data_3Q29
# 
_entry.id   3Q29 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3Q29         
RCSB  RCSB063102   
WWPDB D_1000063102 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3Q25 . unspecified 
PDB 3Q26 . unspecified 
PDB 3Q27 . unspecified 
PDB 3Q28 . unspecified 
# 
_pdbx_database_status.entry_id                        3Q29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-19 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, M.'      1 
'Sawaya, M.R.'  2 
'Cascio, D.'    3 
'Eisenberg, D.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            20 
_citation.page_first                996 
_citation.page_last                 1004 
_citation.year                      2011 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21462277 
_citation.pdbx_database_id_DOI      10.1002/pro.630 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhao, M.'      1 
primary 'Cascio, D.'    2 
primary 'Sawaya, M.R.'  3 
primary 'Eisenberg, D.' 4 
# 
_cell.length_a           68.390 
_cell.length_b           117.470 
_cell.length_c           146.490 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3Q29 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3Q29 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Maltose-binding periplasmic protein/alpha-synuclein chimeric protein' 42696.395 2   ? ? ? ? 
2 non-polymer man MALTOSE                                                                342.296   2   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                          96.063    11  ? ? ? ? 
4 non-polymer syn GLYCEROL                                                               92.094    4   ? ? ? ? 
5 water       nat water                                                                  18.015    190 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEI
TPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP
LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAA
TMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEGVVAAA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEI
TPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP
LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAA
TMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEGVVAAA
;
_entity_poly.pdbx_strand_id                 A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ILE n 
1 4   GLU n 
1 5   GLU n 
1 6   GLY n 
1 7   LYS n 
1 8   LEU n 
1 9   VAL n 
1 10  ILE n 
1 11  TRP n 
1 12  ILE n 
1 13  ASN n 
1 14  GLY n 
1 15  ASP n 
1 16  LYS n 
1 17  GLY n 
1 18  TYR n 
1 19  ASN n 
1 20  GLY n 
1 21  LEU n 
1 22  ALA n 
1 23  GLU n 
1 24  VAL n 
1 25  GLY n 
1 26  LYS n 
1 27  LYS n 
1 28  PHE n 
1 29  GLU n 
1 30  LYS n 
1 31  ASP n 
1 32  THR n 
1 33  GLY n 
1 34  ILE n 
1 35  LYS n 
1 36  VAL n 
1 37  THR n 
1 38  VAL n 
1 39  GLU n 
1 40  HIS n 
1 41  PRO n 
1 42  ASP n 
1 43  LYS n 
1 44  LEU n 
1 45  GLU n 
1 46  GLU n 
1 47  LYS n 
1 48  PHE n 
1 49  PRO n 
1 50  GLN n 
1 51  VAL n 
1 52  ALA n 
1 53  ALA n 
1 54  THR n 
1 55  GLY n 
1 56  ASP n 
1 57  GLY n 
1 58  PRO n 
1 59  ASP n 
1 60  ILE n 
1 61  ILE n 
1 62  PHE n 
1 63  TRP n 
1 64  ALA n 
1 65  HIS n 
1 66  ASP n 
1 67  ARG n 
1 68  PHE n 
1 69  GLY n 
1 70  GLY n 
1 71  TYR n 
1 72  ALA n 
1 73  GLN n 
1 74  SER n 
1 75  GLY n 
1 76  LEU n 
1 77  LEU n 
1 78  ALA n 
1 79  GLU n 
1 80  ILE n 
1 81  THR n 
1 82  PRO n 
1 83  ASP n 
1 84  LYS n 
1 85  ALA n 
1 86  PHE n 
1 87  GLN n 
1 88  ASP n 
1 89  LYS n 
1 90  LEU n 
1 91  TYR n 
1 92  PRO n 
1 93  PHE n 
1 94  THR n 
1 95  TRP n 
1 96  ASP n 
1 97  ALA n 
1 98  VAL n 
1 99  ARG n 
1 100 TYR n 
1 101 ASN n 
1 102 GLY n 
1 103 LYS n 
1 104 LEU n 
1 105 ILE n 
1 106 ALA n 
1 107 TYR n 
1 108 PRO n 
1 109 ILE n 
1 110 ALA n 
1 111 VAL n 
1 112 GLU n 
1 113 ALA n 
1 114 LEU n 
1 115 SER n 
1 116 LEU n 
1 117 ILE n 
1 118 TYR n 
1 119 ASN n 
1 120 LYS n 
1 121 ASP n 
1 122 LEU n 
1 123 LEU n 
1 124 PRO n 
1 125 ASN n 
1 126 PRO n 
1 127 PRO n 
1 128 LYS n 
1 129 THR n 
1 130 TRP n 
1 131 GLU n 
1 132 GLU n 
1 133 ILE n 
1 134 PRO n 
1 135 ALA n 
1 136 LEU n 
1 137 ASP n 
1 138 LYS n 
1 139 GLU n 
1 140 LEU n 
1 141 LYS n 
1 142 ALA n 
1 143 LYS n 
1 144 GLY n 
1 145 LYS n 
1 146 SER n 
1 147 ALA n 
1 148 LEU n 
1 149 MET n 
1 150 PHE n 
1 151 ASN n 
1 152 LEU n 
1 153 GLN n 
1 154 GLU n 
1 155 PRO n 
1 156 TYR n 
1 157 PHE n 
1 158 THR n 
1 159 TRP n 
1 160 PRO n 
1 161 LEU n 
1 162 ILE n 
1 163 ALA n 
1 164 ALA n 
1 165 ASP n 
1 166 GLY n 
1 167 GLY n 
1 168 TYR n 
1 169 ALA n 
1 170 PHE n 
1 171 LYS n 
1 172 TYR n 
1 173 GLU n 
1 174 ASN n 
1 175 GLY n 
1 176 LYS n 
1 177 TYR n 
1 178 ASP n 
1 179 ILE n 
1 180 LYS n 
1 181 ASP n 
1 182 VAL n 
1 183 GLY n 
1 184 VAL n 
1 185 ASP n 
1 186 ASN n 
1 187 ALA n 
1 188 GLY n 
1 189 ALA n 
1 190 LYS n 
1 191 ALA n 
1 192 GLY n 
1 193 LEU n 
1 194 THR n 
1 195 PHE n 
1 196 LEU n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 ILE n 
1 201 LYS n 
1 202 ASN n 
1 203 LYS n 
1 204 HIS n 
1 205 MET n 
1 206 ASN n 
1 207 ALA n 
1 208 ASP n 
1 209 THR n 
1 210 ASP n 
1 211 TYR n 
1 212 SER n 
1 213 ILE n 
1 214 ALA n 
1 215 GLU n 
1 216 ALA n 
1 217 ALA n 
1 218 PHE n 
1 219 ASN n 
1 220 LYS n 
1 221 GLY n 
1 222 GLU n 
1 223 THR n 
1 224 ALA n 
1 225 MET n 
1 226 THR n 
1 227 ILE n 
1 228 ASN n 
1 229 GLY n 
1 230 PRO n 
1 231 TRP n 
1 232 ALA n 
1 233 TRP n 
1 234 SER n 
1 235 ASN n 
1 236 ILE n 
1 237 ASP n 
1 238 THR n 
1 239 SER n 
1 240 LYS n 
1 241 VAL n 
1 242 ASN n 
1 243 TYR n 
1 244 GLY n 
1 245 VAL n 
1 246 THR n 
1 247 VAL n 
1 248 LEU n 
1 249 PRO n 
1 250 THR n 
1 251 PHE n 
1 252 LYS n 
1 253 GLY n 
1 254 GLN n 
1 255 PRO n 
1 256 SER n 
1 257 LYS n 
1 258 PRO n 
1 259 PHE n 
1 260 VAL n 
1 261 GLY n 
1 262 VAL n 
1 263 LEU n 
1 264 SER n 
1 265 ALA n 
1 266 GLY n 
1 267 ILE n 
1 268 ASN n 
1 269 ALA n 
1 270 ALA n 
1 271 SER n 
1 272 PRO n 
1 273 ASN n 
1 274 LYS n 
1 275 GLU n 
1 276 LEU n 
1 277 ALA n 
1 278 LYS n 
1 279 GLU n 
1 280 PHE n 
1 281 LEU n 
1 282 GLU n 
1 283 ASN n 
1 284 TYR n 
1 285 LEU n 
1 286 LEU n 
1 287 THR n 
1 288 ASP n 
1 289 GLU n 
1 290 GLY n 
1 291 LEU n 
1 292 GLU n 
1 293 ALA n 
1 294 VAL n 
1 295 ASN n 
1 296 LYS n 
1 297 ASP n 
1 298 LYS n 
1 299 PRO n 
1 300 LEU n 
1 301 GLY n 
1 302 ALA n 
1 303 VAL n 
1 304 ALA n 
1 305 LEU n 
1 306 LYS n 
1 307 SER n 
1 308 TYR n 
1 309 GLU n 
1 310 GLU n 
1 311 GLU n 
1 312 LEU n 
1 313 ALA n 
1 314 LYS n 
1 315 ASP n 
1 316 PRO n 
1 317 ARG n 
1 318 ILE n 
1 319 ALA n 
1 320 ALA n 
1 321 THR n 
1 322 MET n 
1 323 GLU n 
1 324 ASN n 
1 325 ALA n 
1 326 GLN n 
1 327 LYS n 
1 328 GLY n 
1 329 GLU n 
1 330 ILE n 
1 331 MET n 
1 332 PRO n 
1 333 ASN n 
1 334 ILE n 
1 335 PRO n 
1 336 GLN n 
1 337 MET n 
1 338 SER n 
1 339 ALA n 
1 340 PHE n 
1 341 TRP n 
1 342 TYR n 
1 343 ALA n 
1 344 VAL n 
1 345 ARG n 
1 346 THR n 
1 347 ALA n 
1 348 VAL n 
1 349 ILE n 
1 350 ASN n 
1 351 ALA n 
1 352 ALA n 
1 353 SER n 
1 354 GLY n 
1 355 ARG n 
1 356 GLN n 
1 357 THR n 
1 358 VAL n 
1 359 ASP n 
1 360 GLU n 
1 361 ALA n 
1 362 LEU n 
1 363 LYS n 
1 364 ASP n 
1 365 ALA n 
1 366 GLN n 
1 367 THR n 
1 368 ASN n 
1 369 SER n 
1 370 SER n 
1 371 SER n 
1 372 MET n 
1 373 ASP n 
1 374 VAL n 
1 375 PHE n 
1 376 MET n 
1 377 LYS n 
1 378 GLY n 
1 379 LEU n 
1 380 SER n 
1 381 LYS n 
1 382 ALA n 
1 383 LYS n 
1 384 GLU n 
1 385 GLY n 
1 386 VAL n 
1 387 VAL n 
1 388 ALA n 
1 389 ALA n 
1 390 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 2   367 ? ? SNCA ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 (DE3)' 
? ? ? ? ? ? ? plasmid ? ? ? pMAL-C2X ? ? 
