.3484  42  ASN A O   
272  C CB  . ASN A 42  ? 1.0087 1.0731 2.6390 -0.0250 0.1531  0.3782  42  ASN A CB  
273  C CG  . ASN A 42  ? 1.1257 1.1443 2.7224 -0.0364 0.1560  0.4080  42  ASN A CG  
274  O OD1 . ASN A 42  ? 1.1952 1.1303 2.7590 -0.0400 0.1643  0.4142  42  ASN A OD1 
275  N ND2 . ASN A 42  ? 1.1387 1.2108 2.7430 -0.0421 0.1496  0.4268  42  ASN A ND2 
276  N N   . TYR A 43  ? 0.9523 1.2146 2.6793 -0.0049 0.1373  0.3305  43  TYR A N   
277  C CA  . TYR A 43  ? 0.9231 1.2180 2.6743 0.0052  0.1309  0.3060  43  TYR A CA  
278  C C   . TYR A 43  ? 0.8027 1.1258 2.5550 0.0049  0.1089  0.3167  43  TYR A C   
279  O O   . TYR A 43  ? 0.6685 0.9744 2.4190 0.0113  0.1000  0.3058  43  TYR A O   
280  C CB  . TYR A 43  ? 0.8901 1.2678 2.6844 0.0114  0.1404  0.2842  43  TYR A CB  
281  C CG  . TYR A 43  ? 0.8446 1.1928 2.6423 0.0157  0.1601  0.2616  43  TYR A CG  
282  C CD1 . TYR A 43  ? 0.8795 1.1653 2.6637 0.0216  0.1630  0.2446  43  TYR A CD1 
283  C CD2 . TYR A 43  ? 0.8721 1.2560 2.6867 0.0140  0.1761  0.2573  43  TYR A CD2 
284  C CE1 . TYR A 43  ? 0.9630 1.2210 2.7496 0.0250  0.1813  0.2236  43  TYR A CE1 
285  C CE2 . TYR A 43  ? 1.0107 1.3690 2.8282 0.0172  0.1942  0.2364  43  TYR A CE2 
286  C CZ  . TYR A 43  ? 1.0659 1.3607 2.8692 0.0225  0.1967  0.2194  43  TYR A CZ  
287  O OH  . TYR A 43  ? 1.1185 1.3870 2.9240 0.0252  0.2150  0.1983  43  TYR A OH  
288  N N   . PHE A 44  ? 0.8571 1.2233 2.6117 -0.0026 0.1006  0.3385  44  PHE A N   
289  C CA  . PHE A 44  ? 0.9323 1.3259 2.6859 -0.0048 0.0796  0.3517  44  PHE A CA  
290  C C   . PHE A 44  ? 0.9765 1.2859 2.6864 -0.0116 0.0707  0.3702  44  PHE A C   
291  O O   . PHE A 44  ? 1.0178 1.3237 2.7219 -0.0099 0.0547  0.3722  44  PHE A O   
292  C CB  . PHE A 44  ? 0.9842 1.4494 2.7531 -0.0113 0.0746  0.3693  44  PHE A CB  
293  C CG  . PHE A 44  ? 1.0406 1.5987 2.8546 -0.0048 0.0799  0.3522  44  PHE A CG  
294  C CD1 . PHE A 44  ? 1.0873 1.6668 2.9134 -0.0059 0.0970  0.3499  44  PHE A CD1 
295  C CD2 . PHE A 44  ? 1.0488 1.6737 2.8929 0.0024  0.0680  0.3387  44  PHE A CD2 
296  C CE1 . PHE A 44  ? 1.0999 1.7664 2.9673 -0.0006 0.1020  0.3342  44  PHE A CE1 
297  C CE2 . PHE A 44  ? 1.0489 1.7594 2.9342 0.0078  0.0731  0.3227  44  PHE A CE2 
298  C CZ  . PHE A 44  ? 1.0830 1.8146 2.9799 0.0061  0.0900  0.3204  44  PHE A CZ  
299  N N   . VAL A 45  ? 0.9299 1.1722 2.6087 -0.0194 0.0814  0.3841  45  VAL A N   
300  C CA  . VAL A 45  ? 0.9083 1.0655 2.5434 -0.0269 0.0750  0.4019  45  VAL A CA  
301  C C   . VAL A 45  ? 0.9769 1.0872 2.6031 -0.0189 0.0701  0.3858  45  VAL A C   
302  O O   . VAL A 45  ? 1.0694 1.1444 2.6725 -0.0222 0.0561  0.3970  45  VAL A O   
303  C CB  . VAL A 45  ? 0.7960 0.8837 2.4009 -0.0346 0.0908  0.4145  45  VAL A CB  
304  C CG1 . VAL A 45  ? 0.7583 0.7526 2.3177 -0.0417 0.0851  0.4292  45  VAL A CG1 
305  C CG2 . VAL A 45  ? 0.7559 0.8835 2.3643 -0.0430 0.0948  0.4345  45  VAL A CG2 
306  N N   . VAL A 46  ? 0.9081 1.0190 2.5528 -0.0085 0.0822  0.3596  46  VAL A N   
307  C CA  . VAL A 46  ? 0.8763 0.9466 2.5157 0.0007  0.0796  0.3421  46  VAL A CA  
308  C C   . VAL A 46  ? 0.7938 0.9188 2.4525 0.0070  0.0614  0.3376  46  VAL A C   
309  O O   . VAL A 46  ? 0.7588 0.8448 2.4009 0.0102  0.0513  0.3378  46  VAL A O   
310  C CB  . VAL A 46  ? 0.7227 0.7899 2.3807 0.0103  0.0975  0.3136  46  VAL A CB  
311  C CG1 . VAL A 46  ? 0.6816 0.6997 2.3308 0.0198  0.0959  0.2967  46  VAL A CG1 
312  C CG2 . VAL A 46  ? 0.6916 0.7110 2.3327 0.0043  0.1158  0.3181  46  VAL A CG2 
313  N N   . SER A 47  ? 0.7868 1.0030 2.4807 0.0089  0.0575  0.3339  47  SER A N   
314  C CA  . SER A 47  ? 0.9313 1.2074 2.6461 0.0147  0.0403  0.3305  47  SER A CA  
315  C C   . SER A 47  ? 1.0622 1.3178 2.7502 0.0059  0.0219  0.3564  47  SER A C   
316  O O   . SER A 47  ? 1.0552 1.3157 2.7426 0.0109  0.0075  0.3551  47  SER A O   
317  C CB  . SER A 47  ? 0.9758 1.3533 2.7316 0.0165  0.0402  0.3245  47  SER A CB  
318  O OG  . SER A 47  ? 1.1018 1.5382 2.8774 0.0217  0.0232  0.3226  47  SER A OG  
319  N N   . LEU A 48  ? 1.0832 1.3159 2.7483 -0.0072 0.0228  0.3800  48  LEU A N   
320  C CA  . LEU A 48  ? 1.0637 1.2702 2.6991 -0.0180 0.0072  0.4057  48  LEU A CA  
321  C C   . LEU A 48  ? 1.0393 1.1517 2.6371 -0.0188 0.0058  0.4085  48  LEU A C   
322  O O   . LEU A 48  ? 1.0058 1.1038 2.5876 -0.0208 -0.0101 0.4184  48  LEU A O   
323  C CB  . LEU A 48  ? 1.1410 1.3468 2.7618 -0.0320 0.0110  0.4294  48  LEU A CB  
324  C CG  . LEU A 48  ? 1.2799 1.4509 2.8654 -0.0456 -0.0026 0.4573  48  LEU A CG  
325  C CD1 . LEU A 48  ? 1.3150 1.5463 2.9148 -0.0449 -0.0235 0.4616  48  LEU A CD1 
326  C CD2 . LEU A 48  ? 1.3223 1.4895 2.8939 -0.0585 0.0049  0.4788  48  LEU A CD2 
327  N N   . ALA A 49  ? 1.0678 1.1173 2.6515 -0.0172 0.0226  0.3999  49  ALA A N   
328  C CA  . ALA A 49  ? 1.0678 1.0252 2.6164 -0.0173 0.0234  0.4010  49  ALA A CA  
329  C C   . ALA A 49  ? 1.1205 1.0810 2.6798 -0.0042 0.0154  0.3831  49  ALA A C   
330  O O   . ALA A 49  ? 1.2074 1.1407 2.7465 -0.0056 0.0013  0.3930  49  ALA A O   
331  C CB  . ALA A 49  ? 0.9689 0.8658 2.5049 -0.0172 0.0443  0.3929  49  ALA A CB  
332  N N   . ALA A 50  ? 1.0855 1.0797 2.6761 0.0086  0.0251  0.3570  50  ALA A N   
333  C CA  . ALA A 50  ? 1.0934 1.0940 2.6971 0.0226  0.0201  0.3379  50  ALA A CA  
334  C C   . ALA A 50  ? 1.0663 1.1134 2.6761 0.0233  -0.0016 0.3483  50  ALA A C   
335  O O   . ALA A 50  ? 1.1062 1.1300 2.7074 0.0305  -0.0104 0.3449  50  ALA A O   
336  C CB  . ALA A 50  ? 1.1144 1.1658 2.7565 0.0343  0.0327  0.3099  50  ALA A CB  
337  N N   . ALA A 51  ? 1.0194 1.1332 2.6441 0.0160  -0.0098 0.3613  51  ALA A N   
338  C CA  . ALA A 51  ? 1.0234 1.1849 2.6535 0.0149  -0.0307 0.3733  51  ALA A CA  
339  C C   . ALA A 51  ? 1.0615 1.1589 2.6499 0.0052  -0.0425 0.3957  51  ALA A C   
340  O O   . ALA A 51  ? 1.1205 1.2077 2.7020 0.0109  -0.0547 0.3955  51  ALA A O   
341  C CB  . ALA A 51  ? 0.9861 1.2270 2.6382 0.0075  -0.0355 0.3838  51  ALA A CB  
342  N N   . ASP A 52  ? 1.0583 1.1125 2.6185 -0.0095 -0.0384 0.4150  52  ASP A N   
343  C CA  . ASP A 52  ? 1.1107 1.1023 2.6291 -0.0210 -0.0484 0.4372  52  ASP A CA  
344  C C   . ASP A 52  ? 1.0779 0.9876 2.5716 -0.0147 -0.0448 0.4293  52  ASP A C   
345  O O   . ASP A 52  ? 1.1476 1.0049 2.6076 -0.0222 -0.0541 0.4450  52  ASP A O   
346  C CB  . ASP A 52  ? 1.2141 1.1750 2.7078 -0.0378 -0.0420 0.4583  52  ASP A CB  
347  C CG  . ASP A 52  ? 1.2179 1.2533 2.7279 -0.0463 -0.0496 0.4723  52  ASP A CG  
348  O OD1 . ASP A 52  ? 1.2118 1.3232 2.7525 -0.0394 -0.0605 0.4656  52  ASP A OD1 
349  O OD2 . ASP A 52  ? 1.1557 1.1731 2.6475 -0.0596 -0.0444 0.4901  52  ASP A OD2 
350  N N   . ILE A 53  ? 1.0054 0.9046 2.5156 -0.0014 -0.0309 0.4048  53  ILE A N   
351  C CA  . ILE A 53  ? 1.0534 0.8813 2.5447 0.0070  -0.0269 0.3944  53  ILE A CA  
352  C C   . ILE A 53  ? 1.0786 0.9358 2.5820 0.0188  -0.0412 0.3874  53  ILE A C   
353  O O   . ILE A 53  ? 1.0849 0.8929 2.5623 0.0191  -0.0499 0.3950  53  ILE A O   
354  C CB  . ILE A 53  ? 0.9621 0.7685 2.4669 0.0169  -0.0059 0.3697  53  ILE A CB  
355  C CG1 . ILE A 53  ? 0.9112 0.6818 2.4013 0.0059  0.0092  0.3771  53  ILE A CG1 
356  C CG2 . ILE A 53  ? 0.9473 0.6853 2.4350 0.0270  -0.0022 0.3576  53  ILE A CG2 
357  C CD1 . ILE A 53  ? 0.9336 0.6832 2.4356 0.0142  0.0301  0.3539  53  ILE A CD1 
358  N N   . LEU A 54  ? 1.0324 0.9709 2.5755 0.0287  -0.0435 0.3732  54  LEU A N   
359  C CA  . LEU A 54  ? 1.0076 0.9834 2.5664 0.0412  -0.0565 0.3659  54  LEU A CA  
360  C C   . LEU A 54  ? 1.0342 1.0211 2.5754 0.0322  -0.0779 0.3902  54  LEU A C   
361  O O   . LEU A 54  ? 1.0442 1.0457 2.5885 0.0409  -0.0903 0.3891  54  LEU A O   
362  C CB  . LEU A 54  ? 0.9013 0.9673 2.5064 0.0515  -0.0546 0.3478  54  LEU A CB  
363  C CG  . LEU A 54  ? 0.7395 0.8037 2.3661 0.0622  -0.0342 0.3202  54  LEU A CG  
364  C CD1 . LEU A 54  ? 0.6131 0.7722 2.2846 0.0695  -0.0335 0.3051  54  LEU A CD1 
365  C CD2 . LEU A 54  ? 0.7384 0.7463 2.3551 0.0758  -0.0286 0.3043  54  LEU A CD2 
366  N N   . VAL A 55  ? 0.9856 0.9663 2.5081 0.0147  -0.0818 0.4122  55  VAL A N   
367  C CA  . VAL A 55  ? 1.0044 0.9900 2.5062 0.0035  -0.1012 0.4363  55  VAL A CA  
368  C C   . VAL A 55  ? 1.1411 1.0472 2.6059 0.0029  -0.1060 0.4436  55  VAL A C   
369  O O   . VAL A 55  ? 1.2419 1.1602 2.7055 0.0090  -0.1201 0.4460  55  VAL A O   
370  C CB  . VAL A 55  ? 0.9507 0.9395 2.4375 -0.0160 -0.1021 0.4582  55  VAL A CB  
371  C CG1 . VAL A 55  ? 0.9231 0.9032 2.3822 -0.0292 -0.1209 0.4831  55  VAL A CG1 
372  C CG2 . VAL A 55  ? 0.8975 0.9731 2.4216 -0.0155 -0.1001 0.4535  55  VAL A CG2 
373  N N   . GLY A 56  ? 1.1504 0.9759 2.5851 -0.0042 -0.0939 0.4473  56  GLY A N   
374  C CA  . GLY A 56  ? 1.1548 0.9002 2.5529 -0.0054 -0.0969 0.4541  56  GLY A CA  
375  C C   . GLY A 56  ? 1.1075 0.8369 2.5160 0.0142  -0.0935 0.4332  56  GLY A C   
376  O O   . GLY A 56  ? 1.0917 0.7732 2.4763 0.0167  -0.1002 0.4382  56  GLY A O   
377  N N   . VAL A 57  ? 1.0602 0.8304 2.5042 0.0282  -0.0826 0.4098  57  VAL A N   
378  C CA  . VAL A 57  ? 1.0705 0.8265 2.5262 0.0474  -0.0766 0.3879  57  VAL A CA  
379  C C   . VAL A 57  ? 0.9569 0.7798 2.4372 0.0597  -0.0910 0.3837  57  VAL A C   
380  O O   . VAL A 57  ? 0.8974 0.6979 2.3733 0.0726  -0.0939 0.3768  57  VAL A O   
381  C CB  . VAL A 57  ? 1.0338 0.7941 2.5136 0.0564  -0.0556 0.3627  57  VAL A CB  
382  C CG1 . VAL A 57  ? 0.9650 0.7089 2.4557 0.0760  -0.0486 0.3397  57  VAL A CG1 
383  C CG2 . VAL A 57  ? 0.9920 0.6851 2.4476 0.0453  -0.0406 0.3666  57  VAL A CG2 
384  N N   . LEU A 58  ? 0.9311 0.8362 2.4370 0.0561  -0.0999 0.3883  58  LEU A N   
385  C CA  . LEU A 58  ? 0.9468 0.9229 2.4795 0.0678  -0.1130 0.3837  58  LEU A CA  
386  C C   . LEU A 58  ? 0.8782 0.9029 2.4072 0.0557  -0.1336 0.4071  58  LEU A C   
387  O O   . LEU A 58  ? 0.8800 0.9138 2.4020 0.0594  -0.1489 0.4159  58  LEU A O   
388  C CB  . LEU A 58  ? 0.9341 0.9764 2.5104 0.0796  -0.1030 0.3603  58  LEU A CB  
389  C CG  . LEU A 58  ? 0.9691 0.9746 2.5539 0.0936  -0.0832 0.3339  58  LEU A CG  
390  C CD1 . LEU A 58  ? 0.9576 1.0358 2.5859 0.1032  -0.0745 0.3120  58  LEU A CD1 
391  C CD2 . LEU A 58  ? 0.9969 0.9604 2.5692 0.1079  -0.0858 0.3281  58  LEU A CD2 
392  N N   . ALA A 59  ? 0.8248 0.8811 2.3584 0.0414  -0.1336 0.4174  59  ALA A N   
393  C CA  . ALA A 59  ? 0.8287 0.9353 2.3607 0.0289  -0.1518 0.4388  59  ALA A CA  
394  C C   . ALA A 59  ? 0.9007 0.9583 2.3934 0.0189  -0.1657 0.4606  59  ALA A C   
395  O O   . ALA A 59  ? 0.9040 0.9964 2.3990 0.0215  -0.1827 0.4686  59  ALA A O   
396  C CB  . ALA A 59  ? 0.6731 0.8028 2.2085 0.0137  -0.1467 0.4480  59  ALA A CB  
397  N N   . ILE A 60  ? 0.9648 0.9425 2.4214 0.0071  -0.1585 0.4704  60  ILE A N   
398  C CA  . ILE A 60  ? 1.0238 0.9492 2.4403 -0.0042 -0.1703 0.4911  60  ILE A CA  
399  C C   . ILE A 60  ? 1.0090 0.9177 2.4212 0.0104  -0.1781 0.4857  60  ILE A C   
400  O O   . ILE A 60  ? 1.0603 0.9826 2.4599 0.0060  -0.1956 0.5010  60  ILE A O   
401  C CB  . ILE A 60  ? 1.1427 0.9792 2.5215 -0.0177 -0.1586 0.4999  60  ILE A CB  
402  C CG1 . ILE A 60  ? 1.1172 0.9709 2.4949 -0.0344 -0.1538 0.5113  60  ILE A CG1 
403  C CG2 . ILE A 60  ? 1.1977 0.9758 2.5351 -0.0274 -0.1700 0.5184  60  ILE A CG2 
404  C CD1 . ILE A 60  ? 1.0719 0.8412 2.4114 -0.0489 -0.1428 0.5224  60  ILE A CD1 
405  N N   . PRO A 61  ? 1.0040 0.8832 2.4260 0.0278  -0.1648 0.4640  61  PRO A N   
406  C CA  . PRO A 61  ? 1.0407 0.9087 2.4618 0.0440  -0.1709 0.4576  61  PRO A CA  
407  C C   . PRO A 61  ? 0.9948 0.9493 2.4443 0.0529  -0.1866 0.4579  61  PRO A C   
408  O O   . PRO A 61  ? 0.9586 0.9126 2.3978 0.0579  -0.1999 0.4660  61  PRO A O   
409  C CB  . PRO A 61  ? 1.0598 0.9003 2.4964 0.0612  -0.1512 0.4310  61  PRO A CB  
410  C CG  . PRO A 61  ? 1.1122 0.9103 2.5378 0.0495  -0.1355 0.4298  61  PRO A CG  
411  C CD  . PRO A 61  ? 1.0411 0.8888 2.4714 0.0324  -0.1430 0.4458  61  PRO A CD  
412  N N   . PHE A 62  ? 0.9714 0.9998 2.4562 0.0550  -0.1850 0.4494  62  PHE A N   
413  C CA  . PHE A 62  ? 0.8844 0.9992 2.3981 0.0628  -0.1994 0.4495  62  PHE A CA  
414  C C   . PHE A 62  ? 0.8672 1.0117 2.3661 0.0452  -0.2190 0.4756  62  PHE A C   
415  O O   . PHE A 62  ? 0.7548 0.9304 2.2539 0.0490  -0.2353 0.4843  62  PHE A O   
416  C CB  . PHE A 62  ? 0.8674 1.0516 2.4235 0.0699  -0.1909 0.4317  62  PHE A CB  
417  C CG  . PHE A 62  ? 0.8515 1.0244 2.4285 0.0895  -0.1739 0.4041  62  PHE A CG  
418  C CD1 . PHE A 62  ? 0.8279 0.9573 2.3950 0.1045  -0.1718 0.3959  62  PHE A CD1 
419  C CD2 . PHE A 62  ? 0.6809 0.8882 2.2874 0.0927  -0.1597 0.3863  62  PHE A CD2 
420  C CE1 . PHE A 62  ? 0.8533 0.9711 2.4386 0.1221  -0.1553 0.3701  62  PHE A CE1 
421  C CE2 . PHE A 62  ? 0.8593 1.0566 2.4842 0.1096  -0.1437 0.3603  62  PHE A CE2 
422  C CZ  . PHE A 62  ? 0.8608 1.0125 2.4749 0.1242  -0.1412 0.3520  62  PHE A CZ  
423  N N   . ALA A 63  ? 0.7452 0.8805 2.2310 0.0257  -0.2167 0.4881  63  ALA A N   
424  C CA  . ALA A 63  ? 1.0484 1.2101 2.5190 0.0068  -0.2332 0.5127  63  ALA A CA  
425  C C   . ALA A 63  ? 1.0632 1.1805 2.4977 0.0005  -0.2467 0.5301  63  ALA A C   
426  O O   . ALA A 63  ? 1.0574 1.2154 2.4881 -0.0070 -0.2648 0.5460  63  ALA A O   
427  C CB  . ALA A 63  ? 0.7392 0.8805 2.1961 -0.0125 -0.2249 0.5227  63  ALA A CB  
428  N N   . ILE A 64  ? 1.1139 1.1484 2.5219 0.0032  -0.2378 0.5271  64  ILE A N   
429  C CA  . ILE A 64  ? 1.2262 1.2122 2.5982 -0.0027 -0.2491 0.5429  64  ILE A CA  
430  C C   . ILE A 64  ? 1.2653 1.2792 2.6508 0.0168  -0.2589 0.5366  64  ILE A C   
431  O O   . ILE A 64  ? 1.3171 1.3165 2.6798 0.0131  -0.2727 0.5513  64  ILE A O   
432  C CB  . ILE A 64  ? 1.3236 1.2085 2.6610 -0.0070 -0.2357 0.5425  64  ILE A CB  
433  C CG1 . ILE A 64  ? 1.4217 1.2580 2.7173 -0.0198 -0.2483 0.5637  64  ILE A CG1 
434  C CG2 . ILE A 64  ? 1.3107 1.1666 2.6621 0.0157  -0.2216 0.5187  64  ILE A CG2 
435  C CD1 . ILE A 64  ? 1.4837 1.2202 2.7432 -0.0256 -0.2362 0.5651  64  ILE A CD1 
436  N N   . THR A 65  ? 1.2546 1.3093 2.6772 0.0374  -0.2513 0.5147  65  THR A N   
437  C CA  . THR A 65  ? 1.2815 1.3665 2.7205 0.0581  -0.2586 0.5070  65  THR A CA  
438  C C   . THR A 65  ? 1.2981 1.4740 2.7589 0.0575  -0.2770 0.5161  65  THR A C   
439  O O   . THR A 65  ? 1.3208 1.5105 2.7721 0.0597  -0.2926 0.5281  65  THR A O   
440  C CB  . THR A 65  ? 1.2461 1.3345 2.7149 0.0808  -0.2416 0.4788  65  THR A CB  
441  O OG1 . THR A 65  ? 1.3623 1.3633 2.8090 0.0832  -0.2257 0.4705  65  THR A OG1 
442  C CG2 . THR A 65  ? 1.1724 1.3011 2.6609 0.1025  -0.2491 0.4714  65  THR A CG2 
443  N N   . ILE A 66  ? 1.2814 1.5199 2.7713 0.0544  -0.2751 0.5106  66  ILE A N   
444  C CA  . ILE A 66  ? 1.2723 1.6003 2.7853 0.0535  -0.2916 0.5182  66  ILE A CA  
445  C C   . ILE A 66  ? 1.3552 1.6851 2.8395 0.0307  -0.3088 0.5456  66  ILE A C   
446  O O   . ILE A 66  ? 1.3981 1.7956 2.8944 0.0276  -0.3251 0.5558  66  ILE A O   
447  C CB  . ILE A 66  ? 1.2105 1.6025 2.7603 0.0541  -0.2846 0.5061  66  ILE A CB  
448  C CG1 . ILE A 66  ? 1.1518 1.6395 2.7317 0.0597  -0.3001 0.5086  66  ILE A CG1 
449  C CG2 . ILE A 66  ? 1.2472 1.6207 2.7813 0.0314  -0.2800 0.5175  66  ILE A CG2 
450  C CD1 . ILE A 66  ? 1.0742 1.6294 2.6918 0.0613  -0.2940 0.4966  66  ILE A CD1 
451  N N   . SER A 67  ? 1.3732 1.6280 2.8191 0.0143  -0.3048 0.5574  67  SER A N   
452  C CA  . SER A 67  ? 1.3650 1.6105 2.7786 -0.0086 -0.3195 0.5832  67  SER A CA  
453  C C   . SER A 67  ? 1.3224 1.5850 2.7269 -0.0036 -0.3376 0.5940  67  SER A C   
454  O O   . SER A 67  ? 1.3448 1.6620 2.7505 -0.0135 -0.3546 0.6090  67  SER A O   
455  C CB  . SER A 67  ? 1.4210 1.5739 2.7934 -0.0246 -0.3100 0.5918  67  SER A CB  
456  O OG  . SER A 67  ? 1.4624 1.6035 2.8017 -0.0474 -0.3237 0.6164  67  SER A OG  
457  N N   . THR A 68  ? 1.2449 1.4612 2.6404 0.0119  -0.3335 0.5864  68  THR A N   
458  C CA  . THR A 68  ? 1.2515 1.4807 2.6386 0.0194  -0.3492 0.5958  68  THR A CA  
459  C C   . THR A 68  ? 1.2769 1.5839 2.7050 0.0421  -0.3541 0.5833  68  THR A C   
460  O O   . THR A 68  ? 1.3920 1.7303 2.8203 0.0492  -0.3687 0.5916  68  THR A O   
461  C CB  . THR A 68  ? 1.2324 1.3783 2.5915 0.0273  -0.3427 0.5939  68  THR A CB  
462  O OG1 . THR A 68  ? 1.2351 1.3593 2.6147 0.0489  -0.3246 0.5695  68  THR A OG1 
463  C CG2 . THR A 68  ? 1.2148 1.2824 2.5315 0.0044  -0.3385 0.6072  68  THR A CG2 
464  N N   . GLY A 69  ? 0.9077 1.9046 3.6131 0.3241  0.1093  -0.2351 69  GLY A N   
465  C CA  . GLY A 69  ? 0.8281 1.7988 3.4990 0.3377  0.1034  -0.2288 69  GLY A CA  
466  C C   . GLY A 69  ? 0.7454 1.7494 3.4222 0.3517  0.0791  -0.2214 69  GLY A C   
467  O O   . GLY A 69  ? 0.6665 1.7289 3.3782 0.3483  0.0746  -0.2278 69  GLY A O   
468  N N   . PHE A 70  ? 0.7860 1.7524 3.4285 0.3676  0.0632  -0.2079 70  PHE A N   
469  C CA  . PHE A 70  ? 0.8108 1.8033 3.4548 0.3822  0.0393  -0.1997 70  PHE A CA  
470  C C   . PHE A 70  ? 0.8648 1.8266 3.4711 0.3951  0.0366  -0.1946 70  PHE A C   
471  O O   . PHE A 70  ? 0.9196 1.8461 3.5013 0.3916  0.0554  -0.1995 70  PHE A O   
472  C CB  . PHE A 70  ? 0.8279 1.8040 3.4749 0.3919  0.0082  -0.1800 70  PHE A CB  
473  C CG  . PHE A 70  ? 0.8389 1.7386 3.4498 0.3998  -0.0032 -0.1622 70  PHE A CG  
474  C CD1 . PHE A 70  ? 0.8393 1.7051 3.4502 0.3899  0.0055  -0.1609 70  PHE A CD1 
475  C CD2 . PHE A 70  ? 0.8623 1.7239 3.4393 0.4171  -0.0226 -0.1468 70  PHE A CD2 
476  C CE1 . PHE A 70  ? 0.9064 1.7020 3.4843 0.3972  -0.0049 -0.1446 70  PHE A CE1 
477  C CE2 . PHE A 70  ? 0.9062 1.6976 3.4500 0.4245  -0.0331 -0.1305 70  PHE A CE2 
478  C CZ  . PHE A 70  ? 0.9419 1.7002 3.4860 0.4145  -0.0243 -0.1294 70  PHE A CZ  
479  N N   . CYS A 71  ? 0.8797 1.8551 3.4814 0.4100  0.0131  -0.1847 71  CYS A N   
480  C CA  . CYS A 71  ? 0.9699 1.9194 3.5369 0.4233  0.0082  -0.1791 71  CYS A CA  
481  C C   . CYS A 71  ? 1.0344 1.9381 3.5755 0.4411  -0.0234 -0.1555 71  CYS A C   
482  O O   . CYS A 71  ? 1.0671 1.9945 3.6235 0.4491  -0.0473 -0.1462 71  CYS A O   
483  C CB  . CYS A 71  ? 0.9567 1.9667 3.5392 0.4253  0.0118  -0.1910 71  CYS A CB  
484  S SG  . CYS A 71  ? 1.1548 2.2150 3.7616 0.4060  0.0505  -0.2193 71  CYS A SG  
485  N N   . ALA A 72  ? 1.0807 1.9187 3.5824 0.4473  -0.0234 -0.1459 72  ALA A N   
486  C CA  . ALA A 72  ? 1.1162 1.9048 3.5893 0.4644  -0.0521 -0.1235 72  ALA A CA  
487  C C   . ALA A 72  ? 1.1992 1.9242 3.6273 0.4708  -0.0459 -0.1178 72  ALA A C   
488  O O   . ALA A 72  ? 1.2016 1.9162 3.6214 0.4608  -0.0191 -0.1305 72  ALA A O   
489  C CB  . ALA A 72  ? 1.0579 1.8249 3.5410 0.4631  -0.0677 -0.1110 72  ALA A CB  
490  N N   . ALA A 73  ? 1.2517 1.9341 3.6508 0.4876  -0.0707 -0.0988 73  ALA A N   
491  C CA  . ALA A 73  ? 1.3220 1.9422 3.6766 0.4956  -0.0680 -0.0916 73  ALA A CA  
492  C C   . ALA A 73  ? 1.3767 1.9477 3.7179 0.4855  -0.0510 -0.0925 73  ALA A C   
493  O O   . ALA A 73  ? 1.3513 1.9346 3.7173 0.4729  -0.0432 -0.0975 73  ALA A O   
494  C CB  . ALA A 73  ? 1.3528 1.9357 3.6817 0.5151  -0.1000 -0.0696 73  ALA A CB  
495  N N   . CYS A 74  ? 1.4498 1.9648 3.7515 0.4911  -0.0455 -0.0875 74  CYS A N   
496  C CA  . CYS A 74  ? 1.5297 1.9945 3.8151 0.4823  -0.0288 -0.0882 74  CYS A CA  
497  C C   . CYS A 74  ? 1.6108 2.0329 3.8912 0.4860  -0.0487 -0.0707 74  CYS A C   
498  O O   . CYS A 74  ? 1.6194 2.0324 3.9124 0.4737  -0.0378 -0.0742 74  CYS A O   
499  C CB  . CYS A 74  ? 1.5546 1.9714 3.7983 0.4882  -0.0182 -0.0873 74  CYS A CB  
500  S SG  . CYS A 74  ? 1.4393 1.8034 3.6649 0.4751  0.0093  -0.0931 74  CYS A SG  
501  N N   . HIS A 75  ? 1.6589 2.0546 3.9206 0.5029  -0.0780 -0.0518 75  HIS A N   
502  C CA  . HIS A 75  ? 1.6739 2.0302 3.9307 0.5079  -0.0997 -0.0340 75  HIS A CA  
503  C C   . HIS A 75  ? 1.5713 1.9707 3.8704 0.4977  -0.1029 -0.0377 75  HIS A C   
504  O O   . HIS A 75  ? 1.5384 1.9168 3.8440 0.4883  -0.0969 -0.0368 75  HIS A O   
505  C CB  . HIS A 75  ? 1.7716 2.1044 4.0068 0.5281  -0.1319 -0.0144 75  HIS A CB  
506  C CG  . HIS A 75  ? 1.9160 2.1873 4.1048 0.5392  -0.1336 -0.0053 75  HIS A CG  
507  N ND1 . HIS A 75  ? 1.9912 2.2688 4.1618 0.5449  -0.1256 -0.0114 75  HIS A ND1 
508  C CD2 . HIS A 75  ? 1.9703 2.1724 4.1269 0.5457  -0.1425 0.0096  75  HIS A CD2 
509  C CE1 . HIS A 75  ? 2.0528 2.2678 4.1821 0.5545  -0.1294 -0.0007 75  HIS A CE1 
510  N NE2 . HIS A 75  ? 2.0433 2.2117 4.1633 0.5552  -0.1397 0.0121  75  HIS A NE2 
511  N N   . GLY A 76  ? 1.4978 1.9577 3.8253 0.4995  -0.1122 -0.0420 76  GLY A N   
512  C CA  . GLY A 76  ? 1.4976 2.0035 3.8665 0.4907  -0.1162 -0.0457 76  GLY A CA  
513  C C   . GLY A 76  ? 1.5908 2.1163 3.9826 0.4707  -0.0872 -0.0632 76  GLY A C   
514  O O   . GLY A 76  ? 1.5328 2.0623 3.9460 0.4625  -0.0890 -0.0618 76  GLY A O   
515  N N   . CYS A 77  ? 1.7907 1.0926 1.4195 -0.0885 0.0247  0.2257  77  CYS A N   
516  C CA  . CYS A 77  ? 1.9083 1.2210 1.5405 -0.0638 0.0625  0.2151  77  CYS A CA  
517  C C   . CYS A 77  ? 2.0000 1.3176 1.6031 -0.0532 0.0789  0.2330  77  CYS A C   
518  O O   . CYS A 77  ? 2.0239 1.3825 1.6412 -0.0360 0.0931  0.2494  77  CYS A O   
519  C CB  . CYS A 77  ? 1.9005 1.1708 1.5259 -0.0577 0.0880  0.1701  77  CYS A CB  
520  S SG  . CYS A 77  ? 2.2308 1.5124 1.8619 -0.0279 0.1353  0.1544  77  CYS A SG  
521  N N   . LEU A 78  ? 2.0226 1.2995 1.5859 -0.0633 0.0769  0.2291  78  LEU A N   
522  C CA  . LEU A 78  ? 2.0211 1.3003 1.5537 -0.0543 0.0917  0.2452  78  LEU A CA  
523  C C   . LEU A 78  ? 2.0256 1.3633 1.5710 -0.0536 0.0730  0.2860  78  LEU A C   
524  O O   . LEU A 78  ? 1.9476 1.3109 1.4884 -0.0375 0.0907  0.2997  78  LEU A O   
525  C CB  . LEU A 78  ? 2.0081 1.2347 1.4961 -0.0684 0.0875  0.2362  78  LEU A CB  
526  C CG  . LEU A 78  ? 1.9794 1.1489 1.4481 -0.0649 0.1137  0.1946  78  LEU A CG  
527  C CD1 . LEU A 78  ? 2.0160 1.1375 1.4419 -0.0801 0.1058  0.1890  78  LEU A CD1 
528  C CD2 . LEU A 78  ? 1.9418 1.1154 1.4080 -0.0399 0.1546  0.1846  78  LEU A CD2 
529  N N   . PHE A 79  ? 2.0485 1.4081 1.6119 -0.0711 0.0370  0.3043  79  PHE A N   
530  C CA  . PHE A 79  ? 1.9801 1.3986 1.5606 -0.0721 0.0166  0.3417  79  PHE A CA  
531  C C   . PHE A 79  ? 1.8861 1.3566 1.5041 -0.0516 0.0327  0.3495  79  PHE A C   
532  O O   . PHE A 79  ? 2.0069 1.5142 1.6269 -0.0390 0.0417  0.3689  79  PHE A O   
533  C CB  . PHE A 79  ? 2.0286 1.4589 1.6252 -0.0953 -0.0247 0.3572  79  PHE A CB  
