data_3Q0F
# 
_entry.id   3Q0F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3Q0F         
NDB   NA0904       
RCSB  RCSB063037   
WWPDB D_1000063037 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3Q0B 'Crystal structure of SUVH5 SRA-fully methylated CG DNA in space group P42212' unspecified 
PDB 3Q0C 'Crystal structure of SUVH5 SRA-fully methylated CG DNA in space group P6122'  unspecified 
PDB 3Q0D 'Crystal structure of SUVH5 SRA-hemi methylated CG complex'                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3Q0F 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eerappa, R.'    1 
'Simanshu, D.K.' 2 
'Patel, D.J.'    3 
# 
_citation.id                        primary 
_citation.title                     
;A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
;
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            25 
_citation.page_first                137 
_citation.page_last                 152 
_citation.year                      2011 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21245167 
_citation.pdbx_database_id_DOI      10.1101/gad.1980311 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rajakumara, E.' 1 
primary 'Law, J.A.'      2 
primary 'Simanshu, D.K.' 3 
primary 'Voigt, P.'      4 
primary 'Johnson, L.M.'  5 
primary 'Reinberg, D.'   6 
primary 'Patel, D.J.'    7 
primary 'Jacobsen, S.E.' 8 
# 
_cell.entry_id           3Q0F 
_cell.length_a           102.968 
_cell.length_b           102.968 
_cell.length_c           170.493 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3Q0F 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5' 18515.920 2  2.1.1.43 ? 
'SUVH5 SRA Domain (UNP Residues 362-528)' ? 
2 polymer syn 
;DNA (5'-D(*CP*TP*GP*AP*GP*GP*AP*GP*TP*AP*T)-3')
;
3413.246  1  ?        ? ?                                         ? 
3 polymer syn 
;DNA (5'-D(*TP*AP*CP*TP*(5CM)P*CP*TP*CP*AP*G)-3')
;
2993.994  1  ?        ? ?                                         ? 
4 water   nat water                                                            18.015    18 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Histone H3-K9 methyltransferase 5, H3-K9-HMTase 5, Protein SET DOMAIN GROUP 9, Suppressor of variegation 3-9 homolog protein 5, Su(var)3-9 homolog protein 5
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKKNN
EPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPE
LPWKEVA
;
;QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKKNN
EPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPE
LPWKEVA
;
X,A ? 
2 polydeoxyribonucleotide no no  '(DC)(DT)(DG)(DA)(DG)(DG)(DA)(DG)(DT)(DA)(DT)' CTGAGGAGTAT B   ? 
3 polydeoxyribonucleotide no yes '(DT)(DA)(DC)(DT)(5CM)(DC)(DT)(DC)(DA)(DG)' TACTCCTCAG C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ILE n 
1 3   ILE n 
1 4   GLY n 
1 5   THR n 
1 6   VAL n 
1 7   PRO n 
1 8   GLY n 
1 9   VAL n 
1 10  GLU n 
1 11  VAL n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  PHE n 
1 16  GLN n 
1 17  TYR n 
1 18  ARG n 
1 19  MET n 
1 20  GLU n 
1 21  LEU n 
1 22  ASN n 
1 23  LEU n 
1 24  LEU n 
1 25  GLY n 
1 26  ILE n 
1 27  HIS n 
1 28  ARG n 
1 29  PRO n 
1 30  SER n 
1 31  GLN n 
1 32  SER n 
1 33  GLY n 
1 34  ILE n 
1 35  ASP n 
1 36  TYR n 
1 37  MET n 
1 38  LYS n 
1 39  ASP n 
1 40  ASP n 
1 41  GLY n 
1 42  GLY n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  ALA n 
1 47  THR n 
1 48  SER n 
1 49  ILE n 
1 50  VAL n 
1 51  SER n 
1 52  SER n 
1 53  GLY n 
1 54  GLY n 
1 55  TYR n 
1 56  ASN n 
1 57  ASP n 
1 58  VAL n 
1 59  LEU n 
1 60  ASP n 
1 61  ASN n 
1 62  SER n 
1 63  ASP n 
1 64  VAL n 
1 65  LEU n 
1 66  ILE n 
1 67  TYR n 
1 68  THR n 
1 69  GLY n 
1 70  GLN n 
1 71  GLY n 
1 72  GLY n 
1 73  ASN n 
1 74  VAL n 
1 75  GLY n 
1 76  LYS n 
1 77  LYS n 
1 78  LYS n 
1 79  ASN n 
1 80  ASN n 
1 81  GLU n 
1 82  PRO n 
1 83  PRO n 
1 84  LYS n 
1 85  ASP n 
1 86  GLN n 
1 87  GLN n 
1 88  LEU n 
1 89  VAL n 
1 90  THR n 
1 91  GLY n 
1 92  ASN n 
1 93  LEU n 
1 94  ALA n 
1 95  LEU n 
1 96  LYS n 
1 97  ASN n 
1 98  SER n 
1 99  ILE n 
1 100 ASN n 
1 101 LYS n 
1 102 LYS n 
1 103 ASN n 
1 104 PRO n 
1 105 VAL n 
1 106 ARG n 
1 107 VAL n 
1 108 ILE n 
1 109 ARG n 
1 110 GLY n 
1 111 ILE n 
1 112 LYS n 
1 113 ASN n 
1 114 THR n 
1 115 THR n 
1 116 LEU n 
1 117 GLN n 
1 118 SER n 
1 119 SER n 
1 120 VAL n 
1 121 VAL n 
1 122 ALA n 
1 123 LYS n 
1 124 ASN n 
1 125 TYR n 
1 126 VAL n 
1 127 TYR n 
1 128 ASP n 
1 129 GLY n 
1 130 LEU n 
1 131 TYR n 
1 132 LEU n 
1 133 VAL n 
1 134 GLU n 
1 135 GLU n 
1 136 TYR n 
1 137 TRP n 
1 138 GLU n 
1 139 GLU n 
1 140 THR n 
1 141 GLY n 
1 142 SER n 
1 143 HIS n 
1 144 GLY n 
1 145 LYS n 
1 146 LEU n 
1 147 VAL n 
1 148 PHE n 
1 149 LYS n 
1 150 PHE n 
1 151 LYS n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 ILE n 
1 156 PRO n 
1 157 GLY n 
1 158 GLN n 
1 159 PRO n 
1 160 GLU n 
1 161 LEU n 
1 162 PRO n 
1 163 TRP n 
1 164 LYS n 
1 165 GLU n 
1 166 VAL n 
1 167 ALA n 
2 1   DC  n 
2 2   DT  n 
2 3   DG  n 
2 4   DA  n 
2 5   DG  n 
2 6   DG  n 
2 7   DA  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DT  n 
3 5   5CM n 
3 6   DC  n 
3 7   DT  n 
3 8   DC  n 
3 9   DA  n 
3 10  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'mouse-ear cress,thale-cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'At2g35160, SDG9, SET9, SUVH5, T4C15.17' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta2 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET SUMO' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Chemically Synthesized' 
3 1 sample ? ? ? ? ? 'Chemically Synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SUVH5_ARATH O82175 1 
;QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKKNN
EPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPE
LPWKEVA
;
362 ? 
2 PDB 3Q0F        3Q0F   2 CTGAGGAGTAT 1   ? 
3 PDB 3Q0F        3Q0F   3 TACTCCTCAG 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3Q0F X 1 ? 167 ? O82175 362 ? 528 ? 362 528 
2 1 3Q0F A 1 ? 167 ? O82175 362 ? 528 ? 362 528 
3 2 3Q0F B 1 ? 11  ? 3Q0F   1   ? 11  ? 1   11  
4 3 3Q0F C 1 ? 10  ? 3Q0F   1   ? 10  ? 1   10  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5CM 'DNA linking'       n "5-METHYL-2'-DEOXY-CYTIDINE-5'-MONOPHOSPHATE" ? 'C10 H16 N3 O7 P' 321.224 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3Q0F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_percent_sol   59.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '18% PEG4000, 100 mM Na-cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                
;Cryogenically-cooled single crystal Si(111) side bounce monochromator. Optional Si(311) to achive 13.474 keV. Vertical and horizantal focussing mirrors in Kirkpatrick-Baez geometry.
;
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
'Cryogenically-cooled single crystal Si(111) side bounce monochromator. Optional Si(311) to achive 13.474 keV.' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3Q0F 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   14578 
_reflns.number_all                   14607 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        26 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.7 
_reflns_shell.pdbx_Rsym_value        0.59 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        9.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3Q0F 
_refine.ls_number_reflns_obs                     14466 
_refine.ls_number_reflns_all                     14500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.283 
_refine.ls_d_res_high                            2.750 
_refine.ls_percent_reflns_obs                    99.69 
_refine.ls_R_factor_obs                          0.2315 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2294 
_refine.ls_R_factor_R_free                       0.2732 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.04 
_refine.ls_number_reflns_R_free                  729 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            7.7339 
_refine.aniso_B[2][2]                            7.7339 
_refine.aniso_B[3][3]                            -15.4678 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.290 
_refine.solvent_model_param_bsol                 53.600 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      
'SRA molecule from the SUVH5 SRA-fully methylated CG DNA crystallized in P42212 space group' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.09 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 25.07 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2239 
_refine_hist.pdbx_number_atoms_nucleic_acid   425 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               2682 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        29.283 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 2757 'X-RAY DIFFRACTION' ? 
f_angle_d          1.294  ? ? 3817 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 20.905 ? ? 1040 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 415  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 425  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 X 300 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 A 300 0.026 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 X 64  ?     ? POSITIONAL 2 3 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 A 64  0.030 ? POSITIONAL 2 4 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 X 645 ?     ? POSITIONAL 3 5 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 A 645 0.041 ? POSITIONAL 3 6 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.7500 2.9622  2655 0.2957 100.00 0.3353 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 2.9622 3.2599  2679 0.2555 100.00 0.3349 . . 155 . . . . 'X-RAY DIFFRACTION' 
. 3.2599 3.7308  2734 0.2161 100.00 0.2384 . . 125 . . . . 'X-RAY DIFFRACTION' 
. 3.7308 4.6973  2763 0.1871 100.00 0.2320 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 4.6973 29.2842 2906 0.2351 99.00  0.2798 . . 148 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain X resid 362:399'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain A and resid 362:399' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain X resid 405:414'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain A and resid 405:414' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'chain X resid 424:524'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'chain A and resid 424:524' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  3Q0F 
_struct.title                     'Crystal structure of SUVH5 SRA- methylated CHH DNA complex' 
_struct.pdbx_descriptor           'Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 (E.C.2.1.1.43)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3Q0F 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'SRA, fully methylated CG, SUVH5, 5mC binding domain, Methylated CHH duplex DNA, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 17 ? LEU A 24  ? TYR X 378 LEU X 385 1 ? 8  
HELX_P HELX_P2 2 VAL A 89 ? LYS A 102 ? VAL X 450 LYS X 463 1 ? 14 
HELX_P HELX_P3 3 TYR B 17 ? LEU B 24  ? TYR A 378 LEU A 385 1 ? 8  
HELX_P HELX_P4 4 VAL B 89 ? LYS B 102 ? VAL A 450 LYS A 463 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? D DT  4 "O3'" ? ? ? 1_555 D 5CM 5  P  ? ? C DT  4 C 5CM 5  1_555 ? ? ? ? ? ? ?               1.609 ? 
covale2  covale ? ? D 5CM 5 "O3'" ? ? ? 1_555 D DC  6  P  ? ? C 5CM 5 C DC  6  1_555 ? ? ? ? ? ? ?               1.599 ? 
hydrog1  hydrog ? ? C DC  1 N3    ? ? ? 1_555 D DG  10 N1 ? ? B DC  1 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? C DC  1 N4    ? ? ? 1_555 D DG  10 O6 ? ? B DC  1 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? C DC  1 O2    ? ? ? 1_555 D DG  10 N2 ? ? B DC  1 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? C DT  2 O4    ? ? ? 1_555 D DC  8  N4 ? ? B DT  2 C DC  8  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog5  hydrog ? ? C DT  2 N3    ? ? ? 1_555 D DA  9  N1 ? ? B DT  2 C DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? C DT  2 O4    ? ? ? 1_555 D DA  9  N6 ? ? B DT  2 C DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? C DG  3 N1    ? ? ? 1_555 D DC  8  O2 ? ? B DG  3 C DC  8  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog8  hydrog ? ? C DA  4 N1    ? ? ? 1_555 D DT  7  N3 ? ? B DA  4 C DT  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? C DA  4 N6    ? ? ? 1_555 D DT  7  O4 ? ? B DA  4 C DT  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? C DG  5 N1    ? ? ? 1_555 D DC  6  N3 ? ? B DG  5 C DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? C DG  5 N2    ? ? ? 1_555 D DC  6  O2 ? ? B DG  5 C DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? C DG  5 O6    ? ? ? 1_555 D DC  6  N4 ? ? B DG  5 C DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? C DA  7 N1    ? ? ? 1_555 D DT  4  N3 ? ? B DA  7 C DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? C DA  7 N6    ? ? ? 1_555 D DT  4  O4 ? ? B DA  7 C DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? C DG  8 N1    ? ? ? 1_555 D DC  3  N3 ? ? B DG  8 C DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? C DG  8 N2    ? ? ? 1_555 D DC  3  O2 ? ? B DG  8 C DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? C DG  8 O6    ? ? ? 1_555 D DC  3  N4 ? ? B DG  8 C DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? C DT  9 N3    ? ? ? 1_555 D DA  2  N1 ? ? B DT  9 C DA  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? C DT  9 O4    ? ? ? 1_555 D DA  2  N6 ? ? B DT  9 C DA  2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 40 B . ? ASP 401 A GLY 41 B ? GLY 402 A 1 -0.60 
2 GLY 41 B . ? GLY 402 A GLY 42 B ? GLY 403 A 1 -0.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 14  ? PHE A 15  ? GLU X 375 PHE X 376 
A 2 TYR A 125 ? THR A 140 ? TYR X 486 THR X 501 
A 3 VAL A 105 ? GLY A 110 ? VAL X 466 GLY X 471 
A 4 LEU A 44  ? SER A 51  ? LEU X 405 SER X 412 
A 5 ILE A 34  ? LYS A 38  ? ILE X 395 LYS X 399 
B 1 GLU A 14  ? PHE A 15  ? GLU X 375 PHE X 376 
B 2 TYR A 125 ? THR A 140 ? TYR X 486 THR X 501 
B 3 LEU A 146 ? ARG A 154 ? LEU X 507 ARG X 515 
B 4 VAL A 64  ? THR A 68  ? VAL X 425 THR X 429 
C 1 GLU B 14  ? PHE B 15  ? GLU A 375 PHE A 376 
C 2 TYR B 125 ? THR B 140 ? TYR A 486 THR A 501 
C 3 VAL B 105 ? GLY B 110 ? VAL A 466 GLY A 471 
C 4 LEU B 44  ? SER B 51  ? LEU A 405 SER A 412 
C 5 ILE B 34  ? LYS B 38  ? ILE A 395 LYS A 399 
D 1 GLU B 14  ? PHE B 15  ? GLU A 375 PHE A 376 
D 2 TYR B 125 ? THR B 140 ? TYR A 486 THR A 501 
D 3 LEU B 146 ? ARG B 154 ? LEU A 507 ARG A 515 
D 4 VAL B 64  ? THR B 68  ? VAL A 425 THR A 429 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 15  ? N PHE X 376 O TYR A 125 ? O TYR X 486 
A 2 3 O ASP A 128 ? O ASP X 489 N VAL A 107 ? N VAL X 468 
A 3 4 O ILE A 108 ? O ILE X 469 N SER A 51  ? N SER X 412 
A 4 5 O THR A 47  ? O THR X 408 N ASP A 35  ? N ASP X 396 
B 1 2 N PHE A 15  ? N PHE X 376 O TYR A 125 ? O TYR X 486 
B 2 3 N GLU A 139 ? N GLU X 500 O VAL A 147 ? O VAL X 508 
B 3 4 O PHE A 150 ? O PHE X 511 N TYR A 67  ? N TYR X 428 
C 1 2 N PHE B 15  ? N PHE A 376 O TYR B 125 ? O TYR A 486 
C 2 3 O ASP B 128 ? O ASP A 489 N VAL B 107 ? N VAL A 468 
C 3 4 O ILE B 108 ? O ILE A 469 N SER B 51  ? N SER A 412 
C 4 5 O THR B 47  ? O THR A 408 N ASP B 35  ? N ASP A 396 
D 1 2 N PHE B 15  ? N PHE A 376 O TYR B 125 ? O TYR A 486 
D 2 3 N GLU B 139 ? N GLU A 500 O VAL B 147 ? O VAL A 508 
D 3 4 O PHE B 150 ? O PHE A 511 N TYR B 67  ? N TYR A 428 
# 
_database_PDB_matrix.entry_id          3Q0F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3Q0F 
_atom_sites.fract_transf_matrix[1][1]   0.009712 
_atom_sites.fract_transf_matrix[1][2]   0.005607 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011214 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005865 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLN A 1 1   ? 38.096 -18.593 4.369  1.00 86.66  ? 362 GLN X N     1 
ATOM   2    C CA    . GLN A 1 1   ? 39.360 -18.121 4.931  1.00 96.64  ? 362 GLN X CA    1 
ATOM   3    C C     . GLN A 1 1   ? 40.130 -17.221 3.953  1.00 96.73  ? 362 GLN X C     1 
ATOM   4    O O     . GLN A 1 1   ? 40.895 -17.703 3.117  1.00 94.10  ? 362 GLN X O     1 
ATOM   5    C CB    . GLN A 1 1   ? 40.219 -19.307 5.378  1.00 101.90 ? 362 GLN X CB    1 
ATOM   6    C CG    . GLN A 1 1   ? 41.624 -18.942 5.857  1.00 106.77 ? 362 GLN X CG    1 
ATOM   7    C CD    . GLN A 1 1   ? 41.639 -17.922 6.994  1.00 110.13 ? 362 GLN X CD    1 
ATOM   8    O OE1   . GLN A 1 1   ? 40.959 -16.890 6.941  1.00 106.10 ? 362 GLN X OE1   1 
ATOM   9    N NE2   . GLN A 1 1   ? 42.438 -18.200 8.022  1.00 94.75  ? 362 GLN X NE2   1 
ATOM   10   N N     . ILE A 1 2   ? 39.935 -15.910 4.087  1.00 90.62  ? 363 ILE X N     1 
ATOM   11   C CA    . ILE A 1 2   ? 40.370 -14.937 3.081  1.00 84.18  ? 363 ILE X CA    1 
ATOM   12   C C     . ILE A 1 2   ? 41.670 -14.215 3.425  1.00 73.71  ? 363 ILE X C     1 
ATOM   13   O O     . ILE A 1 2   ? 42.035 -14.090 4.590  1.00 80.57  ? 363 ILE X O     1 
ATOM   14   C CB    . ILE A 1 2   ? 39.287 -13.858 2.875  1.00 83.66  ? 363 ILE X CB    1 
ATOM   15   C CG1   . ILE A 1 2   ? 37.927 -14.510 2.617  1.00 94.77  ? 363 ILE X CG1   1 
ATOM   16   C CG2   . ILE A 1 2   ? 39.659 -12.928 1.736  1.00 77.52  ? 363 ILE X CG2   1 
ATOM   17   C CD1   . ILE A 1 2   ? 36.744 -13.586 2.866  1.00 98.69  ? 363 ILE X CD1   1 
ATOM   18   N N     . ILE A 1 3   ? 42.363 -13.733 2.397  1.00 68.80  ? 364 ILE X N     1 
ATOM   19   C CA    . ILE A 1 3   ? 43.524 -12.868 2.590  1.00 70.83  ? 364 ILE X CA    1 
ATOM   20   C C     . ILE A 1 3   ? 43.225 -11.434 2.152  1.00 72.06  ? 364 ILE X C     1 
ATOM   21   O O     . ILE A 1 3   ? 42.644 -11.214 1.087  1.00 68.67  ? 364 ILE X O     1 
ATOM   22   C CB    . ILE A 1 3   ? 44.755 -13.370 1.822  1.00 58.40  ? 364 ILE X CB    1 
ATOM   23   C CG1   . ILE A 1 3   ? 45.251 -14.685 2.414  1.00 68.87  ? 364 ILE X CG1   1 
ATOM   24   C CG2   . ILE A 1 3   ? 45.865 -12.330 1.863  1.00 58.96  ? 364 ILE X CG2   1 
ATOM   25   C CD1   . ILE A 1 3   ? 46.593 -15.137 1.871  1.00 65.65  ? 364 ILE X CD1   1 
ATOM   26   N N     . GLY A 1 4   ? 43.615 -10.466 2.982  1.00 60.76  ? 365 GLY X N     1 
ATOM   27   C CA    . GLY A 1 4   ? 43.401 -9.065  2.675  1.00 52.77  ? 365 GLY X CA    1 
ATOM   28   C C     . GLY A 1 4   ? 42.006 -8.613  3.050  1.00 50.81  ? 365 GLY X C     1 
ATOM   29   O O     . GLY A 1 4   ? 41.428 -9.115  4.000  1.00 55.60  ? 365 GLY X O     1 
ATOM   30   N N     . THR A 1 5   ? 41.460 -7.669  2.296  1.00 50.86  ? 366 THR X N     1 
ATOM   31   C CA    . THR A 1 5   ? 40.138 -7.131  2.588  1.00 56.49  ? 366 THR X CA    1 
ATOM   32   C C     . THR A 1 5   ? 39.039 -8.178  2.673  1.00 61.82  ? 366 THR X C     1 
ATOM   33   O O     . THR A 1 5   ? 39.040 -9.166  1.947  1.00 69.76  ? 366 THR X O     1 
ATOM   34   C CB    . THR A 1 5   ? 39.721 -6.098  1.545  1.00 60.96  ? 366 THR X CB    1 
ATOM   35   O OG1   . THR A 1 5   ? 40.703 -5.060  1.502  1.00 70.59  ? 366 THR X OG1   1 
ATOM   36   C CG2   . THR A 1 5   ? 38.348 -5.501  1.888  1.00 49.03  ? 366 THR X CG2   1 
ATOM   37   N N     . VAL A 1 6   ? 38.093 -7.932  3.568  1.00 67.61  ? 367 VAL X N     1 
ATOM   38   C CA    . VAL A 1 6   ? 36.941 -8.798  3.739  1.00 71.41  ? 367 VAL X CA    1 
ATOM   39   C C     . VAL A 1 6   ? 35.672 -8.014  3.445  1.00 78.75  ? 367 VAL X C     1 
ATOM   40   O O     . VAL A 1 6   ? 35.418 -6.977  4.053  1.00 73.79  ? 367 VAL X O     1 
ATOM   41   C CB    . VAL A 1 6   ? 36.871 -9.366  5.167  1.00 67.20  ? 367 VAL X CB    1 
ATOM   42   C CG1   . VAL A 1 6   ? 35.499 -9.948  5.433  1.00 78.16  ? 367 VAL X CG1   1 
ATOM   43   C CG2   . VAL A 1 6   ? 37.951 -10.415 5.376  1.00 63.45  ? 367 VAL X CG2   1 
ATOM   44   N N     . PRO A 1 7   ? 34.872 -8.515  2.497  1.00 89.63  ? 368 PRO X N     1 
ATOM   45   C CA    . PRO A 1 7   ? 33.640 -7.883  2.022  1.00 87.57  ? 368 PRO X CA    1 
ATOM   46   C C     . PRO A 1 7   ? 32.813 -7.275  3.150  1.00 84.99  ? 368 PRO X C     1 
ATOM   47   O O     . PRO A 1 7   ? 32.497 -7.964  4.121  1.00 71.25  ? 368 PRO X O     1 
ATOM   48   C CB    . PRO A 1 7   ? 32.884 -9.051  1.394  1.00 84.35  ? 368 PRO X CB    1 
ATOM   49   C CG    . PRO A 1 7   ? 33.960 -9.945  0.886  1.00 89.38  ? 368 PRO X CG    1 
ATOM   50   C CD    . PRO A 1 7   ? 35.126 -9.803  1.828  1.00 87.08  ? 368 PRO X CD    1 
ATOM   51   N N     . GLY A 1 8   ? 32.478 -5.994  3.016  1.00 87.92  ? 369 GLY X N     1 
ATOM   52   C CA    . GLY A 1 8   ? 31.571 -5.332  3.936  1.00 83.06  ? 369 GLY X CA    1 
ATOM   53   C C     . GLY A 1 8   ? 32.162 -4.979  5.287  1.00 83.26  ? 369 GLY X C     1 
ATOM   54   O O     . GLY A 1 8   ? 31.435 -4.647  6.221  1.00 88.70  ? 369 GLY X O     1 
ATOM   55   N N     . VAL A 1 9   ? 33.482 -5.056  5.402  1.00 85.65  ? 370 VAL X N     1 
ATOM   56   C CA    . VAL A 1 9   ? 34.154 -4.630  6.620  1.00 85.05  ? 370 VAL X CA    1 
ATOM   57   C C     . VAL A 1 9   ? 35.072 -3.459  6.305  1.00 78.18  ? 370 VAL X C     1 
ATOM   58   O O     . VAL A 1 9   ? 36.109 -3.615  5.659  1.00 74.69  ? 370 VAL X O     1 
ATOM   59   C CB    . VAL A 1 9   ? 34.967 -5.772  7.275  1.00 85.65  ? 370 VAL X CB    1 
ATOM   60   C CG1   . VAL A 1 9   ? 35.478 -5.342  8.649  1.00 69.19  ? 370 VAL X CG1   1 
ATOM   61   C CG2   . VAL A 1 9   ? 34.125 -7.027  7.397  1.00 75.20  ? 370 VAL X CG2   1 
ATOM   62   N N     . GLU A 1 10  ? 34.684 -2.281  6.764  1.00 65.21  ? 371 GLU X N     1 
ATOM   63   C CA    . GLU A 1 10  ? 35.436 -1.082  6.445  1.00 77.66  ? 371 GLU X CA    1 
ATOM   64   C C     . GLU A 1 10  ? 36.420 -0.737  7.553  1.00 72.47  ? 371 GLU X C     1 
ATOM   65   O O     . GLU A 1 10  ? 36.219 -1.085  8.714  1.00 76.02  ? 371 GLU X O     1 
ATOM   66   C CB    . GLU A 1 10  ? 34.482 0.092   6.196  1.00 83.79  ? 371 GLU X CB    1 
ATOM   67   C CG    . GLU A 1 10  ? 33.279 -0.247  5.316  1.00 92.08  ? 371 GLU X CG    1 
ATOM   68   C CD    . GLU A 1 10  ? 33.675 -0.766  3.941  1.00 106.94 ? 371 GLU X CD    1 
ATOM   69   O OE1   . GLU A 1 10  ? 34.704 -0.299  3.406  1.00 110.93 ? 371 GLU X OE1   1 
ATOM   70   O OE2   . GLU A 1 10  ? 32.956 -1.637  3.392  1.00 98.90  ? 371 GLU X OE2   1 
ATOM   71   N N     . VAL A 1 11  ? 37.493 -0.056  7.186  1.00 63.26  ? 372 VAL X N     1 
ATOM   72   C CA    . VAL A 1 11  ? 38.428 0.458   8.165  1.00 56.29  ? 372 VAL X CA    1 
ATOM   73   C C     . VAL A 1 11  ? 37.675 1.329   9.157  1.00 65.68  ? 372 VAL X C     1 
ATOM   74   O O     . VAL A 1 11  ? 36.883 2.184   8.761  1.00 69.68  ? 372 VAL X O     1 
ATOM   75   C CB    . VAL A 1 11  ? 39.535 1.267   7.488  1.00 55.34  ? 372 VAL X CB    1 
ATOM   76   C CG1   . VAL A 1 11  ? 40.242 2.170   8.477  1.00 53.98  ? 372 VAL X CG1   1 
ATOM   77   C CG2   . VAL A 1 11  ? 40.516 0.333   6.801  1.00 53.06  ? 372 VAL X CG2   1 
ATOM   78   N N     . GLY A 1 12  ? 37.907 1.092   10.447 1.00 61.04  ? 373 GLY X N     1 
ATOM   79   C CA    . GLY A 1 12  ? 37.281 1.876   11.494 1.00 55.78  ? 373 GLY X CA    1 
ATOM   80   C C     . GLY A 1 12  ? 36.042 1.225   12.074 1.00 59.07  ? 373 GLY X C     1 
ATOM   81   O O     . GLY A 1 12  ? 35.474 1.715   13.048 1.00 65.83  ? 373 GLY X O     1 
ATOM   82   N N     . ASP A 1 13  ? 35.616 0.118   11.474 1.00 63.45  ? 374 ASP X N     1 
ATOM   83   C CA    . ASP A 1 13  ? 34.493 -0.646  12.006 1.00 60.54  ? 374 ASP X CA    1 
ATOM   84   C C     . ASP A 1 13  ? 34.826 -1.224  13.381 1.00 64.31  ? 374 ASP X C     1 
ATOM   85   O O     . ASP A 1 13  ? 35.936 -1.689  13.622 1.00 58.08  ? 374 ASP X O     1 
ATOM   86   C CB    . ASP A 1 13  ? 34.091 -1.756  11.037 1.00 68.33  ? 374 ASP X CB    1 
ATOM   87   C CG    . ASP A 1 13  ? 33.263 -1.241  9.856  1.00 84.46  ? 374 ASP X CG    1 
ATOM   88   O OD1   . ASP A 1 13  ? 32.858 -0.055  9.868  1.00 75.73  ? 374 ASP X OD1   1 
ATOM   89   O OD2   . ASP A 1 13  ? 33.012 -2.029  8.914  1.00 83.15  ? 374 ASP X OD2   1 
ATOM   90   N N     . GLU A 1 14  ? 33.859 -1.194  14.288 1.00 66.47  ? 375 GLU X N     1 
ATOM   91   C CA    . GLU A 1 14  ? 34.128 -1.583  15.666 1.00 61.77  ? 375 GLU X CA    1 
ATOM   92   C C     . GLU A 1 14  ? 33.327 -2.780  16.147 1.00 63.91  ? 375 GLU X C     1 
ATOM   93   O O     . GLU A 1 14  ? 32.272 -3.110  15.603 1.00 60.84  ? 375 GLU X O     1 
ATOM   94   C CB    . GLU A 1 14  ? 33.897 -0.404  16.601 1.00 70.70  ? 375 GLU X CB    1 
ATOM   95   C CG    . GLU A 1 14  ? 34.688 0.831   16.219 1.00 77.66  ? 375 GLU X CG    1 
ATOM   96   C CD    . GLU A 1 14  ? 34.489 1.968   17.202 1.00 102.22 ? 375 GLU X CD    1 
ATOM   97   O OE1   . GLU A 1 14  ? 33.446 1.982   17.897 1.00 102.25 ? 375 GLU X OE1   1 
ATOM   98   O OE2   . GLU A 1 14  ? 35.378 2.845   17.279 1.00 108.26 ? 375 GLU X OE2   1 
ATOM   99   N N     . PHE A 1 15  ? 33.846 -3.426  17.183 1.00 65.34  ? 376 PHE X N     1 
ATOM   100  C CA    . PHE A 1 15  ? 33.253 -4.650  17.699 1.00 62.55  ? 376 PHE X CA    1 
ATOM   101  C C     . PHE A 1 15  ? 33.442 -4.785  19.201 1.00 61.70  ? 376 PHE X C     1 
ATOM   102  O O     . PHE A 1 15  ? 34.364 -4.227  19.792 1.00 62.23  ? 376 PHE X O     1 
ATOM   103  C CB    . PHE A 1 15  ? 33.859 -5.858  16.990 1.00 62.24  ? 376 PHE X CB    1 
ATOM   104  C CG    . PHE A 1 15  ? 33.989 -5.677  15.509 1.00 63.38  ? 376 PHE X CG    1 
ATOM   105  C CD1   . PHE A 1 15  ? 32.983 -6.098  14.655 1.00 63.30  ? 376 PHE X CD1   1 
ATOM   106  C CD2   . PHE A 1 15  ? 35.110 -5.065  14.970 1.00 65.15  ? 376 PHE X CD2   1 
ATOM   107  C CE1   . PHE A 1 15  ? 33.094 -5.926  13.299 1.00 60.63  ? 376 PHE X CE1   1 
ATOM   108  C CE2   . PHE A 1 15  ? 35.225 -4.886  13.605 1.00 65.50  ? 376 PHE X CE2   1 
ATOM   109  C CZ    . PHE A 1 15  ? 34.219 -5.317  12.771 1.00 65.90  ? 376 PHE X CZ    1 
ATOM   110  N N     . GLN A 1 16  ? 32.562 -5.554  19.812 1.00 64.25  ? 377 GLN X N     1 
ATOM   111  C CA    . GLN A 1 16  ? 32.576 -5.721  21.245 1.00 62.08  ? 377 GLN X CA    1 
ATOM   112  C C     . GLN A 1 16  ? 33.305 -7.004  21.636 1.00 55.28  ? 377 GLN X C     1 
ATOM   113  O O     . GLN A 1 16  ? 33.881 -7.091  22.712 1.00 63.75  ? 377 GLN X O     1 
ATOM   114  C CB    . GLN A 1 16  ? 31.133 -5.744  21.740 1.00 63.40  ? 377 GLN X CB    1 
ATOM   115  C CG    . GLN A 1 16  ? 30.972 -5.721  23.235 1.00 77.94  ? 377 GLN X CG    1 
ATOM   116  C CD    . GLN A 1 16  ? 29.534 -5.944  23.650 1.00 80.90  ? 377 GLN X CD    1 
ATOM   117  O OE1   . GLN A 1 16  ? 29.229 -6.029  24.839 1.00 82.39  ? 377 GLN X OE1   1 
ATOM   118  N NE2   . GLN A 1 16  ? 28.641 -6.048  22.668 1.00 74.43  ? 377 GLN X NE2   1 
ATOM   119  N N     . TYR A 1 17  ? 33.289 -7.990  20.749 1.00 50.62  ? 378 TYR X N     1 
ATOM   120  C CA    . TYR A 1 17  ? 33.769 -9.323  21.078 1.00 54.53  ? 378 TYR X CA    1 
ATOM   121  C C     . TYR A 1 17  ? 34.634 -9.979  20.009 1.00 60.64  ? 378 TYR X C     1 
ATOM   122  O O     . TYR A 1 17  ? 34.404 -9.822  18.810 1.00 63.27  ? 378 TYR X O     1 
ATOM   123  C CB    . TYR A 1 17  ? 32.585 -10.230 21.412 1.00 52.57  ? 378 TYR X CB    1 
ATOM   124  C CG    . TYR A 1 17  ? 31.874 -9.801  22.659 1.00 58.07  ? 378 TYR X CG    1 
ATOM   125  C CD1   . TYR A 1 17  ? 32.543 -9.766  23.876 1.00 56.44  ? 378 TYR X CD1   1 
ATOM   126  C CD2   . TYR A 1 17  ? 30.544 -9.411  22.627 1.00 63.25  ? 378 TYR X CD2   1 
ATOM   127  C CE1   . TYR A 1 17  ? 31.908 -9.366  25.025 1.00 61.92  ? 378 TYR X CE1   1 
ATOM   128  C CE2   . TYR A 1 17  ? 29.893 -9.010  23.777 1.00 63.46  ? 378 TYR X CE2   1 
ATOM   129  C CZ    . TYR A 1 17  ? 30.580 -8.988  24.974 1.00 70.12  ? 378 TYR X CZ    1 
ATOM   130  O OH    . TYR A 1 17  ? 29.939 -8.582  26.124 1.00 64.75  ? 378 TYR X OH    1 
ATOM   131  N N     . ARG A 1 18  ? 35.619 -10.740 20.462 1.00 49.92  ? 379 ARG X N     1 
ATOM   132  C CA    . ARG A 1 18  ? 36.501 -11.457 19.563 1.00 50.04  ? 379 ARG X CA    1 
ATOM   133  C C     . ARG A 1 18  ? 35.764 -12.393 18.613 1.00 53.16  ? 379 ARG X C     1 
ATOM   134  O O     . ARG A 1 18  ? 36.305 -12.761 17.580 1.00 60.79  ? 379 ARG X O     1 
ATOM   135  C CB    . ARG A 1 18  ? 37.511 -12.262 20.371 1.00 48.78  ? 379 ARG X CB    1 
ATOM   136  C CG    . ARG A 1 18  ? 38.608 -11.433 20.937 1.00 49.92  ? 379 ARG X CG    1 
ATOM   137  C CD    . ARG A 1 18  ? 39.527 -11.016 19.855 1.00 45.84  ? 379 ARG X CD    1 
ATOM   138  N NE    . ARG A 1 18  ? 40.192 -12.167 19.259 1.00 46.86  ? 379 ARG X NE    1 
ATOM   139  C CZ    . ARG A 1 18  ? 41.338 -12.650 19.703 1.00 45.29  ? 379 ARG X CZ    1 
ATOM   140  N NH1   . ARG A 1 18  ? 41.916 -12.078 20.743 1.00 54.94  ? 379 ARG X NH1   1 
ATOM   141  N NH2   . ARG A 1 18  ? 41.902 -13.695 19.122 1.00 49.10  ? 379 ARG X NH2   1 
ATOM   142  N N     . MET A 1 19  ? 34.550 -12.797 18.968 1.00 56.71  ? 380 MET X N     1 
ATOM   143  C CA    . MET A 1 19  ? 33.812 -13.756 18.149 1.00 62.79  ? 380 MET X CA    1 
ATOM   144  C C     . MET A 1 19  ? 33.031 -13.056 17.060 1.00 64.14  ? 380 MET X C     1 
ATOM   145  O O     . MET A 1 19  ? 32.716 -13.658 16.034 1.00 65.30  ? 380 MET X O     1 
ATOM   146  C CB    . MET A 1 19  ? 32.878 -14.637 18.986 1.00 69.16  ? 380 MET X CB    1 
ATOM   147  C CG    . MET A 1 19  ? 33.599 -15.614 19.929 1.00 83.55  ? 380 MET X CG    1 
ATOM   148  S SD    . MET A 1 19  ? 34.796 -16.727 19.133 1.00 86.82  ? 380 MET X SD    1 
ATOM   149  C CE    . MET A 1 19  ? 33.814 -17.443 17.823 1.00 73.95  ? 380 MET X CE    1 
ATOM   150  N N     . GLU A 1 20  ? 32.710 -11.788 17.279 1.00 56.87  ? 381 GLU X N     1 
ATOM   151  C CA    . GLU A 1 20  ? 32.147 -10.991 16.200 1.00 60.33  ? 381 GLU X CA    1 
ATOM   152  C C     . GLU A 1 20  ? 33.108 -11.026 15.013 1.00 63.12  ? 381 GLU X C     1 
ATOM   153  O O     . GLU A 1 20  ? 32.690 -11.165 13.865 1.00 73.36  ? 381 GLU X O     1 
ATOM   154  C CB    . GLU A 1 20  ? 31.897 -9.559  16.660 1.00 57.97  ? 381 GLU X CB    1 
ATOM   155  C CG    . GLU A 1 20  ? 30.617 -9.378  17.467 1.00 62.02  ? 381 GLU X CG    1 
ATOM   156  C CD    . GLU A 1 20  ? 30.635 -8.109  18.301 1.00 77.52  ? 381 GLU X CD    1 
ATOM   157  O OE1   . GLU A 1 20  ? 29.634 -7.358  18.307 1.00 83.26  ? 381 GLU X OE1   1 
ATOM   158  O OE2   . GLU A 1 20  ? 31.666 -7.859  18.952 1.00 78.49  ? 381 GLU X OE2   1 
ATOM   159  N N     . LEU A 1 21  ? 34.402 -10.931 15.307 1.00 57.59  ? 382 LEU X N     1 
ATOM   160  C CA    . LEU A 1 21  ? 35.438 -10.959 14.279 1.00 59.71  ? 382 LEU X CA    1 
ATOM   161  C C     . LEU A 1 21  ? 35.445 -12.289 13.551 1.00 62.11  ? 382 LEU X C     1 
ATOM   162  O O     . LEU A 1 21  ? 35.757 -12.360 12.369 1.00 66.23  ? 382 LEU X O     1 
ATOM   163  C CB    . LEU A 1 21  ? 36.818 -10.726 14.892 1.00 54.70  ? 382 LEU X CB    1 
ATOM   164  C CG    . LEU A 1 21  ? 36.956 -9.550  15.853 1.00 57.63  ? 382 LEU X CG    1 
ATOM   165  C CD1   . LEU A 1 21  ? 38.385 -9.433  16.365 1.00 51.28  ? 382 LEU X CD1   1 
ATOM   166  C CD2   . LEU A 1 21  ? 36.513 -8.271  15.179 1.00 55.06  ? 382 LEU X CD2   1 
ATOM   167  N N     . ASN A 1 22  ? 35.118 -13.347 14.277 1.00 59.55  ? 383 ASN X N     1 
ATOM   168  C CA    . ASN A 1 22  ? 35.049 -14.676 13.709 1.00 61.19  ? 383 ASN X CA    1 
ATOM   169  C C     . ASN A 1 22  ? 33.868 -14.782 12.748 1.00 65.64  ? 383 ASN X C     1 
ATOM   170  O O     . ASN A 1 22  ? 34.009 -15.234 11.610 1.00 63.88  ? 383 ASN X O     1 
ATOM   171  C CB    . ASN A 1 22  ? 34.937 -15.710 14.831 1.00 56.59  ? 383 ASN X CB    1 
ATOM   172  C CG    . ASN A 1 22  ? 34.864 -17.134 14.308 1.00 70.40  ? 383 ASN X CG    1 
ATOM   173  O OD1   . ASN A 1 22  ? 34.074 -17.447 13.417 1.00 75.51  ? 383 ASN X OD1   1 
ATOM   174  N ND2   . ASN A 1 22  ? 35.693 -18.004 14.859 1.00 66.80  ? 383 ASN X ND2   1 
ATOM   175  N N     . LEU A 1 23  ? 32.708 -14.343 13.218 1.00 59.57  ? 384 LEU X N     1 
ATOM   176  C CA    . LEU A 1 23  ? 31.481 -14.383 12.441 1.00 63.82  ? 384 LEU X CA    1 
ATOM   177  C C     . LEU A 1 23  ? 31.575 -13.647 11.111 1.00 73.17  ? 384 LEU X C     1 
ATOM   178  O O     . LEU A 1 23  ? 30.828 -13.943 10.181 1.00 74.35  ? 384 LEU X O     1 
ATOM   179  C CB    . LEU A 1 23  ? 30.331 -13.809 13.268 1.00 68.65  ? 384 LEU X CB    1 
ATOM   180  C CG    . LEU A 1 23  ? 29.409 -14.853 13.904 1.00 70.43  ? 384 LEU X CG    1 
ATOM   181  C CD1   . LEU A 1 23  ? 30.046 -16.232 13.863 1.00 67.03  ? 384 LEU X CD1   1 
ATOM   182  C CD2   . LEU A 1 23  ? 29.029 -14.452 15.321 1.00 64.38  ? 384 LEU X CD2   1 
ATOM   183  N N     . LEU A 1 24  ? 32.483 -12.683 11.025 1.00 71.77  ? 385 LEU X N     1 
ATOM   184  C CA    . LEU A 1 24  ? 32.641 -11.904 9.807  1.00 59.40  ? 385 LEU X CA    1 
ATOM   185  C C     . LEU A 1 24  ? 33.859 -12.368 9.008  1.00 67.54  ? 385 LEU X C     1 
ATOM   186  O O     . LEU A 1 24  ? 34.108 -11.903 7.897  1.00 64.91  ? 385 LEU X O     1 
ATOM   187  C CB    . LEU A 1 24  ? 32.732 -10.420 10.138 1.00 65.64  ? 385 LEU X CB    1 
ATOM   188  C CG    . LEU A 1 24  ? 31.475 -9.868  10.806 1.00 73.47  ? 385 LEU X CG    1 
ATOM   189  C CD1   . LEU A 1 24  ? 31.642 -8.406  11.154 1.00 62.42  ? 385 LEU X CD1   1 
ATOM   190  C CD2   . LEU A 1 24  ? 30.275 -10.068 9.902  1.00 81.81  ? 385 LEU X CD2   1 
ATOM   191  N N     . GLY A 1 25  ? 34.612 -13.301 9.572  1.00 63.02  ? 386 GLY X N     1 
ATOM   192  C CA    . GLY A 1 25  ? 35.749 -13.856 8.867  1.00 66.65  ? 386 GLY X CA    1 
ATOM   193  C C     . GLY A 1 25  ? 36.981 -12.976 8.902  1.00 68.51  ? 386 GLY X C     1 
ATOM   194  O O     . GLY A 1 25  ? 37.903 -13.157 8.116  1.00 66.60  ? 386 GLY X O     1 
ATOM   195  N N     . ILE A 1 26  ? 37.004 -12.018 9.820  1.00 67.72  ? 387 ILE X N     1 
ATOM   196  C CA    . ILE A 1 26  ? 38.159 -11.150 9.979  1.00 58.93  ? 387 ILE X CA    1 
ATOM   197  C C     . ILE A 1 26  ? 39.269 -11.867 10.734 1.00 61.87  ? 387 ILE X C     1 
ATOM   198  O O     . ILE A 1 26  ? 40.442 -11.771 10.388 1.00 66.24  ? 387 ILE X O     1 
ATOM   199  C CB    . ILE A 1 26  ? 37.784 -9.903  10.764 1.00 62.81  ? 387 ILE X CB    1 
ATOM   200  C CG1   . ILE A 1 26  ? 36.508 -9.286  10.196 1.00 68.68  ? 387 ILE X CG1   1 
ATOM   201  C CG2   . ILE A 1 26  ? 38.926 -8.906  10.769 1.00 64.30  ? 387 ILE X CG2   1 
ATOM   202  C CD1   . ILE A 1 26  ? 35.934 -8.201  11.082 1.00 75.37  ? 387 ILE X CD1   1 
ATOM   203  N N     . HIS A 1 27  ? 38.886 -12.592 11.775 1.00 64.94  ? 388 HIS X N     1 
ATOM   204  C CA    . HIS A 1 27  ? 39.846 -13.268 12.625 1.00 59.48  ? 388 HIS X CA    1 
ATOM   205  C C     . HIS A 1 27  ? 39.138 -14.445 13.274 1.00 58.99  ? 388 HIS X C     1 
ATOM   206  O O     . HIS A 1 27  ? 38.112 -14.266 13.926 1.00 64.23  ? 388 HIS X O     1 
ATOM   207  C CB    . HIS A 1 27  ? 40.374 -12.296 13.686 1.00 53.07  ? 388 HIS X CB    1 
ATOM   208  C CG    . HIS A 1 27  ? 41.666 -12.721 14.301 1.00 42.48  ? 388 HIS X CG    1 
ATOM   209  N ND1   . HIS A 1 27  ? 41.753 -13.212 15.580 1.00 48.65  ? 388 HIS X ND1   1 
ATOM   210  C CD2   . HIS A 1 27  ? 42.922 -12.751 13.801 1.00 51.18  ? 388 HIS X CD2   1 
ATOM   211  C CE1   . HIS A 1 27  ? 43.008 -13.517 15.850 1.00 47.30  ? 388 HIS X CE1   1 
ATOM   212  N NE2   . HIS A 1 27  ? 43.738 -13.249 14.785 1.00 57.60  ? 388 HIS X NE2   1 
ATOM   213  N N     . ARG A 1 28  ? 39.671 -15.648 13.089 1.00 61.62  ? 389 ARG X N     1 
ATOM   214  C CA    . ARG A 1 28  ? 38.953 -16.851 13.497 1.00 63.68  ? 389 ARG X CA    1 