1 2 sample ? 372 390 ? ? SNCA ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 (DE3)' 
? ? ? ? ? ? ? plasmid ? ? ? pMAL-C2X ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MALE_ECOLI P0AEX9 1 
;KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT
PDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPL
IAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT
MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
;
27 ? 
2 UNP SYUA_HUMAN P37840 1 MDVFMKGLSKAKEGVVAAA 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3Q29 A 2   ? 367 ? P0AEX9 27 ? 392 ? 2   367 
2 2 3Q29 A 372 ? 390 ? P37840 1  ? 19  ? 372 390 
3 1 3Q29 C 2   ? 367 ? P0AEX9 27 ? 392 ? 2   367 
4 2 3Q29 C 372 ? 390 ? P37840 1  ? 19  ? 372 390 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3Q29 MET A 1   ? UNP P0AEX9 ? ? 'INITIATING METHIONINE' 1   1  
1 3Q29 ASN A 368 ? UNP P0AEX9 ? ? LINKER                  368 2  
1 3Q29 SER A 369 ? UNP P0AEX9 ? ? LINKER                  369 3  
1 3Q29 SER A 370 ? UNP P0AEX9 ? ? LINKER                  370 4  
1 3Q29 SER A 371 ? UNP P0AEX9 ? ? LINKER                  371 5  
3 3Q29 MET A 1   ? UNP P0AEX9 ? ? 'INITIATING METHIONINE' 1   6  
3 3Q29 ASN C 368 ? UNP P0AEX9 ? ? LINKER                  368 7  
3 3Q29 SER C 369 ? UNP P0AEX9 ? ? LINKER                  369 8  
3 3Q29 SER C 370 ? UNP P0AEX9 ? ? LINKER                  370 9  
3 3Q29 SER C 371 ? UNP P0AEX9 ? ? LINKER                  371 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MAL D-saccharide        . MALTOSE         ?                               'C12 H22 O11'    342.296 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3Q29 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.46 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   64.41 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.pdbx_details    '0.1M TRIS pH 8.0, 2.4 M AMMONIUM SULFATE, vapor diffusion, hanging drop, temperature 290K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-04-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97938 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength_list        0.97938 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3Q29 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   53017 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_netI_over_sigmaI        16.320 
_reflns.percent_possible_obs         99.600 
_reflns.B_iso_Wilson_estimate        50.218 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.5320 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300  2.360  19139 ? 3883 0.461 3.3  ? ? ? ? ? 100.000 1  1 
2.360  2.420  18623 ? 3762 0.389 3.9  ? ? ? ? ? 99.900  2  1 
2.420  2.490  18133 ? 3683 0.326 4.6  ? ? ? ? ? 99.900  3  1 
2.490  2.570  17678 ? 3595 0.273 5.4  ? ? ? ? ? 99.900  4  1 
2.570  2.660  17108 ? 3468 0.217 6.9  ? ? ? ? ? 99.900  5  1 
2.660  2.750  16542 ? 3360 0.168 8.5  ? ? ? ? ? 99.900  6  1 
2.750  2.850  15991 ? 3252 0.136 10.1 ? ? ? ? ? 100.000 7  1 
2.850  2.970  15337 ? 3123 0.108 12.2 ? ? ? ? ? 99.900  8  1 
2.970  3.100  14745 ? 3022 0.087 15.3 ? ? ? ? ? 99.900  9  1 
3.100  3.250  13958 ? 2862 0.068 18.6 ? ? ? ? ? 99.800  10 1 
3.250  3.430  13229 ? 2729 0.056 22.1 ? ? ? ? ? 99.700  11 1 
3.430  3.640  12485 ? 2599 0.048 25.9 ? ? ? ? ? 99.700  12 1 
3.640  3.890  11640 ? 2443 0.044 28.9 ? ? ? ? ? 99.600  13 1 
3.890  4.200  10792 ? 2295 0.041 31.3 ? ? ? ? ? 99.800  14 1 
4.200  4.600  9751  ? 2119 0.039 33.3 ? ? ? ? ? 99.700  15 1 
4.600  5.140  8861  ? 1915 0.037 34.1 ? ? ? ? ? 99.700  16 1 
5.140  5.940  8201  ? 1715 0.036 34.2 ? ? ? ? ? 99.700  17 1 
5.940  7.270  6869  ? 1453 0.034 35.7 ? ? ? ? ? 99.500  18 1 
7.270  10.290 5068  ? 1135 0.033 36.6 ? ? ? ? ? 97.300  19 1 
10.290 ?      2262  ? 604  0.031 33.2 ? ? ? ? ? 87.000  20 1 
# 
_refine.entry_id                                 3Q29 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             34.5320 
_refine.pdbx_ls_sigma_F                          1.990 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6300 
_refine.ls_number_reflns_obs                     53001 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1945 
_refine.ls_R_factor_R_work                       0.1926 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2318 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  2650 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               53.8536 
_refine.solvent_model_param_bsol                 47.0750 
_refine.solvent_model_param_ksol                 0.3430 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            19.7861 
_refine.aniso_B[2][2]                            -7.9676 
_refine.aniso_B[3][3]                            -11.8185 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3300 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9500 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ANF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8066 
_refine.B_iso_max                                201.190 
_refine.B_iso_min                                21.480 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5858 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             190 
_refine_hist.number_atoms_total               6173 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        34.5320 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           6114 0.004  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          8314 0.837  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     912  0.056  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      1062 0.003  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 2203 12.606 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.3000 2.3418  19 100.0000 2621 . 0.2765 0.3467 . 138 . 2759 . . 'X-RAY DIFFRACTION' 
2.3418 2.3869  19 100.0000 2603 . 0.2486 0.2578 . 137 . 2740 . . 'X-RAY DIFFRACTION' 
2.3869 2.4356  19 100.0000 2636 . 0.2367 0.2947 . 139 . 2775 . . 'X-RAY DIFFRACTION' 
2.4356 2.4885  19 100.0000 2597 . 0.2456 0.2887 . 136 . 2733 . . 'X-RAY DIFFRACTION' 
2.4885 2.5464  19 100.0000 2646 . 0.2505 0.2860 . 139 . 2785 . . 'X-RAY DIFFRACTION' 
2.5464 2.6100  19 100.0000 2636 . 0.2463 0.3313 . 139 . 2775 . . 'X-RAY DIFFRACTION' 
2.6100 2.6806  19 100.0000 2603 . 0.2407 0.3289 . 137 . 2740 . . 'X-RAY DIFFRACTION' 
2.6806 2.7594  19 100.0000 2646 . 0.2244 0.2858 . 139 . 2785 . . 'X-RAY DIFFRACTION' 
2.7594 2.8484  19 100.0000 2641 . 0.2299 0.2583 . 140 . 2781 . . 'X-RAY DIFFRACTION' 
2.8484 2.9502  19 100.0000 2632 . 0.2350 0.2883 . 138 . 2770 . . 'X-RAY DIFFRACTION' 
2.9502 3.0683  19 100.0000 2635 . 0.2352 0.2953 . 139 . 2774 . . 'X-RAY DIFFRACTION' 
3.0683 3.2078  19 100.0000 2627 . 0.2319 0.2750 . 138 . 2765 . . 'X-RAY DIFFRACTION' 
3.2078 3.3768  19 100.0000 2660 . 0.2271 0.2651 . 140 . 2800 . . 'X-RAY DIFFRACTION' 
3.3768 3.5882  19 100.0000 2680 . 0.2079 0.2698 . 141 . 2821 . . 'X-RAY DIFFRACTION' 
3.5882 3.8649  19 100.0000 2648 . 0.1805 0.2156 . 139 . 2787 . . 'X-RAY DIFFRACTION' 
3.8649 4.2532  19 100.0000 2692 . 0.1530 0.1994 . 142 . 2834 . . 'X-RAY DIFFRACTION' 
4.2532 4.8671  19 100.0000 2681 . 0.1310 0.1501 . 141 . 2822 . . 'X-RAY DIFFRACTION' 
4.8671 6.1265  19 100.0000 2711 . 0.1535 0.1852 . 143 . 2854 . . 'X-RAY DIFFRACTION' 
6.1265 34.5357 19 96.0000  2756 . 0.1691 0.1856 . 145 . 2901 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3Q29 
_struct.title                     'Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP)' 
_struct.pdbx_descriptor           'Maltose-binding periplasmic protein/alpha-synuclein chimeric protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3Q29 
_struct_keywords.text            'fusion protein, amyloid, SUGAR BINDING PROTEIN, PROTEIN FIBRIL' 
_struct_keywords.pdbx_keywords   'SUGAR BINDING PROTEIN, PROTEIN FIBRIL' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 2 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 4 ? 
T N N 5 ? 