534  C CG  . PHE A 79  ? 2.1213 1.6164 1.7432 -0.0968 -0.0461 0.3938  79  PHE A CG  
535  C CD1 . PHE A 79  ? 2.1557 1.6661 1.7567 -0.1026 -0.0586 0.4181  79  PHE A CD1 
536  C CD2 . PHE A 79  ? 2.1203 1.6624 1.7881 -0.0926 -0.0533 0.4034  79  PHE A CD2 
537  C CE1 . PHE A 79  ? 2.1176 1.6887 1.7445 -0.1045 -0.0778 0.4504  79  PHE A CE1 
538  C CE2 . PHE A 79  ? 2.0922 1.6949 1.7855 -0.0946 -0.0722 0.4363  79  PHE A CE2 
539  C CZ  . PHE A 79  ? 2.0884 1.7055 1.7620 -0.1007 -0.0843 0.4594  79  PHE A CZ  
540  N N   . ILE A 80  ? 1.7044 1.1778 1.3527 -0.0482 0.0363  0.3336  80  ILE A N   
541  C CA  . ILE A 80  ? 1.6250 1.1457 1.3104 -0.0291 0.0514  0.3388  80  ILE A CA  
542  C C   . ILE A 80  ? 1.6123 1.1237 1.2851 -0.0052 0.0918  0.3248  80  ILE A C   
543  O O   . ILE A 80  ? 1.5895 1.1390 1.2888 0.0133  0.1082  0.3300  80  ILE A O   
544  C CB  . ILE A 80  ? 1.5899 1.1109 1.3079 -0.0313 0.0471  0.3220  80  ILE A CB  
545  C CG1 . ILE A 80  ? 1.6099 1.1340 1.3396 -0.0558 0.0071  0.3339  80  ILE A CG1 
546  C CG2 . ILE A 80  ? 1.5497 1.1240 1.3072 -0.0127 0.0595  0.3307  80  ILE A CG2 
547  C CD1 . ILE A 80  ? 1.6085 1.1341 1.3713 -0.0590 0.0003  0.3187  80  ILE A CD1 
548  N N   . ALA A 81  ? 1.6248 1.0852 1.2576 -0.0057 0.1078  0.3075  81  ALA A N   
549  C CA  . ALA A 81  ? 1.6868 1.1317 1.3056 0.0158  0.1468  0.2921  81  ALA A CA  
550  C C   . ALA A 81  ? 1.6678 1.1159 1.2572 0.0206  0.1531  0.3098  81  ALA A C   
551  O O   . ALA A 81  ? 1.6363 1.0914 1.2231 0.0409  0.1818  0.3079  81  ALA A O   
552  C CB  . ALA A 81  ? 1.8072 1.1912 1.4066 0.0148  0.1668  0.2539  81  ALA A CB  
553  N N   . CYS A 82  ? 1.7440 1.1874 1.3121 0.0020  0.1262  0.3267  82  CYS A N   
554  C CA  . CYS A 82  ? 1.9244 1.3688 1.4619 0.0045  0.1298  0.3430  82  CYS A CA  
555  C C   . CYS A 82  ? 2.0399 1.5412 1.5935 -0.0006 0.1035  0.3796  82  CYS A C   
556  O O   . CYS A 82  ? 2.0931 1.6031 1.6256 0.0008  0.1031  0.3964  82  CYS A O   
557  C CB  . CYS A 82  ? 1.9500 1.3374 1.4423 -0.0118 0.1242  0.3310  82  CYS A CB  
558  S SG  . CYS A 82  ? 2.4666 1.7849 1.9369 -0.0061 0.1575  0.2873  82  CYS A SG  
559  N N   . PHE A 83  ? 2.0122 1.5529 1.6040 -0.0067 0.0819  0.3919  83  PHE A N   
560  C CA  . PHE A 83  ? 1.9618 1.5594 1.5739 -0.0123 0.0566  0.4262  83  PHE A CA  
561  C C   . PHE A 83  ? 1.9038 1.5440 1.5288 0.0097  0.0769  0.4412  83  PHE A C   
562  O O   . PHE A 83  ? 1.9131 1.5841 1.5347 0.0076  0.0655  0.4665  83  PHE A O   
563  C CB  . PHE A 83  ? 1.9947 1.6260 1.6481 -0.0222 0.0321  0.4347  83  PHE A CB  
564  C CG  . PHE A 83  ? 2.1341 1.8251 1.8115 -0.0292 0.0062  0.4697  83  PHE A CG  
565  C CD1 . PHE A 83  ? 2.1792 1.8687 1.8414 -0.0508 -0.0251 0.4870  83  PHE A CD1 
566  C CD2 . PHE A 83  ? 2.1581 1.9070 1.8737 -0.0142 0.0133  0.4850  83  PHE A CD2 
567  C CE1 . PHE A 83  ? 2.1347 1.8796 1.8203 -0.0579 -0.0483 0.5189  83  PHE A CE1 
568  C CE2 . PHE A 83  ? 2.1192 1.9238 1.8583 -0.0212 -0.0096 0.5169  83  PHE A CE2 
569  C CZ  . PHE A 83  ? 2.0996 1.9023 1.8240 -0.0433 -0.0402 0.5338  83  PHE A CZ  
570  N N   . VAL A 84  ? 1.8497 1.4912 1.4903 0.0308  0.1070  0.4252  84  VAL A N   
571  C CA  . VAL A 84  ? 1.7899 1.4684 1.4445 0.0536  0.1286  0.4368  84  VAL A CA  
572  C C   . VAL A 84  ? 1.7320 1.3877 1.3485 0.0598  0.1438  0.4387  84  VAL A C   
573  O O   . VAL A 84  ? 1.6906 1.3814 1.3136 0.0723  0.1506  0.4579  84  VAL A O   
574  C CB  . VAL A 84  ? 1.8023 1.4800 1.4789 0.0751  0.1589  0.4162  84  VAL A CB  
575  C CG1 . VAL A 84  ? 1.7954 1.4080 1.4411 0.0789  0.1843  0.3829  84  VAL A CG1 
576  C CG2 . VAL A 84  ? 1.8156 1.5355 1.5107 0.0986  0.1784  0.4305  84  VAL A CG2 
577  N N   . LEU A 85  ? 1.7551 1.3520 1.3323 0.0509  0.1491  0.4190  85  LEU A N   
578  C CA  . LEU A 85  ? 1.8197 1.3907 1.3576 0.0550  0.1629  0.4198  85  LEU A CA  
579  C C   . LEU A 85  ? 1.7693 1.3660 1.2959 0.0411  0.1350  0.4492  85  LEU A C   
580  O O   . LEU A 85  ? 1.7247 1.3264 1.2321 0.0487  0.1440  0.4609  85  LEU A O   
581  C CB  . LEU A 85  ? 1.9074 1.4094 1.4065 0.0471  0.1740  0.3912  85  LEU A CB  
582  C CG  . LEU A 85  ? 1.8804 1.3501 1.3860 0.0601  0.2042  0.3592  85  LEU A CG  
583  C CD1 . LEU A 85  ? 1.9500 1.3528 1.4174 0.0489  0.2115  0.3326  85  LEU A CD1 
584  C CD2 . LEU A 85  ? 1.8072 1.2896 1.3205 0.0871  0.2385  0.3574  85  LEU A CD2 
585  N N   . VAL A 86  ? 1.7742 1.3872 1.3138 0.0207  0.1010  0.4611  86  VAL A N   
586  C CA  . VAL A 86  ? 1.8119 1.4509 1.3443 0.0054  0.0715  0.4892  86  VAL A CA  
587  C C   . VAL A 86  ? 1.7265 1.4307 1.2900 0.0175  0.0707  0.5169  86  VAL A C   
588  O O   . VAL A 86  ? 1.7561 1.4733 1.3039 0.0222  0.0737  0.5329  86  VAL A O   
589  C CB  . VAL A 86  ? 1.8922 1.5314 1.4339 -0.0197 0.0350  0.4943  86  VAL A CB  
590  C CG1 . VAL A 86  ? 1.9514 1.6205 1.4884 -0.0352 0.0046  0.5242  86  VAL A CG1 
591  C CG2 . VAL A 86  ? 1.9293 1.5029 1.4397 -0.0324 0.0345  0.4675  86  VAL A CG2 
592  N N   . LEU A 87  ? 1.5617 1.3068 1.1693 0.0225  0.0669  0.5225  87  LEU A N   
593  C CA  . LEU A 87  ? 1.3683 1.1775 1.0096 0.0340  0.0665  0.5481  87  LEU A CA  
594  C C   . LEU A 87  ? 1.4217 1.2335 1.0523 0.0575  0.0973  0.5486  87  LEU A C   
595  O O   . LEU A 87  ? 1.5603 1.4087 1.1948 0.0617  0.0936  0.5725  87  LEU A O   
596  C CB  . LEU A 87  ? 1.1981 1.0429 0.8861 0.0404  0.0666  0.5472  87  LEU A CB  
597  C CG  . LEU A 87  ? 1.2172 1.0636 0.9221 0.0188  0.0371  0.5472  87  LEU A CG  
598  C CD1 . LEU A 87  ? 1.1561 1.0457 0.9090 0.0274  0.0389  0.5500  87  LEU A CD1 
599  C CD2 . LEU A 87  ? 1.3033 1.1706 1.0047 -0.0034 0.0023  0.5732  87  LEU A CD2 
600  N N   . ALA A 88  ? 1.3950 1.1675 1.0130 0.0727  0.1279  0.5221  88  ALA A N   
601  C CA  . ALA A 88  ? 1.4826 1.2517 1.0903 0.0957  0.1591  0.5200  88  ALA A CA  
602  C C   . ALA A 88  ? 1.5854 1.3315 1.1511 0.0903  0.1579  0.5275  88  ALA A C   
603  O O   . ALA A 88  ? 1.5952 1.3623 1.1586 0.1040  0.1697  0.5422  88  ALA A O   
604  C CB  . ALA A 88  ? 1.5047 1.2331 1.1082 0.1112  0.1911  0.4885  88  ALA A CB  
605  N N   . GLN A 89  ? 1.6542 1.3574 1.1868 0.0704  0.1434  0.5177  89  GLN A N   
606  C CA  . GLN A 89  ? 1.7247 1.4032 1.2146 0.0635  0.1408  0.5237  89  GLN A CA  
607  C C   . GLN A 89  ? 1.7946 1.5193 1.2905 0.0533  0.1137  0.5568  89  GLN A C   
608  O O   . GLN A 89  ? 1.8938 1.6234 1.3693 0.0583  0.1188  0.5700  89  GLN A O   
609  C CB  . GLN A 89  ? 1.7627 1.3829 1.2161 0.0445  0.1319  0.5038  89  GLN A CB  
610  C CG  . GLN A 89  ? 1.7760 1.3677 1.1824 0.0373  0.1299  0.5082  89  GLN A CG  
611  C CD  . GLN A 89  ? 1.7399 1.3124 1.1263 0.0585  0.1655  0.4998  89  GLN A CD  
612  O OE1 . GLN A 89  ? 1.7113 1.2891 1.1187 0.0789  0.1921  0.4896  89  GLN A OE1 
613  N NE2 . GLN A 89  ? 1.7662 1.3162 1.1121 0.0540  0.1659  0.5044  89  GLN A NE2 
614  N N   . SER A 90  ? 1.7407 1.4990 1.2652 0.0387  0.0851  0.5702  90  SER A N   
615  C CA  . SER A 90  ? 1.6905 1.4969 1.2267 0.0285  0.0589  0.6021  90  SER A CA  
616  C C   . SER A 90  ? 1.5586 1.4117 1.1162 0.0499  0.0758  0.6200  90  SER A C   
617  O O   . SER A 90  ? 1.5443 1.4158 1.0895 0.0500  0.0711  0.6400  90  SER A O   
618  C CB  . SER A 90  ? 1.6954 1.5327 1.2657 0.0116  0.0289  0.6122  90  SER A CB  
619  O OG  . SER A 90  ? 1.7162 1.6017 1.3002 0.0017  0.0044  0.6434  90  SER A OG  
620  N N   . SER A 91  ? 1.4470 1.3187 1.0370 0.0682  0.0956  0.6124  91  SER A N   
621  C CA  . SER A 91  ? 1.3572 1.2717 0.9702 0.0905  0.1138  0.6271  91  SER A CA  
622  C C   . SER A 91  ? 1.3876 1.2774 0.9673 0.1045  0.1371  0.6250  91  SER A C   
623  O O   . SER A 91  ? 1.4811 1.4060 1.0690 0.1165  0.1432  0.6450  91  SER A O   
624  C CB  . SER A 91  ? 1.2385 1.1657 0.8861 0.1088  0.1342  0.6137  91  SER A CB  
625  O OG  . SER A 91  ? 1.1321 1.0888 0.8135 0.0970  0.1129  0.6187  91  SER A OG  
626  N N   . ILE A 92  ? 1.4235 1.2531 0.9659 0.1028  0.1503  0.6010  92  ILE A N   
627  C CA  . ILE A 92  ? 1.6499 1.4513 1.1577 0.1143  0.1720  0.5978  92  ILE A CA  
628  C C   . ILE A 92  ? 1.7121 1.5299 1.1989 0.1025  0.1519  0.6227  92  ILE A C   
629  O O   . ILE A 92  ? 1.7302 1.5616 1.2091 0.1158  0.1648  0.6358  92  ILE A O   
630  C CB  . ILE A 92  ? 1.8690 1.6016 1.3392 0.1110  0.1871  0.5674  92  ILE A CB  
631  C CG1 . ILE A 92  ? 1.8944 1.6089 1.3836 0.1261  0.2125  0.5419  92  ILE A CG1 
632  C CG2 . ILE A 92  ? 1.9488 1.6535 1.3800 0.1190  0.2052  0.5673  92  ILE A CG2 
633  C CD1 . ILE A 92  ? 1.8918 1.6204 1.3959 0.1543  0.2441  0.5425  92  ILE A CD1 
634  N N   . PHE A 93  ? 1.7532 1.5695 1.2315 0.0775  0.1200  0.6292  93  PHE A N   
635  C CA  . PHE A 93  ? 1.8064 1.6381 1.2652 0.0638  0.0976  0.6525  93  PHE A CA  
636  C C   . PHE A 93  ? 1.6190 1.5179 1.1125 0.0692  0.0878  0.6832  93  PHE A C   
637  O O   . PHE A 93  ? 1.5797 1.4963 1.0612 0.0738  0.0888  0.7018  93  PHE A O   
638  C CB  . PHE A 93  ? 1.8555 1.6688 1.2997 0.0355  0.0649  0.6512  93  PHE A CB  
639  C CG  . PHE A 93  ? 1.8345 1.5813 1.2405 0.0281  0.0719  0.6229  93  PHE A CG  
640  C CD1 . PHE A 93  ? 1.7997 1.5227 1.2154 0.0188  0.0659  0.6031  93  PHE A CD1 
641  C CD2 . PHE A 93  ? 1.8173 1.5259 1.1780 0.0304  0.0849  0.6164  93  PHE A CD2 
642  C CE1 . PHE A 93  ? 1.8324 1.4944 1.2135 0.0118  0.0728  0.5770  93  PHE A CE1 
643  C CE2 . PHE A 93  ? 1.8186 1.4668 1.1442 0.0233  0.0921  0.5905  93  PHE A CE2 
644  C CZ  . PHE A 93  ? 1.8592 1.4837 1.1950 0.0139  0.0861  0.5706  93  PHE A CZ  
645  N N   . SER A 94  ? 1.4055 1.3421 0.9424 0.0684  0.0786  0.6886  94  SER A N   
646  C CA  . SER A 94  ? 1.2612 1.2637 0.8349 0.0730  0.0695  0.7169  94  SER A CA  
647  C C   . SER A 94  ? 1.3670 1.3887 0.9476 0.0998  0.0984  0.7234  94  SER A C   
648  O O   . SER A 94  ? 1.4059 1.4580 0.9847 0.1026  0.0945  0.7466  94  SER A O   
649  C CB  . SER A 94  ? 1.0889 1.1245 0.7078 0.0694  0.0588  0.7179  94  SER A CB  
650  O OG  . SER A 94  ? 1.0926 1.1142 0.7078 0.0440  0.0299  0.7150  94  SER A OG  
651  N N   . LEU A 95  ? 1.3691 1.3725 0.9579 0.1196  0.1273  0.7028  95  LEU A N   
652  C CA  . LEU A 95  ? 1.3218 1.3402 0.9190 0.1465  0.1562  0.7069  95  LEU A CA  
653  C C   . LEU A 95  ? 1.3375 1.3337 0.8957 0.1507  0.1657  0.7126  95  LEU A C   
654  O O   . LEU A 95  ? 1.2936 1.3190 0.8591 0.1662  0.1768  0.7299  95  LEU A O   
655  C CB  . LEU A 95  ? 1.2899 1.2813 0.8964 0.1653  0.1856  0.6802  95  LEU A CB  
656  C CG  . LEU A 95  ? 1.3223 1.3388 0.9702 0.1661  0.1814  0.6742  95  LEU A CG  
657  C CD1 . LEU A 95  ? 1.3879 1.3761 1.0419 0.1867  0.2130  0.6481  95  LEU A CD1 
658  C CD2 . LEU A 95  ? 1.3298 1.4163 1.0188 0.1711  0.1713  0.7019  95  LEU A CD2 
659  N N   . LEU A 96  ? 1.4109 1.3557 0.9277 0.1372  0.1615  0.6981  96  LEU A N   
660  C CA  . LEU A 96  ? 1.5829 1.5038 1.0593 0.1393  0.1692  0.7027  96  LEU A CA  
661  C C   . LEU A 96  ? 1.6843 1.6447 1.1589 0.1265  0.1430  0.7333  96  LEU A C   
662  O O   . LEU A 96  ? 1.6874 1.6597 1.1493 0.1361  0.1512  0.7486  96  LEU A O   
663  C CB  . LEU A 96  ? 1.6500 1.5064 1.0828 0.1268  0.1703  0.6787  96  LEU A CB  
664  C CG  . LEU A 96  ? 1.7333 1.5492 1.1256 0.1378  0.1945  0.6703  96  LEU A CG  
665  C CD1 . LEU A 96  ? 1.8122 1.5655 1.1654 0.1244  0.1953  0.6447  96  LEU A CD1 
666  C CD2 . LEU A 96  ? 1.7345 1.5740 1.1095 0.1362  0.1852  0.6968  96  LEU A CD2 
667  N N   . ALA A 97  ? 1.7166 1.6974 1.2047 0.1047  0.1115  0.7423  97  ALA A N   
668  C CA  . ALA A 97  ? 1.6989 1.7193 1.1892 0.0907  0.0843  0.7714  97  ALA A CA  
669  C C   . ALA A 97  ? 1.6346 1.7143 1.1594 0.1071  0.0913  0.7956  97  ALA A C   
670  O O   . ALA A 97  ? 1.6811 1.7789 1.1940 0.1112  0.0915  0.8149  97  ALA A O   
671  C CB  . ALA A 97  ? 1.6532 1.6848 1.1575 0.0653  0.0507  0.7753  97  ALA A CB  
672  N N   . ILE A 98  ? 1.4501 1.5600 1.0172 0.1165  0.0972  0.7944  98  ILE A N   
673  C CA  . ILE A 98  ? 1.2932 1.4600 0.8960 0.1332  0.1052  0.8156  98  ILE A CA  
674  C C   . ILE A 98  ? 1.3548 1.5130 0.9412 0.1565  0.1338  0.8173  98  ILE A C   
675  O O   . ILE A 98  ? 1.3582 1.5565 0.9548 0.1644  0.1339  0.8412  98  ILE A O   
676  C CB  . ILE A 98  ? 1.1164 1.3065 0.7625 0.1438  0.1142  0.8076  98  ILE A CB  
677  C CG1 . ILE A 98  ? 1.1388 1.3377 0.8027 0.1210  0.0864  0.8063  98  ILE A CG1 
678  C CG2 . ILE A 98  ? 1.0115 1.2612 0.6938 0.1612  0.1225  0.8300  98  ILE A CG2 
679  C CD1 . ILE A 98  ? 1.1228 1.3456 0.8289 0.1300  0.0936  0.7987  98  ILE A CD1 
680  N N   . ALA A 99  ? 1.4972 1.6028 1.0590 0.1674  0.1581  0.7920  99  ALA A N   
681  C CA  . ALA A 99  ? 1.6780 1.7688 1.2221 0.1893  0.1865  0.7914  99  ALA A CA  
682  C C   . ALA A 99  ? 1.8483 1.9418 1.3615 0.1818  0.1759  0.8108  99  ALA A C   
683  O O   . ALA A 99  ? 1.8902 2.0130 1.4092 0.1960  0.1852  0.8300  99  ALA A O   
684  C CB  . ALA A 99  ? 1.6827 1.7115 1.2020 0.1977  0.2114  0.7600  99  ALA A CB  
685  N N   . ILE A 100 ? 1.9264 1.9895 1.4066 0.1595  0.1563  0.8059  100 ILE A N   
686  C CA  . ILE A 100 ? 2.0020 2.0655 1.4502 0.1502  0.1438  0.8231  100 ILE A CA  
687  C C   . ILE A 100 ? 1.9498 2.0754 1.4237 0.1427  0.1204  0.8550  100 ILE A C   
688  O O   . ILE A 100 ? 2.0308 2.1767 1.4942 0.1472  0.1202  0.8754  100 ILE A O   
689  C CB  . ILE A 100 ? 2.1090 2.1273 1.5176 0.1265  0.1254  0.8103  100 ILE A CB  
690  C CG1 . ILE A 100 ? 2.1785 2.1347 1.5619 0.1328  0.1486  0.7780  100 ILE A CG1 
691  C CG2 . ILE A 100 ? 2.1336 2.1528 1.5079 0.1179  0.1132  0.8282  100 ILE A CG2 
692  C CD1 . ILE A 100 ? 2.2093 2.1187 1.5532 0.1106  0.1325  0.7635  100 ILE A CD1 
693  N N   . ASP A 101 ? 1.8145 1.9704 1.3227 0.1311  0.1010  0.8592  101 ASP A N   
694  C CA  . ASP A 101 ? 1.7077 1.9240 1.2445 0.1225  0.0782  0.8887  101 ASP A CA  
695  C C   . ASP A 101 ? 1.6567 1.9160 1.2151 0.1451  0.0957  0.9081  101 ASP A C   
696  O O   . ASP A 101 ? 1.6554 1.9382 1.2042 0.1441  0.0887  0.9305  101 ASP A O   
697  C CB  . ASP A 101 ? 1.6157 1.8571 1.1910 0.1111  0.0612  0.8874  101 ASP A CB  
698  C CG  . ASP A 101 ? 1.5328 1.8390 1.1417 0.1033  0.0399  0.9179  101 ASP A CG  
699  O OD1 . ASP A 101 ? 1.5876 1.9088 1.1809 0.0932  0.0241  0.9381  101 ASP A OD1 
700  O OD2 . ASP A 101 ? 1.4113 1.7539 1.0622 0.1071  0.0393  0.9218  101 ASP A OD2 
701  N N   . ARG A 102 ? 1.6252 1.8949 1.2127 0.1655  0.1183  0.8994  102 ARG A N   
702  C CA  . ARG A 102 ? 1.6172 1.9266 1.2278 0.1887  0.1366  0.9160  102 ARG A CA  
703  C C   . ARG A 102 ? 1.6390 1.9275 1.2157 0.2015  0.1538  0.9204  102 ARG A C   
704  O O   . ARG A 102 ? 1.6455 1.9701 1.2331 0.2145  0.1605  0.9418  102 ARG A O   
705  C CB  . ARG A 102 ? 1.6196 1.9318 1.2609 0.2095  0.1606  0.9007  102 ARG A CB  
706  C CG  . ARG A 102 ? 1.6762 2.0166 1.3556 0.1997  0.1455  0.8988  102 ARG A CG  
707  C CD  . ARG A 102 ? 1.7958 2.2057 1.5119 0.1971  0.1298  0.9290  102 ARG A CD  
708  N NE  . ARG A 102 ? 1.8982 2.3239 1.5992 0.1763  0.1028  0.9504  102 ARG A NE  
709  C CZ  . ARG A 102 ? 1.9011 2.3842 1.6285 0.1696  0.0854  0.9781  102 ARG A CZ  
710  N NH1 . ARG A 102 ? 1.8733 2.4041 1.6434 0.1820  0.0922  0.9879  102 ARG A NH1 
711  N NH2 . ARG A 102 ? 1.9278 2.4207 1.6388 0.1503  0.0612  0.9960  102 ARG A NH2 
712  N N   . TYR A 103 ? 1.6835 1.9137 1.2190 0.1976  0.1612  0.9004  103 TYR A N   
713  C CA  . TYR A 103 ? 1.7657 1.9720 1.2654 0.2078  0.1769  0.9036  103 TYR A CA  
714  C C   . TYR A 103 ? 1.8403 2.0699 1.3226 0.1929  0.1533  0.9290  103 TYR A C   
715  O O   . TYR A 103 ? 1.8712 2.1229 1.3503 0.2050  0.1615  0.9481  103 TYR A O   
716  C CB  . TYR A 103 ? 1.7710 1.9089 1.2309 0.2058  0.1901  0.8751  103 TYR A CB  
717  C CG  . TYR A 103 ? 1.7971 1.9082 1.2177 0.2147  0.2055  0.8780  103 TYR A CG  
718  C CD1 . TYR A 103 ? 1.7950 1.8987 1.2176 0.2411  0.2377  0.8756  103 TYR A CD1 
719  C CD2 . TYR A 103 ? 1.8390 1.9323 1.2205 0.1968  0.1878  0.8836  103 TYR A CD2 
720  C CE1 . TYR A 103 ? 1.8520 1.9317 1.2394 0.2493  0.2522  0.8791  103 TYR A CE1 
721  C CE2 . TYR A 103 ? 1.8961 1.9661 1.2413 0.2050  0.2021  0.8868  103 TYR A CE2 
722  C CZ  . TYR A 103 ? 1.9046 1.9680 1.2531 0.2312  0.2344  0.8848  103 TYR A CZ  
723  O OH  . TYR A 103 ? 1.9454 1.9861 1.2585 0.2395  0.2490  0.8887  103 TYR A OH  
724  N N   . ILE A 104 ? 1.8959 2.1204 1.3674 0.1665  0.1238  0.9294  104 ILE A N   
725  C CA  . ILE A 104 ? 1.9898 2.2347 1.4443 0.1499  0.0987  0.9524  104 ILE A CA  
726  C C   . ILE A 104 ? 1.9379 2.2497 1.4283 0.1547  0.0906  0.9827  104 ILE A C   
727  O O   . ILE A 104 ? 1.9952 2.3277 1.4730 0.1550  0.0852  1.0042  104 ILE A O   
728  C CB  . ILE A 104 ? 2.0703 2.3011 1.5136 0.1204  0.0669  0.9472  104 ILE A CB  
729  C CG1 . ILE A 104 ? 2.1185 2.2827 1.5260 0.1151  0.0747  0.9167  104 ILE A CG1 
730  C CG2 . ILE A 104 ? 2.1334 2.3841 1.5580 0.1035  0.0410  0.9709  104 ILE A CG2 
731  C CD1 . ILE A 104 ? 2.1514 2.2974 1.5468 0.0869  0.0445  0.9099  104 ILE A CD1 
732  N N   . ALA A 105 ? 1.4198 2.0523 3.0538 -0.1453 -0.3511 0.4636  105 ALA A N   
733  C CA  . ALA A 105 ? 1.2695 1.8591 2.9306 -0.1407 -0.3422 0.4296  105 ALA A CA  
734  C C   . ALA A 105 ? 1.2774 1.8377 2.9228 -0.1419 -0.3703 0.4374  105 ALA A C   
735  O O   . ALA A 105 ? 1.3162 1.8723 2.9925 -0.1263 -0.3779 0.4085  105 ALA A O   
736  C CB  . ALA A 105 ? 1.1960 1.7434 2.8502 -0.1569 -0.3143 0.4266  105 ALA A CB  
737  N N   . ILE A 106 ? 1.2579 1.7982 2.8551 -0.1604 -0.3856 0.4764  106 ILE A N   
738  C CA  . ILE A 106 ? 1.2234 1.7332 2.8009 -0.1638 -0.4121 0.4875  106 ILE A CA  
739  C C   . ILE A 106 ? 1.3258 1.8740 2.9070 -0.1484 -0.4418 0.4926  106 ILE A C   
740  O O   . ILE A 106 ? 1.4095 1.9424 3.0018 -0.1394 -0.4590 0.4793  106 ILE A O   
741  C CB  . ILE A 106 ? 1.0676 1.5453 2.5910 -0.1887 -0.4197 0.5291  106 ILE A CB  
742  C CG1 . ILE A 106 ? 0.9855 1.4190 2.5055 -0.2039 -0.3916 0.5223  106 ILE A CG1 
743  C CG2 . ILE A 106 ? 1.0745 1.5250 2.5764 -0.1915 -0.4490 0.5424  106 ILE A CG2 
744  C CD1 . ILE A 106 ? 0.9540 1.3508 2.4230 -0.2286 -0.3981 0.5599  106 ILE A CD1 
745  N N   . ALA A 107 ? 1.3204 1.9185 2.8924 -0.1454 -0.4475 0.5117  107 ALA A N   
746  C CA  . ALA A 107 ? 1.3340 1.9722 2.9081 -0.1312 -0.4753 0.5186  107 ALA A CA  
747  C C   . ALA A 107 ? 1.3335 1.9977 2.9606 -0.1062 -0.4717 0.4764  107 ALA A C   
748  O O   . ALA A 107 ? 1.3962 2.0551 3.0371 -0.0943 -0.4904 0.4626  107 ALA A O   
749  C CB  . ALA A 107 ? 1.3277 2.0112 2.8758 -0.1360 -0.4816 0.5520  107 ALA A CB  
750  N N   . ILE A 108 ? 1.3024 1.9948 2.9591 -0.0982 -0.4474 0.4558  108 ILE A N   
751  C CA  . ILE A 108 ? 1.3892 2.1092 3.0972 -0.0746 -0.4419 0.4152  108 ILE A CA  
752  C C   . ILE A 108 ? 1.4210 2.1190 3.1645 -0.0721 -0.4089 0.3784  108 ILE A C   
753  O O   . ILE A 108 ? 1.4469 2.1708 3.2079 -0.0690 -0.3864 0.3681  108 ILE A O   
754  C CB  . ILE A 108 ? 1.3714 2.1551 3.0888 -0.0628 -0.4449 0.4204  108 ILE A CB  
755  C CG1 . ILE A 108 ? 1.2957 2.1001 2.9684 -0.0714 -0.4718 0.4653  108 ILE A CG1 
756  C CG2 . ILE A 108 ? 1.3954 2.2085 3.1594 -0.0375 -0.4505 0.3842  108 ILE A CG2 
757  C CD1 . ILE A 108 ? 1.2301 2.0965 2.9084 -0.0613 -0.4755 0.4737  108 ILE A CD1 
758  N N   . PRO A 109 ? 1.3435 1.9933 3.0976 -0.0734 -0.4060 0.3584  109 PRO A N   
759  C CA  . PRO A 109 ? 1.2541 1.8762 3.0399 -0.0724 -0.3755 0.3238  109 PRO A CA  
760  C C   . PRO A 109 ? 1.2269 1.8859 3.0647 -0.0506 -0.3609 0.2845  109 PRO A C   
761  O O   . PRO A 109 ? 1.1971 1.8543 3.0565 -0.0508 -0.3315 0.2646  109 PRO A O   
762  C CB  . PRO A 109 ? 1.2545 1.8255 3.0426 -0.0736 -0.3847 0.3107  109 PRO A CB  
763  C CG  . PRO A 109 ? 1.2959 1.8566 3.0386 -0.0846 -0.4148 0.3495  109 PRO A CG  
764  C CD  . PRO A 109 ? 1.3251 1.9428 3.0601 -0.0765 -0.4321 0.3687  109 PRO A CD  
765  N N   . LEU A 110 ? 1.2747 1.9667 3.1321 -0.0322 -0.3811 0.2737  110 LEU A N   
766  C CA  . LEU A 110 ? 1.3049 2.0326 3.2126 -0.0105 -0.3696 0.2356  110 LEU A CA  
767  C C   . LEU A 110 ? 1.3216 2.0980 3.2330 -0.0084 -0.3557 0.2427  110 LEU A C   
768  O O   . LEU A 110 ? 1.2687 2.0551 3.2127 -0.0018 -0.3290 0.2152  110 LEU A O   
769  C CB  . LEU A 110 ? 1.3191 2.0689 3.2452 0.0084  -0.3965 0.2234  110 LEU A CB  
770  C CG  . LEU A 110 ? 1.3352 2.0440 3.2771 0.0139  -0.4051 0.2003  110 LEU A CG  
771  C CD1 . LEU A 110 ? 1.3613 2.0204 3.2599 -0.0057 -0.4176 0.2292  110 LEU A CD1 
772  C CD2 . LEU A 110 ? 1.3215 2.0606 3.2856 0.0347  -0.4295 0.1864  110 LEU A CD2 
773  N N   . ARG A 111 ? 1.3917 2.1982 3.2695 -0.0139 -0.3738 0.2796  111 ARG A N   
774  C CA  . ARG A 111 ? 1.3915 2.2456 3.2691 -0.0124 -0.3631 0.2900  111 ARG A CA  
775  C C   . ARG A 111 ? 1.2647 2.1003 3.1226 -0.0309 -0.3371 0.3042  111 ARG A C   
776  O O   . ARG A 111 ? 1.2321 2.1015 3.0937 -0.0304 -0.3218 0.3083  111 ARG A O   
777  C CB  . ARG A 111 ? 1.5158 2.4072 3.3627 -0.0125 -0.3915 0.3258  111 ARG A CB  
778  C CG  . ARG A 111 ? 1.6381 2.5586 3.5068 0.0078  -0.4161 0.3119  111 ARG A CG  
779  C CD  . ARG A 111 ? 1.7129 2.6719 3.6324 0.0287  -0.4009 0.2737  111 ARG A CD  
780  N NE  . ARG A 111 ? 1.7691 2.7675 3.6875 0.0272  -0.3846 0.2832  111 ARG A NE  
781  C CZ  . ARG A 111 ? 1.7984 2.8453 3.7047 0.0318  -0.3992 0.3043  111 ARG A CZ  
782  N NH1 . ARG A 111 ? 1.8358 2.8980 3.7299 0.0383  -0.4306 0.3184  111 ARG A NH1 
783  N NH2 . ARG A 111 ? 1.7668 2.8468 3.6731 0.0300  -0.3823 0.3116  111 ARG A NH2 
784  N N   . TYR A 112 ? 1.1912 1.9729 3.0281 -0.0472 -0.3322 0.3118  112 TYR A N   
785  C CA  . TYR A 112 ? 1.1310 1.8900 2.9480 -0.0657 -0.3078 0.3253  112 TYR A CA  
786  C C   . TYR A 112 ? 1.0862 1.8583 2.9418 -0.0579 -0.2744 0.2931  112 TYR A C   
787  O O   . TYR A 112 ? 1.0368 1.8246 2.8818 -0.0660 -0.2567 0.3062  112 TYR A O   
788  C CB  . TYR A 112 ? 1.1521 1.8480 2.9485 -0.0816 -0.3066 0.3303  112 TYR A CB  
789  C CG  . TYR A 112 ? 1.1528 1.8209 2.9363 -0.0989 -0.2781 0.3361  112 TYR A CG  
790  C CD1 . TYR A 112 ? 1.1601 1.8055 2.9776 -0.0953 -0.2494 0.3004  112 TYR A CD1 
791  C CD2 . TYR A 112 ? 1.1472 1.8118 2.8846 -0.1186 -0.2797 0.3772  112 TYR A CD2 
792  C CE1 . TYR A 112 ? 1.1536 1.7735 2.9594 -0.1109 -0.2232 0.3056  112 TYR A CE1 
793  C CE2 . TYR A 112 ? 1.1463 1.7858 2.8717 -0.1343 -0.2538 0.3826  112 TYR A CE2 
794  C CZ  . TYR A 112 ? 1.1281 1.7452 2.8877 -0.1303 -0.2256 0.3468  112 TYR A CZ  