ATOM   215  C C     . ARG A 1 28  ? 39.172 -17.257 14.949 1.00 66.51  ? 389 ARG X C     1 
ATOM   216  O O     . ARG A 1 28  ? 38.216 -17.558 15.657 1.00 62.49  ? 389 ARG X O     1 
ATOM   217  C CB    . ARG A 1 28  ? 39.262 -18.019 12.561 1.00 54.41  ? 389 ARG X CB    1 
ATOM   218  C CG    . ARG A 1 28  ? 38.761 -17.802 11.141 1.00 81.82  ? 389 ARG X CG    1 
ATOM   219  C CD    . ARG A 1 28  ? 39.040 -19.008 10.255 1.00 97.15  ? 389 ARG X CD    1 
ATOM   220  N NE    . ARG A 1 28  ? 40.470 -19.272 10.117 1.00 102.70 ? 389 ARG X NE    1 
ATOM   221  C CZ    . ARG A 1 28  ? 40.980 -20.427 9.698  1.00 106.47 ? 389 ARG X CZ    1 
ATOM   222  N NH1   . ARG A 1 28  ? 40.177 -21.435 9.374  1.00 111.70 ? 389 ARG X NH1   1 
ATOM   223  N NH2   . ARG A 1 28  ? 42.295 -20.575 9.606  1.00 99.78  ? 389 ARG X NH2   1 
ATOM   224  N N     . PRO A 1 29  ? 40.429 -17.280 15.402 1.00 59.66  ? 390 PRO X N     1 
ATOM   225  C CA    . PRO A 1 29  ? 40.607 -17.753 16.772 1.00 49.46  ? 390 PRO X CA    1 
ATOM   226  C C     . PRO A 1 29  ? 39.877 -16.866 17.781 1.00 50.48  ? 390 PRO X C     1 
ATOM   227  O O     . PRO A 1 29  ? 39.692 -15.676 17.558 1.00 59.35  ? 390 PRO X O     1 
ATOM   228  C CB    . PRO A 1 29  ? 42.124 -17.687 16.967 1.00 47.15  ? 390 PRO X CB    1 
ATOM   229  C CG    . PRO A 1 29  ? 42.687 -17.757 15.622 1.00 45.21  ? 390 PRO X CG    1 
ATOM   230  C CD    . PRO A 1 29  ? 41.716 -17.011 14.745 1.00 59.57  ? 390 PRO X CD    1 
ATOM   231  N N     . SER A 1 30  ? 39.458 -17.466 18.885 1.00 65.71  ? 391 SER X N     1 
ATOM   232  C CA    . SER A 1 30  ? 38.694 -16.774 19.910 1.00 53.82  ? 391 SER X CA    1 
ATOM   233  C C     . SER A 1 30  ? 39.610 -16.040 20.887 1.00 55.10  ? 391 SER X C     1 
ATOM   234  O O     . SER A 1 30  ? 39.186 -15.109 21.570 1.00 54.92  ? 391 SER X O     1 
ATOM   235  C CB    . SER A 1 30  ? 37.831 -17.782 20.661 1.00 61.19  ? 391 SER X CB    1 
ATOM   236  O OG    . SER A 1 30  ? 38.616 -18.874 21.105 1.00 57.40  ? 391 SER X OG    1 
ATOM   237  N N     . GLN A 1 31  ? 40.868 -16.462 20.945 1.00 53.90  ? 392 GLN X N     1 
ATOM   238  C CA    . GLN A 1 31  ? 41.825 -15.863 21.861 1.00 54.69  ? 392 GLN X CA    1 
ATOM   239  C C     . GLN A 1 31  ? 43.172 -15.605 21.209 1.00 51.99  ? 392 GLN X C     1 
ATOM   240  O O     . GLN A 1 31  ? 43.756 -14.542 21.379 1.00 52.47  ? 392 GLN X O     1 
ATOM   241  C CB    . GLN A 1 31  ? 42.014 -16.755 23.080 1.00 55.32  ? 392 GLN X CB    1 
ATOM   242  C CG    . GLN A 1 31  ? 40.750 -16.943 23.888 1.00 62.50  ? 392 GLN X CG    1 
ATOM   243  C CD    . GLN A 1 31  ? 41.007 -17.616 25.205 1.00 61.25  ? 392 GLN X CD    1 
ATOM   244  O OE1   . GLN A 1 31  ? 40.119 -18.241 25.770 1.00 71.93  ? 392 GLN X OE1   1 
ATOM   245  N NE2   . GLN A 1 31  ? 42.228 -17.493 25.706 1.00 64.53  ? 392 GLN X NE2   1 
ATOM   246  N N     . SER A 1 32  ? 43.668 -16.586 20.469 1.00 54.62  ? 393 SER X N     1 
ATOM   247  C CA    . SER A 1 32  ? 44.978 -16.460 19.854 1.00 52.11  ? 393 SER X CA    1 
ATOM   248  C C     . SER A 1 32  ? 45.050 -15.174 19.033 1.00 57.16  ? 393 SER X C     1 
ATOM   249  O O     . SER A 1 32  ? 44.152 -14.885 18.241 1.00 52.63  ? 393 SER X O     1 
ATOM   250  C CB    . SER A 1 32  ? 45.274 -17.678 18.986 1.00 45.72  ? 393 SER X CB    1 
ATOM   251  O OG    . SER A 1 32  ? 46.574 -17.603 18.424 1.00 63.54  ? 393 SER X OG    1 
ATOM   252  N N     . GLY A 1 33  ? 46.122 -14.407 19.233 1.00 51.36  ? 394 GLY X N     1 
ATOM   253  C CA    . GLY A 1 33  ? 46.283 -13.117 18.588 1.00 48.14  ? 394 GLY X CA    1 
ATOM   254  C C     . GLY A 1 33  ? 46.605 -13.212 17.110 1.00 52.31  ? 394 GLY X C     1 
ATOM   255  O O     . GLY A 1 33  ? 46.321 -12.301 16.345 1.00 51.69  ? 394 GLY X O     1 
ATOM   256  N N     . ILE A 1 34  ? 47.194 -14.329 16.708 1.00 55.42  ? 395 ILE X N     1 
ATOM   257  C CA    . ILE A 1 34  ? 47.593 -14.519 15.329 1.00 50.63  ? 395 ILE X CA    1 
ATOM   258  C C     . ILE A 1 34  ? 46.691 -15.517 14.615 1.00 52.02  ? 395 ILE X C     1 
ATOM   259  O O     . ILE A 1 34  ? 46.360 -16.562 15.166 1.00 60.37  ? 395 ILE X O     1 
ATOM   260  C CB    . ILE A 1 34  ? 49.041 -15.016 15.259 1.00 51.05  ? 395 ILE X CB    1 
ATOM   261  C CG1   . ILE A 1 34  ? 49.946 -14.127 16.128 1.00 43.37  ? 395 ILE X CG1   1 
ATOM   262  C CG2   . ILE A 1 34  ? 49.502 -15.083 13.807 1.00 48.84  ? 395 ILE X CG2   1 
ATOM   263  C CD1   . ILE A 1 34  ? 51.418 -14.536 16.142 1.00 44.16  ? 395 ILE X CD1   1 
ATOM   264  N N     . ASP A 1 35  ? 46.293 -15.191 13.390 1.00 54.14  ? 396 ASP X N     1 
ATOM   265  C CA    . ASP A 1 35  ? 45.475 -16.086 12.574 1.00 48.31  ? 396 ASP X CA    1 
ATOM   266  C C     . ASP A 1 35  ? 46.121 -16.313 11.214 1.00 58.71  ? 396 ASP X C     1 
ATOM   267  O O     . ASP A 1 35  ? 46.592 -15.377 10.577 1.00 62.03  ? 396 ASP X O     1 
ATOM   268  C CB    . ASP A 1 35  ? 44.073 -15.519 12.394 1.00 52.97  ? 396 ASP X CB    1 
ATOM   269  C CG    . ASP A 1 35  ? 43.133 -16.494 11.715 1.00 75.11  ? 396 ASP X CG    1 
ATOM   270  O OD1   . ASP A 1 35  ? 43.475 -17.695 11.639 1.00 76.34  ? 396 ASP X OD1   1 
ATOM   271  O OD2   . ASP A 1 35  ? 42.049 -16.062 11.261 1.00 71.72  ? 396 ASP X OD2   1 
ATOM   272  N N     . TYR A 1 36  ? 46.136 -17.557 10.758 1.00 67.57  ? 397 TYR X N     1 
ATOM   273  C CA    . TYR A 1 36  ? 46.863 -17.887 9.543  1.00 60.97  ? 397 TYR X CA    1 
ATOM   274  C C     . TYR A 1 36  ? 46.202 -18.998 8.753  1.00 64.09  ? 397 TYR X C     1 
ATOM   275  O O     . TYR A 1 36  ? 45.171 -19.529 9.155  1.00 71.51  ? 397 TYR X O     1 
ATOM   276  C CB    . TYR A 1 36  ? 48.278 -18.310 9.898  1.00 57.87  ? 397 TYR X CB    1 
ATOM   277  C CG    . TYR A 1 36  ? 48.312 -19.459 10.859 1.00 59.24  ? 397 TYR X CG    1 
ATOM   278  C CD1   . TYR A 1 36  ? 48.368 -20.771 10.405 1.00 59.74  ? 397 TYR X CD1   1 
ATOM   279  C CD2   . TYR A 1 36  ? 48.283 -19.235 12.226 1.00 59.07  ? 397 TYR X CD2   1 
ATOM   280  C CE1   . TYR A 1 36  ? 48.398 -21.829 11.291 1.00 69.11  ? 397 TYR X CE1   1 
ATOM   281  C CE2   . TYR A 1 36  ? 48.316 -20.282 13.118 1.00 64.51  ? 397 TYR X CE2   1 
ATOM   282  C CZ    . TYR A 1 36  ? 48.372 -21.577 12.649 1.00 71.53  ? 397 TYR X CZ    1 
ATOM   283  O OH    . TYR A 1 36  ? 48.408 -22.613 13.552 1.00 78.01  ? 397 TYR X OH    1 
ATOM   284  N N     . MET A 1 37  ? 46.819 -19.340 7.626  1.00 63.77  ? 398 MET X N     1 
ATOM   285  C CA    . MET A 1 37  ? 46.338 -20.404 6.761  1.00 62.23  ? 398 MET X CA    1 
ATOM   286  C C     . MET A 1 37  ? 47.514 -21.043 6.028  1.00 75.02  ? 398 MET X C     1 
ATOM   287  O O     . MET A 1 37  ? 48.674 -20.689 6.257  1.00 70.36  ? 398 MET X O     1 
ATOM   288  C CB    . MET A 1 37  ? 45.338 -19.848 5.755  1.00 55.22  ? 398 MET X CB    1 
ATOM   289  C CG    . MET A 1 37  ? 45.976 -18.953 4.714  1.00 71.22  ? 398 MET X CG    1 
ATOM   290  S SD    . MET A 1 37  ? 44.787 -18.290 3.535  1.00 94.09  ? 398 MET X SD    1 
ATOM   291  C CE    . MET A 1 37  ? 44.340 -19.770 2.624  1.00 104.94 ? 398 MET X CE    1 
ATOM   292  N N     . LYS A 1 38  ? 47.209 -21.990 5.148  1.00 87.33  ? 399 LYS X N     1 
ATOM   293  C CA    . LYS A 1 38  ? 48.226 -22.612 4.313  1.00 81.49  ? 399 LYS X CA    1 
ATOM   294  C C     . LYS A 1 38  ? 48.111 -22.092 2.890  1.00 80.74  ? 399 LYS X C     1 
ATOM   295  O O     . LYS A 1 38  ? 47.013 -21.972 2.354  1.00 77.79  ? 399 LYS X O     1 
ATOM   296  C CB    . LYS A 1 38  ? 48.086 -24.135 4.346  1.00 79.53  ? 399 LYS X CB    1 
ATOM   297  C CG    . LYS A 1 38  ? 48.447 -24.746 5.695  1.00 90.20  ? 399 LYS X CG    1 
ATOM   298  C CD    . LYS A 1 38  ? 47.958 -26.183 5.833  1.00 105.07 ? 399 LYS X CD    1 
ATOM   299  C CE    . LYS A 1 38  ? 48.326 -26.766 7.197  1.00 108.69 ? 399 LYS X CE    1 
ATOM   300  N NZ    . LYS A 1 38  ? 47.672 -28.086 7.447  1.00 103.60 ? 399 LYS X NZ    1 
ATOM   301  N N     . ASP A 1 39  ? 49.245 -21.770 2.283  1.00 77.11  ? 400 ASP X N     1 
ATOM   302  C CA    . ASP A 1 39  ? 49.248 -21.308 0.902  1.00 87.48  ? 400 ASP X CA    1 
ATOM   303  C C     . ASP A 1 39  ? 49.251 -22.466 -0.101 1.00 98.50  ? 400 ASP X C     1 
ATOM   304  O O     . ASP A 1 39  ? 49.730 -23.565 0.200  1.00 93.10  ? 400 ASP X O     1 
ATOM   305  C CB    . ASP A 1 39  ? 50.449 -20.392 0.643  1.00 87.56  ? 400 ASP X CB    1 
ATOM   306  C CG    . ASP A 1 39  ? 51.785 -21.083 0.891  1.00 93.22  ? 400 ASP X CG    1 
ATOM   307  O OD1   . ASP A 1 39  ? 52.821 -20.555 0.432  1.00 95.32  ? 400 ASP X OD1   1 
ATOM   308  O OD2   . ASP A 1 39  ? 51.804 -22.148 1.542  1.00 84.31  ? 400 ASP X OD2   1 
ATOM   309  N N     . ASP A 1 40  ? 48.688 -22.216 -1.282 1.00 105.64 ? 401 ASP X N     1 
ATOM   310  C CA    . ASP A 1 40  ? 48.942 -23.068 -2.429 1.00 97.50  ? 401 ASP X CA    1 
ATOM   311  C C     . ASP A 1 40  ? 50.449 -23.183 -2.433 1.00 102.31 ? 401 ASP X C     1 
ATOM   312  O O     . ASP A 1 40  ? 51.158 -22.180 -2.506 1.00 111.34 ? 401 ASP X O     1 
ATOM   313  N N     . GLY A 1 41  ? 50.938 -24.409 -2.336 1.00 101.46 ? 402 GLY X N     1 
ATOM   314  C CA    . GLY A 1 41  ? 52.277 -24.651 -1.839 1.00 95.15  ? 402 GLY X CA    1 
ATOM   315  C C     . GLY A 1 41  ? 51.988 -25.401 -0.560 1.00 96.69  ? 402 GLY X C     1 
ATOM   316  O O     . GLY A 1 41  ? 50.961 -26.075 -0.483 1.00 107.33 ? 402 GLY X O     1 
ATOM   317  N N     . GLY A 1 42  ? 52.842 -25.281 0.449  1.00 87.69  ? 403 GLY X N     1 
ATOM   318  C CA    . GLY A 1 42  ? 52.566 -25.944 1.715  1.00 96.41  ? 403 GLY X CA    1 
ATOM   319  C C     . GLY A 1 42  ? 52.519 -25.062 2.957  1.00 90.70  ? 403 GLY X C     1 
ATOM   320  O O     . GLY A 1 42  ? 51.945 -25.447 3.975  1.00 76.59  ? 403 GLY X O     1 
ATOM   321  N N     . GLU A 1 43  ? 53.104 -23.871 2.862  1.00 94.74  ? 404 GLU X N     1 
ATOM   322  C CA    . GLU A 1 43  ? 53.470 -23.081 4.038  1.00 83.41  ? 404 GLU X CA    1 
ATOM   323  C C     . GLU A 1 43  ? 52.368 -22.230 4.683  1.00 73.22  ? 404 GLU X C     1 
ATOM   324  O O     . GLU A 1 43  ? 51.319 -21.966 4.092  1.00 69.25  ? 404 GLU X O     1 
ATOM   325  C CB    . GLU A 1 43  ? 54.688 -22.221 3.723  1.00 81.97  ? 404 GLU X CB    1 
ATOM   326  N N     . LEU A 1 44  ? 52.640 -21.811 5.916  1.00 78.41  ? 405 LEU X N     1 
ATOM   327  C CA    . LEU A 1 44  ? 51.743 -20.962 6.692  1.00 72.25  ? 405 LEU X CA    1 
ATOM   328  C C     . LEU A 1 44  ? 51.941 -19.490 6.370  1.00 67.46  ? 405 LEU X C     1 
ATOM   329  O O     . LEU A 1 44  ? 53.073 -19.019 6.246  1.00 73.45  ? 405 LEU X O     1 
ATOM   330  C CB    . LEU A 1 44  ? 52.021 -21.150 8.180  1.00 65.56  ? 405 LEU X CB    1 
ATOM   331  C CG    . LEU A 1 44  ? 52.011 -22.562 8.757  1.00 67.21  ? 405 LEU X CG    1 
ATOM   332  C CD1   . LEU A 1 44  ? 52.344 -22.523 10.249 1.00 52.10  ? 405 LEU X CD1   1 
ATOM   333  C CD2   . LEU A 1 44  ? 50.656 -23.203 8.509  1.00 72.01  ? 405 LEU X CD2   1 
ATOM   334  N N     . VAL A 1 45  ? 50.842 -18.760 6.238  1.00 58.88  ? 406 VAL X N     1 
ATOM   335  C CA    . VAL A 1 45  ? 50.924 -17.307 6.169  1.00 65.28  ? 406 VAL X CA    1 
ATOM   336  C C     . VAL A 1 45  ? 49.868 -16.648 7.052  1.00 57.67  ? 406 VAL X C     1 
ATOM   337  O O     . VAL A 1 45  ? 48.714 -17.081 7.091  1.00 55.61  ? 406 VAL X O     1 
ATOM   338  C CB    . VAL A 1 45  ? 50.805 -16.767 4.728  1.00 60.29  ? 406 VAL X CB    1 
ATOM   339  C CG1   . VAL A 1 45  ? 51.850 -17.408 3.839  1.00 69.10  ? 406 VAL X CG1   1 
ATOM   340  C CG2   . VAL A 1 45  ? 49.408 -16.996 4.185  1.00 60.72  ? 406 VAL X CG2   1 
ATOM   341  N N     . ALA A 1 46  ? 50.277 -15.599 7.759  1.00 49.09  ? 407 ALA X N     1 
ATOM   342  C CA    . ALA A 1 46  ? 49.367 -14.845 8.605  1.00 48.38  ? 407 ALA X CA    1 
ATOM   343  C C     . ALA A 1 46  ? 48.308 -14.112 7.792  1.00 49.81  ? 407 ALA X C     1 
ATOM   344  O O     . ALA A 1 46  ? 48.562 -13.679 6.674  1.00 53.70  ? 407 ALA X O     1 
ATOM   345  C CB    . ALA A 1 46  ? 50.143 -13.875 9.453  1.00 52.95  ? 407 ALA X CB    1 
ATOM   346  N N     . THR A 1 47  ? 47.117 -13.974 8.356  1.00 48.70  ? 408 THR X N     1 
ATOM   347  C CA    . THR A 1 47  ? 46.036 -13.278 7.672  1.00 53.72  ? 408 THR X CA    1 
ATOM   348  C C     . THR A 1 47  ? 45.494 -12.133 8.527  1.00 53.35  ? 408 THR X C     1 
ATOM   349  O O     . THR A 1 47  ? 44.858 -11.210 8.027  1.00 44.32  ? 408 THR X O     1 
ATOM   350  C CB    . THR A 1 47  ? 44.883 -14.245 7.304  1.00 60.95  ? 408 THR X CB    1 
ATOM   351  O OG1   . THR A 1 47  ? 44.477 -14.985 8.466  1.00 60.51  ? 408 THR X OG1   1 
ATOM   352  C CG2   . THR A 1 47  ? 45.325 -15.209 6.213  1.00 54.38  ? 408 THR X CG2   1 
ATOM   353  N N     . SER A 1 48  ? 45.749 -12.207 9.826  1.00 40.40  ? 409 SER X N     1 
ATOM   354  C CA    . SER A 1 48  ? 45.208 -11.229 10.754 1.00 49.11  ? 409 SER X CA    1 
ATOM   355  C C     . SER A 1 48  ? 45.873 -11.327 12.109 1.00 45.74  ? 409 SER X C     1 
ATOM   356  O O     . SER A 1 48  ? 46.268 -12.395 12.536 1.00 47.15  ? 409 SER X O     1 
ATOM   357  C CB    . SER A 1 48  ? 43.682 -11.359 10.899 1.00 56.65  ? 409 SER X CB    1 
ATOM   358  O OG    . SER A 1 48  ? 43.238 -12.703 10.821 1.00 65.49  ? 409 SER X OG    1 
ATOM   359  N N     . ILE A 1 49  ? 46.029 -10.187 12.761 1.00 45.04  ? 410 ILE X N     1 
ATOM   360  C CA    . ILE A 1 49  ? 46.453 -10.179 14.139 1.00 47.60  ? 410 ILE X CA    1 
ATOM   361  C C     . ILE A 1 49  ? 45.532 -9.292  14.950 1.00 49.16  ? 410 ILE X C     1 
ATOM   362  O O     . ILE A 1 49  ? 44.860 -8.409  14.410 1.00 46.85  ? 410 ILE X O     1 
ATOM   363  C CB    . ILE A 1 49  ? 47.908 -9.734  14.306 1.00 46.74  ? 410 ILE X CB    1 
ATOM   364  C CG1   . ILE A 1 49  ? 48.083 -8.278  13.907 1.00 44.23  ? 410 ILE X CG1   1 
ATOM   365  C CG2   . ILE A 1 49  ? 48.830 -10.606 13.492 1.00 38.82  ? 410 ILE X CG2   1 
ATOM   366  C CD1   . ILE A 1 49  ? 49.532 -7.916  13.694 1.00 43.33  ? 410 ILE X CD1   1 
ATOM   367  N N     . VAL A 1 50  ? 45.476 -9.575  16.244 1.00 44.57  ? 411 VAL X N     1 
ATOM   368  C CA    . VAL A 1 50  ? 44.766 -8.731  17.182 1.00 48.82  ? 411 VAL X CA    1 
ATOM   369  C C     . VAL A 1 50  ? 45.778 -8.191  18.174 1.00 48.75  ? 411 VAL X C     1 
ATOM   370  O O     . VAL A 1 50  ? 46.526 -8.949  18.780 1.00 52.80  ? 411 VAL X O     1 
ATOM   371  C CB    . VAL A 1 50  ? 43.668 -9.506  17.935 1.00 49.89  ? 411 VAL X CB    1 
ATOM   372  C CG1   . VAL A 1 50  ? 43.004 -8.609  18.958 1.00 44.91  ? 411 VAL X CG1   1 
ATOM   373  C CG2   . VAL A 1 50  ? 42.634 -10.051 16.964 1.00 45.19  ? 411 VAL X CG2   1 
ATOM   374  N N     . SER A 1 51  ? 45.827 -6.875  18.315 1.00 55.16  ? 412 SER X N     1 
ATOM   375  C CA    . SER A 1 51  ? 46.648 -6.265  19.353 1.00 56.31  ? 412 SER X CA    1 
ATOM   376  C C     . SER A 1 51  ? 45.745 -5.651  20.400 1.00 58.31  ? 412 SER X C     1 
ATOM   377  O O     . SER A 1 51  ? 45.174 -4.587  20.177 1.00 60.61  ? 412 SER X O     1 
ATOM   378  C CB    . SER A 1 51  ? 47.560 -5.187  18.775 1.00 55.27  ? 412 SER X CB    1 
ATOM   379  O OG    . SER A 1 51  ? 48.596 -4.874  19.689 1.00 68.25  ? 412 SER X OG    1 
ATOM   380  N N     . SER A 1 52  ? 45.581 -6.356  21.518 1.00 68.46  ? 413 SER X N     1 
ATOM   381  C CA    . SER A 1 52  ? 44.924 -5.804  22.698 1.00 69.95  ? 413 SER X CA    1 
ATOM   382  C C     . SER A 1 52  ? 46.045 -5.333  23.612 1.00 76.85  ? 413 SER X C     1 
ATOM   383  O O     . SER A 1 52  ? 46.897 -4.528  23.207 1.00 86.68  ? 413 SER X O     1 
ATOM   384  C CB    . SER A 1 52  ? 44.098 -6.871  23.421 1.00 68.37  ? 413 SER X CB    1 
ATOM   385  O OG    . SER A 1 52  ? 43.675 -7.910  22.547 1.00 67.01  ? 413 SER X OG    1 
ATOM   386  N N     . GLY A 1 53  ? 46.043 -5.854  24.835 1.00 57.29  ? 414 GLY X N     1 
ATOM   387  C CA    . GLY A 1 53  ? 47.188 -5.772  25.723 1.00 67.43  ? 414 GLY X CA    1 
ATOM   388  C C     . GLY A 1 53  ? 47.621 -7.178  26.123 1.00 84.13  ? 414 GLY X C     1 
ATOM   389  O O     . GLY A 1 53  ? 47.034 -8.174  25.686 1.00 79.92  ? 414 GLY X O     1 
ATOM   390  N N     . GLY A 1 54  ? 48.649 -7.278  26.954 1.00 89.47  ? 415 GLY X N     1 
ATOM   391  C CA    . GLY A 1 54  ? 49.116 -8.583  27.388 1.00 96.42  ? 415 GLY X CA    1 
ATOM   392  C C     . GLY A 1 54  ? 50.559 -8.836  27.004 1.00 100.62 ? 415 GLY X C     1 
ATOM   393  O O     . GLY A 1 54  ? 51.439 -8.898  27.866 1.00 107.01 ? 415 GLY X O     1 
ATOM   394  N N     . TYR A 1 55  ? 50.797 -9.005  25.707 1.00 85.85  ? 416 TYR X N     1 
ATOM   395  C CA    . TYR A 1 55  ? 52.152 -9.012  25.182 1.00 72.68  ? 416 TYR X CA    1 
ATOM   396  C C     . TYR A 1 55  ? 52.529 -7.553  25.004 1.00 75.13  ? 416 TYR X C     1 
ATOM   397  O O     . TYR A 1 55  ? 51.666 -6.720  24.716 1.00 82.88  ? 416 TYR X O     1 
ATOM   398  C CB    . TYR A 1 55  ? 52.212 -9.746  23.846 1.00 68.19  ? 416 TYR X CB    1 
ATOM   399  C CG    . TYR A 1 55  ? 51.935 -11.236 23.928 1.00 71.88  ? 416 TYR X CG    1 
ATOM   400  C CD1   . TYR A 1 55  ? 52.975 -12.163 23.870 1.00 71.14  ? 416 TYR X CD1   1 
ATOM   401  C CD2   . TYR A 1 55  ? 50.635 -11.717 24.061 1.00 67.48  ? 416 TYR X CD2   1 
ATOM   402  C CE1   . TYR A 1 55  ? 52.729 -13.526 23.943 1.00 68.54  ? 416 TYR X CE1   1 
ATOM   403  C CE2   . TYR A 1 55  ? 50.377 -13.080 24.134 1.00 67.20  ? 416 TYR X CE2   1 
ATOM   404  C CZ    . TYR A 1 55  ? 51.426 -13.981 24.075 1.00 65.02  ? 416 TYR X CZ    1 
ATOM   405  O OH    . TYR A 1 55  ? 51.170 -15.335 24.146 1.00 52.08  ? 416 TYR X OH    1 
ATOM   406  N N     . ASN A 1 56  ? 53.805 -7.236  25.181 1.00 82.26  ? 417 ASN X N     1 
ATOM   407  C CA    . ASN A 1 56  ? 54.236 -5.835  25.196 1.00 90.45  ? 417 ASN X CA    1 
ATOM   408  C C     . ASN A 1 56  ? 54.386 -5.196  23.812 1.00 84.30  ? 417 ASN X C     1 
ATOM   409  O O     . ASN A 1 56  ? 55.452 -4.677  23.467 1.00 82.70  ? 417 ASN X O     1 
ATOM   410  C CB    . ASN A 1 56  ? 55.523 -5.668  26.014 1.00 93.88  ? 417 ASN X CB    1 
ATOM   411  C CG    . ASN A 1 56  ? 55.261 -5.648  27.512 1.00 98.61  ? 417 ASN X CG    1 
ATOM   412  O OD1   . ASN A 1 56  ? 54.141 -5.896  27.962 1.00 100.83 ? 417 ASN X OD1   1 
ATOM   413  N ND2   . ASN A 1 56  ? 56.295 -5.343  28.289 1.00 105.68 ? 417 ASN X ND2   1 
ATOM   414  N N     . ASP A 1 57  ? 53.303 -5.227  23.035 1.00 75.70  ? 418 ASP X N     1 
ATOM   415  C CA    . ASP A 1 57  ? 53.303 -4.684  21.683 1.00 68.02  ? 418 ASP X CA    1 
ATOM   416  C C     . ASP A 1 57  ? 53.523 -3.181  21.711 1.00 78.16  ? 418 ASP X C     1 
ATOM   417  O O     . ASP A 1 57  ? 52.975 -2.473  22.564 1.00 75.25  ? 418 ASP X O     1 
ATOM   418  C CB    . ASP A 1 57  ? 51.973 -4.963  20.986 1.00 67.49  ? 418 ASP X CB    1 
ATOM   419  C CG    . ASP A 1 57  ? 51.698 -6.440  20.807 1.00 69.68  ? 418 ASP X CG    1 
ATOM   420  O OD1   . ASP A 1 57  ? 50.612 -6.747  20.273 1.00 62.21  ? 418 ASP X OD1   1 
ATOM   421  O OD2   . ASP A 1 57  ? 52.553 -7.283  21.178 1.00 56.95  ? 418 ASP X OD2   1 
ATOM   422  N N     . VAL A 1 58  ? 54.321 -2.698  20.766 1.00 69.38  ? 419 VAL X N     1 
ATOM   423  C CA    . VAL A 1 58  ? 54.521 -1.267  20.597 1.00 69.11  ? 419 VAL X CA    1 
ATOM   424  C C     . VAL A 1 58  ? 53.670 -0.711  19.455 1.00 72.01  ? 419 VAL X C     1 
ATOM   425  O O     . VAL A 1 58  ? 54.036 -0.805  18.278 1.00 55.00  ? 419 VAL X O     1 
ATOM   426  C CB    . VAL A 1 58  ? 55.990 -0.920  20.310 1.00 66.17  ? 419 VAL X CB    1 
ATOM   427  C CG1   . VAL A 1 58  ? 56.188 0.579   20.412 1.00 58.77  ? 419 VAL X CG1   1 
ATOM   428  C CG2   . VAL A 1 58  ? 56.915 -1.665  21.254 1.00 67.08  ? 419 VAL X CG2   1 
ATOM   429  N N     . LEU A 1 59  ? 52.528 -0.140  19.811 1.00 75.60  ? 420 LEU X N     1 
ATOM   430  C CA    . LEU A 1 59  ? 51.753 0.643   18.865 1.00 72.21  ? 420 LEU X CA    1 
ATOM   431  C C     . LEU A 1 59  ? 51.412 2.007   19.449 1.00 83.41  ? 420 LEU X C     1 
ATOM   432  O O     . LEU A 1 59  ? 51.182 2.140   20.649 1.00 96.11  ? 420 LEU X O     1 
ATOM   433  C CB    . LEU A 1 59  ? 50.488 -0.099  18.428 1.00 77.79  ? 420 LEU X CB    1 
ATOM   434  C CG    . LEU A 1 59  ? 49.897 -1.229  19.272 1.00 70.78  ? 420 LEU X CG    1 
ATOM   435  C CD1   . LEU A 1 59  ? 49.596 -0.801  20.703 1.00 70.53  ? 420 LEU X CD1   1 
ATOM   436  C CD2   . LEU A 1 59  ? 48.638 -1.739  18.577 1.00 68.36  ? 420 LEU X CD2   1 
ATOM   437  N N     . ASP A 1 60  ? 51.411 3.024   18.597 1.00 91.97  ? 421 ASP X N     1 
ATOM   438  C CA    . ASP A 1 60  ? 50.972 4.355   18.996 1.00 105.24 ? 421 ASP X CA    1 
ATOM   439  C C     . ASP A 1 60  ? 50.114 4.971   17.900 1.00 105.92 ? 421 ASP X C     1 
ATOM   440  O O     . ASP A 1 60  ? 49.124 4.374   17.476 1.00 104.78 ? 421 ASP X O     1 
ATOM   441  C CB    . ASP A 1 60  ? 52.163 5.257   19.322 1.00 108.08 ? 421 ASP X CB    1 
ATOM   442  C CG    . ASP A 1 60  ? 53.361 4.978   18.446 1.00 97.18  ? 421 ASP X CG    1 
ATOM   443  O OD1   . ASP A 1 60  ? 53.644 5.808   17.556 1.00 110.13 ? 421 ASP X OD1   1 
ATOM   444  O OD2   . ASP A 1 60  ? 54.016 3.930   18.646 1.00 83.83  ? 421 ASP X OD2   1 
ATOM   445  N N     . ASN A 1 61  ? 50.492 6.164   17.447 1.00 103.31 ? 422 ASN X N     1 
ATOM   446  C CA    . ASN A 1 61  ? 49.777 6.821   16.358 1.00 92.10  ? 422 ASN X CA    1 
ATOM   447  C C     . ASN A 1 61  ? 50.663 6.970   15.128 1.00 83.34  ? 422 ASN X C     1 
ATOM   448  O O     . ASN A 1 61  ? 50.814 8.069   14.599 1.00 87.49  ? 422 ASN X O     1 
ATOM   449  C CB    . ASN A 1 61  ? 49.244 8.189   16.797 1.00 90.29  ? 422 ASN X CB    1 
ATOM   450  C CG    . ASN A 1 61  ? 48.425 8.118   18.078 1.00 124.51 ? 422 ASN X CG    1 
ATOM   451  O OD1   . ASN A 1 61  ? 48.816 8.668   19.113 1.00 129.28 ? 422 ASN X OD1   1 
ATOM   452  N ND2   . ASN A 1 61  ? 47.285 7.434   18.018 1.00 124.02 ? 422 ASN X ND2   1 
ATOM   453  N N     . SER A 1 62  ? 51.259 5.865   14.685 1.00 70.40  ? 423 SER X N     1 
ATOM   454  C CA    . SER A 1 62  ? 52.044 5.869   13.453 1.00 65.21  ? 423 SER X CA    1 
ATOM   455  C C     . SER A 1 62  ? 51.702 4.699   12.521 1.00 55.69  ? 423 SER X C     1 
ATOM   456  O O     . SER A 1 62  ? 50.829 3.883   12.819 1.00 53.69  ? 423 SER X O     1 
ATOM   457  C CB    . SER A 1 62  ? 53.544 5.909   13.756 1.00 65.71  ? 423 SER X CB    1 
ATOM   458  O OG    . SER A 1 62  ? 54.067 4.623   14.001 1.00 51.84  ? 423 SER X OG    1 
ATOM   459  N N     . ASP A 1 63  ? 52.384 4.628   11.383 1.00 55.77  ? 424 ASP X N     1 
ATOM   460  C CA    . ASP A 1 63  ? 52.101 3.583   10.409 1.00 53.99  ? 424 ASP X CA    1 
ATOM   461  C C     . ASP A 1 63  ? 52.828 2.296   10.774 1.00 53.82  ? 424 ASP X C     1 
ATOM   462  O O     . ASP A 1 63  ? 52.622 1.261   10.147 1.00 53.07  ? 424 ASP X O     1 
ATOM   463  C CB    . ASP A 1 63  ? 52.462 4.040   8.992  1.00 45.74  ? 424 ASP X CB    1 
ATOM   464  C CG    . ASP A 1 63  ? 53.905 4.460   8.868  1.00 58.30  ? 424 ASP X CG    1 
ATOM   465  O OD1   . ASP A 1 63  ? 54.466 4.938   9.871  1.00 56.46  ? 424 ASP X OD1   1 
ATOM   466  O OD2   . ASP A 1 63  ? 54.480 4.320   7.766  1.00 59.87  ? 424 ASP X OD2   1 
ATOM   467  N N     . VAL A 1 64  ? 53.666 2.366   11.801 1.00 51.30  ? 425 VAL X N     1 
ATOM   468  C CA    . VAL A 1 64  ? 54.415 1.201   12.244 1.00 47.15  ? 425 VAL X CA    1 
ATOM   469  C C     . VAL A 1 64  ? 53.925 0.612   13.565 1.00 47.47  ? 425 VAL X C     1 
ATOM   470  O O     . VAL A 1 64  ? 53.607 1.322   14.515 1.00 57.90  ? 425 VAL X O     1 
ATOM   471  C CB    . VAL A 1 64  ? 55.914 1.484   12.335 1.00 47.67  ? 425 VAL X CB    1 
ATOM   472  C CG1   . VAL A 1 64  ? 56.629 0.308   12.983 1.00 44.82  ? 425 VAL X CG1   1 
ATOM   473  C CG2   . VAL A 1 64  ? 56.473 1.742   10.956 1.00 48.58  ? 425 VAL X CG2   1 
ATOM   474  N N     . LEU A 1 65  ? 53.883 -0.709  13.603 1.00 51.59  ? 426 LEU X N     1 
ATOM   475  C CA    . LEU A 1 65  ? 53.425 -1.448  14.758 1.00 43.42  ? 426 LEU X CA    1 
ATOM   476  C C     . LEU A 1 65  ? 54.434 -2.552  15.046 1.00 41.08  ? 426 LEU X C     1 
ATOM   477  O O     . LEU A 1 65  ? 54.768 -3.303  14.158 1.00 43.01  ? 426 LEU X O     1 
ATOM   478  C CB    . LEU A 1 65  ? 52.056 -2.032  14.436 1.00 44.71  ? 426 LEU X CB    1 
ATOM   479  C CG    . LEU A 1 65  ? 51.516 -3.277  15.134 1.00 56.76  ? 426 LEU X CG    1 
ATOM   480  C CD1   . LEU A 1 65  ? 51.462 -3.102  16.639 1.00 61.35  ? 426 LEU X CD1   1 
ATOM   481  C CD2   . LEU A 1 65  ? 50.131 -3.573  14.597 1.00 58.87  ? 426 LEU X CD2   1 
ATOM   482  N N     . ILE A 1 66  ? 54.953 -2.624  16.271 1.00 44.33  ? 427 ILE X N     1 
ATOM   483  C CA    . ILE A 1 66  ? 55.772 -3.770  16.674 1.00 45.80  ? 427 ILE X CA    1 
ATOM   484  C C     . ILE A 1 66  ? 54.921 -4.785  17.409 1.00 45.81  ? 427 ILE X C     1 
ATOM   485  O O     . ILE A 1 66  ? 54.338 -4.471  18.435 1.00 47.57  ? 427 ILE X O     1 
ATOM   486  C CB    . ILE A 1 66  ? 56.904 -3.388  17.612 1.00 52.12  ? 427 ILE X CB    1 
ATOM   487  C CG1   . ILE A 1 66  ? 57.666 -2.170  17.084 1.00 45.43  ? 427 ILE X CG1   1 
ATOM   488  C CG2   . ILE A 1 66  ? 57.828 -4.583  17.811 1.00 43.30  ? 427 ILE X CG2   1 
ATOM   489  C CD1   . ILE A 1 66  ? 58.371 -2.416  15.778 1.00 52.82  ? 427 ILE X CD1   1 
ATOM   490  N N     . TYR A 1 67  ? 54.849 -6.004  16.890 1.00 44.20  ? 428 TYR X N     1 
ATOM   491  C CA    . TYR A 1 67  ? 53.962 -7.010  17.460 1.00 40.35  ? 428 TYR X CA    1 
ATOM   492  C C     . TYR A 1 67  ? 54.789 -8.126  18.056 1.00 46.00  ? 428 TYR X C     1 
ATOM   493  O O     . TYR A 1 67  ? 55.762 -8.572  17.454 1.00 44.72  ? 428 TYR X O     1 
ATOM   494  C CB    . TYR A 1 67  ? 53.079 -7.560  16.367 1.00 39.88  ? 428 TYR X CB    1 
ATOM   495  C CG    . TYR A 1 67  ? 51.903 -8.388  16.799 1.00 40.49  ? 428 TYR X CG    1 
ATOM   496  C CD1   . TYR A 1 67  ? 50.756 -7.793  17.302 1.00 39.37  ? 428 TYR X CD1   1 
ATOM   497  C CD2   . TYR A 1 67  ? 51.905 -9.765  16.624 1.00 45.55  ? 428 TYR X CD2   1 
ATOM   498  C CE1   . TYR A 1 67  ? 49.657 -8.551  17.669 1.00 40.58  ? 428 TYR X CE1   1 
ATOM   499  C CE2   . TYR A 1 67  ? 50.816 -10.533 16.996 1.00 43.78  ? 428 TYR X CE2   1 
ATOM   500  C CZ    . TYR A 1 67  ? 49.695 -9.917  17.511 1.00 43.95  ? 428 TYR X CZ    1 
ATOM   501  O OH    . TYR A 1 67  ? 48.611 -10.669 17.865 1.00 48.38  ? 428 TYR X OH    1 
ATOM   502  N N     . THR A 1 68  ? 54.414 -8.562  19.251 1.00 42.84  ? 429 THR X N     1 
ATOM   503  C CA    . THR A 1 68  ? 55.141 -9.616  19.931 1.00 46.26  ? 429 THR X CA    1 
ATOM   504  C C     . THR A 1 68  ? 54.615 -10.977 19.500 1.00 51.60  ? 429 THR X C     1 
ATOM   505  O O     . THR A 1 68  ? 53.415 -11.146 19.304 1.00 49.90  ? 429 THR X O     1 
ATOM   506  C CB    . THR A 1 68  ? 55.000 -9.481  21.443 1.00 49.74  ? 429 THR X CB    1 
ATOM   507  O OG1   . THR A 1 68  ? 55.278 -8.130  21.825 1.00 56.00  ? 429 THR X OG1   1 
ATOM   508  C CG2   . THR A 1 68  ? 55.963 -10.415 22.150 1.00 46.89  ? 429 THR X CG2   1 
ATOM   509  N N     . GLY A 1 69  ? 55.513 -11.945 19.347 1.00 47.97  ? 430 GLY X N     1 
ATOM   510  C CA    . GLY A 1 69  ? 55.099 -13.293 19.005 1.00 49.39  ? 430 GLY X CA    1 
ATOM   511  C C     . GLY A 1 69  ? 54.471 -13.995 20.193 1.00 50.19  ? 430 GLY X C     1 
ATOM   512  O O     . GLY A 1 69  ? 54.525 -13.491 21.307 1.00 52.21  ? 430 GLY X O     1 
ATOM   513  N N     . GLN A 1 70  ? 53.874 -15.161 19.973 1.00 54.25  ? 431 GLN X N     1 
ATOM   514  C CA    . GLN A 1 70  ? 53.227 -15.876 21.070 1.00 56.07  ? 431 GLN X CA    1 
ATOM   515  C C     . GLN A 1 70  ? 54.101 -16.971 21.680 1.00 53.59  ? 431 GLN X C     1 
ATOM   516  O O     . GLN A 1 70  ? 55.002 -17.497 21.028 1.00 58.06  ? 431 GLN X O     1 
ATOM   517  C CB    . GLN A 1 70  ? 51.878 -16.438 20.623 1.00 53.14  ? 431 GLN X CB    1 
ATOM   518  C CG    . GLN A 1 70  ? 51.966 -17.370 19.445 1.00 62.67  ? 431 GLN X CG    1 
ATOM   519  C CD    . GLN A 1 70  ? 50.664 -17.479 18.703 1.00 55.44  ? 431 GLN X CD    1 
ATOM   520  O OE1   . GLN A 1 70  ? 49.679 -16.832 19.056 1.00 52.17  ? 431 GLN X OE1   1 
ATOM   521  N NE2   . GLN A 1 70  ? 50.650 -18.298 17.656 1.00 55.92  ? 431 GLN X NE2   1 
ATOM   522  N N     . GLY A 1 71  ? 53.838 -17.295 22.943 1.00 47.54  ? 432 GLY X N     1 
ATOM   523  C CA    . GLY A 1 71  ? 54.546 -18.375 23.609 1.00 55.25  ? 432 GLY X CA    1 
ATOM   524  C C     . GLY A 1 71  ? 55.315 -18.024 24.867 1.00 58.88  ? 432 GLY X C     1 
ATOM   525  O O     . GLY A 1 71  ? 55.446 -16.857 25.217 1.00 71.12  ? 432 GLY X O     1 
ATOM   526  N N     . GLY A 1 72  ? 55.810 -19.058 25.545 1.00 61.93  ? 433 GLY X N     1 
ATOM   527  C CA    . GLY A 1 72  ? 56.662 -18.933 26.719 1.00 73.44  ? 433 GLY X CA    1 
ATOM   528  C C     . GLY A 1 72  ? 56.288 -17.967 27.836 1.00 83.57  ? 433 GLY X C     1 
ATOM   529  O O     . GLY A 1 72  ? 56.982 -17.921 28.850 1.00 92.87  ? 433 GLY X O     1 
ATOM   530  N N     . ASN A 1 73  ? 55.194 -17.226 27.659 1.00 86.93  ? 434 ASN X N     1 
ATOM   531  C CA    . ASN A 1 73  ? 54.846 -16.061 28.485 1.00 91.49  ? 434 ASN X CA    1 
ATOM   532  C C     . ASN A 1 73  ? 55.476 -14.766 27.968 1.00 99.04  ? 434 ASN X C     1 
ATOM   533  O O     . ASN A 1 73  ? 54.772 -13.815 27.623 1.00 105.43 ? 434 ASN X O     1 
ATOM   534  C CB    . ASN A 1 73  ? 55.213 -16.263 29.952 1.00 86.64  ? 434 ASN X CB    1 
ATOM   535  C CG    . ASN A 1 73  ? 54.482 -17.424 30.575 1.00 107.36 ? 434 ASN X CG    1 
ATOM   536  O OD1   . ASN A 1 73  ? 54.678 -18.578 30.186 1.00 103.50 ? 434 ASN X OD1   1 
ATOM   537  N ND2   . ASN A 1 73  ? 53.631 -17.129 31.557 1.00 107.06 ? 434 ASN X ND2   1 
ATOM   538  N N     . PRO A 1 82  ? 56.406 -21.137 34.383 1.00 112.62 ? 443 PRO X N     1 
ATOM   539  C CA    . PRO A 1 82  ? 57.849 -21.069 34.116 1.00 111.47 ? 443 PRO X CA    1 
ATOM   540  C C     . PRO A 1 82  ? 58.166 -20.687 32.668 1.00 104.73 ? 443 PRO X C     1 
ATOM   541  O O     . PRO A 1 82  ? 57.742 -21.381 31.740 1.00 102.10 ? 443 PRO X O     1 
ATOM   542  C CB    . PRO A 1 82  ? 58.325 -22.494 34.410 1.00 107.11 ? 443 PRO X CB    1 
ATOM   543  C CG    . PRO A 1 82  ? 57.340 -23.012 35.408 1.00 112.45 ? 443 PRO X CG    1 
ATOM   544  C CD    . PRO A 1 82  ? 56.019 -22.407 35.022 1.00 112.41 ? 443 PRO X CD    1 
ATOM   545  N N     . PRO A 1 83  ? 58.918 -19.590 32.481 1.00 94.08  ? 444 PRO X N     1 
ATOM   546  C CA    . PRO A 1 83  ? 59.244 -18.991 31.179 1.00 93.73  ? 444 PRO X CA    1 
ATOM   547  C C     . PRO A 1 83  ? 60.130 -19.875 30.301 1.00 86.97  ? 444 PRO X C     1 
ATOM   548  O O     . PRO A 1 83  ? 60.980 -20.600 30.818 1.00 85.07  ? 444 PRO X O     1 
ATOM   549  C CB    . PRO A 1 83  ? 60.002 -17.711 31.561 1.00 91.49  ? 444 PRO X CB    1 
ATOM   550  C CG    . PRO A 1 83  ? 59.660 -17.458 32.997 1.00 88.21  ? 444 PRO X CG    1 
ATOM   551  C CD    . PRO A 1 83  ? 59.465 -18.807 33.600 1.00 85.01  ? 444 PRO X CD    1 
ATOM   552  N N     . LYS A 1 84  ? 59.934 -19.797 28.987 1.00 79.25  ? 445 LYS X N     1 
ATOM   553  C CA    . LYS A 1 84  ? 60.742 -20.556 28.030 1.00 82.55  ? 445 LYS X CA    1 
ATOM   554  C C     . LYS A 1 84  ? 60.815 -19.861 26.665 1.00 75.48  ? 445 LYS X C     1 
ATOM   555  O O     . LYS A 1 84  ? 60.009 -18.980 26.362 1.00 83.88  ? 445 LYS X O     1 
ATOM   556  C CB    . LYS A 1 84  ? 60.168 -21.960 27.864 1.00 78.34  ? 445 LYS X CB    1 
ATOM   557  C CG    . LYS A 1 84  ? 58.652 -21.996 27.936 1.00 77.54  ? 445 LYS X CG    1 
ATOM   558  C CD    . LYS A 1 84  ? 58.099 -23.373 27.613 1.00 85.75  ? 445 LYS X CD    1 
ATOM   559  C CE    . LYS A 1 84  ? 57.985 -23.592 26.119 1.00 93.66  ? 445 LYS X CE    1 
ATOM   560  N NZ    . LYS A 1 84  ? 56.997 -24.663 25.796 1.00 83.57  ? 445 LYS X NZ    1 
ATOM   561  N N     . ASP A 1 85  ? 61.777 -20.262 25.840 1.00 61.43  ? 446 ASP X N     1 
ATOM   562  C CA    . ASP A 1 85  ? 61.935 -19.667 24.512 1.00 69.44  ? 446 ASP X CA    1 
ATOM   563  C C     . ASP A 1 85  ? 60.678 -19.823 23.667 1.00 68.23  ? 446 ASP X C     1 
ATOM   564  O O     . ASP A 1 85  ? 60.017 -20.856 23.709 1.00 72.49  ? 446 ASP X O     1 
ATOM   565  C CB    . ASP A 1 85  ? 63.121 -20.277 23.758 1.00 58.18  ? 446 ASP X CB    1 
ATOM   566  C CG    . ASP A 1 85  ? 64.454 -19.984 24.422 1.00 77.20  ? 446 ASP X CG    1 
ATOM   567  O OD1   . ASP A 1 85  ? 64.502 -19.119 25.324 1.00 80.35  ? 446 ASP X OD1   1 
ATOM   568  O OD2   . ASP A 1 85  ? 65.457 -20.626 24.038 1.00 77.20  ? 446 ASP X OD2   1 
ATOM   569  N N     . GLN A 1 86  ? 60.351 -18.784 22.906 1.00 65.72  ? 447 GLN X N     1 
ATOM   570  C CA    . GLN A 1 86  ? 59.242 -18.855 21.977 1.00 57.15  ? 447 GLN X CA    1 
ATOM   571  C C     . GLN A 1 86  ? 59.702 -19.685 20.809 1.00 56.52  ? 447 GLN X C     1 
ATOM   572  O O     . GLN A 1 86  ? 60.900 -19.794 20.557 1.00 64.81  ? 447 GLN X O     1 
ATOM   573  C CB    . GLN A 1 86  ? 58.838 -17.462 21.503 1.00 50.87  ? 447 GLN X CB    1 
ATOM   574  C CG    . GLN A 1 86  ? 58.162 -16.620 22.563 1.00 55.17  ? 447 GLN X CG    1 
ATOM   575  C CD    . GLN A 1 86  ? 57.547 -15.361 21.994 1.00 54.49  ? 447 GLN X CD    1 
ATOM   576  O OE1   . GLN A 1 86  ? 57.834 -14.971 20.865 1.00 58.04  ? 447 GLN X OE1   1 
ATOM   577  N NE2   . GLN A 1 86  ? 56.685 -14.726 22.769 1.00 45.22  ? 447 GLN X NE2   1 
ATOM   578  N N     . GLN A 1 87  ? 58.759 -20.265 20.083 1.00 60.46  ? 448 GLN X N     1 
ATOM   579  C CA    . GLN A 1 87  ? 59.127 -21.145 18.986 1.00 61.43  ? 448 GLN X CA    1 
ATOM   580  C C     . GLN A 1 87  ? 58.629 -20.624 17.655 1.00 61.44  ? 448 GLN X C     1 
ATOM   581  O O     . GLN A 1 87  ? 57.532 -20.083 17.549 1.00 54.90  ? 448 GLN X O     1 
ATOM   582  C CB    . GLN A 1 87  ? 58.607 -22.569 19.230 1.00 67.40  ? 448 GLN X CB    1 
ATOM   583  C CG    . GLN A 1 87  ? 59.063 -23.180 20.558 1.00 73.37  ? 448 GLN X CG    1 
ATOM   584  C CD    . GLN A 1 87  ? 60.568 -23.442 20.604 1.00 90.93  ? 448 GLN X CD    1 
ATOM   585  O OE1   . GLN A 1 87  ? 61.129 -23.737 21.664 1.00 81.82  ? 448 GLN X OE1   1 
ATOM   586  N NE2   . GLN A 1 87  ? 61.228 -23.334 19.450 1.00 91.65  ? 448 GLN X NE2   1 
ATOM   587  N N     . LEU A 1 88  ? 59.451 -20.792 16.631 1.00 64.85  ? 449 LEU X N     1 
ATOM   588  C CA    . LEU A 1 88  ? 59.055 -20.415 15.296 1.00 52.08  ? 449 LEU X CA    1 
ATOM   589  C C     . LEU A 1 88  ? 58.047 -21.430 14.777 1.00 58.84  ? 449 LEU X C     1 
ATOM   590  O O     . LEU A 1 88  ? 58.357 -22.233 13.904 1.00 64.45  ? 449 LEU X O     1 
ATOM   591  C CB    . LEU A 1 88  ? 60.282 -20.365 14.395 1.00 65.22  ? 449 LEU X CB    1 
ATOM   592  C CG    . LEU A 1 88  ? 60.273 -19.261 13.339 1.00 73.69  ? 449 LEU X CG    1 
ATOM   593  C CD1   . LEU A 1 88  ? 59.599 -18.001 13.898 1.00 63.26  ? 449 LEU X CD1   1 
ATOM   594  C CD2   . LEU A 1 88  ? 61.693 -18.974 12.866 1.00 62.35  ? 449 LEU X CD2   1 
ATOM   595  N N     . VAL A 1 89  ? 56.839 -21.403 15.326 1.00 54.11  ? 450 VAL X N     1 
ATOM   596  C CA    . VAL A 1 89  ? 55.801 -22.340 14.912 1.00 55.97  ? 450 VAL X CA    1 
ATOM   597  C C     . VAL A 1 89  ? 54.448 -21.654 14.845 1.00 56.66  ? 450 VAL X C     1 
ATOM   598  O O     . VAL A 1 89  ? 54.272 -20.558 15.374 1.00 62.63  ? 450 VAL X O     1 
ATOM   599  C CB    . VAL A 1 89  ? 55.699 -23.579 15.859 1.00 66.62  ? 450 VAL X CB    1 
ATOM   600  C CG1   . VAL A 1 89  ? 57.036 -24.293 15.951 1.00 62.22  ? 450 VAL X CG1   1 
ATOM   601  C CG2   . VAL A 1 89  ? 55.187 -23.196 17.267 1.00 44.13  ? 450 VAL X CG2   1 
ATOM   602  N N     . THR A 1 90  ? 53.497 -22.307 14.189 1.00 55.41  ? 451 THR X N     1 