U N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 17  ? LYS A 30  ? GLY A 17  LYS A 30  1 ? 14 
HELX_P HELX_P2  2  LYS A 43  ? ALA A 52  ? LYS A 43  ALA A 52  1 ? 10 
HELX_P HELX_P3  3  ALA A 53  ? GLY A 55  ? ALA A 53  GLY A 55  5 ? 3  
HELX_P HELX_P4  4  ARG A 67  ? SER A 74  ? ARG A 67  SER A 74  1 ? 8  
HELX_P HELX_P5  5  ASP A 83  ? ASP A 88  ? ASP A 83  ASP A 88  1 ? 6  
HELX_P HELX_P6  6  TYR A 91  ? VAL A 98  ? TYR A 91  VAL A 98  1 ? 8  
HELX_P HELX_P7  7  THR A 129 ? GLU A 131 ? THR A 129 GLU A 131 5 ? 3  
HELX_P HELX_P8  8  GLU A 132 ? ALA A 142 ? GLU A 132 ALA A 142 1 ? 11 
HELX_P HELX_P9  9  GLU A 154 ? PHE A 157 ? GLU A 154 PHE A 157 5 ? 4  
HELX_P HELX_P10 10 THR A 158 ? ASP A 165 ? THR A 158 ASP A 165 1 ? 8  
HELX_P HELX_P11 11 ASN A 186 ? ASN A 202 ? ASN A 186 ASN A 202 1 ? 17 
HELX_P HELX_P12 12 ASP A 210 ? LYS A 220 ? ASP A 210 LYS A 220 1 ? 11 
HELX_P HELX_P13 13 GLY A 229 ? TRP A 231 ? GLY A 229 TRP A 231 5 ? 3  
HELX_P HELX_P14 14 ALA A 232 ? LYS A 240 ? ALA A 232 LYS A 240 1 ? 9  
HELX_P HELX_P15 15 ASN A 273 ? TYR A 284 ? ASN A 273 TYR A 284 1 ? 12 
HELX_P HELX_P16 16 THR A 287 ? LYS A 298 ? THR A 287 LYS A 298 1 ? 12 
HELX_P HELX_P17 17 LEU A 305 ? SER A 307 ? LEU A 305 SER A 307 5 ? 3  
HELX_P HELX_P18 18 TYR A 308 ? ASP A 315 ? TYR A 308 ASP A 315 1 ? 8  
HELX_P HELX_P19 19 ASP A 315 ? GLY A 328 ? ASP A 315 GLY A 328 1 ? 14 
HELX_P HELX_P20 20 GLN A 336 ? GLY A 354 ? GLN A 336 GLY A 354 1 ? 19 
HELX_P HELX_P21 21 THR A 357 ? SER A 370 ? THR A 357 SER A 370 1 ? 14 
HELX_P HELX_P22 22 SER A 371 ? SER A 380 ? SER A 371 SER A 380 1 ? 10 
HELX_P HELX_P23 23 GLY B 17  ? GLY B 33  ? GLY C 17  GLY C 33  1 ? 17 
HELX_P HELX_P24 24 LYS B 43  ? ALA B 53  ? LYS C 43  ALA C 53  1 ? 11 
HELX_P HELX_P25 25 ARG B 67  ? SER B 74  ? ARG C 67  SER C 74  1 ? 8  
HELX_P HELX_P26 26 ASP B 83  ? ASP B 88  ? ASP C 83  ASP C 88  1 ? 6  
HELX_P HELX_P27 27 TYR B 91  ? VAL B 98  ? TYR C 91  VAL C 98  1 ? 8  
HELX_P HELX_P28 28 GLU B 132 ? ALA B 142 ? GLU C 132 ALA C 142 1 ? 11 
HELX_P HELX_P29 29 GLU B 154 ? ASP B 165 ? GLU C 154 ASP C 165 1 ? 12 
HELX_P HELX_P30 30 ASN B 186 ? ASN B 202 ? ASN C 186 ASN C 202 1 ? 17 
HELX_P HELX_P31 31 ASP B 210 ? LYS B 220 ? ASP C 210 LYS C 220 1 ? 11 
HELX_P HELX_P32 32 GLY B 229 ? TRP B 231 ? GLY C 229 TRP C 231 5 ? 3  
HELX_P HELX_P33 33 ALA B 232 ? LYS B 240 ? ALA C 232 LYS C 240 1 ? 9  
HELX_P HELX_P34 34 ASN B 273 ? TYR B 284 ? ASN C 273 TYR C 284 1 ? 12 
HELX_P HELX_P35 35 THR B 287 ? LYS B 298 ? THR C 287 LYS C 298 1 ? 12 
HELX_P HELX_P36 36 LEU B 305 ? SER B 307 ? LEU C 305 SER C 307 5 ? 3  
HELX_P HELX_P37 37 TYR B 308 ? ALA B 313 ? TYR C 308 ALA C 313 1 ? 6  
HELX_P HELX_P38 38 ASP B 315 ? GLY B 328 ? ASP C 315 GLY C 328 1 ? 14 
HELX_P HELX_P39 39 GLN B 336 ? SER B 353 ? GLN C 336 SER C 353 1 ? 18 
HELX_P HELX_P40 40 THR B 357 ? ASN B 368 ? THR C 357 ASN C 368 1 ? 12 
HELX_P HELX_P41 41 SER B 371 ? ALA B 382 ? SER C 371 ALA C 382 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
H ? 5 ? 
I ? 2 ? 
J ? 4 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 36  ? GLU A 39  ? VAL A 36  GLU A 39  
A 2 LEU A 8   ? TRP A 11  ? LEU A 8   TRP A 11  
A 3 ILE A 60  ? ALA A 64  ? ILE A 60  ALA A 64  
A 4 PHE A 259 ? ILE A 267 ? PHE A 259 ILE A 267 
A 5 TYR A 107 ? GLU A 112 ? TYR A 107 GLU A 112 
A 6 ALA A 302 ? VAL A 303 ? ALA A 302 VAL A 303 
B 1 VAL A 36  ? GLU A 39  ? VAL A 36  GLU A 39  
B 2 LEU A 8   ? TRP A 11  ? LEU A 8   TRP A 11  
B 3 ILE A 60  ? ALA A 64  ? ILE A 60  ALA A 64  
B 4 PHE A 259 ? ILE A 267 ? PHE A 259 ILE A 267 
B 5 GLU A 329 ? ILE A 330 ? GLU A 329 ILE A 330 
C 1 ARG A 99  ? TYR A 100 ? ARG A 99  TYR A 100 
C 2 LYS A 103 ? LEU A 104 ? LYS A 103 LEU A 104 
D 1 SER A 146 ? LEU A 148 ? SER A 146 LEU A 148 
D 2 THR A 223 ? ASN A 228 ? THR A 223 ASN A 228 
D 3 SER A 115 ? ASN A 119 ? SER A 115 ASN A 119 
D 4 TYR A 243 ? THR A 246 ? TYR A 243 THR A 246 
E 1 TYR A 168 ? GLU A 173 ? TYR A 168 GLU A 173 
E 2 LYS A 176 ? GLY A 183 ? LYS A 176 GLY A 183 
F 1 THR A 250 ? PHE A 251 ? THR A 250 PHE A 251 
F 2 GLN A 254 ? PRO A 255 ? GLN A 254 PRO A 255 
G 1 VAL B 36  ? GLU B 39  ? VAL C 36  GLU C 39  
G 2 LEU B 8   ? TRP B 11  ? LEU C 8   TRP C 11  
G 3 ILE B 60  ? ALA B 64  ? ILE C 60  ALA C 64  
G 4 PHE B 259 ? ILE B 267 ? PHE C 259 ILE C 267 
G 5 TYR B 107 ? GLU B 112 ? TYR C 107 GLU C 112 
G 6 ALA B 302 ? VAL B 303 ? ALA C 302 VAL C 303 
H 1 VAL B 36  ? GLU B 39  ? VAL C 36  GLU C 39  
H 2 LEU B 8   ? TRP B 11  ? LEU C 8   TRP C 11  
H 3 ILE B 60  ? ALA B 64  ? ILE C 60  ALA C 64  
H 4 PHE B 259 ? ILE B 267 ? PHE C 259 ILE C 267 
H 5 GLU B 329 ? ILE B 330 ? GLU C 329 ILE C 330 
I 1 ARG B 99  ? TYR B 100 ? ARG C 99  TYR C 100 
I 2 LYS B 103 ? LEU B 104 ? LYS C 103 LEU C 104 
J 1 SER B 146 ? LEU B 148 ? SER C 146 LEU C 148 
J 2 THR B 223 ? ASN B 228 ? THR C 223 ASN C 228 
J 3 SER B 115 ? ASN B 119 ? SER C 115 ASN C 119 
J 4 TYR B 243 ? THR B 246 ? TYR C 243 THR C 246 
K 1 TYR B 168 ? GLU B 173 ? TYR C 168 GLU C 173 
K 2 LYS B 176 ? GLY B 183 ? LYS C 176 GLY C 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 37  ? O THR A 37  N LEU A 8   ? N LEU A 8   
A 2 3 N TRP A 11  ? N TRP A 11  O ILE A 60  ? O ILE A 60  
A 3 4 N ILE A 61  ? N ILE A 61  O GLY A 266 ? O GLY A 266 
A 4 5 O GLY A 261 ? O GLY A 261 N GLU A 112 ? N GLU A 112 
A 5 6 N VAL A 111 ? N VAL A 111 O ALA A 302 ? O ALA A 302 
B 1 2 O THR A 37  ? O THR A 37  N LEU A 8   ? N LEU A 8   
B 2 3 N TRP A 11  ? N TRP A 11  O ILE A 60  ? O ILE A 60  
B 3 4 N ILE A 61  ? N ILE A 61  O GLY A 266 ? O GLY A 266 
B 4 5 N VAL A 260 ? N VAL A 260 O GLU A 329 ? O GLU A 329 
C 1 2 N TYR A 100 ? N TYR A 100 O LYS A 103 ? O LYS A 103 
D 1 2 N SER A 146 ? N SER A 146 O ALA A 224 ? O ALA A 224 
D 2 3 O THR A 226 ? O THR A 226 N ILE A 117 ? N ILE A 117 
D 3 4 N LEU A 116 ? N LEU A 116 O THR A 246 ? O THR A 246 
E 1 2 N LYS A 171 ? N LYS A 171 O ASP A 178 ? O ASP A 178 
F 1 2 N PHE A 251 ? N PHE A 251 O GLN A 254 ? O GLN A 254 
G 1 2 O GLU B 39  ? O GLU C 39  N ILE B 10  ? N ILE C 10  
G 2 3 N TRP B 11  ? N TRP C 11  O PHE B 62  ? O PHE C 62  
G 3 4 N ILE B 61  ? N ILE C 61  O GLY B 266 ? O GLY C 266 
G 4 5 O GLY B 261 ? O GLY C 261 N GLU B 112 ? N GLU C 112 
G 5 6 N VAL B 111 ? N VAL C 111 O ALA B 302 ? O ALA C 302 
H 1 2 O GLU B 39  ? O GLU C 39  N ILE B 10  ? N ILE C 10  
H 2 3 N TRP B 11  ? N TRP C 11  O PHE B 62  ? O PHE C 62  
H 3 4 N ILE B 61  ? N ILE C 61  O GLY B 266 ? O GLY C 266 
H 4 5 N VAL B 260 ? N VAL C 260 O GLU B 329 ? O GLU C 329 
I 1 2 N TYR B 100 ? N TYR C 100 O LYS B 103 ? O LYS C 103 
J 1 2 N SER B 146 ? N SER C 146 O ALA B 224 ? O ALA C 224 
J 2 3 O ALA B 224 ? O ALA C 224 N ASN B 119 ? N ASN C 119 
J 3 4 N LEU B 116 ? N LEU C 116 O THR B 246 ? O THR C 246 
K 1 2 N TYR B 168 ? N TYR C 168 O GLY B 183 ? O GLY C 183 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE MAL A 5044' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 391'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 392'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 393'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 394'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 395'  
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1'    
AC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 396'  
AC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE MAL C 5044' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 1'    
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 391'  
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 392'  
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 393'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 394'  
BC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 395'  
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL C 396'  
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL C 397'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ASN A 13  ? ASN A 13  . ? 1_555 ? 