795  O OH  . TYR A 112 ? 1.0887 1.6808 2.8364 -0.1457 -0.1996 0.3521  112 TYR A OH  
796  N N   . ASN A 113 ? 1.1425 1.9080 3.0430 -0.0420 -0.2658 0.2508  113 ASN A N   
797  C CA  . ASN A 113 ? 1.1570 1.9320 3.0971 -0.0337 -0.2340 0.2168  113 ASN A CA  
798  C C   . ASN A 113 ? 1.1594 1.9962 3.1213 -0.0186 -0.2314 0.2103  113 ASN A C   
799  O O   . ASN A 113 ? 1.1207 1.9742 3.0973 -0.0182 -0.2055 0.2006  113 ASN A O   
800  C CB  . ASN A 113 ? 1.1570 1.9032 3.1380 -0.0220 -0.2258 0.1735  113 ASN A CB  
801  C CG  . ASN A 113 ? 1.1833 1.8677 3.1447 -0.0364 -0.2275 0.1781  113 ASN A CG  
802  O OD1 . ASN A 113 ? 1.1744 1.8245 3.1345 -0.0478 -0.2033 0.1719  113 ASN A OD1 
803  N ND2 . ASN A 113 ? 1.2136 1.8831 3.1592 -0.0360 -0.2562 0.1892  113 ASN A ND2 
804  N N   . GLY A 114 ? 1.1862 2.0566 3.1497 -0.0063 -0.2584 0.2157  114 GLY A N   
805  C CA  . GLY A 114 ? 1.1501 2.0801 3.1336 0.0088  -0.2592 0.2102  114 GLY A CA  
806  C C   . GLY A 114 ? 1.1040 2.0641 3.0514 -0.0023 -0.2617 0.2497  114 GLY A C   
807  O O   . GLY A 114 ? 1.0373 2.0454 2.9988 0.0072  -0.2561 0.2470  114 GLY A O   
808  N N   . LEU A 115 ? 1.1529 2.0847 3.0535 -0.0226 -0.2702 0.2864  115 LEU A N   
809  C CA  . LEU A 115 ? 1.2177 2.1740 3.0801 -0.0352 -0.2735 0.3266  115 LEU A CA  
810  C C   . LEU A 115 ? 1.2297 2.1588 3.0741 -0.0537 -0.2466 0.3376  115 LEU A C   
811  O O   . LEU A 115 ? 1.2185 2.1750 3.0667 -0.0545 -0.2275 0.3402  115 LEU A O   
812  C CB  . LEU A 115 ? 1.2549 2.2064 3.0740 -0.0442 -0.3069 0.3649  115 LEU A CB  
813  C CG  . LEU A 115 ? 1.2715 2.2539 3.1019 -0.0272 -0.3362 0.3610  115 LEU A CG  
814  C CD1 . LEU A 115 ? 1.2949 2.2628 3.0809 -0.0381 -0.3675 0.3981  115 LEU A CD1 
815  C CD2 . LEU A 115 ? 1.2649 2.3096 3.1110 -0.0138 -0.3360 0.3600  115 LEU A CD2 
816  N N   . VAL A 116 ? 1.2190 2.0941 3.0436 -0.0684 -0.2454 0.3439  116 VAL A N   
817  C CA  . VAL A 116 ? 1.1475 1.9913 2.9541 -0.0866 -0.2206 0.3537  116 VAL A CA  
818  C C   . VAL A 116 ? 1.2209 2.0549 3.0706 -0.0788 -0.1877 0.3125  116 VAL A C   
819  O O   . VAL A 116 ? 1.2657 2.0559 3.1291 -0.0805 -0.1785 0.2905  116 VAL A O   
820  C CB  . VAL A 116 ? 1.0248 1.8124 2.7972 -0.1048 -0.2301 0.3726  116 VAL A CB  
821  C CG1 . VAL A 116 ? 0.9703 1.7289 2.7202 -0.1245 -0.2058 0.3868  116 VAL A CG1 
822  C CG2 . VAL A 116 ? 0.9868 1.7824 2.7190 -0.1112 -0.2641 0.4107  116 VAL A CG2 
823  N N   . THR A 117 ? 1.2197 2.0948 3.0906 -0.0702 -0.1701 0.3022  117 THR A N   
824  C CA  . THR A 117 ? 1.1823 2.0535 3.0953 -0.0618 -0.1383 0.2632  117 THR A CA  
825  C C   . THR A 117 ? 1.1668 2.0249 3.0639 -0.0776 -0.1102 0.2751  117 THR A C   
826  O O   . THR A 117 ? 1.1244 1.9921 2.9826 -0.0916 -0.1147 0.3128  117 THR A O   
827  C CB  . THR A 117 ? 1.1322 2.0574 3.0852 -0.0401 -0.1347 0.2383  117 THR A CB  
828  O OG1 . THR A 117 ? 1.1731 2.1420 3.1074 -0.0430 -0.1343 0.2650  117 THR A OG1 
829  C CG2 . THR A 117 ? 1.1002 2.0413 3.0687 -0.0240 -0.1631 0.2272  117 THR A CG2 
830  N N   . GLY A 118 ? 1.1994 2.0358 3.1269 -0.0752 -0.0811 0.2428  118 GLY A N   
831  C CA  . GLY A 118 ? 1.2244 2.0459 3.1408 -0.0891 -0.0523 0.2499  118 GLY A CA  
832  C C   . GLY A 118 ? 1.2017 2.0727 3.1174 -0.0866 -0.0409 0.2615  118 GLY A C   
833  O O   . GLY A 118 ? 1.1220 1.9875 3.0158 -0.1008 -0.0235 0.2806  118 GLY A O   
834  N N   . THR A 119 ? 1.8110 1.2209 2.4133 -0.0926 -0.5187 0.0384  119 THR A N   
835  C CA  . THR A 119 ? 1.8437 1.2828 2.4248 -0.0646 -0.5069 0.0116  119 THR A CA  
836  C C   . THR A 119 ? 1.8374 1.3391 2.3945 -0.0778 -0.4686 0.0057  119 THR A C   
837  O O   . THR A 119 ? 1.7889 1.3506 2.3690 -0.0621 -0.4473 -0.0123 119 THR A O   
838  C CB  . THR A 119 ? 1.9210 1.3001 2.4459 -0.0491 -0.5293 0.0035  119 THR A CB  
839  O OG1 . THR A 119 ? 1.9119 1.2330 2.4597 -0.0361 -0.5651 0.0082  119 THR A OG1 
840  C CG2 . THR A 119 ? 1.9263 1.3372 2.4314 -0.0194 -0.5170 -0.0250 119 THR A CG2 
841  N N   . ARG A 120 ? 1.8321 1.3193 2.3428 -0.1070 -0.4601 0.0207  120 ARG A N   
842  C CA  . ARG A 120 ? 1.8296 1.3728 2.3149 -0.1236 -0.4239 0.0176  120 ARG A CA  
843  C C   . ARG A 120 ? 1.7438 1.3540 2.2873 -0.1330 -0.3999 0.0206  120 ARG A C   
844  O O   . ARG A 120 ? 1.7449 1.4178 2.2866 -0.1330 -0.3687 0.0085  120 ARG A O   
845  C CB  . ARG A 120 ? 1.8790 1.3898 2.3100 -0.1567 -0.4219 0.0373  120 ARG A CB  
846  C CG  . ARG A 120 ? 1.9532 1.4053 2.3184 -0.1494 -0.4401 0.0328  120 ARG A CG  
847  C CD  . ARG A 120 ? 2.0410 1.4675 2.3519 -0.1834 -0.4348 0.0517  120 ARG A CD  
848  N NE  . ARG A 120 ? 2.1471 1.5207 2.3919 -0.1769 -0.4499 0.0466  120 ARG A NE  
849  C CZ  . ARG A 120 ? 2.2249 1.5688 2.4125 -0.2023 -0.4482 0.0599  120 ARG A CZ  
850  N NH1 . ARG A 120 ? 2.2745 1.5703 2.4038 -0.1941 -0.4628 0.0540  120 ARG A NH1 
851  N NH2 . ARG A 120 ? 2.2316 1.5935 2.4201 -0.2359 -0.4320 0.0791  120 ARG A NH2 
852  N N   . ALA A 121 ? 1.6627 1.2593 2.2579 -0.1411 -0.4145 0.0367  121 ALA A N   
853  C CA  . ALA A 121 ? 1.5488 1.2046 2.2036 -0.1491 -0.3948 0.0405  121 ALA A CA  
854  C C   . ALA A 121 ? 1.5093 1.2171 2.1985 -0.1174 -0.3834 0.0150  121 ALA A C   
855  O O   . ALA A 121 ? 1.5933 1.3683 2.2991 -0.1206 -0.3530 0.0072  121 ALA A O   
856  C CB  . ALA A 121 ? 1.4786 1.1032 2.1821 -0.1602 -0.4168 0.0609  121 ALA A CB  
857  N N   . ALA A 122 ? 1.4115 1.0875 2.1111 -0.0869 -0.4082 0.0019  122 ALA A N   
858  C CA  . ALA A 122 ? 1.4538 1.1727 2.1846 -0.0544 -0.4011 -0.0231 122 ALA A CA  
859  C C   . ALA A 122 ? 1.6179 1.3790 2.3069 -0.0453 -0.3748 -0.0438 122 ALA A C   
860  O O   . ALA A 122 ? 1.6551 1.4813 2.3707 -0.0354 -0.3507 -0.0587 122 ALA A O   
861  C CB  . ALA A 122 ? 1.4329 1.1019 2.1747 -0.0245 -0.4347 -0.0324 122 ALA A CB  
862  N N   . GLY A 123 ? 1.6654 1.3891 2.2890 -0.0489 -0.3797 -0.0448 123 GLY A N   
863  C CA  . GLY A 123 ? 1.6606 1.4182 2.2387 -0.0416 -0.3561 -0.0639 123 GLY A CA  
864  C C   . GLY A 123 ? 1.5577 1.3828 2.1389 -0.0642 -0.3183 -0.0615 123 GLY A C   
865  O O   . GLY A 123 ? 1.5668 1.4517 2.1568 -0.0504 -0.2943 -0.0815 123 GLY A O   
866  N N   . ILE A 124 ? 1.4478 1.2633 2.0219 -0.0990 -0.3132 -0.0370 124 ILE A N   
867  C CA  . ILE A 124 ? 1.3655 1.2417 1.9430 -0.1237 -0.2782 -0.0318 124 ILE A CA  
868  C C   . ILE A 124 ? 1.3648 1.3061 2.0097 -0.1137 -0.2618 -0.0402 124 ILE A C   
869  O O   . ILE A 124 ? 1.4097 1.4148 2.0565 -0.1109 -0.2317 -0.0550 124 ILE A O   
870  C CB  . ILE A 124 ? 1.3154 1.1655 1.8828 -0.1624 -0.2797 -0.0020 124 ILE A CB  
871  C CG1 . ILE A 124 ? 1.3713 1.1675 1.8651 -0.1758 -0.2888 0.0053  124 ILE A CG1 
872  C CG2 . ILE A 124 ? 1.0267 0.9432 1.6116 -0.1866 -0.2447 0.0041  124 ILE A CG2 
873  C CD1 . ILE A 124 ? 1.3822 1.1520 1.8606 -0.2142 -0.2899 0.0339  124 ILE A CD1 
874  N N   . ILE A 125 ? 1.3344 1.2591 2.0343 -0.1084 -0.2818 -0.0311 125 ILE A N   
875  C CA  . ILE A 125 ? 1.3512 1.3324 2.1181 -0.0984 -0.2696 -0.0378 125 ILE A CA  
876  C C   . ILE A 125 ? 1.3779 1.4046 2.1506 -0.0659 -0.2567 -0.0682 125 ILE A C   
877  O O   . ILE A 125 ? 1.3866 1.4813 2.1871 -0.0651 -0.2293 -0.0778 125 ILE A O   
878  C CB  . ILE A 125 ? 1.3284 1.2749 2.1491 -0.0913 -0.2986 -0.0269 125 ILE A CB  
879  C CG1 . ILE A 125 ? 1.3825 1.2957 2.2075 -0.1255 -0.3072 0.0033  125 ILE A CG1 
880  C CG2 . ILE A 125 ? 1.2419 1.2455 2.1296 -0.0760 -0.2875 -0.0375 125 ILE A CG2 
881  C CD1 . ILE A 125 ? 1.3784 1.2539 2.2535 -0.1210 -0.3362 0.0153  125 ILE A CD1 
882  N N   . ALA A 126 ? 1.3553 1.3444 2.1018 -0.0391 -0.2766 -0.0834 126 ALA A N   
883  C CA  . ALA A 126 ? 1.3326 1.3590 2.0805 -0.0068 -0.2670 -0.1130 126 ALA A CA  
884  C C   . ALA A 126 ? 1.3464 1.4278 2.0590 -0.0156 -0.2313 -0.1247 126 ALA A C   
885  O O   . ALA A 126 ? 1.2865 1.4332 2.0274 -0.0049 -0.2080 -0.1409 126 ALA A O   
886  C CB  . ALA A 126 ? 1.3656 1.3356 2.0822 0.0198  -0.2950 -0.1250 126 ALA A CB  
887  N N   . ILE A 127 ? 1.3996 1.4540 2.0503 -0.0353 -0.2273 -0.1166 127 ILE A N   
888  C CA  . ILE A 127 ? 1.4089 1.5102 2.0202 -0.0467 -0.1940 -0.1261 127 ILE A CA  
889  C C   . ILE A 127 ? 1.3662 1.5324 2.0132 -0.0689 -0.1638 -0.1183 127 ILE A C   
890  O O   . ILE A 127 ? 1.4044 1.6335 2.0512 -0.0654 -0.1341 -0.1348 127 ILE A O   
891  C CB  . ILE A 127 ? 1.4614 1.5170 2.0014 -0.0692 -0.1967 -0.1139 127 ILE A CB  
892  C CG1 . ILE A 127 ? 1.4847 1.4796 1.9850 -0.0463 -0.2242 -0.1239 127 ILE A CG1 
893  C CG2 . ILE A 127 ? 1.5190 1.6254 2.0206 -0.0844 -0.1606 -0.1220 127 ILE A CG2 
894  C CD1 . ILE A 127 ? 1.5528 1.5022 1.9805 -0.0660 -0.2275 -0.1140 127 ILE A CD1 
895  N N   . CYS A 128 ? 1.3024 1.4530 1.9801 -0.0917 -0.1716 -0.0934 128 CYS A N   
896  C CA  . CYS A 128 ? 1.2710 1.4788 1.9848 -0.1143 -0.1451 -0.0835 128 CYS A CA  
897  C C   . CYS A 128 ? 1.3066 1.5806 2.0753 -0.0918 -0.1294 -0.1033 128 CYS A C   
898  O O   . CYS A 128 ? 1.3483 1.6869 2.1243 -0.1005 -0.0973 -0.1102 128 CYS A O   
899  C CB  . CYS A 128 ? 1.1812 1.3561 1.9255 -0.1380 -0.1611 -0.0545 128 CYS A CB  
900  S SG  . CYS A 128 ? 1.5144 1.6237 2.1970 -0.1722 -0.1727 -0.0283 128 CYS A SG  
901  N N   . TRP A 129 ? 1.2708 1.5280 2.0777 -0.0630 -0.1524 -0.1125 129 TRP A N   
902  C CA  . TRP A 129 ? 1.2508 1.5657 2.1108 -0.0391 -0.1411 -0.1318 129 TRP A CA  
903  C C   . TRP A 129 ? 1.2965 1.6515 2.1292 -0.0173 -0.1221 -0.1610 129 TRP A C   
904  O O   . TRP A 129 ? 1.2747 1.6978 2.1335 -0.0125 -0.0957 -0.1747 129 TRP A O   
905  C CB  . TRP A 129 ? 1.2199 1.5017 2.1254 -0.0144 -0.1724 -0.1335 129 TRP A CB  
906  C CG  . TRP A 129 ? 1.1655 1.4314 2.1175 -0.0331 -0.1843 -0.1089 129 TRP A CG  
907  C CD1 . TRP A 129 ? 1.1066 1.3078 2.0492 -0.0493 -0.2095 -0.0860 129 TRP A CD1 
908  C CD2 . TRP A 129 ? 1.1301 1.4463 2.1456 -0.0377 -0.1712 -0.1051 129 TRP A CD2 
909  N NE1 . TRP A 129 ? 1.0522 1.2604 2.0487 -0.0637 -0.2128 -0.0683 129 TRP A NE1 
910  C CE2 . TRP A 129 ? 1.0988 1.3769 2.1405 -0.0571 -0.1896 -0.0794 129 TRP A CE2 
911  C CE3 . TRP A 129 ? 1.0423 1.4320 2.0954 -0.0273 -0.1460 -0.1211 129 TRP A CE3 
912  C CZ2 . TRP A 129 ? 1.0678 1.3788 2.1711 -0.0665 -0.1833 -0.0691 129 TRP A CZ2 
913  C CZ3 . TRP A 129 ? 0.9584 1.3802 2.0723 -0.0365 -0.1401 -0.1108 129 TRP A CZ3 
914  C CH2 . TRP A 129 ? 0.9852 1.3678 2.1235 -0.0560 -0.1585 -0.0849 129 TRP A CH2 
915  N N   . VAL A 130 ? 1.3463 1.6589 2.1267 -0.0041 -0.1357 -0.1706 130 VAL A N   
916  C CA  . VAL A 130 ? 1.3520 1.6973 2.1004 0.0156  -0.1188 -0.1980 130 VAL A CA  
917  C C   . VAL A 130 ? 1.3927 1.7947 2.1180 -0.0078 -0.0807 -0.1993 130 VAL A C   
918  O O   . VAL A 130 ? 1.4499 1.9154 2.1896 0.0042  -0.0561 -0.2198 130 VAL A O   
919  C CB  . VAL A 130 ? 1.4052 1.6902 2.0933 0.0273  -0.1391 -0.2041 130 VAL A CB  
920  C CG1 . VAL A 130 ? 1.3928 1.7143 2.0423 0.0423  -0.1178 -0.2307 130 VAL A CG1 
921  C CG2 . VAL A 130 ? 1.4306 1.6649 2.1417 0.0550  -0.1753 -0.2075 130 VAL A CG2 
922  N N   . LEU A 131 ? 1.4107 1.7891 2.1001 -0.0415 -0.0762 -0.1774 131 LEU A N   
923  C CA  . LEU A 131 ? 1.4581 1.8856 2.1235 -0.0674 -0.0409 -0.1755 131 LEU A CA  
924  C C   . LEU A 131 ? 1.4372 1.9260 2.1617 -0.0791 -0.0199 -0.1698 131 LEU A C   
925  O O   . LEU A 131 ? 1.4383 1.9869 2.1588 -0.0913 0.0130  -0.1764 131 LEU A O   
926  C CB  . LEU A 131 ? 1.4524 1.8339 2.0649 -0.1009 -0.0442 -0.1519 131 LEU A CB  
927  C CG  . LEU A 131 ? 1.4845 1.8023 2.0333 -0.0939 -0.0644 -0.1547 131 LEU A CG  
928  C CD1 . LEU A 131 ? 1.4876 1.7667 1.9869 -0.1298 -0.0645 -0.1306 131 LEU A CD1 
929  C CD2 . LEU A 131 ? 1.5307 1.8786 2.0446 -0.0728 -0.0483 -0.1839 131 LEU A CD2 
930  N N   . SER A 132 ? 1.3929 1.8664 2.1723 -0.0756 -0.0391 -0.1577 132 SER A N   
931  C CA  . SER A 132 ? 1.3548 1.8818 2.1942 -0.0856 -0.0224 -0.1512 132 SER A CA  
932  C C   . SER A 132 ? 1.2926 1.8878 2.1665 -0.0596 -0.0032 -0.1786 132 SER A C   
933  O O   . SER A 132 ? 1.2449 1.9034 2.1457 -0.0707 0.0249  -0.1803 132 SER A O   
934  C CB  . SER A 132 ? 1.3497 1.8392 2.2382 -0.0865 -0.0500 -0.1323 132 SER A CB  
935  O OG  . SER A 132 ? 1.3626 1.9021 2.3076 -0.0985 -0.0339 -0.1244 132 SER A OG  
936  N N   . PHE A 133 ? 1.2530 1.8347 2.1259 -0.0248 -0.0188 -0.2001 133 PHE A N   
937  C CA  . PHE A 133 ? 1.2087 1.8508 2.1105 0.0027  -0.0029 -0.2281 133 PHE A CA  
938  C C   . PHE A 133 ? 1.3231 2.0070 2.1787 0.0008  0.0269  -0.2464 133 PHE A C   
939  O O   . PHE A 133 ? 1.2772 2.0298 2.1560 0.0066  0.0537  -0.2627 133 PHE A O   
940  C CB  . PHE A 133 ? 1.1214 1.7326 2.0382 0.0409  -0.0311 -0.2446 133 PHE A CB  
941  C CG  . PHE A 133 ? 1.0311 1.6236 2.0085 0.0489  -0.0543 -0.2337 133 PHE A CG  
942  C CD1 . PHE A 133 ? 0.9540 1.5983 1.9917 0.0654  -0.0461 -0.2456 133 PHE A CD1 
943  C CD2 . PHE A 133 ? 1.0768 1.5997 2.0507 0.0397  -0.0844 -0.2118 133 PHE A CD2 
944  C CE1 . PHE A 133 ? 0.8564 1.4832 1.9492 0.0723  -0.0674 -0.2357 133 PHE A CE1 
945  C CE2 . PHE A 133 ? 1.0250 1.5307 2.0543 0.0465  -0.1055 -0.2022 133 PHE A CE2 
946  C CZ  . PHE A 133 ? 0.8969 1.4546 1.9855 0.0627  -0.0969 -0.2140 133 PHE A CZ  
947  N N   . ALA A 134 ? 1.4224 2.0643 2.2127 -0.0076 0.0220  -0.2438 134 ALA A N   
948  C CA  . ALA A 134 ? 1.4890 2.1639 2.2293 -0.0113 0.0489  -0.2600 134 ALA A CA  
949  C C   . ALA A 134 ? 1.4491 2.1813 2.1935 -0.0420 0.0840  -0.2518 134 ALA A C   
950  O O   . ALA A 134 ? 1.4702 2.2617 2.2072 -0.0388 0.1132  -0.2710 134 ALA A O   
951  C CB  . ALA A 134 ? 1.5419 2.1547 2.2114 -0.0187 0.0351  -0.2544 134 ALA A CB  
952  N N   . ILE A 135 ? 1.3918 2.1061 2.1482 -0.0718 0.0809  -0.2234 135 ILE A N   
953  C CA  . ILE A 135 ? 1.3419 2.1054 2.1026 -0.1034 0.1123  -0.2124 135 ILE A CA  
954  C C   . ILE A 135 ? 1.2643 2.0871 2.0970 -0.0991 0.1254  -0.2149 135 ILE A C   
955  O O   . ILE A 135 ? 1.2540 2.1448 2.0974 -0.1031 0.1571  -0.2270 135 ILE A O   
956  C CB  . ILE A 135 ? 1.3017 2.0188 2.0393 -0.1396 0.1040  -0.1800 135 ILE A CB  
957  C CG1 . ILE A 135 ? 1.3199 1.9834 1.9818 -0.1475 0.0952  -0.1774 135 ILE A CG1 
958  C CG2 . ILE A 135 ? 1.2878 2.0574 2.0374 -0.1716 0.1355  -0.1679 135 ILE A CG2 
959  C CD1 . ILE A 135 ? 1.2806 1.8966 1.9153 -0.1829 0.0866  -0.1463 135 ILE A CD1 
960  N N   . GLY A 136 ? 1.1969 1.9935 2.0786 -0.0911 0.1008  -0.2035 136 GLY A N   
961  C CA  . GLY A 136 ? 1.1052 1.9513 2.0567 -0.0878 0.1098  -0.2033 136 GLY A CA  
962  C C   . GLY A 136 ? 1.0462 1.9536 2.0252 -0.0581 0.1257  -0.2339 136 GLY A C   
963  O O   . GLY A 136 ? 0.9650 1.9325 1.9904 -0.0604 0.1458  -0.2375 136 GLY A O   
964  N N   . LEU A 137 ? 1.0751 1.9673 2.0258 -0.0302 0.1164  -0.2562 137 LEU A N   
965  C CA  . LEU A 137 ? 1.0391 1.9853 2.0133 0.0005  0.1291  -0.2868 137 LEU A CA  
966  C C   . LEU A 137 ? 1.0394 2.0184 1.9623 0.0011  0.1550  -0.3071 137 LEU A C   
967  O O   . LEU A 137 ? 0.9646 1.9681 1.8875 0.0302  0.1587  -0.3347 137 LEU A O   
968  C CB  . LEU A 137 ? 1.0071 1.9161 1.9994 0.0371  0.0974  -0.2997 137 LEU A CB  
969  C CG  . LEU A 137 ? 0.8850 1.7640 1.9320 0.0413  0.0709  -0.2834 137 LEU A CG  
970  C CD1 . LEU A 137 ? 0.8865 1.7286 1.9446 0.0782  0.0406  -0.2983 137 LEU A CD1 
971  C CD2 . LEU A 137 ? 0.7305 1.6719 1.8410 0.0365  0.0892  -0.2822 137 LEU A CD2 
972  N N   . THR A 138 ? 1.0798 2.0589 1.9592 -0.0313 0.1728  -0.2936 138 THR A N   
973  C CA  . THR A 138 ? 1.1552 2.1664 1.9841 -0.0354 0.1996  -0.3108 138 THR A CA  
974  C C   . THR A 138 ? 1.2017 2.2977 2.0630 -0.0234 0.2305  -0.3349 138 THR A C   
975  O O   . THR A 138 ? 1.2536 2.3750 2.0894 -0.0059 0.2430  -0.3607 138 THR A O   
976  C CB  . THR A 138 ? 1.1756 2.1759 1.9569 -0.0757 0.2151  -0.2896 138 THR A CB  
977  O OG1 . THR A 138 ? 1.1476 2.0677 1.8923 -0.0851 0.1863  -0.2698 138 THR A OG1 
978  C CG2 . THR A 138 ? 1.2639 2.3008 1.9943 -0.0801 0.2442  -0.3084 138 THR A CG2 
979  N N   . PRO A 139 ? 1.1590 2.2994 2.0766 -0.0329 0.2430  -0.3270 139 PRO A N   
980  C CA  . PRO A 139 ? 1.1230 2.3440 2.0761 -0.0204 0.2709  -0.3500 139 PRO A CA  
981  C C   . PRO A 139 ? 1.1206 2.3511 2.0943 0.0222  0.2592  -0.3788 139 PRO A C   
982  O O   . PRO A 139 ? 1.1297 2.4213 2.1148 0.0364  0.2820  -0.4037 139 PRO A O   
983  C CB  . PRO A 139 ? 1.0700 2.3179 2.0859 -0.0339 0.2748  -0.3328 139 PRO A CB  
984  C CG  . PRO A 139 ? 1.0865 2.2840 2.0819 -0.0669 0.2641  -0.2998 139 PRO A CG  
985  C CD  . PRO A 139 ? 1.1245 2.2456 2.0730 -0.0579 0.2344  -0.2965 139 PRO A CD  
986  N N   . MET A 140 ? 1.1602 2.3311 2.1391 0.0421  0.2239  -0.3757 140 MET A N   
987  C CA  . MET A 140 ? 1.1729 2.3460 2.1697 0.0828  0.2097  -0.4018 140 MET A CA  
988  C C   . MET A 140 ? 1.2267 2.3856 2.1630 0.0964  0.2114  -0.4221 140 MET A C   
989  O O   . MET A 140 ? 1.2196 2.3989 2.1634 0.1282  0.2105  -0.4493 140 MET A O   
990  C CB  . MET A 140 ? 1.1619 2.2766 2.1886 0.0988  0.1711  -0.3906 140 MET A CB  
991  C CG  . MET A 140 ? 1.1197 2.2466 2.2090 0.0880  0.1672  -0.3719 140 MET A CG  
992  S SD  . MET A 140 ? 1.1848 2.2511 2.3143 0.1121  0.1233  -0.3644 140 MET A SD  
993  C CE  . MET A 140 ? 0.8406 1.9346 1.9858 0.1591  0.1195  -0.4023 140 MET A CE  
994  N N   . LEU A 141 ? 1.2816 2.4051 2.1580 0.0721  0.2137  -0.4086 141 LEU A N   
995  C CA  . LEU A 141 ? 1.3362 2.4418 2.1502 0.0813  0.2153  -0.4252 141 LEU A CA  
996  C C   . LEU A 141 ? 1.3877 2.5660 2.1913 0.0846  0.2513  -0.4510 141 LEU A C   
997  O O   . LEU A 141 ? 1.4744 2.6515 2.2358 0.0988  0.2554  -0.4715 141 LEU A O   
998  C CB  . LEU A 141 ? 1.3491 2.3991 2.1024 0.0515  0.2095  -0.4024 141 LEU A CB  
999  C CG  . LEU A 141 ? 1.2526 2.2266 2.0092 0.0451  0.1741  -0.3758 141 LEU A CG  
1000 C CD1 . LEU A 141 ? 1.2613 2.1879 1.9569 0.0134  0.1725  -0.3541 141 LEU A CD1 
1001 C CD2 . LEU A 141 ? 1.2274 2.1563 1.9886 0.0808  0.1415  -0.3883 141 LEU A CD2 
1002 N N   . GLY A 142 ? 1.7834 1.2322 3.5386 -0.2860 -0.2059 -0.3099 142 GLY A N   
1003 C CA  . GLY A 142 ? 1.7866 1.2126 3.4926 -0.2836 -0.1528 -0.2583 142 GLY A CA  
1004 C C   . GLY A 142 ? 1.7344 1.1788 3.4419 -0.2766 -0.1932 -0.2125 142 GLY A C   
1005 O O   . GLY A 142 ? 1.7660 1.2120 3.4627 -0.2696 -0.1501 -0.1636 142 GLY A O   
1006 N N   . TRP A 143 ? 1.6881 1.1464 3.4092 -0.2786 -0.2764 -0.2286 143 TRP A N   
1007 C CA  . TRP A 143 ? 1.6345 1.1117 3.3596 -0.2725 -0.3235 -0.1892 143 TRP A CA  
1008 C C   . TRP A 143 ? 1.5375 1.0868 3.3693 -0.2541 -0.3127 -0.1645 143 TRP A C   
1009 O O   . TRP A 143 ? 1.4184 1.0090 3.3088 -0.2486 -0.3735 -0.1732 143 TRP A O   
1010 C CB  . TRP A 143 ? 1.6306 1.0971 3.3334 -0.2813 -0.4172 -0.2178 143 TRP A CB  
1011 C CG  . TRP A 143 ? 1.5919 1.0629 3.2755 -0.2784 -0.4684 -0.1790 143 TRP A CG  
1012 C CD1 . TRP A 143 ? 1.5126 1.0138 3.2250 -0.2659 -0.4483 -0.1258 143 TRP A CD1 
1013 C CD2 . TRP A 143 ? 1.6945 1.1396 3.3266 -0.2881 -0.5489 -0.1907 143 TRP A CD2 
1014 N NE1 . TRP A 143 ? 1.5683 1.0636 3.2500 -0.2674 -0.5108 -0.1036 143 TRP A NE1 
1015 C CE2 . TRP A 143 ? 1.6603 1.1213 3.2925 -0.2809 -0.5733 -0.1426 143 TRP A CE2 
1016 C CE3 . TRP A 143 ? 1.7777 1.1876 3.3634 -0.3021 -0.6025 -0.2372 143 TRP A CE3 
1017 C CZ2 . TRP A 143 ? 1.7096 1.1523 3.2972 -0.2872 -0.6489 -0.1395 143 TRP A CZ2 
1018 C CZ3 . TRP A 143 ? 1.8051 1.1970 3.3465 -0.3083 -0.6776 -0.2341 143 TRP A CZ3 
1019 C CH2 . TRP A 143 ? 1.7866 1.1949 3.3293 -0.3009 -0.7000 -0.1856 143 TRP A CH2 
1020 N N   . ASN A 144 ? 1.5890 1.1532 3.4456 -0.2447 -0.2352 -0.1336 144 ASN A N   
1021 C CA  . ASN A 144 ? 1.5189 1.1509 3.4767 -0.2270 -0.2161 -0.1093 144 ASN A CA  
1022 C C   . ASN A 144 ? 1.4957 1.1330 3.4460 -0.2176 -0.1589 -0.0495 144 ASN A C   
1023 O O   . ASN A 144 ? 1.5560 1.1436 3.4217 -0.2249 -0.1308 -0.0268 144 ASN A O   
1024 C CB  . ASN A 144 ? 1.4753 1.1383 3.5059 -0.2220 -0.1764 -0.1442 144 ASN A CB  
1025 C CG  . ASN A 144 ? 1.5045 1.1314 3.4942 -0.2266 -0.0931 -0.1471 144 ASN A CG  
1026 O OD1 . ASN A 144 ? 1.5477 1.1729 3.5276 -0.2202 -0.0314 -0.1054 144 ASN A OD1 
1027 N ND2 . ASN A 144 ? 1.4662 1.0642 3.4324 -0.2376 -0.0909 -0.1966 144 ASN A ND2 
1028 N N   . ASN A 145 ? 1.3790 1.0772 3.4185 -0.2012 -0.1421 -0.0245 145 ASN A N   
1029 C CA  . ASN A 145 ? 1.3172 1.0282 3.3613 -0.1906 -0.0880 0.0323  145 ASN A CA  
1030 C C   . ASN A 145 ? 1.3683 1.1157 3.4824 -0.1789 -0.0115 0.0373  145 ASN A C   
1031 O O   . ASN A 145 ? 1.3445 1.1426 3.5276 -0.1639 0.0062  0.0704  145 ASN A O   
1032 C CB  . ASN A 145 ? 1.1086 0.8590 3.1900 -0.1808 -0.1379 0.0686  145 ASN A CB  
1033 C CG  . ASN A 145 ? 1.1101 0.8223 3.1162 -0.1918 -0.2072 0.0721  145 ASN A CG  
1034 O OD1 . ASN A 145 ? 1.1673 0.8199 3.0855 -0.2064 -0.2111 0.0548  145 ASN A OD1 
1035 N ND2 . ASN A 145 ? 1.0636 0.8098 3.1037 -0.1846 -0.2624 0.0948  145 ASN A ND2 
1036 N N   . CYS A 146 ? 1.4114 1.1328 3.5074 -0.1857 0.0337  0.0043  146 CYS A N   
1037 C CA  . CYS A 146 ? 1.3539 1.1045 3.5099 -0.1757 0.1095  0.0060  146 CYS A CA  
1038 C C   . CYS A 146 ? 1.3744 1.1017 3.4865 -0.1729 0.1857  0.0515  146 CYS A C   
1039 O O   . CYS A 146 ? 1.4893 1.1635 3.5278 -0.1835 0.2259  0.0436  146 CYS A O   
1040 C CB  . CYS A 146 ? 1.3763 1.1095 3.5333 -0.1841 0.1261  -0.0495 146 CYS A CB  
1041 S SG  . CYS A 146 ? 1.9085 1.6716 4.1236 -0.1869 0.0429  -0.1065 146 CYS A SG  
1042 N N   . GLY A 147 ? 1.2452 1.0124 3.4027 -0.1587 0.2053  0.0990  147 GLY A N   
1043 C CA  . GLY A 147 ? 1.1886 0.9396 3.3119 -0.1545 0.2766  0.1454  147 GLY A CA  
1044 C C   . GLY A 147 ? 1.2325 0.9518 3.2820 -0.1589 0.2510  0.1855  147 GLY A C   
1045 O O   . GLY A 147 ? 1.2837 0.9598 3.2614 -0.1639 0.2976  0.2103  147 GLY A O   
1046 N N   . GLN A 148 ? 1.2571 0.9979 3.3242 -0.1571 0.1764  0.1918  148 GLN A N   
1047 C CA  . GLN A 148 ? 1.3988 1.1138 3.4017 -0.1606 0.1455  0.2299  148 GLN A CA  
1048 C C   . GLN A 148 ? 1.4045 1.1737 3.4707 -0.1448 0.1380  0.2764  148 GLN A C   
1049 O O   . GLN A 148 ? 1.3970 1.2027 3.5119 -0.1403 0.0730  0.2715  148 GLN A O   
1050 C CB  . GLN A 148 ? 1.4473 1.1325 3.4010 -0.1738 0.0606  0.2003  148 GLN A CB  
1051 C CG  . GLN A 148 ? 1.5849 1.2112 3.4653 -0.1905 0.0637  0.1566  148 GLN A CG  
1052 C CD  . GLN A 148 ? 1.7171 1.2842 3.5026 -0.1988 0.1185  0.1800  148 GLN A CD  
1053 O OE1 . GLN A 148 ? 1.7785 1.3456 3.5466 -0.1927 0.1487  0.2298  148 GLN A OE1 
1054 N NE2 . GLN A 148 ? 1.7963 1.3126 3.5195 -0.2126 0.1314  0.1439  148 GLN A NE2 
1055 N N   . PRO A 149 ? 1.3218 1.0963 3.3874 -0.1364 0.2050  0.3217  149 PRO A N   
1056 C CA  . PRO A 149 ? 1.0874 0.9114 3.2098 -0.1210 0.2083  0.3699  149 PRO A CA  