ATOM   603  C CA    . THR A 1 90  ? 52.143 -21.795 14.106 1.00 53.56  ? 451 THR X CA    1 
ATOM   604  C C     . THR A 1 90  ? 52.121 -20.323 13.700 1.00 56.02  ? 451 THR X C     1 
ATOM   605  O O     . THR A 1 90  ? 52.724 -19.939 12.696 1.00 60.04  ? 451 THR X O     1 
ATOM   606  C CB    . THR A 1 90  ? 51.422 -21.961 15.454 1.00 71.34  ? 451 THR X CB    1 
ATOM   607  O OG1   . THR A 1 90  ? 52.091 -21.185 16.458 1.00 78.25  ? 451 THR X OG1   1 
ATOM   608  C CG2   . THR A 1 90  ? 51.411 -23.425 15.878 1.00 61.36  ? 451 THR X CG2   1 
ATOM   609  N N     . GLY A 1 91  ? 51.419 -19.509 14.487 1.00 57.34  ? 452 GLY X N     1 
ATOM   610  C CA    . GLY A 1 91  ? 51.329 -18.077 14.262 1.00 48.35  ? 452 GLY X CA    1 
ATOM   611  C C     . GLY A 1 91  ? 52.672 -17.404 14.049 1.00 54.31  ? 452 GLY X C     1 
ATOM   612  O O     . GLY A 1 91  ? 52.867 -16.734 13.046 1.00 57.21  ? 452 GLY X O     1 
ATOM   613  N N     . ASN A 1 92  ? 53.600 -17.578 14.982 1.00 46.31  ? 453 ASN X N     1 
ATOM   614  C CA    . ASN A 1 92  ? 54.915 -16.978 14.846 1.00 45.12  ? 453 ASN X CA    1 
ATOM   615  C C     . ASN A 1 92  ? 55.506 -17.260 13.482 1.00 52.65  ? 453 ASN X C     1 
ATOM   616  O O     . ASN A 1 92  ? 55.937 -16.348 12.783 1.00 58.93  ? 453 ASN X O     1 
ATOM   617  C CB    . ASN A 1 92  ? 55.860 -17.462 15.946 1.00 46.87  ? 453 ASN X CB    1 
ATOM   618  C CG    . ASN A 1 92  ? 55.448 -16.972 17.313 1.00 52.14  ? 453 ASN X CG    1 
ATOM   619  O OD1   . ASN A 1 92  ? 54.541 -16.150 17.439 1.00 51.62  ? 453 ASN X OD1   1 
ATOM   620  N ND2   . ASN A 1 92  ? 56.107 -17.476 18.349 1.00 51.84  ? 453 ASN X ND2   1 
ATOM   621  N N     . LEU A 1 93  ? 55.513 -18.529 13.103 1.00 53.52  ? 454 LEU X N     1 
ATOM   622  C CA    . LEU A 1 93  ? 56.046 -18.936 11.816 1.00 50.99  ? 454 LEU X CA    1 
ATOM   623  C C     . LEU A 1 93  ? 55.245 -18.295 10.681 1.00 53.48  ? 454 LEU X C     1 
ATOM   624  O O     . LEU A 1 93  ? 55.806 -17.721 9.757  1.00 51.34  ? 454 LEU X O     1 
ATOM   625  C CB    . LEU A 1 93  ? 56.015 -20.459 11.704 1.00 57.43  ? 454 LEU X CB    1 
ATOM   626  C CG    . LEU A 1 93  ? 56.429 -21.040 10.356 1.00 64.39  ? 454 LEU X CG    1 
ATOM   627  C CD1   . LEU A 1 93  ? 57.828 -20.565 9.965  1.00 62.49  ? 454 LEU X CD1   1 
ATOM   628  C CD2   . LEU A 1 93  ? 56.356 -22.541 10.412 1.00 49.59  ? 454 LEU X CD2   1 
ATOM   629  N N     . ALA A 1 94  ? 53.925 -18.394 10.763 1.00 54.52  ? 455 ALA X N     1 
ATOM   630  C CA    . ALA A 1 94  ? 53.050 -17.771 9.778  1.00 52.47  ? 455 ALA X CA    1 
ATOM   631  C C     . ALA A 1 94  ? 53.462 -16.327 9.488  1.00 61.29  ? 455 ALA X C     1 
ATOM   632  O O     . ALA A 1 94  ? 53.606 -15.942 8.328  1.00 53.06  ? 455 ALA X O     1 
ATOM   633  C CB    . ALA A 1 94  ? 51.602 -17.828 10.244 1.00 42.67  ? 455 ALA X CB    1 
ATOM   634  N N     . LEU A 1 95  ? 53.637 -15.529 10.544 1.00 58.04  ? 456 LEU X N     1 
ATOM   635  C CA    . LEU A 1 95  ? 54.037 -14.133 10.394 1.00 50.80  ? 456 LEU X CA    1 
ATOM   636  C C     . LEU A 1 95  ? 55.359 -14.012 9.658  1.00 53.85  ? 456 LEU X C     1 
ATOM   637  O O     . LEU A 1 95  ? 55.457 -13.279 8.683  1.00 58.27  ? 456 LEU X O     1 
ATOM   638  C CB    . LEU A 1 95  ? 54.133 -13.418 11.746 1.00 54.57  ? 456 LEU X CB    1 
ATOM   639  C CG    . LEU A 1 95  ? 52.876 -12.736 12.298 1.00 49.77  ? 456 LEU X CG    1 
ATOM   640  C CD1   . LEU A 1 95  ? 53.149 -12.156 13.663 1.00 43.32  ? 456 LEU X CD1   1 
ATOM   641  C CD2   . LEU A 1 95  ? 52.323 -11.655 11.372 1.00 39.21  ? 456 LEU X CD2   1 
ATOM   642  N N     . LYS A 1 96  ? 56.375 -14.728 10.120 1.00 53.95  ? 457 LYS X N     1 
ATOM   643  C CA    . LYS A 1 96  ? 57.661 -14.715 9.435  1.00 57.27  ? 457 LYS X CA    1 
ATOM   644  C C     . LYS A 1 96  ? 57.532 -15.014 7.943  1.00 54.17  ? 457 LYS X C     1 
ATOM   645  O O     . LYS A 1 96  ? 58.154 -14.350 7.115  1.00 59.21  ? 457 LYS X O     1 
ATOM   646  C CB    . LYS A 1 96  ? 58.637 -15.694 10.074 1.00 52.18  ? 457 LYS X CB    1 
ATOM   647  C CG    . LYS A 1 96  ? 59.748 -16.089 9.131  1.00 60.04  ? 457 LYS X CG    1 
ATOM   648  C CD    . LYS A 1 96  ? 60.945 -16.642 9.865  1.00 66.88  ? 457 LYS X CD    1 
ATOM   649  C CE    . LYS A 1 96  ? 62.037 -17.042 8.886  1.00 70.34  ? 457 LYS X CE    1 
ATOM   650  N NZ    . LYS A 1 96  ? 63.302 -17.394 9.591  1.00 88.92  ? 457 LYS X NZ    1 
ATOM   651  N N     . ASN A 1 97  ? 56.729 -16.013 7.600  1.00 51.01  ? 458 ASN X N     1 
ATOM   652  C CA    . ASN A 1 97  ? 56.553 -16.374 6.198  1.00 62.09  ? 458 ASN X CA    1 
ATOM   653  C C     . ASN A 1 97  ? 55.855 -15.267 5.425  1.00 56.03  ? 458 ASN X C     1 
ATOM   654  O O     . ASN A 1 97  ? 55.989 -15.160 4.205  1.00 62.93  ? 458 ASN X O     1 
ATOM   655  C CB    . ASN A 1 97  ? 55.802 -17.703 6.046  1.00 62.94  ? 458 ASN X CB    1 
ATOM   656  C CG    . ASN A 1 97  ? 56.568 -18.870 6.625  1.00 63.19  ? 458 ASN X CG    1 
ATOM   657  O OD1   . ASN A 1 97  ? 57.796 -18.831 6.726  1.00 61.78  ? 458 ASN X OD1   1 
ATOM   658  N ND2   . ASN A 1 97  ? 55.845 -19.909 7.027  1.00 65.69  ? 458 ASN X ND2   1 
ATOM   659  N N     . SER A 1 98  ? 55.116 -14.435 6.140  1.00 51.02  ? 459 SER X N     1 
ATOM   660  C CA    . SER A 1 98  ? 54.398 -13.351 5.495  1.00 50.19  ? 459 SER X CA    1 
ATOM   661  C C     . SER A 1 98  ? 55.330 -12.230 5.066  1.00 56.21  ? 459 SER X C     1 
ATOM   662  O O     . SER A 1 98  ? 54.965 -11.386 4.247  1.00 61.05  ? 459 SER X O     1 
ATOM   663  C CB    . SER A 1 98  ? 53.307 -12.815 6.402  1.00 51.99  ? 459 SER X CB    1 
ATOM   664  O OG    . SER A 1 98  ? 52.128 -13.568 6.242  1.00 62.79  ? 459 SER X OG    1 
ATOM   665  N N     . ILE A 1 99  ? 56.536 -12.223 5.618  1.00 50.56  ? 460 ILE X N     1 
ATOM   666  C CA    . ILE A 1 99  ? 57.540 -11.257 5.214  1.00 50.01  ? 460 ILE X CA    1 
ATOM   667  C C     . ILE A 1 99  ? 57.870 -11.436 3.735  1.00 62.34  ? 460 ILE X C     1 
ATOM   668  O O     . ILE A 1 99  ? 57.700 -10.514 2.936  1.00 62.48  ? 460 ILE X O     1 
ATOM   669  C CB    . ILE A 1 99  ? 58.815 -11.386 6.062  1.00 51.88  ? 460 ILE X CB    1 
ATOM   670  C CG1   . ILE A 1 99  ? 58.525 -10.995 7.511  1.00 45.08  ? 460 ILE X CG1   1 
ATOM   671  C CG2   . ILE A 1 99  ? 59.922 -10.520 5.509  1.00 42.34  ? 460 ILE X CG2   1 
ATOM   672  C CD1   . ILE A 1 99  ? 59.647 -11.330 8.495  1.00 45.59  ? 460 ILE X CD1   1 
ATOM   673  N N     . ASN A 1 100 ? 58.324 -12.633 3.371  1.00 66.00  ? 461 ASN X N     1 
ATOM   674  C CA    . ASN A 1 100 ? 58.690 -12.926 1.986  1.00 60.54  ? 461 ASN X CA    1 
ATOM   675  C C     . ASN A 1 100 ? 57.513 -13.054 1.035  1.00 51.38  ? 461 ASN X C     1 
ATOM   676  O O     . ASN A 1 100 ? 57.608 -12.652 -0.109 1.00 67.15  ? 461 ASN X O     1 
ATOM   677  C CB    . ASN A 1 100 ? 59.554 -14.177 1.911  1.00 63.48  ? 461 ASN X CB    1 
ATOM   678  C CG    . ASN A 1 100 ? 60.723 -14.121 2.855  1.00 78.40  ? 461 ASN X CG    1 
ATOM   679  O OD1   . ASN A 1 100 ? 61.823 -13.725 2.475  1.00 70.08  ? 461 ASN X OD1   1 
ATOM   680  N ND2   . ASN A 1 100 ? 60.488 -14.493 4.109  1.00 95.23  ? 461 ASN X ND2   1 
ATOM   681  N N     . LYS A 1 101 ? 56.408 -13.615 1.504  1.00 58.91  ? 462 LYS X N     1 
ATOM   682  C CA    . LYS A 1 101 ? 55.221 -13.726 0.672  1.00 62.32  ? 462 LYS X CA    1 
ATOM   683  C C     . LYS A 1 101 ? 54.666 -12.339 0.391  1.00 60.25  ? 462 LYS X C     1 
ATOM   684  O O     . LYS A 1 101 ? 53.961 -12.139 -0.592 1.00 60.50  ? 462 LYS X O     1 
ATOM   685  C CB    . LYS A 1 101 ? 54.155 -14.591 1.352  1.00 69.41  ? 462 LYS X CB    1 
ATOM   686  C CG    . LYS A 1 101 ? 53.103 -15.147 0.396  1.00 77.70  ? 462 LYS X CG    1 
ATOM   687  C CD    . LYS A 1 101 ? 53.557 -16.480 -0.198 1.00 99.38  ? 462 LYS X CD    1 
ATOM   688  C CE    . LYS A 1 101 ? 52.868 -16.798 -1.530 1.00 113.40 ? 462 LYS X CE    1 
ATOM   689  N NZ    . LYS A 1 101 ? 53.637 -16.305 -2.719 1.00 96.45  ? 462 LYS X NZ    1 
ATOM   690  N N     . LYS A 1 102 ? 54.986 -11.389 1.269  1.00 58.09  ? 463 LYS X N     1 
ATOM   691  C CA    . LYS A 1 102 ? 54.548 -10.001 1.131  1.00 52.02  ? 463 LYS X CA    1 
ATOM   692  C C     . LYS A 1 102 ? 53.035 -9.855  1.029  1.00 51.50  ? 463 LYS X C     1 
ATOM   693  O O     . LYS A 1 102 ? 52.541 -8.946  0.380  1.00 50.25  ? 463 LYS X O     1 
ATOM   694  C CB    . LYS A 1 102 ? 55.211 -9.326  -0.072 1.00 54.27  ? 463 LYS X CB    1 
ATOM   695  C CG    . LYS A 1 102 ? 56.723 -9.266  -0.008 1.00 57.80  ? 463 LYS X CG    1 
ATOM   696  C CD    . LYS A 1 102 ? 57.281 -8.375  -1.095 1.00 69.44  ? 463 LYS X CD    1 
ATOM   697  C CE    . LYS A 1 102 ? 58.795 -8.439  -1.147 1.00 86.52  ? 463 LYS X CE    1 
ATOM   698  N NZ    . LYS A 1 102 ? 59.408 -8.175  0.184  1.00 92.79  ? 463 LYS X NZ    1 
ATOM   699  N N     . ASN A 1 103 ? 52.302 -10.748 1.683  1.00 56.00  ? 464 ASN X N     1 
ATOM   700  C CA    . ASN A 1 103 ? 50.850 -10.646 1.735  1.00 44.96  ? 464 ASN X CA    1 
ATOM   701  C C     . ASN A 1 103 ? 50.342 -9.674  2.801  1.00 58.01  ? 464 ASN X C     1 
ATOM   702  O O     . ASN A 1 103 ? 50.963 -9.496  3.860  1.00 52.44  ? 464 ASN X O     1 
ATOM   703  C CB    . ASN A 1 103 ? 50.245 -12.014 2.013  1.00 51.02  ? 464 ASN X CB    1 
ATOM   704  C CG    . ASN A 1 103 ? 50.401 -12.426 3.459  1.00 53.90  ? 464 ASN X CG    1 
ATOM   705  O OD1   . ASN A 1 103 ? 51.478 -12.831 3.889  1.00 51.77  ? 464 ASN X OD1   1 
ATOM   706  N ND2   . ASN A 1 103 ? 49.320 -12.332 4.217  1.00 48.13  ? 464 ASN X ND2   1 
ATOM   707  N N     . PRO A 1 104 ? 49.195 -9.047  2.522  1.00 57.04  ? 465 PRO X N     1 
ATOM   708  C CA    . PRO A 1 104 ? 48.467 -8.159  3.431  1.00 49.78  ? 465 PRO X CA    1 
ATOM   709  C C     . PRO A 1 104 ? 48.004 -8.886  4.688  1.00 59.11  ? 465 PRO X C     1 
ATOM   710  O O     . PRO A 1 104 ? 47.537 -10.021 4.621  1.00 63.51  ? 465 PRO X O     1 
ATOM   711  C CB    . PRO A 1 104 ? 47.235 -7.763  2.619  1.00 51.87  ? 465 PRO X CB    1 
ATOM   712  C CG    . PRO A 1 104 ? 47.617 -7.985  1.219  1.00 53.50  ? 465 PRO X CG    1 
ATOM   713  C CD    . PRO A 1 104 ? 48.543 -9.141  1.210  1.00 52.07  ? 465 PRO X CD    1 
ATOM   714  N N     . VAL A 1 105 ? 48.111 -8.220  5.828  1.00 58.54  ? 466 VAL X N     1 
ATOM   715  C CA    . VAL A 1 105 ? 47.632 -8.781  7.074  1.00 45.32  ? 466 VAL X CA    1 
ATOM   716  C C     . VAL A 1 105 ? 46.628 -7.835  7.713  1.00 39.93  ? 466 VAL X C     1 
ATOM   717  O O     . VAL A 1 105 ? 46.894 -6.648  7.859  1.00 51.06  ? 466 VAL X O     1 
ATOM   718  C CB    . VAL A 1 105 ? 48.799 -9.028  8.027  1.00 47.37  ? 466 VAL X CB    1 
ATOM   719  C CG1   . VAL A 1 105 ? 48.299 -9.525  9.382  1.00 42.59  ? 466 VAL X CG1   1 
ATOM   720  C CG2   . VAL A 1 105 ? 49.761 -10.002 7.402  1.00 42.42  ? 466 VAL X CG2   1 
ATOM   721  N N     . ARG A 1 106 ? 45.463 -8.356  8.066  1.00 37.89  ? 467 ARG X N     1 
ATOM   722  C CA    . ARG A 1 106 ? 44.464 -7.566  8.767  1.00 52.59  ? 467 ARG X CA    1 
ATOM   723  C C     . ARG A 1 106 ? 44.940 -7.288  10.194 1.00 52.35  ? 467 ARG X C     1 
ATOM   724  O O     . ARG A 1 106 ? 45.608 -8.120  10.811 1.00 47.68  ? 467 ARG X O     1 
ATOM   725  C CB    . ARG A 1 106 ? 43.108 -8.277  8.773  1.00 51.18  ? 467 ARG X CB    1 
ATOM   726  C CG    . ARG A 1 106 ? 42.434 -8.325  7.404  1.00 52.03  ? 467 ARG X CG    1 
ATOM   727  C CD    . ARG A 1 106 ? 41.080 -9.049  7.445  1.00 48.46  ? 467 ARG X CD    1 
ATOM   728  N NE    . ARG A 1 106 ? 41.237 -10.453 7.795  1.00 54.04  ? 467 ARG X NE    1 
ATOM   729  C CZ    . ARG A 1 106 ? 41.443 -11.432 6.920  1.00 62.55  ? 467 ARG X CZ    1 
ATOM   730  N NH1   . ARG A 1 106 ? 41.503 -11.163 5.623  1.00 60.80  ? 467 ARG X NH1   1 
ATOM   731  N NH2   . ARG A 1 106 ? 41.589 -12.684 7.342  1.00 59.17  ? 467 ARG X NH2   1 
ATOM   732  N N     . VAL A 1 107 ? 44.627 -6.101  10.700 1.00 47.63  ? 468 VAL X N     1 
ATOM   733  C CA    . VAL A 1 107 ? 45.046 -5.720  12.037 1.00 41.62  ? 468 VAL X CA    1 
ATOM   734  C C     . VAL A 1 107 ? 43.866 -5.177  12.810 1.00 50.95  ? 468 VAL X C     1 
ATOM   735  O O     . VAL A 1 107 ? 43.163 -4.284  12.347 1.00 49.30  ? 468 VAL X O     1 
ATOM   736  C CB    . VAL A 1 107 ? 46.188 -4.694  12.019 1.00 41.67  ? 468 VAL X CB    1 
ATOM   737  C CG1   . VAL A 1 107 ? 46.257 -3.946  13.337 1.00 41.09  ? 468 VAL X CG1   1 
ATOM   738  C CG2   . VAL A 1 107 ? 47.516 -5.385  11.727 1.00 36.90  ? 468 VAL X CG2   1 
ATOM   739  N N     . ILE A 1 108 ? 43.640 -5.754  13.983 1.00 50.62  ? 469 ILE X N     1 
ATOM   740  C CA    . ILE A 1 108 ? 42.589 -5.299  14.874 1.00 54.61  ? 469 ILE X CA    1 
ATOM   741  C C     . ILE A 1 108 ? 43.249 -4.814  16.142 1.00 51.93  ? 469 ILE X C     1 
ATOM   742  O O     . ILE A 1 108 ? 44.135 -5.475  16.670 1.00 54.52  ? 469 ILE X O     1 
ATOM   743  C CB    . ILE A 1 108 ? 41.616 -6.433  15.222 1.00 55.69  ? 469 ILE X CB    1 
ATOM   744  C CG1   . ILE A 1 108 ? 40.855 -6.869  13.977 1.00 49.85  ? 469 ILE X CG1   1 
ATOM   745  C CG2   . ILE A 1 108 ? 40.650 -6.010  16.303 1.00 50.16  ? 469 ILE X CG2   1 
ATOM   746  C CD1   . ILE A 1 108 ? 41.630 -7.846  13.137 1.00 55.21  ? 469 ILE X CD1   1 
ATOM   747  N N     . ARG A 1 109 ? 42.836 -3.648  16.618 1.00 54.82  ? 470 ARG X N     1 
ATOM   748  C CA    . ARG A 1 109 ? 43.356 -3.135  17.871 1.00 53.81  ? 470 ARG X CA    1 
ATOM   749  C C     . ARG A 1 109 ? 42.265 -3.186  18.917 1.00 55.70  ? 470 ARG X C     1 
ATOM   750  O O     . ARG A 1 109 ? 41.094 -2.934  18.622 1.00 52.46  ? 470 ARG X O     1 
ATOM   751  C CB    . ARG A 1 109 ? 43.864 -1.702  17.709 1.00 61.30  ? 470 ARG X CB    1 
ATOM   752  C CG    . ARG A 1 109 ? 44.722 -1.492  16.467 1.00 68.84  ? 470 ARG X CG    1 
ATOM   753  C CD    . ARG A 1 109 ? 45.411 -0.133  16.471 1.00 80.00  ? 470 ARG X CD    1 
ATOM   754  N NE    . ARG A 1 109 ? 46.514 -0.086  15.512 1.00 73.80  ? 470 ARG X NE    1 
ATOM   755  C CZ    . ARG A 1 109 ? 47.629 0.620   15.689 1.00 83.11  ? 470 ARG X CZ    1 
ATOM   756  N NH1   . ARG A 1 109 ? 47.794 1.333   16.795 1.00 93.68  ? 470 ARG X NH1   1 
ATOM   757  N NH2   . ARG A 1 109 ? 48.589 0.604   14.770 1.00 70.60  ? 470 ARG X NH2   1 
ATOM   758  N N     . GLY A 1 110 ? 42.654 -3.550  20.134 1.00 60.74  ? 471 GLY X N     1 
ATOM   759  C CA    . GLY A 1 110 ? 41.792 -3.396  21.290 1.00 66.99  ? 471 GLY X CA    1 
ATOM   760  C C     . GLY A 1 110 ? 41.778 -1.932  21.684 1.00 66.07  ? 471 GLY X C     1 
ATOM   761  O O     . GLY A 1 110 ? 42.661 -1.177  21.286 1.00 76.59  ? 471 GLY X O     1 
ATOM   762  N N     . ILE A 1 111 ? 40.781 -1.522  22.459 1.00 72.30  ? 472 ILE X N     1 
ATOM   763  C CA    . ILE A 1 111 ? 40.655 -0.122  22.845 1.00 76.16  ? 472 ILE X CA    1 
ATOM   764  C C     . ILE A 1 111 ? 40.026 0.050   24.231 1.00 84.56  ? 472 ILE X C     1 
ATOM   765  O O     . ILE A 1 111 ? 39.289 -0.821  24.698 1.00 69.95  ? 472 ILE X O     1 
ATOM   766  C CB    . ILE A 1 111 ? 39.836 0.651   21.807 1.00 73.84  ? 472 ILE X CB    1 
ATOM   767  C CG1   . ILE A 1 111 ? 38.405 0.115   21.759 1.00 78.75  ? 472 ILE X CG1   1 
ATOM   768  C CG2   . ILE A 1 111 ? 40.481 0.536   20.432 1.00 64.43  ? 472 ILE X CG2   1 
ATOM   769  C CD1   . ILE A 1 111 ? 37.655 0.461   20.475 1.00 67.90  ? 472 ILE X CD1   1 
ATOM   770  N N     . LYS A 1 112 ? 40.320 1.182   24.874 1.00 100.21 ? 473 LYS X N     1 
ATOM   771  C CA    . LYS A 1 112 ? 39.825 1.476   26.223 1.00 100.14 ? 473 LYS X CA    1 
ATOM   772  C C     . LYS A 1 112 ? 38.298 1.536   26.286 1.00 100.56 ? 473 LYS X C     1 
ATOM   773  O O     . LYS A 1 112 ? 37.692 1.209   27.313 1.00 101.39 ? 473 LYS X O     1 
ATOM   774  C CB    . LYS A 1 112 ? 40.432 2.778   26.747 1.00 84.78  ? 473 LYS X CB    1 
ATOM   775  N N     . LYS A 1 123 ? 32.121 -1.690  22.836 1.00 73.17  ? 484 LYS X N     1 
ATOM   776  C CA    . LYS A 1 123 ? 33.011 -1.889  21.691 1.00 77.08  ? 484 LYS X CA    1 
ATOM   777  C C     . LYS A 1 123 ? 34.496 -1.824  22.088 1.00 76.09  ? 484 LYS X C     1 
ATOM   778  O O     . LYS A 1 123 ? 34.985 -0.794  22.547 1.00 73.89  ? 484 LYS X O     1 
ATOM   779  C CB    . LYS A 1 123 ? 32.696 -0.874  20.587 1.00 66.52  ? 484 LYS X CB    1 
ATOM   780  C CG    . LYS A 1 123 ? 31.288 -0.995  20.002 1.00 67.83  ? 484 LYS X CG    1 
ATOM   781  C CD    . LYS A 1 123 ? 31.085 -2.338  19.319 1.00 78.99  ? 484 LYS X CD    1 
ATOM   782  C CE    . LYS A 1 123 ? 29.895 -2.319  18.362 1.00 89.98  ? 484 LYS X CE    1 
ATOM   783  N NZ    . LYS A 1 123 ? 29.897 -3.504  17.432 1.00 92.79  ? 484 LYS X NZ    1 
ATOM   784  N N     . ASN A 1 124 ? 35.208 -2.929  21.902 1.00 67.39  ? 485 ASN X N     1 
ATOM   785  C CA    . ASN A 1 124 ? 36.578 -3.036  22.378 1.00 54.90  ? 485 ASN X CA    1 
ATOM   786  C C     . ASN A 1 124 ? 37.593 -3.294  21.285 1.00 53.00  ? 485 ASN X C     1 
ATOM   787  O O     . ASN A 1 124 ? 38.771 -3.435  21.569 1.00 57.58  ? 485 ASN X O     1 
ATOM   788  C CB    . ASN A 1 124 ? 36.682 -4.168  23.396 1.00 65.10  ? 485 ASN X CB    1 
ATOM   789  C CG    . ASN A 1 124 ? 35.701 -4.016  24.540 1.00 77.97  ? 485 ASN X CG    1 
ATOM   790  O OD1   . ASN A 1 124 ? 34.633 -4.650  24.551 1.00 67.87  ? 485 ASN X OD1   1 
ATOM   791  N ND2   . ASN A 1 124 ? 36.054 -3.171  25.516 1.00 70.63  ? 485 ASN X ND2   1 
ATOM   792  N N     . TYR A 1 125 ? 37.137 -3.380  20.041 1.00 56.60  ? 486 TYR X N     1 
ATOM   793  C CA    . TYR A 1 125 ? 38.020 -3.722  18.925 1.00 55.32  ? 486 TYR X CA    1 
ATOM   794  C C     . TYR A 1 125 ? 37.748 -2.872  17.678 1.00 57.39  ? 486 TYR X C     1 
ATOM   795  O O     . TYR A 1 125 ? 36.597 -2.654  17.302 1.00 56.46  ? 486 TYR X O     1 
ATOM   796  C CB    . TYR A 1 125 ? 37.878 -5.210  18.580 1.00 56.79  ? 486 TYR X CB    1 
ATOM   797  C CG    . TYR A 1 125 ? 38.237 -6.137  19.712 1.00 53.64  ? 486 TYR X CG    1 
ATOM   798  C CD1   . TYR A 1 125 ? 39.562 -6.390  20.031 1.00 47.88  ? 486 TYR X CD1   1 
ATOM   799  C CD2   . TYR A 1 125 ? 37.250 -6.757  20.466 1.00 55.76  ? 486 TYR X CD2   1 
ATOM   800  C CE1   . TYR A 1 125 ? 39.897 -7.230  21.075 1.00 56.29  ? 486 TYR X CE1   1 
ATOM   801  C CE2   . TYR A 1 125 ? 37.574 -7.596  21.509 1.00 52.47  ? 486 TYR X CE2   1 
ATOM   802  C CZ    . TYR A 1 125 ? 38.900 -7.832  21.815 1.00 57.57  ? 486 TYR X CZ    1 
ATOM   803  O OH    . TYR A 1 125 ? 39.240 -8.671  22.862 1.00 47.65  ? 486 TYR X OH    1 
ATOM   804  N N     . VAL A 1 126 ? 38.811 -2.402  17.034 1.00 56.37  ? 487 VAL X N     1 
ATOM   805  C CA    . VAL A 1 126 ? 38.667 -1.672  15.781 1.00 58.77  ? 487 VAL X CA    1 
ATOM   806  C C     . VAL A 1 126 ? 39.419 -2.372  14.680 1.00 56.68  ? 487 VAL X C     1 
ATOM   807  O O     . VAL A 1 126 ? 40.549 -2.817  14.880 1.00 54.51  ? 487 VAL X O     1 
ATOM   808  C CB    . VAL A 1 126 ? 39.264 -0.265  15.849 1.00 59.79  ? 487 VAL X CB    1 
ATOM   809  C CG1   . VAL A 1 126 ? 38.392 0.709   15.061 1.00 56.91  ? 487 VAL X CG1   1 
ATOM   810  C CG2   . VAL A 1 126 ? 39.414 0.174   17.274 1.00 75.44  ? 487 VAL X CG2   1 
ATOM   811  N N     . TYR A 1 127 ? 38.801 -2.453  13.508 1.00 54.81  ? 488 TYR X N     1 
ATOM   812  C CA    . TYR A 1 127 ? 39.523 -2.900  12.334 1.00 53.68  ? 488 TYR X CA    1 
ATOM   813  C C     . TYR A 1 127 ? 40.387 -1.751  11.848 1.00 57.03  ? 488 TYR X C     1 
ATOM   814  O O     . TYR A 1 127 ? 39.885 -0.666  11.554 1.00 57.93  ? 488 TYR X O     1 
ATOM   815  C CB    . TYR A 1 127 ? 38.574 -3.358  11.234 1.00 48.95  ? 488 TYR X CB    1 
ATOM   816  C CG    . TYR A 1 127 ? 39.289 -3.731  9.950  1.00 59.02  ? 488 TYR X CG    1 
ATOM   817  C CD1   . TYR A 1 127 ? 40.308 -4.670  9.954  1.00 56.04  ? 488 TYR X CD1   1 
ATOM   818  C CD2   . TYR A 1 127 ? 38.950 -3.141  8.741  1.00 54.42  ? 488 TYR X CD2   1 
ATOM   819  C CE1   . TYR A 1 127 ? 40.970 -5.011  8.800  1.00 53.62  ? 488 TYR X CE1   1 
ATOM   820  C CE2   . TYR A 1 127 ? 39.609 -3.475  7.583  1.00 55.89  ? 488 TYR X CE2   1 
ATOM   821  C CZ    . TYR A 1 127 ? 40.616 -4.417  7.616  1.00 59.71  ? 488 TYR X CZ    1 
ATOM   822  O OH    . TYR A 1 127 ? 41.272 -4.772  6.459  1.00 59.63  ? 488 TYR X OH    1 
ATOM   823  N N     . ASP A 1 128 ? 41.689 -1.992  11.766 1.00 55.01  ? 489 ASP X N     1 
ATOM   824  C CA    . ASP A 1 128 ? 42.640 -0.938  11.444 1.00 52.97  ? 489 ASP X CA    1 
ATOM   825  C C     . ASP A 1 128 ? 43.228 -1.036  10.021 1.00 58.23  ? 489 ASP X C     1 
ATOM   826  O O     . ASP A 1 128 ? 44.200 -0.353  9.693  1.00 55.28  ? 489 ASP X O     1 
ATOM   827  C CB    . ASP A 1 128 ? 43.753 -0.943  12.486 1.00 58.33  ? 489 ASP X CB    1 
ATOM   828  C CG    . ASP A 1 128 ? 44.660 0.259   12.381 1.00 71.29  ? 489 ASP X CG    1 
ATOM   829  O OD1   . ASP A 1 128 ? 44.205 1.323   11.910 1.00 72.55  ? 489 ASP X OD1   1 
ATOM   830  O OD2   . ASP A 1 128 ? 45.837 0.137   12.775 1.00 77.80  ? 489 ASP X OD2   1 
ATOM   831  N N     . GLY A 1 129 ? 42.644 -1.884  9.181  1.00 50.79  ? 490 GLY X N     1 
ATOM   832  C CA    . GLY A 1 129 ? 43.090 -2.008  7.809  1.00 40.67  ? 490 GLY X CA    1 
ATOM   833  C C     . GLY A 1 129 ? 44.201 -3.013  7.592  1.00 48.30  ? 490 GLY X C     1 
ATOM   834  O O     . GLY A 1 129 ? 44.387 -3.927  8.385  1.00 51.02  ? 490 GLY X O     1 
ATOM   835  N N     . LEU A 1 130 ? 44.952 -2.840  6.510  1.00 46.56  ? 491 LEU X N     1 
ATOM   836  C CA    . LEU A 1 130 ? 45.942 -3.830  6.121  1.00 43.73  ? 491 LEU X CA    1 
ATOM   837  C C     . LEU A 1 130 ? 47.378 -3.377  6.330  1.00 40.45  ? 491 LEU X C     1 
ATOM   838  O O     . LEU A 1 130 ? 47.718 -2.227  6.088  1.00 41.47  ? 491 LEU X O     1 
ATOM   839  C CB    . LEU A 1 130 ? 45.730 -4.231  4.662  1.00 57.67  ? 491 LEU X CB    1 
ATOM   840  C CG    . LEU A 1 130 ? 44.303 -4.637  4.291  1.00 51.06  ? 491 LEU X CG    1 
ATOM   841  C CD1   . LEU A 1 130 ? 44.175 -4.758  2.793  1.00 44.62  ? 491 LEU X CD1   1 
ATOM   842  C CD2   . LEU A 1 130 ? 43.899 -5.928  4.988  1.00 47.97  ? 491 LEU X CD2   1 
ATOM   843  N N     . TYR A 1 131 ? 48.215 -4.308  6.768  1.00 43.38  ? 492 TYR X N     1 
ATOM   844  C CA    . TYR A 1 131 ? 49.620 -4.047  7.043  1.00 40.72  ? 492 TYR X CA    1 
ATOM   845  C C     . TYR A 1 131 ? 50.453 -5.114  6.349  1.00 46.03  ? 492 TYR X C     1 
ATOM   846  O O     . TYR A 1 131 ? 49.936 -6.151  5.959  1.00 46.17  ? 492 TYR X O     1 
ATOM   847  C CB    . TYR A 1 131 ? 49.893 -4.143  8.545  1.00 41.77  ? 492 TYR X CB    1 
ATOM   848  C CG    . TYR A 1 131 ? 49.407 -2.989  9.400  1.00 42.31  ? 492 TYR X CG    1 
ATOM   849  C CD1   . TYR A 1 131 ? 50.308 -2.215  10.116 1.00 43.40  ? 492 TYR X CD1   1 
ATOM   850  C CD2   . TYR A 1 131 ? 48.052 -2.699  9.521  1.00 38.53  ? 492 TYR X CD2   1 
ATOM   851  C CE1   . TYR A 1 131 ? 49.884 -1.179  10.902 1.00 35.01  ? 492 TYR X CE1   1 
ATOM   852  C CE2   . TYR A 1 131 ? 47.618 -1.663  10.304 1.00 33.98  ? 492 TYR X CE2   1 
ATOM   853  C CZ    . TYR A 1 131 ? 48.542 -0.910  10.994 1.00 38.90  ? 492 TYR X CZ    1 
ATOM   854  O OH    . TYR A 1 131 ? 48.130 0.129   11.780 1.00 46.60  ? 492 TYR X OH    1 
ATOM   855  N N     . LEU A 1 132 ? 51.747 -4.866  6.221  1.00 40.87  ? 493 LEU X N     1 
ATOM   856  C CA    . LEU A 1 132 ? 52.666 -5.860  5.705  1.00 42.10  ? 493 LEU X CA    1 
ATOM   857  C C     . LEU A 1 132 ? 53.739 -6.129  6.743  1.00 48.86  ? 493 LEU X C     1 
ATOM   858  O O     . LEU A 1 132 ? 54.185 -5.215  7.426  1.00 51.24  ? 493 LEU X O     1 
ATOM   859  C CB    . LEU A 1 132 ? 53.346 -5.368  4.428  1.00 49.11  ? 493 LEU X CB    1 
ATOM   860  C CG    . LEU A 1 132 ? 52.530 -5.030  3.182  1.00 54.90  ? 493 LEU X CG    1 
ATOM   861  C CD1   . LEU A 1 132 ? 53.481 -4.614  2.103  1.00 45.91  ? 493 LEU X CD1   1 
ATOM   862  C CD2   . LEU A 1 132 ? 51.687 -6.196  2.715  1.00 55.96  ? 493 LEU X CD2   1 
ATOM   863  N N     . VAL A 1 133 ? 54.174 -7.378  6.846  1.00 49.81  ? 494 VAL X N     1 
ATOM   864  C CA    . VAL A 1 133 ? 55.224 -7.722  7.789  1.00 48.55  ? 494 VAL X CA    1 
ATOM   865  C C     . VAL A 1 133 ? 56.579 -7.422  7.175  1.00 44.53  ? 494 VAL X C     1 
ATOM   866  O O     . VAL A 1 133 ? 57.033 -8.129  6.300  1.00 52.31  ? 494 VAL X O     1 
ATOM   867  C CB    . VAL A 1 133 ? 55.158 -9.196  8.228  1.00 44.46  ? 494 VAL X CB    1 
ATOM   868  C CG1   . VAL A 1 133 ? 56.133 -9.446  9.361  1.00 50.89  ? 494 VAL X CG1   1 
ATOM   869  C CG2   . VAL A 1 133 ? 53.750 -9.560  8.665  1.00 38.19  ? 494 VAL X CG2   1 
ATOM   870  N N     . GLU A 1 134 ? 57.225 -6.367  7.648  1.00 52.31  ? 495 GLU X N     1 
ATOM   871  C CA    . GLU A 1 134 ? 58.490 -5.936  7.077  1.00 51.71  ? 495 GLU X CA    1 
ATOM   872  C C     . GLU A 1 134 ? 59.681 -6.755  7.556  1.00 46.26  ? 495 GLU X C     1 
ATOM   873  O O     . GLU A 1 134 ? 60.608 -7.014  6.799  1.00 55.46  ? 495 GLU X O     1 
ATOM   874  C CB    . GLU A 1 134 ? 58.724 -4.455  7.364  1.00 59.44  ? 495 GLU X CB    1 
ATOM   875  C CG    . GLU A 1 134 ? 57.699 -3.539  6.724  1.00 67.37  ? 495 GLU X CG    1 
ATOM   876  C CD    . GLU A 1 134 ? 58.208 -2.116  6.544  1.00 84.51  ? 495 GLU X CD    1 
ATOM   877  O OE1   . GLU A 1 134 ? 58.846 -1.585  7.478  1.00 92.13  ? 495 GLU X OE1   1 
ATOM   878  O OE2   . GLU A 1 134 ? 57.969 -1.527  5.465  1.00 91.14  ? 495 GLU X OE2   1 
ATOM   879  N N     . GLU A 1 135 ? 59.666 -7.169  8.811  1.00 48.80  ? 496 GLU X N     1 
ATOM   880  C CA    . GLU A 1 135 ? 60.787 -7.941  9.330  1.00 53.77  ? 496 GLU X CA    1 
ATOM   881  C C     . GLU A 1 135 ? 60.495 -8.474  10.712 1.00 50.40  ? 496 GLU X C     1 
ATOM   882  O O     . GLU A 1 135 ? 59.471 -8.147  11.311 1.00 44.21  ? 496 GLU X O     1 
ATOM   883  C CB    . GLU A 1 135 ? 62.045 -7.077  9.402  1.00 54.30  ? 496 GLU X CB    1 
ATOM   884  C CG    . GLU A 1 135 ? 61.989 -6.048  10.515 1.00 56.94  ? 496 GLU X CG    1 
ATOM   885  C CD    . GLU A 1 135 ? 63.344 -5.465  10.848 1.00 70.12  ? 496 GLU X CD    1 
ATOM   886  O OE1   . GLU A 1 135 ? 63.421 -4.234  11.044 1.00 71.52  ? 496 GLU X OE1   1 
ATOM   887  O OE2   . GLU A 1 135 ? 64.326 -6.235  10.921 1.00 81.27  ? 496 GLU X OE2   1 
ATOM   888  N N     . TYR A 1 136 ? 61.414 -9.293  11.208 1.00 46.01  ? 497 TYR X N     1 
ATOM   889  C CA    . TYR A 1 136 ? 61.328 -9.804  12.564 1.00 40.67  ? 497 TYR X CA    1 
ATOM   890  C C     . TYR A 1 136 ? 62.711 -9.950  13.162 1.00 46.13  ? 497 TYR X C     1 
ATOM   891  O O     . TYR A 1 136 ? 63.720 -9.919  12.462 1.00 53.07  ? 497 TYR X O     1 
ATOM   892  C CB    . TYR A 1 136 ? 60.598 -11.147 12.598 1.00 50.05  ? 497 TYR X CB    1 
ATOM   893  C CG    . TYR A 1 136 ? 61.489 -12.356 12.391 1.00 59.45  ? 497 TYR X CG    1 
ATOM   894  C CD1   . TYR A 1 136 ? 61.858 -13.164 13.458 1.00 60.01  ? 497 TYR X CD1   1 
ATOM   895  C CD2   . TYR A 1 136 ? 61.950 -12.697 11.126 1.00 72.65  ? 497 TYR X CD2   1 
ATOM   896  C CE1   . TYR A 1 136 ? 62.665 -14.271 13.273 1.00 60.47  ? 497 TYR X CE1   1 
ATOM   897  C CE2   . TYR A 1 136 ? 62.760 -13.803 10.931 1.00 64.44  ? 497 TYR X CE2   1 
ATOM   898  C CZ    . TYR A 1 136 ? 63.114 -14.587 12.007 1.00 68.59  ? 497 TYR X CZ    1 
ATOM   899  O OH    . TYR A 1 136 ? 63.915 -15.693 11.808 1.00 74.05  ? 497 TYR X OH    1 
ATOM   900  N N     . TRP A 1 137 ? 62.752 -10.103 14.471 1.00 44.28  ? 498 TRP X N     1 
ATOM   901  C CA    . TRP A 1 137 ? 64.013 -10.305 15.160 1.00 45.05  ? 498 TRP X CA    1 
ATOM   902  C C     . TRP A 1 137 ? 63.670 -10.889 16.500 1.00 51.59  ? 498 TRP X C     1 
ATOM   903  O O     . TRP A 1 137 ? 62.495 -10.980 16.854 1.00 50.55  ? 498 TRP X O     1 
ATOM   904  C CB    . TRP A 1 137 ? 64.784 -8.996  15.325 1.00 46.05  ? 498 TRP X CB    1 
ATOM   905  C CG    . TRP A 1 137 ? 64.156 -8.024  16.264 1.00 46.68  ? 498 TRP X CG    1 
ATOM   906  C CD1   . TRP A 1 137 ? 64.321 -7.971  17.611 1.00 51.69  ? 498 TRP X CD1   1 
ATOM   907  C CD2   . TRP A 1 137 ? 63.264 -6.958  15.926 1.00 53.68  ? 498 TRP X CD2   1 
ATOM   908  N NE1   . TRP A 1 137 ? 63.580 -6.946  18.142 1.00 51.44  ? 498 TRP X NE1   1 
ATOM   909  C CE2   . TRP A 1 137 ? 62.921 -6.306  17.128 1.00 49.36  ? 498 TRP X CE2   1 
ATOM   910  C CE3   . TRP A 1 137 ? 62.712 -6.497  14.726 1.00 50.78  ? 498 TRP X CE3   1 
ATOM   911  C CZ2   . TRP A 1 137 ? 62.063 -5.209  17.164 1.00 47.02  ? 498 TRP X CZ2   1 
ATOM   912  C CZ3   . TRP A 1 137 ? 61.856 -5.417  14.765 1.00 50.48  ? 498 TRP X CZ3   1 
ATOM   913  C CH2   . TRP A 1 137 ? 61.539 -4.782  15.978 1.00 45.34  ? 498 TRP X CH2   1 
ATOM   914  N N     . GLU A 1 138 ? 64.685 -11.300 17.242 1.00 46.09  ? 499 GLU X N     1 
ATOM   915  C CA    . GLU A 1 138 ? 64.427 -11.884 18.538 1.00 54.13  ? 499 GLU X CA    1 
ATOM   916  C C     . GLU A 1 138 ? 65.066 -11.079 19.653 1.00 53.54  ? 499 GLU X C     1 
ATOM   917  O O     . GLU A 1 138 ? 66.077 -10.399 19.453 1.00 51.11  ? 499 GLU X O     1 
ATOM   918  C CB    . GLU A 1 138 ? 64.871 -13.341 18.577 1.00 66.07  ? 499 GLU X CB    1 
ATOM   919  C CG    . GLU A 1 138 ? 66.301 -13.572 18.149 1.00 87.06  ? 499 GLU X CG    1 
ATOM   920  C CD    . GLU A 1 138 ? 66.582 -15.042 17.897 1.00 100.21 ? 499 GLU X CD    1 
ATOM   921  O OE1   . GLU A 1 138 ? 65.707 -15.712 17.301 1.00 86.73  ? 499 GLU X OE1   1 
ATOM   922  O OE2   . GLU A 1 138 ? 67.668 -15.524 18.298 1.00 103.38 ? 499 GLU X OE2   1 
ATOM   923  N N     . GLU A 1 139 ? 64.439 -11.150 20.819 1.00 53.10  ? 500 GLU X N     1 
ATOM   924  C CA    . GLU A 1 139 ? 64.847 -10.379 21.976 1.00 60.33  ? 500 GLU X CA    1 
ATOM   925  C C     . GLU A 1 139 ? 65.026 -11.322 23.140 1.00 63.26  ? 500 GLU X C     1 
ATOM   926  O O     . GLU A 1 139 ? 64.630 -12.483 23.078 1.00 68.19  ? 500 GLU X O     1 
ATOM   927  C CB    . GLU A 1 139 ? 63.773 -9.356  22.339 1.00 52.65  ? 500 GLU X CB    1 
ATOM   928  C CG    . GLU A 1 139 ? 63.688 -8.185  21.398 1.00 59.12  ? 500 GLU X CG    1 
ATOM   929  C CD    . GLU A 1 139 ? 62.911 -7.028  21.985 1.00 66.91  ? 500 GLU X CD    1 
ATOM   930  O OE1   . GLU A 1 139 ? 62.605 -7.074  23.197 1.00 67.62  ? 500 GLU X OE1   1 
ATOM   931  O OE2   . GLU A 1 139 ? 62.607 -6.070  21.236 1.00 70.37  ? 500 GLU X OE2   1 
ATOM   932  N N     . THR A 1 140 ? 65.601 -10.806 24.216 1.00 65.67  ? 501 THR X N     1 
ATOM   933  C CA    . THR A 1 140 ? 65.813 -11.601 25.407 1.00 64.27  ? 501 THR X CA    1 
ATOM   934  C C     . THR A 1 140 ? 65.390 -10.824 26.633 1.00 67.22  ? 501 THR X C     1 
ATOM   935  O O     . THR A 1 140 ? 66.034 -9.845  26.994 1.00 70.35  ? 501 THR X O     1 
ATOM   936  C CB    . THR A 1 140 ? 67.291 -11.982 25.540 1.00 67.28  ? 501 THR X CB    1 
ATOM   937  O OG1   . THR A 1 140 ? 67.701 -12.702 24.367 1.00 64.32  ? 501 THR X OG1   1 
ATOM   938  C CG2   . THR A 1 140 ? 67.507 -12.837 26.776 1.00 62.22  ? 501 THR X CG2   1 
ATOM   939  N N     . GLY A 1 141 ? 64.300 -11.253 27.263 1.00 72.89  ? 502 GLY X N     1 
ATOM   940  C CA    . GLY A 1 141 ? 63.901 -10.697 28.548 1.00 89.67  ? 502 GLY X CA    1 
ATOM   941  C C     . GLY A 1 141 ? 64.923 -10.998 29.642 1.00 93.26  ? 502 GLY X C     1 
ATOM   942  O O     . GLY A 1 141 ? 65.970 -11.592 29.378 1.00 91.99  ? 502 GLY X O     1 
ATOM   943  N N     . SER A 1 142 ? 64.628 -10.594 30.874 1.00 97.65  ? 503 SER X N     1 
ATOM   944  C CA    . SER A 1 142 ? 65.560 -10.811 31.985 1.00 106.51 ? 503 SER X CA    1 
ATOM   945  C C     . SER A 1 142 ? 65.587 -12.274 32.422 1.00 105.27 ? 503 SER X C     1 
ATOM   946  O O     . SER A 1 142 ? 66.628 -12.801 32.823 1.00 98.65  ? 503 SER X O     1 
ATOM   947  C CB    . SER A 1 142 ? 65.197 -9.922  33.178 1.00 118.40 ? 503 SER X CB    1 
ATOM   948  O OG    . SER A 1 142 ? 64.081 -10.440 33.886 1.00 118.76 ? 503 SER X OG    1 
ATOM   949  N N     . HIS A 1 143 ? 64.420 -12.908 32.359 1.00 102.84 ? 504 HIS X N     1 
ATOM   950  C CA    . HIS A 1 143 ? 64.264 -14.332 32.613 1.00 98.17  ? 504 HIS X CA    1 
ATOM   951  C C     . HIS A 1 143 ? 65.267 -15.133 31.794 1.00 96.45  ? 504 HIS X C     1 
ATOM   952  O O     . HIS A 1 143 ? 65.617 -16.255 32.153 1.00 100.92 ? 504 HIS X O     1 
ATOM   953  C CB    . HIS A 1 143 ? 62.858 -14.721 32.203 1.00 98.10  ? 504 HIS X CB    1 
ATOM   954  C CG    . HIS A 1 143 ? 62.328 -13.880 31.085 1.00 110.41 ? 504 HIS X CG    1 
ATOM   955  N ND1   . HIS A 1 143 ? 61.550 -12.762 31.301 1.00 102.46 ? 504 HIS X ND1   1 
ATOM   956  C CD2   . HIS A 1 143 ? 62.504 -13.965 29.743 1.00 104.06 ? 504 HIS X CD2   1 
ATOM   957  C CE1   . HIS A 1 143 ? 61.248 -12.209 30.138 1.00 112.25 ? 504 HIS X CE1   1 
ATOM   958  N NE2   . HIS A 1 143 ? 61.813 -12.920 29.178 1.00 109.82 ? 504 HIS X NE2   1 
ATOM   959  N N     . GLY A 1 144 ? 65.714 -14.549 30.684 1.00 89.77  ? 505 GLY X N     1 
ATOM   960  C CA    . GLY A 1 144 ? 66.731 -15.157 29.844 1.00 76.53  ? 505 GLY X CA    1 
ATOM   961  C C     . GLY A 1 144 ? 66.152 -15.781 28.590 1.00 77.94  ? 505 GLY X C     1 
ATOM   962  O O     . GLY A 1 144 ? 66.882 -16.265 27.720 1.00 67.21  ? 505 GLY X O     1 
ATOM   963  N N     . LYS A 1 145 ? 64.827 -15.756 28.489 1.00 88.29  ? 506 LYS X N     1 
ATOM   964  C CA    . LYS A 1 145 ? 64.131 -16.471 27.424 1.00 87.29  ? 506 LYS X CA    1 
ATOM   965  C C     . LYS A 1 145 ? 63.904 -15.631 26.164 1.00 75.03  ? 506 LYS X C     1 
ATOM   966  O O     . LYS A 1 145 ? 63.859 -14.399 26.216 1.00 77.76  ? 506 LYS X O     1 
ATOM   967  C CB    . LYS A 1 145 ? 62.817 -17.035 27.941 1.00 89.42  ? 506 LYS X CB    1 
ATOM   968  N N     . LEU A 1 146 ? 63.750 -16.324 25.038 1.00 67.72  ? 507 LEU X N     1 
ATOM   969  C CA    . LEU A 1 146 ? 63.652 -15.701 23.719 1.00 61.13  ? 507 LEU X CA    1 
ATOM   970  C C     . LEU A 1 146 ? 62.237 -15.230 23.371 1.00 66.92  ? 507 LEU X C     1 
ATOM   971  O O     . LEU A 1 146 ? 61.261 -15.945 23.595 1.00 63.30  ? 507 LEU X O     1 
ATOM   972  C CB    . LEU A 1 146 ? 64.105 -16.698 22.665 1.00 62.85  ? 507 LEU X CB    1 
ATOM   973  C CG    . LEU A 1 146 ? 64.705 -16.118 21.393 1.00 87.05  ? 507 LEU X CG    1 
ATOM   974  C CD1   . LEU A 1 146 ? 66.086 -15.545 21.705 1.00 87.22  ? 507 LEU X CD1   1 
ATOM   975  C CD2   . LEU A 1 146 ? 64.779 -17.194 20.312 1.00 71.00  ? 507 LEU X CD2   1 
ATOM   976  N N     . VAL A 1 147 ? 62.140 -14.027 22.813 1.00 66.50  ? 508 VAL X N     1 
ATOM   977  C CA    . VAL A 1 147 ? 60.867 -13.466 22.370 1.00 52.92  ? 508 VAL X CA    1 
ATOM   978  C C     . VAL A 1 147 ? 61.002 -12.916 20.957 1.00 53.77  ? 508 VAL X C     1 
ATOM   979  O O     . VAL A 1 147 ? 61.974 -12.236 20.639 1.00 63.92  ? 508 VAL X O     1 
ATOM   980  C CB    . VAL A 1 147 ? 60.426 -12.316 23.282 1.00 57.82  ? 508 VAL X CB    1 
ATOM   981  C CG1   . VAL A 1 147 ? 59.062 -11.762 22.842 1.00 48.16  ? 508 VAL X CG1   1 
ATOM   982  C CG2   . VAL A 1 147 ? 60.407 -12.780 24.742 1.00 42.26  ? 508 VAL X CG2   1 
ATOM   983  N N     . PHE A 1 148 ? 60.033 -13.214 20.105 1.00 55.31  ? 509 PHE X N     1 
ATOM   984  C CA    . PHE A 1 148 ? 60.020 -12.654 18.761 1.00 52.47  ? 509 PHE X CA    1 
ATOM   985  C C     . PHE A 1 148 ? 59.285 -11.313 18.695 1.00 54.95  ? 509 PHE X C     1 
ATOM   986  O O     . PHE A 1 148 ? 58.319 -11.063 19.433 1.00 45.16  ? 509 PHE X O     1 
ATOM   987  C CB    . PHE A 1 148 ? 59.380 -13.624 17.778 1.00 47.33  ? 509 PHE X CB    1 
ATOM   988  C CG    . PHE A 1 148 ? 60.065 -14.946 17.700 1.00 60.41  ? 509 PHE X CG    1 
ATOM   989  C CD1   . PHE A 1 148 ? 61.343 -15.047 17.183 1.00 67.51  ? 509 PHE X CD1   1 