2  AC1 13 ASP A 15  ? ASP A 15  . ? 1_555 ? 
3  AC1 13 LYS A 16  ? LYS A 16  . ? 1_555 ? 
4  AC1 13 TRP A 63  ? TRP A 63  . ? 1_555 ? 
5  AC1 13 ALA A 64  ? ALA A 64  . ? 1_555 ? 
6  AC1 13 ASP A 66  ? ASP A 66  . ? 1_555 ? 
7  AC1 13 ARG A 67  ? ARG A 67  . ? 1_555 ? 
8  AC1 13 GLU A 112 ? GLU A 112 . ? 1_555 ? 
9  AC1 13 GLU A 154 ? GLU A 154 . ? 1_555 ? 
10 AC1 13 PRO A 155 ? PRO A 155 . ? 1_555 ? 
11 AC1 13 TYR A 156 ? TYR A 156 . ? 1_555 ? 
12 AC1 13 TRP A 341 ? TRP A 341 . ? 1_555 ? 
13 AC1 13 HOH T .   ? HOH A 404 . ? 1_555 ? 
14 AC2 6  ASN A 151 ? ASN A 151 . ? 1_555 ? 
15 AC2 6  GLN A 153 ? GLN A 153 . ? 1_555 ? 
16 AC2 6  GLU A 154 ? GLU A 154 . ? 1_555 ? 
17 AC2 6  ASP A 210 ? ASP A 210 . ? 1_555 ? 
18 AC2 6  TYR A 211 ? TYR A 211 . ? 1_555 ? 
19 AC2 6  HOH T .   ? HOH A 443 . ? 1_555 ? 
20 AC3 3  PRO A 41  ? PRO A 41  . ? 1_555 ? 
21 AC3 3  ASP A 42  ? ASP A 42  . ? 1_555 ? 
22 AC3 3  LYS A 47  ? LYS A 47  . ? 1_555 ? 
23 AC4 2  ASP A 83  ? ASP A 83  . ? 1_555 ? 
24 AC4 2  LYS A 84  ? LYS A 84  . ? 1_555 ? 
25 AC5 3  ASN A 186 ? ASN A 186 . ? 1_555 ? 
26 AC5 3  ALA A 187 ? ALA A 187 . ? 1_555 ? 
27 AC5 3  HOH T .   ? HOH A 481 . ? 1_555 ? 
28 AC6 2  TYR A 18  ? TYR A 18  . ? 1_555 ? 
29 AC6 2  ASN A 19  ? ASN A 19  . ? 1_555 ? 
30 AC7 7  PRO A 335 ? PRO A 335 . ? 1_555 ? 
31 AC7 7  GLN A 336 ? GLN A 336 . ? 1_555 ? 
32 AC7 7  SER A 338 ? SER A 338 . ? 1_555 ? 
33 AC7 7  ALA A 339 ? ALA A 339 . ? 1_555 ? 
34 AC7 7  GLU B 309 ? GLU C 309 . ? 3_644 ? 
35 AC7 7  GLU B 310 ? GLU C 310 . ? 3_644 ? 
36 AC7 7  HOH U .   ? HOH C 461 . ? 3_644 ? 
37 AC8 11 MET A 149 ? MET A 149 . ? 1_555 ? 
38 AC8 11 ILE A 213 ? ILE A 213 . ? 1_555 ? 
39 AC8 11 ALA A 216 ? ALA A 216 . ? 1_555 ? 
40 AC8 11 ALA A 217 ? ALA A 217 . ? 1_555 ? 
41 AC8 11 LYS A 220 ? LYS A 220 . ? 1_555 ? 
42 AC8 11 GLU A 222 ? GLU A 222 . ? 1_555 ? 
43 AC8 11 HOH T .   ? HOH A 455 . ? 1_555 ? 
44 AC8 11 HOH T .   ? HOH A 465 . ? 1_555 ? 
45 AC8 11 GLY B 144 ? GLY C 144 . ? 2_555 ? 
46 AC8 11 LYS B 145 ? LYS C 145 . ? 2_555 ? 
47 AC8 11 HOH U .   ? HOH C 456 . ? 2_555 ? 
48 AC9 14 ASP B 15  ? ASP C 15  . ? 1_555 ? 
49 AC9 14 LYS B 16  ? LYS C 16  . ? 1_555 ? 
50 AC9 14 TRP B 63  ? TRP C 63  . ? 1_555 ? 
51 AC9 14 ALA B 64  ? ALA C 64  . ? 1_555 ? 
52 AC9 14 ASP B 66  ? ASP C 66  . ? 1_555 ? 
53 AC9 14 ARG B 67  ? ARG C 67  . ? 1_555 ? 
54 AC9 14 GLU B 112 ? GLU C 112 . ? 1_555 ? 
55 AC9 14 GLU B 154 ? GLU C 154 . ? 1_555 ? 
56 AC9 14 PRO B 155 ? PRO C 155 . ? 1_555 ? 
57 AC9 14 TYR B 156 ? TYR C 156 . ? 1_555 ? 
58 AC9 14 PHE B 157 ? PHE C 157 . ? 1_555 ? 
59 AC9 14 TRP B 341 ? TRP C 341 . ? 1_555 ? 
60 AC9 14 HOH U .   ? HOH C 429 . ? 1_555 ? 
61 AC9 14 HOH U .   ? HOH C 449 . ? 1_555 ? 
62 BC1 5  ASN B 151 ? ASN C 151 . ? 1_555 ? 
63 BC1 5  GLN B 153 ? GLN C 153 . ? 1_555 ? 
64 BC1 5  ASP B 210 ? ASP C 210 . ? 1_555 ? 
65 BC1 5  TYR B 211 ? TYR C 211 . ? 1_555 ? 
66 BC1 5  HOH U .   ? HOH C 444 . ? 1_555 ? 
67 BC2 2  PRO B 41  ? PRO C 41  . ? 1_555 ? 
68 BC2 2  ASP B 42  ? ASP C 42  . ? 1_555 ? 
69 BC3 2  TYR B 18  ? TYR C 18  . ? 1_555 ? 
70 BC3 2  ASN B 19  ? ASN C 19  . ? 1_555 ? 
71 BC4 2  ASP B 83  ? ASP C 83  . ? 1_555 ? 
72 BC4 2  LYS B 84  ? LYS C 84  . ? 1_555 ? 
73 BC5 2  ARG A 345 ? ARG A 345 . ? 3_654 ? 
74 BC5 2  LYS B 314 ? LYS C 314 . ? 1_555 ? 
75 BC6 2  LYS A 203 ? LYS A 203 . ? 2_554 ? 
76 BC6 2  LYS B 138 ? LYS C 138 . ? 1_555 ? 
77 BC7 6  GLN A 356 ? GLN A 356 . ? 3_654 ? 
78 BC7 6  GLU A 360 ? GLU A 360 . ? 3_654 ? 
79 BC7 6  LYS B 120 ? LYS C 120 . ? 1_555 ? 
80 BC7 6  GLY B 244 ? GLY C 244 . ? 1_555 ? 
81 BC7 6  VAL B 245 ? VAL C 245 . ? 1_555 ? 
82 BC7 6  HOH U .   ? HOH C 437 . ? 1_555 ? 
83 BC8 3  THR A 367 ? THR A 367 . ? 3_654 ? 
84 BC8 3  HOH T .   ? HOH A 426 . ? 3_654 ? 
85 BC8 3  GLN B 326 ? GLN C 326 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3Q29 
_atom_sites.fract_transf_matrix[1][1]   0.014622 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008513 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006826 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 2   ? -1.051  -52.239 -34.019 1.00 89.07  ? 2    LYS A N     1 
ATOM   2    C CA    . LYS A 1 2   ? -1.550  -51.725 -32.750 1.00 89.32  ? 2    LYS A CA    1 
ATOM   3    C C     . LYS A 1 2   ? -2.076  -50.297 -32.907 1.00 93.48  ? 2    LYS A C     1 
ATOM   4    O O     . LYS A 1 2   ? -2.322  -49.601 -31.920 1.00 89.49  ? 2    LYS A O     1 
ATOM   5    C CB    . LYS A 1 2   ? -0.454  -51.780 -31.682 1.00 85.09  ? 2    LYS A CB    1 
ATOM   6    N N     . ILE A 1 3   ? -2.237  -49.866 -34.157 1.00 97.12  ? 3    ILE A N     1 
ATOM   7    C CA    . ILE A 1 3   ? -2.828  -48.564 -34.462 1.00 94.33  ? 3    ILE A CA    1 
ATOM   8    C C     . ILE A 1 3   ? -4.168  -48.750 -35.156 1.00 99.29  ? 3    ILE A C     1 
ATOM   9    O O     . ILE A 1 3   ? -4.231  -49.255 -36.279 1.00 100.23 ? 3    ILE A O     1 
ATOM   10   C CB    . ILE A 1 3   ? -1.925  -47.715 -35.373 1.00 86.68  ? 3    ILE A CB    1 
ATOM   11   C CG1   . ILE A 1 3   ? -0.665  -47.278 -34.627 1.00 82.82  ? 3    ILE A CG1   1 
ATOM   12   C CG2   . ILE A 1 3   ? -2.687  -46.501 -35.891 1.00 81.43  ? 3    ILE A CG2   1 
ATOM   13   C CD1   . ILE A 1 3   ? 0.283   -46.463 -35.476 1.00 83.35  ? 3    ILE A CD1   1 
ATOM   14   N N     . GLU A 1 4   ? -5.237  -48.335 -34.486 1.00 102.40 ? 4    GLU A N     1 
ATOM   15   C CA    . GLU A 1 4   ? -6.591  -48.563 -34.979 1.00 106.42 ? 4    GLU A CA    1 
ATOM   16   C C     . GLU A 1 4   ? -6.885  -47.772 -36.249 1.00 100.53 ? 4    GLU A C     1 
ATOM   17   O O     . GLU A 1 4   ? -6.591  -46.581 -36.331 1.00 98.41  ? 4    GLU A O     1 
ATOM   18   C CB    . GLU A 1 4   ? -7.611  -48.228 -33.888 1.00 111.79 ? 4    GLU A CB    1 
ATOM   19   C CG    . GLU A 1 4   ? -9.057  -48.488 -34.270 1.00 117.40 ? 4    GLU A CG    1 
ATOM   20   C CD    . GLU A 1 4   ? -9.995  -48.375 -33.083 1.00 121.87 ? 4    GLU A CD    1 
ATOM   21   O OE1   . GLU A 1 4   ? -9.724  -49.018 -32.046 1.00 120.73 ? 4    GLU A OE1   1 
ATOM   22   O OE2   . GLU A 1 4   ? -10.997 -47.636 -33.186 1.00 124.08 ? 4    GLU A OE2   1 