1057 C C   . PRO A 149 ? 1.0206 0.8360 3.1057 -0.1238 0.1412  0.3951  149 PRO A C   
1058 O O   . PRO A 149 ? 0.9529 0.8109 3.0866 -0.1116 0.1307  0.4320  149 PRO A O   
1059 C CB  . PRO A 149 ? 1.0946 0.9039 3.1908 -0.1165 0.2960  0.4093  149 PRO A CB  
1060 C CG  . PRO A 149 ? 1.2138 0.9878 3.2795 -0.1250 0.3460  0.3739  149 PRO A CG  
1061 C CD  . PRO A 149 ? 1.3321 1.0655 3.3439 -0.1410 0.2849  0.3281  149 PRO A CD  
1062 N N   . GLY A 158 ? 2.1721 2.4434 3.8128 0.5020  -0.0286 -0.1752 158 GLY A N   
1063 C CA  . GLY A 158 ? 2.1738 2.3717 3.7912 0.4816  -0.0172 -0.1354 158 GLY A CA  
1064 C C   . GLY A 158 ? 2.1904 2.3046 3.8100 0.4983  -0.0060 -0.1295 158 GLY A C   
1065 O O   . GLY A 158 ? 2.2315 2.2532 3.8305 0.5194  -0.0043 -0.1143 158 GLY A O   
1066 N N   . CYS A 159 ? 2.1496 2.2965 3.7944 0.4887  0.0017  -0.1416 159 CYS A N   
1067 C CA  . CYS A 159 ? 2.1323 2.2068 3.7819 0.5024  0.0129  -0.1376 159 CYS A CA  
1068 C C   . CYS A 159 ? 2.1223 2.2348 3.8044 0.5257  0.0113  -0.1765 159 CYS A C   
1069 O O   . CYS A 159 ? 2.1255 2.1849 3.8154 0.5408  0.0197  -0.1793 159 CYS A O   
1070 C CB  . CYS A 159 ? 2.1123 2.1753 3.7595 0.4673  0.0264  -0.1103 159 CYS A CB  
1071 S SG  . CYS A 159 ? 2.4132 2.4267 4.0223 0.4381  0.0300  -0.0625 159 CYS A SG  
1072 N N   . GLY A 160 ? 2.1025 2.3072 3.8035 0.5285  0.0006  -0.2066 160 GLY A N   
1073 C CA  . GLY A 160 ? 2.0896 2.3398 3.8223 0.5494  -0.0019 -0.2453 160 GLY A CA  
1074 C C   . GLY A 160 ? 2.0447 2.3482 3.8023 0.5247  0.0071  -0.2519 160 GLY A C   
1075 O O   . GLY A 160 ? 2.0411 2.3270 3.7903 0.4953  0.0171  -0.2245 160 GLY A O   
1076 N N   . GLU A 161 ? 2.0203 2.3894 3.8087 0.5366  0.0035  -0.2885 161 GLU A N   
1077 C CA  . GLU A 161 ? 1.9719 2.3973 3.7864 0.5151  0.0113  -0.2987 161 GLU A CA  
1078 C C   . GLU A 161 ? 1.9068 2.2543 3.7190 0.5138  0.0260  -0.2807 161 GLU A C   
1079 O O   . GLU A 161 ? 1.9060 2.1675 3.7086 0.5421  0.0288  -0.2773 161 GLU A O   
1080 C CB  . GLU A 161 ? 2.0178 2.5171 3.8653 0.5339  0.0048  -0.3429 161 GLU A CB  
1081 C CG  . GLU A 161 ? 2.0791 2.5208 3.9329 0.5771  0.0039  -0.3631 161 GLU A CG  
1082 C CD  . GLU A 161 ? 2.0993 2.6166 3.9860 0.5945  -0.0024 -0.4067 161 GLU A CD  
1083 O OE1 . GLU A 161 ? 2.1189 2.5974 4.0138 0.6295  -0.0031 -0.4264 161 GLU A OE1 
1084 O OE2 . GLU A 161 ? 2.0944 2.7100 3.9986 0.5731  -0.0065 -0.4215 161 GLU A OE2 
1085 N N   . GLY A 162 ? 1.8411 2.2193 3.6620 0.4808  0.0353  -0.2690 162 GLY A N   
1086 C CA  . GLY A 162 ? 1.8037 2.1144 3.6227 0.4754  0.0496  -0.2504 162 GLY A CA  
1087 C C   . GLY A 162 ? 1.7910 2.0411 3.5797 0.4518  0.0565  -0.2066 162 GLY A C   
1088 O O   . GLY A 162 ? 1.7891 2.0521 3.5793 0.4203  0.0657  -0.1883 162 GLY A O   
1089 N N   . GLN A 163 ? 1.7802 1.9643 3.5412 0.4670  0.0520  -0.1897 163 GLN A N   
1090 C CA  . GLN A 163 ? 1.7537 1.8749 3.4838 0.4471  0.0579  -0.1479 163 GLN A CA  
1091 C C   . GLN A 163 ? 1.6562 1.8424 3.3765 0.4144  0.0525  -0.1345 163 GLN A C   
1092 O O   . GLN A 163 ? 1.5959 1.8570 3.3252 0.4162  0.0411  -0.1560 163 GLN A O   
1093 C CB  . GLN A 163 ? 1.8094 1.8319 3.5132 0.4763  0.0554  -0.1347 163 GLN A CB  
1094 C CG  . GLN A 163 ? 1.8434 1.7852 3.5514 0.5055  0.0629  -0.1400 163 GLN A CG  
1095 C CD  . GLN A 163 ? 1.8880 1.7285 3.5677 0.5313  0.0614  -0.1229 163 GLN A CD  
1096 O OE1 . GLN A 163 ? 1.9227 1.7569 3.5810 0.5308  0.0535  -0.1108 163 GLN A OE1 
1097 N NE2 . GLN A 163 ? 1.8891 1.6497 3.5683 0.5538  0.0691  -0.1220 163 GLN A NE2 
1098 N N   . VAL A 164 ? 1.6007 1.7575 3.3026 0.3846  0.0608  -0.0990 164 VAL A N   
1099 C CA  . VAL A 164 ? 1.4915 1.7038 3.1824 0.3510  0.0574  -0.0826 164 VAL A CA  
1100 C C   . VAL A 164 ? 1.4345 1.5699 3.0890 0.3440  0.0592  -0.0445 164 VAL A C   
1101 O O   . VAL A 164 ? 1.4476 1.4938 3.0875 0.3484  0.0687  -0.0214 164 VAL A O   
1102 C CB  . VAL A 164 ? 1.4206 1.6897 3.1265 0.3138  0.0661  -0.0759 164 VAL A CB  
1103 C CG1 . VAL A 164 ? 1.3697 1.6902 3.0621 0.2785  0.0631  -0.0565 164 VAL A CG1 
1104 C CG2 . VAL A 164 ? 1.4124 1.7631 3.1547 0.3189  0.0640  -0.1139 164 VAL A CG2 
1105 N N   . ALA A 165 ? 1.3918 1.5616 3.0315 0.3334  0.0501  -0.0382 165 ALA A N   
1106 C CA  . ALA A 165 ? 1.3585 1.4646 2.9637 0.3233  0.0514  -0.0019 165 ALA A CA  
1107 C C   . ALA A 165 ? 1.2791 1.3629 2.8758 0.2890  0.0645  0.0308  165 ALA A C   
1108 O O   . ALA A 165 ? 1.2537 1.4004 2.8515 0.2554  0.0651  0.0397  165 ALA A O   
1109 C CB  . ALA A 165 ? 1.3873 1.5499 2.9817 0.3132  0.0397  -0.0031 165 ALA A CB  
1110 N N   . CYS A 166 ? 1.2896 1.2836 2.8777 0.2980  0.0750  0.0484  166 CYS A N   
1111 C CA  . CYS A 166 ? 1.2599 1.2277 2.8422 0.2685  0.0883  0.0777  166 CYS A CA  
1112 C C   . CYS A 166 ? 1.2134 1.1614 2.7660 0.2414  0.0895  0.1141  166 CYS A C   
1113 O O   . CYS A 166 ? 1.1799 1.0396 2.7059 0.2488  0.0927  0.1400  166 CYS A O   
1114 C CB  . CYS A 166 ? 1.2296 1.1019 2.8090 0.2871  0.0989  0.0872  166 CYS A CB  
1115 S SG  . CYS A 166 ? 1.6333 1.4833 3.2136 0.2538  0.1157  0.1159  166 CYS A SG  
1116 N N   . LEU A 167 ? 1.1699 1.2012 2.7272 0.2098  0.0870  0.1155  167 LEU A N   
1117 C CA  . LEU A 167 ? 1.1690 1.1923 2.7003 0.1802  0.0886  0.1491  167 LEU A CA  
1118 C C   . LEU A 167 ? 1.0728 1.1442 2.6135 0.1417  0.0975  0.1619  167 LEU A C   
1119 O O   . LEU A 167 ? 1.0143 1.1767 2.5798 0.1296  0.0948  0.1394  167 LEU A O   
1120 C CB  . LEU A 167 ? 1.2546 1.3343 2.7784 0.1787  0.0752  0.1397  167 LEU A CB  
1121 C CG  . LEU A 167 ? 1.2960 1.3447 2.8133 0.2168  0.0644  0.1224  167 LEU A CG  
1122 C CD1 . LEU A 167 ? 1.2911 1.4037 2.8017 0.2104  0.0518  0.1144  167 LEU A CD1 
1123 C CD2 . LEU A 167 ? 1.3365 1.2678 2.8260 0.2340  0.0691  0.1486  167 LEU A CD2 
1124 N N   . PHE A 168 ? 1.0643 1.0741 2.5853 0.1227  0.1082  0.1982  168 PHE A N   
1125 C CA  . PHE A 168 ? 1.0980 1.1413 2.6261 0.0871  0.1181  0.2137  168 PHE A CA  
1126 C C   . PHE A 168 ? 1.1299 1.2862 2.6716 0.0602  0.1121  0.2009  168 PHE A C   
1127 O O   . PHE A 168 ? 1.1491 1.3729 2.7180 0.0511  0.1138  0.1811  168 PHE A O   
1128 C CB  . PHE A 168 ? 1.1300 1.0996 2.6282 0.0671  0.1274  0.2577  168 PHE A CB  
1129 C CG  . PHE A 168 ? 1.1941 1.1831 2.6984 0.0334  0.1389  0.2760  168 PHE A CG  
1130 C CD1 . PHE A 168 ? 1.2073 1.2688 2.7109 -0.0020 0.1382  0.2850  168 PHE A CD1 
1131 C CD2 . PHE A 168 ? 1.2749 1.2097 2.7855 0.0372  0.1506  0.2842  168 PHE A CD2 
1132 C CE1 . PHE A 168 ? 1.2409 1.3205 2.7500 -0.0328 0.1488  0.3020  168 PHE A CE1 
1133 C CE2 . PHE A 168 ? 1.2869 1.2398 2.8032 0.0064  0.1612  0.3011  168 PHE A CE2 
1134 C CZ  . PHE A 168 ? 1.2744 1.2997 2.7899 -0.0285 0.1602  0.3101  168 PHE A CZ  
1135 N N   . GLU A 169 ? 1.1079 1.2846 2.6306 0.0477  0.1050  0.2122  169 GLU A N   
1136 C CA  . GLU A 169 ? 1.0532 1.3322 2.5846 0.0193  0.0997  0.2046  169 GLU A CA  
1137 C C   . GLU A 169 ? 1.0703 1.4397 2.6336 0.0314  0.0910  0.1617  169 GLU A C   
1138 O O   . GLU A 169 ? 0.9262 1.3807 2.5079 0.0076  0.0914  0.1514  169 GLU A O   
1139 C CB  . GLU A 169 ? 1.0281 1.3078 2.5327 0.0094  0.0924  0.2211  169 GLU A CB  
1140 C CG  . GLU A 169 ? 1.0512 1.3112 2.5486 0.0429  0.0805  0.2039  169 GLU A CG  
1141 C CD  . GLU A 169 ? 1.0601 1.2064 2.5393 0.0710  0.0842  0.2180  169 GLU A CD  
1142 O OE1 . GLU A 169 ? 1.0439 1.1218 2.5086 0.0599  0.0955  0.2483  169 GLU A OE1 
1143 O OE2 . GLU A 169 ? 1.0721 1.1975 2.5516 0.1043  0.0758  0.1989  169 GLU A OE2 
1144 N N   . ASP A 170 ? 1.1235 1.4740 2.6930 0.0683  0.0834  0.1370  170 ASP A N   
1145 C CA  . ASP A 170 ? 1.1549 1.5878 2.7530 0.0828  0.0740  0.0955  170 ASP A CA  
1146 C C   . ASP A 170 ? 1.1338 1.5834 2.7619 0.0909  0.0802  0.0742  170 ASP A C   
1147 O O   . ASP A 170 ? 1.1122 1.6462 2.7672 0.0913  0.0751  0.0431  170 ASP A O   
1148 C CB  . ASP A 170 ? 1.2669 1.6761 2.8593 0.1194  0.0625  0.0769  170 ASP A CB  
1149 C CG  . ASP A 170 ? 1.4103 1.8258 2.9779 0.1114  0.0541  0.0904  170 ASP A CG  
1150 O OD1 . ASP A 170 ? 1.4298 1.8677 2.9845 0.0773  0.0573  0.1141  170 ASP A OD1 
1151 O OD2 . ASP A 170 ? 1.4895 1.8878 3.0504 0.1391  0.0443  0.0772  170 ASP A OD2 
1152 N N   . VAL A 171 ? 1.1191 1.4885 2.7425 0.0971  0.0913  0.0909  171 VAL A N   
1153 C CA  . VAL A 171 ? 1.0808 1.4555 2.7311 0.1075  0.0977  0.0715  171 VAL A CA  
1154 C C   . VAL A 171 ? 1.0541 1.4503 2.7125 0.0740  0.1095  0.0878  171 VAL A C   
1155 O O   . VAL A 171 ? 1.0462 1.4881 2.7321 0.0724  0.1129  0.0671  171 VAL A O   
1156 C CB  . VAL A 171 ? 1.1065 1.3797 2.7505 0.1414  0.1021  0.0733  171 VAL A CB  
1157 C CG1 . VAL A 171 ? 1.0088 1.2606 2.6455 0.1758  0.0903  0.0563  171 VAL A CG1 
1158 C CG2 . VAL A 171 ? 1.1284 1.3090 2.7452 0.1298  0.1128  0.1147  171 VAL A CG2 
1159 N N   . VAL A 172 ? 1.0564 1.4199 2.6909 0.0474  0.1158  0.1248  172 VAL A N   
1160 C CA  . VAL A 172 ? 1.0616 1.4388 2.7008 0.0151  0.1273  0.1439  172 VAL A CA  
1161 C C   . VAL A 172 ? 1.0603 1.5253 2.7001 -0.0214 0.1245  0.1494  172 VAL A C   
1162 O O   . VAL A 172 ? 1.1076 1.5685 2.7241 -0.0338 0.1204  0.1683  172 VAL A O   
1163 C CB  . VAL A 172 ? 1.0334 1.3085 2.6468 0.0091  0.1385  0.1834  172 VAL A CB  
1164 C CG1 . VAL A 172 ? 1.0033 1.2961 2.6217 -0.0250 0.1502  0.2030  172 VAL A CG1 
1165 C CG2 . VAL A 172 ? 1.0290 1.2168 2.6424 0.0442  0.1421  0.1782  172 VAL A CG2 
1166 N N   . PRO A 173 ? 1.0201 1.5651 2.6864 -0.0387 0.1268  0.1327  173 PRO A N   
1167 C CA  . PRO A 173 ? 1.0361 1.6727 2.7070 -0.0737 0.1245  0.1346  173 PRO A CA  
1168 C C   . PRO A 173 ? 1.1314 1.7377 2.7758 -0.1058 0.1316  0.1763  173 PRO A C   
1169 O O   . PRO A 173 ? 1.1494 1.6737 2.7791 -0.1065 0.1416  0.2031  173 PRO A O   
1170 C CB  . PRO A 173 ? 0.9437 1.6412 2.6464 -0.0836 0.1299  0.1152  173 PRO A CB  
1171 C CG  . PRO A 173 ? 0.9233 1.5892 2.6433 -0.0470 0.1292  0.0888  173 PRO A CG  
1172 C CD  . PRO A 173 ? 0.9730 1.5260 2.6676 -0.0246 0.1318  0.1095  173 PRO A CD  
1173 N N   . MET A 174 ? 1.2477 1.9202 2.8860 -0.1322 0.1266  0.1815  174 MET A N   
1174 C CA  . MET A 174 ? 1.3819 2.0366 2.9963 -0.1652 0.1330  0.2197  174 MET A CA  
1175 C C   . MET A 174 ? 1.4721 2.1879 3.1020 -0.1989 0.1409  0.2247  174 MET A C   
1176 O O   . MET A 174 ? 1.5174 2.1948 3.1342 -0.2206 0.1514  0.2563  174 MET A O   
1177 C CB  . MET A 174 ? 1.4622 2.1473 3.0578 -0.1752 0.1233  0.2254  174 MET A CB  
1178 C CG  . MET A 174 ? 1.5364 2.1433 3.1073 -0.1493 0.1181  0.2341  174 MET A CG  
1179 S SD  . MET A 174 ? 0.8500 1.3329 2.3897 -0.1532 0.1305  0.2800  174 MET A SD  
1180 C CE  . MET A 174 ? 0.8271 1.3489 2.3518 -0.2025 0.1363  0.3124  174 MET A CE  
1181 N N   . ASN A 175 ? 1.5291 2.3403 3.1870 -0.2029 0.1357  0.1933  175 ASN A N   
1182 C CA  . ASN A 175 ? 1.5755 2.4514 3.2512 -0.2329 0.1425  0.1938  175 ASN A CA  
1183 C C   . ASN A 175 ? 1.6780 2.5013 3.3623 -0.2297 0.1550  0.2026  175 ASN A C   
1184 O O   . ASN A 175 ? 1.6407 2.4899 3.3318 -0.2569 0.1636  0.2151  175 ASN A O   
1185 C CB  . ASN A 175 ? 1.4950 2.4791 3.2009 -0.2326 0.1341  0.1548  175 ASN A CB  
1186 C CG  . ASN A 175 ? 1.4523 2.4310 3.1809 -0.1959 0.1302  0.1199  175 ASN A CG  
1187 O OD1 . ASN A 175 ? 1.4553 2.3495 3.1755 -0.1684 0.1322  0.1236  175 ASN A OD1 
1188 N ND2 . ASN A 175 ? 1.4108 2.4800 3.1682 -0.1953 0.1246  0.0857  175 ASN A ND2 
1189 N N   . TYR A 176 ? 1.7184 1.9144 1.9602 0.1106  -0.1708 0.6460  176 TYR A N   
1190 C CA  . TYR A 176 ? 1.7359 1.9352 1.9591 0.1120  -0.1342 0.6364  176 TYR A CA  
1191 C C   . TYR A 176 ? 1.6858 1.8738 1.9050 0.1193  -0.1347 0.5973  176 TYR A C   
1192 O O   . TYR A 176 ? 1.7544 1.9477 2.0106 0.1171  -0.1285 0.5870  176 TYR A O   
1193 C CB  . TYR A 176 ? 1.8366 2.0342 1.9940 0.1154  -0.1039 0.6452  176 TYR A CB  
1194 C CG  . TYR A 176 ? 1.9198 2.1145 2.0418 0.1197  -0.0684 0.6245  176 TYR A CG  
1195 C CD1 . TYR A 176 ? 1.9137 2.1221 2.0535 0.1145  -0.0401 0.6345  176 TYR A CD1 
1196 C CD2 . TYR A 176 ? 1.9932 2.1715 2.0635 0.1285  -0.0629 0.5945  176 TYR A CD2 
1197 C CE1 . TYR A 176 ? 1.9544 2.1608 2.0629 0.1181  -0.0074 0.6148  176 TYR A CE1 
1198 C CE2 . TYR A 176 ? 2.0264 2.2025 2.0644 0.1315  -0.0298 0.5745  176 TYR A CE2 
1199 C CZ  . TYR A 176 ? 2.0265 2.2169 2.0843 0.1265  -0.0020 0.5845  176 TYR A CZ  
1200 O OH  . TYR A 176 ? 2.0740 2.2630 2.1008 0.1292  0.0314  0.5638  176 TYR A OH  
1201 N N   . MET A 177 ? 1.5012 1.6735 1.6760 0.1278  -0.1426 0.5752  177 MET A N   
1202 C CA  . MET A 177 ? 1.3670 1.5283 1.5307 0.1348  -0.1408 0.5360  177 MET A CA  
1203 C C   . MET A 177 ? 1.4158 1.5771 1.6428 0.1337  -0.1697 0.5209  177 MET A C   
1204 O O   . MET A 177 ? 1.5644 1.7197 1.7959 0.1385  -0.1677 0.4887  177 MET A O   
1205 C CB  . MET A 177 ? 1.2064 1.3501 1.3097 0.1429  -0.1467 0.5173  177 MET A CB  
1206 C CG  . MET A 177 ? 1.1286 1.2681 1.1612 0.1452  -0.1139 0.5225  177 MET A CG  
1207 S SD  . MET A 177 ? 2.1608 2.2766 2.1207 0.1542  -0.1183 0.4929  177 MET A SD  
1208 C CE  . MET A 177 ? 1.1848 1.2962 1.1661 0.1580  -0.1180 0.4480  177 MET A CE  
1209 N N   . VAL A 178 ? 1.2580 1.4257 1.5340 0.1270  -0.1967 0.5437  178 VAL A N   
1210 C CA  . VAL A 178 ? 1.2181 1.3848 1.5556 0.1247  -0.2262 0.5326  178 VAL A CA  
1211 C C   . VAL A 178 ? 1.3503 1.5302 1.7407 0.1161  -0.2180 0.5476  178 VAL A C   
1212 O O   . VAL A 178 ? 1.3512 1.5309 1.7634 0.1178  -0.2105 0.5268  178 VAL A O   
1213 C CB  . VAL A 178 ? 1.0700 1.2329 1.4303 0.1223  -0.2655 0.5445  178 VAL A CB  
1214 C CG1 . VAL A 178 ? 0.9192 1.0821 1.3471 0.1177  -0.2947 0.5387  178 VAL A CG1 
1215 C CG2 . VAL A 178 ? 1.1419 1.2895 1.4555 0.1316  -0.2781 0.5239  178 VAL A CG2 
1216 N N   . TYR A 179 ? 1.4800 1.6713 1.8911 0.1065  -0.2195 0.5834  179 TYR A N   
1217 C CA  . TYR A 179 ? 1.5812 1.7848 2.0414 0.0967  -0.2128 0.6011  179 TYR A CA  
1218 C C   . TYR A 179 ? 1.5312 1.7412 1.9729 0.0984  -0.1732 0.5953  179 TYR A C   
1219 O O   . TYR A 179 ? 1.5115 1.7243 1.9897 0.0964  -0.1693 0.5857  179 TYR A O   
1220 C CB  . TYR A 179 ? 1.6468 1.8620 2.1247 0.0856  -0.2183 0.6408  179 TYR A CB  
1221 C CG  . TYR A 179 ? 1.6918 1.9036 2.2063 0.0805  -0.2587 0.6491  179 TYR A CG  
1222 C CD1 . TYR A 179 ? 1.7490 1.9544 2.2358 0.0849  -0.2759 0.6495  179 TYR A CD1 
1223 C CD2 . TYR A 179 ? 1.6680 1.8822 2.2444 0.0709  -0.2801 0.6564  179 TYR A CD2 
1224 C CE1 . TYR A 179 ? 1.7823 1.9852 2.3031 0.0801  -0.3125 0.6564  179 TYR A CE1 
1225 C CE2 . TYR A 179 ? 1.6967 1.9074 2.3060 0.0653  -0.3165 0.6638  179 TYR A CE2 
1226 C CZ  . TYR A 179 ? 1.7648 1.9706 2.3467 0.0700  -0.3323 0.6634  179 TYR A CZ  
1227 O OH  . TYR A 179 ? 1.7854 1.9883 2.4005 0.0644  -0.3683 0.6701  179 TYR A OH  
1228 N N   . PHE A 180 ? 1.5199 1.7318 1.9050 0.1020  -0.1443 0.6009  180 PHE A N   
1229 C CA  . PHE A 180 ? 1.4790 1.6979 1.8423 0.1028  -0.1045 0.5983  180 PHE A CA  
1230 C C   . PHE A 180 ? 1.4025 1.6115 1.7367 0.1129  -0.0906 0.5586  180 PHE A C   
1231 O O   . PHE A 180 ? 1.3920 1.6028 1.7563 0.1135  -0.0852 0.5402  180 PHE A O   
1232 C CB  . PHE A 180 ? 1.5560 1.7813 1.8719 0.1013  -0.0788 0.6235  180 PHE A CB  
1233 C CG  . PHE A 180 ? 1.6034 1.8374 1.9000 0.1005  -0.0377 0.6257  180 PHE A CG  
1234 C CD1 . PHE A 180 ? 1.5746 1.8234 1.9095 0.0913  -0.0263 0.6489  180 PHE A CD1 
1235 C CD2 . PHE A 180 ? 1.6423 1.8695 1.8816 0.1084  -0.0103 0.6045  180 PHE A CD2 
1236 C CE1 . PHE A 180 ? 1.5511 1.8082 1.8687 0.0907  0.0115  0.6508  180 PHE A CE1 
1237 C CE2 . PHE A 180 ? 1.6293 1.8647 1.8508 0.1074  0.0279  0.6061  180 PHE A CE2 
1238 C CZ  . PHE A 180 ? 1.5807 1.8314 1.8421 0.0989  0.0387  0.6293  180 PHE A CZ  
1239 N N   . ASN A 181 ? 1.2893 1.4877 1.5649 0.1203  -0.0851 0.5452  181 ASN A N   
1240 C CA  . ASN A 181 ? 1.2130 1.4017 1.4528 0.1288  -0.0692 0.5075  181 ASN A CA  
1241 C C   . ASN A 181 ? 1.2712 1.4542 1.5533 0.1324  -0.0907 0.4755  181 ASN A C   
1242 O O   . ASN A 181 ? 1.3458 1.5339 1.6536 0.1325  -0.0771 0.4601  181 ASN A O   
1243 C CB  . ASN A 181 ? 1.1288 1.3041 1.3017 0.1351  -0.0683 0.4994  181 ASN A CB  
1244 C CG  . ASN A 181 ? 1.1059 1.2704 1.2385 0.1426  -0.0518 0.4597  181 ASN A CG  
1245 O OD1 . ASN A 181 ? 1.0873 1.2455 1.2432 0.1466  -0.0690 0.4302  181 ASN A OD1 
1246 N ND2 . ASN A 181 ? 1.0950 1.2570 1.1663 0.1442  -0.0184 0.4584  181 ASN A ND2 
1247 N N   . PHE A 182 ? 1.2637 1.4359 1.5535 0.1355  -0.1248 0.4653  182 PHE A N   
1248 C CA  . PHE A 182 ? 1.2641 1.4292 1.5902 0.1397  -0.1470 0.4329  182 PHE A CA  
1249 C C   . PHE A 182 ? 1.1835 1.3570 1.5811 0.1341  -0.1580 0.4381  182 PHE A C   
1250 O O   . PHE A 182 ? 0.9995 1.1759 1.4134 0.1360  -0.1423 0.4176  182 PHE A O   
1251 C CB  . PHE A 182 ? 1.2994 1.4524 1.6252 0.1428  -0.1842 0.4263  182 PHE A CB  
1252 C CG  . PHE A 182 ? 1.3811 1.5275 1.7530 0.1460  -0.2119 0.3978  182 PHE A CG  
1253 C CD1 . PHE A 182 ? 1.4503 1.5910 1.8113 0.1530  -0.2010 0.3581  182 PHE A CD1 
1254 C CD2 . PHE A 182 ? 1.3721 1.5180 1.7984 0.1414  -0.2488 0.4102  182 PHE A CD2 
1255 C CE1 . PHE A 182 ? 1.4514 1.5862 1.8562 0.1563  -0.2269 0.3311  182 PHE A CE1 
1256 C CE2 . PHE A 182 ? 1.3935 1.5324 1.8622 0.1444  -0.2750 0.3841  182 PHE A CE2 
1257 C CZ  . PHE A 182 ? 1.4210 1.5544 1.8796 0.1522  -0.2643 0.3444  182 PHE A CZ  
1258 N N   . PHE A 183 ? 1.2829 1.4595 1.7225 0.1267  -0.1851 0.4651  183 PHE A N   
1259 C CA  . PHE A 183 ? 1.3087 1.4899 1.8167 0.1204  -0.2016 0.4707  183 PHE A CA  
1260 C C   . PHE A 183 ? 1.2562 1.4482 1.7792 0.1174  -0.1718 0.4735  183 PHE A C   
1261 O O   . PHE A 183 ? 1.2542 1.4454 1.8193 0.1180  -0.1779 0.4556  183 PHE A O   
1262 C CB  . PHE A 183 ? 1.3089 1.4940 1.8510 0.1103  -0.2278 0.5060  183 PHE A CB  
1263 C CG  . PHE A 183 ? 1.3404 1.5144 1.8994 0.1119  -0.2680 0.4981  183 PHE A CG  
1264 C CD1 . PHE A 183 ? 1.3928 1.5581 1.9920 0.1149  -0.2928 0.4720  183 PHE A CD1 
1265 C CD2 . PHE A 183 ? 1.3465 1.5191 1.8828 0.1104  -0.2815 0.5165  183 PHE A CD2 
1266 C CE1 . PHE A 183 ? 1.4027 1.5578 2.0177 0.1162  -0.3298 0.4645  183 PHE A CE1 
1267 C CE2 . PHE A 183 ? 1.3735 1.5363 1.9260 0.1118  -0.3185 0.5089  183 PHE A CE2 
1268 C CZ  . PHE A 183 ? 1.3891 1.5432 1.9806 0.1145  -0.3424 0.4831  183 PHE A CZ  
1269 N N   . ALA A 184 ? 1.2302 1.4319 1.7194 0.1143  -0.1401 0.4955  184 ALA A N   
1270 C CA  . ALA A 184 ? 1.2171 1.4303 1.7217 0.1101  -0.1120 0.5035  184 ALA A CA  
1271 C C   . ALA A 184 ? 1.2112 1.4250 1.6763 0.1178  -0.0761 0.4759  184 ALA A C   
1272 O O   . ALA A 184 ? 1.2160 1.4333 1.7079 0.1189  -0.0653 0.4589  184 ALA A O   
1273 C CB  . ALA A 184 ? 1.2187 1.4439 1.7177 0.1007  -0.0986 0.5457  184 ALA A CB  
1274 N N   . CYS A 185 ? 1.1940 1.4039 1.5951 0.1227  -0.0580 0.4714  185 CYS A N   
1275 C CA  . CYS A 185 ? 1.1760 1.3867 1.5321 0.1282  -0.0203 0.4492  185 CYS A CA  
1276 C C   . CYS A 185 ? 1.2397 1.4389 1.5809 0.1372  -0.0247 0.4044  185 CYS A C   
1277 O O   . CYS A 185 ? 1.3513 1.5499 1.6527 0.1416  0.0054  0.3816  185 CYS A O   
1278 C CB  . CYS A 185 ? 1.1735 1.3851 1.4644 0.1277  0.0048  0.4687  185 CYS A CB  
1279 S SG  . CYS A 185 ? 1.8102 2.0370 2.1142 0.1171  0.0153  0.5197  185 CYS A SG  
1280 N N   . VAL A 186 ? 1.1682 1.3586 1.5413 0.1396  -0.0618 0.3912  186 VAL A N   
1281 C CA  . VAL A 186 ? 1.1293 1.3091 1.4932 0.1478  -0.0688 0.3479  186 VAL A CA  
1282 C C   . VAL A 186 ? 1.1463 1.3230 1.5777 0.1488  -0.1024 0.3314  186 VAL A C   
1283 O O   . VAL A 186 ? 1.0741 1.2507 1.5257 0.1532  -0.0969 0.2988  186 VAL A O   
1284 C CB  . VAL A 186 ? 1.0093 1.1763 1.3204 0.1522  -0.0795 0.3412  186 VAL A CB  
1285 C CG1 . VAL A 186 ? 1.0042 1.1603 1.3145 0.1597  -0.0922 0.2970  186 VAL A CG1 
1286 C CG2 . VAL A 186 ? 0.9178 1.0847 1.1566 0.1523  -0.0446 0.3502  186 VAL A CG2 
1287 N N   . LEU A 187 ? 1.2267 1.4009 1.6934 0.1444  -0.1371 0.3536  187 LEU A N   
1288 C CA  . LEU A 187 ? 1.2429 1.4124 1.7729 0.1444  -0.1721 0.3409  187 LEU A CA  
1289 C C   . LEU A 187 ? 1.1582 1.3360 1.7403 0.1407  -0.1652 0.3425  187 LEU A C   
1290 O O   . LEU A 187 ? 1.1410 1.3155 1.7576 0.1451  -0.1738 0.3123  187 LEU A O   
1291 C CB  . LEU A 187 ? 1.2302 1.3955 1.7844 0.1389  -0.2089 0.3678  187 LEU A CB  
1292 C CG  . LEU A 187 ? 1.2241 1.3815 1.8385 0.1388  -0.2490 0.3544  187 LEU A CG  
1293 C CD1 . LEU A 187 ? 1.2521 1.3986 1.8543 0.1491  -0.2587 0.3109  187 LEU A CD1 
1294 C CD2 . LEU A 187 ? 1.2093 1.3640 1.8450 0.1316  -0.2818 0.3845  187 LEU A CD2 
1295 N N   . VAL A 188 ? 1.1393 1.3278 1.7274 0.1325  -0.1502 0.3774  188 VAL A N   
1296 C CA  . VAL A 188 ? 1.2142 1.4106 1.8489 0.1280  -0.1426 0.3826  188 VAL A CA  
1297 C C   . VAL A 188 ? 1.3883 1.5881 2.0140 0.1351  -0.1135 0.3481  188 VAL A C   
1298 O O   . VAL A 188 ? 1.4709 1.6696 2.1439 0.1369  -0.1231 0.3282  188 VAL A O   
1299 C CB  . VAL A 188 ? 1.1679 1.3762 1.8018 0.1178  -0.1262 0.4260  188 VAL A CB  
1300 C CG1 . VAL A 188 ? 1.1568 1.3730 1.8312 0.1139  -0.1131 0.4282  188 VAL A CG1 
1301 C CG2 . VAL A 188 ? 1.1557 1.3618 1.8123 0.1091  -0.1576 0.4587  188 VAL A CG2 
1302 N N   . PRO A 189 ? 1.3451 1.5484 1.9101 0.1389  -0.0782 0.3405  189 PRO A N   
1303 C CA  . PRO A 189 ? 1.2673 1.4740 1.8201 0.1451  -0.0490 0.3056  189 PRO A CA  
1304 C C   . PRO A 189 ? 1.1659 1.3634 1.7417 0.1531  -0.0688 0.2617  189 PRO A C   
1305 O O   . PRO A 189 ? 1.1532 1.3538 1.7668 0.1557  -0.0654 0.2384  189 PRO A O   
1306 C CB  . PRO A 189 ? 1.2952 1.5024 1.7712 0.1473  -0.0161 0.3050  189 PRO A CB  
1307 C CG  . PRO A 189 ? 1.2788 1.4890 1.7370 0.1402  -0.0185 0.3498  189 PRO A CG  
1308 C CD  . PRO A 189 ? 1.2890 1.4935 1.7949 0.1368  -0.0625 0.3646  189 PRO A CD  
1309 N N   . LEU A 190 ? 1.0658 1.2522 1.6200 0.1569  -0.0896 0.2501  190 LEU A N   
1310 C CA  . LEU A 190 ? 0.9996 1.1770 1.5745 0.1643  -0.1103 0.2088  190 LEU A CA  
1311 C C   . LEU A 190 ? 1.0701 1.2460 1.7224 0.1632  -0.1416 0.2056  190 LEU A C   
1312 O O   . LEU A 190 ? 1.1270 1.3004 1.8090 0.1691  -0.1478 0.1690  190 LEU A O   
1313 C CB  . LEU A 190 ? 0.9921 1.1575 1.5358 0.1672  -0.1328 0.2044  190 LEU A CB  
1314 C CG  . LEU A 190 ? 1.0856 1.2478 1.5508 0.1702  -0.1058 0.1950  190 LEU A CG  
1315 C CD1 . LEU A 190 ? 1.2413 1.3923 1.6789 0.1708  -0.1312 0.2049  190 LEU A CD1 
1316 C CD2 . LEU A 190 ? 0.9977 1.1583 1.4456 0.1770  -0.0864 0.1468  190 LEU A CD2 
1317 N N   . LEU A 191 ? 1.1172 1.2942 1.8019 0.1551  -0.1616 0.2436  191 LEU A N   
1318 C CA  . LEU A 191 ? 1.1606 1.3346 1.9170 0.1522  -0.1917 0.2456  191 LEU A CA  