ATOM   990  C CD2   . PHE A 1 148 ? 59.421 -16.098 18.120 1.00 62.37  ? 509 PHE X CD2   1 
ATOM   991  C CE1   . PHE A 1 148 ? 61.981 -16.277 17.097 1.00 71.25  ? 509 PHE X CE1   1 
ATOM   992  C CE2   . PHE A 1 148 ? 60.048 -17.330 18.034 1.00 67.86  ? 509 PHE X CE2   1 
ATOM   993  C CZ    . PHE A 1 148 ? 61.333 -17.418 17.523 1.00 63.25  ? 509 PHE X CZ    1 
ATOM   994  N N     . LYS A 1 149 ? 59.753 -10.464 17.787 1.00 48.71  ? 510 LYS X N     1 
ATOM   995  C CA    . LYS A 1 149 ? 59.152 -9.169  17.542 1.00 44.39  ? 510 LYS X CA    1 
ATOM   996  C C     . LYS A 1 149 ? 58.983 -9.028  16.055 1.00 44.35  ? 510 LYS X C     1 
ATOM   997  O O     . LYS A 1 149 ? 59.906 -9.295  15.300 1.00 49.80  ? 510 LYS X O     1 
ATOM   998  C CB    . LYS A 1 149 ? 60.067 -8.056  18.044 1.00 47.23  ? 510 LYS X CB    1 
ATOM   999  C CG    . LYS A 1 149 ? 60.236 -8.041  19.534 1.00 41.22  ? 510 LYS X CG    1 
ATOM   1000 C CD    . LYS A 1 149 ? 58.957 -7.624  20.208 1.00 41.22  ? 510 LYS X CD    1 
ATOM   1001 C CE    . LYS A 1 149 ? 59.161 -7.524  21.697 1.00 41.56  ? 510 LYS X CE    1 
ATOM   1002 N NZ    . LYS A 1 149 ? 57.939 -7.024  22.373 1.00 59.58  ? 510 LYS X NZ    1 
ATOM   1003 N N     . PHE A 1 150 ? 57.800 -8.610  15.636 1.00 51.61  ? 511 PHE X N     1 
ATOM   1004 C CA    . PHE A 1 150 ? 57.524 -8.408  14.229 1.00 46.68  ? 511 PHE X CA    1 
ATOM   1005 C C     . PHE A 1 150 ? 57.185 -6.956  13.973 1.00 46.48  ? 511 PHE X C     1 
ATOM   1006 O O     . PHE A 1 150 ? 56.318 -6.376  14.627 1.00 47.96  ? 511 PHE X O     1 
ATOM   1007 C CB    . PHE A 1 150 ? 56.373 -9.302  13.791 1.00 41.55  ? 511 PHE X CB    1 
ATOM   1008 C CG    . PHE A 1 150 ? 56.624 -10.745 14.046 1.00 49.35  ? 511 PHE X CG    1 
ATOM   1009 C CD1   . PHE A 1 150 ? 57.217 -11.536 13.080 1.00 52.74  ? 511 PHE X CD1   1 
ATOM   1010 C CD2   . PHE A 1 150 ? 56.294 -11.312 15.268 1.00 56.61  ? 511 PHE X CD2   1 
ATOM   1011 C CE1   . PHE A 1 150 ? 57.463 -12.868 13.313 1.00 50.37  ? 511 PHE X CE1   1 
ATOM   1012 C CE2   . PHE A 1 150 ? 56.542 -12.649 15.511 1.00 52.15  ? 511 PHE X CE2   1 
ATOM   1013 C CZ    . PHE A 1 150 ? 57.125 -13.428 14.525 1.00 53.01  ? 511 PHE X CZ    1 
ATOM   1014 N N     . LYS A 1 151 ? 57.886 -6.379  13.013 1.00 46.08  ? 512 LYS X N     1 
ATOM   1015 C CA    . LYS A 1 151 ? 57.636 -5.018  12.589 1.00 45.81  ? 512 LYS X CA    1 
ATOM   1016 C C     . LYS A 1 151 ? 56.668 -5.030  11.412 1.00 47.56  ? 512 LYS X C     1 
ATOM   1017 O O     . LYS A 1 151 ? 56.973 -5.563  10.351 1.00 54.25  ? 512 LYS X O     1 
ATOM   1018 C CB    . LYS A 1 151 ? 58.961 -4.352  12.214 1.00 43.55  ? 512 LYS X CB    1 
ATOM   1019 C CG    . LYS A 1 151 ? 58.833 -2.921  11.736 1.00 53.98  ? 512 LYS X CG    1 
ATOM   1020 C CD    . LYS A 1 151 ? 60.201 -2.317  11.512 1.00 55.08  ? 512 LYS X CD    1 
ATOM   1021 C CE    . LYS A 1 151 ? 60.200 -1.392  10.307 1.00 67.73  ? 512 LYS X CE    1 
ATOM   1022 N NZ    . LYS A 1 151 ? 61.586 -1.100  9.839  1.00 72.01  ? 512 LYS X NZ    1 
ATOM   1023 N N     . LEU A 1 152 ? 55.489 -4.468  11.613 1.00 37.34  ? 513 LEU X N     1 
ATOM   1024 C CA    . LEU A 1 152 ? 54.522 -4.355  10.541 1.00 43.57  ? 513 LEU X CA    1 
ATOM   1025 C C     . LEU A 1 152 ? 54.304 -2.898  10.172 1.00 50.68  ? 513 LEU X C     1 
ATOM   1026 O O     . LEU A 1 152 ? 54.324 -2.036  11.042 1.00 43.86  ? 513 LEU X O     1 
ATOM   1027 C CB    . LEU A 1 152 ? 53.199 -4.969  10.955 1.00 42.55  ? 513 LEU X CB    1 
ATOM   1028 C CG    . LEU A 1 152 ? 53.186 -6.484  11.003 1.00 49.56  ? 513 LEU X CG    1 
ATOM   1029 C CD1   . LEU A 1 152 ? 53.731 -6.970  12.333 1.00 51.51  ? 513 LEU X CD1   1 
ATOM   1030 C CD2   . LEU A 1 152 ? 51.768 -6.982  10.772 1.00 43.50  ? 513 LEU X CD2   1 
ATOM   1031 N N     . ARG A 1 153 ? 54.108 -2.627  8.881  1.00 54.22  ? 514 ARG X N     1 
ATOM   1032 C CA    . ARG A 1 153 ? 53.844 -1.269  8.420  1.00 42.19  ? 514 ARG X CA    1 
ATOM   1033 C C     . ARG A 1 153 ? 52.524 -1.206  7.690  1.00 42.89  ? 514 ARG X C     1 
ATOM   1034 O O     . ARG A 1 153 ? 52.210 -2.084  6.896  1.00 49.94  ? 514 ARG X O     1 
ATOM   1035 C CB    . ARG A 1 153 ? 54.976 -0.760  7.534  1.00 46.53  ? 514 ARG X CB    1 
ATOM   1036 C CG    . ARG A 1 153 ? 54.832 0.710   7.175  1.00 49.03  ? 514 ARG X CG    1 
ATOM   1037 C CD    . ARG A 1 153 ? 55.932 1.185   6.253  1.00 39.97  ? 514 ARG X CD    1 
ATOM   1038 N NE    . ARG A 1 153 ? 57.247 1.246   6.890  1.00 42.40  ? 514 ARG X NE    1 
ATOM   1039 C CZ    . ARG A 1 153 ? 57.703 2.289   7.578  1.00 41.35  ? 514 ARG X CZ    1 
ATOM   1040 N NH1   . ARG A 1 153 ? 56.948 3.365   7.748  1.00 38.28  ? 514 ARG X NH1   1 
ATOM   1041 N NH2   . ARG A 1 153 ? 58.912 2.249   8.107  1.00 44.10  ? 514 ARG X NH2   1 
ATOM   1042 N N     . ARG A 1 154 ? 51.740 -0.176  7.978  1.00 41.03  ? 515 ARG X N     1 
ATOM   1043 C CA    . ARG A 1 154 ? 50.437 -0.003  7.355  1.00 41.04  ? 515 ARG X CA    1 
ATOM   1044 C C     . ARG A 1 154 ? 50.578 0.342   5.872  1.00 54.65  ? 515 ARG X C     1 
ATOM   1045 O O     . ARG A 1 154 ? 51.332 1.244   5.497  1.00 54.50  ? 515 ARG X O     1 
ATOM   1046 C CB    . ARG A 1 154 ? 49.660 1.095   8.067  1.00 32.37  ? 515 ARG X CB    1 
ATOM   1047 C CG    . ARG A 1 154 ? 48.174 1.056   7.816  1.00 40.38  ? 515 ARG X CG    1 
ATOM   1048 C CD    . ARG A 1 154 ? 47.473 2.167   8.564  1.00 38.02  ? 515 ARG X CD    1 
ATOM   1049 N NE    . ARG A 1 154 ? 46.057 1.897   8.794  1.00 43.63  ? 515 ARG X NE    1 
ATOM   1050 C CZ    . ARG A 1 154 ? 45.070 2.687   8.385  1.00 46.28  ? 515 ARG X CZ    1 
ATOM   1051 N NH1   . ARG A 1 154 ? 45.343 3.796   7.722  1.00 46.19  ? 515 ARG X NH1   1 
ATOM   1052 N NH2   . ARG A 1 154 ? 43.808 2.377   8.643  1.00 50.09  ? 515 ARG X NH2   1 
ATOM   1053 N N     . ILE A 1 155 ? 49.856 -0.384  5.027  1.00 53.79  ? 516 ILE X N     1 
ATOM   1054 C CA    . ILE A 1 155 ? 49.857 -0.100  3.602  1.00 56.46  ? 516 ILE X CA    1 
ATOM   1055 C C     . ILE A 1 155 ? 49.246 1.279   3.379  1.00 50.60  ? 516 ILE X C     1 
ATOM   1056 O O     . ILE A 1 155 ? 48.150 1.558   3.865  1.00 48.18  ? 516 ILE X O     1 
ATOM   1057 C CB    . ILE A 1 155 ? 49.059 -1.174  2.811  1.00 58.01  ? 516 ILE X CB    1 
ATOM   1058 C CG1   . ILE A 1 155 ? 49.724 -2.544  2.956  1.00 51.98  ? 516 ILE X CG1   1 
ATOM   1059 C CG2   . ILE A 1 155 ? 48.956 -0.808  1.345  1.00 49.44  ? 516 ILE X CG2   1 
ATOM   1060 C CD1   . ILE A 1 155 ? 48.794 -3.704  2.692  1.00 44.35  ? 516 ILE X CD1   1 
ATOM   1061 N N     . PRO A 1 156 ? 49.963 2.145   2.650  1.00 46.22  ? 517 PRO X N     1 
ATOM   1062 C CA    . PRO A 1 156 ? 49.527 3.506   2.326  1.00 42.93  ? 517 PRO X CA    1 
ATOM   1063 C C     . PRO A 1 156 ? 48.181 3.567   1.611  1.00 42.41  ? 517 PRO X C     1 
ATOM   1064 O O     . PRO A 1 156 ? 47.754 2.602   1.004  1.00 53.52  ? 517 PRO X O     1 
ATOM   1065 C CB    . PRO A 1 156 ? 50.627 4.006   1.405  1.00 39.02  ? 517 PRO X CB    1 
ATOM   1066 C CG    . PRO A 1 156 ? 51.816 3.187   1.748  1.00 40.80  ? 517 PRO X CG    1 
ATOM   1067 C CD    . PRO A 1 156 ? 51.299 1.847   2.113  1.00 45.87  ? 517 PRO X CD    1 
ATOM   1068 N N     . GLY A 1 157 ? 47.498 4.693   1.718  1.00 45.85  ? 518 GLY X N     1 
ATOM   1069 C CA    . GLY A 1 157 ? 46.306 4.914   0.927  1.00 40.43  ? 518 GLY X CA    1 
ATOM   1070 C C     . GLY A 1 157 ? 44.984 4.611   1.585  1.00 51.30  ? 518 GLY X C     1 
ATOM   1071 O O     . GLY A 1 157 ? 43.928 4.885   1.001  1.00 58.56  ? 518 GLY X O     1 
ATOM   1072 N N     . GLN A 1 158 ? 45.019 4.050   2.789  1.00 46.58  ? 519 GLN X N     1 
ATOM   1073 C CA    . GLN A 1 158 ? 43.782 3.633   3.443  1.00 42.84  ? 519 GLN X CA    1 
ATOM   1074 C C     . GLN A 1 158 ? 43.245 4.739   4.326  1.00 49.92  ? 519 GLN X C     1 
ATOM   1075 O O     . GLN A 1 158 ? 43.992 5.614   4.765  1.00 55.83  ? 519 GLN X O     1 
ATOM   1076 C CB    . GLN A 1 158 ? 43.988 2.365   4.264  1.00 47.73  ? 519 GLN X CB    1 
ATOM   1077 C CG    . GLN A 1 158 ? 44.876 1.337   3.611  1.00 45.22  ? 519 GLN X CG    1 
ATOM   1078 C CD    . GLN A 1 158 ? 45.137 0.133   4.497  1.00 54.82  ? 519 GLN X CD    1 
ATOM   1079 O OE1   . GLN A 1 158 ? 44.210 -0.569  4.913  1.00 55.75  ? 519 GLN X OE1   1 
ATOM   1080 N NE2   . GLN A 1 158 ? 46.408 -0.129  4.769  1.00 49.69  ? 519 GLN X NE2   1 
ATOM   1081 N N     . PRO A 1 159 ? 41.938 4.707   4.586  1.00 48.57  ? 520 PRO X N     1 
ATOM   1082 C CA    . PRO A 1 159 ? 41.314 5.660   5.504  1.00 57.69  ? 520 PRO X CA    1 
ATOM   1083 C C     . PRO A 1 159 ? 42.093 5.753   6.803  1.00 58.26  ? 520 PRO X C     1 
ATOM   1084 O O     . PRO A 1 159 ? 42.808 4.813   7.143  1.00 59.46  ? 520 PRO X O     1 
ATOM   1085 C CB    . PRO A 1 159 ? 39.947 5.031   5.773  1.00 57.21  ? 520 PRO X CB    1 
ATOM   1086 C CG    . PRO A 1 159 ? 39.649 4.263   4.528  1.00 58.58  ? 520 PRO X CG    1 
ATOM   1087 C CD    . PRO A 1 159 ? 40.969 3.754   4.021  1.00 52.57  ? 520 PRO X CD    1 
ATOM   1088 N N     . GLU A 1 160 ? 41.953 6.869   7.516  1.00 77.32  ? 521 GLU X N     1 
ATOM   1089 C CA    . GLU A 1 160 ? 42.543 7.025   8.847  1.00 72.21  ? 521 GLU X CA    1 
ATOM   1090 C C     . GLU A 1 160 ? 41.525 6.653   9.926  1.00 80.89  ? 521 GLU X C     1 
ATOM   1091 O O     . GLU A 1 160 ? 40.328 6.546   9.656  1.00 86.68  ? 521 GLU X O     1 
ATOM   1092 C CB    . GLU A 1 160 ? 43.024 8.443   9.043  1.00 68.64  ? 521 GLU X CB    1 
ATOM   1093 N N     . LEU A 1 161 ? 42.002 6.457   11.149 1.00 89.97  ? 522 LEU X N     1 
ATOM   1094 C CA    . LEU A 1 161 ? 41.114 6.131   12.259 1.00 96.65  ? 522 LEU X CA    1 
ATOM   1095 C C     . LEU A 1 161 ? 40.417 7.359   12.853 1.00 109.30 ? 522 LEU X C     1 
ATOM   1096 O O     . LEU A 1 161 ? 41.048 8.394   13.072 1.00 114.89 ? 522 LEU X O     1 
ATOM   1097 C CB    . LEU A 1 161 ? 41.880 5.365   13.336 1.00 87.58  ? 522 LEU X CB    1 
ATOM   1098 C CG    . LEU A 1 161 ? 41.481 3.889   13.456 1.00 93.62  ? 522 LEU X CG    1 
ATOM   1099 C CD1   . LEU A 1 161 ? 41.176 3.160   12.140 1.00 67.99  ? 522 LEU X CD1   1 
ATOM   1100 C CD2   . LEU A 1 161 ? 42.344 3.064   14.422 1.00 96.21  ? 522 LEU X CD2   1 
ATOM   1101 N N     . PRO A 1 162 ? 39.101 7.242   13.107 1.00 113.54 ? 523 PRO X N     1 
ATOM   1102 C CA    . PRO A 1 162 ? 38.281 8.285   13.738 1.00 111.93 ? 523 PRO X CA    1 
ATOM   1103 C C     . PRO A 1 162 ? 38.826 8.701   15.104 1.00 113.87 ? 523 PRO X C     1 
ATOM   1104 O O     . PRO A 1 162 ? 39.701 8.022   15.643 1.00 119.05 ? 523 PRO X O     1 
ATOM   1105 C CB    . PRO A 1 162 ? 36.919 7.602   13.905 1.00 118.87 ? 523 PRO X CB    1 
ATOM   1106 C CG    . PRO A 1 162 ? 36.886 6.553   12.838 1.00 110.63 ? 523 PRO X CG    1 
ATOM   1107 C CD    . PRO A 1 162 ? 38.300 6.067   12.713 1.00 108.90 ? 523 PRO X CD    1 
ATOM   1108 N N     . TRP A 1 163 ? 38.306 9.803   15.647 1.00 126.85 ? 524 TRP X N     1 
ATOM   1109 C CA    . TRP A 1 163 ? 38.707 10.318  16.963 1.00 131.92 ? 524 TRP X CA    1 
ATOM   1110 C C     . TRP A 1 163 ? 40.198 10.663  17.057 1.00 142.05 ? 524 TRP X C     1 
ATOM   1111 O O     . TRP A 1 163 ? 41.063 9.937   16.558 1.00 136.51 ? 524 TRP X O     1 
ATOM   1112 C CB    . TRP A 1 163 ? 38.307 9.347   18.084 1.00 122.69 ? 524 TRP X CB    1 
ATOM   1113 N N     . GLN B 1 1   ? 19.623 -7.365  32.306 1.00 87.53  ? 362 GLN A N     1 
ATOM   1114 C CA    . GLN B 1 1   ? 19.763 -8.655  32.984 1.00 97.73  ? 362 GLN A CA    1 
ATOM   1115 C C     . GLN B 1 1   ? 18.411 -9.214  33.448 1.00 97.04  ? 362 GLN A C     1 
ATOM   1116 O O     . GLN B 1 1   ? 17.938 -8.902  34.543 1.00 97.31  ? 362 GLN A O     1 
ATOM   1117 C CB    . GLN B 1 1   ? 20.740 -8.534  34.160 1.00 101.39 ? 362 GLN A CB    1 
ATOM   1118 C CG    . GLN B 1 1   ? 20.847 -9.778  35.038 1.00 106.02 ? 362 GLN A CG    1 
ATOM   1119 C CD    . GLN B 1 1   ? 21.221 -11.038 34.265 1.00 107.98 ? 362 GLN A CD    1 
ATOM   1120 O OE1   . GLN B 1 1   ? 20.639 -11.343 33.218 1.00 105.68 ? 362 GLN A OE1   1 
ATOM   1121 N NE2   . GLN B 1 1   ? 22.185 -11.787 34.793 1.00 94.86  ? 362 GLN A NE2   1 
ATOM   1122 N N     . ILE B 1 2   ? 17.813 -10.061 32.614 1.00 88.28  ? 363 ILE A N     1 
ATOM   1123 C CA    . ILE B 1 2   ? 16.414 -10.468 32.778 1.00 85.01  ? 363 ILE A CA    1 
ATOM   1124 C C     . ILE B 1 2   ? 16.223 -11.836 33.427 1.00 75.12  ? 363 ILE A C     1 
ATOM   1125 O O     . ILE B 1 2   ? 17.096 -12.699 33.353 1.00 83.03  ? 363 ILE A O     1 
ATOM   1126 C CB    . ILE B 1 2   ? 15.707 -10.506 31.409 1.00 82.72  ? 363 ILE A CB    1 
ATOM   1127 C CG1   . ILE B 1 2   ? 15.943 -9.198  30.654 1.00 89.96  ? 363 ILE A CG1   1 
ATOM   1128 C CG2   . ILE B 1 2   ? 14.220 -10.787 31.573 1.00 77.13  ? 363 ILE A CG2   1 
ATOM   1129 C CD1   . ILE B 1 2   ? 15.703 -9.307  29.166 1.00 99.33  ? 363 ILE A CD1   1 
ATOM   1130 N N     . ILE B 1 3   ? 15.067 -12.031 34.052 1.00 69.65  ? 364 ILE A N     1 
ATOM   1131 C CA    . ILE B 1 3   ? 14.671 -13.342 34.556 1.00 69.70  ? 364 ILE A CA    1 
ATOM   1132 C C     . ILE B 1 3   ? 13.520 -13.931 33.738 1.00 76.06  ? 364 ILE A C     1 
ATOM   1133 O O     . ILE B 1 3   ? 12.545 -13.240 33.423 1.00 73.71  ? 364 ILE A O     1 
ATOM   1134 C CB    . ILE B 1 3   ? 14.241 -13.286 36.024 1.00 60.27  ? 364 ILE A CB    1 
ATOM   1135 C CG1   . ILE B 1 3   ? 15.435 -12.960 36.919 1.00 69.43  ? 364 ILE A CG1   1 
ATOM   1136 C CG2   . ILE B 1 3   ? 13.621 -14.605 36.441 1.00 61.32  ? 364 ILE A CG2   1 
ATOM   1137 C CD1   . ILE B 1 3   ? 15.139 -13.092 38.403 1.00 69.56  ? 364 ILE A CD1   1 
ATOM   1138 N N     . GLY B 1 4   ? 13.637 -15.213 33.396 1.00 70.27  ? 365 GLY A N     1 
ATOM   1139 C CA    . GLY B 1 4   ? 12.613 -15.892 32.622 1.00 57.50  ? 365 GLY A CA    1 
ATOM   1140 C C     . GLY B 1 4   ? 12.778 -15.630 31.144 1.00 53.36  ? 365 GLY A C     1 
ATOM   1141 O O     . GLY B 1 4   ? 13.896 -15.455 30.662 1.00 60.90  ? 365 GLY A O     1 
ATOM   1142 N N     . THR B 1 5   ? 11.663 -15.590 30.425 1.00 57.64  ? 366 THR A N     1 
ATOM   1143 C CA    . THR B 1 5   ? 11.686 -15.401 28.975 1.00 61.69  ? 366 THR A CA    1 
ATOM   1144 C C     . THR B 1 5   ? 12.405 -14.133 28.517 1.00 65.28  ? 366 THR A C     1 
ATOM   1145 O O     . THR B 1 5   ? 12.345 -13.089 29.168 1.00 72.89  ? 366 THR A O     1 
ATOM   1146 C CB    . THR B 1 5   ? 10.266 -15.381 28.400 1.00 64.49  ? 366 THR A CB    1 
ATOM   1147 O OG1   . THR B 1 5   ? 9.607  -16.610 28.729 1.00 69.28  ? 366 THR A OG1   1 
ATOM   1148 C CG2   . THR B 1 5   ? 10.310 -15.206 26.882 1.00 55.32  ? 366 THR A CG2   1 
ATOM   1149 N N     . VAL B 1 6   ? 13.083 -14.241 27.384 1.00 66.82  ? 367 VAL A N     1 
ATOM   1150 C CA    . VAL B 1 6   ? 13.762 -13.106 26.786 1.00 72.18  ? 367 VAL A CA    1 
ATOM   1151 C C     . VAL B 1 6   ? 13.156 -12.807 25.418 1.00 85.21  ? 367 VAL A C     1 
ATOM   1152 O O     . VAL B 1 6   ? 13.101 -13.681 24.544 1.00 79.19  ? 367 VAL A O     1 
ATOM   1153 C CB    . VAL B 1 6   ? 15.264 -13.367 26.640 1.00 71.22  ? 367 VAL A CB    1 
ATOM   1154 C CG1   . VAL B 1 6   ? 15.890 -12.360 25.689 1.00 78.57  ? 367 VAL A CG1   1 
ATOM   1155 C CG2   . VAL B 1 6   ? 15.941 -13.336 28.005 1.00 66.18  ? 367 VAL A CG2   1 
ATOM   1156 N N     . PRO B 1 7   ? 12.685 -11.565 25.238 1.00 94.69  ? 368 PRO A N     1 
ATOM   1157 C CA    . PRO B 1 7   ? 12.009 -11.090 24.027 1.00 88.67  ? 368 PRO A CA    1 
ATOM   1158 C C     . PRO B 1 7   ? 12.657 -11.605 22.751 1.00 85.34  ? 368 PRO A C     1 
ATOM   1159 O O     . PRO B 1 7   ? 13.862 -11.424 22.559 1.00 74.92  ? 368 PRO A O     1 
ATOM   1160 C CB    . PRO B 1 7   ? 12.181 -9.575  24.116 1.00 86.81  ? 368 PRO A CB    1 
ATOM   1161 C CG    . PRO B 1 7   ? 12.203 -9.296  25.583 1.00 91.17  ? 368 PRO A CG    1 
ATOM   1162 C CD    . PRO B 1 7   ? 12.835 -10.496 26.244 1.00 89.58  ? 368 PRO A CD    1 
ATOM   1163 N N     . GLY B 1 8   ? 11.859 -12.240 21.896 1.00 86.76  ? 369 GLY A N     1 
ATOM   1164 C CA    . GLY B 1 8   ? 12.312 -12.646 20.577 1.00 84.71  ? 369 GLY A CA    1 
ATOM   1165 C C     . GLY B 1 8   ? 13.218 -13.861 20.549 1.00 84.95  ? 369 GLY A C     1 
ATOM   1166 O O     . GLY B 1 8   ? 13.858 -14.145 19.537 1.00 91.25  ? 369 GLY A O     1 
ATOM   1167 N N     . VAL B 1 9   ? 13.286 -14.580 21.661 1.00 88.83  ? 370 VAL A N     1 
ATOM   1168 C CA    . VAL B 1 9   ? 14.025 -15.835 21.700 1.00 87.14  ? 370 VAL A CA    1 
ATOM   1169 C C     . VAL B 1 9   ? 13.065 -16.979 21.986 1.00 82.85  ? 370 VAL A C     1 
ATOM   1170 O O     . VAL B 1 9   ? 12.545 -17.117 23.103 1.00 80.10  ? 370 VAL A O     1 
ATOM   1171 C CB    . VAL B 1 9   ? 15.140 -15.826 22.755 1.00 86.21  ? 370 VAL A CB    1 
ATOM   1172 C CG1   . VAL B 1 9   ? 16.004 -17.070 22.608 1.00 70.47  ? 370 VAL A CG1   1 
ATOM   1173 C CG2   . VAL B 1 9   ? 15.981 -14.572 22.622 1.00 77.52  ? 370 VAL A CG2   1 
ATOM   1174 N N     . GLU B 1 10  ? 12.824 -17.794 20.968 1.00 68.90  ? 371 GLU A N     1 
ATOM   1175 C CA    . GLU B 1 10  ? 11.857 -18.870 21.089 1.00 82.43  ? 371 GLU A CA    1 
ATOM   1176 C C     . GLU B 1 10  ? 12.527 -20.188 21.464 1.00 77.78  ? 371 GLU A C     1 
ATOM   1177 O O     . GLU B 1 10  ? 13.695 -20.424 21.146 1.00 73.21  ? 371 GLU A O     1 
ATOM   1178 C CB    . GLU B 1 10  ? 11.069 -19.028 19.786 1.00 83.06  ? 371 GLU A CB    1 
ATOM   1179 C CG    . GLU B 1 10  ? 10.577 -17.711 19.184 1.00 95.81  ? 371 GLU A CG    1 
ATOM   1180 C CD    . GLU B 1 10  ? 9.700  -16.901 20.139 1.00 113.99 ? 371 GLU A CD    1 
ATOM   1181 O OE1   . GLU B 1 10  ? 8.942  -17.518 20.926 1.00 114.48 ? 371 GLU A OE1   1 
ATOM   1182 O OE2   . GLU B 1 10  ? 9.769  -15.646 20.098 1.00 106.30 ? 371 GLU A OE2   1 
ATOM   1183 N N     . VAL B 1 11  ? 11.782 -21.041 22.156 1.00 67.21  ? 372 VAL A N     1 
ATOM   1184 C CA    . VAL B 1 11  ? 12.244 -22.389 22.430 1.00 62.31  ? 372 VAL A CA    1 
ATOM   1185 C C     . VAL B 1 11  ? 12.626 -23.068 21.117 1.00 65.86  ? 372 VAL A C     1 
ATOM   1186 O O     . VAL B 1 11  ? 11.870 -23.026 20.149 1.00 70.91  ? 372 VAL A O     1 
ATOM   1187 C CB    . VAL B 1 11  ? 11.152 -23.212 23.142 1.00 59.73  ? 372 VAL A CB    1 
ATOM   1188 C CG1   . VAL B 1 11  ? 11.444 -24.709 23.031 1.00 58.16  ? 372 VAL A CG1   1 
ATOM   1189 C CG2   . VAL B 1 11  ? 11.028 -22.776 24.592 1.00 57.28  ? 372 VAL A CG2   1 
ATOM   1190 N N     . GLY B 1 12  ? 13.806 -23.679 21.082 1.00 63.67  ? 373 GLY A N     1 
ATOM   1191 C CA    . GLY B 1 12  ? 14.269 -24.372 19.895 1.00 55.66  ? 373 GLY A CA    1 
ATOM   1192 C C     . GLY B 1 12  ? 15.212 -23.547 19.041 1.00 58.56  ? 373 GLY A C     1 
ATOM   1193 O O     . GLY B 1 12  ? 15.799 -24.062 18.096 1.00 64.97  ? 373 GLY A O     1 
ATOM   1194 N N     . ASP B 1 13  ? 15.352 -22.265 19.364 1.00 63.32  ? 374 ASP A N     1 
ATOM   1195 C CA    . ASP B 1 13  ? 16.282 -21.396 18.652 1.00 61.21  ? 374 ASP A CA    1 
ATOM   1196 C C     . ASP B 1 13  ? 17.715 -21.865 18.870 1.00 68.69  ? 374 ASP A C     1 
ATOM   1197 O O     . ASP B 1 13  ? 18.088 -22.277 19.971 1.00 63.52  ? 374 ASP A O     1 
ATOM   1198 C CB    . ASP B 1 13  ? 16.125 -19.942 19.100 1.00 69.81  ? 374 ASP A CB    1 
ATOM   1199 C CG    . ASP B 1 13  ? 14.914 -19.264 18.473 1.00 87.70  ? 374 ASP A CG    1 
ATOM   1200 O OD1   . ASP B 1 13  ? 14.304 -19.866 17.561 1.00 80.12  ? 374 ASP A OD1   1 
ATOM   1201 O OD2   . ASP B 1 13  ? 14.574 -18.129 18.889 1.00 91.12  ? 374 ASP A OD2   1 
ATOM   1202 N N     . GLU B 1 14  ? 18.522 -21.802 17.821 1.00 65.31  ? 375 GLU A N     1 
ATOM   1203 C CA    . GLU B 1 14  ? 19.857 -22.367 17.891 1.00 58.99  ? 375 GLU A CA    1 
ATOM   1204 C C     . GLU B 1 14  ? 20.951 -21.329 17.698 1.00 68.63  ? 375 GLU A C     1 
ATOM   1205 O O     . GLU B 1 14  ? 20.707 -20.234 17.177 1.00 66.85  ? 375 GLU A O     1 
ATOM   1206 C CB    . GLU B 1 14  ? 20.003 -23.487 16.875 1.00 66.75  ? 375 GLU A CB    1 
ATOM   1207 C CG    . GLU B 1 14  ? 18.974 -24.574 17.052 1.00 74.96  ? 375 GLU A CG    1 
ATOM   1208 C CD    . GLU B 1 14  ? 19.165 -25.715 16.077 1.00 98.79  ? 375 GLU A CD    1 
ATOM   1209 O OE1   . GLU B 1 14  ? 19.797 -25.495 15.020 1.00 101.81 ? 375 GLU A OE1   1 
ATOM   1210 O OE2   . GLU B 1 14  ? 18.678 -26.829 16.365 1.00 104.38 ? 375 GLU A OE2   1 
ATOM   1211 N N     . PHE B 1 15  ? 22.157 -21.684 18.135 1.00 65.94  ? 376 PHE A N     1 
ATOM   1212 C CA    . PHE B 1 15  ? 23.293 -20.777 18.094 1.00 61.36  ? 376 PHE A CA    1 
ATOM   1213 C C     . PHE B 1 15  ? 24.602 -21.525 17.930 1.00 61.04  ? 376 PHE A C     1 
ATOM   1214 O O     . PHE B 1 15  ? 24.705 -22.697 18.249 1.00 61.07  ? 376 PHE A O     1 
ATOM   1215 C CB    . PHE B 1 15  ? 23.331 -19.937 19.356 1.00 56.62  ? 376 PHE A CB    1 
ATOM   1216 C CG    . PHE B 1 15  ? 21.995 -19.408 19.754 1.00 59.47  ? 376 PHE A CG    1 
ATOM   1217 C CD1   . PHE B 1 15  ? 21.580 -18.164 19.335 1.00 65.14  ? 376 PHE A CD1   1 
ATOM   1218 C CD2   . PHE B 1 15  ? 21.142 -20.165 20.536 1.00 65.37  ? 376 PHE A CD2   1 
ATOM   1219 C CE1   . PHE B 1 15  ? 20.345 -17.676 19.697 1.00 64.70  ? 376 PHE A CE1   1 
ATOM   1220 C CE2   . PHE B 1 15  ? 19.904 -19.686 20.899 1.00 64.47  ? 376 PHE A CE2   1 
ATOM   1221 C CZ    . PHE B 1 15  ? 19.506 -18.439 20.481 1.00 68.66  ? 376 PHE A CZ    1 
ATOM   1222 N N     . GLN B 1 16  ? 25.606 -20.827 17.426 1.00 64.49  ? 377 GLN A N     1 
ATOM   1223 C CA    . GLN B 1 16  ? 26.885 -21.437 17.128 1.00 61.36  ? 377 GLN A CA    1 
ATOM   1224 C C     . GLN B 1 16  ? 27.881 -21.151 18.250 1.00 59.35  ? 377 GLN A C     1 
ATOM   1225 O O     . GLN B 1 16  ? 28.807 -21.925 18.483 1.00 57.22  ? 377 GLN A O     1 
ATOM   1226 C CB    . GLN B 1 16  ? 27.396 -20.865 15.808 1.00 64.18  ? 377 GLN A CB    1 
ATOM   1227 C CG    . GLN B 1 16  ? 28.634 -21.528 15.252 1.00 78.54  ? 377 GLN A CG    1 
ATOM   1228 C CD    . GLN B 1 16  ? 29.183 -20.791 14.039 1.00 84.43  ? 377 GLN A CD    1 
ATOM   1229 O OE1   . GLN B 1 16  ? 30.231 -21.154 13.501 1.00 85.28  ? 377 GLN A OE1   1 
ATOM   1230 N NE2   . GLN B 1 16  ? 28.477 -19.745 13.608 1.00 73.68  ? 377 GLN A NE2   1 
ATOM   1231 N N     . TYR B 1 17  ? 27.672 -20.038 18.950 1.00 53.79  ? 378 TYR A N     1 
ATOM   1232 C CA    . TYR B 1 17  ? 28.656 -19.522 19.894 1.00 56.80  ? 378 TYR A CA    1 
ATOM   1233 C C     . TYR B 1 17  ? 28.088 -19.015 21.226 1.00 62.93  ? 378 TYR A C     1 
ATOM   1234 O O     . TYR B 1 17  ? 27.010 -18.419 21.300 1.00 59.46  ? 378 TYR A O     1 
ATOM   1235 C CB    . TYR B 1 17  ? 29.504 -18.423 19.238 1.00 53.32  ? 378 TYR A CB    1 
ATOM   1236 C CG    . TYR B 1 17  ? 30.357 -18.941 18.122 1.00 55.86  ? 378 TYR A CG    1 
ATOM   1237 C CD1   . TYR B 1 17  ? 31.307 -19.921 18.357 1.00 59.42  ? 378 TYR A CD1   1 
ATOM   1238 C CD2   . TYR B 1 17  ? 30.203 -18.472 16.829 1.00 63.16  ? 378 TYR A CD2   1 
ATOM   1239 C CE1   . TYR B 1 17  ? 32.083 -20.423 17.338 1.00 64.45  ? 378 TYR A CE1   1 
ATOM   1240 C CE2   . TYR B 1 17  ? 30.980 -18.964 15.802 1.00 67.08  ? 378 TYR A CE2   1 
ATOM   1241 C CZ    . TYR B 1 17  ? 31.917 -19.945 16.063 1.00 68.94  ? 378 TYR A CZ    1 
ATOM   1242 O OH    . TYR B 1 17  ? 32.701 -20.451 15.057 1.00 62.33  ? 378 TYR A OH    1 
ATOM   1243 N N     . ARG B 1 18  ? 28.852 -19.240 22.281 1.00 50.62  ? 379 ARG A N     1 
ATOM   1244 C CA    . ARG B 1 18  ? 28.449 -18.809 23.600 1.00 54.61  ? 379 ARG A CA    1 
ATOM   1245 C C     . ARG B 1 18  ? 28.211 -17.311 23.672 1.00 60.23  ? 379 ARG A C     1 
ATOM   1246 O O     . ARG B 1 18  ? 27.502 -16.832 24.558 1.00 69.04  ? 379 ARG A O     1 
ATOM   1247 C CB    . ARG B 1 18  ? 29.508 -19.214 24.620 1.00 53.50  ? 379 ARG A CB    1 
ATOM   1248 C CG    . ARG B 1 18  ? 29.446 -20.672 24.990 1.00 52.24  ? 379 ARG A CG    1 
ATOM   1249 C CD    . ARG B 1 18  ? 28.225 -20.906 25.827 1.00 49.03  ? 379 ARG A CD    1 
ATOM   1250 N NE    . ARG B 1 18  ? 28.325 -20.203 27.105 1.00 51.31  ? 379 ARG A NE    1 
ATOM   1251 C CZ    . ARG B 1 18  ? 28.925 -20.716 28.170 1.00 48.83  ? 379 ARG A CZ    1 
ATOM   1252 N NH1   . ARG B 1 18  ? 29.473 -21.920 28.082 1.00 52.21  ? 379 ARG A NH1   1 
ATOM   1253 N NH2   . ARG B 1 18  ? 28.987 -20.031 29.306 1.00 52.25  ? 379 ARG A NH2   1 
ATOM   1254 N N     . MET B 1 19  ? 28.813 -16.561 22.757 1.00 64.53  ? 380 MET A N     1 
ATOM   1255 C CA    . MET B 1 19  ? 28.679 -15.108 22.805 1.00 67.79  ? 380 MET A CA    1 
ATOM   1256 C C     . MET B 1 19  ? 27.413 -14.631 22.112 1.00 63.90  ? 380 MET A C     1 
ATOM   1257 O O     . MET B 1 19  ? 26.889 -13.571 22.434 1.00 64.84  ? 380 MET A O     1 
ATOM   1258 C CB    . MET B 1 19  ? 29.915 -14.411 22.231 1.00 71.19  ? 380 MET A CB    1 
ATOM   1259 C CG    . MET B 1 19  ? 31.193 -14.623 23.052 1.00 84.51  ? 380 MET A CG    1 
ATOM   1260 S SD    . MET B 1 19  ? 31.114 -14.110 24.794 1.00 90.55  ? 380 MET A SD    1 
ATOM   1261 C CE    . MET B 1 19  ? 30.443 -12.451 24.677 1.00 75.54  ? 380 MET A CE    1 
ATOM   1262 N N     . GLU B 1 20  ? 26.919 -15.411 21.160 1.00 55.41  ? 381 GLU A N     1 
ATOM   1263 C CA    . GLU B 1 20  ? 25.616 -15.114 20.591 1.00 58.82  ? 381 GLU A CA    1 
ATOM   1264 C C     . GLU B 1 20  ? 24.597 -15.026 21.725 1.00 66.52  ? 381 GLU A C     1 
ATOM   1265 O O     . GLU B 1 20  ? 23.745 -14.136 21.742 1.00 77.71  ? 381 GLU A O     1 
ATOM   1266 C CB    . GLU B 1 20  ? 25.201 -16.175 19.575 1.00 53.75  ? 381 GLU A CB    1 
ATOM   1267 C CG    . GLU B 1 20  ? 25.862 -16.017 18.208 1.00 63.52  ? 381 GLU A CG    1 
ATOM   1268 C CD    . GLU B 1 20  ? 25.841 -17.307 17.387 1.00 82.08  ? 381 GLU A CD    1 
ATOM   1269 O OE1   . GLU B 1 20  ? 25.497 -17.260 16.183 1.00 83.40  ? 381 GLU A OE1   1 
ATOM   1270 O OE2   . GLU B 1 20  ? 26.167 -18.373 17.953 1.00 80.10  ? 381 GLU A OE2   1 
ATOM   1271 N N     . LEU B 1 21  ? 24.707 -15.942 22.684 1.00 61.79  ? 382 LEU A N     1 
ATOM   1272 C CA    . LEU B 1 21  ? 23.804 -15.986 23.829 1.00 60.43  ? 382 LEU A CA    1 
ATOM   1273 C C     . LEU B 1 21  ? 23.931 -14.729 24.665 1.00 63.31  ? 382 LEU A C     1 
ATOM   1274 O O     . LEU B 1 21  ? 22.965 -14.272 25.273 1.00 64.44  ? 382 LEU A O     1 
ATOM   1275 C CB    . LEU B 1 21  ? 24.119 -17.193 24.714 1.00 59.19  ? 382 LEU A CB    1 
ATOM   1276 C CG    . LEU B 1 21  ? 24.253 -18.548 24.021 1.00 62.08  ? 382 LEU A CG    1 
ATOM   1277 C CD1   . LEU B 1 21  ? 24.516 -19.638 25.045 1.00 53.68  ? 382 LEU A CD1   1 
ATOM   1278 C CD2   . LEU B 1 21  ? 23.010 -18.856 23.199 1.00 59.52  ? 382 LEU A CD2   1 
ATOM   1279 N N     . ASN B 1 22  ? 25.144 -14.192 24.713 1.00 62.83  ? 383 ASN A N     1 
ATOM   1280 C CA    . ASN B 1 22  ? 25.408 -12.965 25.440 1.00 62.30  ? 383 ASN A CA    1 
ATOM   1281 C C     . ASN B 1 22  ? 24.742 -11.777 24.757 1.00 67.09  ? 383 ASN A C     1 
ATOM   1282 O O     . ASN B 1 22  ? 24.050 -10.977 25.394 1.00 64.28  ? 383 ASN A O     1 
ATOM   1283 C CB    . ASN B 1 22  ? 26.911 -12.747 25.538 1.00 58.73  ? 383 ASN A CB    1 
ATOM   1284 C CG    . ASN B 1 22  ? 27.264 -11.499 26.299 1.00 69.41  ? 383 ASN A CG    1 
ATOM   1285 O OD1   . ASN B 1 22  ? 26.729 -10.424 26.033 1.00 72.36  ? 383 ASN A OD1   1 
ATOM   1286 N ND2   . ASN B 1 22  ? 28.180 -11.629 27.251 1.00 69.42  ? 383 ASN A ND2   1 
ATOM   1287 N N     . LEU B 1 23  ? 24.946 -11.690 23.447 1.00 68.13  ? 384 LEU A N     1 
ATOM   1288 C CA    . LEU B 1 23  ? 24.398 -10.615 22.630 1.00 67.73  ? 384 LEU A CA    1 
ATOM   1289 C C     . LEU B 1 23  ? 22.881 -10.516 22.704 1.00 73.29  ? 384 LEU A C     1 
ATOM   1290 O O     . LEU B 1 23  ? 22.309 -9.449  22.478 1.00 77.72  ? 384 LEU A O     1 
ATOM   1291 C CB    . LEU B 1 23  ? 24.838 -10.788 21.179 1.00 64.09  ? 384 LEU A CB    1 
ATOM   1292 C CG    . LEU B 1 23  ? 26.000 -9.887  20.761 1.00 72.03  ? 384 LEU A CG    1 
ATOM   1293 C CD1   . LEU B 1 23  ? 26.679 -9.258  21.975 1.00 63.80  ? 384 LEU A CD1   1 
ATOM   1294 C CD2   . LEU B 1 23  ? 26.997 -10.641 19.873 1.00 63.88  ? 384 LEU A CD2   1 
ATOM   1295 N N     . LEU B 1 24  ? 22.230 -11.627 23.017 1.00 69.46  ? 385 LEU A N     1 
ATOM   1296 C CA    . LEU B 1 24  ? 20.779 -11.636 23.098 1.00 61.94  ? 385 LEU A CA    1 
ATOM   1297 C C     . LEU B 1 24  ? 20.302 -11.570 24.544 1.00 68.47  ? 385 LEU A C     1 
ATOM   1298 O O     . LEU B 1 24  ? 19.108 -11.458 24.809 1.00 67.70  ? 385 LEU A O     1 
ATOM   1299 C CB    . LEU B 1 24  ? 20.220 -12.863 22.388 1.00 66.79  ? 385 LEU A CB    1 
ATOM   1300 C CG    . LEU B 1 24  ? 20.540 -12.884 20.890 1.00 79.52  ? 385 LEU A CG    1 
ATOM   1301 C CD1   . LEU B 1 24  ? 20.011 -14.142 20.231 1.00 64.90  ? 385 LEU A CD1   1 
ATOM   1302 C CD2   . LEU B 1 24  ? 19.964 -11.648 20.216 1.00 83.70  ? 385 LEU A CD2   1 
ATOM   1303 N N     . GLY B 1 25  ? 21.248 -11.623 25.475 1.00 69.18  ? 386 GLY A N     1 
ATOM   1304 C CA    . GLY B 1 25  ? 20.932 -11.529 26.889 1.00 72.06  ? 386 GLY A CA    1 
ATOM   1305 C C     . GLY B 1 25  ? 20.378 -12.809 27.489 1.00 70.77  ? 386 GLY A C     1 
ATOM   1306 O O     . GLY B 1 25  ? 19.745 -12.785 28.541 1.00 65.80  ? 386 GLY A O     1 
ATOM   1307 N N     . ILE B 1 26  ? 20.615 -13.929 26.818 1.00 70.06  ? 387 ILE A N     1 
ATOM   1308 C CA    . ILE B 1 26  ? 20.176 -15.220 27.325 1.00 64.78  ? 387 ILE A CA    1 
ATOM   1309 C C     . ILE B 1 26  ? 21.123 -15.713 28.411 1.00 63.95  ? 387 ILE A C     1 
ATOM   1310 O O     . ILE B 1 26  ? 20.696 -16.245 29.435 1.00 63.87  ? 387 ILE A O     1 
ATOM   1311 C CB    . ILE B 1 26  ? 20.153 -16.259 26.203 1.00 66.36  ? 387 ILE A CB    1 
ATOM   1312 C CG1   . ILE B 1 26  ? 19.419 -15.711 24.985 1.00 70.26  ? 387 ILE A CG1   1 
ATOM   1313 C CG2   . ILE B 1 26  ? 19.507 -17.548 26.677 1.00 70.18  ? 387 ILE A CG2   1 
ATOM   1314 C CD1   . ILE B 1 26  ? 19.601 -16.578 23.754 1.00 77.00  ? 387 ILE A CD1   1 
ATOM   1315 N N     . HIS B 1 27  ? 22.417 -15.526 28.170 1.00 69.52  ? 388 HIS A N     1 
ATOM   1316 C CA    . HIS B 1 27  ? 23.456 -16.010 29.067 1.00 61.57  ? 388 HIS A CA    1 
ATOM   1317 C C     . HIS B 1 27  ? 24.699 -15.156 28.872 1.00 60.01  ? 388 HIS A C     1 
ATOM   1318 O O     . HIS B 1 27  ? 25.238 -15.081 27.773 1.00 67.25  ? 388 HIS A O     1 
ATOM   1319 C CB    . HIS B 1 27  ? 23.764 -17.476 28.764 1.00 53.40  ? 388 HIS A CB    1 
ATOM   1320 C CG    . HIS B 1 27  ? 24.429 -18.198 29.892 1.00 50.42  ? 388 HIS A CG    1 
ATOM   1321 N ND1   . HIS B 1 27  ? 25.762 -18.549 29.870 1.00 56.51  ? 388 HIS A ND1   1 
ATOM   1322 C CD2   . HIS B 1 27  ? 23.950 -18.623 31.084 1.00 50.86  ? 388 HIS A CD2   1 
ATOM   1323 C CE1   . HIS B 1 27  ? 26.077 -19.158 30.997 1.00 45.97  ? 388 HIS A CE1   1 
ATOM   1324 N NE2   . HIS B 1 27  ? 24.993 -19.218 31.750 1.00 58.88  ? 388 HIS A NE2   1 
ATOM   1325 N N     . ARG B 1 28  ? 25.154 -14.508 29.937 1.00 65.59  ? 389 ARG A N     1 
ATOM   1326 C CA    . ARG B 1 28  ? 26.207 -13.502 29.811 1.00 69.88  ? 389 ARG A CA    1 
ATOM   1327 C C     . ARG B 1 28  ? 27.633 -14.062 29.817 1.00 67.52  ? 389 ARG A C     1 
ATOM   1328 O O     . ARG B 1 28  ? 28.462 -13.666 28.997 1.00 64.17  ? 389 ARG A O     1 
ATOM   1329 C CB    . ARG B 1 28  ? 26.049 -12.409 30.878 1.00 60.04  ? 389 ARG A CB    1 
ATOM   1330 C CG    . ARG B 1 28  ? 24.775 -11.592 30.724 1.00 75.84  ? 389 ARG A CG    1 
ATOM   1331 C CD    . ARG B 1 28  ? 24.691 -10.490 31.762 1.00 90.89  ? 389 ARG A CD    1 
ATOM   1332 N NE    . ARG B 1 28  ? 24.641 -11.021 33.122 1.00 99.36  ? 389 ARG A NE    1 
ATOM   1333 C CZ    . ARG B 1 28  ? 24.910 -10.311 34.215 1.00 103.75 ? 389 ARG A CZ    1 
ATOM   1334 N NH1   . ARG B 1 28  ? 25.254 -9.033  34.114 1.00 111.12 ? 389 ARG A NH1   1 
ATOM   1335 N NH2   . ARG B 1 28  ? 24.844 -10.881 35.411 1.00 95.07  ? 389 ARG A NH2   1 
ATOM   1336 N N     . PRO B 1 29  ? 27.937 -14.973 30.750 1.00 62.24  ? 390 PRO A N     1 
ATOM   1337 C CA    . PRO B 1 29  ? 29.338 -15.409 30.780 1.00 54.52  ? 390 PRO A CA    1 
ATOM   1338 C C     . PRO B 1 29  ? 29.737 -16.110 29.490 1.00 54.62  ? 390 PRO A C     1 
ATOM   1339 O O     . PRO B 1 29  ? 28.913 -16.717 28.821 1.00 59.05  ? 390 PRO A O     1 
ATOM   1340 C CB    . PRO B 1 29  ? 29.394 -16.370 31.977 1.00 48.15  ? 390 PRO A CB    1 
ATOM   1341 C CG    . PRO B 1 29  ? 28.238 -15.980 32.837 1.00 47.83  ? 390 PRO A CG    1 
ATOM   1342 C CD    . PRO B 1 29  ? 27.160 -15.512 31.879 1.00 62.62  ? 390 PRO A CD    1 
ATOM   1343 N N     . SER B 1 30  ? 31.010 -16.002 29.144 1.00 65.58  ? 391 SER A N     1 
ATOM   1344 C CA    . SER B 1 30  ? 31.513 -16.566 27.907 1.00 54.67  ? 391 SER A CA    1 
ATOM   1345 C C     . SER B 1 30  ? 31.855 -18.044 28.061 1.00 57.11  ? 391 SER A C     1 
ATOM   1346 O O     . SER B 1 30  ? 31.928 -18.777 27.073 1.00 58.77  ? 391 SER A O     1 
ATOM   1347 C CB    . SER B 1 30  ? 32.754 -15.795 27.473 1.00 64.17  ? 391 SER A CB    1 
ATOM   1348 O OG    . SER B 1 30  ? 33.673 -15.700 28.541 1.00 57.67  ? 391 SER A OG    1 
ATOM   1349 N N     . GLN B 1 31  ? 32.069 -18.477 29.300 1.00 55.27  ? 392 GLN A N     1 
ATOM   1350 C CA    . GLN B 1 31  ? 32.444 -19.857 29.567 1.00 54.57  ? 392 GLN A CA    1 
ATOM   1351 C C     . GLN B 1 31  ? 31.686 -20.449 30.740 1.00 51.62  ? 392 GLN A C     1 
ATOM   1352 O O     . GLN B 1 31  ? 31.224 -21.577 30.672 1.00 54.82  ? 392 GLN A O     1 
ATOM   1353 C CB    . GLN B 1 31  ? 33.939 -19.959 29.828 1.00 52.65  ? 392 GLN A CB    1 
ATOM   1354 C CG    . GLN B 1 31  ? 34.794 -19.515 28.669 1.00 59.75  ? 392 GLN A CG    1 
ATOM   1355 C CD    . GLN B 1 31  ? 36.252 -19.890 28.858 1.00 64.42  ? 392 GLN A CD    1 
ATOM   1356 O OE1   . GLN B 1 31  ? 37.138 -19.305 28.240 1.00 76.17  ? 392 GLN A OE1   1 
ATOM   1357 N NE2   . GLN B 1 31  ? 36.507 -20.868 29.721 1.00 62.12  ? 392 GLN A NE2   1 
ATOM   1358 N N     . SER B 1 32  ? 31.574 -19.690 31.822 1.00 58.02  ? 393 SER A N     1 
ATOM   1359 C CA    . SER B 1 32  ? 30.910 -20.170 33.024 1.00 51.09  ? 393 SER A CA    1 
ATOM   1360 C C     . SER B 1 32  ? 29.512 -20.668 32.689 1.00 56.03  ? 393 SER A C     1 
ATOM   1361 O O     . SER B 1 32  ? 28.734 -19.961 32.043 1.00 52.78  ? 393 SER A O     1 
ATOM   1362 C CB    . SER B 1 32  ? 30.836 -19.056 34.064 1.00 48.21  ? 393 SER A CB    1 
ATOM   1363 O OG    . SER B 1 32  ? 30.269 -19.526 35.273 1.00 67.14  ? 393 SER A OG    1 
ATOM   1364 N N     . GLY B 1 33  ? 29.202 -21.887 33.131 1.00 50.56  ? 394 GLY A N     1 
ATOM   1365 C CA    . GLY B 1 33  ? 27.933 -22.521 32.827 1.00 47.33  ? 394 GLY A CA    1 
ATOM   1366 C C     . GLY B 1 33  ? 26.744 -21.899 33.537 1.00 50.42  ? 394 GLY A C     1 
ATOM   1367 O O     . GLY B 1 33  ? 25.605 -21.982 33.078 1.00 51.32  ? 394 GLY A O     1 
ATOM   1368 N N     . ILE B 1 34  ? 27.005 -21.263 34.666 1.00 54.28  ? 395 ILE A N     1 
ATOM   1369 C CA    . ILE B 1 34  ? 25.933 -20.676 35.455 1.00 55.62  ? 395 ILE A CA    1 
ATOM   1370 C C     . ILE B 1 34  ? 25.945 -19.159 35.375 1.00 54.49  ? 395 ILE A C     1 
ATOM   1371 O O     . ILE B 1 34  ? 26.997 -18.538 35.493 1.00 59.58  ? 395 ILE A O     1 
ATOM   1372 C CB    . ILE B 1 34  ? 26.053 -21.089 36.928 1.00 50.76  ? 395 ILE A CB    1 
ATOM   1373 C CG1   . ILE B 1 34  ? 26.224 -22.607 37.032 1.00 46.51  ? 395 ILE A CG1   1 
ATOM   1374 C CG2   . ILE B 1 34  ? 24.853 -20.601 37.702 1.00 48.19  ? 395 ILE A CG2   1 
ATOM   1375 C CD1   . ILE B 1 34  ? 26.378 -23.124 38.450 1.00 51.89  ? 395 ILE A CD1   1 
ATOM   1376 N N     . ASP B 1 35  ? 24.769 -18.570 35.177 1.00 56.18  ? 396 ASP A N     1 
ATOM   1377 C CA    . ASP B 1 35  ? 24.626 -17.118 35.146 1.00 51.27  ? 396 ASP A CA    1 