ATOM   23   N N     . GLU A 1 5   ? -7.460  -48.449 -37.239 1.00 101.48 ? 5    GLU A N     1 
ATOM   24   C CA    . GLU A 1 5   ? -7.840  -47.807 -38.493 1.00 106.17 ? 5    GLU A CA    1 
ATOM   25   C C     . GLU A 1 5   ? -9.247  -47.237 -38.398 1.00 108.10 ? 5    GLU A C     1 
ATOM   26   O O     . GLU A 1 5   ? -10.134 -47.854 -37.810 1.00 109.93 ? 5    GLU A O     1 
ATOM   27   C CB    . GLU A 1 5   ? -7.776  -48.798 -39.657 1.00 108.80 ? 5    GLU A CB    1 
ATOM   28   C CG    . GLU A 1 5   ? -8.248  -48.212 -40.983 1.00 108.99 ? 5    GLU A CG    1 
ATOM   29   C CD    . GLU A 1 5   ? -8.401  -49.258 -42.070 1.00 109.81 ? 5    GLU A CD    1 
ATOM   30   O OE1   . GLU A 1 5   ? -8.474  -48.876 -43.259 1.00 109.61 ? 5    GLU A OE1   1 
ATOM   31   O OE2   . GLU A 1 5   ? -8.452  -50.461 -41.737 1.00 109.80 ? 5    GLU A OE2   1 
ATOM   32   N N     . GLY A 1 6   ? -9.449  -46.061 -38.984 1.00 106.98 ? 6    GLY A N     1 
ATOM   33   C CA    . GLY A 1 6   ? -10.754 -45.429 -38.982 1.00 107.39 ? 6    GLY A CA    1 
ATOM   34   C C     . GLY A 1 6   ? -10.790 -44.124 -38.209 1.00 108.70 ? 6    GLY A C     1 
ATOM   35   O O     . GLY A 1 6   ? -11.605 -43.251 -38.501 1.00 115.81 ? 6    GLY A O     1 
ATOM   36   N N     . LYS A 1 7   ? -9.912  -43.991 -37.219 1.00 98.72  ? 7    LYS A N     1 
ATOM   37   C CA    . LYS A 1 7   ? -9.822  -42.761 -36.442 1.00 95.06  ? 7    LYS A CA    1 
ATOM   38   C C     . LYS A 1 7   ? -8.381  -42.257 -36.360 1.00 93.29  ? 7    LYS A C     1 
ATOM   39   O O     . LYS A 1 7   ? -7.439  -43.013 -36.593 1.00 96.69  ? 7    LYS A O     1 
ATOM   40   C CB    . LYS A 1 7   ? -10.388 -42.967 -35.038 1.00 98.37  ? 7    LYS A CB    1 
ATOM   41   C CG    . LYS A 1 7   ? -9.522  -43.825 -34.134 1.00 99.68  ? 7    LYS A CG    1 
ATOM   42   C CD    . LYS A 1 7   ? -9.676  -43.394 -32.683 1.00 101.76 ? 7    LYS A CD    1 
ATOM   43   C CE    . LYS A 1 7   ? -8.828  -44.246 -31.753 1.00 100.19 ? 7    LYS A CE    1 
ATOM   44   N NZ    . LYS A 1 7   ? -8.864  -43.733 -30.356 1.00 98.18  ? 7    LYS A NZ    1 
ATOM   45   N N     . LEU A 1 8   ? -8.216  -40.981 -36.020 1.00 86.20  ? 8    LEU A N     1 
ATOM   46   C CA    . LEU A 1 8   ? -6.891  -40.365 -35.955 1.00 73.03  ? 8    LEU A CA    1 
ATOM   47   C C     . LEU A 1 8   ? -6.440  -40.037 -34.532 1.00 70.97  ? 8    LEU A C     1 
ATOM   48   O O     . LEU A 1 8   ? -7.130  -39.331 -33.796 1.00 77.03  ? 8    LEU A O     1 
ATOM   49   C CB    . LEU A 1 8   ? -6.853  -39.094 -36.805 1.00 68.88  ? 8    LEU A CB    1 
ATOM   50   C CG    . LEU A 1 8   ? -6.844  -39.293 -38.321 1.00 73.31  ? 8    LEU A CG    1 
ATOM   51   C CD1   . LEU A 1 8   ? -6.900  -37.956 -39.050 1.00 67.24  ? 8    LEU A CD1   1 
ATOM   52   C CD2   . LEU A 1 8   ? -5.619  -40.084 -38.742 1.00 76.40  ? 8    LEU A CD2   1 
ATOM   53   N N     . VAL A 1 9   ? -5.276  -40.552 -34.150 1.00 61.96  ? 9    VAL A N     1 
ATOM   54   C CA    . VAL A 1 9   ? -4.640  -40.148 -32.906 1.00 63.77  ? 9    VAL A CA    1 
ATOM   55   C C     . VAL A 1 9   ? -3.468  -39.217 -33.200 1.00 73.42  ? 9    VAL A C     1 
ATOM   56   O O     . VAL A 1 9   ? -2.560  -39.565 -33.958 1.00 80.20  ? 9    VAL A O     1 
ATOM   57   C CB    . VAL A 1 9   ? -4.141  -41.354 -32.096 1.00 73.71  ? 9    VAL A CB    1 
ATOM   58   C CG1   . VAL A 1 9   ? -3.200  -40.901 -30.990 1.00 73.84  ? 9    VAL A CG1   1 
ATOM   59   C CG2   . VAL A 1 9   ? -5.318  -42.126 -31.517 1.00 78.07  ? 9    VAL A CG2   1 
ATOM   60   N N     . ILE A 1 10  ? -3.497  -38.031 -32.602 1.00 68.80  ? 10   ILE A N     1 
ATOM   61   C CA    . ILE A 1 10  ? -2.458  -37.034 -32.821 1.00 59.20  ? 10   ILE A CA    1 
ATOM   62   C C     . ILE A 1 10  ? -1.701  -36.714 -31.536 1.00 63.62  ? 10   ILE A C     1 
ATOM   63   O O     . ILE A 1 10  ? -2.305  -36.492 -30.483 1.00 66.70  ? 10   ILE A O     1 
ATOM   64   C CB    . ILE A 1 10  ? -3.054  -35.739 -33.377 1.00 54.72  ? 10   ILE A CB    1 
ATOM   65   C CG1   . ILE A 1 10  ? -3.901  -36.038 -34.614 1.00 48.99  ? 10   ILE A CG1   1 
ATOM   66   C CG2   . ILE A 1 10  ? -1.957  -34.740 -33.692 1.00 57.31  ? 10   ILE A CG2   1 
ATOM   67   C CD1   . ILE A 1 10  ? -4.537  -34.814 -35.231 1.00 51.56  ? 10   ILE A CD1   1 
ATOM   68   N N     . TRP A 1 11  ? -0.374  -36.701 -31.626 1.00 59.20  ? 11   TRP A N     1 
ATOM   69   C CA    . TRP A 1 11  ? 0.460   -36.292 -30.503 1.00 55.76  ? 11   TRP A CA    1 
ATOM   70   C C     . TRP A 1 11  ? 1.036   -34.891 -30.716 1.00 57.08  ? 11   TRP A C     1 
ATOM   71   O O     . TRP A 1 11  ? 1.486   -34.545 -31.811 1.00 52.08  ? 11   TRP A O     1 
ATOM   72   C CB    . TRP A 1 11  ? 1.592   -37.293 -30.274 1.00 61.54  ? 11   TRP A CB    1 
ATOM   73   C CG    . TRP A 1 11  ? 1.144   -38.598 -29.688 1.00 70.54  ? 11   TRP A CG    1 
ATOM   74   C CD1   . TRP A 1 11  ? -0.142  -39.010 -29.486 1.00 76.04  ? 11   TRP A CD1   1 
ATOM   75   C CD2   . TRP A 1 11  ? 1.984   -39.662 -29.221 1.00 67.32  ? 11   TRP A CD2   1 
ATOM   76   N NE1   . TRP A 1 11  ? -0.154  -40.265 -28.926 1.00 72.53  ? 11   TRP A NE1   1 
ATOM   77   C CE2   . TRP A 1 11  ? 1.138   -40.687 -28.754 1.00 70.87  ? 11   TRP A CE2   1 
ATOM   78   C CE3   . TRP A 1 11  ? 3.369   -39.848 -29.157 1.00 61.08  ? 11   TRP A CE3   1 
ATOM   79   C CZ2   . TRP A 1 11  ? 1.632   -41.881 -28.226 1.00 70.89  ? 11   TRP A CZ2   1 
ATOM   80   C CZ3   . TRP A 1 11  ? 3.858   -41.031 -28.634 1.00 61.66  ? 11   TRP A CZ3   1 
ATOM   81   C CH2   . TRP A 1 11  ? 2.991   -42.033 -28.175 1.00 68.19  ? 11   TRP A CH2   1 
ATOM   82   N N     . ILE A 1 12  ? 1.010   -34.085 -29.662 1.00 53.42  ? 12   ILE A N     1 
ATOM   83   C CA    . ILE A 1 12  ? 1.592   -32.751 -29.701 1.00 52.88  ? 12   ILE A CA    1 
ATOM   84   C C     . ILE A 1 12  ? 1.975   -32.344 -28.290 1.00 53.79  ? 12   ILE A C     1 
ATOM   85   O O     . ILE A 1 12  ? 1.333   -32.755 -27.328 1.00 56.04  ? 12   ILE A O     1 
ATOM   86   C CB    . ILE A 1 12  ? 0.623   -31.716 -30.311 1.00 51.24  ? 12   ILE A CB    1 
ATOM   87   C CG1   . ILE A 1 12  ? 1.307   -30.352 -30.420 1.00 48.26  ? 12   ILE A CG1   1 