1319 C C   . LEU A 191 ? 1.0758 1.2589 1.8612 0.1517  -0.1702 0.2387  191 LEU A C   
1320 O O   . LEU A 191 ? 1.0083 1.1877 1.8479 0.1536  -0.1887 0.2206  191 LEU A O   
1321 C CB  . LEU A 191 ? 1.1648 1.3372 1.9439 0.1419  -0.2172 0.2893  191 LEU A CB  
1322 C CG  . LEU A 191 ? 1.1184 1.2788 1.9077 0.1420  -0.2573 0.2903  191 LEU A CG  
1323 C CD1 . LEU A 191 ? 1.1241 1.2746 1.9712 0.1454  -0.2904 0.2636  191 LEU A CD1 
1324 C CD2 . LEU A 191 ? 1.0939 1.2500 1.8236 0.1488  -0.2500 0.2748  191 LEU A CD2 
1325 N N   . LEU A 192 ? 1.0812 1.2756 1.8303 0.1493  -0.1315 0.2531  192 LEU A N   
1326 C CA  . LEU A 192 ? 1.1495 1.3536 1.9189 0.1493  -0.1062 0.2454  192 LEU A CA  
1327 C C   . LEU A 192 ? 1.1143 1.3185 1.8759 0.1594  -0.0901 0.1954  192 LEU A C   
1328 O O   . LEU A 192 ? 1.0790 1.2842 1.8877 0.1625  -0.0953 0.1726  192 LEU A O   
1329 C CB  . LEU A 192 ? 1.2320 1.4483 1.9617 0.1436  -0.0687 0.2754  192 LEU A CB  
1330 C CG  . LEU A 192 ? 1.2590 1.4785 2.0013 0.1325  -0.0790 0.3253  192 LEU A CG  
1331 C CD1 . LEU A 192 ? 1.2449 1.4762 1.9397 0.1283  -0.0398 0.3507  192 LEU A CD1 
1332 C CD2 . LEU A 192 ? 1.2325 1.4518 2.0429 0.1268  -0.0991 0.3356  192 LEU A CD2 
1333 N N   . MET A 193 ? 1.0787 1.2818 1.7807 0.1640  -0.0709 0.1781  193 MET A N   
1334 C CA  . MET A 193 ? 1.0400 1.2430 1.7279 0.1725  -0.0545 0.1294  193 MET A CA  
1335 C C   . MET A 193 ? 1.1504 1.3446 1.8920 0.1783  -0.0897 0.0972  193 MET A C   
1336 O O   . MET A 193 ? 1.1758 1.3734 1.9472 0.1834  -0.0832 0.0630  193 MET A O   
1337 C CB  . MET A 193 ? 0.8790 1.0781 1.4927 0.1751  -0.0360 0.1192  193 MET A CB  
1338 C CG  . MET A 193 ? 0.8317 1.0394 1.3880 0.1713  0.0063  0.1388  193 MET A CG  
1339 S SD  . MET A 193 ? 1.2911 1.4913 1.7580 0.1738  0.0265  0.1262  193 MET A SD  
1340 C CE  . MET A 193 ? 4.9243 5.1156 5.3800 0.1696  -0.0062 0.1684  193 MET A CE  
1341 N N   . LEU A 194 ? 1.1615 1.3448 1.9163 0.1774  -0.1272 0.1077  194 LEU A N   
1342 C CA  . LEU A 194 ? 1.1831 1.3569 1.9911 0.1821  -0.1644 0.0813  194 LEU A CA  
1343 C C   . LEU A 194 ? 1.1125 1.2887 1.9891 0.1803  -0.1764 0.0839  194 LEU A C   
1344 O O   . LEU A 194 ? 1.0044 1.1790 1.9201 0.1866  -0.1846 0.0476  194 LEU A O   
1345 C CB  . LEU A 194 ? 1.1751 1.3372 1.9879 0.1795  -0.2029 0.1007  194 LEU A CB  
1346 C CG  . LEU A 194 ? 1.2137 1.3644 2.0812 0.1838  -0.2448 0.0768  194 LEU A CG  
1347 C CD1 . LEU A 194 ? 1.2943 1.4429 2.1505 0.1937  -0.2380 0.0243  194 LEU A CD1 
1348 C CD2 . LEU A 194 ? 1.2107 1.3509 2.0802 0.1799  -0.2806 0.1006  194 LEU A CD2 
1349 N N   . GLY A 195 ? 1.1032 1.2831 1.9939 0.1714  -0.1774 0.1266  195 GLY A N   
1350 C CA  . GLY A 195 ? 1.0669 1.2478 2.0192 0.1680  -0.1892 0.1348  195 GLY A CA  
1351 C C   . GLY A 195 ? 1.0749 1.2657 2.0374 0.1731  -0.1596 0.1062  195 GLY A C   
1352 O O   . GLY A 195 ? 1.0848 1.2733 2.1040 0.1752  -0.1749 0.0907  195 GLY A O   
1353 N N   . VAL A 196 ? 1.0780 1.2792 1.9854 0.1750  -0.1175 0.0992  196 VAL A N   
1354 C CA  . VAL A 196 ? 1.0131 1.2249 1.9239 0.1796  -0.0852 0.0704  196 VAL A CA  
1355 C C   . VAL A 196 ? 0.9864 1.1944 1.9197 0.1895  -0.0943 0.0166  196 VAL A C   
1356 O O   . VAL A 196 ? 0.9041 1.1132 1.8911 0.1931  -0.1024 -0.0049 196 VAL A O   
1357 C CB  . VAL A 196 ? 0.9735 1.1962 1.8148 0.1785  -0.0375 0.0748  196 VAL A CB  
1358 C CG1 . VAL A 196 ? 0.9583 1.1911 1.8000 0.1842  -0.0050 0.0360  196 VAL A CG1 
1359 C CG2 . VAL A 196 ? 0.9356 1.1648 1.7625 0.1690  -0.0242 0.1251  196 VAL A CG2 
1360 N N   . TYR A 197 ? 1.0747 1.2779 1.9673 0.1939  -0.0935 -0.0054 197 TYR A N   
1361 C CA  . TYR A 197 ? 1.1654 1.3650 2.0752 0.2028  -0.1021 -0.0573 197 TYR A CA  
1362 C C   . TYR A 197 ? 1.1658 1.3556 2.1501 0.2055  -0.1474 -0.0667 197 TYR A C   
1363 O O   . TYR A 197 ? 1.1550 1.3437 2.1723 0.2130  -0.1555 -0.1100 197 TYR A O   
1364 C CB  . TYR A 197 ? 1.2786 1.4718 2.1329 0.2054  -0.1010 -0.0723 197 TYR A CB  
1365 C CG  . TYR A 197 ? 1.3291 1.5302 2.1101 0.2045  -0.0549 -0.0783 197 TYR A CG  
1366 C CD1 . TYR A 197 ? 1.3681 1.5763 2.1359 0.2094  -0.0258 -0.1230 197 TYR A CD1 
1367 C CD2 . TYR A 197 ? 1.3097 1.5106 2.0346 0.1984  -0.0407 -0.0398 197 TYR A CD2 
1368 C CE1 . TYR A 197 ? 1.3938 1.6079 2.0926 0.2076  0.0164  -0.1285 197 TYR A CE1 
1369 C CE2 . TYR A 197 ? 1.3356 1.5419 1.9921 0.1973  0.0004  -0.0448 197 TYR A CE2 
1370 C CZ  . TYR A 197 ? 1.3847 1.5971 2.0275 0.2015  0.0289  -0.0889 197 TYR A CZ  
1371 O OH  . TYR A 197 ? 1.4095 1.6259 1.9824 0.1994  0.0699  -0.0939 197 TYR A OH  
1372 N N   . LEU A 198 ? 1.2000 1.3824 2.2107 0.1988  -0.1770 -0.0265 198 LEU A N   
1373 C CA  . LEU A 198 ? 1.2153 1.3867 2.2962 0.1997  -0.2209 -0.0299 198 LEU A CA  
1374 C C   . LEU A 198 ? 1.1443 1.3207 2.2779 0.2017  -0.2165 -0.0441 198 LEU A C   
1375 O O   . LEU A 198 ? 1.0941 1.2651 2.2771 0.2084  -0.2379 -0.0780 198 LEU A O   
1376 C CB  . LEU A 198 ? 1.1929 1.3556 2.2858 0.1900  -0.2500 0.0193  198 LEU A CB  
1377 C CG  . LEU A 198 ? 1.1710 1.3249 2.2316 0.1887  -0.2694 0.0307  198 LEU A CG  
1378 C CD1 . LEU A 198 ? 1.2053 1.3534 2.2789 0.1778  -0.2934 0.0807  198 LEU A CD1 
1379 C CD2 . LEU A 198 ? 1.1189 1.2619 2.2063 0.1967  -0.3003 -0.0080 198 LEU A CD2 
1380 N N   . ARG A 199 ? 1.1536 1.3403 2.2769 0.1961  -0.1890 -0.0181 199 ARG A N   
1381 C CA  . ARG A 199 ? 1.2349 1.4273 2.4048 0.1975  -0.1820 -0.0283 199 ARG A CA  
1382 C C   . ARG A 199 ? 1.2048 1.4078 2.3670 0.2069  -0.1520 -0.0787 199 ARG A C   
1383 O O   . ARG A 199 ? 1.1929 1.3960 2.4073 0.2127  -0.1612 -0.1089 199 ARG A O   
1384 C CB  . ARG A 199 ? 1.3352 1.5362 2.4924 0.1883  -0.1596 0.0151  199 ARG A CB  
1385 C CG  . ARG A 199 ? 1.4526 1.6455 2.6107 0.1774  -0.1836 0.0665  199 ARG A CG  
1386 C CD  . ARG A 199 ? 1.5934 1.7702 2.8160 0.1758  -0.2333 0.0696  199 ARG A CD  
1387 N NE  . ARG A 199 ? 1.6933 1.8631 2.9194 0.1637  -0.2542 0.1195  199 ARG A NE  
1388 C CZ  . ARG A 199 ? 1.7515 1.9143 2.9548 0.1599  -0.2725 0.1375  199 ARG A CZ  
1389 N NH1 . ARG A 199 ? 1.8060 1.9669 2.9799 0.1676  -0.2731 0.1106  199 ARG A NH1 
1390 N NH2 . ARG A 199 ? 1.7318 1.8896 2.9416 0.1481  -0.2900 0.1819  199 ARG A NH2 
1391 N N   . ILE A 200 ? 1.1439 1.3554 2.2409 0.2079  -0.1165 -0.0877 200 ILE A N   
1392 C CA  . ILE A 200 ? 1.0961 1.3179 2.1770 0.2152  -0.0846 -0.1355 200 ILE A CA  
1393 C C   . ILE A 200 ? 1.2046 1.4201 2.3308 0.2243  -0.1105 -0.1841 200 ILE A C   
1394 O O   . ILE A 200 ? 1.3185 1.5391 2.4905 0.2296  -0.1085 -0.2146 200 ILE A O   
1395 C CB  . ILE A 200 ? 1.0371 1.2637 2.0369 0.2142  -0.0508 -0.1389 200 ILE A CB  
1396 C CG1 . ILE A 200 ? 1.0389 1.2743 1.9937 0.2063  -0.0180 -0.0977 200 ILE A CG1 
1397 C CG2 . ILE A 200 ? 1.0091 1.2438 1.9941 0.2211  -0.0232 -0.1934 200 ILE A CG2 
1398 C CD1 . ILE A 200 ? 1.1053 1.3445 1.9790 0.2050  0.0169  -0.1002 200 ILE A CD1 
1399 N N   . PHE A 201 ? 1.1987 1.4033 2.3130 0.2261  -0.1352 -0.1914 201 PHE A N   
1400 C CA  . PHE A 201 ? 1.3263 1.5245 2.4795 0.2347  -0.1602 -0.2377 201 PHE A CA  
1401 C C   . PHE A 201 ? 1.3674 1.5554 2.6005 0.2362  -0.2038 -0.2347 201 PHE A C   
1402 O O   . PHE A 201 ? 1.3863 1.5698 2.6639 0.2439  -0.2253 -0.2743 201 PHE A O   
1403 C CB  . PHE A 201 ? 1.4314 1.6204 2.5465 0.2357  -0.1742 -0.2445 201 PHE A CB  
1404 C CG  . PHE A 201 ? 1.5268 1.7237 2.5666 0.2356  -0.1338 -0.2596 201 PHE A CG  
1405 C CD1 . PHE A 201 ? 1.5839 1.7837 2.6132 0.2420  -0.1225 -0.3120 201 PHE A CD1 
1406 C CD2 . PHE A 201 ? 1.5642 1.7650 2.5433 0.2284  -0.1072 -0.2218 201 PHE A CD2 
1407 C CE1 . PHE A 201 ? 1.6287 1.8339 2.5862 0.2406  -0.0854 -0.3257 201 PHE A CE1 
1408 C CE2 . PHE A 201 ? 1.6190 1.8250 2.5271 0.2278  -0.0709 -0.2351 201 PHE A CE2 
1409 C CZ  . PHE A 201 ? 1.6468 1.8545 2.5431 0.2335  -0.0600 -0.2868 201 PHE A CZ  
1410 N N   . ALA A 202 ? 1.3870 1.5709 2.6378 0.2286  -0.2168 -0.1880 202 ALA A N   
1411 C CA  . ALA A 202 ? 1.4137 1.5862 2.7373 0.2283  -0.2573 -0.1806 202 ALA A CA  
1412 C C   . ALA A 202 ? 1.4009 1.5817 2.7683 0.2324  -0.2444 -0.2025 202 ALA A C   
1413 O O   . ALA A 202 ? 1.4477 1.6223 2.8742 0.2391  -0.2700 -0.2331 202 ALA A O   
1414 C CB  . ALA A 202 ? 1.4046 1.5691 2.7290 0.2172  -0.2756 -0.1227 202 ALA A CB  
1415 N N   . ALA A 203 ? 1.3625 1.5572 2.7011 0.2286  -0.2049 -0.1871 203 ALA A N   
1416 C CA  . ALA A 203 ? 1.3632 1.5674 2.7387 0.2320  -0.1887 -0.2054 203 ALA A CA  
1417 C C   . ALA A 203 ? 1.4297 1.6453 2.8023 0.2419  -0.1641 -0.2639 203 ALA A C   
1418 O O   . ALA A 203 ? 1.4378 1.6574 2.8604 0.2480  -0.1656 -0.2947 203 ALA A O   
1419 C CB  . ALA A 203 ? 1.2926 1.5080 2.6374 0.2240  -0.1547 -0.1678 203 ALA A CB  
1420 N N   . ALA A 204 ? 1.4792 1.6997 2.7930 0.2430  -0.1416 -0.2796 204 ALA A N   
1421 C CA  . ALA A 204 ? 1.5473 1.7787 2.8503 0.2508  -0.1156 -0.3350 204 ALA A CA  
1422 C C   . ALA A 204 ? 1.6113 1.8359 2.9795 0.2600  -0.1491 -0.3796 204 ALA A C   
1423 O O   . ALA A 204 ? 1.6127 1.8471 3.0110 0.2667  -0.1356 -0.4225 204 ALA A O   
1424 C CB  . ALA A 204 ? 1.5780 1.8114 2.8061 0.2491  -0.0932 -0.3407 204 ALA A CB  
1425 N N   . ARG A 205 ? 1.6580 1.8661 3.0486 0.2603  -0.1929 -0.3699 205 ARG A N   
1426 C CA  . ARG A 205 ? 1.7036 1.9031 3.1569 0.2689  -0.2291 -0.4091 205 ARG A CA  
1427 C C   . ARG A 205 ? 1.6540 1.8488 3.1817 0.2707  -0.2530 -0.4054 205 ARG A C   
1428 O O   . ARG A 205 ? 1.6451 1.8369 3.2304 0.2791  -0.2740 -0.4451 205 ARG A O   
1429 C CB  . ARG A 205 ? 1.7794 1.9619 3.2314 0.2681  -0.2687 -0.3981 205 ARG A CB  
1430 C CG  . ARG A 205 ? 1.8963 2.0816 3.2927 0.2702  -0.2536 -0.4229 205 ARG A CG  
1431 C CD  . ARG A 205 ? 1.9760 2.1725 3.2921 0.2638  -0.2075 -0.4023 205 ARG A CD  
1432 N NE  . ARG A 205 ? 2.0727 2.2702 3.3331 0.2652  -0.1933 -0.4259 205 ARG A NE  
1433 C CZ  . ARG A 205 ? 2.1176 2.3054 3.3362 0.2611  -0.2059 -0.4008 205 ARG A CZ  
1434 N NH1 . ARG A 205 ? 2.0934 2.2707 3.3205 0.2553  -0.2324 -0.3518 205 ARG A NH1 
1435 N NH2 . ARG A 205 ? 2.1682 2.3565 3.3363 0.2625  -0.1921 -0.4252 205 ARG A NH2 
1436 N N   . ARG A 206 ? 1.6249 1.8186 3.1510 0.2627  -0.2501 -0.3579 206 ARG A N   
1437 C CA  . ARG A 206 ? 1.6315 1.8207 3.2218 0.2631  -0.2689 -0.3507 206 ARG A CA  
1438 C C   . ARG A 206 ? 1.6015 1.8080 3.2075 0.2695  -0.2356 -0.3889 206 ARG A C   
1439 O O   . ARG A 206 ? 1.6030 1.8068 3.2735 0.2758  -0.2542 -0.4135 206 ARG A O   
1440 C CB  . ARG A 206 ? 1.6517 1.8364 3.2298 0.2516  -0.2704 -0.2893 206 ARG A CB  
1441 C CG  . ARG A 206 ? 1.7539 1.9219 3.3197 0.2440  -0.3036 -0.2493 206 ARG A CG  
1442 C CD  . ARG A 206 ? 1.8192 1.9858 3.3675 0.2317  -0.2988 -0.1903 206 ARG A CD  
1443 N NE  . ARG A 206 ? 1.8843 2.0375 3.4145 0.2236  -0.3256 -0.1524 206 ARG A NE  
1444 C CZ  . ARG A 206 ? 1.8911 2.0422 3.4010 0.2118  -0.3244 -0.0998 206 ARG A CZ  
1445 N NH1 . ARG A 206 ? 1.8756 2.0367 3.3796 0.2068  -0.2978 -0.0782 206 ARG A NH1 
1446 N NH2 . ARG A 206 ? 1.9113 2.0507 3.4072 0.2048  -0.3496 -0.0696 206 ARG A NH2 
1447 N N   . GLN A 207 ? 1.5667 1.7905 3.1132 0.2678  -0.1866 -0.3939 207 GLN A N   
1448 C CA  . GLN A 207 ? 1.5399 1.7819 3.0930 0.2731  -0.1499 -0.4318 207 GLN A CA  
1449 C C   . GLN A 207 ? 1.5682 1.8120 3.1609 0.2841  -0.1608 -0.4945 207 GLN A C   
1450 O O   . GLN A 207 ? 1.6045 1.8535 3.2524 0.2907  -0.1634 -0.5258 207 GLN A O   
1451 C CB  . GLN A 207 ? 1.5745 1.8325 3.0488 0.2684  -0.0966 -0.4271 207 GLN A CB  
1452 C CG  . GLN A 207 ? 1.5945 1.8518 3.0235 0.2576  -0.0836 -0.3662 207 GLN A CG  
1453 C CD  . GLN A 207 ? 1.6018 1.8625 3.0648 0.2543  -0.0801 -0.3408 207 GLN A CD  
1454 O OE1 . GLN A 207 ? 1.6793 1.9449 3.1944 0.2605  -0.0815 -0.3705 207 GLN A OE1 
1455 N NE2 . GLN A 207 ? 1.5149 1.7731 2.9488 0.2445  -0.0756 -0.2860 207 GLN A NE2 
1456 N N   . LEU A 208 ? 1.6124 1.8520 3.1774 0.2859  -0.1675 -0.5131 208 LEU A N   
1457 C CA  . LEU A 208 ? 1.6941 1.9350 3.2931 0.2957  -0.1789 -0.5725 208 LEU A CA  
1458 C C   . LEU A 208 ? 1.7172 1.9439 3.4017 0.3020  -0.2292 -0.5827 208 LEU A C   
1459 O O   . LEU A 208 ? 1.7227 1.9531 3.4553 0.3112  -0.2375 -0.6336 208 LEU A O   
1460 C CB  . LEU A 208 ? 1.7660 2.0017 3.3185 0.2953  -0.1826 -0.5824 208 LEU A CB  
1461 C CG  . LEU A 208 ? 1.7933 2.0397 3.2573 0.2890  -0.1365 -0.5740 208 LEU A CG  
1462 C CD1 . LEU A 208 ? 1.8174 2.0549 3.2410 0.2884  -0.1485 -0.5795 208 LEU A CD1 
1463 C CD2 . LEU A 208 ? 1.8288 2.0954 3.2787 0.2917  -0.0902 -0.6183 208 LEU A CD2 
1464 N N   . LYS A 209 ? 1.7479 1.9580 3.4507 0.2965  -0.2628 -0.5343 209 LYS A N   
1465 C CA  . LYS A 209 ? 1.7780 1.9712 3.5583 0.3008  -0.3131 -0.5372 209 LYS A CA  
1466 C C   . LYS A 209 ? 1.7347 1.9333 3.5662 0.3036  -0.3089 -0.5442 209 LYS A C   
1467 O O   . LYS A 209 ? 1.6868 1.8788 3.5870 0.3116  -0.3379 -0.5746 209 LYS A O   
1468 C CB  . LYS A 209 ? 1.7766 1.9493 3.5552 0.2923  -0.3500 -0.4823 209 LYS A CB  
1469 C CG  . LYS A 209 ? 1.7964 1.9482 3.6505 0.2954  -0.4051 -0.4835 209 LYS A CG  
1470 C CD  . LYS A 209 ? 1.7954 1.9272 3.6421 0.2856  -0.4394 -0.4301 209 LYS A CD  
1471 C CE  . LYS A 209 ? 1.8129 1.9219 3.7326 0.2880  -0.4951 -0.4320 209 LYS A CE  
1472 N NZ  . LYS A 209 ? 1.8124 1.9016 3.7249 0.2773  -0.5286 -0.3811 209 LYS A NZ  
1473 N N   . GLN A 210 ? 1.7495 1.9598 3.5477 0.2972  -0.2731 -0.5160 210 GLN A N   
1474 C CA  . GLN A 210 ? 1.8005 2.0175 3.6408 0.2993  -0.2645 -0.5205 210 GLN A CA  
1475 C C   . GLN A 210 ? 1.8953 2.1318 3.7505 0.3089  -0.2346 -0.5817 210 GLN A C   
1476 O O   . GLN A 210 ? 1.9340 2.1729 3.8484 0.3153  -0.2424 -0.6061 210 GLN A O   
1477 C CB  . GLN A 210 ? 1.7891 2.0131 3.5865 0.2889  -0.2343 -0.4707 210 GLN A CB  
1478 C CG  . GLN A 210 ? 1.8096 2.0156 3.5985 0.2784  -0.2630 -0.4094 210 GLN A CG  
1479 C CD  . GLN A 210 ? 1.8047 2.0189 3.5536 0.2682  -0.2322 -0.3623 210 GLN A CD  
1480 O OE1 . GLN A 210 ? 1.8001 2.0334 3.5251 0.2691  -0.1885 -0.3745 210 GLN A OE1 
1481 N NE2 . GLN A 210 ? 1.7962 1.9963 3.5379 0.2580  -0.2544 -0.3087 210 GLN A NE2 
1482 N N   . MET A 211 ? 1.9351 2.1851 3.7359 0.3094  -0.2005 -0.6066 211 MET A N   
1483 C CA  . MET A 211 ? 1.9657 2.2350 3.7736 0.3171  -0.1691 -0.6663 211 MET A CA  
1484 C C   . MET A 211 ? 2.0540 2.3177 3.9099 0.3270  -0.1996 -0.7177 211 MET A C   
1485 O O   . MET A 211 ? 2.1128 2.3916 3.9736 0.3332  -0.1771 -0.7720 211 MET A O   
1486 C CB  . MET A 211 ? 1.9357 2.2213 3.6603 0.3118  -0.1172 -0.6704 211 MET A CB  
1487 C CG  . MET A 211 ? 1.8846 2.1771 3.5579 0.3023  -0.0836 -0.6224 211 MET A CG  
1488 S SD  . MET A 211 ? 1.3150 1.6251 2.8919 0.2966  -0.0230 -0.6320 211 MET A SD  
1489 C CE  . MET A 211 ? 4.8421 5.1374 6.3807 0.2953  -0.0472 -0.6284 211 MET A CE  
1490 N N   . GLU A 212 ? 1.8192 3.3163 3.4170 -0.0721 -0.4031 0.7585  212 GLU A N   
1491 C CA  . GLU A 212 ? 1.8168 3.3062 3.4703 -0.0975 -0.4103 0.7737  212 GLU A CA  
1492 C C   . GLU A 212 ? 1.7395 3.2758 3.4744 -0.1373 -0.4068 0.7994  212 GLU A C   
1493 O O   . GLU A 212 ? 1.7258 3.2289 3.5000 -0.1629 -0.4033 0.8084  212 GLU A O   
1494 C CB  . GLU A 212 ? 1.8550 3.4085 3.5325 -0.0885 -0.4364 0.7839  212 GLU A CB  
1495 C CG  . GLU A 212 ? 1.8601 3.4059 3.5926 -0.1128 -0.4452 0.7989  212 GLU A CG  
1496 C CD  . GLU A 212 ? 1.8489 3.4538 3.5995 -0.1018 -0.4705 0.8069  212 GLU A CD  
1497 O OE1 . GLU A 212 ? 1.8478 3.4942 3.5638 -0.0738 -0.4809 0.7990  212 GLU A OE1 
1498 O OE2 . GLU A 212 ? 1.8390 3.4488 3.6381 -0.1212 -0.4801 0.8209  212 GLU A OE2 
1499 N N   . SER A 213 ? 1.6982 3.3118 3.4577 -0.1422 -0.4078 0.8108  213 SER A N   
1500 C CA  . SER A 213 ? 1.6505 3.3135 3.4849 -0.1785 -0.4044 0.8349  213 SER A CA  
1501 C C   . SER A 213 ? 1.6855 3.3037 3.4928 -0.1826 -0.3801 0.8243  213 SER A C   
1502 O O   . SER A 213 ? 1.7013 3.3826 3.5474 -0.1979 -0.3782 0.8389  213 SER A O   
1503 C CB  . SER A 213 ? 1.5942 3.3857 3.4868 -0.1853 -0.4244 0.8592  213 SER A CB  
1504 O OG  . SER A 213 ? 1.6047 3.4404 3.5260 -0.1834 -0.4469 0.8699  213 SER A OG  
1505 N N   . GLN A 214 ? 1.6991 3.2079 3.4393 -0.1689 -0.3617 0.7986  214 GLN A N   
1506 C CA  . GLN A 214 ? 1.6928 3.1486 3.3996 -0.1708 -0.3374 0.7855  214 GLN A CA  
1507 C C   . GLN A 214 ? 1.7343 3.1213 3.4667 -0.2000 -0.3210 0.7877  214 GLN A C   
1508 O O   . GLN A 214 ? 1.8039 3.1255 3.5277 -0.2022 -0.3202 0.7813  214 GLN A O   
1509 C CB  . GLN A 214 ? 1.7009 3.0816 3.3088 -0.1337 -0.3263 0.7536  214 GLN A CB  
1510 C CG  . GLN A 214 ? 1.7098 3.0005 3.2704 -0.1185 -0.3256 0.7353  214 GLN A CG  
1511 C CD  . GLN A 214 ? 1.7558 2.9722 3.2179 -0.0818 -0.3145 0.7038  214 GLN A CD  
1512 O OE1 . GLN A 214 ? 1.7971 3.0280 3.2249 -0.0675 -0.3069 0.6952  214 GLN A OE1 
1513 N NE2 . GLN A 214 ? 1.7580 2.8938 3.1734 -0.0664 -0.3135 0.6864  214 GLN A NE2 
1514 N N   . PRO A 215 ? 1.6663 3.0691 3.4309 -0.2225 -0.3080 0.7968  215 PRO A N   
1515 C CA  . PRO A 215 ? 1.5935 2.9366 3.3852 -0.2516 -0.2912 0.7993  215 PRO A CA  
1516 C C   . PRO A 215 ? 1.6473 2.8672 3.3624 -0.2377 -0.2680 0.7696  215 PRO A C   
1517 O O   . PRO A 215 ? 1.7104 2.8799 3.4335 -0.2575 -0.2492 0.7672  215 PRO A O   
1518 C CB  . PRO A 215 ? 1.5402 2.9452 3.3780 -0.2729 -0.2848 0.8151  215 PRO A CB  
1519 C CG  . PRO A 215 ? 1.5471 3.0613 3.4046 -0.2618 -0.3039 0.8286  215 PRO A CG  
1520 C CD  . PRO A 215 ? 1.6277 3.1174 3.4134 -0.2235 -0.3106 0.8079  215 PRO A CD  
1521 N N   . LEU A 216 ? 1.6484 2.8205 3.2900 -0.2042 -0.2693 0.7472  216 LEU A N   
1522 C CA  . LEU A 216 ? 1.6833 2.7373 3.2471 -0.1886 -0.2482 0.7179  216 LEU A CA  
1523 C C   . LEU A 216 ? 1.7202 2.7246 3.2230 -0.1578 -0.2561 0.6993  216 LEU A C   
1524 O O   . LEU A 216 ? 1.7761 2.8417 3.2772 -0.1394 -0.2757 0.7037  216 LEU A O   
1525 C CB  . LEU A 216 ? 1.7027 2.7428 3.2180 -0.1756 -0.2308 0.7031  216 LEU A CB  
1526 C CG  . LEU A 216 ? 1.7283 2.8430 3.2214 -0.1506 -0.2419 0.7026  216 LEU A CG  
1527 C CD1 . LEU A 216 ? 1.7655 2.8418 3.1829 -0.1122 -0.2484 0.6807  216 LEU A CD1 
1528 C CD2 . LEU A 216 ? 1.7425 2.8565 3.2132 -0.1500 -0.2240 0.6954  216 LEU A CD2 
1529 N N   . PRO A 217 ? 1.6736 2.5666 3.1263 -0.1524 -0.2409 0.6784  217 PRO A N   
1530 C CA  . PRO A 217 ? 1.6856 2.5191 3.0760 -0.1235 -0.2462 0.6588  217 PRO A CA  
1531 C C   . PRO A 217 ? 1.6441 2.4908 2.9666 -0.0857 -0.2500 0.6420  217 PRO A C   
1532 O O   . PRO A 217 ? 1.6370 2.5436 2.9635 -0.0691 -0.2710 0.6476  217 PRO A O   
1533 C CB  . PRO A 217 ? 1.7235 2.4327 3.0677 -0.1265 -0.2228 0.6377  217 PRO A CB  
1534 C CG  . PRO A 217 ? 1.6737 2.3889 3.0828 -0.1649 -0.2122 0.6540  217 PRO A CG  
1535 C CD  . PRO A 217 ? 1.6319 2.4491 3.0872 -0.1748 -0.2177 0.6727  217 PRO A CD  
1536 N N   . GLY A 218 ? 1.5839 2.3749 2.8448 -0.0722 -0.2300 0.6215  218 GLY A N   
1537 C CA  . GLY A 218 ? 1.5129 2.3100 2.7057 -0.0364 -0.2314 0.6042  218 GLY A CA  
1538 C C   . GLY A 218 ? 1.4627 2.2324 2.6053 -0.0057 -0.2446 0.5900  218 GLY A C   
1539 O O   . GLY A 218 ? 1.4368 2.2738 2.5738 0.0148  -0.2624 0.5931  218 GLY A O   
1540 N N   . GLU A 219 ? 1.4812 2.1520 2.5873 -0.0025 -0.2360 0.5743  219 GLU A N   
1541 C CA  . GLU A 219 ? 1.5440 2.1783 2.5997 0.0263  -0.2471 0.5595  219 GLU A CA  
1542 C C   . GLU A 219 ? 1.6038 2.2040 2.5690 0.0650  -0.2415 0.5337  219 GLU A C   
1543 O O   . GLU A 219 ? 1.6616 2.2516 2.5832 0.0935  -0.2536 0.5221  219 GLU A O   
1544 C CB  . GLU A 219 ? 1.5890 2.1234 2.6302 0.0180  -0.2381 0.5495  219 GLU A CB  
1545 C CG  . GLU A 219 ? 1.5844 2.1513 2.7124 -0.0173 -0.2465 0.5743  219 GLU A CG  
1546 C CD  . GLU A 219 ? 1.5838 2.2511 2.7656 -0.0171 -0.2746 0.5953  219 GLU A CD  
1547 O OE1 . GLU A 219 ? 1.5463 2.2868 2.8112 -0.0467 -0.2833 0.6219  219 GLU A OE1 
1548 O OE2 . GLU A 219 ? 1.6102 2.2834 2.7508 0.0126  -0.2879 0.5852  219 GLU A OE2 
1549 N N   . ARG A 220 ? 1.5580 2.1404 2.4951 0.0659  -0.2233 0.5248  220 ARG A N   
1550 C CA  . ARG A 220 ? 1.5473 2.1026 2.4010 0.1012  -0.2173 0.5015  220 ARG A CA  
1551 C C   . ARG A 220 ? 1.5720 2.2257 2.4321 0.1223  -0.2400 0.5093  220 ARG A C   
1552 O O   . ARG A 220 ? 1.5555 2.1884 2.3513 0.1565  -0.2462 0.4915  220 ARG A O   
1553 C CB  . ARG A 220 ? 1.4052 1.9373 2.2395 0.0942  -0.1945 0.4943  220 ARG A CB  
1554 C CG  . ARG A 220 ? 1.3496 1.7557 2.1269 0.0938  -0.1691 0.4713  220 ARG A CG  
1555 C CD  . ARG A 220 ? 1.3437 1.6733 2.0229 0.1329  -0.1659 0.4419  220 ARG A CD  
1556 N NE  . ARG A 220 ? 1.3361 1.5415 1.9635 0.1321  -0.1444 0.4207  220 ARG A NE  
1557 C CZ  . ARG A 220 ? 1.3169 1.4597 1.9346 0.1319  -0.1466 0.4147  220 ARG A CZ  
1558 N NH1 . ARG A 220 ? 1.2789 1.4717 1.9351 0.1326  -0.1694 0.4284  220 ARG A NH1 
1559 N NH2 . ARG A 220 ? 1.3517 1.3818 1.9210 0.1310  -0.1259 0.3950  220 ARG A NH2 
1560 N N   . ALA A 221 ? 1.1458 2.4323 2.6466 0.0320  -0.4792 0.5892  221 ALA A N   
1561 C CA  . ALA A 221 ? 1.1635 2.4108 2.5996 0.0296  -0.4690 0.6041  221 ALA A CA  
1562 C C   . ALA A 221 ? 1.2556 2.3618 2.7372 0.0483  -0.4303 0.5889  221 ALA A C   
1563 O O   . ALA A 221 ? 1.2965 2.3224 2.7067 0.0260  -0.4179 0.5435  221 ALA A O   
1564 C CB  . ALA A 221 ? 1.1896 2.5441 2.6411 0.0599  -0.4812 0.7013  221 ALA A CB  
1565 N N   . ARG A 222 ? 1.3393 2.4190 2.9436 0.0888  -0.4098 0.6252  222 ARG A N   
1566 C CA  . ARG A 222 ? 1.4319 2.3866 3.0947 0.1065  -0.3719 0.6079  222 ARG A CA  
1567 C C   . ARG A 222 ? 1.4094 2.2706 3.0268 0.0746  -0.3630 0.5090  222 ARG A C   
1568 O O   . ARG A 222 ? 1.4295 2.2085 2.9997 0.0619  -0.3468 0.4743  222 ARG A O   
1569 C CB  . ARG A 222 ? 1.5336 2.4826 3.3441 0.1522  -0.3496 0.6554  222 ARG A CB  
1570 C CG  . ARG A 222 ? 1.7017 2.7132 3.5767 0.1939  -0.3429 0.7621  222 ARG A CG  
1571 C CD  . ARG A 222 ? 1.8250 2.8127 3.8557 0.2389  -0.3119 0.8032  222 ARG A CD  
1572 N NE  . ARG A 222 ? 1.9700 3.0052 4.0734 0.2831  -0.2965 0.9103  222 ARG A NE  
1573 C CZ  . ARG A 222 ? 2.0390 3.0607 4.2864 0.3279  -0.2637 0.9648  222 ARG A CZ  
1574 N NH1 . ARG A 222 ? 2.0221 2.9854 4.3533 0.3324  -0.2445 0.9171  222 ARG A NH1 
1575 N NH2 . ARG A 222 ? 2.1025 3.1701 4.4126 0.3693  -0.2471 1.0682  222 ARG A NH2 
1576 N N   . SER A 223 ? 1.3746 2.2532 3.0083 0.0635  -0.3725 0.4673  223 SER A N   
1577 C CA  . SER A 223 ? 1.3265 2.1267 2.9243 0.0379  -0.3624 0.3795  223 SER A CA  
1578 C C   . SER A 223 ? 1.3332 2.1092 2.8012 -0.0026 -0.3697 0.3330  223 SER A C   
1579 O O   . SER A 223 ? 1.3864 2.0729 2.8229 -0.0124 -0.3500 0.2847  223 SER A O   
1580 C CB  . SER A 223 ? 1.3074 2.1490 2.9357 0.0314  -0.3739 0.3506  223 SER A CB  