ATOM   1378 C C     . ASP B 1 35  ? 23.576 -16.656 36.159 1.00 64.93  ? 396 ASP A C     1 
ATOM   1379 O O     . ASP B 1 35  ? 22.502 -17.256 36.282 1.00 63.98  ? 396 ASP A O     1 
ATOM   1380 C CB    . ASP B 1 35  ? 24.236 -16.649 33.745 1.00 57.55  ? 396 ASP A CB    1 
ATOM   1381 C CG    . ASP B 1 35  ? 24.261 -15.129 33.609 1.00 81.97  ? 396 ASP A CG    1 
ATOM   1382 O OD1   . ASP B 1 35  ? 24.856 -14.464 34.497 1.00 80.07  ? 396 ASP A OD1   1 
ATOM   1383 O OD2   . ASP B 1 35  ? 23.689 -14.605 32.619 1.00 74.84  ? 396 ASP A OD2   1 
ATOM   1384 N N     . TYR B 1 36  ? 23.880 -15.579 36.877 1.00 71.38  ? 397 TYR A N     1 
ATOM   1385 C CA    . TYR B 1 36  ? 23.019 -15.138 37.967 1.00 62.37  ? 397 TYR A CA    1 
ATOM   1386 C C     . TYR B 1 36  ? 23.022 -13.635 38.163 1.00 65.51  ? 397 TYR A C     1 
ATOM   1387 O O     . TYR B 1 36  ? 23.718 -12.902 37.471 1.00 75.60  ? 397 TYR A O     1 
ATOM   1388 C CB    . TYR B 1 36  ? 23.469 -15.788 39.264 1.00 59.76  ? 397 TYR A CB    1 
ATOM   1389 C CG    . TYR B 1 36  ? 24.909 -15.503 39.587 1.00 60.12  ? 397 TYR A CG    1 
ATOM   1390 C CD1   . TYR B 1 36  ? 25.261 -14.418 40.371 1.00 65.27  ? 397 TYR A CD1   1 
ATOM   1391 C CD2   . TYR B 1 36  ? 25.919 -16.320 39.109 1.00 60.98  ? 397 TYR A CD2   1 
ATOM   1392 C CE1   . TYR B 1 36  ? 26.580 -14.155 40.673 1.00 69.01  ? 397 TYR A CE1   1 
ATOM   1393 C CE2   . TYR B 1 36  ? 27.241 -16.064 39.399 1.00 63.56  ? 397 TYR A CE2   1 
ATOM   1394 C CZ    . TYR B 1 36  ? 27.569 -14.980 40.180 1.00 70.86  ? 397 TYR A CZ    1 
ATOM   1395 O OH    . TYR B 1 36  ? 28.893 -14.729 40.471 1.00 73.99  ? 397 TYR A OH    1 
ATOM   1396 N N     . MET B 1 37  ? 22.237 -13.188 39.132 1.00 65.80  ? 398 MET A N     1 
ATOM   1397 C CA    . MET B 1 37  ? 22.138 -11.777 39.452 1.00 67.96  ? 398 MET A CA    1 
ATOM   1398 C C     . MET B 1 37  ? 21.824 -11.623 40.931 1.00 80.23  ? 398 MET A C     1 
ATOM   1399 O O     . MET B 1 37  ? 21.767 -12.613 41.664 1.00 78.67  ? 398 MET A O     1 
ATOM   1400 C CB    . MET B 1 37  ? 21.036 -11.122 38.624 1.00 62.08  ? 398 MET A CB    1 
ATOM   1401 C CG    . MET B 1 37  ? 19.640 -11.567 39.014 1.00 72.28  ? 398 MET A CG    1 
ATOM   1402 S SD    . MET B 1 37  ? 18.366 -10.810 37.987 1.00 99.37  ? 398 MET A SD    1 
ATOM   1403 C CE    . MET B 1 37  ? 18.463 -9.107  38.544 1.00 106.83 ? 398 MET A CE    1 
ATOM   1404 N N     . LYS B 1 38  ? 21.625 -10.381 41.365 1.00 91.50  ? 399 LYS A N     1 
ATOM   1405 C CA    . LYS B 1 38  ? 21.213 -10.101 42.737 1.00 82.67  ? 399 LYS A CA    1 
ATOM   1406 C C     . LYS B 1 38  ? 19.738 -9.716  42.777 1.00 85.32  ? 399 LYS A C     1 
ATOM   1407 O O     . LYS B 1 38  ? 19.275 -8.907  41.971 1.00 85.45  ? 399 LYS A O     1 
ATOM   1408 C CB    . LYS B 1 38  ? 22.086 -9.005  43.343 1.00 78.78  ? 399 LYS A CB    1 
ATOM   1409 C CG    . LYS B 1 38  ? 23.523 -9.448  43.558 1.00 88.59  ? 399 LYS A CG    1 
ATOM   1410 C CD    . LYS B 1 38  ? 24.456 -8.275  43.831 1.00 104.80 ? 399 LYS A CD    1 
ATOM   1411 C CE    . LYS B 1 38  ? 25.888 -8.748  44.069 1.00 105.81 ? 399 LYS A CE    1 
ATOM   1412 N NZ    . LYS B 1 38  ? 26.861 -7.618  44.097 1.00 102.05 ? 399 LYS A NZ    1 
ATOM   1413 N N     . ASP B 1 39  ? 18.999 -10.323 43.699 1.00 94.47  ? 400 ASP A N     1 
ATOM   1414 C CA    . ASP B 1 39  ? 17.570 -10.065 43.813 1.00 103.71 ? 400 ASP A CA    1 
ATOM   1415 C C     . ASP B 1 39  ? 17.329 -8.775  44.588 1.00 111.99 ? 400 ASP A C     1 
ATOM   1416 O O     . ASP B 1 39  ? 18.219 -8.277  45.278 1.00 105.39 ? 400 ASP A O     1 
ATOM   1417 C CB    . ASP B 1 39  ? 16.856 -11.244 44.491 1.00 101.73 ? 400 ASP A CB    1 
ATOM   1418 C CG    . ASP B 1 39  ? 16.959 -11.205 46.015 1.00 114.02 ? 400 ASP A CG    1 
ATOM   1419 O OD1   . ASP B 1 39  ? 16.215 -10.421 46.647 1.00 118.52 ? 400 ASP A OD1   1 
ATOM   1420 O OD2   . ASP B 1 39  ? 17.764 -11.978 46.584 1.00 101.94 ? 400 ASP A OD2   1 
ATOM   1421 N N     . ASP B 1 40  ? 16.130 -8.222  44.448 1.00 115.13 ? 401 ASP A N     1 
ATOM   1422 C CA    . ASP B 1 40  ? 15.709 -7.129  45.299 1.00 110.29 ? 401 ASP A CA    1 
ATOM   1423 C C     . ASP B 1 40  ? 15.123 -7.728  46.561 1.00 114.14 ? 401 ASP A C     1 
ATOM   1424 O O     . ASP B 1 40  ? 14.017 -8.266  46.538 1.00 117.93 ? 401 ASP A O     1 
ATOM   1425 N N     . GLY B 1 41  ? 15.872 -7.670  47.659 1.00 116.91 ? 402 GLY A N     1 
ATOM   1426 C CA    . GLY B 1 41  ? 17.197 -7.077  47.667 1.00 106.60 ? 402 GLY A CA    1 
ATOM   1427 C C     . GLY B 1 41  ? 17.930 -7.382  48.957 1.00 109.00 ? 402 GLY A C     1 
ATOM   1428 O O     . GLY B 1 41  ? 17.710 -6.723  49.973 1.00 125.51 ? 402 GLY A O     1 
ATOM   1429 N N     . GLY B 1 42  ? 18.798 -8.389  48.919 1.00 98.40  ? 403 GLY A N     1 
ATOM   1430 C CA    . GLY B 1 42  ? 19.010 -9.146  47.701 1.00 106.87 ? 403 GLY A CA    1 
ATOM   1431 C C     . GLY B 1 42  ? 20.252 -10.016 47.667 1.00 106.49 ? 403 GLY A C     1 
ATOM   1432 O O     . GLY B 1 42  ? 21.381 -9.527  47.724 1.00 100.20 ? 403 GLY A O     1 
ATOM   1433 N N     . GLU B 1 43  ? 20.033 -11.322 47.564 1.00 103.95 ? 404 GLU A N     1 
ATOM   1434 C CA    . GLU B 1 43  ? 21.123 -12.273 47.405 1.00 96.59  ? 404 GLU A CA    1 
ATOM   1435 C C     . GLU B 1 43  ? 21.167 -12.801 45.971 1.00 88.79  ? 404 GLU A C     1 
ATOM   1436 O O     . GLU B 1 43  ? 20.467 -12.299 45.089 1.00 80.28  ? 404 GLU A O     1 
ATOM   1437 C CB    . GLU B 1 43  ? 20.990 -13.421 48.410 1.00 90.70  ? 404 GLU A CB    1 
ATOM   1438 C CG    . GLU B 1 43  ? 19.554 -13.846 48.682 1.00 104.68 ? 404 GLU A CG    1 
ATOM   1439 C CD    . GLU B 1 43  ? 19.462 -15.096 49.549 1.00 117.40 ? 404 GLU A CD    1 
ATOM   1440 O OE1   . GLU B 1 43  ? 18.771 -16.054 49.129 1.00 105.18 ? 404 GLU A OE1   1 
ATOM   1441 O OE2   . GLU B 1 43  ? 20.085 -15.126 50.638 1.00 106.04 ? 404 GLU A OE2   1 
ATOM   1442 N N     . LEU B 1 44  ? 21.992 -13.817 45.743 1.00 79.98  ? 405 LEU A N     1 
ATOM   1443 C CA    . LEU B 1 44  ? 22.207 -14.331 44.396 1.00 72.14  ? 405 LEU A CA    1 
ATOM   1444 C C     . LEU B 1 44  ? 21.083 -15.243 43.934 1.00 68.79  ? 405 LEU A C     1 
ATOM   1445 O O     . LEU B 1 44  ? 20.636 -16.108 44.678 1.00 74.77  ? 405 LEU A O     1 
ATOM   1446 C CB    . LEU B 1 44  ? 23.512 -15.120 44.335 1.00 66.71  ? 405 LEU A CB    1 
ATOM   1447 C CG    . LEU B 1 44  ? 24.786 -14.457 44.848 1.00 67.79  ? 405 LEU A CG    1 
ATOM   1448 C CD1   . LEU B 1 44  ? 25.967 -15.427 44.747 1.00 52.49  ? 405 LEU A CD1   1 
ATOM   1449 C CD2   . LEU B 1 44  ? 25.051 -13.170 44.083 1.00 67.60  ? 405 LEU A CD2   1 
ATOM   1450 N N     . VAL B 1 45  ? 20.633 -15.059 42.699 1.00 65.44  ? 406 VAL A N     1 
ATOM   1451 C CA    . VAL B 1 45  ? 19.736 -16.028 42.082 1.00 66.22  ? 406 VAL A CA    1 
ATOM   1452 C C     . VAL B 1 45  ? 20.177 -16.330 40.653 1.00 58.79  ? 406 VAL A C     1 
ATOM   1453 O O     . VAL B 1 45  ? 20.567 -15.431 39.916 1.00 56.87  ? 406 VAL A O     1 
ATOM   1454 C CB    . VAL B 1 45  ? 18.263 -15.563 42.095 1.00 61.48  ? 406 VAL A CB    1 
ATOM   1455 C CG1   . VAL B 1 45  ? 17.817 -15.254 43.509 1.00 67.11  ? 406 VAL A CG1   1 
ATOM   1456 C CG2   . VAL B 1 45  ? 18.075 -14.361 41.200 1.00 61.64  ? 406 VAL A CG2   1 
ATOM   1457 N N     . ALA B 1 46  ? 20.115 -17.603 40.275 1.00 54.93  ? 407 ALA A N     1 
ATOM   1458 C CA    . ALA B 1 46  ? 20.481 -18.031 38.928 1.00 52.08  ? 407 ALA A CA    1 
ATOM   1459 C C     . ALA B 1 46  ? 19.466 -17.530 37.913 1.00 51.51  ? 407 ALA A C     1 
ATOM   1460 O O     . ALA B 1 46  ? 18.289 -17.375 38.228 1.00 58.07  ? 407 ALA A O     1 
ATOM   1461 C CB    . ALA B 1 46  ? 20.581 -19.540 38.867 1.00 54.66  ? 407 ALA A CB    1 
ATOM   1462 N N     . THR B 1 47  ? 19.921 -17.275 36.694 1.00 49.09  ? 408 THR A N     1 
ATOM   1463 C CA    . THR B 1 47  ? 19.033 -16.778 35.647 1.00 53.08  ? 408 THR A CA    1 
ATOM   1464 C C     . THR B 1 47  ? 19.114 -17.671 34.415 1.00 57.15  ? 408 THR A C     1 
ATOM   1465 O O     . THR B 1 47  ? 18.205 -17.686 33.578 1.00 49.75  ? 408 THR A O     1 
ATOM   1466 C CB    . THR B 1 47  ? 19.372 -15.318 35.259 1.00 60.44  ? 408 THR A CB    1 
ATOM   1467 O OG1   . THR B 1 47  ? 20.781 -15.191 35.019 1.00 64.55  ? 408 THR A OG1   1 
ATOM   1468 C CG2   . THR B 1 47  ? 18.992 -14.374 36.377 1.00 59.09  ? 408 THR A CG2   1 
ATOM   1469 N N     . SER B 1 48  ? 20.206 -18.424 34.320 1.00 42.47  ? 409 SER A N     1 
ATOM   1470 C CA    . SER B 1 48  ? 20.441 -19.270 33.171 1.00 47.65  ? 409 SER A CA    1 
ATOM   1471 C C     . SER B 1 48  ? 21.562 -20.257 33.432 1.00 48.04  ? 409 SER A C     1 
ATOM   1472 O O     . SER B 1 48  ? 22.498 -19.975 34.180 1.00 48.18  ? 409 SER A O     1 
ATOM   1473 C CB    . SER B 1 48  ? 20.752 -18.422 31.924 1.00 60.07  ? 409 SER A CB    1 
ATOM   1474 O OG    . SER B 1 48  ? 21.470 -17.231 32.242 1.00 70.70  ? 409 SER A OG    1 
ATOM   1475 N N     . ILE B 1 49  ? 21.451 -21.428 32.820 1.00 49.31  ? 410 ILE A N     1 
ATOM   1476 C CA    . ILE B 1 49  ? 22.556 -22.368 32.797 1.00 48.60  ? 410 ILE A CA    1 
ATOM   1477 C C     . ILE B 1 49  ? 22.776 -22.877 31.380 1.00 50.06  ? 410 ILE A C     1 
ATOM   1478 O O     . ILE B 1 49  ? 21.888 -22.817 30.534 1.00 48.10  ? 410 ILE A O     1 
ATOM   1479 C CB    . ILE B 1 49  ? 22.337 -23.559 33.747 1.00 51.13  ? 410 ILE A CB    1 
ATOM   1480 C CG1   . ILE B 1 49  ? 21.149 -24.404 33.293 1.00 46.54  ? 410 ILE A CG1   1 
ATOM   1481 C CG2   . ILE B 1 49  ? 22.131 -23.079 35.173 1.00 42.91  ? 410 ILE A CG2   1 
ATOM   1482 C CD1   . ILE B 1 49  ? 20.666 -25.341 34.367 1.00 46.75  ? 410 ILE A CD1   1 
ATOM   1483 N N     . VAL B 1 50  ? 23.988 -23.345 31.131 1.00 47.82  ? 411 VAL A N     1 
ATOM   1484 C CA    . VAL B 1 50  ? 24.324 -23.978 29.883 1.00 47.27  ? 411 VAL A CA    1 
ATOM   1485 C C     . VAL B 1 50  ? 24.775 -25.390 30.195 1.00 50.67  ? 411 VAL A C     1 
ATOM   1486 O O     . VAL B 1 50  ? 25.682 -25.603 31.003 1.00 51.35  ? 411 VAL A O     1 
ATOM   1487 C CB    . VAL B 1 50  ? 25.463 -23.233 29.161 1.00 52.83  ? 411 VAL A CB    1 
ATOM   1488 C CG1   . VAL B 1 50  ? 25.862 -23.972 27.883 1.00 46.33  ? 411 VAL A CG1   1 
ATOM   1489 C CG2   . VAL B 1 50  ? 25.044 -21.811 28.843 1.00 50.23  ? 411 VAL A CG2   1 
ATOM   1490 N N     . SER B 1 51  ? 24.127 -26.359 29.564 1.00 54.13  ? 412 SER A N     1 
ATOM   1491 C CA    . SER B 1 51  ? 24.553 -27.739 29.680 1.00 55.27  ? 412 SER A CA    1 
ATOM   1492 C C     . SER B 1 51  ? 25.133 -28.186 28.355 1.00 58.60  ? 412 SER A C     1 
ATOM   1493 O O     . SER B 1 51  ? 24.396 -28.468 27.416 1.00 63.24  ? 412 SER A O     1 
ATOM   1494 C CB    . SER B 1 51  ? 23.387 -28.641 30.067 1.00 51.27  ? 412 SER A CB    1 
ATOM   1495 O OG    . SER B 1 51  ? 23.871 -29.899 30.492 1.00 69.30  ? 412 SER A OG    1 
ATOM   1496 N N     . SER B 1 52  ? 26.458 -28.204 28.273 1.00 68.29  ? 413 SER A N     1 
ATOM   1497 C CA    . SER B 1 52  ? 27.149 -28.824 27.150 1.00 73.28  ? 413 SER A CA    1 
ATOM   1498 C C     . SER B 1 52  ? 27.538 -30.213 27.633 1.00 79.49  ? 413 SER A C     1 
ATOM   1499 O O     . SER B 1 52  ? 26.687 -31.007 28.068 1.00 83.12  ? 413 SER A O     1 
ATOM   1500 C CB    . SER B 1 52  ? 28.419 -28.046 26.774 1.00 66.36  ? 413 SER A CB    1 
ATOM   1501 O OG    . SER B 1 52  ? 28.331 -26.674 27.135 1.00 67.63  ? 413 SER A OG    1 
ATOM   1502 N N     . GLY B 1 53  ? 28.835 -30.487 27.566 1.00 65.32  ? 414 GLY A N     1 
ATOM   1503 C CA    . GLY B 1 53  ? 29.420 -31.621 28.259 1.00 73.41  ? 414 GLY A CA    1 
ATOM   1504 C C     . GLY B 1 53  ? 30.545 -31.156 29.169 1.00 80.00  ? 414 GLY A C     1 
ATOM   1505 O O     . GLY B 1 53  ? 30.764 -29.955 29.338 1.00 79.58  ? 414 GLY A O     1 
ATOM   1506 N N     . GLY B 1 54  ? 31.275 -32.105 29.746 1.00 81.29  ? 415 GLY A N     1 
ATOM   1507 C CA    . GLY B 1 54  ? 32.414 -31.774 30.587 1.00 100.96 ? 415 GLY A CA    1 
ATOM   1508 C C     . GLY B 1 54  ? 32.140 -32.012 32.062 1.00 104.51 ? 415 GLY A C     1 
ATOM   1509 O O     . GLY B 1 54  ? 32.651 -32.963 32.658 1.00 103.88 ? 415 GLY A O     1 
ATOM   1510 N N     . TYR B 1 55  ? 31.349 -31.132 32.663 1.00 86.91  ? 416 TYR A N     1 
ATOM   1511 C CA    . TYR B 1 55  ? 30.819 -31.403 33.985 1.00 77.55  ? 416 TYR A CA    1 
ATOM   1512 C C     . TYR B 1 55  ? 29.821 -32.530 33.817 1.00 90.18  ? 416 TYR A C     1 
ATOM   1513 O O     . TYR B 1 55  ? 28.749 -32.328 33.246 1.00 93.82  ? 416 TYR A O     1 
ATOM   1514 C CB    . TYR B 1 55  ? 30.135 -30.161 34.549 1.00 77.37  ? 416 TYR A CB    1 
ATOM   1515 C CG    . TYR B 1 55  ? 31.108 -29.158 35.127 1.00 82.84  ? 416 TYR A CG    1 
ATOM   1516 C CD1   . TYR B 1 55  ? 31.009 -28.753 36.450 1.00 69.94  ? 416 TYR A CD1   1 
ATOM   1517 C CD2   . TYR B 1 55  ? 32.144 -28.636 34.354 1.00 83.11  ? 416 TYR A CD2   1 
ATOM   1518 C CE1   . TYR B 1 55  ? 31.900 -27.848 36.991 1.00 78.15  ? 416 TYR A CE1   1 
ATOM   1519 C CE2   . TYR B 1 55  ? 33.046 -27.725 34.888 1.00 86.86  ? 416 TYR A CE2   1 
ATOM   1520 C CZ    . TYR B 1 55  ? 32.918 -27.332 36.213 1.00 86.64  ? 416 TYR A CZ    1 
ATOM   1521 O OH    . TYR B 1 55  ? 33.805 -26.427 36.769 1.00 70.84  ? 416 TYR A OH    1 
ATOM   1522 N N     . ASN B 1 56  ? 30.188 -33.721 34.285 1.00 91.34  ? 417 ASN A N     1 
ATOM   1523 C CA    . ASN B 1 56  ? 29.344 -34.906 34.128 1.00 93.29  ? 417 ASN A CA    1 
ATOM   1524 C C     . ASN B 1 56  ? 27.924 -34.695 34.654 1.00 93.42  ? 417 ASN A C     1 
ATOM   1525 O O     . ASN B 1 56  ? 27.632 -34.982 35.817 1.00 94.62  ? 417 ASN A O     1 
ATOM   1526 C CB    . ASN B 1 56  ? 29.985 -36.124 34.807 1.00 88.01  ? 417 ASN A CB    1 
ATOM   1527 N N     . ASP B 1 57  ? 27.041 -34.193 33.794 1.00 87.26  ? 418 ASP A N     1 
ATOM   1528 C CA    . ASP B 1 57  ? 25.657 -33.952 34.190 1.00 79.85  ? 418 ASP A CA    1 
ATOM   1529 C C     . ASP B 1 57  ? 24.645 -34.801 33.392 1.00 90.24  ? 418 ASP A C     1 
ATOM   1530 O O     . ASP B 1 57  ? 24.952 -35.297 32.302 1.00 84.69  ? 418 ASP A O     1 
ATOM   1531 C CB    . ASP B 1 57  ? 25.324 -32.450 34.172 1.00 67.02  ? 418 ASP A CB    1 
ATOM   1532 C CG    . ASP B 1 57  ? 25.615 -31.790 32.837 1.00 83.28  ? 418 ASP A CG    1 
ATOM   1533 O OD1   . ASP B 1 57  ? 25.025 -30.715 32.578 1.00 73.84  ? 418 ASP A OD1   1 
ATOM   1534 O OD2   . ASP B 1 57  ? 26.430 -32.328 32.050 1.00 91.33  ? 418 ASP A OD2   1 
ATOM   1535 N N     . VAL B 1 58  ? 23.449 -34.970 33.958 1.00 84.76  ? 419 VAL A N     1 
ATOM   1536 C CA    . VAL B 1 58  ? 22.462 -35.926 33.448 1.00 77.44  ? 419 VAL A CA    1 
ATOM   1537 C C     . VAL B 1 58  ? 21.319 -35.294 32.654 1.00 82.22  ? 419 VAL A C     1 
ATOM   1538 O O     . VAL B 1 58  ? 20.388 -34.711 33.218 1.00 62.64  ? 419 VAL A O     1 
ATOM   1539 C CB    . VAL B 1 58  ? 21.854 -36.767 34.580 1.00 76.25  ? 419 VAL A CB    1 
ATOM   1540 C CG1   . VAL B 1 58  ? 20.835 -37.743 34.019 1.00 84.05  ? 419 VAL A CG1   1 
ATOM   1541 C CG2   . VAL B 1 58  ? 22.943 -37.494 35.336 1.00 73.21  ? 419 VAL A CG2   1 
ATOM   1542 N N     . LEU B 1 59  ? 21.390 -35.463 31.338 1.00 95.94  ? 420 LEU A N     1 
ATOM   1543 C CA    . LEU B 1 59  ? 20.472 -34.833 30.408 1.00 87.72  ? 420 LEU A CA    1 
ATOM   1544 C C     . LEU B 1 59  ? 19.809 -35.866 29.496 1.00 103.10 ? 420 LEU A C     1 
ATOM   1545 O O     . LEU B 1 59  ? 20.094 -35.921 28.297 1.00 109.78 ? 420 LEU A O     1 
ATOM   1546 C CB    . LEU B 1 59  ? 21.236 -33.796 29.577 1.00 105.58 ? 420 LEU A CB    1 
ATOM   1547 C CG    . LEU B 1 59  ? 22.743 -34.058 29.392 1.00 113.33 ? 420 LEU A CG    1 
ATOM   1548 C CD1   . LEU B 1 59  ? 23.025 -35.326 28.564 1.00 98.63  ? 420 LEU A CD1   1 
ATOM   1549 C CD2   . LEU B 1 59  ? 23.457 -32.836 28.790 1.00 107.53 ? 420 LEU A CD2   1 
ATOM   1550 N N     . ASP B 1 60  ? 18.926 -36.685 30.062 1.00 99.85  ? 421 ASP A N     1 
ATOM   1551 C CA    . ASP B 1 60  ? 18.219 -37.700 29.275 1.00 107.93 ? 421 ASP A CA    1 
ATOM   1552 C C     . ASP B 1 60  ? 17.096 -37.108 28.409 1.00 106.55 ? 421 ASP A C     1 
ATOM   1553 O O     . ASP B 1 60  ? 17.223 -35.998 27.890 1.00 104.90 ? 421 ASP A O     1 
ATOM   1554 C CB    . ASP B 1 60  ? 17.699 -38.833 30.170 1.00 101.91 ? 421 ASP A CB    1 
ATOM   1555 C CG    . ASP B 1 60  ? 16.971 -38.322 31.400 1.00 100.45 ? 421 ASP A CG    1 
ATOM   1556 O OD1   . ASP B 1 60  ? 16.723 -39.128 32.324 1.00 88.83  ? 421 ASP A OD1   1 
ATOM   1557 O OD2   . ASP B 1 60  ? 16.647 -37.116 31.445 1.00 101.68 ? 421 ASP A OD2   1 
ATOM   1558 N N     . ASN B 1 61  ? 16.004 -37.849 28.245 1.00 101.26 ? 422 ASN A N     1 
ATOM   1559 C CA    . ASN B 1 61  ? 14.931 -37.426 27.345 1.00 104.35 ? 422 ASN A CA    1 
ATOM   1560 C C     . ASN B 1 61  ? 13.710 -36.922 28.088 1.00 99.67  ? 422 ASN A C     1 
ATOM   1561 O O     . ASN B 1 61  ? 12.592 -36.957 27.567 1.00 98.85  ? 422 ASN A O     1 
ATOM   1562 C CB    . ASN B 1 61  ? 14.520 -38.578 26.428 1.00 105.95 ? 422 ASN A CB    1 
ATOM   1563 C CG    . ASN B 1 61  ? 15.675 -39.106 25.612 1.00 106.98 ? 422 ASN A CG    1 
ATOM   1564 O OD1   . ASN B 1 61  ? 16.106 -40.248 25.786 1.00 97.78  ? 422 ASN A OD1   1 
ATOM   1565 N ND2   . ASN B 1 61  ? 16.201 -38.267 24.725 1.00 96.39  ? 422 ASN A ND2   1 
ATOM   1566 N N     . SER B 1 62  ? 13.923 -36.446 29.306 1.00 76.81  ? 423 SER A N     1 
ATOM   1567 C CA    . SER B 1 62  ? 12.802 -36.112 30.160 1.00 73.10  ? 423 SER A CA    1 
ATOM   1568 C C     . SER B 1 62  ? 12.646 -34.627 30.425 1.00 71.67  ? 423 SER A C     1 
ATOM   1569 O O     . SER B 1 62  ? 13.313 -33.779 29.820 1.00 58.45  ? 423 SER A O     1 
ATOM   1570 C CB    . SER B 1 62  ? 12.928 -36.842 31.491 1.00 77.16  ? 423 SER A CB    1 
ATOM   1571 O OG    . SER B 1 62  ? 14.194 -36.597 32.070 1.00 74.42  ? 423 SER A OG    1 
ATOM   1572 N N     . ASP B 1 63  ? 11.734 -34.335 31.343 1.00 56.68  ? 424 ASP A N     1 
ATOM   1573 C CA    . ASP B 1 63  ? 11.527 -32.983 31.821 1.00 55.10  ? 424 ASP A CA    1 
ATOM   1574 C C     . ASP B 1 63  ? 12.489 -32.695 32.973 1.00 59.72  ? 424 ASP A C     1 
ATOM   1575 O O     . ASP B 1 63  ? 12.509 -31.585 33.521 1.00 56.16  ? 424 ASP A O     1 
ATOM   1576 C CB    . ASP B 1 63  ? 10.079 -32.796 32.274 1.00 50.13  ? 424 ASP A CB    1 
ATOM   1577 C CG    . ASP B 1 63  ? 9.643  -33.842 33.292 1.00 65.82  ? 424 ASP A CG    1 
ATOM   1578 O OD1   . ASP B 1 63  ? 10.178 -34.975 33.237 1.00 66.96  ? 424 ASP A OD1   1 
ATOM   1579 O OD2   . ASP B 1 63  ? 8.764  -33.535 34.140 1.00 63.76  ? 424 ASP A OD2   1 
ATOM   1580 N N     . VAL B 1 64  ? 13.287 -33.699 33.336 1.00 57.41  ? 425 VAL A N     1 
ATOM   1581 C CA    . VAL B 1 64  ? 14.250 -33.544 34.420 1.00 48.54  ? 425 VAL A CA    1 
ATOM   1582 C C     . VAL B 1 64  ? 15.696 -33.534 33.950 1.00 49.38  ? 425 VAL A C     1 
ATOM   1583 O O     . VAL B 1 64  ? 16.099 -34.324 33.105 1.00 59.60  ? 425 VAL A O     1 
ATOM   1584 C CB    . VAL B 1 64  ? 14.081 -34.613 35.495 1.00 49.35  ? 425 VAL A CB    1 
ATOM   1585 C CG1   . VAL B 1 64  ? 15.224 -34.527 36.495 1.00 50.67  ? 425 VAL A CG1   1 
ATOM   1586 C CG2   . VAL B 1 64  ? 12.751 -34.434 36.191 1.00 52.02  ? 425 VAL A CG2   1 
ATOM   1587 N N     . LEU B 1 65  ? 16.468 -32.622 34.523 1.00 52.73  ? 426 LEU A N     1 
ATOM   1588 C CA    . LEU B 1 65  ? 17.864 -32.447 34.184 1.00 44.42  ? 426 LEU A CA    1 
ATOM   1589 C C     . LEU B 1 65  ? 18.658 -32.366 35.481 1.00 46.98  ? 426 LEU A C     1 
ATOM   1590 O O     . LEU B 1 65  ? 18.307 -31.591 36.368 1.00 48.54  ? 426 LEU A O     1 
ATOM   1591 C CB    . LEU B 1 65  ? 18.000 -31.156 33.390 1.00 47.67  ? 426 LEU A CB    1 
ATOM   1592 C CG    . LEU B 1 65  ? 19.298 -30.357 33.372 1.00 57.90  ? 426 LEU A CG    1 
ATOM   1593 C CD1   . LEU B 1 65  ? 20.444 -31.182 32.830 1.00 61.05  ? 426 LEU A CD1   1 
ATOM   1594 C CD2   . LEU B 1 65  ? 19.089 -29.120 32.517 1.00 57.89  ? 426 LEU A CD2   1 
ATOM   1595 N N     . ILE B 1 66  ? 19.694 -33.191 35.618 1.00 46.79  ? 427 ILE A N     1 
ATOM   1596 C CA    . ILE B 1 66  ? 20.602 -33.074 36.756 1.00 49.13  ? 427 ILE A CA    1 
ATOM   1597 C C     . ILE B 1 66  ? 21.827 -32.289 36.326 1.00 50.23  ? 427 ILE A C     1 
ATOM   1598 O O     . ILE B 1 66  ? 22.553 -32.711 35.436 1.00 48.71  ? 427 ILE A O     1 
ATOM   1599 C CB    . ILE B 1 66  ? 21.110 -34.420 37.271 1.00 51.33  ? 427 ILE A CB    1 
ATOM   1600 C CG1   . ILE B 1 66  ? 19.968 -35.403 37.484 1.00 46.51  ? 427 ILE A CG1   1 
ATOM   1601 C CG2   . ILE B 1 66  ? 21.847 -34.210 38.567 1.00 47.06  ? 427 ILE A CG2   1 
ATOM   1602 C CD1   . ILE B 1 66  ? 18.983 -34.957 38.529 1.00 55.06  ? 427 ILE A CD1   1 
ATOM   1603 N N     . TYR B 1 67  ? 22.061 -31.157 36.973 1.00 47.42  ? 428 TYR A N     1 
ATOM   1604 C CA    . TYR B 1 67  ? 23.136 -30.264 36.586 1.00 43.51  ? 428 TYR A CA    1 
ATOM   1605 C C     . TYR B 1 67  ? 24.225 -30.254 37.653 1.00 47.74  ? 428 TYR A C     1 
ATOM   1606 O O     . TYR B 1 67  ? 23.936 -30.127 38.838 1.00 47.40  ? 428 TYR A O     1 
ATOM   1607 C CB    . TYR B 1 67  ? 22.559 -28.870 36.403 1.00 38.20  ? 428 TYR A CB    1 
ATOM   1608 C CG    . TYR B 1 67  ? 23.462 -27.888 35.704 1.00 45.76  ? 428 TYR A CG    1 
ATOM   1609 C CD1   . TYR B 1 67  ? 23.657 -27.945 34.328 1.00 43.02  ? 428 TYR A CD1   1 
ATOM   1610 C CD2   . TYR B 1 67  ? 24.094 -26.875 36.414 1.00 47.93  ? 428 TYR A CD2   1 
ATOM   1611 C CE1   . TYR B 1 67  ? 24.469 -27.031 33.689 1.00 45.57  ? 428 TYR A CE1   1 
ATOM   1612 C CE2   . TYR B 1 67  ? 24.908 -25.964 35.784 1.00 44.91  ? 428 TYR A CE2   1 
ATOM   1613 C CZ    . TYR B 1 67  ? 25.091 -26.040 34.431 1.00 47.84  ? 428 TYR A CZ    1 
ATOM   1614 O OH    . TYR B 1 67  ? 25.904 -25.115 33.829 1.00 55.30  ? 428 TYR A OH    1 
ATOM   1615 N N     . THR B 1 68  ? 25.476 -30.393 37.231 1.00 45.50  ? 429 THR A N     1 
ATOM   1616 C CA    . THR B 1 68  ? 26.598 -30.363 38.159 1.00 48.36  ? 429 THR A CA    1 
ATOM   1617 C C     . THR B 1 68  ? 27.025 -28.925 38.475 1.00 52.92  ? 429 THR A C     1 
ATOM   1618 O O     . THR B 1 68  ? 27.076 -28.082 37.588 1.00 52.47  ? 429 THR A O     1 
ATOM   1619 C CB    . THR B 1 68  ? 27.802 -31.129 37.592 1.00 47.96  ? 429 THR A CB    1 
ATOM   1620 O OG1   . THR B 1 68  ? 27.369 -32.390 37.077 1.00 54.30  ? 429 THR A OG1   1 
ATOM   1621 C CG2   . THR B 1 68  ? 28.822 -31.374 38.664 1.00 46.23  ? 429 THR A CG2   1 
ATOM   1622 N N     . GLY B 1 69  ? 27.326 -28.648 39.739 1.00 50.30  ? 430 GLY A N     1 
ATOM   1623 C CA    . GLY B 1 69  ? 27.849 -27.351 40.128 1.00 48.53  ? 430 GLY A CA    1 
ATOM   1624 C C     . GLY B 1 69  ? 29.276 -27.140 39.656 1.00 50.62  ? 430 GLY A C     1 
ATOM   1625 O O     . GLY B 1 69  ? 29.921 -28.075 39.193 1.00 47.77  ? 430 GLY A O     1 
ATOM   1626 N N     . GLN B 1 70  ? 29.778 -25.911 39.770 1.00 55.94  ? 431 GLN A N     1 
ATOM   1627 C CA    . GLN B 1 70  ? 31.137 -25.615 39.301 1.00 55.54  ? 431 GLN A CA    1 
ATOM   1628 C C     . GLN B 1 70  ? 32.195 -25.657 40.399 1.00 55.23  ? 431 GLN A C     1 
ATOM   1629 O O     . GLN B 1 70  ? 31.894 -25.458 41.581 1.00 62.24  ? 431 GLN A O     1 
ATOM   1630 C CB    . GLN B 1 70  ? 31.187 -24.278 38.561 1.00 54.82  ? 431 GLN A CB    1 
ATOM   1631 C CG    . GLN B 1 70  ? 30.702 -23.103 39.368 1.00 63.65  ? 431 GLN A CG    1 
ATOM   1632 C CD    . GLN B 1 70  ? 30.161 -21.973 38.500 1.00 59.89  ? 431 GLN A CD    1 
ATOM   1633 O OE1   . GLN B 1 70  ? 30.116 -22.075 37.267 1.00 54.28  ? 431 GLN A OE1   1 
ATOM   1634 N NE2   . GLN B 1 70  ? 29.743 -20.889 39.145 1.00 58.29  ? 431 GLN A NE2   1 
ATOM   1635 N N     . GLY B 1 71  ? 33.430 -25.940 40.005 1.00 46.24  ? 432 GLY A N     1 
ATOM   1636 C CA    . GLY B 1 71  ? 34.549 -25.876 40.924 1.00 51.96  ? 432 GLY A CA    1 
ATOM   1637 C C     . GLY B 1 71  ? 35.346 -27.153 41.064 1.00 60.85  ? 432 GLY A C     1 
ATOM   1638 O O     . GLY B 1 71  ? 34.983 -28.179 40.494 1.00 77.86  ? 432 GLY A O     1 
ATOM   1639 N N     . GLY B 1 72  ? 36.444 -27.069 41.815 1.00 59.90  ? 433 GLY A N     1 
ATOM   1640 C CA    . GLY B 1 72  ? 37.301 -28.197 42.148 1.00 67.59  ? 433 GLY A CA    1 
ATOM   1641 C C     . GLY B 1 72  ? 37.714 -29.193 41.072 1.00 84.77  ? 433 GLY A C     1 
ATOM   1642 O O     . GLY B 1 72  ? 38.495 -30.102 41.358 1.00 95.06  ? 433 GLY A O     1 
ATOM   1643 N N     . ASN B 1 73  ? 37.212 -29.018 39.850 1.00 86.81  ? 434 ASN A N     1 
ATOM   1644 C CA    . ASN B 1 73  ? 37.279 -30.031 38.787 1.00 92.90  ? 434 ASN A CA    1 
ATOM   1645 C C     . ASN B 1 73  ? 36.090 -30.991 38.831 1.00 99.67  ? 434 ASN A C     1 
ATOM   1646 O O     . ASN B 1 73  ? 35.310 -31.077 37.879 1.00 109.62 ? 434 ASN A O     1 
ATOM   1647 C CB    . ASN B 1 73  ? 38.590 -30.823 38.819 1.00 87.74  ? 434 ASN A CB    1 
ATOM   1648 C CG    . ASN B 1 73  ? 39.809 -29.946 38.590 1.00 112.41 ? 434 ASN A CG    1 
ATOM   1649 O OD1   . ASN B 1 73  ? 40.126 -29.077 39.409 1.00 105.67 ? 434 ASN A OD1   1 
ATOM   1650 N ND2   . ASN B 1 73  ? 40.507 -30.175 37.473 1.00 109.62 ? 434 ASN A ND2   1 
ATOM   1651 N N     . GLU B 1 81  ? 44.641 -30.370 37.292 1.00 100.30 ? 442 GLU A N     1 
ATOM   1652 C CA    . GLU B 1 81  ? 44.949 -29.706 38.560 1.00 120.83 ? 442 GLU A CA    1 
ATOM   1653 C C     . GLU B 1 81  ? 44.304 -30.428 39.752 1.00 120.04 ? 442 GLU A C     1 
ATOM   1654 O O     . GLU B 1 81  ? 43.259 -31.065 39.600 1.00 114.75 ? 442 GLU A O     1 
ATOM   1655 C CB    . GLU B 1 81  ? 44.514 -28.235 38.518 1.00 101.87 ? 442 GLU A CB    1 
ATOM   1656 N N     . PRO B 1 82  ? 44.934 -30.325 40.940 1.00 116.51 ? 443 PRO A N     1 
ATOM   1657 C CA    . PRO B 1 82  ? 44.559 -31.005 42.194 1.00 113.84 ? 443 PRO A CA    1 
ATOM   1658 C C     . PRO B 1 82  ? 43.127 -30.724 42.665 1.00 103.15 ? 443 PRO A C     1 
ATOM   1659 O O     . PRO B 1 82  ? 42.769 -29.571 42.904 1.00 96.27  ? 443 PRO A O     1 
ATOM   1660 C CB    . PRO B 1 82  ? 45.571 -30.453 43.205 1.00 108.51 ? 443 PRO A CB    1 
ATOM   1661 C CG    . PRO B 1 82  ? 46.746 -30.055 42.375 1.00 109.67 ? 443 PRO A CG    1 
ATOM   1662 C CD    . PRO B 1 82  ? 46.172 -29.540 41.092 1.00 111.74 ? 443 PRO A CD    1 
ATOM   1663 N N     . PRO B 1 83  ? 42.320 -31.786 42.810 1.00 93.15  ? 444 PRO A N     1 
ATOM   1664 C CA    . PRO B 1 83  ? 40.891 -31.740 43.151 1.00 93.09  ? 444 PRO A CA    1 
ATOM   1665 C C     . PRO B 1 83  ? 40.603 -31.203 44.554 1.00 83.77  ? 444 PRO A C     1 
ATOM   1666 O O     . PRO B 1 83  ? 41.375 -31.445 45.481 1.00 77.60  ? 444 PRO A O     1 
ATOM   1667 C CB    . PRO B 1 83  ? 40.462 -33.213 43.066 1.00 91.81  ? 444 PRO A CB    1 
ATOM   1668 C CG    . PRO B 1 83  ? 41.534 -33.895 42.280 1.00 86.37  ? 444 PRO A CG    1 
ATOM   1669 C CD    . PRO B 1 83  ? 42.790 -33.163 42.591 1.00 82.13  ? 444 PRO A CD    1 
ATOM   1670 N N     . LYS B 1 84  ? 39.480 -30.503 44.700 1.00 78.97  ? 445 LYS A N     1 
ATOM   1671 C CA    . LYS B 1 84  ? 39.066 -29.943 45.985 1.00 82.05  ? 445 LYS A CA    1 
ATOM   1672 C C     . LYS B 1 84  ? 37.547 -29.776 46.061 1.00 70.53  ? 445 LYS A C     1 
ATOM   1673 O O     . LYS B 1 84  ? 36.869 -29.787 45.041 1.00 77.33  ? 445 LYS A O     1 
ATOM   1674 C CB    . LYS B 1 84  ? 39.757 -28.599 46.226 1.00 75.91  ? 445 LYS A CB    1 
ATOM   1675 C CG    . LYS B 1 84  ? 39.941 -27.785 44.969 1.00 75.48  ? 445 LYS A CG    1 
ATOM   1676 C CD    . LYS B 1 84  ? 40.455 -26.389 45.262 1.00 88.09  ? 445 LYS A CD    1 
ATOM   1677 C CE    . LYS B 1 84  ? 39.329 -25.444 45.675 1.00 96.71  ? 445 LYS A CE    1 
ATOM   1678 N NZ    . LYS B 1 84  ? 39.696 -24.004 45.472 1.00 82.05  ? 445 LYS A NZ    1 
ATOM   1679 N N     . ASP B 1 85  ? 37.019 -29.621 47.272 1.00 62.59  ? 446 ASP A N     1 
ATOM   1680 C CA    . ASP B 1 85  ? 35.577 -29.479 47.465 1.00 66.18  ? 446 ASP A CA    1 
ATOM   1681 C C     . ASP B 1 85  ? 35.051 -28.274 46.712 1.00 66.29  ? 446 ASP A C     1 
ATOM   1682 O O     . ASP B 1 85  ? 35.699 -27.231 46.653 1.00 73.12  ? 446 ASP A O     1 
ATOM   1683 C CB    . ASP B 1 85  ? 35.205 -29.347 48.951 1.00 61.28  ? 446 ASP A CB    1 
ATOM   1684 C CG    . ASP B 1 85  ? 35.538 -30.599 49.766 1.00 77.06  ? 446 ASP A CG    1 
ATOM   1685 O OD1   . ASP B 1 85  ? 35.824 -31.656 49.162 1.00 79.76  ? 446 ASP A OD1   1 
ATOM   1686 O OD2   . ASP B 1 85  ? 35.512 -30.522 51.017 1.00 72.69  ? 446 ASP A OD2   1 
ATOM   1687 N N     . GLN B 1 86  ? 33.874 -28.430 46.124 1.00 64.73  ? 447 GLN A N     1 
ATOM   1688 C CA    . GLN B 1 86  ? 33.189 -27.317 45.500 1.00 58.61  ? 447 GLN A CA    1 
ATOM   1689 C C     . GLN B 1 86  ? 32.653 -26.434 46.605 1.00 52.97  ? 447 GLN A C     1 
ATOM   1690 O O     . GLN B 1 86  ? 32.461 -26.889 47.718 1.00 60.26  ? 447 GLN A O     1 
ATOM   1691 C CB    . GLN B 1 86  ? 32.042 -27.813 44.618 1.00 51.05  ? 447 GLN A CB    1 
ATOM   1692 C CG    . GLN B 1 86  ? 32.493 -28.543 43.371 1.00 53.40  ? 447 GLN A CG    1 
ATOM   1693 C CD    . GLN B 1 86  ? 31.361 -28.741 42.388 1.00 55.33  ? 447 GLN A CD    1 
ATOM   1694 O OE1   . GLN B 1 86  ? 30.192 -28.597 42.738 1.00 58.46  ? 447 GLN A OE1   1 
ATOM   1695 N NE2   . GLN B 1 86  ? 31.700 -29.070 41.151 1.00 44.22  ? 447 GLN A NE2   1 
ATOM   1696 N N     . GLN B 1 87  ? 32.402 -25.173 46.291 1.00 58.53  ? 448 GLN A N     1 
ATOM   1697 C CA    . GLN B 1 87  ? 31.977 -24.229 47.300 1.00 60.19  ? 448 GLN A CA    1 
ATOM   1698 C C     . GLN B 1 87  ? 30.623 -23.638 46.982 1.00 59.30  ? 448 GLN A C     1 
ATOM   1699 O O     . GLN B 1 87  ? 30.310 -23.339 45.831 1.00 50.62  ? 448 GLN A O     1 
ATOM   1700 C CB    . GLN B 1 87  ? 33.011 -23.112 47.461 1.00 65.48  ? 448 GLN A CB    1 
ATOM   1701 C CG    . GLN B 1 87  ? 34.412 -23.603 47.791 1.00 70.70  ? 448 GLN A CG    1 
ATOM   1702 C CD    . GLN B 1 87  ? 34.519 -24.236 49.179 1.00 89.65  ? 448 GLN A CD    1 
ATOM   1703 O OE1   . GLN B 1 87  ? 35.533 -24.858 49.510 1.00 80.98  ? 448 GLN A OE1   1 
ATOM   1704 N NE2   . GLN B 1 87  ? 33.474 -24.079 49.995 1.00 88.49  ? 448 GLN A NE2   1 
ATOM   1705 N N     . LEU B 1 88  ? 29.824 -23.459 48.025 1.00 63.81  ? 449 LEU A N     1 
ATOM   1706 C CA    . LEU B 1 88  ? 28.517 -22.860 47.869 1.00 56.18  ? 449 LEU A CA    1 
ATOM   1707 C C     . LEU B 1 88  ? 28.690 -21.365 47.645 1.00 64.62  ? 449 LEU A C     1 
ATOM   1708 O O     . LEU B 1 88  ? 28.363 -20.556 48.513 1.00 63.97  ? 449 LEU A O     1 
ATOM   1709 C CB    . LEU B 1 88  ? 27.673 -23.132 49.105 1.00 63.06  ? 449 LEU A CB    1 
ATOM   1710 C CG    . LEU B 1 88  ? 26.186 -23.351 48.836 1.00 74.10  ? 449 LEU A CG    1 
ATOM   1711 C CD1   . LEU B 1 88  ? 25.996 -24.102 47.535 1.00 63.55  ? 449 LEU A CD1   1 
ATOM   1712 C CD2   . LEU B 1 88  ? 25.534 -24.100 50.000 1.00 67.70  ? 449 LEU A CD2   1 
ATOM   1713 N N     . VAL B 1 89  ? 29.225 -21.002 46.479 1.00 60.74  ? 450 VAL A N     1 
ATOM   1714 C CA    . VAL B 1 89  ? 29.449 -19.594 46.157 1.00 62.32  ? 450 VAL A CA    1 
ATOM   1715 C C     . VAL B 1 89  ? 29.085 -19.292 44.714 1.00 60.63  ? 450 VAL A C     1 
ATOM   1716 O O     . VAL B 1 89  ? 28.929 -20.201 43.896 1.00 66.34  ? 450 VAL A O     1 
ATOM   1717 C CB    . VAL B 1 89  ? 30.919 -19.156 46.404 1.00 65.80  ? 450 VAL A CB    1 
ATOM   1718 C CG1   . VAL B 1 89  ? 31.343 -19.453 47.840 1.00 54.72  ? 450 VAL A CG1   1 
ATOM   1719 C CG2   . VAL B 1 89  ? 31.856 -19.830 45.410 1.00 50.97  ? 450 VAL A CG2   1 
ATOM   1720 N N     . THR B 1 90  ? 28.945 -18.008 44.408 1.00 61.13  ? 451 THR A N     1 
ATOM   1721 C CA    . THR B 1 90  ? 28.680 -17.580 43.044 1.00 56.93  ? 451 THR A CA    1 
ATOM   1722 C C     . THR B 1 90  ? 27.541 -18.389 42.432 1.00 57.53  ? 451 THR A C     1 
ATOM   1723 O O     . THR B 1 90  ? 26.474 -18.515 43.023 1.00 60.87  ? 451 THR A O     1 
ATOM   1724 C CB    . THR B 1 90  ? 29.937 -17.740 42.169 1.00 70.51  ? 451 THR A CB    1 
ATOM   1725 O OG1   . THR B 1 90  ? 30.292 -19.128 42.088 1.00 77.56  ? 451 THR A OG1   1 
ATOM   1726 C CG2   . THR B 1 90  ? 31.104 -16.953 42.760 1.00 60.90  ? 451 THR A CG2   1 
ATOM   1727 N N     . GLY B 1 91  ? 27.786 -18.942 41.249 1.00 58.97  ? 452 GLY A N     1 
ATOM   1728 C CA    . GLY B 1 91  ? 26.808 -19.753 40.552 1.00 52.74  ? 452 GLY A CA    1 
ATOM   1729 C C     . GLY B 1 91  ? 26.162 -20.819 41.414 1.00 57.78  ? 452 GLY A C     1 
ATOM   1730 O O     . GLY B 1 91  ? 24.932 -20.847 41.548 1.00 56.59  ? 452 GLY A O     1 
ATOM   1731 N N     . ASN B 1 92  ? 26.980 -21.695 41.997 1.00 50.33  ? 453 ASN A N     1 
ATOM   1732 C CA    . ASN B 1 92  ? 26.464 -22.751 42.873 1.00 46.78  ? 453 ASN A CA    1 
ATOM   1733 C C     . ASN B 1 92  ? 25.459 -22.200 43.881 1.00 56.33  ? 453 ASN A C     1 
ATOM   1734 O O     . ASN B 1 92  ? 24.331 -22.695 44.001 1.00 60.80  ? 453 ASN A O     1 
ATOM   1735 C CB    . ASN B 1 92  ? 27.600 -23.481 43.599 1.00 47.43  ? 453 ASN A CB    1 
ATOM   1736 C CG    . ASN B 1 92  ? 28.517 -24.241 42.642 1.00 53.50  ? 453 ASN A CG    1 
ATOM   1737 O OD1   . ASN B 1 92  ? 28.226 -24.358 41.453 1.00 52.14  ? 453 ASN A OD1   1 
ATOM   1738 N ND2   . ASN B 1 92  ? 29.629 -24.754 43.158 1.00 47.89  ? 453 ASN A ND2   1 
ATOM   1739 N N     . LEU B 1 93  ? 25.865 -21.160 44.597 1.00 55.43  ? 454 LEU A N     1 
ATOM   1740 C CA    . LEU B 1 93  ? 24.983 -20.521 45.558 1.00 50.58  ? 454 LEU A CA    1 
ATOM   1741 C C     . LEU B 1 93  ? 23.734 -19.974 44.878 1.00 56.17  ? 454 LEU A C     1 
ATOM   1742 O O     . LEU B 1 93  ? 22.617 -20.205 45.334 1.00 60.30  ? 454 LEU A O     1 
ATOM   1743 C CB    . LEU B 1 93  ? 25.725 -19.404 46.279 1.00 60.89  ? 454 LEU A CB    1 
ATOM   1744 C CG    . LEU B 1 93  ? 24.895 -18.581 47.261 1.00 66.76  ? 454 LEU A CG    1 
ATOM   1745 C CD1   . LEU B 1 93  ? 24.216 -19.468 48.301 1.00 63.26  ? 454 LEU A CD1   1 
ATOM   1746 C CD2   . LEU B 1 93  ? 25.784 -17.559 47.923 1.00 53.99  ? 454 LEU A CD2   1 
ATOM   1747 N N     . ALA B 1 94  ? 23.930 -19.255 43.780 1.00 57.96  ? 455 ALA A N     1 
ATOM   1748 C CA    . ALA B 1 94  ? 22.819 -18.705 43.014 1.00 55.39  ? 455 ALA A CA    1 
ATOM   1749 C C     . ALA B 1 94  ? 21.753 -19.762 42.763 1.00 62.55  ? 455 ALA A C     1 
ATOM   1750 O O     . ALA B 1 94  ? 20.564 -19.531 43.016 1.00 55.98  ? 455 ALA A O     1 
ATOM   1751 C CB    . ALA B 1 94  ? 23.317 -18.123 41.695 1.00 45.69  ? 455 ALA A CB    1 
ATOM   1752 N N     . LEU B 1 95  ? 22.183 -20.920 42.262 1.00 59.81  ? 456 LEU A N     1 
ATOM   1753 C CA    . LEU B 1 95  ? 21.249 -21.998 41.940 1.00 58.27  ? 456 LEU A CA    1 
ATOM   1754 C C     . LEU B 1 95  ? 20.479 -22.425 43.178 1.00 59.01  ? 456 LEU A C     1 
ATOM   1755 O O     . LEU B 1 95  ? 19.250 -22.485 43.162 1.00 59.79  ? 456 LEU A O     1 
ATOM   1756 C CB    . LEU B 1 95  ? 21.961 -23.206 41.310 1.00 55.45  ? 456 LEU A CB    1 
ATOM   1757 C CG    . LEU B 1 95  ? 22.102 -23.239 39.780 1.00 50.53  ? 456 LEU A CG    1 
ATOM   1758 C CD1   . LEU B 1 95  ? 22.921 -24.434 39.313 1.00 45.47  ? 456 LEU A CD1   1 
ATOM   1759 C CD2   . LEU B 1 95  ? 20.752 -23.241 39.090 1.00 36.98  ? 456 LEU A CD2   1 
ATOM   1760 N N     . LYS B 1 96  ? 21.202 -22.712 44.255 1.00 56.65  ? 457 LYS A N     1 
ATOM   1761 C CA    . LYS B 1 96  ? 20.550 -23.094 45.505 1.00 61.25  ? 457 LYS A CA    1 
ATOM   1762 C C     . LYS B 1 96  ? 19.486 -22.088 45.943 1.00 59.47  ? 457 LYS A C     1 
ATOM   1763 O O     . LYS B 1 96  ? 18.379 -22.469 46.325 1.00 63.90  ? 457 LYS A O     1 
ATOM   1764 C CB    . LYS B 1 96  ? 21.565 -23.281 46.624 1.00 55.25  ? 457 LYS A CB    1 