ATOM   88   C CG2   . ILE A 1 12  ? -0.649  -31.615 -29.484 1.00 55.10  ? 12   ILE A CG2   1 
ATOM   89   C CD1   . ILE A 1 12  ? 0.461   -29.288 -31.084 1.00 50.18  ? 12   ILE A CD1   1 
ATOM   90   N N     . ASN A 1 13  ? 3.029   -31.546 -28.162 1.00 53.74  ? 13   ASN A N     1 
ATOM   91   C CA    . ASN A 1 13  ? 3.549   -31.193 -26.845 1.00 55.65  ? 13   ASN A CA    1 
ATOM   92   C C     . ASN A 1 13  ? 2.542   -30.434 -25.983 1.00 56.66  ? 13   ASN A C     1 
ATOM   93   O O     . ASN A 1 13  ? 1.714   -29.677 -26.494 1.00 56.39  ? 13   ASN A O     1 
ATOM   94   C CB    . ASN A 1 13  ? 4.850   -30.398 -26.968 1.00 62.50  ? 13   ASN A CB    1 
ATOM   95   C CG    . ASN A 1 13  ? 5.801   -30.663 -25.817 1.00 64.24  ? 13   ASN A CG    1 
ATOM   96   O OD1   . ASN A 1 13  ? 5.876   -31.782 -25.307 1.00 68.22  ? 13   ASN A OD1   1 
ATOM   97   N ND2   . ASN A 1 13  ? 6.532   -29.635 -25.398 1.00 59.79  ? 13   ASN A ND2   1 
ATOM   98   N N     . GLY A 1 14  ? 2.630   -30.638 -24.670 1.00 55.45  ? 14   GLY A N     1 
ATOM   99   C CA    . GLY A 1 14  ? 1.673   -30.079 -23.735 1.00 50.10  ? 14   GLY A CA    1 
ATOM   100  C C     . GLY A 1 14  ? 1.767   -28.574 -23.585 1.00 55.64  ? 14   GLY A C     1 
ATOM   101  O O     . GLY A 1 14  ? 0.896   -27.952 -22.970 1.00 55.40  ? 14   GLY A O     1 
ATOM   102  N N     . ASP A 1 15  ? 2.825   -27.985 -24.137 1.00 59.71  ? 15   ASP A N     1 
ATOM   103  C CA    . ASP A 1 15  ? 2.972   -26.530 -24.116 1.00 60.20  ? 15   ASP A CA    1 
ATOM   104  C C     . ASP A 1 15  ? 2.351   -25.854 -25.345 1.00 47.98  ? 15   ASP A C     1 
ATOM   105  O O     . ASP A 1 15  ? 2.275   -24.630 -25.402 1.00 50.76  ? 15   ASP A O     1 
ATOM   106  C CB    . ASP A 1 15  ? 4.440   -26.106 -23.924 1.00 61.57  ? 15   ASP A CB    1 
ATOM   107  C CG    . ASP A 1 15  ? 5.370   -26.649 -25.013 1.00 65.21  ? 15   ASP A CG    1 
ATOM   108  O OD1   . ASP A 1 15  ? 4.876   -27.219 -26.012 1.00 67.54  ? 15   ASP A OD1   1 
ATOM   109  O OD2   . ASP A 1 15  ? 6.604   -26.490 -24.871 1.00 54.93  ? 15   ASP A OD2   1 
ATOM   110  N N     . LYS A 1 16  ? 1.897   -26.650 -26.313 1.00 50.89  ? 16   LYS A N     1 
ATOM   111  C CA    . LYS A 1 16  ? 1.279   -26.112 -27.533 1.00 50.74  ? 16   LYS A CA    1 
ATOM   112  C C     . LYS A 1 16  ? -0.242  -26.075 -27.430 1.00 51.40  ? 16   LYS A C     1 
ATOM   113  O O     . LYS A 1 16  ? -0.821  -26.523 -26.437 1.00 45.58  ? 16   LYS A O     1 
ATOM   114  C CB    . LYS A 1 16  ? 1.649   -26.946 -28.761 1.00 47.07  ? 16   LYS A CB    1 
ATOM   115  C CG    . LYS A 1 16  ? 3.095   -27.375 -28.850 1.00 47.62  ? 16   LYS A CG    1 
ATOM   116  C CD    . LYS A 1 16  ? 4.042   -26.198 -28.938 1.00 45.80  ? 16   LYS A CD    1 
ATOM   117  C CE    . LYS A 1 16  ? 5.461   -26.706 -29.159 1.00 42.91  ? 16   LYS A CE    1 
ATOM   118  N NZ    . LYS A 1 16  ? 6.443   -25.601 -29.205 1.00 46.45  ? 16   LYS A NZ    1 
ATOM   119  N N     . GLY A 1 17  ? -0.885  -25.571 -28.480 1.00 49.73  ? 17   GLY A N     1 
ATOM   120  C CA    . GLY A 1 17  ? -2.329  -25.408 -28.489 1.00 52.41  ? 17   GLY A CA    1 
ATOM   121  C C     . GLY A 1 17  ? -3.106  -26.678 -28.787 1.00 56.15  ? 17   GLY A C     1 
ATOM   122  O O     . GLY A 1 17  ? -3.814  -26.755 -29.792 1.00 51.37  ? 17   GLY A O     1 
ATOM   123  N N     . TYR A 1 18  ? -3.002  -27.672 -27.909 1.00 59.06  ? 18   TYR A N     1 
ATOM   124  C CA    . TYR A 1 18  ? -3.638  -28.958 -28.179 1.00 59.33  ? 18   TYR A CA    1 
ATOM   125  C C     . TYR A 1 18  ? -5.163  -28.900 -28.122 1.00 62.89  ? 18   TYR A C     1 
ATOM   126  O O     . TYR A 1 18  ? -5.841  -29.665 -28.808 1.00 64.47  ? 18   TYR A O     1 
ATOM   127  C CB    . TYR A 1 18  ? -3.080  -30.076 -27.290 1.00 58.41  ? 18   TYR A CB    1 
ATOM   128  C CG    . TYR A 1 18  ? -3.210  -29.859 -25.801 1.00 56.44  ? 18   TYR A CG    1 
ATOM   129  C CD1   . TYR A 1 18  ? -4.420  -30.069 -25.149 1.00 58.38  ? 18   TYR A CD1   1 
ATOM   130  C CD2   . TYR A 1 18  ? -2.112  -29.480 -25.040 1.00 56.24  ? 18   TYR A CD2   1 
ATOM   131  C CE1   . TYR A 1 18  ? -4.536  -29.885 -23.784 1.00 58.30  ? 18   TYR A CE1   1 
ATOM   132  C CE2   . TYR A 1 18  ? -2.217  -29.293 -23.677 1.00 58.81  ? 18   TYR A CE2   1 
ATOM   133  C CZ    . TYR A 1 18  ? -3.430  -29.497 -23.055 1.00 61.69  ? 18   TYR A CZ    1 
ATOM   134  O OH    . TYR A 1 18  ? -3.535  -29.313 -21.697 1.00 64.74  ? 18   TYR A OH    1 
ATOM   135  N N     . ASN A 1 19  ? -5.701  -27.989 -27.318 1.00 64.17  ? 19   ASN A N     1 
ATOM   136  C CA    . ASN A 1 19  ? -7.143  -27.770 -27.304 1.00 60.60  ? 19   ASN A CA    1 
ATOM   137  C C     . ASN A 1 19  ? -7.613  -27.115 -28.593 1.00 54.86  ? 19   ASN A C     1 
ATOM   138  O O     . ASN A 1 19  ? -8.634  -27.501 -29.163 1.00 53.05  ? 19   ASN A O     1 
ATOM   139  C CB    . ASN A 1 19  ? -7.565  -26.940 -26.095 1.00 64.12  ? 19   ASN A CB    1 
ATOM   140  C CG    . ASN A 1 19  ? -7.566  -27.745 -24.817 1.00 70.53  ? 19   ASN A CG    1 
ATOM   141  O OD1   . ASN A 1 19  ? -7.774  -28.959 -24.837 1.00 69.63  ? 19   ASN A OD1   1 
ATOM   142  N ND2   . ASN A 1 19  ? -7.332  -27.075 -23.695 1.00 75.64  ? 19   ASN A ND2   1 
ATOM   143  N N     . GLY A 1 20  ? -6.859  -26.123 -29.053 1.00 56.53  ? 20   GLY A N     1 
ATOM   144  C CA    . GLY A 1 20  ? -7.127  -25.518 -30.343 1.00 58.16  ? 20   GLY A CA    1 
ATOM   145  C C     . GLY A 1 20  ? -7.114  -26.577 -31.430 1.00 61.75  ? 20   GLY A C     1 
ATOM   146  O O     . GLY A 1 20  ? -8.028  -26.650 -32.252 1.00 65.19  ? 20   GLY A O     1 
ATOM   147  N N     . LEU A 1 21  ? -6.076  -27.409 -31.427 1.00 60.58  ? 21   LEU A N     1 
ATOM   148  C CA    . LEU A 1 21  ? -5.965  -28.489 -32.399 1.00 60.79  ? 21   LEU A CA    1 
ATOM   149  C C     . LEU A 1 21  ? -7.184  -29.401 -32.309 1.00 63.98  ? 21   LEU A C     1 
ATOM   150  O O     . LEU A 1 21  ? -7.759  -29.784 -33.327 1.00 70.90  ? 21   LEU A O     1 
ATOM   151  C CB    . LEU A 1 21  ? -4.682  -29.296 -32.178 1.00 57.72  ? 21   LEU A CB    1 
ATOM   152  C CG    . LEU A 1 21  ? -4.364  -30.342 -33.254 1.00 55.27  ? 21   LEU A CG    1 