1581 O OG  . SER A 223 ? 1.3369 2.1907 3.0897 0.0698  -0.3620 0.3885  223 SER A OG  
1582 N N   . THR A 224 ? 1.3027 2.1630 2.6985 -0.0259 -0.3968 0.3469  224 THR A N   
1583 C CA  . THR A 224 ? 1.2647 2.1081 2.5400 -0.0657 -0.4013 0.3040  224 THR A CA  
1584 C C   . THR A 224 ? 1.1932 1.9752 2.4363 -0.0581 -0.3839 0.3216  224 THR A C   
1585 O O   . THR A 224 ? 1.1685 1.8724 2.3516 -0.0776 -0.3680 0.2715  224 THR A O   
1586 C CB  . THR A 224 ? 1.2952 2.2532 2.5072 -0.0918 -0.4331 0.3177  224 THR A CB  
1587 O OG1 . THR A 224 ? 1.2364 2.2501 2.4761 -0.1038 -0.4485 0.2939  224 THR A OG1 
1588 C CG2 . THR A 224 ? 1.3225 2.2569 2.4142 -0.1337 -0.4322 0.2702  224 THR A CG2 
1589 N N   . LEU A 225 ? 1.1095 1.9296 2.3965 -0.0279 -0.3848 0.3964  225 LEU A N   
1590 C CA  . LEU A 225 ? 0.9812 1.7498 2.2480 -0.0176 -0.3667 0.4223  225 LEU A CA  
1591 C C   . LEU A 225 ? 0.9177 1.5680 2.2279 -0.0075 -0.3350 0.3846  225 LEU A C   
1592 O O   . LEU A 225 ? 0.9403 1.5249 2.1884 -0.0237 -0.3216 0.3509  225 LEU A O   
1593 C CB  . LEU A 225 ? 0.9358 1.7667 2.2652 0.0203  -0.3680 0.5168  225 LEU A CB  
1594 C CG  . LEU A 225 ? 0.8907 1.6852 2.1982 0.0320  -0.3501 0.5553  225 LEU A CG  
1595 C CD1 . LEU A 225 ? 0.8860 1.7168 2.0613 -0.0024 -0.3662 0.5392  225 LEU A CD1 
1596 C CD2 . LEU A 225 ? 0.6159 1.4634 2.0121 0.0772  -0.3434 0.6534  225 LEU A CD2 
1597 N N   . GLN A 226 ? 0.9612 1.5898 2.3800 0.0192  -0.3225 0.3887  226 GLN A N   
1598 C CA  . GLN A 226 ? 1.1184 1.6475 2.5897 0.0293  -0.2929 0.3494  226 GLN A CA  
1599 C C   . GLN A 226 ? 1.3284 1.8011 2.7223 -0.0021 -0.2895 0.2665  226 GLN A C   
1600 O O   . GLN A 226 ? 1.3534 1.7492 2.7552 -0.0008 -0.2675 0.2310  226 GLN A O   
1601 C CB  . GLN A 226 ? 1.1211 1.6473 2.7187 0.0586  -0.2810 0.3574  226 GLN A CB  
1602 C CG  . GLN A 226 ? 1.2120 1.7779 2.9069 0.0964  -0.2735 0.4430  226 GLN A CG  
1603 C CD  . GLN A 226 ? 1.2917 1.8414 3.1192 0.1255  -0.2540 0.4455  226 GLN A CD  
1604 O OE1 . GLN A 226 ? 1.3092 1.8113 3.1558 0.1176  -0.2444 0.3790  226 GLN A OE1 
1605 N NE2 . GLN A 226 ? 1.3416 1.9335 3.2630 0.1608  -0.2457 0.5239  226 GLN A NE2 
1606 N N   . LYS A 227 ? 1.5177 2.0328 2.8407 -0.0300 -0.3097 0.2369  227 LYS A N   
1607 C CA  . LYS A 227 ? 1.6442 2.1109 2.8933 -0.0587 -0.3032 0.1651  227 LYS A CA  
1608 C C   . LYS A 227 ? 1.6874 2.1368 2.8292 -0.0842 -0.3025 0.1566  227 LYS A C   
1609 O O   . LYS A 227 ? 1.6780 2.0622 2.7725 -0.0971 -0.2856 0.1110  227 LYS A O   
1610 C CB  . LYS A 227 ? 1.6940 2.2054 2.9305 -0.0764 -0.3180 0.1331  227 LYS A CB  
1611 C CG  . LYS A 227 ? 1.7481 2.2588 3.0838 -0.0531 -0.3123 0.1250  227 LYS A CG  
1612 C CD  . LYS A 227 ? 1.7972 2.2242 3.1694 -0.0389 -0.2851 0.0873  227 LYS A CD  
1613 C CE  . LYS A 227 ? 1.7862 2.2134 3.2613 -0.0148 -0.2765 0.0773  227 LYS A CE  
1614 N NZ  . LYS A 227 ? 1.7202 2.0764 3.2332 -0.0022 -0.2505 0.0370  227 LYS A NZ  
1615 N N   . GLU A 228 ? 1.6377 2.1507 2.7422 -0.0901 -0.3196 0.2019  228 GLU A N   
1616 C CA  . GLU A 228 ? 1.5590 2.0596 2.5677 -0.1111 -0.3168 0.2003  228 GLU A CA  
1617 C C   . GLU A 228 ? 1.4276 1.8564 2.4591 -0.0912 -0.2932 0.2165  228 GLU A C   
1618 O O   . GLU A 228 ? 1.4161 1.7933 2.3804 -0.1068 -0.2792 0.1904  228 GLU A O   
1619 C CB  . GLU A 228 ? 1.6200 2.2170 2.5926 -0.1172 -0.3406 0.2498  228 GLU A CB  
1620 C CG  . GLU A 228 ? 1.6651 2.3427 2.6061 -0.1437 -0.3652 0.2281  228 GLU A CG  
1621 C CD  . GLU A 228 ? 1.6935 2.3407 2.5398 -0.1867 -0.3588 0.1587  228 GLU A CD  
1622 O OE1 . GLU A 228 ? 1.6760 2.2489 2.4715 -0.1948 -0.3373 0.1356  228 GLU A OE1 
1623 O OE2 . GLU A 228 ? 1.7318 2.4300 2.5594 -0.2122 -0.3727 0.1283  228 GLU A OE2 
1624 N N   . VAL A 229 ? 1.3056 1.7320 2.4384 -0.0567 -0.2864 0.2598  229 VAL A N   
1625 C CA  . VAL A 229 ? 1.2319 1.5910 2.4088 -0.0369 -0.2612 0.2731  229 VAL A CA  
1626 C C   . VAL A 229 ? 1.2998 1.5815 2.4924 -0.0408 -0.2423 0.2071  229 VAL A C   
1627 O O   . VAL A 229 ? 1.3310 1.5538 2.5018 -0.0437 -0.2241 0.1892  229 VAL A O   
1628 C CB  . VAL A 229 ? 1.1053 1.4830 2.4001 0.0010  -0.2540 0.3363  229 VAL A CB  
1629 C CG1 . VAL A 229 ? 1.0784 1.3786 2.4355 0.0183  -0.2234 0.3364  229 VAL A CG1 
1630 C CG2 . VAL A 229 ? 1.1262 1.5852 2.4042 0.0104  -0.2695 0.4120  229 VAL A CG2 
1631 N N   . HIS A 230 ? 1.3230 1.6114 2.5537 -0.0400 -0.2465 0.1722  230 HIS A N   
1632 C CA  . HIS A 230 ? 1.3561 1.5863 2.5994 -0.0421 -0.2302 0.1093  230 HIS A CA  
1633 C C   . HIS A 230 ? 1.3252 1.5227 2.4612 -0.0691 -0.2251 0.0660  230 HIS A C   
1634 O O   . HIS A 230 ? 1.2879 1.4314 2.4197 -0.0681 -0.2069 0.0312  230 HIS A O   
1635 C CB  . HIS A 230 ? 1.4179 1.6727 2.7084 -0.0379 -0.2368 0.0821  230 HIS A CB  
1636 C CG  . HIS A 230 ? 1.4624 1.6701 2.7663 -0.0373 -0.2204 0.0193  230 HIS A CG  
1637 N ND1 . HIS A 230 ? 1.4632 1.6428 2.8618 -0.0152 -0.2038 0.0050  230 HIS A ND1 
1638 C CD2 . HIS A 230 ? 1.4713 1.6607 2.7073 -0.0552 -0.2163 -0.0323 230 HIS A CD2 
1639 C CE1 . HIS A 230 ? 1.4289 1.5822 2.8122 -0.0198 -0.1933 -0.0542 230 HIS A CE1 
1640 N NE2 . HIS A 230 ? 1.4334 1.5918 2.7191 -0.0419 -0.2001 -0.0739 230 HIS A NE2 
1641 N N   . ALA A 231 ? 1.3193 1.5534 2.3724 -0.0934 -0.2397 0.0680  231 ALA A N   
1642 C CA  . ALA A 231 ? 1.2764 1.4794 2.2297 -0.1200 -0.2307 0.0304  231 ALA A CA  
1643 C C   . ALA A 231 ? 1.2759 1.4466 2.1882 -0.1210 -0.2193 0.0518  231 ALA A C   
1644 O O   . ALA A 231 ? 1.3180 1.4383 2.1812 -0.1303 -0.2014 0.0207  231 ALA A O   
1645 C CB  . ALA A 231 ? 1.3260 1.5787 2.2123 -0.1485 -0.2463 0.0211  231 ALA A CB  
1646 N N   . ALA A 232 ? 1.2443 1.4473 2.1787 -0.1095 -0.2279 0.1083  232 ALA A N   
1647 C CA  . ALA A 232 ? 1.2055 1.3819 2.1092 -0.1073 -0.2158 0.1358  232 ALA A CA  
1648 C C   . ALA A 232 ? 1.1285 1.2407 2.0941 -0.0880 -0.1933 0.1253  232 ALA A C   
1649 O O   . ALA A 232 ? 1.0938 1.1608 2.0177 -0.0941 -0.1768 0.1124  232 ALA A O   
1650 C CB  . ALA A 232 ? 1.2081 1.4426 2.1295 -0.0948 -0.2287 0.2048  232 ALA A CB  
1651 N N   . LYS A 233 ? 1.0887 1.2001 2.1571 -0.0656 -0.1915 0.1286  233 LYS A N   
1652 C CA  . LYS A 233 ? 1.0581 1.1166 2.1973 -0.0498 -0.1702 0.1097  233 LYS A CA  
1653 C C   . LYS A 233 ? 1.0503 1.0710 2.1460 -0.0626 -0.1603 0.0444  233 LYS A C   
1654 O O   . LYS A 233 ? 1.0296 1.0086 2.1197 -0.0620 -0.1433 0.0282  233 LYS A O   
1655 C CB  . LYS A 233 ? 1.0233 1.0925 2.2831 -0.0262 -0.1684 0.1183  233 LYS A CB  
1656 C CG  . LYS A 233 ? 1.0308 1.0510 2.3728 -0.0131 -0.1452 0.0892  233 LYS A CG  
1657 C CD  . LYS A 233 ? 1.1073 1.1371 2.5724 0.0087  -0.1395 0.0942  233 LYS A CD  
1658 C CE  . LYS A 233 ? 1.1759 1.1608 2.7262 0.0175  -0.1146 0.0558  233 LYS A CE  
1659 N NZ  . LYS A 233 ? 1.2312 1.2212 2.9078 0.0375  -0.1037 0.0564  233 LYS A NZ  
1660 N N   . SER A 234 ? 1.0783 1.1181 2.1461 -0.0728 -0.1699 0.0099  234 SER A N   
1661 C CA  . SER A 234 ? 1.1236 1.1362 2.1466 -0.0823 -0.1591 -0.0455 234 SER A CA  
1662 C C   . SER A 234 ? 1.1025 1.0878 2.0303 -0.0995 -0.1486 -0.0478 234 SER A C   
1663 O O   . SER A 234 ? 1.2161 1.1679 2.1226 -0.0995 -0.1321 -0.0789 234 SER A O   
1664 C CB  . SER A 234 ? 1.2496 1.2913 2.2536 -0.0912 -0.1692 -0.0725 234 SER A CB  
1665 O OG  . SER A 234 ? 1.3233 1.3886 2.4172 -0.0740 -0.1762 -0.0731 234 SER A OG  
1666 N N   . ALA A 235 ? 0.9820 0.9869 1.8539 -0.1134 -0.1575 -0.0146 235 ALA A N   
1667 C CA  . ALA A 235 ? 0.9656 0.9455 1.7483 -0.1305 -0.1454 -0.0150 235 ALA A CA  
1668 C C   . ALA A 235 ? 0.9650 0.9094 1.7701 -0.1178 -0.1305 0.0050  235 ALA A C   
1669 O O   . ALA A 235 ? 1.0110 0.9186 1.7683 -0.1239 -0.1126 -0.0121 235 ALA A O   
1670 C CB  . ALA A 235 ? 1.0004 1.0200 1.7206 -0.1498 -0.1593 0.0111  235 ALA A CB  
1671 N N   . ALA A 236 ? 0.9087 0.8647 1.7921 -0.0992 -0.1353 0.0431  236 ALA A N   
1672 C CA  . ALA A 236 ? 0.8731 0.7965 1.7945 -0.0865 -0.1188 0.0640  236 ALA A CA  
1673 C C   . ALA A 236 ? 0.9339 0.8207 1.8936 -0.0798 -0.1029 0.0180  236 ALA A C   
1674 O O   . ALA A 236 ? 0.9474 0.8023 1.8974 -0.0792 -0.0863 0.0155  236 ALA A O   
1675 C CB  . ALA A 236 ? 0.8195 0.7629 1.8315 -0.0661 -0.1226 0.1147  236 ALA A CB  
1676 N N   . ILE A 237 ? 0.9987 0.8967 2.0019 -0.0744 -0.1082 -0.0188 237 ILE A N   
1677 C CA  . ILE A 237 ? 1.0586 0.9376 2.0985 -0.0673 -0.0955 -0.0665 237 ILE A CA  
1678 C C   . ILE A 237 ? 1.0683 0.9311 2.0187 -0.0790 -0.0853 -0.0964 237 ILE A C   
1679 O O   . ILE A 237 ? 1.0382 0.8864 2.0005 -0.0736 -0.0719 -0.1245 237 ILE A O   
1680 C CB  . ILE A 237 ? 1.1020 1.0041 2.2061 -0.0580 -0.1030 -0.0992 237 ILE A CB  
1681 C CG1 . ILE A 237 ? 1.1098 1.0281 2.3054 -0.0451 -0.1100 -0.0656 237 ILE A CG1 
1682 C CG2 . ILE A 237 ? 1.0739 0.9678 2.2208 -0.0500 -0.0902 -0.1496 237 ILE A CG2 
1683 C CD1 . ILE A 237 ? 1.0251 0.9652 2.2895 -0.0352 -0.1149 -0.0964 237 ILE A CD1 
1684 N N   . ILE A 238 ? 1.1288 0.9975 1.9936 -0.0949 -0.0900 -0.0903 238 ILE A N   
1685 C CA  . ILE A 238 ? 1.2432 1.0923 2.0244 -0.1059 -0.0748 -0.1132 238 ILE A CA  
1686 C C   . ILE A 238 ? 1.3023 1.1207 2.0443 -0.1098 -0.0594 -0.0927 238 ILE A C   
1687 O O   . ILE A 238 ? 1.2895 1.0876 2.0172 -0.1055 -0.0420 -0.1115 238 ILE A O   
1688 C CB  . ILE A 238 ? 1.3366 1.1982 2.0457 -0.1250 -0.0797 -0.1161 238 ILE A CB  
1689 C CG1 . ILE A 238 ? 1.4328 1.3269 2.1824 -0.1213 -0.0943 -0.1341 238 ILE A CG1 
1690 C CG2 . ILE A 238 ? 1.3639 1.1993 1.9961 -0.1347 -0.0568 -0.1385 238 ILE A CG2 
1691 C CD1 . ILE A 238 ? 1.5215 1.4338 2.2138 -0.1420 -0.1002 -0.1373 238 ILE A CD1 
1692 N N   . ALA A 239 ? 1.3458 1.1667 2.0708 -0.1166 -0.0655 -0.0521 239 ALA A N   
1693 C CA  . ALA A 239 ? 1.3665 1.1609 2.0541 -0.1200 -0.0504 -0.0280 239 ALA A CA  
1694 C C   . ALA A 239 ? 1.3085 1.0852 2.0709 -0.1030 -0.0403 -0.0250 239 ALA A C   
1695 O O   . ALA A 239 ? 1.3249 1.0754 2.0634 -0.1032 -0.0223 -0.0237 239 ALA A O   
1696 C CB  . ALA A 239 ? 1.4395 1.2526 2.0986 -0.1281 -0.0605 0.0170  239 ALA A CB  
1697 N N   . GLY A 240 ? 1.2767 1.0687 2.1342 -0.0894 -0.0498 -0.0259 240 GLY A N   
1698 C CA  . GLY A 240 ? 1.2494 1.0277 2.1928 -0.0761 -0.0388 -0.0298 240 GLY A CA  
1699 C C   . GLY A 240 ? 1.2151 0.9859 2.1568 -0.0739 -0.0267 -0.0769 240 GLY A C   
1700 O O   . GLY A 240 ? 1.2204 0.9750 2.1849 -0.0705 -0.0120 -0.0778 240 GLY A O   
1701 N N   . LEU A 241 ? 1.2053 0.9938 2.1218 -0.0748 -0.0323 -0.1141 241 LEU A N   
1702 C CA  . LEU A 241 ? 1.2152 1.0101 2.1261 -0.0693 -0.0216 -0.1560 241 LEU A CA  
1703 C C   . LEU A 241 ? 1.2906 1.0628 2.1202 -0.0750 -0.0038 -0.1471 241 LEU A C   
1704 O O   . LEU A 241 ? 1.3562 1.1318 2.1948 -0.0679 0.0089  -0.1661 241 LEU A O   
1705 C CB  . LEU A 241 ? 1.2214 1.0440 2.1201 -0.0664 -0.0294 -0.1905 241 LEU A CB  
1706 C CG  . LEU A 241 ? 1.2956 1.1442 2.2812 -0.0582 -0.0433 -0.2098 241 LEU A CG  
1707 C CD1 . LEU A 241 ? 1.3569 1.2337 2.3205 -0.0549 -0.0483 -0.2421 241 LEU A CD1 
1708 C CD2 . LEU A 241 ? 1.2314 1.0880 2.3093 -0.0489 -0.0375 -0.2345 241 LEU A CD2 
1709 N N   . PHE A 242 ? 1.2595 1.0132 2.0118 -0.0879 -0.0017 -0.1196 242 PHE A N   
1710 C CA  . PHE A 242 ? 1.2020 0.9290 1.8770 -0.0945 0.0192  -0.1099 242 PHE A CA  
1711 C C   . PHE A 242 ? 1.1418 0.8518 1.8479 -0.0892 0.0309  -0.0921 242 PHE A C   
1712 O O   . PHE A 242 ? 1.1368 0.8444 1.8418 -0.0822 0.0464  -0.1069 242 PHE A O   
1713 C CB  . PHE A 242 ? 1.2172 0.9305 1.8132 -0.1126 0.0192  -0.0866 242 PHE A CB  
1714 C CG  . PHE A 242 ? 1.2471 0.9294 1.7637 -0.1210 0.0447  -0.0797 242 PHE A CG  
1715 C CD1 . PHE A 242 ? 1.2953 0.9679 1.7542 -0.1255 0.0623  -0.1015 242 PHE A CD1 
1716 C CD2 . PHE A 242 ? 1.2525 0.9141 1.7558 -0.1234 0.0548  -0.0498 242 PHE A CD2 
1717 C CE1 . PHE A 242 ? 1.3201 0.9606 1.7120 -0.1324 0.0907  -0.0951 242 PHE A CE1 
1718 C CE2 . PHE A 242 ? 1.3202 0.9521 1.7521 -0.1308 0.0809  -0.0448 242 PHE A CE2 
1719 C CZ  . PHE A 242 ? 1.3316 0.9516 1.7089 -0.1355 0.0994  -0.0683 242 PHE A CZ  
1720 N N   . ALA A 243 ? 1.0642 0.7670 1.8011 -0.0912 0.0247  -0.0574 243 ALA A N   
1721 C CA  . ALA A 243 ? 1.0127 0.6985 1.7887 -0.0861 0.0376  -0.0358 243 ALA A CA  
1722 C C   . ALA A 243 ? 1.1376 0.8372 1.9993 -0.0749 0.0410  -0.0690 243 ALA A C   
1723 O O   . ALA A 243 ? 1.2053 0.8962 2.0768 -0.0719 0.0570  -0.0711 243 ALA A O   
1724 C CB  . ALA A 243 ? 0.8597 0.5439 1.6737 -0.0854 0.0302  0.0087  243 ALA A CB  
1725 N N   . LEU A 244 ? 1.1397 0.8652 2.0644 -0.0695 0.0263  -0.0975 244 LEU A N   
1726 C CA  . LEU A 244 ? 1.1294 0.8777 2.1404 -0.0612 0.0282  -0.1375 244 LEU A CA  
1727 C C   . LEU A 244 ? 1.0578 0.8330 2.0282 -0.0558 0.0364  -0.1712 244 LEU A C   
1728 O O   . LEU A 244 ? 0.9181 0.7177 1.9454 -0.0505 0.0414  -0.2016 244 LEU A O   
1729 C CB  . LEU A 244 ? 1.1263 0.8989 2.2072 -0.0570 0.0123  -0.1627 244 LEU A CB  
1730 C CG  . LEU A 244 ? 1.0787 0.8835 2.2606 -0.0502 0.0144  -0.2100 244 LEU A CG  
1731 C CD1 . LEU A 244 ? 1.1502 0.9361 2.4105 -0.0515 0.0292  -0.1969 244 LEU A CD1 
1732 C CD2 . LEU A 244 ? 0.9578 0.7800 2.2025 -0.0468 0.0014  -0.2324 244 LEU A CD2 
1733 N N   . CYS A 245 ? 1.1414 0.9109 2.0168 -0.0582 0.0397  -0.1658 245 CYS A N   
1734 C CA  . CYS A 245 ? 1.1983 0.9886 2.0322 -0.0506 0.0508  -0.1902 245 CYS A CA  
1735 C C   . CYS A 245 ? 1.2229 0.9823 1.9850 -0.0531 0.0732  -0.1639 245 CYS A C   
1736 O O   . CYS A 245 ? 1.2072 0.9717 1.9187 -0.0467 0.0873  -0.1728 245 CYS A O   
1737 C CB  . CYS A 245 ? 1.2502 1.0582 2.0408 -0.0482 0.0446  -0.2074 245 CYS A CB  
1738 S SG  . CYS A 245 ? 1.5350 1.3861 2.4061 -0.0421 0.0221  -0.2454 245 CYS A SG  
1739 N N   . TRP A 246 ? 1.2928 1.0185 2.0523 -0.0610 0.0791  -0.1296 246 TRP A N   
1740 C CA  . TRP A 246 ? 1.3588 1.0532 2.0522 -0.0640 0.1024  -0.1043 246 TRP A CA  
1741 C C   . TRP A 246 ? 1.2971 0.9757 2.0348 -0.0644 0.1112  -0.0819 246 TRP A C   
1742 O O   . TRP A 246 ? 1.2340 0.9025 1.9505 -0.0610 0.1314  -0.0739 246 TRP A O   
1743 C CB  . TRP A 246 ? 1.4262 1.0866 2.0321 -0.0777 0.1067  -0.0809 246 TRP A CB  
1744 C CG  . TRP A 246 ? 1.5107 1.1792 2.0623 -0.0782 0.1099  -0.1007 246 TRP A CG  
1745 C CD1 . TRP A 246 ? 1.5674 1.2554 2.1285 -0.0805 0.0914  -0.1179 246 TRP A CD1 
1746 C CD2 . TRP A 246 ? 1.5919 1.2469 2.0770 -0.0755 0.1371  -0.1029 246 TRP A CD2 
1747 N NE1 . TRP A 246 ? 1.6111 1.2994 2.1161 -0.0800 0.1053  -0.1308 246 TRP A NE1 
1748 C CE2 . TRP A 246 ? 1.6429 1.3092 2.1021 -0.0766 0.1348  -0.1212 246 TRP A CE2 
1749 C CE3 . TRP A 246 ? 1.5839 1.2164 2.0332 -0.0713 0.1661  -0.0893 246 TRP A CE3 
1750 C CZ2 . TRP A 246 ? 1.6633 1.3164 2.0654 -0.0734 0.1627  -0.1249 246 TRP A CZ2 
1751 C CZ3 . TRP A 246 ? 1.6036 1.2229 1.9955 -0.0673 0.1934  -0.0929 246 TRP A CZ3 
1752 C CH2 . TRP A 246 ? 1.6437 1.2719 2.0139 -0.0683 0.1927  -0.1100 246 TRP A CH2 
1753 N N   . LEU A 247 ? 1.2830 0.9577 2.0863 -0.0674 0.0988  -0.0691 247 LEU A N   
1754 C CA  . LEU A 247 ? 1.3164 0.9750 2.1739 -0.0671 0.1098  -0.0447 247 LEU A CA  
1755 C C   . LEU A 247 ? 1.2937 0.9734 2.2031 -0.0604 0.1215  -0.0700 247 LEU A C   
1756 O O   . LEU A 247 ? 1.3276 0.9893 2.2302 -0.0604 0.1403  -0.0484 247 LEU A O   
1757 C CB  . LEU A 247 ? 1.3036 0.9588 2.2462 -0.0678 0.0976  -0.0313 247 LEU A CB  
1758 C CG  . LEU A 247 ? 1.2685 0.9065 2.1698 -0.0729 0.0894  0.0111  247 LEU A CG  
1759 C CD1 . LEU A 247 ? 1.2419 0.8827 2.2426 -0.0676 0.0833  0.0309  247 LEU A CD1 
1760 C CD2 . LEU A 247 ? 1.2917 0.9019 2.1142 -0.0781 0.1061  0.0521  247 LEU A CD2 
1761 N N   . PRO A 248 ? 1.2461 0.9657 2.2082 -0.0555 0.1104  -0.1171 248 PRO A N   
1762 C CA  . PRO A 248 ? 1.2302 0.9846 2.2430 -0.0500 0.1187  -0.1462 248 PRO A CA  
1763 C C   . PRO A 248 ? 1.3286 1.0770 2.2678 -0.0448 0.1389  -0.1293 248 PRO A C   
1764 O O   . PRO A 248 ? 1.3892 1.1369 2.3594 -0.0444 0.1537  -0.1203 248 PRO A O   
1765 C CB  . PRO A 248 ? 1.1528 0.9626 2.1907 -0.0437 0.1025  -0.1978 248 PRO A CB  
1766 C CG  . PRO A 248 ? 1.1680 0.9648 2.2236 -0.0481 0.0856  -0.1981 248 PRO A CG  
1767 C CD  . PRO A 248 ? 1.2310 0.9772 2.2107 -0.0539 0.0897  -0.1468 248 PRO A CD  
1768 N N   . LEU A 249 ? 1.3002 1.0431 2.1482 -0.0408 0.1425  -0.1245 249 LEU A N   
1769 C CA  . LEU A 249 ? 1.2004 0.9351 1.9795 -0.0337 0.1664  -0.1079 249 LEU A CA  
1770 C C   . LEU A 249 ? 1.2272 0.9073 1.9695 -0.0416 0.1859  -0.0643 249 LEU A C   
1771 O O   . LEU A 249 ? 1.2378 0.9139 1.9661 -0.0361 0.2077  -0.0507 249 LEU A O   
1772 C CB  . LEU A 249 ? 1.1150 0.8482 1.8118 -0.0286 0.1711  -0.1109 249 LEU A CB  
1773 C CG  . LEU A 249 ? 1.0189 0.7461 1.6510 -0.0177 0.2009  -0.0954 249 LEU A CG  
1774 C CD1 . LEU A 249 ? 1.0296 0.8135 1.7128 -0.0018 0.2059  -0.1102 249 LEU A CD1 
1775 C CD2 . LEU A 249 ? 0.9935 0.7198 1.5607 -0.0122 0.2082  -0.1005 249 LEU A CD2 
1776 N N   . HIS A 250 ? 1.2981 0.9417 2.0244 -0.0534 0.1784  -0.0413 250 HIS A N   
1777 C CA  . HIS A 250 ? 1.3151 0.9183 2.0027 -0.0599 0.1955  0.0008  250 HIS A CA  
1778 C C   . HIS A 250 ? 1.1619 0.7647 1.9308 -0.0585 0.2022  0.0148  250 HIS A C   
1779 O O   . HIS A 250 ? 1.1064 0.6885 1.8540 -0.0576 0.2250  0.0406  250 HIS A O   
1780 C CB  . HIS A 250 ? 1.4426 1.0238 2.0902 -0.0710 0.1833  0.0219  250 HIS A CB  
1781 C CG  . HIS A 250 ? 1.4798 1.0500 2.0363 -0.0776 0.1848  0.0137  250 HIS A CG  
1782 N ND1 . HIS A 250 ? 1.5413 1.0775 2.0088 -0.0848 0.2087  0.0306  250 HIS A ND1 
1783 C CD2 . HIS A 250 ? 1.4695 1.0568 2.0146 -0.0793 0.1682  -0.0113 250 HIS A CD2 
1784 C CE1 . HIS A 250 ? 1.5693 1.1003 1.9782 -0.0922 0.2079  0.0147  250 HIS A CE1 
1785 N NE2 . HIS A 250 ? 1.5376 1.1003 1.9916 -0.0883 0.1830  -0.0090 250 HIS A NE2 
1786 N N   . ILE A 251 ? 1.1004 0.7249 1.9664 -0.0587 0.1853  -0.0031 251 ILE A N   
1787 C CA  . ILE A 251 ? 1.1229 0.7473 2.0836 -0.0589 0.1942  0.0044  251 ILE A CA  
1788 C C   . ILE A 251 ? 1.2080 0.8558 2.1862 -0.0536 0.2098  -0.0126 251 ILE A C   
1789 O O   . ILE A 251 ? 1.2892 0.9229 2.2971 -0.0542 0.2289  0.0100  251 ILE A O   
1790 C CB  . ILE A 251 ? 1.0875 0.7348 2.1588 -0.0608 0.1770  -0.0241 251 ILE A CB  
1791 C CG1 . ILE A 251 ? 1.0896 0.7195 2.1553 -0.0626 0.1644  0.0025  251 ILE A CG1 
1792 C CG2 . ILE A 251 ? 1.0917 0.7426 2.2723 -0.0627 0.1912  -0.0255 251 ILE A CG2 
1793 C CD1 . ILE A 251 ? 1.1122 0.7589 2.2896 -0.0628 0.1521  -0.0213 251 ILE A CD1 
1794 N N   . ILE A 252 ? 1.1863 0.8763 2.1473 -0.0467 0.2024  -0.0498 252 ILE A N   
1795 C CA  . ILE A 252 ? 1.1688 0.8957 2.1392 -0.0381 0.2157  -0.0639 252 ILE A CA  
1796 C C   . ILE A 252 ? 1.2683 0.9557 2.1622 -0.0348 0.2438  -0.0218 252 ILE A C   
1797 O O   . ILE A 252 ? 1.3815 1.0760 2.3080 -0.0322 0.2610  -0.0120 252 ILE A O   
1798 C CB  . ILE A 252 ? 1.1244 0.9071 2.0718 -0.0269 0.2047  -0.1014 252 ILE A CB  
1799 C CG1 . ILE A 252 ? 1.0739 0.9090 2.1106 -0.0297 0.1800  -0.1513 252 ILE A CG1 
1800 C CG2 . ILE A 252 ? 1.1521 0.9728 2.0867 -0.0137 0.2224  -0.1018 252 ILE A CG2 
1801 C CD1 . ILE A 252 ? 1.0578 0.9598 2.0771 -0.0168 0.1688  -0.1889 252 ILE A CD1 
1802 N N   . ASN A 253 ? 1.2750 0.9221 2.0701 -0.0363 0.2499  0.0003  253 ASN A N   
1803 C CA  . ASN A 253 ? 1.3893 0.9936 2.1070 -0.0355 0.2793  0.0369  253 ASN A CA  
1804 C C   . ASN A 253 ? 1.4481 1.0189 2.1930 -0.0424 0.2917  0.0721  253 ASN A C   
1805 O O   . ASN A 253 ? 1.5526 1.1034 2.2702 -0.0392 0.3187  0.0971  253 ASN A O   
1806 C CB  . ASN A 253 ? 1.5387 1.1063 2.1540 -0.0411 0.2831  0.0468  253 ASN A CB  
1807 C CG  . ASN A 253 ? 1.6457 1.2403 2.2284 -0.0319 0.2805  0.0196  253 ASN A CG  
1808 O OD1 . ASN A 253 ? 1.6129 1.2570 2.2365 -0.0181 0.2790  -0.0012 253 ASN A OD1 
1809 N ND2 . ASN A 253 ? 1.7674 1.3349 2.2777 -0.0394 0.2809  0.0203  253 ASN A ND2 
1810 N N   . CYS A 254 ? 1.4417 1.0075 2.2431 -0.0500 0.2747  0.0768  254 CYS A N   
1811 C CA  . CYS A 254 ? 1.4832 1.0283 2.3212 -0.0525 0.2875  0.1139  254 CYS A CA  
1812 C C   . CYS A 254 ? 1.4288 0.9917 2.3700 -0.0508 0.2974  0.1044  254 CYS A C   
1813 O O   . CYS A 254 ? 1.4939 1.0374 2.4564 -0.0505 0.3191  0.1369  254 CYS A O   
1814 C CB  . CYS A 254 ? 1.5691 1.1079 2.4388 -0.0574 0.2692  0.1275  254 CYS A CB  
1815 S SG  . CYS A 254 ? 1.3111 0.8301 2.0657 -0.0637 0.2562  0.1409  254 CYS A SG  
1816 N N   . PHE A 255 ? 1.3912 1.0043 2.3971 -0.0488 0.2817  0.0567  255 PHE A N   
1817 C CA  . PHE A 255 ? 1.4331 1.0840 2.5391 -0.0486 0.2887  0.0351  255 PHE A CA  
1818 C C   . PHE A 255 ? 1.4161 1.0783 2.4812 -0.0399 0.3111  0.0456  255 PHE A C   
1819 O O   . PHE A 255 ? 1.4118 1.0682 2.5206 -0.0408 0.3316  0.0647  255 PHE A O   
1820 C CB  . PHE A 255 ? 1.4207 1.1335 2.5982 -0.0497 0.2644  -0.0248 255 PHE A CB  
1821 C CG  . PHE A 255 ? 1.4280 1.1406 2.7145 -0.0599 0.2541  -0.0422 255 PHE A CG  
1822 C CD1 . PHE A 255 ? 1.4958 1.1563 2.7795 -0.0633 0.2550  -0.0045 255 PHE A CD1 
1823 C CD2 . PHE A 255 ? 1.3744 1.1434 2.7689 -0.0656 0.2454  -0.0968 255 PHE A CD2 
1824 C CE1 . PHE A 255 ? 1.4770 1.1350 2.8679 -0.0698 0.2506  -0.0157 255 PHE A CE1 
1825 C CE2 . PHE A 255 ? 1.3543 1.1181 2.8565 -0.0757 0.2415  -0.1156 255 PHE A CE2 
1826 C CZ  . PHE A 255 ? 1.3949 1.0998 2.8973 -0.0766 0.2457  -0.0724 255 PHE A CZ  
1827 N N   . THR A 256 ? 1.3103 0.9888 2.2955 -0.0302 0.3097  0.0355  256 THR A N   
1828 C CA  . THR A 256 ? 1.2512 0.9419 2.1944 -0.0181 0.3336  0.0483  256 THR A CA  
1829 C C   . THR A 256 ? 1.3948 1.0215 2.2778 -0.0194 0.3641  0.0991  256 THR A C   
1830 O O   . THR A 256 ? 1.5768 1.2078 2.4699 -0.0131 0.3882  0.1163  256 THR A O   
1831 C CB  . THR A 256 ? 1.0926 0.8049 1.9591 -0.0053 0.3313  0.0348  256 THR A CB  
1832 O OG1 . THR A 256 ? 0.9818 0.7652 1.9043 -0.0015 0.3049  -0.0122 256 THR A OG1 
1833 C CG2 . THR A 256 ? 1.0947 0.8147 1.9186 0.0103  0.3618  0.0559  256 THR A CG2 
1834 N N   . PHE A 257 ? 1.3124 0.8856 2.1334 -0.0276 0.3628  0.1220  257 PHE A N   
1835 C CA  . PHE A 257 ? 1.3262 0.8436 2.0773 -0.0299 0.3906  0.1667  257 PHE A CA  
1836 C C   . PHE A 257 ? 1.3409 0.8453 2.1580 -0.0338 0.4015  0.1957  257 PHE A C   
1837 O O   . PHE A 257 ? 1.4597 0.9585 2.2919 -0.0293 0.4276  0.2156  257 PHE A O   
1838 C CB  . PHE A 257 ? 1.3630 0.8536 2.0231 -0.0358 0.3831  0.1742  257 PHE A CB  
1839 C CG  . PHE A 257 ? 1.3827 0.8355 1.9577 -0.0364 0.4110  0.2084  257 PHE A CG  
1840 C CD1 . PHE A 257 ? 1.3953 0.8306 1.9817 -0.0404 0.4160  0.2423  257 PHE A CD1 
1841 C CD2 . PHE A 257 ? 1.3800 0.8134 1.8654 -0.0328 0.4352  0.2068  257 PHE A CD2 
1842 C CE1 . PHE A 257 ? 1.4587 0.8606 1.9631 -0.0419 0.4416  0.2719  257 PHE A CE1 