ATOM   1765 C CG    . LYS B 1 96  ? 20.946 -23.144 47.983 1.00 57.55  ? 457 LYS A CG    1 
ATOM   1766 C CD    . LYS B 1 96  ? 21.825 -23.751 49.055 1.00 68.67  ? 457 LYS A CD    1 
ATOM   1767 C CE    . LYS B 1 96  ? 21.181 -23.605 50.422 1.00 72.75  ? 457 LYS A CE    1 
ATOM   1768 N NZ    . LYS B 1 96  ? 21.888 -24.427 51.453 1.00 94.62  ? 457 LYS A NZ    1 
ATOM   1769 N N     . ASN B 1 97  ? 19.820 -20.804 45.889 1.00 55.58  ? 458 ASN A N     1 
ATOM   1770 C CA    . ASN B 1 97  ? 18.857 -19.773 46.253 1.00 61.23  ? 458 ASN A CA    1 
ATOM   1771 C C     . ASN B 1 97  ? 17.652 -19.736 45.314 1.00 59.34  ? 458 ASN A C     1 
ATOM   1772 O O     . ASN B 1 97  ? 16.588 -19.235 45.680 1.00 64.45  ? 458 ASN A O     1 
ATOM   1773 C CB    . ASN B 1 97  ? 19.522 -18.398 46.309 1.00 66.41  ? 458 ASN A CB    1 
ATOM   1774 C CG    . ASN B 1 97  ? 20.627 -18.325 47.343 1.00 65.46  ? 458 ASN A CG    1 
ATOM   1775 O OD1   . ASN B 1 97  ? 20.630 -19.073 48.312 1.00 64.43  ? 458 ASN A OD1   1 
ATOM   1776 N ND2   . ASN B 1 97  ? 21.575 -17.422 47.137 1.00 69.65  ? 458 ASN A ND2   1 
ATOM   1777 N N     . SER B 1 98  ? 17.815 -20.261 44.105 1.00 55.20  ? 459 SER A N     1 
ATOM   1778 C CA    . SER B 1 98  ? 16.713 -20.287 43.150 1.00 52.95  ? 459 SER A CA    1 
ATOM   1779 C C     . SER B 1 98  ? 15.682 -21.340 43.510 1.00 56.58  ? 459 SER A C     1 
ATOM   1780 O O     . SER B 1 98  ? 14.552 -21.293 43.033 1.00 62.06  ? 459 SER A O     1 
ATOM   1781 C CB    . SER B 1 98  ? 17.222 -20.514 41.730 1.00 59.15  ? 459 SER A CB    1 
ATOM   1782 O OG    . SER B 1 98  ? 17.575 -19.282 41.116 1.00 64.58  ? 459 SER A OG    1 
ATOM   1783 N N     . ILE B 1 99  ? 16.074 -22.284 44.360 1.00 54.87  ? 460 ILE A N     1 
ATOM   1784 C CA    . ILE B 1 99  ? 15.145 -23.295 44.842 1.00 56.01  ? 460 ILE A CA    1 
ATOM   1785 C C     . ILE B 1 99  ? 13.994 -22.623 45.587 1.00 65.78  ? 460 ILE A C     1 
ATOM   1786 O O     . ILE B 1 99  ? 12.828 -22.750 45.198 1.00 63.60  ? 460 ILE A O     1 
ATOM   1787 C CB    . ILE B 1 99  ? 15.837 -24.312 45.768 1.00 57.18  ? 460 ILE A CB    1 
ATOM   1788 C CG1   . ILE B 1 99  ? 16.849 -25.153 44.983 1.00 48.15  ? 460 ILE A CG1   1 
ATOM   1789 C CG2   . ILE B 1 99  ? 14.802 -25.204 46.436 1.00 49.21  ? 460 ILE A CG2   1 
ATOM   1790 C CD1   . ILE B 1 99  ? 17.767 -26.004 45.871 1.00 46.72  ? 460 ILE A CD1   1 
ATOM   1791 N N     . ASN B 1 100 ? 14.332 -21.892 46.647 1.00 65.70  ? 461 ASN A N     1 
ATOM   1792 C CA    . ASN B 1 100 ? 13.328 -21.209 47.458 1.00 62.19  ? 461 ASN A CA    1 
ATOM   1793 C C     . ASN B 1 100 ? 12.681 -20.009 46.771 1.00 61.96  ? 461 ASN A C     1 
ATOM   1794 O O     . ASN B 1 100 ? 11.486 -19.770 46.924 1.00 79.37  ? 461 ASN A O     1 
ATOM   1795 C CB    . ASN B 1 100 ? 13.903 -20.794 48.804 1.00 60.68  ? 461 ASN A CB    1 
ATOM   1796 C CG    . ASN B 1 100 ? 14.590 -21.938 49.512 1.00 82.97  ? 461 ASN A CG    1 
ATOM   1797 O OD1   . ASN B 1 100 ? 13.987 -22.624 50.341 1.00 71.95  ? 461 ASN A OD1   1 
ATOM   1798 N ND2   . ASN B 1 100 ? 15.860 -22.167 49.174 1.00 94.46  ? 461 ASN A ND2   1 
ATOM   1799 N N     . LYS B 1 101 ? 13.457 -19.248 46.017 1.00 61.76  ? 462 LYS A N     1 
ATOM   1800 C CA    . LYS B 1 101 ? 12.879 -18.134 45.284 1.00 66.61  ? 462 LYS A CA    1 
ATOM   1801 C C     . LYS B 1 101 ? 11.894 -18.657 44.235 1.00 65.68  ? 462 LYS A C     1 
ATOM   1802 O O     . LYS B 1 101 ? 10.981 -17.944 43.815 1.00 66.68  ? 462 LYS A O     1 
ATOM   1803 C CB    . LYS B 1 101 ? 13.973 -17.300 44.611 1.00 74.87  ? 462 LYS A CB    1 
ATOM   1804 C CG    . LYS B 1 101 ? 13.537 -15.877 44.262 1.00 80.80  ? 462 LYS A CG    1 
ATOM   1805 C CD    . LYS B 1 101 ? 13.763 -14.932 45.442 1.00 100.58 ? 462 LYS A CD    1 
ATOM   1806 C CE    . LYS B 1 101 ? 12.882 -13.685 45.362 1.00 113.05 ? 462 LYS A CE    1 
ATOM   1807 N NZ    . LYS B 1 101 ? 11.575 -13.848 46.076 1.00 96.38  ? 462 LYS A NZ    1 
ATOM   1808 N N     . LYS B 1 102 ? 12.093 -19.904 43.814 1.00 60.96  ? 463 LYS A N     1 
ATOM   1809 C CA    . LYS B 1 102 ? 11.235 -20.542 42.811 1.00 56.64  ? 463 LYS A CA    1 
ATOM   1810 C C     . LYS B 1 102 ? 11.154 -19.768 41.506 1.00 59.53  ? 463 LYS A C     1 
ATOM   1811 O O     . LYS B 1 102 ? 10.121 -19.783 40.832 1.00 64.24  ? 463 LYS A O     1 
ATOM   1812 C CB    . LYS B 1 102 ? 9.818  -20.767 43.347 1.00 60.66  ? 463 LYS A CB    1 
ATOM   1813 C CG    . LYS B 1 102 ? 9.754  -21.645 44.582 1.00 66.54  ? 463 LYS A CG    1 
ATOM   1814 C CD    . LYS B 1 102 ? 8.322  -22.035 44.896 1.00 76.44  ? 463 LYS A CD    1 
ATOM   1815 C CE    . LYS B 1 102 ? 8.235  -22.783 46.224 1.00 92.10  ? 463 LYS A CE    1 
ATOM   1816 N NZ    . LYS B 1 102 ? 9.160  -23.955 46.267 1.00 94.76  ? 463 LYS A NZ    1 
ATOM   1817 N N     . ASN B 1 103 ? 12.244 -19.103 41.140 1.00 65.52  ? 464 ASN A N     1 
ATOM   1818 C CA    . ASN B 1 103 ? 12.296 -18.368 39.881 1.00 53.60  ? 464 ASN A CA    1 
ATOM   1819 C C     . ASN B 1 103 ? 12.673 -19.268 38.717 1.00 62.45  ? 464 ASN A C     1 
ATOM   1820 O O     . ASN B 1 103 ? 13.425 -20.231 38.889 1.00 65.19  ? 464 ASN A O     1 
ATOM   1821 C CB    . ASN B 1 103 ? 13.318 -17.247 39.971 1.00 54.43  ? 464 ASN A CB    1 
ATOM   1822 C CG    . ASN B 1 103 ? 14.739 -17.760 39.900 1.00 57.71  ? 464 ASN A CG    1 
ATOM   1823 O OD1   . ASN B 1 103 ? 15.267 -18.298 40.874 1.00 58.58  ? 464 ASN A OD1   1 
ATOM   1824 N ND2   . ASN B 1 103 ? 15.370 -17.594 38.742 1.00 53.78  ? 464 ASN A ND2   1 
ATOM   1825 N N     . PRO B 1 104 ? 12.153 -18.947 37.523 1.00 61.72  ? 465 PRO A N     1 
ATOM   1826 C CA    . PRO B 1 104 ? 12.454 -19.617 36.255 1.00 52.25  ? 465 PRO A CA    1 
ATOM   1827 C C     . PRO B 1 104 ? 13.929 -19.502 35.902 1.00 61.86  ? 465 PRO A C     1 
ATOM   1828 O O     . PRO B 1 104 ? 14.530 -18.448 36.107 1.00 67.93  ? 465 PRO A O     1 
ATOM   1829 C CB    . PRO B 1 104 ? 11.641 -18.812 35.237 1.00 59.37  ? 465 PRO A CB    1 
ATOM   1830 C CG    . PRO B 1 104 ? 10.559 -18.179 36.032 1.00 59.97  ? 465 PRO A CG    1 
ATOM   1831 C CD    . PRO B 1 104 ? 11.155 -17.879 37.362 1.00 56.15  ? 465 PRO A CD    1 
ATOM   1832 N N     . VAL B 1 105 ? 14.497 -20.569 35.353 1.00 63.11  ? 466 VAL A N     1 
ATOM   1833 C CA    . VAL B 1 105 ? 15.874 -20.540 34.882 1.00 50.79  ? 466 VAL A CA    1 
ATOM   1834 C C     . VAL B 1 105 ? 15.935 -20.939 33.418 1.00 43.70  ? 466 VAL A C     1 
ATOM   1835 O O     . VAL B 1 105 ? 15.347 -21.941 33.021 1.00 57.31  ? 466 VAL A O     1 
ATOM   1836 C CB    . VAL B 1 105 ? 16.752 -21.471 35.718 1.00 48.19  ? 466 VAL A CB    1 
ATOM   1837 C CG1   . VAL B 1 105 ? 18.174 -21.535 35.157 1.00 46.13  ? 466 VAL A CG1   1 
ATOM   1838 C CG2   . VAL B 1 105 ? 16.756 -20.996 37.155 1.00 46.80  ? 466 VAL A CG2   1 
ATOM   1839 N N     . ARG B 1 106 ? 16.630 -20.148 32.610 1.00 43.86  ? 467 ARG A N     1 
ATOM   1840 C CA    . ARG B 1 106 ? 16.785 -20.480 31.196 1.00 53.57  ? 467 ARG A CA    1 
ATOM   1841 C C     . ARG B 1 106 ? 17.782 -21.615 31.084 1.00 49.34  ? 467 ARG A C     1 
ATOM   1842 O O     . ARG B 1 106 ? 18.729 -21.690 31.856 1.00 52.27  ? 467 ARG A O     1 
ATOM   1843 C CB    . ARG B 1 106 ? 17.252 -19.268 30.379 1.00 55.14  ? 467 ARG A CB    1 
ATOM   1844 C CG    . ARG B 1 106 ? 16.175 -18.191 30.175 1.00 55.34  ? 467 ARG A CG    1 
ATOM   1845 C CD    . ARG B 1 106 ? 16.702 -16.959 29.403 1.00 53.15  ? 467 ARG A CD    1 
ATOM   1846 N NE    . ARG B 1 106 ? 17.767 -16.246 30.110 1.00 58.20  ? 467 ARG A NE    1 
ATOM   1847 C CZ    . ARG B 1 106 ? 17.561 -15.268 30.990 1.00 65.96  ? 467 ARG A CZ    1 
ATOM   1848 N NH1   . ARG B 1 106 ? 16.324 -14.882 31.271 1.00 60.45  ? 467 ARG A NH1   1 
ATOM   1849 N NH2   . ARG B 1 106 ? 18.593 -14.676 31.592 1.00 62.88  ? 467 ARG A NH2   1 
ATOM   1850 N N     . VAL B 1 107 ? 17.558 -22.513 30.138 1.00 47.92  ? 468 VAL A N     1 
ATOM   1851 C CA    . VAL B 1 107 ? 18.455 -23.641 29.954 1.00 40.29  ? 468 VAL A CA    1 
ATOM   1852 C C     . VAL B 1 107 ? 18.870 -23.773 28.505 1.00 53.31  ? 468 VAL A C     1 
ATOM   1853 O O     . VAL B 1 107 ? 18.030 -23.801 27.602 1.00 56.79  ? 468 VAL A O     1 
ATOM   1854 C CB    . VAL B 1 107 ? 17.810 -24.953 30.393 1.00 45.79  ? 468 VAL A CB    1 
ATOM   1855 C CG1   . VAL B 1 107 ? 18.536 -26.116 29.758 1.00 47.93  ? 468 VAL A CG1   1 
ATOM   1856 C CG2   . VAL B 1 107 ? 17.820 -25.080 31.907 1.00 41.89  ? 468 VAL A CG2   1 
ATOM   1857 N N     . ILE B 1 108 ? 20.173 -23.840 28.282 1.00 50.12  ? 469 ILE A N     1 
ATOM   1858 C CA    . ILE B 1 108 ? 20.699 -24.002 26.940 1.00 55.33  ? 469 ILE A CA    1 
ATOM   1859 C C     . ILE B 1 108 ? 21.458 -25.308 26.909 1.00 54.93  ? 469 ILE A C     1 
ATOM   1860 O O     . ILE B 1 108 ? 22.240 -25.592 27.810 1.00 56.81  ? 469 ILE A O     1 
ATOM   1861 C CB    . ILE B 1 108 ? 21.672 -22.865 26.569 1.00 57.77  ? 469 ILE A CB    1 
ATOM   1862 C CG1   . ILE B 1 108 ? 20.938 -21.532 26.473 1.00 53.50  ? 469 ILE A CG1   1 
ATOM   1863 C CG2   . ILE B 1 108 ? 22.384 -23.168 25.269 1.00 54.65  ? 469 ILE A CG2   1 
ATOM   1864 C CD1   . ILE B 1 108 ? 20.704 -20.876 27.822 1.00 55.14  ? 469 ILE A CD1   1 
ATOM   1865 N N     . ARG B 1 109 ? 21.227 -26.108 25.878 1.00 57.18  ? 470 ARG A N     1 
ATOM   1866 C CA    . ARG B 1 109 ? 21.948 -27.363 25.742 1.00 56.98  ? 470 ARG A CA    1 
ATOM   1867 C C     . ARG B 1 109 ? 22.911 -27.276 24.574 1.00 57.72  ? 470 ARG A C     1 
ATOM   1868 O O     . ARG B 1 109 ? 22.582 -26.709 23.537 1.00 58.58  ? 470 ARG A O     1 
ATOM   1869 C CB    . ARG B 1 109 ? 20.976 -28.524 25.520 1.00 62.28  ? 470 ARG A CB    1 
ATOM   1870 C CG    . ARG B 1 109 ? 19.774 -28.511 26.440 1.00 68.82  ? 470 ARG A CG    1 
ATOM   1871 C CD    . ARG B 1 109 ? 19.009 -29.825 26.392 1.00 78.65  ? 470 ARG A CD    1 
ATOM   1872 N NE    . ARG B 1 109 ? 18.131 -29.978 27.552 1.00 77.31  ? 470 ARG A NE    1 
ATOM   1873 C CZ    . ARG B 1 109 ? 17.827 -31.146 28.112 1.00 85.32  ? 470 ARG A CZ    1 
ATOM   1874 N NH1   . ARG B 1 109 ? 18.341 -32.265 27.617 1.00 98.78  ? 470 ARG A NH1   1 
ATOM   1875 N NH2   . ARG B 1 109 ? 17.022 -31.201 29.170 1.00 68.41  ? 470 ARG A NH2   1 
ATOM   1876 N N     . GLY B 1 110 ? 24.107 -27.824 24.756 1.00 61.45  ? 471 GLY A N     1 
ATOM   1877 C CA    . GLY B 1 110 ? 25.036 -27.990 23.658 1.00 65.54  ? 471 GLY A CA    1 
ATOM   1878 C C     . GLY B 1 110 ? 24.552 -29.169 22.851 1.00 68.30  ? 471 GLY A C     1 
ATOM   1879 O O     . GLY B 1 110 ? 23.745 -29.953 23.344 1.00 82.46  ? 471 GLY A O     1 
ATOM   1880 N N     . ILE B 1 111 ? 25.029 -29.306 21.619 1.00 75.65  ? 472 ILE A N     1 
ATOM   1881 C CA    . ILE B 1 111 ? 24.573 -30.388 20.749 1.00 75.70  ? 472 ILE A CA    1 
ATOM   1882 C C     . ILE B 1 111 ? 25.669 -30.853 19.788 1.00 85.68  ? 472 ILE A C     1 
ATOM   1883 O O     . ILE B 1 111 ? 26.610 -30.106 19.500 1.00 75.54  ? 472 ILE A O     1 
ATOM   1884 C CB    . ILE B 1 111 ? 23.331 -29.956 19.946 1.00 72.00  ? 472 ILE A CB    1 
ATOM   1885 C CG1   . ILE B 1 111 ? 23.682 -28.801 19.008 1.00 73.17  ? 472 ILE A CG1   1 
ATOM   1886 C CG2   . ILE B 1 111 ? 22.204 -29.554 20.885 1.00 65.72  ? 472 ILE A CG2   1 
ATOM   1887 C CD1   . ILE B 1 111 ? 22.483 -28.011 18.521 1.00 71.25  ? 472 ILE A CD1   1 
ATOM   1888 N N     . LYS B 1 112 ? 25.537 -32.084 19.293 1.00 101.48 ? 473 LYS A N     1 
ATOM   1889 C CA    . LYS B 1 112 ? 26.517 -32.670 18.367 1.00 102.02 ? 473 LYS A CA    1 
ATOM   1890 C C     . LYS B 1 112 ? 26.614 -31.904 17.049 1.00 95.83  ? 473 LYS A C     1 
ATOM   1891 O O     . LYS B 1 112 ? 27.670 -31.870 16.417 1.00 100.41 ? 473 LYS A O     1 
ATOM   1892 C CB    . LYS B 1 112 ? 26.200 -34.142 18.101 1.00 84.25  ? 473 LYS A CB    1 
ATOM   1893 N N     . LYS B 1 123 ? 25.903 -24.677 14.326 1.00 73.29  ? 484 LYS A N     1 
ATOM   1894 C CA    . LYS B 1 123 ? 25.020 -24.457 15.474 1.00 78.63  ? 484 LYS A CA    1 
ATOM   1895 C C     . LYS B 1 123 ? 25.227 -25.505 16.590 1.00 77.41  ? 484 LYS A C     1 
ATOM   1896 O O     . LYS B 1 123 ? 24.970 -26.693 16.398 1.00 76.42  ? 484 LYS A O     1 
ATOM   1897 C CB    . LYS B 1 123 ? 23.555 -24.400 15.019 1.00 65.21  ? 484 LYS A CB    1 
ATOM   1898 N N     . ASN B 1 124 ? 25.691 -25.053 17.757 1.00 70.42  ? 485 ASN A N     1 
ATOM   1899 C CA    . ASN B 1 124 ? 26.041 -25.956 18.855 1.00 57.28  ? 485 ASN A CA    1 
ATOM   1900 C C     . ASN B 1 124 ? 25.211 -25.785 20.127 1.00 56.37  ? 485 ASN A C     1 
ATOM   1901 O O     . ASN B 1 124 ? 25.453 -26.475 21.114 1.00 59.52  ? 485 ASN A O     1 
ATOM   1902 C CB    . ASN B 1 124 ? 27.507 -25.780 19.229 1.00 64.22  ? 485 ASN A CB    1 
ATOM   1903 C CG    . ASN B 1 124 ? 28.434 -25.895 18.043 1.00 76.56  ? 485 ASN A CG    1 
ATOM   1904 O OD1   . ASN B 1 124 ? 28.874 -24.885 17.492 1.00 73.47  ? 485 ASN A OD1   1 
ATOM   1905 N ND2   . ASN B 1 124 ? 28.753 -27.127 17.651 1.00 69.84  ? 485 ASN A ND2   1 
ATOM   1906 N N     . TYR B 1 125 ? 24.243 -24.873 20.108 1.00 53.05  ? 486 TYR A N     1 
ATOM   1907 C CA    . TYR B 1 125 ? 23.457 -24.573 21.294 1.00 51.90  ? 486 TYR A CA    1 
ATOM   1908 C C     . TYR B 1 125 ? 21.984 -24.389 20.973 1.00 58.60  ? 486 TYR A C     1 
ATOM   1909 O O     . TYR B 1 125 ? 21.636 -23.726 20.001 1.00 61.65  ? 486 TYR A O     1 
ATOM   1910 C CB    . TYR B 1 125 ? 23.996 -23.312 21.989 1.00 55.02  ? 486 TYR A CB    1 
ATOM   1911 C CG    . TYR B 1 125 ? 25.432 -23.439 22.422 1.00 54.64  ? 486 TYR A CG    1 
ATOM   1912 C CD1   . TYR B 1 125 ? 25.772 -24.158 23.564 1.00 47.48  ? 486 TYR A CD1   1 
ATOM   1913 C CD2   . TYR B 1 125 ? 26.457 -22.869 21.675 1.00 55.84  ? 486 TYR A CD2   1 
ATOM   1914 C CE1   . TYR B 1 125 ? 27.089 -24.297 23.955 1.00 50.41  ? 486 TYR A CE1   1 
ATOM   1915 C CE2   . TYR B 1 125 ? 27.785 -23.000 22.060 1.00 54.08  ? 486 TYR A CE2   1 
ATOM   1916 C CZ    . TYR B 1 125 ? 28.094 -23.713 23.200 1.00 57.28  ? 486 TYR A CZ    1 
ATOM   1917 O OH    . TYR B 1 125 ? 29.412 -23.838 23.583 1.00 48.98  ? 486 TYR A OH    1 
ATOM   1918 N N     . VAL B 1 126 ? 21.120 -24.967 21.806 1.00 60.71  ? 487 VAL A N     1 
ATOM   1919 C CA    . VAL B 1 126 ? 19.680 -24.764 21.677 1.00 60.91  ? 487 VAL A CA    1 
ATOM   1920 C C     . VAL B 1 126 ? 19.112 -24.164 22.942 1.00 59.70  ? 487 VAL A C     1 
ATOM   1921 O O     . VAL B 1 126 ? 19.459 -24.583 24.049 1.00 60.06  ? 487 VAL A O     1 
ATOM   1922 C CB    . VAL B 1 126 ? 18.917 -26.084 21.473 1.00 65.55  ? 487 VAL A CB    1 
ATOM   1923 C CG1   . VAL B 1 126 ? 17.763 -25.878 20.496 1.00 57.42  ? 487 VAL A CG1   1 
ATOM   1924 C CG2   . VAL B 1 126 ? 19.850 -27.173 20.995 1.00 77.03  ? 487 VAL A CG2   1 
ATOM   1925 N N     . TYR B 1 127 ? 18.221 -23.195 22.777 1.00 63.10  ? 488 TYR A N     1 
ATOM   1926 C CA    . TYR B 1 127 ? 17.443 -22.707 23.902 1.00 56.20  ? 488 TYR A CA    1 
ATOM   1927 C C     . TYR B 1 127 ? 16.353 -23.723 24.197 1.00 57.21  ? 488 TYR A C     1 
ATOM   1928 O O     . TYR B 1 127 ? 15.556 -24.062 23.332 1.00 58.65  ? 488 TYR A O     1 
ATOM   1929 C CB    . TYR B 1 127 ? 16.829 -21.346 23.608 1.00 50.68  ? 488 TYR A CB    1 
ATOM   1930 C CG    . TYR B 1 127 ? 15.933 -20.855 24.721 1.00 60.28  ? 488 TYR A CG    1 
ATOM   1931 C CD1   . TYR B 1 127 ? 16.410 -20.754 26.020 1.00 58.01  ? 488 TYR A CD1   1 
ATOM   1932 C CD2   . TYR B 1 127 ? 14.616 -20.496 24.475 1.00 55.46  ? 488 TYR A CD2   1 
ATOM   1933 C CE1   . TYR B 1 127 ? 15.605 -20.312 27.039 1.00 59.07  ? 488 TYR A CE1   1 
ATOM   1934 C CE2   . TYR B 1 127 ? 13.801 -20.054 25.488 1.00 54.73  ? 488 TYR A CE2   1 
ATOM   1935 C CZ    . TYR B 1 127 ? 14.298 -19.960 26.772 1.00 64.13  ? 488 TYR A CZ    1 
ATOM   1936 O OH    . TYR B 1 127 ? 13.495 -19.509 27.801 1.00 67.07  ? 488 TYR A OH    1 
ATOM   1937 N N     . ASP B 1 128 ? 16.323 -24.208 25.428 1.00 59.55  ? 489 ASP A N     1 
ATOM   1938 C CA    . ASP B 1 128 ? 15.438 -25.299 25.785 1.00 54.06  ? 489 ASP A CA    1 
ATOM   1939 C C     . ASP B 1 128 ? 14.283 -24.870 26.690 1.00 60.75  ? 489 ASP A C     1 
ATOM   1940 O O     . ASP B 1 128 ? 13.576 -25.714 27.242 1.00 60.03  ? 489 ASP A O     1 
ATOM   1941 C CB    . ASP B 1 128 ? 16.248 -26.409 26.449 1.00 60.90  ? 489 ASP A CB    1 
ATOM   1942 C CG    . ASP B 1 128 ? 15.449 -27.675 26.643 1.00 73.47  ? 489 ASP A CG    1 
ATOM   1943 O OD1   . ASP B 1 128 ? 14.473 -27.895 25.890 1.00 69.81  ? 489 ASP A OD1   1 
ATOM   1944 O OD2   . ASP B 1 128 ? 15.803 -28.450 27.555 1.00 79.62  ? 489 ASP A OD2   1 
ATOM   1945 N N     . GLY B 1 129 ? 14.093 -23.564 26.850 1.00 56.96  ? 490 GLY A N     1 
ATOM   1946 C CA    . GLY B 1 129 ? 12.978 -23.059 27.630 1.00 44.30  ? 490 GLY A CA    1 
ATOM   1947 C C     . GLY B 1 129 ? 13.301 -22.845 29.090 1.00 51.79  ? 490 GLY A C     1 
ATOM   1948 O O     . GLY B 1 129 ? 14.463 -22.714 29.461 1.00 58.45  ? 490 GLY A O     1 
ATOM   1949 N N     . LEU B 1 130 ? 12.270 -22.822 29.927 1.00 53.09  ? 491 LEU A N     1 
ATOM   1950 C CA    . LEU B 1 130 ? 12.456 -22.498 31.334 1.00 47.12  ? 491 LEU A CA    1 
ATOM   1951 C C     . LEU B 1 130 ? 12.270 -23.688 32.257 1.00 49.42  ? 491 LEU A C     1 
ATOM   1952 O O     . LEU B 1 130 ? 11.381 -24.516 32.056 1.00 49.75  ? 491 LEU A O     1 
ATOM   1953 C CB    . LEU B 1 130 ? 11.492 -21.388 31.740 1.00 62.87  ? 491 LEU A CB    1 
ATOM   1954 C CG    . LEU B 1 130 ? 11.467 -20.166 30.822 1.00 53.97  ? 491 LEU A CG    1 
ATOM   1955 C CD1   . LEU B 1 130 ? 10.283 -19.288 31.195 1.00 51.76  ? 491 LEU A CD1   1 
ATOM   1956 C CD2   . LEU B 1 130 ? 12.780 -19.390 30.903 1.00 50.93  ? 491 LEU A CD2   1 
ATOM   1957 N N     . TYR B 1 131 ? 13.112 -23.743 33.286 1.00 52.67  ? 492 TYR A N     1 
ATOM   1958 C CA    . TYR B 1 131 ? 13.097 -24.808 34.277 1.00 41.40  ? 492 TYR A CA    1 
ATOM   1959 C C     . TYR B 1 131 ? 13.054 -24.177 35.661 1.00 50.90  ? 492 TYR A C     1 
ATOM   1960 O O     . TYR B 1 131 ? 13.321 -22.984 35.817 1.00 53.45  ? 492 TYR A O     1 
ATOM   1961 C CB    . TYR B 1 131 ? 14.382 -25.630 34.171 1.00 46.14  ? 492 TYR A CB    1 
ATOM   1962 C CG    . TYR B 1 131 ? 14.476 -26.570 32.990 1.00 44.33  ? 492 TYR A CG    1 
ATOM   1963 C CD1   . TYR B 1 131 ? 14.568 -27.936 33.188 1.00 44.63  ? 492 TYR A CD1   1 
ATOM   1964 C CD2   . TYR B 1 131 ? 14.505 -26.091 31.684 1.00 45.39  ? 492 TYR A CD2   1 
ATOM   1965 C CE1   . TYR B 1 131 ? 14.668 -28.807 32.132 1.00 42.16  ? 492 TYR A CE1   1 
ATOM   1966 C CE2   . TYR B 1 131 ? 14.596 -26.962 30.607 1.00 42.92  ? 492 TYR A CE2   1 
ATOM   1967 C CZ    . TYR B 1 131 ? 14.677 -28.323 30.846 1.00 47.04  ? 492 TYR A CZ    1 
ATOM   1968 O OH    . TYR B 1 131 ? 14.775 -29.228 29.816 1.00 52.42  ? 492 TYR A OH    1 
ATOM   1969 N N     . LEU B 1 132 ? 12.734 -24.981 36.670 1.00 49.86  ? 493 LEU A N     1 
ATOM   1970 C CA    . LEU B 1 132 ? 12.832 -24.551 38.059 1.00 44.17  ? 493 LEU A CA    1 
ATOM   1971 C C     . LEU B 1 132 ? 13.798 -25.471 38.773 1.00 52.37  ? 493 LEU A C     1 
ATOM   1972 O O     . LEU B 1 132 ? 13.854 -26.665 38.475 1.00 51.63  ? 493 LEU A O     1 
ATOM   1973 C CB    . LEU B 1 132 ? 11.476 -24.638 38.758 1.00 50.81  ? 493 LEU A CB    1 
ATOM   1974 C CG    . LEU B 1 132 ? 10.300 -23.820 38.224 1.00 60.70  ? 493 LEU A CG    1 
ATOM   1975 C CD1   . LEU B 1 132 ? 9.096  -24.067 39.109 1.00 53.93  ? 493 LEU A CD1   1 
ATOM   1976 C CD2   . LEU B 1 132 ? 10.620 -22.336 38.176 1.00 60.39  ? 493 LEU A CD2   1 
ATOM   1977 N N     . VAL B 1 133 ? 14.545 -24.920 39.726 1.00 52.16  ? 494 VAL A N     1 
ATOM   1978 C CA    . VAL B 1 133 ? 15.456 -25.724 40.526 1.00 50.15  ? 494 VAL A CA    1 
ATOM   1979 C C     . VAL B 1 133 ? 14.693 -26.358 41.686 1.00 51.69  ? 494 VAL A C     1 
ATOM   1980 O O     . VAL B 1 133 ? 14.280 -25.675 42.621 1.00 58.35  ? 494 VAL A O     1 
ATOM   1981 C CB    . VAL B 1 133 ? 16.646 -24.898 41.058 1.00 49.18  ? 494 VAL A CB    1 
ATOM   1982 C CG1   . VAL B 1 133 ? 17.666 -25.812 41.709 1.00 54.62  ? 494 VAL A CG1   1 
ATOM   1983 C CG2   . VAL B 1 133 ? 17.296 -24.116 39.931 1.00 43.99  ? 494 VAL A CG2   1 
ATOM   1984 N N     . GLU B 1 134 ? 14.502 -27.670 41.614 1.00 55.60  ? 495 GLU A N     1 
ATOM   1985 C CA    . GLU B 1 134 ? 13.697 -28.373 42.604 1.00 56.15  ? 495 GLU A CA    1 
ATOM   1986 C C     . GLU B 1 134 ? 14.476 -28.695 43.872 1.00 52.07  ? 495 GLU A C     1 
ATOM   1987 O O     . GLU B 1 134 ? 13.932 -28.631 44.974 1.00 57.81  ? 495 GLU A O     1 
ATOM   1988 C CB    . GLU B 1 134 ? 13.093 -29.648 42.009 1.00 59.63  ? 495 GLU A CB    1 
ATOM   1989 C CG    . GLU B 1 134 ? 12.091 -29.383 40.898 1.00 66.23  ? 495 GLU A CG    1 
ATOM   1990 C CD    . GLU B 1 134 ? 11.140 -30.551 40.670 1.00 86.98  ? 495 GLU A CD    1 
ATOM   1991 O OE1   . GLU B 1 134 ? 11.597 -31.718 40.700 1.00 92.70  ? 495 GLU A OE1   1 
ATOM   1992 O OE2   . GLU B 1 134 ? 9.931  -30.301 40.460 1.00 90.46  ? 495 GLU A OE2   1 
ATOM   1993 N N     . GLU B 1 135 ? 15.748 -29.039 43.729 1.00 50.21  ? 496 GLU A N     1 
ATOM   1994 C CA    . GLU B 1 135 ? 16.537 -29.370 44.904 1.00 54.65  ? 496 GLU A CA    1 
ATOM   1995 C C     . GLU B 1 135 ? 17.998 -29.536 44.560 1.00 53.28  ? 496 GLU A C     1 
ATOM   1996 O O     . GLU B 1 135 ? 18.378 -29.508 43.385 1.00 47.30  ? 496 GLU A O     1 
ATOM   1997 C CB    . GLU B 1 135 ? 16.049 -30.670 45.514 1.00 49.56  ? 496 GLU A CB    1 
ATOM   1998 C CG    . GLU B 1 135 ? 16.439 -31.868 44.688 1.00 57.39  ? 496 GLU A CG    1 
ATOM   1999 C CD    . GLU B 1 135 ? 16.300 -33.164 45.445 1.00 72.28  ? 496 GLU A CD    1 
ATOM   2000 O OE1   . GLU B 1 135 ? 15.757 -34.135 44.871 1.00 73.26  ? 496 GLU A OE1   1 
ATOM   2001 O OE2   . GLU B 1 135 ? 16.731 -33.205 46.617 1.00 85.24  ? 496 GLU A OE2   1 
ATOM   2002 N N     . TYR B 1 136 ? 18.812 -29.718 45.596 1.00 43.68  ? 497 TYR A N     1 
ATOM   2003 C CA    . TYR B 1 136 ? 20.222 -29.983 45.405 1.00 40.17  ? 497 TYR A CA    1 
ATOM   2004 C C     . TYR B 1 136 ? 20.718 -30.929 46.462 1.00 48.62  ? 497 TYR A C     1 
ATOM   2005 O O     . TYR B 1 136 ? 20.045 -31.175 47.456 1.00 57.59  ? 497 TYR A O     1 
ATOM   2006 C CB    . TYR B 1 136 ? 21.032 -28.694 45.435 1.00 50.59  ? 497 TYR A CB    1 
ATOM   2007 C CG    . TYR B 1 136 ? 21.482 -28.254 46.805 1.00 57.92  ? 497 TYR A CG    1 
ATOM   2008 C CD1   . TYR B 1 136 ? 22.800 -28.415 47.210 1.00 59.99  ? 497 TYR A CD1   1 
ATOM   2009 C CD2   . TYR B 1 136 ? 20.596 -27.653 47.689 1.00 73.26  ? 497 TYR A CD2   1 
ATOM   2010 C CE1   . TYR B 1 136 ? 23.216 -28.000 48.467 1.00 61.78  ? 497 TYR A CE1   1 
ATOM   2011 C CE2   . TYR B 1 136 ? 21.003 -27.237 48.950 1.00 61.86  ? 497 TYR A CE2   1 
ATOM   2012 C CZ    . TYR B 1 136 ? 22.310 -27.413 49.334 1.00 67.21  ? 497 TYR A CZ    1 
ATOM   2013 O OH    . TYR B 1 136 ? 22.710 -26.990 50.588 1.00 71.98  ? 497 TYR A OH    1 
ATOM   2014 N N     . TRP B 1 137 ? 21.898 -31.476 46.235 1.00 45.28  ? 498 TRP A N     1 
ATOM   2015 C CA    . TRP B 1 137 ? 22.506 -32.368 47.189 1.00 40.75  ? 498 TRP A CA    1 
ATOM   2016 C C     . TRP B 1 137 ? 23.956 -32.464 46.825 1.00 50.46  ? 498 TRP A C     1 
ATOM   2017 O O     . TRP B 1 137 ? 24.371 -31.941 45.792 1.00 47.87  ? 498 TRP A O     1 
ATOM   2018 C CB    . TRP B 1 137 ? 21.858 -33.743 47.143 1.00 46.88  ? 498 TRP A CB    1 
ATOM   2019 C CG    . TRP B 1 137 ? 22.150 -34.528 45.916 1.00 48.86  ? 498 TRP A CG    1 
ATOM   2020 C CD1   . TRP B 1 137 ? 23.238 -35.322 45.683 1.00 53.38  ? 498 TRP A CD1   1 
ATOM   2021 C CD2   . TRP B 1 137 ? 21.328 -34.622 44.752 1.00 50.49  ? 498 TRP A CD2   1 
ATOM   2022 N NE1   . TRP B 1 137 ? 23.154 -35.883 44.426 1.00 50.28  ? 498 TRP A NE1   1 
ATOM   2023 C CE2   . TRP B 1 137 ? 21.991 -35.468 43.836 1.00 45.11  ? 498 TRP A CE2   1 
ATOM   2024 C CE3   . TRP B 1 137 ? 20.103 -34.056 44.387 1.00 53.03  ? 498 TRP A CE3   1 
ATOM   2025 C CZ2   . TRP B 1 137 ? 21.463 -35.770 42.584 1.00 48.46  ? 498 TRP A CZ2   1 
ATOM   2026 C CZ3   . TRP B 1 137 ? 19.579 -34.353 43.143 1.00 52.55  ? 498 TRP A CZ3   1 
ATOM   2027 C CH2   . TRP B 1 137 ? 20.256 -35.207 42.256 1.00 48.67  ? 498 TRP A CH2   1 
ATOM   2028 N N     . GLU B 1 138 ? 24.740 -33.119 47.671 1.00 48.65  ? 499 GLU A N     1 
ATOM   2029 C CA    . GLU B 1 138 ? 26.163 -33.200 47.404 1.00 52.28  ? 499 GLU A CA    1 
ATOM   2030 C C     . GLU B 1 138 ? 26.609 -34.630 47.244 1.00 47.96  ? 499 GLU A C     1 
ATOM   2031 O O     . GLU B 1 138 ? 26.005 -35.545 47.775 1.00 50.57  ? 499 GLU A O     1 
ATOM   2032 C CB    . GLU B 1 138 ? 26.981 -32.464 48.467 1.00 60.66  ? 499 GLU A CB    1 
ATOM   2033 C CG    . GLU B 1 138 ? 26.687 -32.872 49.889 1.00 85.32  ? 499 GLU A CG    1 
ATOM   2034 C CD    . GLU B 1 138 ? 27.269 -31.898 50.904 1.00 97.79  ? 499 GLU A CD    1 
ATOM   2035 O OE1   . GLU B 1 138 ? 27.186 -30.670 50.669 1.00 84.02  ? 499 GLU A OE1   1 
ATOM   2036 O OE2   . GLU B 1 138 ? 27.804 -32.364 51.937 1.00 99.12  ? 499 GLU A OE2   1 
ATOM   2037 N N     . GLU B 1 139 ? 27.666 -34.807 46.476 1.00 52.80  ? 500 GLU A N     1 
ATOM   2038 C CA    . GLU B 1 139 ? 28.159 -36.122 46.138 1.00 59.19  ? 500 GLU A CA    1 
ATOM   2039 C C     . GLU B 1 139 ? 29.631 -36.153 46.441 1.00 59.36  ? 500 GLU A C     1 
ATOM   2040 O O     . GLU B 1 139 ? 30.238 -35.118 46.671 1.00 67.55  ? 500 GLU A O     1 
ATOM   2041 C CB    . GLU B 1 139 ? 27.958 -36.395 44.646 1.00 49.08  ? 500 GLU A CB    1 
ATOM   2042 C CG    . GLU B 1 139 ? 26.531 -36.672 44.264 1.00 56.49  ? 500 GLU A CG    1 
ATOM   2043 C CD    . GLU B 1 139 ? 26.428 -37.334 42.915 1.00 67.93  ? 500 GLU A CD    1 
ATOM   2044 O OE1   . GLU B 1 139 ? 27.477 -37.765 42.390 1.00 69.74  ? 500 GLU A OE1   1 
ATOM   2045 O OE2   . GLU B 1 139 ? 25.300 -37.424 42.378 1.00 72.74  ? 500 GLU A OE2   1 
ATOM   2046 N N     . THR B 1 140 ? 30.205 -37.342 46.408 1.00 58.19  ? 501 THR A N     1 
ATOM   2047 C CA    . THR B 1 140 ? 31.622 -37.502 46.630 1.00 59.45  ? 501 THR A CA    1 
ATOM   2048 C C     . THR B 1 140 ? 32.234 -38.413 45.577 1.00 67.66  ? 501 THR A C     1 
ATOM   2049 O O     . THR B 1 140 ? 31.960 -39.613 45.556 1.00 66.16  ? 501 THR A O     1 
ATOM   2050 C CB    . THR B 1 140 ? 31.873 -38.095 48.016 1.00 65.92  ? 501 THR A CB    1 
ATOM   2051 O OG1   . THR B 1 140 ? 31.277 -37.242 49.005 1.00 60.55  ? 501 THR A OG1   1 
ATOM   2052 C CG2   . THR B 1 140 ? 33.370 -38.245 48.280 1.00 60.48  ? 501 THR A CG2   1 
ATOM   2053 N N     . GLY B 1 141 ? 33.059 -37.838 44.706 1.00 69.98  ? 502 GLY A N     1 
ATOM   2054 C CA    . GLY B 1 141 ? 33.845 -38.625 43.770 1.00 84.29  ? 502 GLY A CA    1 
ATOM   2055 C C     . GLY B 1 141 ? 34.861 -39.504 44.483 1.00 86.85  ? 502 GLY A C     1 
ATOM   2056 O O     . GLY B 1 141 ? 34.908 -39.533 45.711 1.00 90.67  ? 502 GLY A O     1 
ATOM   2057 N N     . SER B 1 142 ? 35.677 -40.225 43.720 1.00 96.07  ? 503 SER A N     1 
ATOM   2058 C CA    . SER B 1 142 ? 36.669 -41.133 44.308 1.00 108.82 ? 503 SER A CA    1 
ATOM   2059 C C     . SER B 1 142 ? 37.841 -40.370 44.921 1.00 102.16 ? 503 SER A C     1 
ATOM   2060 O O     . SER B 1 142 ? 38.389 -40.761 45.950 1.00 91.98  ? 503 SER A O     1 
ATOM   2061 C CB    . SER B 1 142 ? 37.187 -42.123 43.260 1.00 118.59 ? 503 SER A CB    1 
ATOM   2062 O OG    . SER B 1 142 ? 38.110 -41.505 42.379 1.00 113.76 ? 503 SER A OG    1 
ATOM   2063 N N     . HIS B 1 143 ? 38.223 -39.287 44.255 1.00 104.31 ? 504 HIS A N     1 
ATOM   2064 C CA    . HIS B 1 143 ? 39.220 -38.348 44.748 1.00 100.24 ? 504 HIS A CA    1 
ATOM   2065 C C     . HIS B 1 143 ? 38.932 -37.944 46.186 1.00 95.55  ? 504 HIS A C     1 
ATOM   2066 O O     . HIS B 1 143 ? 39.831 -37.531 46.915 1.00 103.55 ? 504 HIS A O     1 
ATOM   2067 C CB    . HIS B 1 143 ? 39.171 -37.111 43.869 1.00 101.60 ? 504 HIS A CB    1 
ATOM   2068 C CG    . HIS B 1 143 ? 37.808 -36.845 43.314 1.00 106.03 ? 504 HIS A CG    1 
ATOM   2069 N ND1   . HIS B 1 143 ? 37.417 -37.281 42.066 1.00 98.56  ? 504 HIS A ND1   1 
ATOM   2070 C CD2   . HIS B 1 143 ? 36.731 -36.226 43.854 1.00 99.03  ? 504 HIS A CD2   1 
ATOM   2071 C CE1   . HIS B 1 143 ? 36.162 -36.922 41.852 1.00 110.14 ? 504 HIS A CE1   1 
ATOM   2072 N NE2   . HIS B 1 143 ? 35.725 -36.279 42.920 1.00 107.73 ? 504 HIS A NE2   1 
ATOM   2073 N N     . GLY B 1 144 ? 37.668 -38.046 46.582 1.00 90.31  ? 505 GLY A N     1 
ATOM   2074 C CA    . GLY B 1 144 ? 37.268 -37.766 47.947 1.00 76.85  ? 505 GLY A CA    1 
ATOM   2075 C C     . GLY B 1 144 ? 36.602 -36.416 48.111 1.00 75.20  ? 505 GLY A C     1 
ATOM   2076 O O     . GLY B 1 144 ? 36.130 -36.075 49.195 1.00 69.39  ? 505 GLY A O     1 
ATOM   2077 N N     . LYS B 1 145 ? 36.551 -35.637 47.040 1.00 72.96  ? 506 LYS A N     1 
ATOM   2078 C CA    . LYS B 1 145 ? 36.075 -34.265 47.175 1.00 71.66  ? 506 LYS A CA    1 
ATOM   2079 C C     . LYS B 1 145 ? 34.609 -34.072 46.800 1.00 56.16  ? 506 LYS A C     1 
ATOM   2080 O O     . LYS B 1 145 ? 34.012 -34.879 46.094 1.00 67.56  ? 506 LYS A O     1 
ATOM   2081 C CB    . LYS B 1 145 ? 36.978 -33.296 46.409 1.00 76.48  ? 506 LYS A CB    1 
ATOM   2082 C CG    . LYS B 1 145 ? 38.449 -33.419 46.777 1.00 81.17  ? 506 LYS A CG    1 
ATOM   2083 C CD    . LYS B 1 145 ? 38.686 -33.105 48.254 1.00 80.03  ? 506 LYS A CD    1 
ATOM   2084 C CE    . LYS B 1 145 ? 40.133 -33.379 48.650 1.00 77.56  ? 506 LYS A CE    1 
ATOM   2085 N NZ    . LYS B 1 145 ? 40.545 -34.796 48.383 1.00 75.03  ? 506 LYS A NZ    1 
ATOM   2086 N N     . LEU B 1 146 ? 34.053 -32.972 47.277 1.00 61.10  ? 507 LEU A N     1 
ATOM   2087 C CA    . LEU B 1 146 ? 32.630 -32.714 47.218 1.00 58.03  ? 507 LEU A CA    1 
ATOM   2088 C C     . LEU B 1 146 ? 32.194 -32.129 45.875 1.00 66.86  ? 507 LEU A C     1 
ATOM   2089 O O     . LEU B 1 146 ? 32.875 -31.272 45.302 1.00 64.21  ? 507 LEU A O     1 
ATOM   2090 C CB    . LEU B 1 146 ? 32.262 -31.743 48.333 1.00 60.04  ? 507 LEU A CB    1 
ATOM   2091 C CG    . LEU B 1 146 ? 30.856 -31.846 48.900 1.00 82.26  ? 507 LEU A CG    1 
ATOM   2092 C CD1   . LEU B 1 146 ? 30.727 -33.144 49.701 1.00 86.23  ? 507 LEU A CD1   1 
ATOM   2093 C CD2   . LEU B 1 146 ? 30.557 -30.628 49.758 1.00 68.98  ? 507 LEU A CD2   1 
ATOM   2094 N N     . VAL B 1 147 ? 31.049 -32.597 45.383 1.00 67.56  ? 508 VAL A N     1 
ATOM   2095 C CA    . VAL B 1 147 ? 30.438 -32.058 44.172 1.00 52.21  ? 508 VAL A CA    1 
ATOM   2096 C C     . VAL B 1 147 ? 28.959 -31.800 44.411 1.00 51.19  ? 508 VAL A C     1 
ATOM   2097 O O     . VAL B 1 147 ? 28.277 -32.627 44.991 1.00 65.75  ? 508 VAL A O     1 
ATOM   2098 C CB    . VAL B 1 147 ? 30.576 -33.037 43.002 1.00 54.27  ? 508 VAL A CB    1 
ATOM   2099 C CG1   . VAL B 1 147 ? 30.000 -32.435 41.734 1.00 50.08  ? 508 VAL A CG1   1 
ATOM   2100 C CG2   . VAL B 1 147 ? 32.023 -33.423 42.804 1.00 38.92  ? 508 VAL A CG2   1 
ATOM   2101 N N     . PHE B 1 148 ? 28.466 -30.650 43.984 1.00 48.92  ? 509 PHE A N     1 
ATOM   2102 C CA    . PHE B 1 148 ? 27.036 -30.381 44.043 1.00 48.89  ? 509 PHE A CA    1 
ATOM   2103 C C     . PHE B 1 148 ? 26.278 -30.868 42.795 1.00 56.00  ? 509 PHE A C     1 
ATOM   2104 O O     . PHE B 1 148 ? 26.805 -30.881 41.673 1.00 43.95  ? 509 PHE A O     1 
ATOM   2105 C CB    . PHE B 1 148 ? 26.787 -28.893 44.225 1.00 48.94  ? 509 PHE A CB    1 
ATOM   2106 C CG    . PHE B 1 148 ? 27.420 -28.323 45.457 1.00 65.96  ? 509 PHE A CG    1 
ATOM   2107 C CD1   . PHE B 1 148 ? 26.956 -28.671 46.714 1.00 69.06  ? 509 PHE A CD1   1 
ATOM   2108 C CD2   . PHE B 1 148 ? 28.466 -27.418 45.363 1.00 63.01  ? 509 PHE A CD2   1 
ATOM   2109 C CE1   . PHE B 1 148 ? 27.535 -28.141 47.851 1.00 69.88  ? 509 PHE A CE1   1 
ATOM   2110 C CE2   . PHE B 1 148 ? 29.046 -26.884 46.500 1.00 67.35  ? 509 PHE A CE2   1 
ATOM   2111 C CZ    . PHE B 1 148 ? 28.581 -27.247 47.744 1.00 60.43  ? 509 PHE A CZ    1 
ATOM   2112 N N     . LYS B 1 149 ? 25.025 -31.255 43.012 1.00 54.01  ? 510 LYS A N     1 
ATOM   2113 C CA    . LYS B 1 149 ? 24.128 -31.668 41.944 1.00 43.21  ? 510 LYS A CA    1 
ATOM   2114 C C     . LYS B 1 149 ? 22.822 -30.930 42.118 1.00 42.16  ? 510 LYS A C     1 
ATOM   2115 O O     . LYS B 1 149 ? 22.293 -30.843 43.217 1.00 47.25  ? 510 LYS A O     1 
ATOM   2116 C CB    . LYS B 1 149 ? 23.873 -33.170 42.016 1.00 48.93  ? 510 LYS A CB    1 
ATOM   2117 C CG    . LYS B 1 149 ? 25.101 -34.015 41.795 1.00 40.94  ? 510 LYS A CG    1 
ATOM   2118 C CD    . LYS B 1 149 ? 25.496 -33.965 40.350 1.00 40.47  ? 510 LYS A CD    1 
ATOM   2119 C CE    . LYS B 1 149 ? 26.703 -34.835 40.091 1.00 42.34  ? 510 LYS A CE    1 
ATOM   2120 N NZ    . LYS B 1 149 ? 27.058 -34.844 38.650 1.00 56.53  ? 510 LYS A NZ    1 
ATOM   2121 N N     . PHE B 1 150 ? 22.302 -30.392 41.026 1.00 54.40  ? 511 PHE A N     1 
ATOM   2122 C CA    . PHE B 1 150 ? 21.042 -29.663 41.069 1.00 50.21  ? 511 PHE A CA    1 
ATOM   2123 C C     . PHE B 1 150 ? 20.027 -30.336 40.184 1.00 47.75  ? 511 PHE A C     1 
ATOM   2124 O O     . PHE B 1 150 ? 20.283 -30.601 39.013 1.00 51.42  ? 511 PHE A O     1 
ATOM   2125 C CB    . PHE B 1 150 ? 21.247 -28.209 40.643 1.00 43.89  ? 511 PHE A CB    1 
ATOM   2126 C CG    . PHE B 1 150 ? 22.240 -27.487 41.491 1.00 52.51  ? 511 PHE A CG    1 
ATOM   2127 C CD1   . PHE B 1 150 ? 21.836 -26.799 42.622 1.00 53.87  ? 511 PHE A CD1   1 
ATOM   2128 C CD2   . PHE B 1 150 ? 23.588 -27.535 41.186 1.00 55.69  ? 511 PHE A CD2   1 
ATOM   2129 C CE1   . PHE B 1 150 ? 22.753 -26.152 43.413 1.00 54.26  ? 511 PHE A CE1   1 
ATOM   2130 C CE2   . PHE B 1 150 ? 24.511 -26.887 41.975 1.00 52.59  ? 511 PHE A CE2   1 
ATOM   2131 C CZ    . PHE B 1 150 ? 24.096 -26.195 43.087 1.00 55.95  ? 511 PHE A CZ    1 
ATOM   2132 N N     . LYS B 1 151 ? 18.874 -30.626 40.760 1.00 43.91  ? 512 LYS A N     1 
ATOM   2133 C CA    . LYS B 1 151 ? 17.793 -31.221 40.004 1.00 46.43  ? 512 LYS A CA    1 
ATOM   2134 C C     . LYS B 1 151 ? 16.856 -30.131 39.476 1.00 50.73  ? 512 LYS A C     1 
ATOM   2135 O O     . LYS B 1 151 ? 16.213 -29.416 40.246 1.00 56.61  ? 512 LYS A O     1 
ATOM   2136 C CB    . LYS B 1 151 ? 17.048 -32.218 40.887 1.00 43.86  ? 512 LYS A CB    1 
ATOM   2137 C CG    . LYS B 1 151 ? 15.871 -32.886 40.235 1.00 53.77  ? 512 LYS A CG    1 
ATOM   2138 C CD    . LYS B 1 151 ? 15.261 -33.900 41.177 1.00 54.32  ? 512 LYS A CD    1 
ATOM   2139 C CE    . LYS B 1 151 ? 13.753 -33.940 41.029 1.00 67.84  ? 512 LYS A CE    1 
ATOM   2140 N NZ    . LYS B 1 151 ? 13.145 -34.701 42.145 1.00 75.70  ? 512 LYS A NZ    1 
ATOM   2141 N N     . LEU B 1 152 ? 16.796 -29.982 38.162 1.00 38.79  ? 513 LEU A N     1 
ATOM   2142 C CA    . LEU B 1 152 ? 15.900 -28.992 37.586 1.00 44.91  ? 513 LEU A CA    1 
ATOM   2143 C C     . LEU B 1 152 ? 14.796 -29.673 36.817 1.00 53.60  ? 513 LEU A C     1 
ATOM   2144 O O     . LEU B 1 152 ? 15.027 -30.699 36.181 1.00 52.73  ? 513 LEU A O     1 
ATOM   2145 C CB    . LEU B 1 152 ? 16.642 -28.036 36.658 1.00 43.18  ? 513 LEU A CB    1 
ATOM   2146 C CG    . LEU B 1 152 ? 17.542 -27.020 37.356 1.00 52.55  ? 513 LEU A CG    1 
ATOM   2147 C CD1   . LEU B 1 152 ? 18.892 -27.649 37.732 1.00 48.03  ? 513 LEU A CD1   1 
ATOM   2148 C CD2   . LEU B 1 152 ? 17.715 -25.809 36.468 1.00 38.38  ? 513 LEU A CD2   1 
ATOM   2149 N N     . ARG B 1 153 ? 13.595 -29.106 36.879 1.00 51.86  ? 514 ARG A N     1 
ATOM   2150 C CA    . ARG B 1 153 ? 12.473 -29.657 36.136 1.00 48.20  ? 514 ARG A CA    1 
ATOM   2151 C C     . ARG B 1 153 ? 11.885 -28.628 35.185 1.00 48.72  ? 514 ARG A C     1 
ATOM   2152 O O     . ARG B 1 153 ? 11.688 -27.472 35.544 1.00 53.60  ? 514 ARG A O     1 