ATOM   153  C CD1   . LEU A 1 21  ? -4.211  -29.680 -34.614 1.00 45.71  ? 21   LEU A CD1   1 
ATOM   154  C CD2   . LEU A 1 21  ? -3.115  -31.130 -32.902 1.00 51.92  ? 21   LEU A CD2   1 
ATOM   155  N N     . ALA A 1 22  ? -7.578  -29.733 -31.083 1.00 54.97  ? 22   ALA A N     1 
ATOM   156  C CA    . ALA A 1 22  ? -8.737  -30.586 -30.851 1.00 56.06  ? 22   ALA A CA    1 
ATOM   157  C C     . ALA A 1 22  ? -9.974  -30.062 -31.570 1.00 63.89  ? 22   ALA A C     1 
ATOM   158  O O     . ALA A 1 22  ? -10.738 -30.836 -32.148 1.00 68.50  ? 22   ALA A O     1 
ATOM   159  C CB    . ALA A 1 22  ? -9.004  -30.727 -29.358 1.00 56.63  ? 22   ALA A CB    1 
ATOM   160  N N     . GLU A 1 23  ? -10.167 -28.746 -31.537 1.00 66.15  ? 23   GLU A N     1 
ATOM   161  C CA    . GLU A 1 23  ? -11.294 -28.125 -32.223 1.00 66.85  ? 23   GLU A CA    1 
ATOM   162  C C     . GLU A 1 23  ? -11.234 -28.389 -33.717 1.00 69.15  ? 23   GLU A C     1 
ATOM   163  O O     . GLU A 1 23  ? -12.248 -28.694 -34.336 1.00 77.30  ? 23   GLU A O     1 
ATOM   164  C CB    . GLU A 1 23  ? -11.335 -26.621 -31.958 1.00 75.36  ? 23   GLU A CB    1 
ATOM   165  C CG    . GLU A 1 23  ? -11.669 -26.258 -30.521 1.00 84.52  ? 23   GLU A CG    1 
ATOM   166  C CD    . GLU A 1 23  ? -11.604 -24.767 -30.272 1.00 92.36  ? 23   GLU A CD    1 
ATOM   167  O OE1   . GLU A 1 23  ? -11.456 -24.007 -31.253 1.00 94.97  ? 23   GLU A OE1   1 
ATOM   168  O OE2   . GLU A 1 23  ? -11.697 -24.355 -29.096 1.00 96.98  ? 23   GLU A OE2   1 
ATOM   169  N N     . VAL A 1 24  ? -10.044 -28.268 -34.297 1.00 65.34  ? 24   VAL A N     1 
ATOM   170  C CA    . VAL A 1 24  ? -9.869  -28.574 -35.711 1.00 64.36  ? 24   VAL A CA    1 
ATOM   171  C C     . VAL A 1 24  ? -10.316 -30.005 -36.006 1.00 68.45  ? 24   VAL A C     1 
ATOM   172  O O     . VAL A 1 24  ? -10.901 -30.281 -37.050 1.00 74.30  ? 24   VAL A O     1 
ATOM   173  C CB    . VAL A 1 24  ? -8.408  -28.393 -36.157 1.00 59.71  ? 24   VAL A CB    1 
ATOM   174  C CG1   . VAL A 1 24  ? -8.275  -28.665 -37.648 1.00 52.13  ? 24   VAL A CG1   1 
ATOM   175  C CG2   . VAL A 1 24  ? -7.923  -26.990 -35.826 1.00 60.19  ? 24   VAL A CG2   1 
ATOM   176  N N     . GLY A 1 25  ? -10.041 -30.909 -35.075 1.00 74.89  ? 25   GLY A N     1 
ATOM   177  C CA    . GLY A 1 25  ? -10.449 -32.294 -35.212 1.00 85.48  ? 25   GLY A CA    1 
ATOM   178  C C     . GLY A 1 25  ? -11.950 -32.468 -35.083 1.00 95.93  ? 25   GLY A C     1 
ATOM   179  O O     . GLY A 1 25  ? -12.518 -33.419 -35.617 1.00 103.05 ? 25   GLY A O     1 
ATOM   180  N N     . LYS A 1 26  ? -12.595 -31.549 -34.370 1.00 96.02  ? 26   LYS A N     1 
ATOM   181  C CA    . LYS A 1 26  ? -14.046 -31.578 -34.217 1.00 90.11  ? 26   LYS A CA    1 
ATOM   182  C C     . LYS A 1 26  ? -14.747 -31.183 -35.516 1.00 88.62  ? 26   LYS A C     1 
ATOM   183  O O     . LYS A 1 26  ? -15.798 -31.731 -35.849 1.00 93.42  ? 26   LYS A O     1 
ATOM   184  C CB    . LYS A 1 26  ? -14.493 -30.671 -33.068 1.00 87.88  ? 26   LYS A CB    1 
ATOM   185  N N     . LYS A 1 27  ? -14.165 -30.236 -36.248 1.00 82.02  ? 27   LYS A N     1 
ATOM   186  C CA    . LYS A 1 27  ? -14.693 -29.847 -37.556 1.00 74.74  ? 27   LYS A CA    1 
ATOM   187  C C     . LYS A 1 27  ? -14.291 -30.868 -38.608 1.00 84.11  ? 27   LYS A C     1 
ATOM   188  O O     . LYS A 1 27  ? -14.736 -30.803 -39.754 1.00 93.55  ? 27   LYS A O     1 
ATOM   189  C CB    . LYS A 1 27  ? -14.197 -28.458 -37.969 1.00 64.08  ? 27   LYS A CB    1 
ATOM   190  N N     . PHE A 1 28  ? -13.433 -31.803 -38.219 1.00 81.42  ? 28   PHE A N     1 
ATOM   191  C CA    . PHE A 1 28  ? -13.045 -32.885 -39.110 1.00 84.27  ? 28   PHE A CA    1 
ATOM   192  C C     . PHE A 1 28  ? -14.003 -34.052 -38.913 1.00 87.70  ? 28   PHE A C     1 
ATOM   193  O O     . PHE A 1 28  ? -14.468 -34.666 -39.875 1.00 87.97  ? 28   PHE A O     1 
ATOM   194  C CB    . PHE A 1 28  ? -11.602 -33.318 -38.841 1.00 78.65  ? 28   PHE A CB    1 
ATOM   195  C CG    . PHE A 1 28  ? -11.078 -34.314 -39.833 1.00 73.79  ? 28   PHE A CG    1 
ATOM   196  C CD1   . PHE A 1 28  ? -10.770 -33.925 -41.127 1.00 64.81  ? 28   PHE A CD1   1 
ATOM   197  C CD2   . PHE A 1 28  ? -10.894 -35.640 -39.476 1.00 73.43  ? 28   PHE A CD2   1 
ATOM   198  C CE1   . PHE A 1 28  ? -10.291 -34.834 -42.047 1.00 61.36  ? 28   PHE A CE1   1 
ATOM   199  C CE2   . PHE A 1 28  ? -10.414 -36.557 -40.393 1.00 72.12  ? 28   PHE A CE2   1 
ATOM   200  C CZ    . PHE A 1 28  ? -10.113 -36.152 -41.682 1.00 66.76  ? 28   PHE A CZ    1 
ATOM   201  N N     . GLU A 1 29  ? -14.300 -34.337 -37.650 1.00 90.55  ? 29   GLU A N     1 
ATOM   202  C CA    . GLU A 1 29  ? -15.228 -35.396 -37.275 1.00 94.80  ? 29   GLU A CA    1 
ATOM   203  C C     . GLU A 1 29  ? -16.654 -35.069 -37.712 1.00 100.25 ? 29   GLU A C     1 
ATOM   204  O O     . GLU A 1 29  ? -17.488 -35.961 -37.855 1.00 100.91 ? 29   GLU A O     1 
ATOM   205  C CB    . GLU A 1 29  ? -15.176 -35.616 -35.762 1.00 93.76  ? 29   GLU A CB    1 
ATOM   206  C CG    . GLU A 1 29  ? -16.072 -36.722 -35.249 1.00 97.32  ? 29   GLU A CG    1 
ATOM   207  C CD    . GLU A 1 29  ? -15.812 -37.042 -33.791 1.00 103.74 ? 29   GLU A CD    1 
ATOM   208  O OE1   . GLU A 1 29  ? -14.920 -36.404 -33.192 1.00 105.81 ? 29   GLU A OE1   1 
ATOM   209  O OE2   . GLU A 1 29  ? -16.494 -37.934 -33.245 1.00 106.45 ? 29   GLU A OE2   1 
ATOM   210  N N     . LYS A 1 30  ? -16.925 -33.786 -37.929 1.00 103.26 ? 30   LYS A N     1 
ATOM   211  C CA    . LYS A 1 30  ? -18.249 -33.341 -38.349 1.00 102.27 ? 30   LYS A CA    1 
ATOM   212  C C     . LYS A 1 30  ? -18.406 -33.393 -39.862 1.00 102.67 ? 30   LYS A C     1 
ATOM   213  O O     . LYS A 1 30  ? -19.500 -33.188 -40.386 1.00 106.29 ? 30   LYS A O     1 
ATOM   214  C CB    . LYS A 1 30  ? -18.522 -31.919 -37.853 1.00 100.28 ? 30   LYS A CB    1 
ATOM   215  N N     . ASP A 1 31  ? -17.312 -33.667 -40.564 1.00 100.43 ? 31   ASP A N     1 
ATOM   216  C CA    . ASP A 1 31  ? -17.332 -33.665 -42.022 1.00 98.24  ? 31   ASP A CA    1 
ATOM   217  C C     . ASP A 1 31  ? -16.995 -35.026 -42.617 1.00 96.89  ? 31   ASP A C     1 