1843 C CE2 . PHE A 257 ? 1.4436 0.8400 1.8513 -0.0356 0.4627  0.2315  257 PHE A CE2 
1844 C CZ  . PHE A 257 ? 1.4991 0.8811 1.9133 -0.0409 0.4645  0.2631  257 PHE A CZ  
1845 N N   . PHE A 258 ? 1.3174 0.8196 2.1774 -0.0401 0.3838  0.2008  258 PHE A N   
1846 C CA  . PHE A 258 ? 1.4111 0.8993 2.3321 -0.0410 0.3973  0.2359  258 PHE A CA  
1847 C C   . PHE A 258 ? 1.3733 0.8801 2.4163 -0.0432 0.4058  0.2234  258 PHE A C   
1848 O O   . PHE A 258 ? 1.4355 0.9290 2.5272 -0.0423 0.4279  0.2553  258 PHE A O   
1849 C CB  . PHE A 258 ? 1.5774 1.0591 2.5233 -0.0451 0.3780  0.2479  258 PHE A CB  
1850 C CG  . PHE A 258 ? 1.6779 1.1394 2.5096 -0.0468 0.3709  0.2662  258 PHE A CG  
1851 C CD1 . PHE A 258 ? 1.6484 1.1200 2.4328 -0.0510 0.3464  0.2343  258 PHE A CD1 
1852 C CD2 . PHE A 258 ? 1.7438 1.1774 2.5168 -0.0460 0.3894  0.3143  258 PHE A CD2 
1853 C CE1 . PHE A 258 ? 1.6937 1.1459 2.3788 -0.0569 0.3405  0.2479  258 PHE A CE1 
1854 C CE2 . PHE A 258 ? 1.7537 1.1701 2.4227 -0.0523 0.3824  0.3276  258 PHE A CE2 
1855 C CZ  . PHE A 258 ? 1.7507 1.1754 2.3779 -0.0591 0.3578  0.2931  258 PHE A CZ  
1856 N N   . CYS A 259 ? 0.9812 1.5575 2.4149 0.3165  -0.3885 -0.3393 259 CYS A N   
1857 C CA  . CYS A 259 ? 1.0856 1.6030 2.4599 0.3256  -0.4017 -0.3333 259 CYS A CA  
1858 C C   . CYS A 259 ? 1.1725 1.6393 2.5242 0.3192  -0.4154 -0.3375 259 CYS A C   
1859 O O   . CYS A 259 ? 1.2240 1.6648 2.5719 0.3294  -0.4032 -0.3241 259 CYS A O   
1860 C CB  . CYS A 259 ? 1.0186 1.5258 2.3914 0.3508  -0.3795 -0.3174 259 CYS A CB  
1861 S SG  . CYS A 259 ? 2.1270 2.5671 3.4201 0.3620  -0.3905 -0.3080 259 CYS A SG  
1862 N N   . PRO A 260 ? 1.1212 1.5754 2.4661 0.3008  -0.4426 -0.3585 260 PRO A N   
1863 C CA  . PRO A 260 ? 1.1740 1.5779 2.5152 0.2925  -0.4675 -0.3650 260 PRO A CA  
1864 C C   . PRO A 260 ? 1.2642 1.6018 2.5426 0.3042  -0.4751 -0.3474 260 PRO A C   
1865 O O   . PRO A 260 ? 1.2965 1.5925 2.5751 0.3026  -0.4886 -0.3329 260 PRO A O   
1866 C CB  . PRO A 260 ? 1.1880 1.5979 2.5408 0.2741  -0.4911 -0.4026 260 PRO A CB  
1867 C CG  . PRO A 260 ? 1.1387 1.6182 2.5167 0.2670  -0.4727 -0.4115 260 PRO A CG  
1868 C CD  . PRO A 260 ? 1.0957 1.5873 2.4477 0.2849  -0.4525 -0.3810 260 PRO A CD  
1869 N N   . ASP A 261 ? 1.3337 1.6609 2.5576 0.3136  -0.4691 -0.3455 261 ASP A N   
1870 C CA  . ASP A 261 ? 1.4225 1.6863 2.5770 0.3241  -0.4707 -0.3299 261 ASP A CA  
1871 C C   . ASP A 261 ? 1.4183 1.6753 2.5678 0.3435  -0.4355 -0.3016 261 ASP A C   
1872 O O   . ASP A 261 ? 1.4143 1.6154 2.5128 0.3508  -0.4289 -0.2851 261 ASP A O   
1873 C CB  . ASP A 261 ? 1.5041 1.7576 2.5973 0.3242  -0.4800 -0.3432 261 ASP A CB  
1874 C CG  . ASP A 261 ? 1.6003 1.9041 2.7038 0.3314  -0.4651 -0.3381 261 ASP A CG  
1875 O OD1 . ASP A 261 ? 1.6392 1.9902 2.8045 0.3351  -0.4481 -0.3304 261 ASP A OD1 
1876 O OD2 . ASP A 261 ? 1.6160 1.9111 2.6676 0.3325  -0.4739 -0.3412 261 ASP A OD2 
1877 N N   . CYS A 262 ? 1.4016 1.7152 2.6076 0.3509  -0.4100 -0.3007 262 CYS A N   
1878 C CA  . CYS A 262 ? 1.3613 1.6764 2.5807 0.3652  -0.3701 -0.2892 262 CYS A CA  
1879 C C   . CYS A 262 ? 1.3323 1.5871 2.5089 0.3262  -0.3586 -0.2834 262 CYS A C   
1880 O O   . CYS A 262 ? 1.4176 1.6781 2.6197 0.3075  -0.3797 -0.2862 262 CYS A O   
1881 C CB  . CYS A 262 ? 1.3417 1.7311 2.6364 0.3758  -0.3481 -0.2980 262 CYS A CB  
1882 S SG  . CYS A 262 ? 1.4043 1.8109 2.6964 0.3902  -0.3482 -0.2970 262 CYS A SG  
1883 N N   . SER A 263 ? 1.1670 1.3660 2.2796 0.3078  -0.3268 -0.2753 263 SER A N   
1884 C CA  . SER A 263 ? 1.1180 1.2552 2.1743 0.2557  -0.3188 -0.2656 263 SER A CA  
1885 C C   . SER A 263 ? 1.2289 1.4004 2.3285 0.2315  -0.3170 -0.2746 263 SER A C   
1886 O O   . SER A 263 ? 1.2742 1.4963 2.4109 0.2315  -0.2788 -0.2925 263 SER A O   
1887 C CB  . SER A 263 ? 1.0161 1.1227 2.0188 0.2308  -0.2688 -0.2662 263 SER A CB  
1888 O OG  . SER A 263 ? 0.9792 1.0611 1.9457 0.2574  -0.2649 -0.2589 263 SER A OG  
1889 N N   . HIS A 264 ? 1.2822 1.4268 2.3829 0.2114  -0.3600 -0.2654 264 HIS A N   
1890 C CA  . HIS A 264 ? 1.2778 1.4458 2.4091 0.1835  -0.3620 -0.2710 264 HIS A CA  
1891 C C   . HIS A 264 ? 1.3106 1.4566 2.3866 0.1318  -0.3196 -0.2732 264 HIS A C   
1892 O O   . HIS A 264 ? 1.3731 1.4467 2.3691 0.0852  -0.3201 -0.2562 264 HIS A O   
1893 C CB  . HIS A 264 ? 1.3040 1.4255 2.4387 0.1606  -0.4207 -0.2578 264 HIS A CB  
1894 C CG  . HIS A 264 ? 1.1919 1.3608 2.4069 0.2015  -0.4577 -0.2723 264 HIS A CG  
1895 N ND1 . HIS A 264 ? 1.0985 1.3650 2.3934 0.2331  -0.4433 -0.2932 264 HIS A ND1 
1896 C CD2 . HIS A 264 ? 1.1289 1.2666 2.3611 0.2085  -0.5084 -0.2739 264 HIS A CD2 
1897 C CE1 . HIS A 264 ? 1.0047 1.3029 2.3590 0.2523  -0.4806 -0.3082 264 HIS A CE1 
1898 N NE2 . HIS A 264 ? 1.0419 1.2644 2.3636 0.2398  -0.5200 -0.3011 264 HIS A NE2 
1899 N N   . ALA A 265 ? 1.2364 1.4498 2.3563 0.1346  -0.2825 -0.2975 265 ALA A N   
1900 C CA  . ALA A 265 ? 1.2029 1.4146 2.2823 0.0829  -0.2354 -0.3152 265 ALA A CA  
1901 C C   . ALA A 265 ? 1.1632 1.2953 2.1507 0.0025  -0.2555 -0.2942 265 ALA A C   
1902 O O   . ALA A 265 ? 1.1287 1.2341 2.1128 -0.0172 -0.3016 -0.2760 265 ALA A O   
1903 C CB  . ALA A 265 ? 1.1509 1.4432 2.2935 0.0912  -0.2067 -0.3458 265 ALA A CB  
1904 N N   . PRO A 266 ? 1.0837 1.1789 2.0003 -0.0496 -0.2234 -0.2966 266 PRO A N   
1905 C CA  . PRO A 266 ? 1.1698 1.1897 1.9879 -0.1430 -0.2410 -0.2737 266 PRO A CA  
1906 C C   . PRO A 266 ? 1.3516 1.3857 2.1568 -0.1990 -0.2471 -0.2837 266 PRO A C   
1907 O O   . PRO A 266 ? 1.3826 1.4939 2.2447 -0.1749 -0.2121 -0.3209 266 PRO A O   
1908 C CB  . PRO A 266 ? 1.0993 1.1209 1.8698 -0.1868 -0.1809 -0.2949 266 PRO A CB  
1909 C CG  . PRO A 266 ? 0.9788 1.0416 1.8144 -0.1020 -0.1543 -0.3103 266 PRO A CG  
1910 C CD  . PRO A 266 ? 0.9489 1.0765 1.8819 -0.0267 -0.1689 -0.3225 266 PRO A CD  
1911 N N   . LEU A 267 ? 1.4991 1.4577 2.2298 -0.2751 -0.2948 -0.2495 267 LEU A N   
1912 C CA  . LEU A 267 ? 1.5988 1.5609 2.3030 -0.3378 -0.3090 -0.2541 267 LEU A CA  
1913 C C   . LEU A 267 ? 1.7340 1.7415 2.3915 -0.4088 -0.2421 -0.2993 267 LEU A C   
1914 O O   . LEU A 267 ? 1.6973 1.7565 2.3685 -0.4243 -0.2235 -0.3303 267 LEU A O   
1915 C CB  . LEU A 267 ? 1.6454 1.5060 2.2809 -0.4100 -0.3873 -0.2013 267 LEU A CB  
1916 C CG  . LEU A 267 ? 1.5917 1.4137 2.2936 -0.3495 -0.4624 -0.1685 267 LEU A CG  
1917 C CD1 . LEU A 267 ? 1.6995 1.4146 2.3423 -0.4286 -0.5456 -0.1172 267 LEU A CD1 
1918 C CD2 . LEU A 267 ? 1.4677 1.3641 2.2656 -0.2864 -0.4622 -0.1933 267 LEU A CD2 
1919 N N   . TRP A 268 ? 1.5306 1.2922 2.0624 -0.3044 -0.2279 -0.3871 268 TRP A N   
1920 C CA  . TRP A 268 ? 1.5961 1.3363 2.1216 -0.2801 -0.2062 -0.3903 268 TRP A CA  
1921 C C   . TRP A 268 ? 1.5706 1.3083 2.1379 -0.2728 -0.1951 -0.3671 268 TRP A C   
1922 O O   . TRP A 268 ? 1.6411 1.3876 2.2184 -0.2555 -0.1781 -0.3527 268 TRP A O   
1923 C CB  . TRP A 268 ? 1.6816 1.3778 2.1750 -0.2742 -0.2038 -0.4215 268 TRP A CB  
1924 C CG  . TRP A 268 ? 1.7880 1.4537 2.2966 -0.2836 -0.2106 -0.4282 268 TRP A CG  
1925 C CD1 . TRP A 268 ? 1.8429 1.5011 2.3462 -0.3040 -0.2301 -0.4407 268 TRP A CD1 
1926 C CD2 . TRP A 268 ? 1.8425 1.4811 2.3745 -0.2729 -0.1977 -0.4227 268 TRP A CD2 
1927 N NE1 . TRP A 268 ? 1.8823 1.5103 2.4039 -0.3068 -0.2303 -0.4434 268 TRP A NE1 
1928 C CE2 . TRP A 268 ? 1.8856 1.5010 2.4250 -0.2878 -0.2105 -0.4325 268 TRP A CE2 
1929 C CE3 . TRP A 268 ? 1.8139 1.4457 2.3617 -0.2520 -0.1764 -0.4102 268 TRP A CE3 
1930 C CZ2 . TRP A 268 ? 1.8698 1.4555 2.4316 -0.2826 -0.2028 -0.4303 268 TRP A CZ2 
1931 C CZ3 . TRP A 268 ? 1.8135 1.4160 2.3839 -0.2467 -0.1686 -0.4078 268 TRP A CZ3 
1932 C CH2 . TRP A 268 ? 1.8247 1.4044 2.4018 -0.2620 -0.1818 -0.4178 268 TRP A CH2 
1933 N N   . LEU A 269 ? 1.4337 1.1595 2.0256 -0.2862 -0.2048 -0.3632 269 LEU A N   
1934 C CA  . LEU A 269 ? 1.2945 1.0185 1.9281 -0.2817 -0.1963 -0.3404 269 LEU A CA  
1935 C C   . LEU A 269 ? 1.1734 0.9418 1.8364 -0.2872 -0.1982 -0.3094 269 LEU A C   
1936 O O   . LEU A 269 ? 1.0899 0.8658 1.7827 -0.2770 -0.1858 -0.2871 269 LEU A O   
1937 C CB  . LEU A 269 ? 1.2339 0.9346 1.8849 -0.2962 -0.2078 -0.3451 269 LEU A CB  
1938 C CG  . LEU A 269 ? 1.2070 0.9041 1.9024 -0.2931 -0.2005 -0.3220 269 LEU A CG  
1939 C CD1 . LEU A 269 ? 1.2861 0.9610 1.9833 -0.2680 -0.1771 -0.3216 269 LEU A CD1 
1940 C CD2 . LEU A 269 ? 1.2304 0.9047 1.9401 -0.3089 -0.2133 -0.3284 269 LEU A CD2 
1941 N N   . MET A 270 ? 1.1167 0.9141 1.7709 -0.3035 -0.2137 -0.3079 270 MET A N   
1942 C CA  . MET A 270 ? 1.0963 0.9369 1.7739 -0.3101 -0.2165 -0.2801 270 MET A CA  
1943 C C   . MET A 270 ? 1.2607 1.1185 1.9305 -0.2905 -0.1994 -0.2710 270 MET A C   
1944 O O   . MET A 270 ? 1.1934 1.0749 1.8913 -0.2859 -0.1919 -0.2446 270 MET A O   
1945 C CB  . MET A 270 ? 0.9867 0.8518 1.6527 -0.3317 -0.2366 -0.2836 270 MET A CB  
1946 C CG  . MET A 270 ? 1.0097 0.9187 1.7000 -0.3411 -0.2410 -0.2553 270 MET A CG  
1947 S SD  . MET A 270 ? 1.5790 1.4939 2.3214 -0.3523 -0.2447 -0.2275 270 MET A SD  
1948 C CE  . MET A 270 ? 0.6109 0.5084 1.3495 -0.3765 -0.2669 -0.2448 270 MET A CE  
1949 N N   . TYR A 271 ? 1.3850 1.2306 2.0161 -0.2791 -0.1936 -0.2931 271 TYR A N   
1950 C CA  . TYR A 271 ? 1.3947 1.2533 2.0142 -0.2594 -0.1769 -0.2877 271 TYR A CA  
1951 C C   . TYR A 271 ? 1.3169 1.1599 1.9590 -0.2399 -0.1570 -0.2755 271 TYR A C   
1952 O O   . TYR A 271 ? 1.3075 1.1745 1.9701 -0.2310 -0.1466 -0.2519 271 TYR A O   
1953 C CB  . TYR A 271 ? 1.5349 1.3775 2.1074 -0.2513 -0.1746 -0.3165 271 TYR A CB  
1954 C CG  . TYR A 271 ? 1.6174 1.4724 2.1747 -0.2311 -0.1577 -0.3129 271 TYR A CG  
1955 C CD1 . TYR A 271 ? 1.6083 1.5020 2.1599 -0.2342 -0.1609 -0.3017 271 TYR A CD1 
1956 C CD2 . TYR A 271 ? 1.6652 1.4928 2.2136 -0.2089 -0.1384 -0.3210 271 TYR A CD2 
1957 C CE1 . TYR A 271 ? 1.5663 1.4715 2.1040 -0.2159 -0.1456 -0.2984 271 TYR A CE1 
1958 C CE2 . TYR A 271 ? 1.6683 1.5071 2.2028 -0.1903 -0.1228 -0.3178 271 TYR A CE2 
1959 C CZ  . TYR A 271 ? 1.6120 1.4898 2.1413 -0.1940 -0.1266 -0.3065 271 TYR A CZ  
1960 O OH  . TYR A 271 ? 1.6186 1.5079 2.1342 -0.1757 -0.1112 -0.3032 271 TYR A OH  
1961 N N   . LEU A 272 ? 1.2525 1.0549 1.8907 -0.2333 -0.1516 -0.2916 272 LEU A N   
1962 C CA  . LEU A 272 ? 1.1672 0.9503 1.8270 -0.2151 -0.1328 -0.2818 272 LEU A CA  
1963 C C   . LEU A 272 ? 1.0896 0.8972 1.7967 -0.2198 -0.1324 -0.2485 272 LEU A C   
1964 O O   . LEU A 272 ? 1.1480 0.9667 1.8731 -0.2046 -0.1168 -0.2296 272 LEU A O   
1965 C CB  . LEU A 272 ? 1.2436 0.9804 1.8973 -0.2136 -0.1318 -0.3027 272 LEU A CB  
1966 C CG  . LEU A 272 ? 1.3377 1.0469 2.0095 -0.1942 -0.1118 -0.2978 272 LEU A CG  
1967 C CD1 . LEU A 272 ? 1.4116 1.0732 2.0608 -0.1903 -0.1096 -0.3267 272 LEU A CD1 
1968 C CD2 . LEU A 272 ? 1.3308 1.0508 2.0519 -0.1995 -0.1123 -0.2696 272 LEU A CD2 
1969 N N   . ALA A 273 ? 1.0681 0.8843 1.7951 -0.2413 -0.1499 -0.2413 273 ALA A N   
1970 C CA  . ALA A 273 ? 1.0528 0.8915 1.8245 -0.2485 -0.1516 -0.2102 273 ALA A CA  
1971 C C   . ALA A 273 ? 1.0513 0.9336 1.8319 -0.2470 -0.1488 -0.1868 273 ALA A C   
1972 O O   . ALA A 273 ? 1.0733 0.9699 1.8847 -0.2391 -0.1384 -0.1615 273 ALA A O   
1973 C CB  . ALA A 273 ? 1.0521 0.8924 1.8385 -0.2732 -0.1722 -0.2092 273 ALA A CB  
1974 N N   . ILE A 274 ? 1.0929 0.9962 1.8467 -0.2549 -0.1581 -0.1952 274 ILE A N   
1975 C CA  . ILE A 274 ? 1.1657 1.1102 1.9240 -0.2542 -0.1560 -0.1752 274 ILE A CA  
1976 C C   . ILE A 274 ? 1.0994 1.0438 1.8515 -0.2290 -0.1344 -0.1709 274 ILE A C   
1977 O O   . ILE A 274 ? 1.1488 1.1208 1.9221 -0.2234 -0.1266 -0.1458 274 ILE A O   
1978 C CB  . ILE A 274 ? 1.3420 1.3066 2.0700 -0.2673 -0.1702 -0.1876 274 ILE A CB  
1979 C CG1 . ILE A 274 ? 1.3423 1.3102 2.0783 -0.2931 -0.1918 -0.1899 274 ILE A CG1 
1980 C CG2 . ILE A 274 ? 1.3413 1.3471 2.0726 -0.2651 -0.1665 -0.1675 274 ILE A CG2 
1981 C CD1 . ILE A 274 ? 1.2989 1.2855 2.0066 -0.3069 -0.2062 -0.2020 274 ILE A CD1 
1982 N N   . VAL A 275 ? 1.0735 0.9863 1.7960 -0.2140 -0.1247 -0.1955 275 VAL A N   
1983 C CA  . VAL A 275 ? 1.0550 0.9629 1.7687 -0.1892 -0.1033 -0.1945 275 VAL A CA  
1984 C C   . VAL A 275 ? 1.1031 1.0069 1.8556 -0.1771 -0.0888 -0.1715 275 VAL A C   
1985 O O   . VAL A 275 ? 1.1670 1.0900 1.9307 -0.1634 -0.0752 -0.1533 275 VAL A O   
1986 C CB  . VAL A 275 ? 0.9609 0.8305 1.6364 -0.1765 -0.0960 -0.2267 275 VAL A CB  
1987 C CG1 . VAL A 275 ? 0.8838 0.7409 1.5579 -0.1500 -0.0720 -0.2241 275 VAL A CG1 
1988 C CG2 . VAL A 275 ? 0.9644 0.8431 1.5991 -0.1834 -0.1063 -0.2469 275 VAL A CG2 
1989 N N   . LEU A 276 ? 1.0479 0.9270 1.8213 -0.1824 -0.0918 -0.1721 276 LEU A N   
1990 C CA  . LEU A 276 ? 1.0969 0.9693 1.9085 -0.1719 -0.0787 -0.1511 276 LEU A CA  
1991 C C   . LEU A 276 ? 1.2189 1.1328 2.0635 -0.1753 -0.0782 -0.1167 276 LEU A C   
1992 O O   . LEU A 276 ? 1.2681 1.1864 2.1353 -0.1596 -0.0621 -0.0979 276 LEU A O   
1993 C CB  . LEU A 276 ? 1.0174 0.8632 1.8487 -0.1828 -0.0869 -0.1548 276 LEU A CB  
1994 C CG  . LEU A 276 ? 1.0113 0.8417 1.8790 -0.1705 -0.0725 -0.1378 276 LEU A CG  
1995 C CD1 . LEU A 276 ? 1.0283 0.8280 1.8787 -0.1453 -0.0513 -0.1522 276 LEU A CD1 
1996 C CD2 . LEU A 276 ? 1.0704 0.8800 1.9590 -0.1848 -0.0836 -0.1395 276 LEU A CD2 
1997 N N   . ALA A 277 ? 1.2022 1.1463 2.0497 -0.1959 -0.0957 -0.1084 277 ALA A N   
1998 C CA  . ALA A 277 ? 1.1539 1.1387 2.0307 -0.2017 -0.0971 -0.0765 277 ALA A CA  
1999 C C   . ALA A 277 ? 1.1979 1.2049 2.0624 -0.1854 -0.0834 -0.0689 277 ALA A C   
2000 O O   . ALA A 277 ? 1.1852 1.2150 2.0769 -0.1792 -0.0747 -0.0419 277 ALA A O   
2001 C CB  . ALA A 277 ? 1.1092 1.1190 1.9876 -0.2279 -0.1190 -0.0723 277 ALA A CB  
2002 N N   . HIS A 278 ? 1.2595 1.2599 2.0830 -0.1789 -0.0818 -0.0925 278 HIS A N   
2003 C CA  . HIS A 278 ? 1.3178 1.3370 2.1255 -0.1630 -0.0689 -0.0884 278 HIS A CA  
2004 C C   . HIS A 278 ? 1.2137 1.2126 2.0281 -0.1374 -0.0459 -0.0858 278 HIS A C   
2005 O O   . HIS A 278 ? 1.1572 1.1714 1.9663 -0.1220 -0.0325 -0.0775 278 HIS A O   
2006 C CB  . HIS A 278 ? 1.4504 1.4670 2.2114 -0.1640 -0.0743 -0.1154 278 HIS A CB  
2007 C CG  . HIS A 278 ? 1.4906 1.5300 2.2433 -0.1878 -0.0955 -0.1175 278 HIS A CG  
2008 N ND1 . HIS A 278 ? 1.5191 1.5395 2.2566 -0.2032 -0.1111 -0.1386 278 HIS A ND1 
2009 C CD2 . HIS A 278 ? 1.4948 1.5740 2.2520 -0.1989 -0.1034 -0.1010 278 HIS A CD2 
2010 C CE1 . HIS A 278 ? 1.5073 1.5551 2.2410 -0.2226 -0.1276 -0.1350 278 HIS A CE1 
2011 N NE2 . HIS A 278 ? 1.4970 1.5804 2.2422 -0.2204 -0.1232 -0.1124 278 HIS A NE2 
2012 N N   . THR A 279 ? 1.1809 1.1450 2.0070 -0.1328 -0.0413 -0.0929 279 THR A N   
2013 C CA  . THR A 279 ? 1.2818 1.2225 2.1150 -0.1087 -0.0194 -0.0919 279 THR A CA  
2014 C C   . THR A 279 ? 1.3295 1.2876 2.2092 -0.1039 -0.0108 -0.0579 279 THR A C   
2015 O O   . THR A 279 ? 1.1937 1.1479 2.0823 -0.0831 0.0086  -0.0487 279 THR A O   
2016 C CB  . THR A 279 ? 1.2619 1.1553 2.0857 -0.1051 -0.0172 -0.1157 279 THR A CB  
2017 O OG1 . THR A 279 ? 1.1223 0.9993 1.9018 -0.1092 -0.0250 -0.1474 279 THR A OG1 
2018 C CG2 . THR A 279 ? 1.3694 1.2378 2.2000 -0.0797 0.0064  -0.1149 279 THR A CG2 
2019 N N   . ASN A 280 ? 1.4124 1.3898 2.3215 -0.1233 -0.0252 -0.0391 280 ASN A N   
2020 C CA  . ASN A 280 ? 1.4129 1.4086 2.3675 -0.1218 -0.0196 -0.0057 280 ASN A CA  
2021 C C   . ASN A 280 ? 1.4254 1.4560 2.3857 -0.1115 -0.0093 0.0157  280 ASN A C   
2022 O O   . ASN A 280 ? 1.4828 1.5275 2.4782 -0.1052 -0.0004 0.0431  280 ASN A O   
2023 C CB  . ASN A 280 ? 1.4217 1.4337 2.4023 -0.1471 -0.0391 0.0088  280 ASN A CB  
2024 C CG  . ASN A 280 ? 1.4474 1.4742 2.4762 -0.1467 -0.0342 0.0423  280 ASN A CG  
2025 O OD1 . ASN A 280 ? 1.4297 1.4901 2.4793 -0.1616 -0.0443 0.0651  280 ASN A OD1 
2026 N ND2 . ASN A 280 ? 1.5082 1.5097 2.5548 -0.1299 -0.0185 0.0455  280 ASN A ND2 
2027 N N   . SER A 281 ? 1.4000 1.4445 2.3259 -0.1100 -0.0107 0.0032  281 SER A N   
2028 C CA  . SER A 281 ? 1.2925 1.3704 2.2194 -0.1009 -0.0019 0.0211  281 SER A CA  
2029 C C   . SER A 281 ? 1.2519 1.3130 2.1621 -0.0737 0.0202  0.0121  281 SER A C   
2030 O O   . SER A 281 ? 1.2314 1.3134 2.1260 -0.0647 0.0272  0.0152  281 SER A O   
2031 C CB  . SER A 281 ? 1.1495 1.2550 2.0497 -0.1152 -0.0160 0.0146  281 SER A CB  
2032 O OG  . SER A 281 ? 1.0311 1.1534 1.9468 -0.1404 -0.0359 0.0238  281 SER A OG  
2033 N N   . VAL A 282 ? 1.2233 1.2465 2.1367 -0.0609 0.0313  0.0009  282 VAL A N   
2034 C CA  . VAL A 282 ? 1.1867 1.1889 2.0822 -0.0352 0.0525  -0.0107 282 VAL A CA  
2035 C C   . VAL A 282 ? 1.1533 1.1327 2.0801 -0.0197 0.0690  0.0008  282 VAL A C   
2036 O O   . VAL A 282 ? 1.1066 1.0814 2.0345 0.0022  0.0889  0.0056  282 VAL A O   
2037 C CB  . VAL A 282 ? 1.0875 1.0578 1.9366 -0.0327 0.0507  -0.0485 282 VAL A CB  
2038 C CG1 . VAL A 282 ? 1.2029 1.1483 2.0341 -0.0062 0.0733  -0.0608 282 VAL A CG1 
2039 C CG2 . VAL A 282 ? 0.9240 0.9175 1.7412 -0.0457 0.0363  -0.0596 282 VAL A CG2 
2040 N N   . VAL A 283 ? 1.1102 1.0758 2.0630 -0.0312 0.0608  0.0057  283 VAL A N   
2041 C CA  . VAL A 283 ? 1.1173 1.0581 2.0997 -0.0179 0.0752  0.0147  283 VAL A CA  
2042 C C   . VAL A 283 ? 1.1083 1.0763 2.1319 -0.0100 0.0856  0.0509  283 VAL A C   
2043 O O   . VAL A 283 ? 1.1567 1.1083 2.1991 0.0085  0.1038  0.0589  283 VAL A O   
2044 C CB  . VAL A 283 ? 1.1122 1.0306 2.1111 -0.0333 0.0626  0.0097  283 VAL A CB  
2045 C CG1 . VAL A 283 ? 1.1272 1.0116 2.0866 -0.0375 0.0557  -0.0271 283 VAL A CG1 
2046 C CG2 . VAL A 283 ? 1.0449 0.9961 2.0679 -0.0579 0.0425  0.0301  283 VAL A CG2 
2047 N N   . ASN A 284 ? 1.0633 1.0727 2.1011 -0.0242 0.0742  0.0727  284 ASN A N   
2048 C CA  . ASN A 284 ? 1.0884 1.1266 2.1659 -0.0194 0.0819  0.1085  284 ASN A CA  
2049 C C   . ASN A 284 ? 1.0531 1.0939 2.1280 0.0065  0.1048  0.1151  284 ASN A C   
2050 O O   . ASN A 284 ? 0.9799 1.0174 2.0870 0.0198  0.1191  0.1345  284 ASN A O   
2051 C CB  . ASN A 284 ? 1.1394 1.2217 2.2271 -0.0400 0.0651  0.1284  284 ASN A CB  
2052 C CG  . ASN A 284 ? 1.2446 1.3264 2.3439 -0.0654 0.0438  0.1280  284 ASN A CG  
2053 O OD1 . ASN A 284 ? 1.2375 1.2877 2.3431 -0.0675 0.0419  0.1166  284 ASN A OD1 
2054 N ND2 . ASN A 284 ? 1.3104 1.4271 2.4127 -0.0850 0.0279  0.1405  284 ASN A ND2 
2055 N N   . PRO A 285 ? 1.1262 1.1733 2.1633 0.0139  0.1085  0.0992  285 PRO A N   
2056 C CA  . PRO A 285 ? 1.1144 1.1624 2.1466 0.0390  0.1306  0.1036  285 PRO A CA  
2057 C C   . PRO A 285 ? 1.0706 1.0772 2.1075 0.0591  0.1491  0.0934  285 PRO A C   
2058 O O   . PRO A 285 ? 1.1334 1.1420 2.1956 0.0763  0.1666  0.1125  285 PRO A O   
2059 C CB  . PRO A 285 ? 1.2141 1.2650 2.1977 0.0409  0.1285  0.0792  285 PRO A CB  
2060 C CG  . PRO A 285 ? 1.2272 1.2984 2.2013 0.0148  0.1044  0.0758  285 PRO A CG  
2061 C CD  . PRO A 285 ? 1.1969 1.2522 2.1954 -0.0004 0.0927  0.0780  285 PRO A CD  
2062 N N   . PHE A 286 ? 1.0259 0.9953 2.0386 0.0568  0.1453  0.0638  286 PHE A N   
2063 C CA  . PHE A 286 ? 1.0414 0.9682 2.0541 0.0749  0.1624  0.0506  286 PHE A CA  
2064 C C   . PHE A 286 ? 1.0025 0.9208 2.0623 0.0742  0.1654  0.0717  286 PHE A C   
2065 O O   . PHE A 286 ? 1.0606 0.9530 2.1328 0.0928  0.1838  0.0723  286 PHE A O   
2066 C CB  . PHE A 286 ? 1.1611 1.0511 2.1344 0.0704  0.1558  0.0130  286 PHE A CB  
2067 C CG  . PHE A 286 ? 1.2028 1.0944 2.1278 0.0749  0.1562  -0.0105 286 PHE A CG  
2068 C CD1 . PHE A 286 ? 1.1481 1.0682 2.0542 0.0571  0.1378  -0.0135 286 PHE A CD1 
2069 C CD2 . PHE A 286 ? 1.2312 1.0953 2.1295 0.0967  0.1750  -0.0295 286 PHE A CD2 
2070 C CE1 . PHE A 286 ? 1.1149 1.0369 1.9772 0.0611  0.1380  -0.0347 286 PHE A CE1 
2071 C CE2 . PHE A 286 ? 1.2276 1.0933 2.0814 0.1005  0.1752  -0.0510 286 PHE A CE2 
2072 C CZ  . PHE A 286 ? 1.1699 1.0648 2.0059 0.0828  0.1565  -0.0534 286 PHE A CZ  
2073 N N   . ILE A 287 ? 0.9808 0.9207 2.0667 0.0528  0.1475  0.0891  287 ILE A N   
2074 C CA  . ILE A 287 ? 1.0963 1.0303 2.2278 0.0499  0.1483  0.1103  287 ILE A CA  
2075 C C   . ILE A 287 ? 1.1523 1.1144 2.3215 0.0609  0.1609  0.1456  287 ILE A C   
2076 O O   . ILE A 287 ? 1.1726 1.1245 2.3780 0.0687  0.1706  0.1626  287 ILE A O   
2077 C CB  . ILE A 287 ? 1.1570 1.1024 2.3028 0.0221  0.1241  0.1156  287 ILE A CB  
2078 C CG1 . ILE A 287 ? 1.1961 1.1166 2.3758 0.0202  0.1250  0.1225  287 ILE A CG1 
2079 C CG2 . ILE A 287 ? 1.1501 1.1442 2.3173 0.0086  0.1135  0.1451  287 ILE A CG2 
2080 C CD1 . ILE A 287 ? 1.1921 1.1231 2.3882 -0.0067 0.1020  0.1290  287 ILE A CD1 
2081 N N   . TYR A 288 ? 1.1169 1.1146 2.2777 0.0615  0.1606  0.1569  288 TYR A N   
2082 C CA  . TYR A 288 ? 0.9531 0.9788 2.1456 0.0730  0.1732  0.1893  288 TYR A CA  
2083 C C   . TYR A 288 ? 0.9442 0.9479 2.1302 0.1018  0.1990  0.1834  288 TYR A C   
2084 O O   . TYR A 288 ? 1.0001 1.0004 2.2206 0.1151  0.2135  0.2038  288 TYR A O   
2085 C CB  . TYR A 288 ? 0.8331 0.9032 2.0164 0.0641  0.1646  0.2020  288 TYR A CB  
2086 C CG  . TYR A 288 ? 0.8631 0.9587 2.0562 0.0358  0.1403  0.2117  288 TYR A CG  
2087 C CD1 . TYR A 288 ? 0.8464 0.9414 2.0770 0.0227  0.1315  0.2288  288 TYR A CD1 
2088 C CD2 . TYR A 288 ? 0.8596 0.9801 2.0248 0.0221  0.1264  0.2043  288 TYR A CD2 
2089 C CE1 . TYR A 288 ? 0.7574 0.8753 1.9966 -0.0033 0.1096  0.2377  288 TYR A CE1 
2090 C CE2 . TYR A 288 ? 0.8215 0.9648 1.9954 -0.0037 0.1048  0.2132  288 TYR A CE2 
2091 C CZ  . TYR A 288 ? 0.8147 0.9564 2.0254 -0.0164 0.0965  0.2298  288 TYR A CZ  
2092 O OH  . TYR A 288 ? 0.8761 1.0401 2.0953 -0.0423 0.0753  0.2386  288 TYR A OH  
2093 N N   . ALA A 289 ? 0.9286 0.9171 2.0700 0.1113  0.2045  0.1553  289 ALA A N   
2094 C CA  . ALA A 289 ? 1.0056 0.9712 2.1348 0.1384  0.2288  0.1459  289 ALA A CA  
2095 C C   . ALA A 289 ? 1.1930 1.1138 2.3331 0.1486  0.2399  0.1353  289 ALA A C   
2096 O O   . ALA A 289 ? 1.3514 1.2474 2.4831 0.1711  0.2608  0.1262  289 ALA A O   
2097 C CB  . ALA A 289 ? 0.9060 0.8645 1.9826 0.1436  0.2300  0.1165  289 ALA A CB  
2098 N N   . TYR A 290 ? 1.1878 1.0984 2.3469 0.1320  0.2260  0.1364  290 TYR A N   
2099 C CA  . TYR A 290 ? 1.3001 1.1686 2.4712 0.1395  0.2348  0.1269  290 TYR A CA  
2100 C C   . TYR A 290 ? 1.2806 1.1581 2.5062 0.1359  0.2350  0.1585  290 TYR A C   
2101 O O   . TYR A 290 ? 1.1982 1.0571 2.4477 0.1534  0.2534  0.1677  290 TYR A O   
2102 C CB  . TYR A 290 ? 1.4225 1.2625 2.5647 0.1243  0.2194  0.0956  290 TYR A CB  
2103 C CG  . TYR A 290 ? 1.6357 1.4292 2.7845 0.1323  0.2286  0.0818  290 TYR A CG  
2104 C CD1 . TYR A 290 ? 1.7499 1.5053 2.8670 0.1501  0.2446  0.0543  290 TYR A CD1 