ATOM   2153 C CB    . ARG B 1 153 ? 11.391 -30.177 37.080 1.00 51.53  ? 514 ARG A CB    1 
ATOM   2154 C CG    . ARG B 1 153 ? 10.291 -30.937 36.357 1.00 54.23  ? 514 ARG A CG    1 
ATOM   2155 C CD    . ARG B 1 153 ? 9.206  -31.399 37.311 1.00 46.41  ? 514 ARG A CD    1 
ATOM   2156 N NE    . ARG B 1 153 ? 9.634  -32.485 38.192 1.00 45.46  ? 514 ARG A NE    1 
ATOM   2157 C CZ    . ARG B 1 153 ? 9.590  -33.775 37.864 1.00 48.36  ? 514 ARG A CZ    1 
ATOM   2158 N NH1   . ARG B 1 153 ? 9.154  -34.147 36.665 1.00 42.93  ? 514 ARG A NH1   1 
ATOM   2159 N NH2   . ARG B 1 153 ? 9.986  -34.699 38.732 1.00 49.14  ? 514 ARG A NH2   1 
ATOM   2160 N N     . ARG B 1 154 ? 11.613 -29.055 33.961 1.00 46.54  ? 515 ARG A N     1 
ATOM   2161 C CA    . ARG B 1 154 ? 11.065 -28.157 32.951 1.00 50.98  ? 515 ARG A CA    1 
ATOM   2162 C C     . ARG B 1 154 ? 9.637  -27.737 33.289 1.00 56.07  ? 515 ARG A C     1 
ATOM   2163 O O     . ARG B 1 154 ? 8.769  -28.576 33.552 1.00 58.02  ? 515 ARG A O     1 
ATOM   2164 C CB    . ARG B 1 154 ? 11.092 -28.827 31.576 1.00 43.16  ? 515 ARG A CB    1 
ATOM   2165 C CG    . ARG B 1 154 ? 11.015 -27.857 30.419 1.00 47.17  ? 515 ARG A CG    1 
ATOM   2166 C CD    . ARG B 1 154 ? 11.041 -28.604 29.106 1.00 43.97  ? 515 ARG A CD    1 
ATOM   2167 N NE    . ARG B 1 154 ? 11.465 -27.762 27.991 1.00 49.25  ? 515 ARG A NE    1 
ATOM   2168 C CZ    . ARG B 1 154 ? 10.752 -27.565 26.886 1.00 53.66  ? 515 ARG A CZ    1 
ATOM   2169 N NH1   . ARG B 1 154 ? 9.569  -28.143 26.743 1.00 53.56  ? 515 ARG A NH1   1 
ATOM   2170 N NH2   . ARG B 1 154 ? 11.226 -26.798 25.912 1.00 57.01  ? 515 ARG A NH2   1 
ATOM   2171 N N     . ILE B 1 155 ? 9.393  -26.433 33.277 1.00 56.07  ? 516 ILE A N     1 
ATOM   2172 C CA    . ILE B 1 155 ? 8.049  -25.923 33.496 1.00 57.01  ? 516 ILE A CA    1 
ATOM   2173 C C     . ILE B 1 155 ? 7.138  -26.417 32.378 1.00 58.06  ? 516 ILE A C     1 
ATOM   2174 O O     . ILE B 1 155 ? 7.452  -26.245 31.195 1.00 53.77  ? 516 ILE A O     1 
ATOM   2175 C CB    . ILE B 1 155 ? 8.033  -24.389 33.532 1.00 60.48  ? 516 ILE A CB    1 
ATOM   2176 C CG1   . ILE B 1 155 ? 8.880  -23.881 34.702 1.00 58.65  ? 516 ILE A CG1   1 
ATOM   2177 C CG2   . ILE B 1 155 ? 6.608  -23.882 33.653 1.00 56.53  ? 516 ILE A CG2   1 
ATOM   2178 C CD1   . ILE B 1 155 ? 9.339  -22.450 34.557 1.00 49.38  ? 516 ILE A CD1   1 
ATOM   2179 N N     . PRO B 1 156 ? 6.011  -27.051 32.751 1.00 57.62  ? 517 PRO A N     1 
ATOM   2180 C CA    . PRO B 1 156 ? 5.019  -27.603 31.810 1.00 49.30  ? 517 PRO A CA    1 
ATOM   2181 C C     . PRO B 1 156 ? 4.455  -26.553 30.854 1.00 52.57  ? 517 PRO A C     1 
ATOM   2182 O O     . PRO B 1 156 ? 4.480  -25.353 31.150 1.00 64.94  ? 517 PRO A O     1 
ATOM   2183 C CB    . PRO B 1 156 ? 3.905  -28.098 32.728 1.00 45.27  ? 517 PRO A CB    1 
ATOM   2184 C CG    . PRO B 1 156 ? 4.577  -28.335 34.065 1.00 45.02  ? 517 PRO A CG    1 
ATOM   2185 C CD    . PRO B 1 156 ? 5.641  -27.286 34.160 1.00 53.89  ? 517 PRO A CD    1 
ATOM   2186 N N     . GLY B 1 157 ? 3.961  -26.999 29.706 1.00 51.11  ? 518 GLY A N     1 
ATOM   2187 C CA    . GLY B 1 157 ? 3.243  -26.106 28.815 1.00 47.59  ? 518 GLY A CA    1 
ATOM   2188 C C     . GLY B 1 157 ? 4.043  -25.494 27.678 1.00 60.95  ? 518 GLY A C     1 
ATOM   2189 O O     . GLY B 1 157 ? 3.478  -24.829 26.804 1.00 70.09  ? 518 GLY A O     1 
ATOM   2190 N N     . GLN B 1 158 ? 5.351  -25.716 27.668 1.00 52.48  ? 519 GLN A N     1 
ATOM   2191 C CA    . GLN B 1 158 ? 6.195  -25.091 26.656 1.00 50.55  ? 519 GLN A CA    1 
ATOM   2192 C C     . GLN B 1 158 ? 6.340  -25.989 25.440 1.00 53.41  ? 519 GLN A C     1 
ATOM   2193 O O     . GLN B 1 158 ? 6.175  -27.205 25.529 1.00 62.33  ? 519 GLN A O     1 
ATOM   2194 C CB    . GLN B 1 158 ? 7.580  -24.763 27.227 1.00 55.47  ? 519 GLN A CB    1 
ATOM   2195 C CG    . GLN B 1 158 ? 7.555  -24.193 28.639 1.00 52.55  ? 519 GLN A CG    1 
ATOM   2196 C CD    . GLN B 1 158 ? 8.946  -23.922 29.206 1.00 60.61  ? 519 GLN A CD    1 
ATOM   2197 O OE1   . GLN B 1 158 ? 9.732  -23.161 28.629 1.00 61.13  ? 519 GLN A OE1   1 
ATOM   2198 N NE2   . GLN B 1 158 ? 9.245  -24.526 30.356 1.00 55.75  ? 519 GLN A NE2   1 
ATOM   2199 N N     . PRO B 1 159 ? 6.647  -25.388 24.292 1.00 52.76  ? 520 PRO A N     1 
ATOM   2200 C CA    . PRO B 1 159 ? 6.925  -26.155 23.074 1.00 62.82  ? 520 PRO A CA    1 
ATOM   2201 C C     . PRO B 1 159 ? 7.922  -27.280 23.340 1.00 59.87  ? 520 PRO A C     1 
ATOM   2202 O O     . PRO B 1 159 ? 8.679  -27.210 24.306 1.00 63.00  ? 520 PRO A O     1 
ATOM   2203 C CB    . PRO B 1 159 ? 7.555  -25.114 22.139 1.00 57.09  ? 520 PRO A CB    1 
ATOM   2204 C CG    . PRO B 1 159 ? 6.971  -23.810 22.586 1.00 61.66  ? 520 PRO A CG    1 
ATOM   2205 C CD    . PRO B 1 159 ? 6.721  -23.932 24.077 1.00 59.57  ? 520 PRO A CD    1 
ATOM   2206 N N     . GLU B 1 160 ? 7.916  -28.299 22.488 1.00 72.89  ? 521 GLU A N     1 
ATOM   2207 C CA    . GLU B 1 160 ? 8.891  -29.382 22.566 1.00 75.49  ? 521 GLU A CA    1 
ATOM   2208 C C     . GLU B 1 160 ? 10.053 -29.094 21.626 1.00 80.52  ? 521 GLU A C     1 
ATOM   2209 O O     . GLU B 1 160 ? 9.955  -28.224 20.761 1.00 88.79  ? 521 GLU A O     1 
ATOM   2210 C CB    . GLU B 1 160 ? 8.238  -30.715 22.208 1.00 68.06  ? 521 GLU A CB    1 
ATOM   2211 N N     . LEU B 1 161 ? 11.152 -29.821 21.783 1.00 87.55  ? 522 LEU A N     1 
ATOM   2212 C CA    . LEU B 1 161 ? 12.286 -29.641 20.878 1.00 96.16  ? 522 LEU A CA    1 
ATOM   2213 C C     . LEU B 1 161 ? 12.122 -30.401 19.566 1.00 105.57 ? 522 LEU A C     1 
ATOM   2214 O O     . LEU B 1 161 ? 11.688 -31.555 19.557 1.00 114.25 ? 522 LEU A O     1 
ATOM   2215 C CB    . LEU B 1 161 ? 13.607 -30.049 21.532 1.00 91.39  ? 522 LEU A CB    1 
ATOM   2216 C CG    . LEU B 1 161 ? 14.269 -29.058 22.492 1.00 90.95  ? 522 LEU A CG    1 
ATOM   2217 C CD1   . LEU B 1 161 ? 15.774 -29.278 22.681 1.00 91.12  ? 522 LEU A CD1   1 
ATOM   2218 C CD2   . LEU B 1 161 ? 13.904 -27.594 22.275 1.00 68.17  ? 522 LEU A CD2   1 
ATOM   2219 N N     . PRO B 1 162 ? 12.484 -29.748 18.452 1.00 106.30 ? 523 PRO A N     1 
ATOM   2220 C CA    . PRO B 1 162 ? 12.484 -30.317 17.099 1.00 107.91 ? 523 PRO A CA    1 
ATOM   2221 C C     . PRO B 1 162 ? 13.360 -31.564 16.985 1.00 112.16 ? 523 PRO A C     1 
ATOM   2222 O O     . PRO B 1 162 ? 14.139 -31.839 17.897 1.00 119.27 ? 523 PRO A O     1 
ATOM   2223 C CB    . PRO B 1 162 ? 13.080 -29.192 16.255 1.00 114.89 ? 523 PRO A CB    1 
ATOM   2224 C CG    . PRO B 1 162 ? 12.775 -27.945 17.012 1.00 101.18 ? 523 PRO A CG    1 
ATOM   2225 C CD    . PRO B 1 162 ? 12.854 -28.322 18.453 1.00 102.40 ? 523 PRO A CD    1 
ATOM   2226 N N     . TRP B 1 163 ? 13.230 -32.294 15.878 1.00 118.15 ? 524 TRP A N     1 
ATOM   2227 C CA    . TRP B 1 163 ? 14.011 -33.512 15.628 1.00 129.09 ? 524 TRP A CA    1 
ATOM   2228 C C     . TRP B 1 163 ? 13.804 -34.594 16.697 1.00 145.50 ? 524 TRP A C     1 
ATOM   2229 O O     . TRP B 1 163 ? 13.746 -34.338 17.906 1.00 137.89 ? 524 TRP A O     1 
ATOM   2230 C CB    . TRP B 1 163 ? 15.506 -33.186 15.459 1.00 122.49 ? 524 TRP A CB    1 
ATOM   2231 C CG    . TRP B 1 163 ? 16.428 -34.396 15.443 1.00 126.88 ? 524 TRP A CG    1 
ATOM   2232 C CD1   . TRP B 1 163 ? 16.632 -35.284 16.463 1.00 130.29 ? 524 TRP A CD1   1 
ATOM   2233 C CD2   . TRP B 1 163 ? 17.281 -34.826 14.369 1.00 128.60 ? 524 TRP A CD2   1 
ATOM   2234 N NE1   . TRP B 1 163 ? 17.543 -36.243 16.087 1.00 127.40 ? 524 TRP A NE1   1 
ATOM   2235 C CE2   . TRP B 1 163 ? 17.959 -35.985 14.808 1.00 121.01 ? 524 TRP A CE2   1 
ATOM   2236 C CE3   . TRP B 1 163 ? 17.534 -34.347 13.079 1.00 127.33 ? 524 TRP A CE3   1 
ATOM   2237 C CZ2   . TRP B 1 163 ? 18.871 -36.671 14.007 1.00 115.58 ? 524 TRP A CZ2   1 
ATOM   2238 C CZ3   . TRP B 1 163 ? 18.443 -35.031 12.282 1.00 116.57 ? 524 TRP A CZ3   1 
ATOM   2239 C CH2   . TRP B 1 163 ? 19.098 -36.181 12.750 1.00 122.55 ? 524 TRP A CH2   1 
ATOM   2240 O "O5'" . DC  C 2 1   ? 44.690 -2.982  36.808 1.00 121.67 ? 1   DC  B "O5'" 1 
ATOM   2241 C "C5'" . DC  C 2 1   ? 45.251 -4.289  36.654 1.00 133.12 ? 1   DC  B "C5'" 1 
ATOM   2242 C "C4'" . DC  C 2 1   ? 45.641 -4.899  37.992 1.00 136.79 ? 1   DC  B "C4'" 1 
ATOM   2243 O "O4'" . DC  C 2 1   ? 44.464 -5.014  38.827 1.00 126.92 ? 1   DC  B "O4'" 1 
ATOM   2244 C "C3'" . DC  C 2 1   ? 46.125 -6.338  37.949 1.00 133.20 ? 1   DC  B "C3'" 1 
ATOM   2245 O "O3'" . DC  C 2 1   ? 46.565 -6.692  39.255 1.00 142.61 ? 1   DC  B "O3'" 1 
ATOM   2246 C "C2'" . DC  C 2 1   ? 44.801 -7.014  37.624 1.00 125.39 ? 1   DC  B "C2'" 1 
ATOM   2247 C "C1'" . DC  C 2 1   ? 43.913 -6.308  38.647 1.00 124.95 ? 1   DC  B "C1'" 1 
ATOM   2248 N N1    . DC  C 2 1   ? 42.495 -6.106  38.242 1.00 116.65 ? 1   DC  B N1    1 
ATOM   2249 C C2    . DC  C 2 1   ? 41.520 -7.085  38.496 1.00 107.70 ? 1   DC  B C2    1 
ATOM   2250 O O2    . DC  C 2 1   ? 41.828 -8.150  39.053 1.00 94.90  ? 1   DC  B O2    1 
ATOM   2251 N N3    . DC  C 2 1   ? 40.244 -6.830  38.110 1.00 102.18 ? 1   DC  B N3    1 
ATOM   2252 C C4    . DC  C 2 1   ? 39.935 -5.674  37.514 1.00 93.89  ? 1   DC  B C4    1 
ATOM   2253 N N4    . DC  C 2 1   ? 38.663 -5.471  37.165 1.00 89.13  ? 1   DC  B N4    1 
ATOM   2254 C C5    . DC  C 2 1   ? 40.912 -4.671  37.250 1.00 95.06  ? 1   DC  B C5    1 
ATOM   2255 C C6    . DC  C 2 1   ? 42.164 -4.929  37.633 1.00 108.90 ? 1   DC  B C6    1 
ATOM   2256 P P     . DT  C 2 2   ? 47.084 -8.165  39.612 1.00 161.62 ? 2   DT  B P     1 
ATOM   2257 O OP1   . DT  C 2 2   ? 47.464 -8.149  41.046 1.00 140.98 ? 2   DT  B OP1   1 
ATOM   2258 O OP2   . DT  C 2 2   ? 48.065 -8.579  38.581 1.00 125.29 ? 2   DT  B OP2   1 
ATOM   2259 O "O5'" . DT  C 2 2   ? 45.784 -9.087  39.446 1.00 141.28 ? 2   DT  B "O5'" 1 
ATOM   2260 C "C5'" . DT  C 2 2   ? 44.989 -9.412  40.587 1.00 136.45 ? 2   DT  B "C5'" 1 
ATOM   2261 C "C4'" . DT  C 2 2   ? 44.635 -10.889 40.554 1.00 129.48 ? 2   DT  B "C4'" 1 
ATOM   2262 O "O4'" . DT  C 2 2   ? 43.281 -11.092 40.075 1.00 128.36 ? 2   DT  B "O4'" 1 
ATOM   2263 C "C3'" . DT  C 2 2   ? 45.526 -11.735 39.650 1.00 124.07 ? 2   DT  B "C3'" 1 
ATOM   2264 O "O3'" . DT  C 2 2   ? 45.730 -13.004 40.274 1.00 122.89 ? 2   DT  B "O3'" 1 
ATOM   2265 C "C2'" . DT  C 2 2   ? 44.725 -11.806 38.348 1.00 112.03 ? 2   DT  B "C2'" 1 
ATOM   2266 C "C1'" . DT  C 2 2   ? 43.289 -11.832 38.862 1.00 119.44 ? 2   DT  B "C1'" 1 
ATOM   2267 N N1    . DT  C 2 2   ? 42.308 -11.164 37.968 1.00 110.18 ? 2   DT  B N1    1 
ATOM   2268 C C2    . DT  C 2 2   ? 40.983 -11.575 37.973 1.00 101.06 ? 2   DT  B C2    1 
ATOM   2269 O O2    . DT  C 2 2   ? 40.547 -12.485 38.668 1.00 84.72  ? 2   DT  B O2    1 
ATOM   2270 N N3    . DT  C 2 2   ? 40.178 -10.863 37.116 1.00 92.88  ? 2   DT  B N3    1 
ATOM   2271 C C4    . DT  C 2 2   ? 40.560 -9.814  36.291 1.00 92.49  ? 2   DT  B C4    1 
ATOM   2272 O O4    . DT  C 2 2   ? 39.776 -9.227  35.555 1.00 85.68  ? 2   DT  B O4    1 
ATOM   2273 C C5    . DT  C 2 2   ? 41.949 -9.442  36.341 1.00 106.03 ? 2   DT  B C5    1 
ATOM   2274 C C7    . DT  C 2 2   ? 42.447 -8.322  35.474 1.00 97.56  ? 2   DT  B C7    1 
ATOM   2275 C C6    . DT  C 2 2   ? 42.750 -10.125 37.170 1.00 102.32 ? 2   DT  B C6    1 
ATOM   2276 P P     . DG  C 2 3   ? 46.045 -14.323 39.422 1.00 127.00 ? 3   DG  B P     1 
ATOM   2277 O OP1   . DG  C 2 3   ? 46.763 -15.276 40.300 1.00 107.84 ? 3   DG  B OP1   1 
ATOM   2278 O OP2   . DG  C 2 3   ? 46.637 -13.916 38.126 1.00 124.33 ? 3   DG  B OP2   1 
ATOM   2279 O "O5'" . DG  C 2 3   ? 44.585 -14.912 39.134 1.00 110.37 ? 3   DG  B "O5'" 1 
ATOM   2280 C "C5'" . DG  C 2 3   ? 43.900 -15.647 40.146 1.00 107.96 ? 3   DG  B "C5'" 1 
ATOM   2281 C "C4'" . DG  C 2 3   ? 42.775 -16.489 39.565 1.00 105.56 ? 3   DG  B "C4'" 1 
ATOM   2282 O "O4'" . DG  C 2 3   ? 41.946 -15.675 38.695 1.00 105.17 ? 3   DG  B "O4'" 1 
ATOM   2283 C "C3'" . DG  C 2 3   ? 43.181 -17.642 38.655 1.00 95.85  ? 3   DG  B "C3'" 1 
ATOM   2284 O "O3'" . DG  C 2 3   ? 42.056 -18.487 38.482 1.00 94.63  ? 3   DG  B "O3'" 1 
ATOM   2285 C "C2'" . DG  C 2 3   ? 43.384 -16.891 37.354 1.00 91.76  ? 3   DG  B "C2'" 1 
ATOM   2286 C "C1'" . DG  C 2 3   ? 42.012 -16.241 37.401 1.00 82.90  ? 3   DG  B "C1'" 1 
ATOM   2287 N N9    . DG  C 2 3   ? 41.747 -15.193 36.432 1.00 81.66  ? 3   DG  B N9    1 
ATOM   2288 C C8    . DG  C 2 3   ? 42.615 -14.506 35.617 1.00 82.02  ? 3   DG  B C8    1 
ATOM   2289 N N7    . DG  C 2 3   ? 42.004 -13.623 34.871 1.00 90.30  ? 3   DG  B N7    1 
ATOM   2290 C C5    . DG  C 2 3   ? 40.661 -13.739 35.227 1.00 80.67  ? 3   DG  B C5    1 
ATOM   2291 C C6    . DG  C 2 3   ? 39.518 -13.047 34.765 1.00 82.08  ? 3   DG  B C6    1 
ATOM   2292 O O6    . DG  C 2 3   ? 39.479 -12.154 33.904 1.00 76.59  ? 3   DG  B O6    1 
ATOM   2293 N N1    . DG  C 2 3   ? 38.352 -13.489 35.402 1.00 82.75  ? 3   DG  B N1    1 
ATOM   2294 C C2    . DG  C 2 3   ? 38.301 -14.481 36.367 1.00 90.15  ? 3   DG  B C2    1 
ATOM   2295 N N2    . DG  C 2 3   ? 37.101 -14.803 36.884 1.00 76.98  ? 3   DG  B N2    1 
ATOM   2296 N N3    . DG  C 2 3   ? 39.368 -15.133 36.801 1.00 88.92  ? 3   DG  B N3    1 
ATOM   2297 C C4    . DG  C 2 3   ? 40.496 -14.703 36.186 1.00 79.32  ? 3   DG  B C4    1 
ATOM   2298 P P     . DA  C 2 4   ? 41.809 -19.755 39.422 1.00 104.52 ? 4   DA  B P     1 
ATOM   2299 O OP1   . DA  C 2 4   ? 42.194 -19.409 40.818 1.00 84.92  ? 4   DA  B OP1   1 
ATOM   2300 O OP2   . DA  C 2 4   ? 42.423 -20.904 38.703 1.00 80.95  ? 4   DA  B OP2   1 
ATOM   2301 O "O5'" . DA  C 2 4   ? 40.215 -19.919 39.387 1.00 85.75  ? 4   DA  B "O5'" 1 
ATOM   2302 C "C5'" . DA  C 2 4   ? 39.361 -19.054 40.133 1.00 71.73  ? 4   DA  B "C5'" 1 
ATOM   2303 C "C4'" . DA  C 2 4   ? 37.938 -19.139 39.610 1.00 66.33  ? 4   DA  B "C4'" 1 
ATOM   2304 O "O4'" . DA  C 2 4   ? 37.766 -18.437 38.352 1.00 81.54  ? 4   DA  B "O4'" 1 
ATOM   2305 C "C3'" . DA  C 2 4   ? 37.443 -20.532 39.277 1.00 65.99  ? 4   DA  B "C3'" 1 
ATOM   2306 O "O3'" . DA  C 2 4   ? 36.057 -20.427 39.279 1.00 68.47  ? 4   DA  B "O3'" 1 
ATOM   2307 C "C2'" . DA  C 2 4   ? 37.939 -20.755 37.858 1.00 70.42  ? 4   DA  B "C2'" 1 
ATOM   2308 C "C1'" . DA  C 2 4   ? 37.669 -19.367 37.271 1.00 83.79  ? 4   DA  B "C1'" 1 
ATOM   2309 N N9    . DA  C 2 4   ? 38.627 -18.903 36.266 1.00 74.92  ? 4   DA  B N9    1 
ATOM   2310 C C8    . DA  C 2 4   ? 39.931 -19.276 36.120 1.00 70.07  ? 4   DA  B C8    1 
ATOM   2311 N N7    . DA  C 2 4   ? 40.552 -18.665 35.141 1.00 73.74  ? 4   DA  B N7    1 
ATOM   2312 C C5    . DA  C 2 4   ? 39.595 -17.822 34.623 1.00 68.06  ? 4   DA  B C5    1 
ATOM   2313 C C6    . DA  C 2 4   ? 39.628 -16.900 33.574 1.00 67.74  ? 4   DA  B C6    1 
ATOM   2314 N N6    . DA  C 2 4   ? 40.718 -16.673 32.838 1.00 68.36  ? 4   DA  B N6    1 
ATOM   2315 N N1    . DA  C 2 4   ? 38.495 -16.220 33.314 1.00 73.91  ? 4   DA  B N1    1 
ATOM   2316 C C2    . DA  C 2 4   ? 37.407 -16.440 34.051 1.00 68.79  ? 4   DA  B C2    1 
ATOM   2317 N N3    . DA  C 2 4   ? 37.261 -17.283 35.067 1.00 84.16  ? 4   DA  B N3    1 
ATOM   2318 C C4    . DA  C 2 4   ? 38.403 -17.949 35.303 1.00 78.20  ? 4   DA  B C4    1 
ATOM   2319 P P     . DG  C 2 5   ? 35.196 -21.750 39.183 1.00 75.00  ? 5   DG  B P     1 
ATOM   2320 O OP1   . DG  C 2 5   ? 33.940 -21.503 39.927 1.00 58.96  ? 5   DG  B OP1   1 
ATOM   2321 O OP2   . DG  C 2 5   ? 36.071 -22.905 39.484 1.00 60.81  ? 5   DG  B OP2   1 
ATOM   2322 O "O5'" . DG  C 2 5   ? 34.848 -21.774 37.625 1.00 70.04  ? 5   DG  B "O5'" 1 
ATOM   2323 C "C5'" . DG  C 2 5   ? 33.952 -20.778 37.147 1.00 68.31  ? 5   DG  B "C5'" 1 
ATOM   2324 C "C4'" . DG  C 2 5   ? 33.942 -20.805 35.640 1.00 62.60  ? 5   DG  B "C4'" 1 
ATOM   2325 O "O4'" . DG  C 2 5   ? 35.148 -20.162 35.166 1.00 77.44  ? 5   DG  B "O4'" 1 
ATOM   2326 C "C3'" . DG  C 2 5   ? 33.985 -22.233 35.116 1.00 65.18  ? 5   DG  B "C3'" 1 
ATOM   2327 O "O3'" . DG  C 2 5   ? 32.794 -22.567 34.432 1.00 74.72  ? 5   DG  B "O3'" 1 
ATOM   2328 C "C2'" . DG  C 2 5   ? 35.173 -22.265 34.178 1.00 56.56  ? 5   DG  B "C2'" 1 
ATOM   2329 C "C1'" . DG  C 2 5   ? 35.416 -20.784 33.947 1.00 59.01  ? 5   DG  B "C1'" 1 
ATOM   2330 N N9    . DG  C 2 5   ? 36.777 -20.631 33.489 1.00 67.00  ? 5   DG  B N9    1 
ATOM   2331 C C8    . DG  C 2 5   ? 37.842 -21.445 33.797 1.00 69.23  ? 5   DG  B C8    1 
ATOM   2332 N N7    . DG  C 2 5   ? 38.945 -21.100 33.191 1.00 73.56  ? 5   DG  B N7    1 
ATOM   2333 C C5    . DG  C 2 5   ? 38.569 -20.004 32.418 1.00 78.69  ? 5   DG  B C5    1 
ATOM   2334 C C6    . DG  C 2 5   ? 39.332 -19.203 31.543 1.00 67.09  ? 5   DG  B C6    1 
ATOM   2335 O O6    . DG  C 2 5   ? 40.530 -19.307 31.260 1.00 72.12  ? 5   DG  B O6    1 
ATOM   2336 N N1    . DG  C 2 5   ? 38.563 -18.196 30.968 1.00 76.70  ? 5   DG  B N1    1 
ATOM   2337 C C2    . DG  C 2 5   ? 37.222 -17.989 31.202 1.00 73.11  ? 5   DG  B C2    1 
ATOM   2338 N N2    . DG  C 2 5   ? 36.654 -16.965 30.546 1.00 81.17  ? 5   DG  B N2    1 
ATOM   2339 N N3    . DG  C 2 5   ? 36.492 -18.723 32.026 1.00 68.32  ? 5   DG  B N3    1 
ATOM   2340 C C4    . DG  C 2 5   ? 37.233 -19.708 32.587 1.00 78.60  ? 5   DG  B C4    1 
ATOM   2341 P P     . DG  C 2 6   ? 32.139 -24.002 34.705 1.00 63.51  ? 6   DG  B P     1 
ATOM   2342 O OP1   . DG  C 2 6   ? 30.682 -23.772 34.746 1.00 59.76  ? 6   DG  B OP1   1 
ATOM   2343 O OP2   . DG  C 2 6   ? 32.802 -24.651 35.849 1.00 69.63  ? 6   DG  B OP2   1 
ATOM   2344 O "O5'" . DG  C 2 6   ? 32.540 -24.821 33.406 1.00 49.43  ? 6   DG  B "O5'" 1 
ATOM   2345 C "C5'" . DG  C 2 6   ? 31.896 -24.366 32.253 1.00 57.88  ? 6   DG  B "C5'" 1 
ATOM   2346 C "C4'" . DG  C 2 6   ? 32.022 -25.276 31.067 1.00 48.73  ? 6   DG  B "C4'" 1 
ATOM   2347 O "O4'" . DG  C 2 6   ? 31.335 -26.516 31.350 1.00 51.86  ? 6   DG  B "O4'" 1 
ATOM   2348 C "C3'" . DG  C 2 6   ? 31.253 -24.670 29.911 1.00 57.74  ? 6   DG  B "C3'" 1 
ATOM   2349 O "O3'" . DG  C 2 6   ? 31.646 -25.278 28.658 1.00 75.44  ? 6   DG  B "O3'" 1 
ATOM   2350 C "C2'" . DG  C 2 6   ? 29.841 -25.064 30.354 1.00 57.19  ? 6   DG  B "C2'" 1 
ATOM   2351 C "C1'" . DG  C 2 6   ? 30.150 -26.541 30.566 1.00 62.97  ? 6   DG  B "C1'" 1 
ATOM   2352 N N9    . DG  C 2 6   ? 29.179 -27.441 31.204 1.00 66.56  ? 6   DG  B N9    1 
ATOM   2353 C C8    . DG  C 2 6   ? 28.566 -28.521 30.617 1.00 63.27  ? 6   DG  B C8    1 
ATOM   2354 N N7    . DG  C 2 6   ? 27.776 -29.180 31.415 1.00 66.33  ? 6   DG  B N7    1 
ATOM   2355 C C5    . DG  C 2 6   ? 27.878 -28.506 32.623 1.00 66.52  ? 6   DG  B C5    1 
ATOM   2356 C C6    . DG  C 2 6   ? 27.258 -28.759 33.873 1.00 71.42  ? 6   DG  B C6    1 
ATOM   2357 O O6    . DG  C 2 6   ? 26.462 -29.657 34.180 1.00 75.39  ? 6   DG  B O6    1 
ATOM   2358 N N1    . DG  C 2 6   ? 27.635 -27.829 34.839 1.00 62.94  ? 6   DG  B N1    1 
ATOM   2359 C C2    . DG  C 2 6   ? 28.506 -26.794 34.623 1.00 63.59  ? 6   DG  B C2    1 
ATOM   2360 N N2    . DG  C 2 6   ? 28.756 -25.998 35.669 1.00 61.41  ? 6   DG  B N2    1 
ATOM   2361 N N3    . DG  C 2 6   ? 29.099 -26.552 33.465 1.00 66.19  ? 6   DG  B N3    1 
ATOM   2362 C C4    . DG  C 2 6   ? 28.741 -27.440 32.510 1.00 66.47  ? 6   DG  B C4    1 
ATOM   2363 P P     . DA  C 2 7   ? 33.106 -25.082 28.005 1.00 72.37  ? 7   DA  B P     1 
ATOM   2364 O OP1   . DA  C 2 7   ? 33.490 -26.322 27.289 1.00 63.16  ? 7   DA  B OP1   1 
ATOM   2365 O OP2   . DA  C 2 7   ? 34.046 -24.538 29.009 1.00 53.20  ? 7   DA  B OP2   1 
ATOM   2366 O "O5'" . DA  C 2 7   ? 32.792 -23.969 26.908 1.00 52.44  ? 7   DA  B "O5'" 1 
ATOM   2367 C "C5'" . DA  C 2 7   ? 32.596 -22.616 27.242 1.00 53.52  ? 7   DA  B "C5'" 1 
ATOM   2368 C "C4'" . DA  C 2 7   ? 33.100 -21.756 26.096 1.00 50.87  ? 7   DA  B "C4'" 1 
ATOM   2369 O "O4'" . DA  C 2 7   ? 34.525 -21.592 26.248 1.00 54.00  ? 7   DA  B "O4'" 1 
ATOM   2370 C "C3'" . DA  C 2 7   ? 32.879 -22.335 24.701 1.00 49.36  ? 7   DA  B "C3'" 1 
ATOM   2371 O "O3'" . DA  C 2 7   ? 32.517 -21.305 23.788 1.00 46.38  ? 7   DA  B "O3'" 1 
ATOM   2372 C "C2'" . DA  C 2 7   ? 34.224 -22.959 24.362 1.00 48.14  ? 7   DA  B "C2'" 1 
ATOM   2373 C "C1'" . DA  C 2 7   ? 35.182 -22.028 25.084 1.00 55.51  ? 7   DA  B "C1'" 1 
ATOM   2374 N N9    . DA  C 2 7   ? 36.398 -22.697 25.504 1.00 62.21  ? 7   DA  B N9    1 
ATOM   2375 C C8    . DA  C 2 7   ? 36.501 -23.734 26.380 1.00 70.08  ? 7   DA  B C8    1 
ATOM   2376 N N7    . DA  C 2 7   ? 37.730 -24.146 26.578 1.00 72.82  ? 7   DA  B N7    1 
ATOM   2377 C C5    . DA  C 2 7   ? 38.481 -23.317 25.772 1.00 76.04  ? 7   DA  B C5    1 
ATOM   2378 C C6    . DA  C 2 7   ? 39.861 -23.248 25.534 1.00 73.43  ? 7   DA  B C6    1 
ATOM   2379 N N6    . DA  C 2 7   ? 40.737 -24.066 26.125 1.00 59.45  ? 7   DA  B N6    1 
ATOM   2380 N N1    . DA  C 2 7   ? 40.292 -22.307 24.665 1.00 76.54  ? 7   DA  B N1    1 
ATOM   2381 C C2    . DA  C 2 7   ? 39.394 -21.496 24.092 1.00 75.99  ? 7   DA  B C2    1 
ATOM   2382 N N3    . DA  C 2 7   ? 38.070 -21.465 24.243 1.00 66.78  ? 7   DA  B N3    1 
ATOM   2383 C C4    . DA  C 2 7   ? 37.678 -22.414 25.103 1.00 69.96  ? 7   DA  B C4    1 
ATOM   2384 P P     . DG  C 2 8   ? 31.968 -21.621 22.310 1.00 56.77  ? 8   DG  B P     1 
ATOM   2385 O OP1   . DG  C 2 8   ? 31.280 -20.409 21.817 1.00 48.41  ? 8   DG  B OP1   1 
ATOM   2386 O OP2   . DG  C 2 8   ? 31.267 -22.918 22.268 1.00 61.79  ? 8   DG  B OP2   1 
ATOM   2387 O "O5'" . DG  C 2 8   ? 33.329 -21.809 21.532 1.00 42.01  ? 8   DG  B "O5'" 1 
ATOM   2388 C "C5'" . DG  C 2 8   ? 33.948 -20.638 21.074 1.00 48.05  ? 8   DG  B "C5'" 1 
ATOM   2389 C "C4'" . DG  C 2 8   ? 35.140 -20.977 20.216 1.00 52.18  ? 8   DG  B "C4'" 1 
ATOM   2390 O "O4'" . DG  C 2 8   ? 36.141 -21.576 21.059 1.00 48.00  ? 8   DG  B "O4'" 1 
ATOM   2391 C "C3'" . DG  C 2 8   ? 34.853 -21.961 19.088 1.00 44.92  ? 8   DG  B "C3'" 1 
ATOM   2392 O "O3'" . DG  C 2 8   ? 35.297 -21.419 17.849 1.00 63.94  ? 8   DG  B "O3'" 1 
ATOM   2393 C "C2'" . DG  C 2 8   ? 35.654 -23.193 19.484 1.00 57.33  ? 8   DG  B "C2'" 1 
ATOM   2394 C "C1'" . DG  C 2 8   ? 36.755 -22.617 20.354 1.00 51.42  ? 8   DG  B "C1'" 1 
ATOM   2395 N N9    . DG  C 2 8   ? 37.232 -23.562 21.340 1.00 58.07  ? 8   DG  B N9    1 
ATOM   2396 C C8    . DG  C 2 8   ? 36.489 -24.344 22.192 1.00 73.41  ? 8   DG  B C8    1 
ATOM   2397 N N7    . DG  C 2 8   ? 37.213 -25.095 22.982 1.00 72.06  ? 8   DG  B N7    1 
ATOM   2398 C C5    . DG  C 2 8   ? 38.510 -24.786 22.615 1.00 62.83  ? 8   DG  B C5    1 
ATOM   2399 C C6    . DG  C 2 8   ? 39.722 -25.288 23.108 1.00 73.14  ? 8   DG  B C6    1 
ATOM   2400 O O6    . DG  C 2 8   ? 39.898 -26.132 23.997 1.00 92.00  ? 8   DG  B O6    1 
ATOM   2401 N N1    . DG  C 2 8   ? 40.801 -24.706 22.455 1.00 81.68  ? 8   DG  B N1    1 
ATOM   2402 C C2    . DG  C 2 8   ? 40.709 -23.762 21.458 1.00 76.70  ? 8   DG  B C2    1 
ATOM   2403 N N2    . DG  C 2 8   ? 41.862 -23.318 20.945 1.00 80.48  ? 8   DG  B N2    1 
ATOM   2404 N N3    . DG  C 2 8   ? 39.573 -23.282 20.987 1.00 63.37  ? 8   DG  B N3    1 
ATOM   2405 C C4    . DG  C 2 8   ? 38.531 -23.845 21.614 1.00 59.76  ? 8   DG  B C4    1 
ATOM   2406 P P     . DT  C 2 9   ? 35.145 -22.250 16.488 1.00 63.55  ? 9   DT  B P     1 
ATOM   2407 O OP1   . DT  C 2 9   ? 34.906 -21.289 15.390 1.00 55.48  ? 9   DT  B OP1   1 
ATOM   2408 O OP2   . DT  C 2 9   ? 34.215 -23.368 16.738 1.00 63.88  ? 9   DT  B OP2   1 
ATOM   2409 O "O5'" . DT  C 2 9   ? 36.592 -22.867 16.291 1.00 52.24  ? 9   DT  B "O5'" 1 
ATOM   2410 C "C5'" . DT  C 2 9   ? 37.657 -21.982 16.021 1.00 63.60  ? 9   DT  B "C5'" 1 
ATOM   2411 C "C4'" . DT  C 2 9   ? 38.908 -22.814 15.871 1.00 71.83  ? 9   DT  B "C4'" 1 
ATOM   2412 O "O4'" . DT  C 2 9   ? 39.219 -23.475 17.120 1.00 72.25  ? 9   DT  B "O4'" 1 
ATOM   2413 C "C3'" . DT  C 2 9   ? 38.765 -23.939 14.859 1.00 82.10  ? 9   DT  B "C3'" 1 
ATOM   2414 O "O3'" . DT  C 2 9   ? 39.984 -24.035 14.179 1.00 95.42  ? 9   DT  B "O3'" 1 
ATOM   2415 C "C2'" . DT  C 2 9   ? 38.541 -25.167 15.726 1.00 74.76  ? 9   DT  B "C2'" 1 
ATOM   2416 C "C1'" . DT  C 2 9   ? 39.524 -24.816 16.824 1.00 74.13  ? 9   DT  B "C1'" 1 
ATOM   2417 N N1    . DT  C 2 9   ? 39.386 -25.661 18.032 1.00 74.45  ? 9   DT  B N1    1 
ATOM   2418 C C2    . DT  C 2 9   ? 40.527 -25.984 18.722 1.00 75.07  ? 9   DT  B C2    1 
ATOM   2419 O O2    . DT  C 2 9   ? 41.629 -25.587 18.389 1.00 82.41  ? 9   DT  B O2    1 
ATOM   2420 N N3    . DT  C 2 9   ? 40.328 -26.778 19.816 1.00 72.43  ? 9   DT  B N3    1 
ATOM   2421 C C4    . DT  C 2 9   ? 39.121 -27.266 20.268 1.00 82.80  ? 9   DT  B C4    1 
ATOM   2422 O O4    . DT  C 2 9   ? 39.047 -27.971 21.270 1.00 92.61  ? 9   DT  B O4    1 
ATOM   2423 C C5    . DT  C 2 9   ? 37.965 -26.890 19.489 1.00 69.58  ? 9   DT  B C5    1 
ATOM   2424 C C7    . DT  C 2 9   ? 36.599 -27.363 19.878 1.00 61.08  ? 9   DT  B C7    1 
ATOM   2425 C C6    . DT  C 2 9   ? 38.146 -26.115 18.418 1.00 66.07  ? 9   DT  B C6    1 
ATOM   2426 P P     . DA  C 2 10  ? 40.002 -24.434 12.640 1.00 98.95  ? 10  DA  B P     1 
ATOM   2427 O OP1   . DA  C 2 10  ? 40.126 -23.176 11.865 1.00 78.81  ? 10  DA  B OP1   1 
ATOM   2428 O OP2   . DA  C 2 10  ? 38.912 -25.407 12.366 1.00 88.26  ? 10  DA  B OP2   1 
ATOM   2429 O "O5'" . DA  C 2 10  ? 41.411 -25.167 12.618 1.00 78.36  ? 10  DA  B "O5'" 1 
ATOM   2430 C "C5'" . DA  C 2 10  ? 42.457 -24.347 13.082 1.00 86.30  ? 10  DA  B "C5'" 1 
ATOM   2431 C "C4'" . DA  C 2 10  ? 43.500 -25.140 13.836 1.00 111.66 ? 10  DA  B "C4'" 1 
ATOM   2432 O "O4'" . DA  C 2 10  ? 42.920 -25.885 14.942 1.00 115.44 ? 10  DA  B "O4'" 1 
ATOM   2433 C "C3'" . DA  C 2 10  ? 44.241 -26.148 12.977 1.00 122.27 ? 10  DA  B "C3'" 1 
ATOM   2434 O "O3'" . DA  C 2 10  ? 45.602 -25.991 13.337 1.00 130.55 ? 10  DA  B "O3'" 1 
ATOM   2435 C "C2'" . DA  C 2 10  ? 43.626 -27.493 13.385 1.00 121.84 ? 10  DA  B "C2'" 1 
ATOM   2436 C "C1'" . DA  C 2 10  ? 43.257 -27.256 14.848 1.00 111.57 ? 10  DA  B "C1'" 1 
ATOM   2437 N N9    . DA  C 2 10  ? 42.098 -28.000 15.338 1.00 104.71 ? 10  DA  B N9    1 
ATOM   2438 C C8    . DA  C 2 10  ? 40.918 -28.244 14.686 1.00 106.56 ? 10  DA  B C8    1 
ATOM   2439 N N7    . DA  C 2 10  ? 40.050 -28.927 15.399 1.00 101.03 ? 10  DA  B N7    1 
ATOM   2440 C C5    . DA  C 2 10  ? 40.704 -29.140 16.601 1.00 94.66  ? 10  DA  B C5    1 
ATOM   2441 C C6    . DA  C 2 10  ? 40.331 -29.804 17.785 1.00 98.15  ? 10  DA  B C6    1 
ATOM   2442 N N6    . DA  C 2 10  ? 39.147 -30.400 17.953 1.00 98.37  ? 10  DA  B N6    1 
ATOM   2443 N N1    . DA  C 2 10  ? 41.222 -29.830 18.796 1.00 99.27  ? 10  DA  B N1    1 
ATOM   2444 C C2    . DA  C 2 10  ? 42.406 -29.238 18.626 1.00 98.77  ? 10  DA  B C2    1 
ATOM   2445 N N3    . DA  C 2 10  ? 42.871 -28.581 17.567 1.00 100.91 ? 10  DA  B N3    1 
ATOM   2446 C C4    . DA  C 2 10  ? 41.963 -28.570 16.581 1.00 95.82  ? 10  DA  B C4    1 
ATOM   2447 P P     . DT  C 2 11  ? 46.802 -26.541 12.438 1.00 137.23 ? 11  DT  B P     1 
ATOM   2448 O OP1   . DT  C 2 11  ? 47.775 -25.444 12.201 1.00 87.06  ? 11  DT  B OP1   1 
ATOM   2449 O OP2   . DT  C 2 11  ? 46.221 -27.303 11.301 1.00 123.21 ? 11  DT  B OP2   1 
ATOM   2450 O "O5'" . DT  C 2 11  ? 47.452 -27.546 13.501 1.00 131.88 ? 11  DT  B "O5'" 1 
ATOM   2451 C "C5'" . DT  C 2 11  ? 47.117 -27.436 14.894 1.00 114.83 ? 11  DT  B "C5'" 1 
ATOM   2452 C "C4'" . DT  C 2 11  ? 47.238 -28.821 15.487 1.00 120.14 ? 11  DT  B "C4'" 1 
ATOM   2453 O "O4'" . DT  C 2 11  ? 45.944 -29.492 15.604 1.00 124.50 ? 11  DT  B "O4'" 1 
ATOM   2454 C "C3'" . DT  C 2 11  ? 48.092 -29.673 14.558 1.00 117.60 ? 11  DT  B "C3'" 1 
ATOM   2455 O "O3'" . DT  C 2 11  ? 49.170 -30.307 15.255 1.00 101.37 ? 11  DT  B "O3'" 1 
ATOM   2456 C "C2'" . DT  C 2 11  ? 47.054 -30.633 13.979 1.00 119.07 ? 11  DT  B "C2'" 1 
ATOM   2457 C "C1'" . DT  C 2 11  ? 46.153 -30.826 15.190 1.00 119.12 ? 11  DT  B "C1'" 1 
ATOM   2458 N N1    . DT  C 2 11  ? 44.905 -31.618 14.879 1.00 121.84 ? 11  DT  B N1    1 
ATOM   2459 C C2    . DT  C 2 11  ? 44.013 -31.995 15.872 1.00 127.99 ? 11  DT  B C2    1 
ATOM   2460 O O2    . DT  C 2 11  ? 44.129 -31.707 17.054 1.00 122.19 ? 11  DT  B O2    1 
ATOM   2461 N N3    . DT  C 2 11  ? 42.944 -32.735 15.417 1.00 134.41 ? 11  DT  B N3    1 
ATOM   2462 C C4    . DT  C 2 11  ? 42.685 -33.140 14.115 1.00 132.62 ? 11  DT  B C4    1 
ATOM   2463 O O4    . DT  C 2 11  ? 41.701 -33.810 13.809 1.00 120.24 ? 11  DT  B O4    1 
ATOM   2464 C C5    . DT  C 2 11  ? 43.659 -32.729 13.137 1.00 126.44 ? 11  DT  B C5    1 
ATOM   2465 C C7    . DT  C 2 11  ? 43.486 -33.106 11.692 1.00 115.51 ? 11  DT  B C7    1 
ATOM   2466 C C6    . DT  C 2 11  ? 44.703 -32.004 13.565 1.00 126.56 ? 11  DT  B C6    1 
ATOM   2467 O "O5'" . DT  D 3 1   ? 42.023 -36.030 25.384 1.00 93.83  ? 1   DT  C "O5'" 1 
ATOM   2468 C "C5'" . DT  D 3 1   ? 43.121 -35.697 26.241 1.00 122.08 ? 1   DT  C "C5'" 1 
ATOM   2469 C "C4'" . DT  D 3 1   ? 44.146 -34.775 25.583 1.00 137.06 ? 1   DT  C "C4'" 1 
ATOM   2470 O "O4'" . DT  D 3 1   ? 43.986 -34.782 24.134 1.00 149.36 ? 1   DT  C "O4'" 1 
ATOM   2471 C "C3'" . DT  D 3 1   ? 44.115 -33.302 26.007 1.00 127.05 ? 1   DT  C "C3'" 1 
ATOM   2472 O "O3'" . DT  D 3 1   ? 45.464 -32.800 26.129 1.00 132.40 ? 1   DT  C "O3'" 1 
ATOM   2473 C "C2'" . DT  D 3 1   ? 43.346 -32.671 24.848 1.00 126.81 ? 1   DT  C "C2'" 1 
ATOM   2474 C "C1'" . DT  D 3 1   ? 43.949 -33.443 23.676 1.00 137.10 ? 1   DT  C "C1'" 1 
ATOM   2475 N N1    . DT  D 3 1   ? 43.215 -33.368 22.355 1.00 130.49 ? 1   DT  C N1    1 
ATOM   2476 C C2    . DT  D 3 1   ? 43.701 -34.104 21.293 1.00 131.79 ? 1   DT  C C2    1 
ATOM   2477 O O2    . DT  D 3 1   ? 44.693 -34.808 21.366 1.00 129.39 ? 1   DT  C O2    1 
ATOM   2478 N N3    . DT  D 3 1   ? 42.983 -33.983 20.129 1.00 134.00 ? 1   DT  C N3    1 
ATOM   2479 C C4    . DT  D 3 1   ? 41.850 -33.222 19.922 1.00 125.14 ? 1   DT  C C4    1 
ATOM   2480 O O4    . DT  D 3 1   ? 41.280 -33.185 18.834 1.00 124.91 ? 1   DT  C O4    1 
ATOM   2481 C C5    . DT  D 3 1   ? 41.393 -32.477 21.071 1.00 122.98 ? 1   DT  C C5    1 
ATOM   2482 C C7    . DT  D 3 1   ? 40.170 -31.614 20.967 1.00 110.47 ? 1   DT  C C7    1 
ATOM   2483 C C6    . DT  D 3 1   ? 42.086 -32.582 22.216 1.00 122.33 ? 1   DT  C C6    1 
ATOM   2484 P P     . DA  D 3 2   ? 45.879 -31.615 27.138 1.00 144.97 ? 2   DA  C P     1 
ATOM   2485 O OP1   . DA  D 3 2   ? 46.875 -32.144 28.101 1.00 116.10 ? 2   DA  C OP1   1 
ATOM   2486 O OP2   . DA  D 3 2   ? 44.630 -31.000 27.641 1.00 137.55 ? 2   DA  C OP2   1 
ATOM   2487 O "O5'" . DA  D 3 2   ? 46.631 -30.556 26.192 1.00 132.82 ? 2   DA  C "O5'" 1 
ATOM   2488 C "C5'" . DA  D 3 2   ? 48.004 -30.785 25.850 1.00 130.19 ? 2   DA  C "C5'" 1 
ATOM   2489 C "C4'" . DA  D 3 2   ? 48.484 -29.999 24.634 1.00 125.25 ? 2   DA  C "C4'" 1 
ATOM   2490 O "O4'" . DA  D 3 2   ? 47.826 -30.461 23.417 1.00 125.13 ? 2   DA  C "O4'" 1 
ATOM   2491 C "C3'" . DA  D 3 2   ? 48.292 -28.489 24.717 1.00 117.36 ? 2   DA  C "C3'" 1 
ATOM   2492 O "O3'" . DA  D 3 2   ? 49.553 -27.867 25.058 1.00 121.37 ? 2   DA  C "O3'" 1 
ATOM   2493 C "C2'" . DA  D 3 2   ? 47.846 -28.116 23.301 1.00 112.95 ? 2   DA  C "C2'" 1 
ATOM   2494 C "C1'" . DA  D 3 2   ? 47.248 -29.384 22.703 1.00 114.02 ? 2   DA  C "C1'" 1 
ATOM   2495 N N9    . DA  D 3 2   ? 45.785 -29.516 22.769 1.00 118.49 ? 2   DA  C N9    1 
ATOM   2496 C C8    . DA  D 3 2   ? 45.115 -30.419 23.543 1.00 125.27 ? 2   DA  C C8    1 
ATOM   2497 N N7    . DA  D 3 2   ? 43.810 -30.371 23.435 1.00 116.56 ? 2   DA  C N7    1 
ATOM   2498 C C5    . DA  D 3 2   ? 43.592 -29.370 22.520 1.00 101.34 ? 2   DA  C C5    1 
ATOM   2499 C C6    . DA  D 3 2   ? 42.400 -28.845 21.994 1.00 103.58 ? 2   DA  C C6    1 
ATOM   2500 N N6    . DA  D 3 2   ? 41.190 -29.295 22.341 1.00 99.33  ? 2   DA  C N6    1 
ATOM   2501 N N1    . DA  D 3 2   ? 42.508 -27.841 21.103 1.00 98.87  ? 2   DA  C N1    1 
ATOM   2502 C C2    . DA  D 3 2   ? 43.732 -27.411 20.771 1.00 98.40  ? 2   DA  C C2    1 
ATOM   2503 N N3    . DA  D 3 2   ? 44.926 -27.830 21.201 1.00 112.65 ? 2   DA  C N3    1 
ATOM   2504 C C4    . DA  D 3 2   ? 44.792 -28.826 22.092 1.00 108.28 ? 2   DA  C C4    1 
ATOM   2505 P P     . DC  D 3 3   ? 49.682 -26.529 25.949 1.00 122.80 ? 3   DC  C P     1 
ATOM   2506 O OP1   . DC  D 3 3   ? 50.880 -26.682 26.805 1.00 112.42 ? 3   DC  C OP1   1 
ATOM   2507 O OP2   . DC  D 3 3   ? 48.378 -26.223 26.584 1.00 106.70 ? 3   DC  C OP2   1 
ATOM   2508 O "O5'" . DC  D 3 3   ? 50.000 -25.398 24.857 1.00 105.40 ? 3   DC  C "O5'" 1 
ATOM   2509 C "C5'" . DC  D 3 3   ? 49.985 -25.690 23.454 1.00 98.08  ? 3   DC  C "C5'" 1 
ATOM   2510 C "C4'" . DC  D 3 3   ? 49.148 -24.677 22.692 1.00 85.47  ? 3   DC  C "C4'" 1 
ATOM   2511 O "O4'" . DC  D 3 3   ? 47.858 -25.240 22.330 1.00 85.44  ? 3   DC  C "O4'" 1 
ATOM   2512 C "C3'" . DC  D 3 3   ? 48.908 -23.390 23.466 1.00 74.03  ? 3   DC  C "C3'" 1 
ATOM   2513 O "O3'" . DC  D 3 3   ? 49.574 -22.358 22.769 1.00 76.67  ? 3   DC  C "O3'" 1 
ATOM   2514 C "C2'" . DC  D 3 3   ? 47.392 -23.203 23.447 1.00 83.99  ? 3   DC  C "C2'" 1 
ATOM   2515 C "C1'" . DC  D 3 3   ? 46.789 -24.384 22.682 1.00 87.39  ? 3   DC  C "C1'" 1 
ATOM   2516 N N1    . DC  D 3 3   ? 45.710 -25.228 23.368 1.00 102.36 ? 3   DC  C N1    1 
ATOM   2517 C C2    . DC  D 3 3   ? 44.362 -25.096 22.994 1.00 97.09  ? 3   DC  C C2    1 
ATOM   2518 O O2    . DC  D 3 3   ? 44.073 -24.270 22.123 1.00 85.59  ? 3   DC  C O2    1 
ATOM   2519 N N3    . DC  D 3 3   ? 43.413 -25.873 23.596 1.00 93.96  ? 3   DC  C N3    1 
ATOM   2520 C C4    . DC  D 3 3   ? 43.758 -26.763 24.536 1.00 90.57  ? 3   DC  C C4    1 
ATOM   2521 N N4    . DC  D 3 3   ? 42.798 -27.503 25.105 1.00 74.82  ? 3   DC  C N4    1 
ATOM   2522 C C5    . DC  D 3 3   ? 45.120 -26.922 24.930 1.00 97.41  ? 3   DC  C C5    1 
ATOM   2523 C C6    . DC  D 3 3   ? 46.037 -26.146 24.329 1.00 101.61 ? 3   DC  C C6    1 
ATOM   2524 P P     . DT  D 3 4   ? 50.176 -21.058 23.476 1.00 95.48  ? 4   DT  C P     1 
ATOM   2525 O OP1   . DT  D 3 4   ? 51.362 -20.649 22.690 1.00 65.68  ? 4   DT  C OP1   1 
ATOM   2526 O OP2   . DT  D 3 4   ? 50.265 -21.340 24.926 1.00 89.89  ? 4   DT  C OP2   1 
ATOM   2527 O "O5'" . DT  D 3 4   ? 49.037 -19.945 23.284 1.00 79.88  ? 4   DT  C "O5'" 1 
ATOM   2528 C "C5'" . DT  D 3 4   ? 48.489 -19.675 22.005 1.00 63.69  ? 4   DT  C "C5'" 1 
ATOM   2529 C "C4'" . DT  D 3 4   ? 47.158 -18.969 22.165 1.00 59.83  ? 4   DT  C "C4'" 1 
ATOM   2530 O "O4'" . DT  D 3 4   ? 46.092 -19.906 22.454 1.00 62.56  ? 4   DT  C "O4'" 1 
ATOM   2531 C "C3'" . DT  D 3 4   ? 47.144 -17.935 23.274 1.00 49.94  ? 4   DT  C "C3'" 1 
ATOM   2532 O "O3'" . DT  D 3 4   ? 46.943 -16.644 22.666 1.00 64.42  ? 4   DT  C "O3'" 1 
ATOM   2533 C "C2'" . DT  D 3 4   ? 46.004 -18.364 24.213 1.00 57.92  ? 4   DT  C "C2'" 1 
ATOM   2534 C "C1'" . DT  D 3 4   ? 45.194 -19.381 23.415 1.00 60.74  ? 4   DT  C "C1'" 1 
ATOM   2535 N N1    . DT  D 3 4   ? 44.629 -20.595 24.130 1.00 85.13  ? 4   DT  C N1    1 
ATOM   2536 C C2    . DT  D 3 4   ? 43.270 -20.880 24.076 1.00 85.69  ? 4   DT  C C2    1 
ATOM   2537 O O2    . DT  D 3 4   ? 42.433 -20.193 23.516 1.00 79.66  ? 4   DT  C O2    1 
ATOM   2538 N N3    . DT  D 3 4   ? 42.907 -22.031 24.732 1.00 92.29  ? 4   DT  C N3    1 
ATOM   2539 C C4    . DT  D 3 4   ? 43.724 -22.914 25.410 1.00 83.62  ? 4   DT  C C4    1 
ATOM   2540 O O4    . DT  D 3 4   ? 43.307 -23.916 25.969 1.00 67.55  ? 4   DT  C O4    1 