2105 C CD2 . TYR A 290 ? 1.6988 1.4861 2.8852 0.1217  0.2215  0.0961  290 TYR A CD2 
2106 C CE1 . TYR A 290 ? 1.8321 1.5442 2.9546 0.1572  0.2534  0.0414  290 TYR A CE1 
2107 C CE2 . TYR A 290 ? 1.7679 1.5125 2.9606 0.1290  0.2302  0.0835  290 TYR A CE2 
2108 C CZ  . TYR A 290 ? 1.8331 1.5400 2.9937 0.1467  0.2462  0.0560  290 TYR A CZ  
2109 O OH  . TYR A 290 ? 1.8878 1.5514 3.0540 0.1538  0.2552  0.0432  290 TYR A OH  
2110 N N   . ARG A 291 ? 1.3097 1.2157 2.5547 0.1129  0.2145  0.1752  291 ARG A N   
2111 C CA  . ARG A 291 ? 1.3088 1.2253 2.6049 0.1062  0.2116  0.2053  291 ARG A CA  
2112 C C   . ARG A 291 ? 1.2666 1.2190 2.5957 0.1150  0.2215  0.2410  291 ARG A C   
2113 O O   . ARG A 291 ? 1.2044 1.1608 2.5774 0.1177  0.2268  0.2669  291 ARG A O   
2114 C CB  . ARG A 291 ? 1.2129 1.1441 2.5161 0.0771  0.1854  0.2083  291 ARG A CB  
2115 C CG  . ARG A 291 ? 1.1762 1.0693 2.4639 0.0677  0.1762  0.1809  291 ARG A CG  
2116 C CD  . ARG A 291 ? 1.2033 1.0668 2.5243 0.0767  0.1873  0.1882  291 ARG A CD  
2117 N NE  . ARG A 291 ? 1.1958 1.0846 2.5666 0.0668  0.1812  0.2235  291 ARG A NE  
2118 C CZ  . ARG A 291 ? 1.2611 1.1327 2.6691 0.0722  0.1889  0.2373  291 ARG A CZ  
2119 N NH1 . ARG A 291 ? 1.3331 1.1616 2.7344 0.0875  0.2033  0.2185  291 ARG A NH1 
2120 N NH2 . ARG A 291 ? 1.2243 1.1218 2.6762 0.0620  0.1822  0.2699  291 ARG A NH2 
2121 N N   . ILE A 292 ? 1.2530 1.2319 2.5613 0.1194  0.2237  0.2426  292 ILE A N   
2122 C CA  . ILE A 292 ? 1.1919 1.2072 2.5284 0.1270  0.2322  0.2758  292 ILE A CA  
2123 C C   . ILE A 292 ? 1.2517 1.2588 2.5747 0.1545  0.2564  0.2715  292 ILE A C   
2124 O O   . ILE A 292 ? 1.2489 1.2553 2.5310 0.1599  0.2586  0.2507  292 ILE A O   
2125 C CB  . ILE A 292 ? 1.1172 1.1772 2.4469 0.1083  0.2145  0.2877  292 ILE A CB  
2126 C CG1 . ILE A 292 ? 1.1736 1.2400 2.5110 0.0802  0.1899  0.2880  292 ILE A CG1 
2127 C CG2 . ILE A 292 ? 0.9705 1.0684 2.3341 0.1141  0.2220  0.3247  292 ILE A CG2 
2128 C CD1 . ILE A 292 ? 1.1966 1.2611 2.5824 0.0741  0.1878  0.3123  292 ILE A CD1 
2129 N N   . ARG A 293 ? 1.7659 2.1310 2.7708 0.5453  0.1258  0.0045  293 ARG A N   
2130 C CA  . ARG A 293 ? 1.7506 2.2245 2.8192 0.5386  0.1485  -0.0014 293 ARG A CA  
2131 C C   . ARG A 293 ? 1.5142 2.1751 2.7531 0.4891  0.1064  -0.0157 293 ARG A C   
2132 O O   . ARG A 293 ? 1.4833 2.2171 2.7908 0.4306  0.1184  -0.0159 293 ARG A O   
2133 C CB  . ARG A 293 ? 1.9667 2.4660 2.9825 0.6530  0.1754  -0.0117 293 ARG A CB  
2134 C CG  . ARG A 293 ? 2.0863 2.6944 3.1534 0.7382  0.1369  -0.0313 293 ARG A CG  
2135 C CD  . ARG A 293 ? 2.2755 2.9012 3.2803 0.8550  0.1655  -0.0411 293 ARG A CD  
2136 N NE  . ARG A 293 ? 2.3055 3.0507 3.3668 0.9377  0.1276  -0.0616 293 ARG A NE  
2137 C CZ  . ARG A 293 ? 2.4027 3.0727 3.3903 1.0045  0.1115  -0.0620 293 ARG A CZ  
2138 N NH1 . ARG A 293 ? 2.5084 2.9827 3.3619 0.9965  0.1309  -0.0435 293 ARG A NH1 
2139 N NH2 . ARG A 293 ? 2.3802 3.1717 3.4272 1.0784  0.0764  -0.0817 293 ARG A NH2 
2140 N N   . GLU A 294 ? 1.3409 2.0762 2.6446 0.5117  0.0581  -0.0279 294 GLU A N   
2141 C CA  . GLU A 294 ? 1.1812 2.0895 2.6423 0.4655  0.0158  -0.0428 294 GLU A CA  
2142 C C   . GLU A 294 ? 1.0810 1.9634 2.5897 0.3445  0.0028  -0.0304 294 GLU A C   
2143 O O   . GLU A 294 ? 0.9849 1.9837 2.6019 0.2840  -0.0073 -0.0370 294 GLU A O   
2144 C CB  . GLU A 294 ? 1.1686 2.1462 2.6760 0.5178  -0.0327 -0.0579 294 GLU A CB  
2145 C CG  . GLU A 294 ? 1.1291 2.2648 2.7910 0.4598  -0.0802 -0.0721 294 GLU A CG  
2146 C CD  . GLU A 294 ? 1.2120 2.5212 2.9785 0.4586  -0.0736 -0.0899 294 GLU A CD  
2147 O OE1 . GLU A 294 ? 1.1642 2.5873 3.0498 0.3882  -0.1015 -0.0987 294 GLU A OE1 
2148 O OE2 . GLU A 294 ? 1.3286 2.6597 3.0561 0.5277  -0.0399 -0.0959 294 GLU A OE2 
2149 N N   . PHE A 295 ? 1.1197 1.8482 2.5435 0.3104  0.0039  -0.0131 295 PHE A N   
2150 C CA  . PHE A 295 ? 0.9980 1.6883 2.4540 0.2011  -0.0099 -0.0008 295 PHE A CA  
2151 C C   . PHE A 295 ? 1.0122 1.6746 2.4556 0.1381  0.0303  0.0108  295 PHE A C   
2152 O O   . PHE A 295 ? 0.7196 1.4571 2.2541 0.0602  0.0174  0.0105  295 PHE A O   
2153 C CB  . PHE A 295 ? 0.9757 1.5099 2.3376 0.1874  -0.0177 0.0127  295 PHE A CB  
2154 C CG  . PHE A 295 ? 0.9571 1.5340 2.3873 0.1676  -0.0737 0.0063  295 PHE A CG  
2155 C CD1 . PHE A 295 ? 0.8649 1.4750 2.3747 0.0733  -0.1023 0.0101  295 PHE A CD1 
2156 C CD2 . PHE A 295 ? 1.0242 1.6038 2.4347 0.2443  -0.0974 -0.0033 295 PHE A CD2 
2157 C CE1 . PHE A 295 ? 0.7721 1.4185 2.3419 0.0556  -0.1533 0.0042  295 PHE A CE1 
2158 C CE2 . PHE A 295 ? 0.9592 1.5771 2.4318 0.2256  -0.1486 -0.0093 295 PHE A CE2 
2159 C CZ  . PHE A 295 ? 0.8200 1.4715 2.3727 0.1310  -0.1764 -0.0056 295 PHE A CZ  
2160 N N   . ARG A 296 ? 1.1116 1.6621 2.4381 0.1718  0.0794  0.0210  296 ARG A N   
2161 C CA  . ARG A 296 ? 1.1389 1.6464 2.4384 0.1151  0.1209  0.0331  296 ARG A CA  
2162 C C   . ARG A 296 ? 1.0959 1.7602 2.5087 0.0927  0.1233  0.0221  296 ARG A C   
2163 O O   . ARG A 296 ? 1.0710 1.7474 2.5246 0.0084  0.1301  0.0294  296 ARG A O   
2164 C CB  . ARG A 296 ? 1.2506 1.6263 2.4068 0.1701  0.1748  0.0425  296 ARG A CB  
2165 C CG  . ARG A 296 ? 1.3835 1.8109 2.5173 0.2816  0.1892  0.0291  296 ARG A CG  
2166 C CD  . ARG A 296 ? 1.5756 1.8785 2.5731 0.3248  0.2479  0.0391  296 ARG A CD  
2167 N NE  . ARG A 296 ? 1.6905 1.8070 2.5564 0.3130  0.2641  0.0546  296 ARG A NE  
2168 C CZ  . ARG A 296 ? 1.8461 1.8237 2.5747 0.3417  0.3147  0.0649  296 ARG A CZ  
2169 N NH1 . ARG A 296 ? 1.9094 1.7234 2.5230 0.3243  0.3272  0.0768  296 ARG A NH1 
2170 N NH2 . ARG A 296 ? 1.8963 1.8990 2.6012 0.3871  0.3535  0.0624  296 ARG A NH2 
2171 N N   . GLN A 297 ? 1.1266 1.9115 2.5880 0.1683  0.1179  0.0035  297 GLN A N   
2172 C CA  . GLN A 297 ? 1.1377 2.0818 2.7063 0.1541  0.1213  -0.0106 297 GLN A CA  
2173 C C   . GLN A 297 ? 1.0632 2.1128 2.7607 0.0693  0.0790  -0.0168 297 GLN A C   
2174 O O   . GLN A 297 ? 0.9986 2.1310 2.7690 0.0115  0.0873  -0.0201 297 GLN A O   
2175 C CB  . GLN A 297 ? 1.1657 2.2230 2.7599 0.2579  0.1195  -0.0319 297 GLN A CB  
2176 C CG  . GLN A 297 ? 1.3018 2.2603 2.7671 0.3481  0.1628  -0.0269 297 GLN A CG  
2177 C CD  . GLN A 297 ? 1.3846 2.4511 2.8703 0.4577  0.1559  -0.0483 297 GLN A CD  
2178 O OE1 . GLN A 297 ? 1.3673 2.5980 2.9721 0.4630  0.1216  -0.0686 297 GLN A OE1 
2179 N NE2 . GLN A 297 ? 1.4952 2.4693 2.8617 0.5463  0.1888  -0.0446 297 GLN A NE2 
2180 N N   . THR A 298 ? 1.0560 2.0982 2.7773 0.0621  0.0345  -0.0184 298 THR A N   
2181 C CA  . THR A 298 ? 0.9728 2.1002 2.8064 -0.0162 -0.0078 -0.0235 298 THR A CA  
2182 C C   . THR A 298 ? 0.9975 2.0382 2.8147 -0.1187 0.0020  -0.0041 298 THR A C   
2183 O O   . THR A 298 ? 0.9478 2.0674 2.8476 -0.1891 -0.0033 -0.0068 298 THR A O   
2184 C CB  . THR A 298 ? 0.9267 2.0526 2.7787 0.0034  -0.0569 -0.0286 298 THR A CB  
2185 O OG1 . THR A 298 ? 0.9829 2.1811 2.8408 0.1037  -0.0655 -0.0461 298 THR A OG1 
2186 C CG2 . THR A 298 ? 0.8411 2.0656 2.8128 -0.0731 -0.1004 -0.0360 298 THR A CG2 
2187 N N   . PHE A 299 ? 1.0770 1.9554 2.7846 -0.1268 0.0168  0.0147  299 PHE A N   
2188 C CA  . PHE A 299 ? 1.1033 1.8897 2.7824 -0.2182 0.0276  0.0332  299 PHE A CA  
2189 C C   . PHE A 299 ? 1.1454 1.9593 2.8343 -0.2534 0.0682  0.0368  299 PHE A C   
2190 O O   . PHE A 299 ? 1.1350 1.9688 2.8734 -0.3378 0.0638  0.0425  299 PHE A O   
2191 C CB  . PHE A 299 ? 1.2505 1.8600 2.7977 -0.2092 0.0456  0.0500  299 PHE A CB  
2192 C CG  . PHE A 299 ? 1.3371 1.9054 2.8651 -0.1802 0.0081  0.0477  299 PHE A CG  
2193 C CD1 . PHE A 299 ? 1.2885 1.8950 2.8906 -0.2338 -0.0400 0.0458  299 PHE A CD1 
2194 C CD2 . PHE A 299 ? 1.4290 1.9146 2.8597 -0.0998 0.0219  0.0476  299 PHE A CD2 
2195 C CE1 . PHE A 299 ? 1.2492 1.8182 2.8337 -0.2075 -0.0742 0.0433  299 PHE A CE1 
2196 C CE2 . PHE A 299 ? 1.3992 1.8447 2.8099 -0.0742 -0.0117 0.0452  299 PHE A CE2 
2197 C CZ  . PHE A 299 ? 1.3015 1.7909 2.7912 -0.1284 -0.0600 0.0429  299 PHE A CZ  
2198 N N   . ARG A 300 ? 1.2171 2.0292 2.8552 -0.1869 0.1078  0.0335  300 ARG A N   
2199 C CA  . ARG A 300 ? 1.2583 2.0952 2.8982 -0.2100 0.1499  0.0360  300 ARG A CA  
2200 C C   . ARG A 300 ? 1.1925 2.1868 2.9655 -0.2614 0.1319  0.0227  300 ARG A C   
2201 O O   . ARG A 300 ? 1.1847 2.1806 2.9779 -0.3334 0.1494  0.0302  300 ARG A O   
2202 C CB  . ARG A 300 ? 1.4032 2.2395 2.9816 -0.1153 0.1883  0.0296  300 ARG A CB  
2203 C CG  . ARG A 300 ? 1.5152 2.3560 3.0755 -0.1319 0.2372  0.0337  300 ARG A CG  
2204 C CD  . ARG A 300 ? 1.6647 2.4906 3.1516 -0.0317 0.2743  0.0282  300 ARG A CD  
2205 N NE  . ARG A 300 ? 1.7531 2.4183 3.1068 0.0153  0.2887  0.0405  300 ARG A NE  
2206 C CZ  . ARG A 300 ? 1.8688 2.4852 3.1331 0.1069  0.3194  0.0384  300 ARG A CZ  
2207 N NH1 . ARG A 300 ? 1.9313 2.6527 3.2281 0.1647  0.3378  0.0241  300 ARG A NH1 
2208 N NH2 . ARG A 300 ? 1.9021 2.3642 3.0418 0.1410  0.3322  0.0497  300 ARG A NH2 
2209 N N   . LYS A 301 ? 1.1349 2.2604 2.9959 -0.2250 0.0973  0.0023  301 LYS A N   
2210 C CA  . LYS A 301 ? 1.0396 2.3208 3.0290 -0.2730 0.0772  -0.0135 301 LYS A CA  
2211 C C   . LYS A 301 ? 1.1121 2.3645 3.1399 -0.3789 0.0540  -0.0023 301 LYS A C   
2212 O O   . LYS A 301 ? 1.1304 2.4276 3.2055 -0.4464 0.0661  -0.0017 301 LYS A O   
2213 C CB  . LYS A 301 ? 0.8873 2.2995 2.9567 -0.2181 0.0384  -0.0370 301 LYS A CB  
2214 C CG  . LYS A 301 ? 0.7491 2.3182 2.9515 -0.2748 0.0124  -0.0547 301 LYS A CG  
2215 C CD  . LYS A 301 ? 0.6535 2.3009 2.9242 -0.2547 -0.0396 -0.0702 301 LYS A CD  
2216 C CE  . LYS A 301 ? 0.6240 2.3159 2.8753 -0.1417 -0.0422 -0.0851 301 LYS A CE  
2217 N NZ  . LYS A 301 ? 0.4659 2.2289 2.7800 -0.1219 -0.0934 -0.0997 301 LYS A NZ  
2218 N N   . ILE A 302 ? 1.1385 2.3151 3.1431 -0.3916 0.0205  0.0060  302 ILE A N   
2219 C CA  . ILE A 302 ? 1.1145 2.2595 3.1508 -0.4844 -0.0066 0.0161  302 ILE A CA  
2220 C C   . ILE A 302 ? 1.1788 2.2394 3.1688 -0.5542 0.0273  0.0347  302 ILE A C   
2221 O O   . ILE A 302 ? 1.1849 2.2970 3.2368 -0.6271 0.0239  0.0345  302 ILE A O   
2222 C CB  . ILE A 302 ? 1.0865 2.1355 3.0782 -0.4785 -0.0400 0.0247  302 ILE A CB  
2223 C CG1 . ILE A 302 ? 1.0064 2.1402 3.0480 -0.4138 -0.0770 0.0063  302 ILE A CG1 
2224 C CG2 . ILE A 302 ? 1.0502 2.0624 3.0686 -0.5723 -0.0666 0.0355  302 ILE A CG2 
2225 C CD1 . ILE A 302 ? 0.9119 1.9587 2.9135 -0.4051 -0.1108 0.0131  302 ILE A CD1 
2226 N N   . ILE A 303 ? 1.2233 2.1524 3.1013 -0.5320 0.0604  0.0502  303 ILE A N   
2227 C CA  . ILE A 303 ? 1.2201 2.0574 3.0423 -0.5941 0.0937  0.0685  303 ILE A CA  
2228 C C   . ILE A 303 ? 1.3095 2.2319 3.1805 -0.6212 0.1238  0.0633  303 ILE A C   
2229 O O   . ILE A 303 ? 1.3405 2.2742 3.2491 -0.7017 0.1221  0.0692  303 ILE A O   
2230 C CB  . ILE A 303 ? 1.1791 1.8723 2.8698 -0.5541 0.1305  0.0823  303 ILE A CB  
2231 C CG1 . ILE A 303 ? 1.0396 1.6446 2.6769 -0.5299 0.1028  0.0866  303 ILE A CG1 
2232 C CG2 . ILE A 303 ? 1.1863 1.7887 2.8213 -0.6212 0.1643  0.1003  303 ILE A CG2 
2233 C CD1 . ILE A 303 ? 1.0207 1.4807 2.5243 -0.4919 0.1384  0.0983  303 ILE A CD1 
2234 N N   . ARG A 304 ? 1.3455 2.3263 3.2130 -0.5526 0.1516  0.0519  304 ARG A N   
2235 C CA  . ARG A 304 ? 1.4014 2.4694 3.3135 -0.5700 0.1826  0.0447  304 ARG A CA  
2236 C C   . ARG A 304 ? 1.3263 2.5242 3.3600 -0.6325 0.1537  0.0318  304 ARG A C   
2237 O O   . ARG A 304 ? 1.3199 2.5386 3.3810 -0.6991 0.1710  0.0354  304 ARG A O   
2238 C CB  . ARG A 304 ? 1.5215 2.6549 3.4244 -0.4756 0.2075  0.0298  304 ARG A CB  
2239 C CG  . ARG A 304 ? 1.6619 2.6634 3.4362 -0.4150 0.2448  0.0424  304 ARG A CG  
2240 C CD  . ARG A 304 ? 1.7151 2.7848 3.4804 -0.3192 0.2692  0.0272  304 ARG A CD  
2241 N NE  . ARG A 304 ? 1.8091 2.7444 3.4436 -0.2630 0.3083  0.0397  304 ARG A NE  
2242 C CZ  . ARG A 304 ? 1.8524 2.8081 3.4472 -0.1732 0.3354  0.0307  304 ARG A CZ  
2243 N NH1 . ARG A 304 ? 1.9269 2.7456 3.3941 -0.1284 0.3716  0.0433  304 ARG A NH1 
2244 N NH2 . ARG A 304 ? 1.8364 2.9496 3.5164 -0.1279 0.3265  0.0081  304 ARG A NH2 
2245 N N   . SER A 305 ? 1.2884 2.5704 3.3918 -0.6120 0.1103  0.0165  305 SER A N   
2246 C CA  . SER A 305 ? 1.2219 2.6282 3.4392 -0.6688 0.0810  0.0020  305 SER A CA  
2247 C C   . SER A 305 ? 1.1413 2.4642 3.3369 -0.7171 0.0386  0.0118  305 SER A C   
2248 O O   . SER A 305 ? 1.1727 2.3745 3.2828 -0.7596 0.0426  0.0275  305 SER A O   
2249 C CB  . SER A 305 ? 1.2344 2.7921 3.5310 -0.6059 0.0615  -0.0255 305 SER A CB  
2250 O OG  . SER A 305 ? 1.1786 2.8602 3.5841 -0.6638 0.0366  -0.0415 305 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   MET 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  TRP 32  32  32  TRP TRP A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 CYS 128 128 128 CYS CYS A . n 
A 1 129 TRP 129 129 129 TRP TRP A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 TRP 143 143 143 TRP TRP A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 CYS 146 146 146 CYS CYS A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LYS 150 150 ?   ?   ?   A . n 
A 1 151 GLU 151 151 ?   ?   ?   A . n 
A 1 152 GLY 152 152 ?   ?   ?   A . n 
A 1 153 LYS 153 153 ?   ?   ?   A . n 
A 1 154 ASN 154 154 ?   ?   ?   A . n 
A 1 155 HIS 155 155 ?   ?   ?   A . n 
A 1 156 SER 156 156 ?   ?   ?   A . n 
A 1 157 GLN 157 157 ?   ?   ?   A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 CYS 166 166 166 CYS CYS A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 CYS 185 185 185 CYS CYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 MET 193 193 193 MET MET A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 TRP 246 246 246 TRP TRP A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 HIS 250 250 250 HIS HIS A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 TRP 268 268 268 TRP TRP A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 MET 270 270 270 MET MET A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 ASN 284 284 284 ASN ASN A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 ARG 300 300 300 ARG ARG A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 ILE 302 302 302 ILE ILE A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 ?   ?   ?   A . n 
A 1 307 VAL 307 307 ?   ?   ?   A . n 
A 1 308 LEU 308 308 ?   ?   ?   A . n 
A 1 309 ARG 309 309 ?   ?   ?   A . n 
A 1 310 GLN 310 310 ?   ?   ?   A . n 
A 1 311 GLN 311 311 ?   ?   ?   A . n 
A 1 312 GLU 312 312 ?   ?   ?   A . n 
A 1 313 PRO 313 313 ?   ?   ?   A . n 
A 1 314 PHE 314 314 ?   ?   ?   A . n 
A 1 315 LYS 315 315 ?   ?   ?   A . n 
A 1 316 ALA 316 316 ?   ?   ?   A . n 
A 1 317 ALA 317 317 ?   ?   ?   A . n 
A 1 318 ALA 318 318 ?   ?   ?   A . n 
A 1 319 ALA 319 319 ?   ?   ?   A . n 
A 1 320 HIS 320 320 ?   ?   ?   A . n 
A 1 321 HIS 321 321 ?   ?   ?   A . n 
A 1 322 HIS 322 322 ?   ?   ?   A . n 
A 1 323 HIS 323 323 ?   ?   ?   A . n 
A 1 324 HIS 324 324 ?   ?   ?   A . n 
A 1 325 HIS 325 325 ?   ?   ?   A . n 
A 1 326 HIS 326 326 ?   ?   ?   A . n 
A 1 327 HIS 327 327 ?   ?   ?   A . n 
A 1 328 HIS 328 328 ?   ?   ?   A . n 
A 1 329 HIS 329 329 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-09-07 
2 'Structure model' 1 1 2012-06-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 30.0903 20.0227 41.8459 0.9211 0.7868 0.0494 -0.0079 -0.2712 1.1006  0.2837 1.0271 1.1611 -0.0605 
-0.2252 -0.9329 0.3050  0.3460  2.5930  -1.1647 -0.6916 0.3410  0.6959  0.0072  -0.5034 
'X-RAY DIFFRACTION' 2  ? refined 11.9500 21.4088 29.5774 0.6181 1.2560 2.4789 -0.3004 -0.0002 0.0674  0.0179 0.0126 0.0072 0.0188  
0.0099  0.0105  0.2431  -0.2015 -0.0015 0.4499  0.3506  0.1379  0.4031  0.5653  0.2159  
'X-RAY DIFFRACTION' 3  ? refined 33.7968 17.8208 33.2584 0.6444 0.6958 2.1995 0.0104  -0.0720 0.4078  0.3400 0.0304 0.8841 0.1162  
-0.5555 -0.1762 -0.0073 -0.1882 -0.0003 0.9717  -0.3867 -0.0308 0.8159  0.0405  0.7148  
'X-RAY DIFFRACTION' 4  ? refined 52.1300 7.7666  31.2759 0.7674 1.4392 3.2011 0.4522  -0.0309 -0.1161 0.0494 0.0616 0.0010 -0.0592 
0.0014  -0.0014 0.4390  0.1256  -0.0035 -0.4443 0.3581  -0.0364 -0.8761 -0.1894 0.6682  
'X-RAY DIFFRACTION' 5  ? refined 33.1345 21.9108 23.7102 0.9418 0.6518 0.3077 0.0588  0.1172  0.7339  0.9018 0.1728 0.2185 -0.1748 
0.0520  0.0181  0.3603  0.6562  3.7247  0.2035  -0.2160 0.0135  -0.8378 0.0900  -0.9455 
'X-RAY DIFFRACTION' 6  ? refined 13.1924 27.6597 14.2698 0.7109 1.4749 2.5201 -0.0667 -0.3136 0.3334  0.0855 0.0571 0.1330 -0.0189 
-0.1159 0.0225  -0.1357 -0.7862 0.0016  0.7708  0.0448  0.8670  0.2042  -0.6183 0.3015  
'X-RAY DIFFRACTION' 7  ? refined 33.2066 15.0152 19.2255 0.9309 1.2932 1.6890 -0.0492 -0.0956 -0.1547 0.1087 0.3116 0.1868 0.1902  
0.1455  0.2566  0.1289  0.2723  0.0015  0.9782  -0.2504 -0.1716 -1.4147 0.0517  1.5458  
'X-RAY DIFFRACTION' 8  ? refined 56.6014 14.3154 21.3033 1.1242 0.7607 3.0569 -0.2078 -0.0809 0.0185  0.0395 0.0360 0.0808 -0.0348 
-0.0577 0.0526  -1.1638 -0.5167 0.0027  0.8039  -0.2811 0.4101  -2.1942 0.2744  -0.0732 
'X-RAY DIFFRACTION' 9  ? refined 56.1127 13.6131 29.0989 1.0142 1.3040 2.6543 0.1886  0.0797  0.0367  0.1730 0.0527 0.2845 0.0423  
-0.1081 0.0794  -0.2575 0.5917  -0.0007 1.2049  -0.6624 -0.0998 0.5518  0.2657  1.3951  
'X-RAY DIFFRACTION' 10 ? refined 30.6937 34.9887 17.9274 0.7017 0.8913 1.4949 0.1718  -0.1259 0.1322  0.4578 0.9302 0.4198 0.5212  
0.3065  0.6336  -0.6245 -0.3353 -0.0041 -0.8116 1.3017  0.3319  0.8934  -0.2005 -0.1411 
'X-RAY DIFFRACTION' 11 ? refined 2.2806  46.3634 19.0215 0.7062 1.7584 2.1099 -0.0814 -0.2921 0.6776  0.0230 0.1282 0.3368 0.0027  
0.0185  0.2109  -0.3229 0.1196  -0.0012 1.0170  0.7152  0.1671  0.8995  0.9409  1.1865  
'X-RAY DIFFRACTION' 12 ? refined 31.7215 34.2568 26.8291 0.3774 0.1430 1.2283 -0.0882 -0.0336 0.0039  7.1391 1.9193 2.5122 -0.6267 
-3.2333 -0.3072 -0.1125 0.1149  -0.0703 0.7533  1.9754  -0.0020 -0.8069 0.1038  -0.5891 
'X-RAY DIFFRACTION' 13 ? refined 58.6658 33.0067 30.2595 0.3917 0.6275 1.5789 0.2507  -0.3550 -0.2840 5.4141 2.0108 1.0883 7.3105  
2.4189  3.3681  0.9678  -0.7472 -0.1050 -0.0944 -0.4939 0.7135  1.5923  0.1913  -1.0872 
'X-RAY DIFFRACTION' 14 ? refined 34.6152 29.2923 37.1347 0.7046 0.6132 1.6036 -0.0903 0.0028  -0.0645 0.2195 0.3633 0.1975 0.2123  
-0.1458 -0.2402 -0.1603 0.5300  -0.0007 -0.2871 1.0302  0.4867  0.7656  -0.7544 -0.1844 
'X-RAY DIFFRACTION' 15 ? refined 13.7343 25.7523 41.9297 0.6927 1.6093 2.3490 -0.0336 0.0812  0.0067  0.2272 0.6547 3.9104 -0.0647 
-0.6892 1.1232  1.3292  -1.0580 -0.0150 0.2356  -0.4017 1.4699  0.1520  -1.9681 -3.0048 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 7   A 33  'chain A and resid 7:33'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 34  A 40  'chain A and resid 34:40'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 41  A 68  'chain A and resid 41:68'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 69  A 76  'chain A and resid 69:76'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 77  A 104 'chain A and resid 77:104'  ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 105 A 118 'chain A and resid 105:118' ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 119 A 141 'chain A and resid 119:141' ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 142 A 151 'chain A and resid 142:151' ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 158 A 175 'chain A and resid 158:175' ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 176 A 211 'chain A and resid 176:211' ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 A 212 A 220 'chain A and resid 212:220' ? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 A 221 A 258 'chain A and resid 221:258' ? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 A 259 A 267 'chain A and resid 259:267' ? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 A 268 A 292 'chain A and resid 268:292' ? ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 A 293 A 305 'chain A and resid 293:305' ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .                         ? 1 
PHASER phasing          .                         ? 2 
PHENIX refinement       '(phenix.refine: 1.4_84)' ? 3 
XDS    'data reduction' .                         ? 4 
SCALA  'data scaling'   .                         ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 38  ? ? -84.02  49.47  
2  1 LEU A 58  ? ? -126.55 -54.04 
3  1 ALA A 73  ? ? -58.63  175.65 
4  1 ALA A 165 ? ? -59.77  93.64  
5  1 CYS A 166 ? ? -67.42  91.26  
6  1 VAL A 178 ? ? -100.69 -69.02 
7  1 PHE A 180 ? ? -85.35  -71.78 
8  1 ASN A 181 ? ? -52.68  -76.05 
9  1 PHE A 182 ? ? -57.22  -72.32 
10 1 VAL A 186 ? ? -138.08 -52.70 
11 1 SER A 213 ? ? -107.21 41.06  
12 1 PRO A 215 ? ? -71.62  23.83  
13 1 PRO A 217 ? ? -57.13  -71.05 
14 1 TRP A 246 ? ? -138.98 -34.58 
15 1 SER A 263 ? ? -45.22  108.97 
16 1 ALA A 289 ? ? -65.58  0.32   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ILE 3   ? A ILE 3   
4  1 Y 1 A MET 4   ? A MET 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A LYS 150 ? A LYS 150 
8  1 Y 1 A GLU 151 ? A GLU 151 
9  1 Y 1 A GLY 152 ? A GLY 152 
10 1 Y 1 A LYS 153 ? A LYS 153 
11 1 Y 1 A ASN 154 ? A ASN 154 
12 1 Y 1 A HIS 155 ? A HIS 155 
13 1 Y 1 A SER 156 ? A SER 156 
14 1 Y 1 A GLN 157 ? A GLN 157 
15 1 Y 1 A HIS 306 ? A HIS 306 
16 1 Y 1 A VAL 307 ? A VAL 307 
17 1 Y 1 A LEU 308 ? A LEU 308 
18 1 Y 1 A ARG 309 ? A ARG 309 
19 1 Y 1 A GLN 310 ? A GLN 310 
20 1 Y 1 A GLN 311 ? A GLN 311 
21 1 Y 1 A GLU 312 ? A GLU 312 
22 1 Y 1 A PRO 313 ? A PRO 313 
23 1 Y 1 A PHE 314 ? A PHE 314 
24 1 Y 1 A LYS 315 ? A LYS 315 
25 1 Y 1 A ALA 316 ? A ALA 316 
26 1 Y 1 A ALA 317 ? A ALA 317 
27 1 Y 1 A ALA 318 ? A ALA 318 
28 1 Y 1 A ALA 319 ? A ALA 319 
29 1 Y 1 A HIS 320 ? A HIS 320 
30 1 Y 1 A HIS 321 ? A HIS 321 
31 1 Y 1 A HIS 322 ? A HIS 322 
32 1 Y 1 A HIS 323 ? A HIS 323 
33 1 Y 1 A HIS 324 ? A HIS 324 
34 1 Y 1 A HIS 325 ? A HIS 325 
35 1 Y 1 A HIS 326 ? A HIS 326 
36 1 Y 1 A HIS 327 ? A HIS 327 
37 1 Y 1 A HIS 328 ? A HIS 328 
38 1 Y 1 A HIS 329 ? A HIS 329 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        '4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethyl}phenol' 
_pdbx_entity_nonpoly.comp_id     ZMA 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZMA 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     401 
_pdbx_nonpoly_scheme.auth_seq_num    401 
_pdbx_nonpoly_scheme.pdb_mon_id      ZMA 
_pdbx_nonpoly_scheme.auth_mon_id     ZMA 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
#