ATOM   2541 C C5    . DT  D 3 4   ? 45.114 -22.578 25.421 1.00 76.82  ? 4   DT  C C5    1 
ATOM   2542 C C7    . DT  D 3 4   ? 46.060 -23.484 26.140 1.00 58.87  ? 4   DT  C C7    1 
ATOM   2543 C C6    . DT  D 3 4   ? 45.494 -21.453 24.792 1.00 86.62  ? 4   DT  C C6    1 
HETATM 2544 N N1    . 5CM D 3 5   ? 47.766 -10.427 21.978 1.00 48.43  ? 5   5CM C N1    1 
HETATM 2545 C C2    . 5CM D 3 5   ? 48.326 -9.003  21.907 1.00 35.60  ? 5   5CM C C2    1 
HETATM 2546 N N3    . 5CM D 3 5   ? 49.756 -8.753  21.380 1.00 27.43  ? 5   5CM C N3    1 
HETATM 2547 C C4    . 5CM D 3 5   ? 50.572 -9.888  20.827 1.00 39.74  ? 5   5CM C C4    1 
HETATM 2548 C C5    . 5CM D 3 5   ? 49.926 -11.309 20.708 1.00 38.92  ? 5   5CM C C5    1 
HETATM 2549 C C5A   . 5CM D 3 5   ? 50.675 -12.487 20.078 1.00 48.35  ? 5   5CM C C5A   1 
HETATM 2550 C C6    . 5CM D 3 5   ? 48.553 -11.581 21.360 1.00 53.53  ? 5   5CM C C6    1 
HETATM 2551 O O2    . 5CM D 3 5   ? 47.610 -7.964  22.499 1.00 49.97  ? 5   5CM C O2    1 
HETATM 2552 N N4    . 5CM D 3 5   ? 51.880 -9.564  20.254 1.00 43.43  ? 5   5CM C N4    1 
HETATM 2553 C "C1'" . 5CM D 3 5   ? 46.553 -10.668 22.771 1.00 55.50  ? 5   5CM C "C1'" 1 
HETATM 2554 C "C2'" . 5CM D 3 5   ? 45.340 -11.244 22.040 1.00 52.61  ? 5   5CM C "C2'" 1 
HETATM 2555 C "C3'" . 5CM D 3 5   ? 44.717 -12.084 23.124 1.00 48.11  ? 5   5CM C "C3'" 1 
HETATM 2556 C "C4'" . 5CM D 3 5   ? 45.934 -12.701 23.794 1.00 47.45  ? 5   5CM C "C4'" 1 
HETATM 2557 O "O4'" . 5CM D 3 5   ? 46.944 -11.651 23.781 1.00 46.37  ? 5   5CM C "O4'" 1 
HETATM 2558 O "O3'" . 5CM D 3 5   ? 44.070 -11.288 24.089 1.00 70.52  ? 5   5CM C "O3'" 1 
HETATM 2559 C "C5'" . 5CM D 3 5   ? 46.392 -13.843 22.903 1.00 57.45  ? 5   5CM C "C5'" 1 
HETATM 2560 O "O5'" . 5CM D 3 5   ? 47.657 -14.306 23.290 1.00 47.69  ? 5   5CM C "O5'" 1 
HETATM 2561 P P     . 5CM D 3 5   ? 48.144 -15.605 22.407 1.00 50.71  ? 5   5CM C P     1 
HETATM 2562 O OP1   . 5CM D 3 5   ? 48.255 -15.240 20.801 1.00 59.23  ? 5   5CM C OP1   1 
HETATM 2563 O OP2   . 5CM D 3 5   ? 49.413 -16.114 22.882 1.00 62.09  ? 5   5CM C OP2   1 
ATOM   2564 P P     . DC  D 3 6   ? 43.177 -12.039 25.182 1.00 65.86  ? 6   DC  C P     1 
ATOM   2565 O OP1   . DC  D 3 6   ? 42.780 -11.111 26.263 1.00 46.14  ? 6   DC  C OP1   1 
ATOM   2566 O OP2   . DC  D 3 6   ? 43.856 -13.302 25.535 1.00 53.73  ? 6   DC  C OP2   1 
ATOM   2567 O "O5'" . DC  D 3 6   ? 41.883 -12.315 24.278 1.00 49.73  ? 6   DC  C "O5'" 1 
ATOM   2568 C "C5'" . DC  D 3 6   ? 41.199 -13.519 24.400 1.00 47.74  ? 6   DC  C "C5'" 1 
ATOM   2569 C "C4'" . DC  D 3 6   ? 39.713 -13.296 24.308 1.00 48.44  ? 6   DC  C "C4'" 1 
ATOM   2570 O "O4'" . DC  D 3 6   ? 39.081 -14.275 25.164 1.00 59.86  ? 6   DC  C "O4'" 1 
ATOM   2571 C "C3'" . DC  D 3 6   ? 39.167 -11.971 24.813 1.00 47.42  ? 6   DC  C "C3'" 1 
ATOM   2572 O "O3'" . DC  D 3 6   ? 37.922 -11.831 24.105 1.00 37.37  ? 6   DC  C "O3'" 1 
ATOM   2573 C "C2'" . DC  D 3 6   ? 39.097 -12.215 26.329 1.00 53.71  ? 6   DC  C "C2'" 1 
ATOM   2574 C "C1'" . DC  D 3 6   ? 38.835 -13.724 26.454 1.00 65.93  ? 6   DC  C "C1'" 1 
ATOM   2575 N N1    . DC  D 3 6   ? 39.635 -14.593 27.435 1.00 68.10  ? 6   DC  C N1    1 
ATOM   2576 C C2    . DC  D 3 6   ? 38.999 -15.365 28.442 1.00 75.96  ? 6   DC  C C2    1 
ATOM   2577 O O2    . DC  D 3 6   ? 37.772 -15.325 28.592 1.00 72.42  ? 6   DC  C O2    1 
ATOM   2578 N N3    . DC  D 3 6   ? 39.747 -16.148 29.269 1.00 76.32  ? 6   DC  C N3    1 
ATOM   2579 C C4    . DC  D 3 6   ? 41.072 -16.208 29.112 1.00 75.73  ? 6   DC  C C4    1 
ATOM   2580 N N4    . DC  D 3 6   ? 41.779 -16.996 29.929 1.00 58.15  ? 6   DC  C N4    1 
ATOM   2581 C C5    . DC  D 3 6   ? 41.734 -15.455 28.095 1.00 65.76  ? 6   DC  C C5    1 
ATOM   2582 C C6    . DC  D 3 6   ? 40.989 -14.686 27.293 1.00 66.02  ? 6   DC  C C6    1 
ATOM   2583 P P     . DT  D 3 7   ? 36.677 -10.871 24.424 1.00 61.37  ? 7   DT  C P     1 
ATOM   2584 O OP1   . DT  D 3 7   ? 35.684 -11.102 23.360 1.00 44.37  ? 7   DT  C OP1   1 
ATOM   2585 O OP2   . DT  D 3 7   ? 37.072 -9.464  24.679 1.00 51.54  ? 7   DT  C OP2   1 
ATOM   2586 O "O5'" . DT  D 3 7   ? 36.217 -11.549 25.796 1.00 57.66  ? 7   DT  C "O5'" 1 
ATOM   2587 C "C5'" . DT  D 3 7   ? 34.880 -11.925 26.036 1.00 52.84  ? 7   DT  C "C5'" 1 
ATOM   2588 C "C4'" . DT  D 3 7   ? 34.596 -11.898 27.523 1.00 49.14  ? 7   DT  C "C4'" 1 
ATOM   2589 O "O4'" . DT  D 3 7   ? 35.684 -12.468 28.270 1.00 53.30  ? 7   DT  C "O4'" 1 
ATOM   2590 C "C3'" . DT  D 3 7   ? 34.433 -10.511 28.121 1.00 49.58  ? 7   DT  C "C3'" 1 
ATOM   2591 O "O3'" . DT  D 3 7   ? 33.103 -10.540 28.539 1.00 55.06  ? 7   DT  C "O3'" 1 
ATOM   2592 C "C2'" . DT  D 3 7   ? 35.448 -10.422 29.271 1.00 53.33  ? 7   DT  C "C2'" 1 
ATOM   2593 C "C1'" . DT  D 3 7   ? 35.660 -11.895 29.563 1.00 50.95  ? 7   DT  C "C1'" 1 
ATOM   2594 N N1    . DT  D 3 7   ? 36.908 -12.439 30.153 1.00 52.97  ? 7   DT  C N1    1 
ATOM   2595 C C2    . DT  D 3 7   ? 36.804 -13.293 31.241 1.00 71.58  ? 7   DT  C C2    1 
ATOM   2596 O O2    . DT  D 3 7   ? 35.756 -13.579 31.799 1.00 72.39  ? 7   DT  C O2    1 
ATOM   2597 N N3    . DT  D 3 7   ? 37.992 -13.800 31.694 1.00 70.87  ? 7   DT  C N3    1 
ATOM   2598 C C4    . DT  D 3 7   ? 39.245 -13.574 31.163 1.00 72.76  ? 7   DT  C C4    1 
ATOM   2599 O O4    . DT  D 3 7   ? 40.259 -14.084 31.634 1.00 69.60  ? 7   DT  C O4    1 
ATOM   2600 C C5    . DT  D 3 7   ? 39.281 -12.696 30.019 1.00 71.94  ? 7   DT  C C5    1 
ATOM   2601 C C7    . DT  D 3 7   ? 40.607 -12.397 29.383 1.00 52.76  ? 7   DT  C C7    1 
ATOM   2602 C C6    . DT  D 3 7   ? 38.125 -12.181 29.566 1.00 56.39  ? 7   DT  C C6    1 
ATOM   2603 P P     . DC  D 3 8   ? 32.303 -9.232  28.946 1.00 64.19  ? 8   DC  C P     1 
ATOM   2604 O OP1   . DC  D 3 8   ? 30.891 -9.424  28.572 1.00 53.95  ? 8   DC  C OP1   1 
ATOM   2605 O OP2   . DC  D 3 8   ? 33.066 -8.035  28.533 1.00 60.62  ? 8   DC  C OP2   1 
ATOM   2606 O "O5'" . DC  D 3 8   ? 32.363 -9.371  30.535 1.00 78.07  ? 8   DC  C "O5'" 1 
ATOM   2607 C "C5'" . DC  D 3 8   ? 31.653 -10.447 31.151 1.00 62.13  ? 8   DC  C "C5'" 1 
ATOM   2608 C "C4'" . DC  D 3 8   ? 31.987 -10.498 32.625 1.00 66.70  ? 8   DC  C "C4'" 1 
ATOM   2609 O "O4'" . DC  D 3 8   ? 33.381 -10.842 32.829 1.00 65.83  ? 8   DC  C "O4'" 1 
ATOM   2610 C "C3'" . DC  D 3 8   ? 31.775 -9.191  33.372 1.00 64.73  ? 8   DC  C "C3'" 1 
ATOM   2611 O "O3'" . DC  D 3 8   ? 31.272 -9.521  34.620 1.00 71.57  ? 8   DC  C "O3'" 1 
ATOM   2612 C "C2'" . DC  D 3 8   ? 33.184 -8.664  33.561 1.00 63.71  ? 8   DC  C "C2'" 1 
ATOM   2613 C "C1'" . DC  D 3 8   ? 33.921 -9.970  33.788 1.00 59.67  ? 8   DC  C "C1'" 1 
ATOM   2614 N N1    . DC  D 3 8   ? 35.343 -9.840  33.485 1.00 59.83  ? 8   DC  C N1    1 
ATOM   2615 C C2    . DC  D 3 8   ? 36.247 -10.734 34.046 1.00 62.94  ? 8   DC  C C2    1 
ATOM   2616 O O2    . DC  D 3 8   ? 35.825 -11.620 34.789 1.00 70.28  ? 8   DC  C O2    1 
ATOM   2617 N N3    . DC  D 3 8   ? 37.556 -10.597 33.749 1.00 61.15  ? 8   DC  C N3    1 
ATOM   2618 C C4    . DC  D 3 8   ? 37.955 -9.618  32.931 1.00 70.04  ? 8   DC  C C4    1 
ATOM   2619 N N4    . DC  D 3 8   ? 39.260 -9.515  32.662 1.00 79.48  ? 8   DC  C N4    1 
ATOM   2620 C C5    . DC  D 3 8   ? 37.042 -8.693  32.348 1.00 51.00  ? 8   DC  C C5    1 
ATOM   2621 C C6    . DC  D 3 8   ? 35.754 -8.843  32.655 1.00 61.33  ? 8   DC  C C6    1 
ATOM   2622 P P     . DA  D 3 9   ? 29.997 -8.784  35.207 1.00 77.89  ? 9   DA  C P     1 
ATOM   2623 O OP1   . DA  D 3 9   ? 28.784 -9.092  34.412 1.00 64.48  ? 9   DA  C OP1   1 
ATOM   2624 O OP2   . DA  D 3 9   ? 30.387 -7.384  35.501 1.00 81.84  ? 9   DA  C OP2   1 
ATOM   2625 O "O5'" . DA  D 3 9   ? 29.927 -9.623  36.553 1.00 74.93  ? 9   DA  C "O5'" 1 
ATOM   2626 C "C5'" . DA  D 3 9   ? 30.325 -10.968 36.438 1.00 68.43  ? 9   DA  C "C5'" 1 
ATOM   2627 C "C4'" . DA  D 3 9   ? 30.923 -11.469 37.733 1.00 82.28  ? 9   DA  C "C4'" 1 
ATOM   2628 O "O4'" . DA  D 3 9   ? 32.367 -11.333 37.731 1.00 85.70  ? 9   DA  C "O4'" 1 
ATOM   2629 C "C3'" . DA  D 3 9   ? 30.468 -10.742 38.984 1.00 91.92  ? 9   DA  C "C3'" 1 
ATOM   2630 O "O3'" . DA  D 3 9   ? 30.618 -11.691 40.031 1.00 101.95 ? 9   DA  C "O3'" 1 
ATOM   2631 C "C2'" . DA  D 3 9   ? 31.467 -9.584  39.037 1.00 89.16  ? 9   DA  C "C2'" 1 
ATOM   2632 C "C1'" . DA  D 3 9   ? 32.752 -10.266 38.580 1.00 86.12  ? 9   DA  C "C1'" 1 
ATOM   2633 N N9    . DA  D 3 9   ? 33.613 -9.413  37.779 1.00 76.04  ? 9   DA  C N9    1 
ATOM   2634 C C8    . DA  D 3 9   ? 33.244 -8.324  37.041 1.00 76.85  ? 9   DA  C C8    1 
ATOM   2635 N N7    . DA  D 3 9   ? 34.245 -7.765  36.401 1.00 76.01  ? 9   DA  C N7    1 
ATOM   2636 C C5    . DA  D 3 9   ? 35.333 -8.550  36.745 1.00 65.20  ? 9   DA  C C5    1 
ATOM   2637 C C6    . DA  D 3 9   ? 36.690 -8.483  36.396 1.00 74.89  ? 9   DA  C C6    1 
ATOM   2638 N N6    . DA  D 3 9   ? 37.178 -7.538  35.583 1.00 72.30  ? 9   DA  C N6    1 
ATOM   2639 N N1    . DA  D 3 9   ? 37.514 -9.423  36.914 1.00 80.82  ? 9   DA  C N1    1 
ATOM   2640 C C2    . DA  D 3 9   ? 37.011 -10.368 37.722 1.00 71.70  ? 9   DA  C C2    1 
ATOM   2641 N N3    . DA  D 3 9   ? 35.751 -10.529 38.119 1.00 67.73  ? 9   DA  C N3    1 
ATOM   2642 C C4    . DA  D 3 9   ? 34.962 -9.577  37.587 1.00 66.97  ? 9   DA  C C4    1 
ATOM   2643 P P     . DG  D 3 10  ? 30.507 -11.354 41.588 1.00 102.75 ? 10  DG  C P     1 
ATOM   2644 O OP1   . DG  D 3 10  ? 29.301 -12.057 42.082 1.00 85.29  ? 10  DG  C OP1   1 
ATOM   2645 O OP2   . DG  D 3 10  ? 30.648 -9.889  41.794 1.00 105.99 ? 10  DG  C OP2   1 
ATOM   2646 O "O5'" . DG  D 3 10  ? 31.820 -12.088 42.147 1.00 78.47  ? 10  DG  C "O5'" 1 
ATOM   2647 C "C5'" . DG  D 3 10  ? 32.173 -12.039 43.527 1.00 97.90  ? 10  DG  C "C5'" 1 
ATOM   2648 C "C4'" . DG  D 3 10  ? 33.681 -11.911 43.632 1.00 109.04 ? 10  DG  C "C4'" 1 
ATOM   2649 O "O4'" . DG  D 3 10  ? 34.110 -11.217 42.432 1.00 105.52 ? 10  DG  C "O4'" 1 
ATOM   2650 C "C3'" . DG  D 3 10  ? 34.211 -11.125 44.839 1.00 114.31 ? 10  DG  C "C3'" 1 
ATOM   2651 O "O3'" . DG  D 3 10  ? 34.857 -11.979 45.839 1.00 77.49  ? 10  DG  C "O3'" 1 
ATOM   2652 C "C2'" . DG  D 3 10  ? 35.149 -10.070 44.226 1.00 101.89 ? 10  DG  C "C2'" 1 
ATOM   2653 C "C1'" . DG  D 3 10  ? 35.221 -10.406 42.731 1.00 96.20  ? 10  DG  C "C1'" 1 
ATOM   2654 N N9    . DG  D 3 10  ? 35.221 -9.271  41.800 1.00 85.18  ? 10  DG  C N9    1 
ATOM   2655 C C8    . DG  D 3 10  ? 34.191 -8.417  41.471 1.00 89.70  ? 10  DG  C C8    1 
ATOM   2656 N N7    . DG  D 3 10  ? 34.530 -7.503  40.595 1.00 76.39  ? 10  DG  C N7    1 
ATOM   2657 C C5    . DG  D 3 10  ? 35.870 -7.770  40.326 1.00 74.62  ? 10  DG  C C5    1 
ATOM   2658 C C6    . DG  D 3 10  ? 36.790 -7.130  39.455 1.00 73.04  ? 10  DG  C C6    1 
ATOM   2659 O O6    . DG  D 3 10  ? 36.609 -6.148  38.712 1.00 64.85  ? 10  DG  C O6    1 
ATOM   2660 N N1    . DG  D 3 10  ? 38.042 -7.747  39.503 1.00 65.27  ? 10  DG  C N1    1 
ATOM   2661 C C2    . DG  D 3 10  ? 38.376 -8.833  40.282 1.00 76.91  ? 10  DG  C C2    1 
ATOM   2662 N N2    . DG  D 3 10  ? 39.636 -9.298  40.203 1.00 77.16  ? 10  DG  C N2    1 
ATOM   2663 N N3    . DG  D 3 10  ? 37.524 -9.436  41.094 1.00 81.85  ? 10  DG  C N3    1 
ATOM   2664 C C4    . DG  D 3 10  ? 36.300 -8.856  41.059 1.00 76.94  ? 10  DG  C C4    1 
HETATM 2665 O O     . HOH E 4 .   ? 54.128 -20.219 34.157 1.00 96.25  ? 3   HOH X O     1 
HETATM 2666 O O     . HOH E 4 .   ? 52.454 3.472   5.706  1.00 49.27  ? 6   HOH X O     1 
HETATM 2667 O O     . HOH E 4 .   ? 52.715 -19.618 36.589 1.00 60.40  ? 8   HOH X O     1 
HETATM 2668 O O     . HOH E 4 .   ? 51.198 1.970   15.337 1.00 62.69  ? 10  HOH X O     1 
HETATM 2669 O O     . HOH E 4 .   ? 34.645 -4.440  1.903  1.00 71.98  ? 11  HOH X O     1 
HETATM 2670 O O     . HOH E 4 .   ? 51.561 -12.691 28.537 1.00 83.12  ? 17  HOH X O     1 
HETATM 2671 O O     . HOH E 4 .   ? 50.061 -11.044 30.865 1.00 66.33  ? 18  HOH X O     1 
HETATM 2672 O O     . HOH F 4 .   ? 43.681 -30.502 34.491 1.00 73.15  ? 4   HOH A O     1 
HETATM 2673 O O     . HOH F 4 .   ? 26.355 -24.070 11.274 1.00 59.98  ? 7   HOH A O     1 
HETATM 2674 O O     . HOH F 4 .   ? 7.899  -36.682 40.657 1.00 54.64  ? 12  HOH A O     1 
HETATM 2675 O O     . HOH F 4 .   ? 33.031 -16.994 31.719 1.00 61.32  ? 13  HOH A O     1 
HETATM 2676 O O     . HOH F 4 .   ? 34.876 -30.026 33.203 1.00 68.31  ? 14  HOH A O     1 
HETATM 2677 O O     . HOH F 4 .   ? 29.627 -13.361 19.493 1.00 54.26  ? 16  HOH A O     1 
HETATM 2678 O O     . HOH G 4 .   ? 30.016 -24.502 27.011 1.00 41.15  ? 12  HOH B O     1 
HETATM 2679 O O     . HOH G 4 .   ? 41.124 -20.892 28.100 1.00 66.09  ? 15  HOH B O     1 
HETATM 2680 O O     . HOH H 4 .   ? 30.460 -7.341  42.291 1.00 77.77  ? 11  HOH C O     1 
HETATM 2681 O O     . HOH H 4 .   ? 48.826 -33.271 24.107 1.00 83.07  ? 12  HOH C O     1 
HETATM 2682 O O     . HOH H 4 .   ? 50.883 -28.245 22.691 1.00 80.92  ? 13  HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   362 362 GLN GLN X . n 
A 1 2   ILE 2   363 363 ILE ILE X . n 
A 1 3   ILE 3   364 364 ILE ILE X . n 
A 1 4   GLY 4   365 365 GLY GLY X . n 
A 1 5   THR 5   366 366 THR THR X . n 
A 1 6   VAL 6   367 367 VAL VAL X . n 
A 1 7   PRO 7   368 368 PRO PRO X . n 
A 1 8   GLY 8   369 369 GLY GLY X . n 
A 1 9   VAL 9   370 370 VAL VAL X . n 
A 1 10  GLU 10  371 371 GLU GLU X . n 
A 1 11  VAL 11  372 372 VAL VAL X . n 
A 1 12  GLY 12  373 373 GLY GLY X . n 
A 1 13  ASP 13  374 374 ASP ASP X . n 
A 1 14  GLU 14  375 375 GLU GLU X . n 
A 1 15  PHE 15  376 376 PHE PHE X . n 
A 1 16  GLN 16  377 377 GLN GLN X . n 
A 1 17  TYR 17  378 378 TYR TYR X . n 
A 1 18  ARG 18  379 379 ARG ARG X . n 
A 1 19  MET 19  380 380 MET MET X . n 
A 1 20  GLU 20  381 381 GLU GLU X . n 
A 1 21  LEU 21  382 382 LEU LEU X . n 
A 1 22  ASN 22  383 383 ASN ASN X . n 
A 1 23  LEU 23  384 384 LEU LEU X . n 
A 1 24  LEU 24  385 385 LEU LEU X . n 
A 1 25  GLY 25  386 386 GLY GLY X . n 
A 1 26  ILE 26  387 387 ILE ILE X . n 
A 1 27  HIS 27  388 388 HIS HIS X . n 
A 1 28  ARG 28  389 389 ARG ARG X . n 
A 1 29  PRO 29  390 390 PRO PRO X . n 
A 1 30  SER 30  391 391 SER SER X . n 
A 1 31  GLN 31  392 392 GLN GLN X . n 
A 1 32  SER 32  393 393 SER SER X . n 
A 1 33  GLY 33  394 394 GLY GLY X . n 
A 1 34  ILE 34  395 395 ILE ILE X . n 
A 1 35  ASP 35  396 396 ASP ASP X . n 
A 1 36  TYR 36  397 397 TYR TYR X . n 
A 1 37  MET 37  398 398 MET MET X . n 
A 1 38  LYS 38  399 399 LYS LYS X . n 
A 1 39  ASP 39  400 400 ASP ASP X . n 
A 1 40  ASP 40  401 401 ASP ASP X . n 
A 1 41  GLY 41  402 402 GLY GLY X . n 
A 1 42  GLY 42  403 403 GLY GLY X . n 
A 1 43  GLU 43  404 404 GLU GLU X . n 
A 1 44  LEU 44  405 405 LEU LEU X . n 
A 1 45  VAL 45  406 406 VAL VAL X . n 
A 1 46  ALA 46  407 407 ALA ALA X . n 
A 1 47  THR 47  408 408 THR THR X . n 
A 1 48  SER 48  409 409 SER SER X . n 
A 1 49  ILE 49  410 410 ILE ILE X . n 
A 1 50  VAL 50  411 411 VAL VAL X . n 
A 1 51  SER 51  412 412 SER SER X . n 
A 1 52  SER 52  413 413 SER SER X . n 
A 1 53  GLY 53  414 414 GLY GLY X . n 
A 1 54  GLY 54  415 415 GLY GLY X . n 
A 1 55  TYR 55  416 416 TYR TYR X . n 
A 1 56  ASN 56  417 417 ASN ASN X . n 
A 1 57  ASP 57  418 418 ASP ASP X . n 
A 1 58  VAL 58  419 419 VAL VAL X . n 
A 1 59  LEU 59  420 420 LEU LEU X . n 
A 1 60  ASP 60  421 421 ASP ASP X . n 
A 1 61  ASN 61  422 422 ASN ASN X . n 
A 1 62  SER 62  423 423 SER SER X . n 
A 1 63  ASP 63  424 424 ASP ASP X . n 
A 1 64  VAL 64  425 425 VAL VAL X . n 
A 1 65  LEU 65  426 426 LEU LEU X . n 
A 1 66  ILE 66  427 427 ILE ILE X . n 
A 1 67  TYR 67  428 428 TYR TYR X . n 
A 1 68  THR 68  429 429 THR THR X . n 
A 1 69  GLY 69  430 430 GLY GLY X . n 
A 1 70  GLN 70  431 431 GLN GLN X . n 
A 1 71  GLY 71  432 432 GLY GLY X . n 
A 1 72  GLY 72  433 433 GLY GLY X . n 
A 1 73  ASN 73  434 434 ASN ASN X . n 
A 1 74  VAL 74  435 ?   ?   ?   X . n 
A 1 75  GLY 75  436 ?   ?   ?   X . n 
A 1 76  LYS 76  437 ?   ?   ?   X . n 
A 1 77  LYS 77  438 ?   ?   ?   X . n 
A 1 78  LYS 78  439 ?   ?   ?   X . n 
A 1 79  ASN 79  440 ?   ?   ?   X . n 
A 1 80  ASN 80  441 ?   ?   ?   X . n 
A 1 81  GLU 81  442 ?   ?   ?   X . n 
A 1 82  PRO 82  443 443 PRO PRO X . n 
A 1 83  PRO 83  444 444 PRO PRO X . n 
A 1 84  LYS 84  445 445 LYS LYS X . n 
A 1 85  ASP 85  446 446 ASP ASP X . n 
A 1 86  GLN 86  447 447 GLN GLN X . n 
A 1 87  GLN 87  448 448 GLN GLN X . n 
A 1 88  LEU 88  449 449 LEU LEU X . n 
A 1 89  VAL 89  450 450 VAL VAL X . n 
A 1 90  THR 90  451 451 THR THR X . n 
A 1 91  GLY 91  452 452 GLY GLY X . n 
A 1 92  ASN 92  453 453 ASN ASN X . n 
A 1 93  LEU 93  454 454 LEU LEU X . n 
A 1 94  ALA 94  455 455 ALA ALA X . n 
A 1 95  LEU 95  456 456 LEU LEU X . n 
A 1 96  LYS 96  457 457 LYS LYS X . n 
A 1 97  ASN 97  458 458 ASN ASN X . n 
A 1 98  SER 98  459 459 SER SER X . n 
A 1 99  ILE 99  460 460 ILE ILE X . n 
A 1 100 ASN 100 461 461 ASN ASN X . n 
A 1 101 LYS 101 462 462 LYS LYS X . n 
A 1 102 LYS 102 463 463 LYS LYS X . n 
A 1 103 ASN 103 464 464 ASN ASN X . n 
A 1 104 PRO 104 465 465 PRO PRO X . n 
A 1 105 VAL 105 466 466 VAL VAL X . n 
A 1 106 ARG 106 467 467 ARG ARG X . n 
A 1 107 VAL 107 468 468 VAL VAL X . n 
A 1 108 ILE 108 469 469 ILE ILE X . n 
A 1 109 ARG 109 470 470 ARG ARG X . n 
A 1 110 GLY 110 471 471 GLY GLY X . n 
A 1 111 ILE 111 472 472 ILE ILE X . n 
A 1 112 LYS 112 473 473 LYS LYS X . n 
A 1 113 ASN 113 474 ?   ?   ?   X . n 
A 1 114 THR 114 475 ?   ?   ?   X . n 
A 1 115 THR 115 476 ?   ?   ?   X . n 
A 1 116 LEU 116 477 ?   ?   ?   X . n 
A 1 117 GLN 117 478 ?   ?   ?   X . n 
A 1 118 SER 118 479 ?   ?   ?   X . n 
A 1 119 SER 119 480 ?   ?   ?   X . n 
A 1 120 VAL 120 481 ?   ?   ?   X . n 
A 1 121 VAL 121 482 ?   ?   ?   X . n 
A 1 122 ALA 122 483 ?   ?   ?   X . n 
A 1 123 LYS 123 484 484 LYS LYS X . n 
A 1 124 ASN 124 485 485 ASN ASN X . n 
A 1 125 TYR 125 486 486 TYR TYR X . n 
A 1 126 VAL 126 487 487 VAL VAL X . n 
A 1 127 TYR 127 488 488 TYR TYR X . n 
A 1 128 ASP 128 489 489 ASP ASP X . n 
A 1 129 GLY 129 490 490 GLY GLY X . n 
A 1 130 LEU 130 491 491 LEU LEU X . n 
A 1 131 TYR 131 492 492 TYR TYR X . n 
A 1 132 LEU 132 493 493 LEU LEU X . n 
A 1 133 VAL 133 494 494 VAL VAL X . n 
A 1 134 GLU 134 495 495 GLU GLU X . n 
A 1 135 GLU 135 496 496 GLU GLU X . n 
A 1 136 TYR 136 497 497 TYR TYR X . n 
A 1 137 TRP 137 498 498 TRP TRP X . n 
A 1 138 GLU 138 499 499 GLU GLU X . n 
A 1 139 GLU 139 500 500 GLU GLU X . n 
A 1 140 THR 140 501 501 THR THR X . n 
A 1 141 GLY 141 502 502 GLY GLY X . n 
A 1 142 SER 142 503 503 SER SER X . n 
A 1 143 HIS 143 504 504 HIS HIS X . n 
A 1 144 GLY 144 505 505 GLY GLY X . n 
A 1 145 LYS 145 506 506 LYS LYS X . n 
A 1 146 LEU 146 507 507 LEU LEU X . n 
A 1 147 VAL 147 508 508 VAL VAL X . n 
A 1 148 PHE 148 509 509 PHE PHE X . n 
A 1 149 LYS 149 510 510 LYS LYS X . n 
A 1 150 PHE 150 511 511 PHE PHE X . n 
A 1 151 LYS 151 512 512 LYS LYS X . n 
A 1 152 LEU 152 513 513 LEU LEU X . n 
A 1 153 ARG 153 514 514 ARG ARG X . n 
A 1 154 ARG 154 515 515 ARG ARG X . n 
A 1 155 ILE 155 516 516 ILE ILE X . n 
A 1 156 PRO 156 517 517 PRO PRO X . n 
A 1 157 GLY 157 518 518 GLY GLY X . n 
A 1 158 GLN 158 519 519 GLN GLN X . n 
A 1 159 PRO 159 520 520 PRO PRO X . n 
A 1 160 GLU 160 521 521 GLU GLU X . n 
A 1 161 LEU 161 522 522 LEU LEU X . n 
A 1 162 PRO 162 523 523 PRO PRO X . n 
A 1 163 TRP 163 524 524 TRP TRP X . n 
A 1 164 LYS 164 525 ?   ?   ?   X . n 
A 1 165 GLU 165 526 ?   ?   ?   X . n 
A 1 166 VAL 166 527 ?   ?   ?   X . n 
A 1 167 ALA 167 528 ?   ?   ?   X . n 
B 1 1   GLN 1   362 362 GLN GLN A . n 
B 1 2   ILE 2   363 363 ILE ILE A . n 
B 1 3   ILE 3   364 364 ILE ILE A . n 
B 1 4   GLY 4   365 365 GLY GLY A . n 
B 1 5   THR 5   366 366 THR THR A . n 
B 1 6   VAL 6   367 367 VAL VAL A . n 
B 1 7   PRO 7   368 368 PRO PRO A . n 
B 1 8   GLY 8   369 369 GLY GLY A . n 
B 1 9   VAL 9   370 370 VAL VAL A . n 
B 1 10  GLU 10  371 371 GLU GLU A . n 
B 1 11  VAL 11  372 372 VAL VAL A . n 
B 1 12  GLY 12  373 373 GLY GLY A . n 
B 1 13  ASP 13  374 374 ASP ASP A . n 
B 1 14  GLU 14  375 375 GLU GLU A . n 
B 1 15  PHE 15  376 376 PHE PHE A . n 
B 1 16  GLN 16  377 377 GLN GLN A . n 
B 1 17  TYR 17  378 378 TYR TYR A . n 
B 1 18  ARG 18  379 379 ARG ARG A . n 
B 1 19  MET 19  380 380 MET MET A . n 
B 1 20  GLU 20  381 381 GLU GLU A . n 
B 1 21  LEU 21  382 382 LEU LEU A . n 
B 1 22  ASN 22  383 383 ASN ASN A . n 
B 1 23  LEU 23  384 384 LEU LEU A . n 
B 1 24  LEU 24  385 385 LEU LEU A . n 
B 1 25  GLY 25  386 386 GLY GLY A . n 
B 1 26  ILE 26  387 387 ILE ILE A . n 
B 1 27  HIS 27  388 388 HIS HIS A . n 
B 1 28  ARG 28  389 389 ARG ARG A . n 
B 1 29  PRO 29  390 390 PRO PRO A . n 
B 1 30  SER 30  391 391 SER SER A . n 
B 1 31  GLN 31  392 392 GLN GLN A . n 
B 1 32  SER 32  393 393 SER SER A . n 
B 1 33  GLY 33  394 394 GLY GLY A . n 
B 1 34  ILE 34  395 395 ILE ILE A . n 
B 1 35  ASP 35  396 396 ASP ASP A . n 
B 1 36  TYR 36  397 397 TYR TYR A . n 
B 1 37  MET 37  398 398 MET MET A . n 
B 1 38  LYS 38  399 399 LYS LYS A . n 
B 1 39  ASP 39  400 400 ASP ASP A . n 
B 1 40  ASP 40  401 401 ASP ASP A . n 
B 1 41  GLY 41  402 402 GLY GLY A . n 
B 1 42  GLY 42  403 403 GLY GLY A . n 
B 1 43  GLU 43  404 404 GLU GLU A . n 
B 1 44  LEU 44  405 405 LEU LEU A . n 
B 1 45  VAL 45  406 406 VAL VAL A . n 
B 1 46  ALA 46  407 407 ALA ALA A . n 
B 1 47  THR 47  408 408 THR THR A . n 
B 1 48  SER 48  409 409 SER SER A . n 
B 1 49  ILE 49  410 410 ILE ILE A . n 
B 1 50  VAL 50  411 411 VAL VAL A . n 
B 1 51  SER 51  412 412 SER SER A . n 
B 1 52  SER 52  413 413 SER SER A . n 
B 1 53  GLY 53  414 414 GLY GLY A . n 
B 1 54  GLY 54  415 415 GLY GLY A . n 
B 1 55  TYR 55  416 416 TYR TYR A . n 
B 1 56  ASN 56  417 417 ASN ASN A . n 
B 1 57  ASP 57  418 418 ASP ASP A . n 
B 1 58  VAL 58  419 419 VAL VAL A . n 
B 1 59  LEU 59  420 420 LEU LEU A . n 
B 1 60  ASP 60  421 421 ASP ASP A . n 
B 1 61  ASN 61  422 422 ASN ASN A . n 
B 1 62  SER 62  423 423 SER SER A . n 
B 1 63  ASP 63  424 424 ASP ASP A . n 
B 1 64  VAL 64  425 425 VAL VAL A . n 
B 1 65  LEU 65  426 426 LEU LEU A . n 
B 1 66  ILE 66  427 427 ILE ILE A . n 
B 1 67  TYR 67  428 428 TYR TYR A . n 
B 1 68  THR 68  429 429 THR THR A . n 
B 1 69  GLY 69  430 430 GLY GLY A . n 
B 1 70  GLN 70  431 431 GLN GLN A . n 
B 1 71  GLY 71  432 432 GLY GLY A . n 
B 1 72  GLY 72  433 433 GLY GLY A . n 
B 1 73  ASN 73  434 434 ASN ASN A . n 
B 1 74  VAL 74  435 ?   ?   ?   A . n 
B 1 75  GLY 75  436 ?   ?   ?   A . n 
B 1 76  LYS 76  437 ?   ?   ?   A . n 
B 1 77  LYS 77  438 ?   ?   ?   A . n 
B 1 78  LYS 78  439 ?   ?   ?   A . n 
B 1 79  ASN 79  440 ?   ?   ?   A . n 
B 1 80  ASN 80  441 ?   ?   ?   A . n 
B 1 81  GLU 81  442 442 GLU GLU A . n 
B 1 82  PRO 82  443 443 PRO PRO A . n 
B 1 83  PRO 83  444 444 PRO PRO A . n 
B 1 84  LYS 84  445 445 LYS LYS A . n 
B 1 85  ASP 85  446 446 ASP ASP A . n 
B 1 86  GLN 86  447 447 GLN GLN A . n 
B 1 87  GLN 87  448 448 GLN GLN A . n 
B 1 88  LEU 88  449 449 LEU LEU A . n 
B 1 89  VAL 89  450 450 VAL VAL A . n 
B 1 90  THR 90  451 451 THR THR A . n 
B 1 91  GLY 91  452 452 GLY GLY A . n 
B 1 92  ASN 92  453 453 ASN ASN A . n 
B 1 93  LEU 93  454 454 LEU LEU A . n 
B 1 94  ALA 94  455 455 ALA ALA A . n 
B 1 95  LEU 95  456 456 LEU LEU A . n 
B 1 96  LYS 96  457 457 LYS LYS A . n 
B 1 97  ASN 97  458 458 ASN ASN A . n 
B 1 98  SER 98  459 459 SER SER A . n 
B 1 99  ILE 99  460 460 ILE ILE A . n 
B 1 100 ASN 100 461 461 ASN ASN A . n 
B 1 101 LYS 101 462 462 LYS LYS A . n 
B 1 102 LYS 102 463 463 LYS LYS A . n 
B 1 103 ASN 103 464 464 ASN ASN A . n 
B 1 104 PRO 104 465 465 PRO PRO A . n 
B 1 105 VAL 105 466 466 VAL VAL A . n 
B 1 106 ARG 106 467 467 ARG ARG A . n 
B 1 107 VAL 107 468 468 VAL VAL A . n 
B 1 108 ILE 108 469 469 ILE ILE A . n 
B 1 109 ARG 109 470 470 ARG ARG A . n 
B 1 110 GLY 110 471 471 GLY GLY A . n 
B 1 111 ILE 111 472 472 ILE ILE A . n 
B 1 112 LYS 112 473 473 LYS LYS A . n 
B 1 113 ASN 113 474 ?   ?   ?   A . n 
B 1 114 THR 114 475 ?   ?   ?   A . n 
B 1 115 THR 115 476 ?   ?   ?   A . n 
B 1 116 LEU 116 477 ?   ?   ?   A . n 
B 1 117 GLN 117 478 ?   ?   ?   A . n 
B 1 118 SER 118 479 ?   ?   ?   A . n 
B 1 119 SER 119 480 ?   ?   ?   A . n 
B 1 120 VAL 120 481 ?   ?   ?   A . n 
B 1 121 VAL 121 482 ?   ?   ?   A . n 
B 1 122 ALA 122 483 ?   ?   ?   A . n 
B 1 123 LYS 123 484 484 LYS LYS A . n 
B 1 124 ASN 124 485 485 ASN ASN A . n 
B 1 125 TYR 125 486 486 TYR TYR A . n 
B 1 126 VAL 126 487 487 VAL VAL A . n 
B 1 127 TYR 127 488 488 TYR TYR A . n 
B 1 128 ASP 128 489 489 ASP ASP A . n 
B 1 129 GLY 129 490 490 GLY GLY A . n 
B 1 130 LEU 130 491 491 LEU LEU A . n 
B 1 131 TYR 131 492 492 TYR TYR A . n 
B 1 132 LEU 132 493 493 LEU LEU A . n 
B 1 133 VAL 133 494 494 VAL VAL A . n 
B 1 134 GLU 134 495 495 GLU GLU A . n 
B 1 135 GLU 135 496 496 GLU GLU A . n 
B 1 136 TYR 136 497 497 TYR TYR A . n 
B 1 137 TRP 137 498 498 TRP TRP A . n 
B 1 138 GLU 138 499 499 GLU GLU A . n 
B 1 139 GLU 139 500 500 GLU GLU A . n 
B 1 140 THR 140 501 501 THR THR A . n 
B 1 141 GLY 141 502 502 GLY GLY A . n 
B 1 142 SER 142 503 503 SER SER A . n 
B 1 143 HIS 143 504 504 HIS HIS A . n 
B 1 144 GLY 144 505 505 GLY GLY A . n 
B 1 145 LYS 145 506 506 LYS LYS A . n 
B 1 146 LEU 146 507 507 LEU LEU A . n 
B 1 147 VAL 147 508 508 VAL VAL A . n 
B 1 148 PHE 148 509 509 PHE PHE A . n 
B 1 149 LYS 149 510 510 LYS LYS A . n 
B 1 150 PHE 150 511 511 PHE PHE A . n 
B 1 151 LYS 151 512 512 LYS LYS A . n 
B 1 152 LEU 152 513 513 LEU LEU A . n 
B 1 153 ARG 153 514 514 ARG ARG A . n 
B 1 154 ARG 154 515 515 ARG ARG A . n 
B 1 155 ILE 155 516 516 ILE ILE A . n 
B 1 156 PRO 156 517 517 PRO PRO A . n 
B 1 157 GLY 157 518 518 GLY GLY A . n 
B 1 158 GLN 158 519 519 GLN GLN A . n 
B 1 159 PRO 159 520 520 PRO PRO A . n 
B 1 160 GLU 160 521 521 GLU GLU A . n 
B 1 161 LEU 161 522 522 LEU LEU A . n 
B 1 162 PRO 162 523 523 PRO PRO A . n 
B 1 163 TRP 163 524 524 TRP TRP A . n 
B 1 164 LYS 164 525 ?   ?   ?   A . n 
B 1 165 GLU 165 526 ?   ?   ?   A . n 
B 1 166 VAL 166 527 ?   ?   ?   A . n 
B 1 167 ALA 167 528 ?   ?   ?   A . n 
C 2 1   DC  1   1   1   DC  DC  B . n 
C 2 2   DT  2   2   2   DT  DT  B . n 
C 2 3   DG  3   3   3   DG  DG  B . n 
C 2 4   DA  4   4   4   DA  DA  B . n 
C 2 5   DG  5   5   5   DG  DG  B . n 
C 2 6   DG  6   6   6   DG  DG  B . n 
C 2 7   DA  7   7   7   DA  DA  B . n 
C 2 8   DG  8   8   8   DG  DG  B . n 
C 2 9   DT  9   9   9   DT  DT  B . n 
C 2 10  DA  10  10  10  DA  DA  B . n 
C 2 11  DT  11  11  11  DT  DT  B . n 
D 3 1   DT  1   1   1   DT  DT  C . n 
D 3 2   DA  2   2   2   DA  DA  C . n 
D 3 3   DC  3   3   3   DC  DC  C . n 
D 3 4   DT  4   4   4   DT  DT  C . n 
D 3 5   5CM 5   5   5   5CM 5CM C . n 
D 3 6   DC  6   6   6   DC  DC  C . n 
D 3 7   DT  7   7   7   DT  DT  C . n 
D 3 8   DC  8   8   8   DC  DC  C . n 
D 3 9   DA  9   9   9   DA  DA  C . n 
D 3 10  DG  10  10  10  DG  DG  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1 3  3  HOH HOH X . 
E 4 HOH 2 6  6  HOH HOH X . 
E 4 HOH 3 8  8  HOH HOH X . 
E 4 HOH 4 10 10 HOH HOH X . 
E 4 HOH 5 11 11 HOH HOH X . 
E 4 HOH 6 17 17 HOH HOH X . 
E 4 HOH 7 18 18 HOH HOH X . 
F 4 HOH 1 4  4  HOH HOH A . 
F 4 HOH 2 7  7  HOH HOH A . 
F 4 HOH 3 12 12 HOH HOH A . 
F 4 HOH 4 13 13 HOH HOH A . 
F 4 HOH 5 14 14 HOH HOH A . 
F 4 HOH 6 16 16 HOH HOH A . 
G 4 HOH 1 12 2  HOH HOH B . 
G 4 HOH 2 15 15 HOH HOH B . 
H 4 HOH 1 11 1  HOH HOH C . 
H 4 HOH 2 12 5  HOH HOH C . 
H 4 HOH 3 13 9  HOH HOH C . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    D 
_pdbx_struct_mod_residue.label_comp_id    5CM 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     5CM 
_pdbx_struct_mod_residue.auth_seq_id      5 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4780  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  16530 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-02-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum           ? 1 
MOLREP   phasing           MR                ? 2 
PHENIX   refinement        '(phenix.refine)' ? 3 
HKL-2000 'data reduction'  .                 ? 4 
HKL-2000 'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DC 1  ? ? "C4'" B DC 1  ? ? "C3'" B DC 1  ? ? 101.55 104.50 -2.95 0.40 N 
2  1 "C3'" B DG 3  ? ? "C2'" B DG 3  ? ? "C1'" B DG 3  ? ? 93.70  102.40 -8.70 0.80 N 
3  1 "O4'" B DG 5  ? ? "C1'" B DG 5  ? ? N9    B DG 5  ? ? 114.27 108.30 5.97  0.30 N 
4  1 "C3'" B DG 6  ? ? "C2'" B DG 6  ? ? "C1'" B DG 6  ? ? 95.89  102.40 -6.51 0.80 N 
5  1 "C3'" B DT 9  ? ? "C2'" B DT 9  ? ? "C1'" B DT 9  ? ? 97.51  102.40 -4.89 0.80 N 
6  1 "O4'" B DT 9  ? ? "C1'" B DT 9  ? ? N1    B DT 9  ? ? 110.62 108.30 2.32  0.30 N 
7  1 "O4'" B DT 11 ? ? "C1'" B DT 11 ? ? N1    B DT 11 ? ? 115.68 108.30 7.38  0.30 N 
8  1 "C3'" C DC 6  ? ? "O3'" C DC 6  ? ? P     C DT 7  ? ? 129.18 119.70 9.48  1.20 Y 
9  1 N1    C DT 7  ? ? "C1'" C DT 7  ? ? "C2'" C DT 7  ? ? 123.38 114.30 9.08  1.40 N 
10 1 "O4'" C DT 7  ? ? "C1'" C DT 7  ? ? N1    C DT 7  ? ? 101.58 108.00 -6.42 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN X 392 ? ? -136.06 -45.30  
2  1 SER X 413 ? ? -97.40  -123.52 
3  1 ASP X 421 ? ? -137.90 -125.40 
4  1 ASN X 422 ? ? -115.26 52.56   
5  1 THR X 451 ? ? 48.38   -127.81 
6  1 PRO X 520 ? ? -48.57  156.73  
7  1 GLN A 392 ? ? -136.04 -44.61  
8  1 SER A 413 ? ? -97.60  -123.17 
9  1 ASN A 417 ? ? -53.78  88.19   
10 1 ASP A 421 ? ? -75.84  -144.89 
11 1 THR A 451 ? ? 48.64   -128.50 
12 1 PRO A 520 ? ? -48.72  157.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 X ASP 401 ? CB  ? A ASP 40  CB  
2  1 Y 1 X ASP 401 ? CG  ? A ASP 40  CG  
3  1 Y 1 X ASP 401 ? OD1 ? A ASP 40  OD1 
4  1 Y 1 X ASP 401 ? OD2 ? A ASP 40  OD2 
5  1 Y 1 X GLU 404 ? CG  ? A GLU 43  CG  
6  1 Y 1 X GLU 404 ? CD  ? A GLU 43  CD  
7  1 Y 1 X GLU 404 ? OE1 ? A GLU 43  OE1 
8  1 Y 1 X GLU 404 ? OE2 ? A GLU 43  OE2 
9  1 Y 1 X LYS 473 ? CG  ? A LYS 112 CG  
10 1 Y 1 X LYS 473 ? CD  ? A LYS 112 CD  
11 1 Y 1 X LYS 473 ? CE  ? A LYS 112 CE  
12 1 Y 1 X LYS 473 ? NZ  ? A LYS 112 NZ  
13 1 Y 1 X LYS 506 ? CG  ? A LYS 145 CG  
14 1 Y 1 X LYS 506 ? CD  ? A LYS 145 CD  
15 1 Y 1 X LYS 506 ? CE  ? A LYS 145 CE  
16 1 Y 1 X LYS 506 ? NZ  ? A LYS 145 NZ  
17 1 Y 1 X GLU 521 ? CG  ? A GLU 160 CG  
18 1 Y 1 X GLU 521 ? CD  ? A GLU 160 CD  
19 1 Y 1 X GLU 521 ? OE1 ? A GLU 160 OE1 
20 1 Y 1 X GLU 521 ? OE2 ? A GLU 160 OE2 
21 1 Y 1 X TRP 524 ? CG  ? A TRP 163 CG  
22 1 Y 1 X TRP 524 ? CD1 ? A TRP 163 CD1 
23 1 Y 1 X TRP 524 ? CD2 ? A TRP 163 CD2 
24 1 Y 1 X TRP 524 ? NE1 ? A TRP 163 NE1 
25 1 Y 1 X TRP 524 ? CE2 ? A TRP 163 CE2 
26 1 Y 1 X TRP 524 ? CE3 ? A TRP 163 CE3 
27 1 Y 1 X TRP 524 ? CZ2 ? A TRP 163 CZ2 
28 1 Y 1 X TRP 524 ? CZ3 ? A TRP 163 CZ3 
29 1 Y 1 X TRP 524 ? CH2 ? A TRP 163 CH2 
30 1 Y 1 A ASP 401 ? CB  ? B ASP 40  CB  
31 1 Y 1 A ASP 401 ? CG  ? B ASP 40  CG  
32 1 Y 1 A ASP 401 ? OD1 ? B ASP 40  OD1 
33 1 Y 1 A ASP 401 ? OD2 ? B ASP 40  OD2 
34 1 Y 1 A ASN 417 ? CG  ? B ASN 56  CG  
35 1 Y 1 A ASN 417 ? OD1 ? B ASN 56  OD1 
36 1 Y 1 A ASN 417 ? ND2 ? B ASN 56  ND2 
37 1 Y 1 A GLU 442 ? CG  ? B GLU 81  CG  
38 1 Y 1 A GLU 442 ? CD  ? B GLU 81  CD  
39 1 Y 1 A GLU 442 ? OE1 ? B GLU 81  OE1 
40 1 Y 1 A GLU 442 ? OE2 ? B GLU 81  OE2 
41 1 Y 1 A LYS 473 ? CG  ? B LYS 112 CG  
42 1 Y 1 A LYS 473 ? CD  ? B LYS 112 CD  
43 1 Y 1 A LYS 473 ? CE  ? B LYS 112 CE  
44 1 Y 1 A LYS 473 ? NZ  ? B LYS 112 NZ  
45 1 Y 1 A LYS 484 ? CG  ? B LYS 123 CG  
46 1 Y 1 A LYS 484 ? CD  ? B LYS 123 CD  
47 1 Y 1 A LYS 484 ? CE  ? B LYS 123 CE  
48 1 Y 1 A LYS 484 ? NZ  ? B LYS 123 NZ  
49 1 Y 1 A GLU 521 ? CG  ? B GLU 160 CG  
50 1 Y 1 A GLU 521 ? CD  ? B GLU 160 CD  
51 1 Y 1 A GLU 521 ? OE1 ? B GLU 160 OE1 
52 1 Y 1 A GLU 521 ? OE2 ? B GLU 160 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X VAL 435 ? A VAL 74  
2  1 Y 1 X GLY 436 ? A GLY 75  
3  1 Y 1 X LYS 437 ? A LYS 76  
4  1 Y 1 X LYS 438 ? A LYS 77  
5  1 Y 1 X LYS 439 ? A LYS 78  
6  1 Y 1 X ASN 440 ? A ASN 79  
7  1 Y 1 X ASN 441 ? A ASN 80  
8  1 Y 1 X GLU 442 ? A GLU 81  
9  1 Y 1 X ASN 474 ? A ASN 113 
10 1 Y 1 X THR 475 ? A THR 114 
11 1 Y 1 X THR 476 ? A THR 115 
12 1 Y 1 X LEU 477 ? A LEU 116 
13 1 Y 1 X GLN 478 ? A GLN 117 
14 1 Y 1 X SER 479 ? A SER 118 
15 1 Y 1 X SER 480 ? A SER 119 
16 1 Y 1 X VAL 481 ? A VAL 120 
17 1 Y 1 X VAL 482 ? A VAL 121 
18 1 Y 1 X ALA 483 ? A ALA 122 
19 1 Y 1 X LYS 525 ? A LYS 164 
20 1 Y 1 X GLU 526 ? A GLU 165 
21 1 Y 1 X VAL 527 ? A VAL 166 
22 1 Y 1 X ALA 528 ? A ALA 167 
23 1 Y 1 A VAL 435 ? B VAL 74  
24 1 Y 1 A GLY 436 ? B GLY 75  
25 1 Y 1 A LYS 437 ? B LYS 76  
26 1 Y 1 A LYS 438 ? B LYS 77  
27 1 Y 1 A LYS 439 ? B LYS 78  
28 1 Y 1 A ASN 440 ? B ASN 79  
29 1 Y 1 A ASN 441 ? B ASN 80  
30 1 Y 1 A ASN 474 ? B ASN 113 
31 1 Y 1 A THR 475 ? B THR 114 
32 1 Y 1 A THR 476 ? B THR 115 
33 1 Y 1 A LEU 477 ? B LEU 116 
34 1 Y 1 A GLN 478 ? B GLN 117 
35 1 Y 1 A SER 479 ? B SER 118 
36 1 Y 1 A SER 480 ? B SER 119 
37 1 Y 1 A VAL 481 ? B VAL 120 
38 1 Y 1 A VAL 482 ? B VAL 121 
39 1 Y 1 A ALA 483 ? B ALA 122 
40 1 Y 1 A LYS 525 ? B LYS 164 
41 1 Y 1 A GLU 526 ? B GLU 165 
42 1 Y 1 A VAL 527 ? B VAL 166 
43 1 Y 1 A ALA 528 ? B ALA 167 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3Q0F 'double helix'         
3Q0F 'b-form double helix'  
3Q0F 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 1 1_555 D DG 10 1_555 -0.384 -0.230 1.057  -30.085 -2.958  -4.122  1 B_DC1:DG10_C B 1 ? C 10 ? 19 1 
1 C DT 2 1_555 D DA 9  1_555 -1.823 -0.333 1.165  -21.554 -5.691  -6.585  2 B_DT2:DA9_C  B 2 ? C 9  ? 20 1 
1 C DG 3 1_555 D DC 8  1_555 -1.778 -0.703 0.533  -2.489  -5.672  -18.923 3 B_DG3:DC8_C  B 3 ? C 8  ? ?  1 
1 C DA 4 1_555 D DT 7  1_555 0.830  -0.165 0.845  4.948   -9.470  -8.754  4 B_DA4:DT7_C  B 4 ? C 7  ? 20 1 
1 C DG 5 1_555 D DC 6  1_555 0.163  -0.125 0.639  8.083   -10.459 -2.231  5 B_DG5:DC6_C  B 5 ? C 6  ? 19 1 
1 C DA 7 1_555 D DT 4  1_555 -0.181 -0.425 -0.120 -15.560 4.228   -5.331  6 B_DA7:DT4_C  B 7 ? C 4  ? 20 1 
1 C DG 8 1_555 D DC 3  1_555 -0.881 -0.045 -0.336 -7.710  3.727   7.515   7 B_DG8:DC3_C  B 8 ? C 3  ? 19 1 
1 C DT 9 1_555 D DA 2  1_555 -0.197 -0.227 -0.359 12.243  6.394   -5.032  8 B_DT9:DA2_C  B 9 ? C 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 1 1_555 D DG 10 1_555 C DT 2 1_555 D DA 9 1_555 -0.797 -0.463 3.079 -0.991 -7.684 32.327 0.428  1.234  3.126 -13.559 1.750 
33.218 1 BB_DC1DT2:DA9DG10_CC B 1 ? C 10 ? B 2 ? C 9 ? 
1 C DT 2 1_555 D DA 9  1_555 C DG 3 1_555 D DC 8 1_555 -0.156 1.093  2.913 7.069  -3.625 32.965 2.383  1.255  2.691 -6.275  
-12.236 33.883 2 BB_DT2DG3:DC8DA9_CC  B 2 ? C 9  ? B 3 ? C 8 ? 
1 C DG 3 1_555 D DC 8  1_555 C DA 4 1_555 D DT 7 1_555 -0.315 1.351  3.353 -5.349 -8.927 53.642 2.013  0.020  3.125 -9.788  5.865 
54.568 3 BB_DG3DA4:DT7DC8_CC  B 3 ? C 8  ? B 4 ? C 7 ? 
1 C DA 4 1_555 D DT 7  1_555 C DG 5 1_555 D DC 6 1_555 1.210  -0.326 3.014 5.794  1.073  25.132 -1.017 -1.155 3.191 2.424   
-13.087 25.803 4 BB_DA4DG5:DC6DT7_CC  B 4 ? C 7  ? B 5 ? C 6 ? 
1 C DA 7 1_555 D DT 4  1_555 C DG 8 1_555 D DC 3 1_555 1.084  -0.118 3.159 1.347  9.672  29.298 -2.047 -1.784 3.014 18.486  -2.574 
30.848 5 BB_DA7DG8:DC3DT4_CC  B 7 ? C 4  ? B 8 ? C 3 ? 
1 C DG 8 1_555 D DC 3  1_555 C DT 9 1_555 D DA 2 1_555 -0.238 -0.393 2.910 2.511  1.831  31.045 -1.039 0.865  2.855 3.410   -4.677 
31.196 6 BB_DG8DT9:DA2DC3_CC  B 8 ? C 3  ? B 9 ? C 2 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#