ATOM   218  O O     . ASP A 1 31  ? -17.240 -35.273 -43.798 1.00 99.36  ? 31   ASP A O     1 
ATOM   219  C CB    . ASP A 1 31  ? -16.372 -32.608 -42.566 1.00 97.00  ? 31   ASP A CB    1 
ATOM   220  C CG    . ASP A 1 31  ? -16.848 -31.197 -42.294 1.00 97.40  ? 31   ASP A CG    1 
ATOM   221  O OD1   . ASP A 1 31  ? -17.562 -30.996 -41.288 1.00 96.47  ? 31   ASP A OD1   1 
ATOM   222  O OD2   . ASP A 1 31  ? -16.508 -30.291 -43.087 1.00 95.67  ? 31   ASP A OD2   1 
ATOM   223  N N     . THR A 1 32  ? -16.434 -35.908 -41.800 1.00 92.40  ? 32   THR A N     1 
ATOM   224  C CA    . THR A 1 32  ? -16.023 -37.221 -42.275 1.00 87.89  ? 32   THR A CA    1 
ATOM   225  C C     . THR A 1 32  ? -16.624 -38.321 -41.417 1.00 88.86  ? 32   THR A C     1 
ATOM   226  O O     . THR A 1 32  ? -17.017 -39.370 -41.921 1.00 96.02  ? 32   THR A O     1 
ATOM   227  C CB    . THR A 1 32  ? -14.497 -37.372 -42.236 1.00 80.00  ? 32   THR A CB    1 
ATOM   228  O OG1   . THR A 1 32  ? -14.059 -37.424 -40.871 1.00 72.85  ? 32   THR A OG1   1 
ATOM   229  C CG2   . THR A 1 32  ? -13.829 -36.203 -42.947 1.00 75.11  ? 32   THR A CG2   1 
ATOM   230  N N     . GLY A 1 33  ? -16.690 -38.073 -40.115 1.00 84.64  ? 33   GLY A N     1 
ATOM   231  C CA    . GLY A 1 33  ? -17.159 -39.071 -39.176 1.00 92.13  ? 33   GLY A CA    1 
ATOM   232  C C     . GLY A 1 33  ? -15.989 -39.743 -38.485 1.00 99.06  ? 33   GLY A C     1 
ATOM   233  O O     . GLY A 1 33  ? -16.164 -40.655 -37.675 1.00 103.15 ? 33   GLY A O     1 
ATOM   234  N N     . ILE A 1 34  ? -14.786 -39.283 -38.813 1.00 95.55  ? 34   ILE A N     1 
ATOM   235  C CA    . ILE A 1 34  ? -13.568 -39.814 -38.217 1.00 87.08  ? 34   ILE A CA    1 
ATOM   236  C C     . ILE A 1 34  ? -13.297 -39.134 -36.877 1.00 77.88  ? 34   ILE A C     1 
ATOM   237  O O     . ILE A 1 34  ? -13.013 -37.938 -36.827 1.00 68.69  ? 34   ILE A O     1 
ATOM   238  C CB    . ILE A 1 34  ? -12.359 -39.604 -39.154 1.00 88.52  ? 34   ILE A CB    1 
ATOM   239  C CG1   . ILE A 1 34  ? -12.689 -40.076 -40.572 1.00 87.80  ? 34   ILE A CG1   1 
ATOM   240  C CG2   . ILE A 1 34  ? -11.127 -40.313 -38.613 1.00 87.79  ? 34   ILE A CG2   1 
ATOM   241  C CD1   . ILE A 1 34  ? -13.133 -41.519 -40.647 1.00 85.68  ? 34   ILE A CD1   1 
ATOM   242  N N     . LYS A 1 35  ? -13.396 -39.894 -35.790 1.00 83.76  ? 35   LYS A N     1 
ATOM   243  C CA    . LYS A 1 35  ? -13.138 -39.343 -34.462 1.00 85.50  ? 35   LYS A CA    1 
ATOM   244  C C     . LYS A 1 35  ? -11.659 -39.009 -34.301 1.00 87.19  ? 35   LYS A C     1 
ATOM   245  O O     . LYS A 1 35  ? -10.798 -39.875 -34.453 1.00 91.74  ? 35   LYS A O     1 
ATOM   246  C CB    . LYS A 1 35  ? -13.582 -40.316 -33.365 1.00 84.12  ? 35   LYS A CB    1 
ATOM   247  N N     . VAL A 1 36  ? -11.367 -37.750 -33.998 1.00 80.74  ? 36   VAL A N     1 
ATOM   248  C CA    . VAL A 1 36  ? -9.987  -37.312 -33.846 1.00 71.86  ? 36   VAL A CA    1 
ATOM   249  C C     . VAL A 1 36  ? -9.617  -37.118 -32.380 1.00 76.28  ? 36   VAL A C     1 
ATOM   250  O O     . VAL A 1 36  ? -10.283 -36.382 -31.655 1.00 85.45  ? 36   VAL A O     1 
ATOM   251  C CB    . VAL A 1 36  ? -9.729  -36.018 -34.618 1.00 63.25  ? 36   VAL A CB    1 
ATOM   252  C CG1   . VAL A 1 36  ? -8.338  -35.489 -34.312 1.00 65.10  ? 36   VAL A CG1   1 
ATOM   253  C CG2   . VAL A 1 36  ? -9.915  -36.255 -36.114 1.00 51.33  ? 36   VAL A CG2   1 
ATOM   254  N N     . THR A 1 37  ? -8.550  -37.784 -31.952 1.00 69.53  ? 37   THR A N     1 
ATOM   255  C CA    . THR A 1 37  ? -8.108  -37.716 -30.565 1.00 68.90  ? 37   THR A CA    1 
ATOM   256  C C     . THR A 1 37  ? -6.748  -37.034 -30.452 1.00 68.14  ? 37   THR A C     1 
ATOM   257  O O     . THR A 1 37  ? -5.778  -37.471 -31.063 1.00 72.82  ? 37   THR A O     1 
ATOM   258  C CB    . THR A 1 37  ? -8.015  -39.125 -29.936 1.00 73.55  ? 37   THR A CB    1 
ATOM   259  O OG1   . THR A 1 37  ? -9.294  -39.769 -29.999 1.00 75.27  ? 37   THR A OG1   1 
ATOM   260  C CG2   . THR A 1 37  ? -7.563  -39.039 -28.484 1.00 73.90  ? 37   THR A CG2   1 
ATOM   261  N N     . VAL A 1 38  ? -6.680  -35.966 -29.664 1.00 64.67  ? 38   VAL A N     1 
ATOM   262  C CA    . VAL A 1 38  ? -5.427  -35.253 -29.456 1.00 55.12  ? 38   VAL A CA    1 
ATOM   263  C C     . VAL A 1 38  ? -4.870  -35.533 -28.074 1.00 58.73  ? 38   VAL A C     1 
ATOM   264  O O     . VAL A 1 38  ? -5.542  -35.310 -27.074 1.00 64.11  ? 38   VAL A O     1 
ATOM   265  C CB    . VAL A 1 38  ? -5.611  -33.737 -29.608 1.00 59.10  ? 38   VAL A CB    1 
ATOM   266  C CG1   . VAL A 1 38  ? -4.306  -33.013 -29.305 1.00 62.05  ? 38   VAL A CG1   1 
ATOM   267  C CG2   . VAL A 1 38  ? -6.115  -33.395 -31.005 1.00 57.66  ? 38   VAL A CG2   1 
ATOM   268  N N     . GLU A 1 39  ? -3.636  -36.018 -28.017 1.00 61.93  ? 39   GLU A N     1 
ATOM   269  C CA    . GLU A 1 39  ? -3.004  -36.328 -26.741 1.00 59.67  ? 39   GLU A CA    1 
ATOM   270  C C     . GLU A 1 39  ? -1.671  -35.606 -26.610 1.00 54.27  ? 39   GLU A C     1 
ATOM   271  O O     . GLU A 1 39  ? -1.004  -35.337 -27.605 1.00 58.00  ? 39   GLU A O     1 
ATOM   272  C CB    . GLU A 1 39  ? -2.800  -37.838 -26.605 1.00 73.72  ? 39   GLU A CB    1 
ATOM   273  C CG    . GLU A 1 39  ? -4.076  -38.652 -26.750 1.00 86.38  ? 39   GLU A CG    1 
ATOM   274  C CD    . GLU A 1 39  ? -3.821  -40.148 -26.701 1.00 100.91 ? 39   GLU A CD    1 
ATOM   275  O OE1   . GLU A 1 39  ? -2.666  -40.567 -26.934 1.00 102.67 ? 39   GLU A OE1   1 
ATOM   276  O OE2   . GLU A 1 39  ? -4.776  -40.906 -26.427 1.00 106.22 ? 39   GLU A OE2   1 
ATOM   277  N N     . HIS A 1 40  ? -1.281  -35.293 -25.381 1.00 53.36  ? 40   HIS A N     1 
ATOM   278  C CA    . HIS A 1 40  ? -0.041  -34.564 -25.151 1.00 55.56  ? 40   HIS A CA    1 
ATOM   279  C C     . HIS A 1 40  ? 0.843   -35.242 -24.114 1.00 57.62  ? 40   HIS A C     1 
ATOM   280  O O     . HIS A 1 40  ? 1.074   -34.700 -23.033 1.00 64.93  ? 40   HIS A O     1 
ATOM   281  C CB    . HIS A 1 40  ? -0.327  -33.109 -24.761 1.00 60.11  ? 40   HIS A CB    1 
ATOM   282  C CG    . HIS A 1 40  ? -1.294  -32.960 -23.629 1.00 59.96  ? 40   HIS A CG    1 
ATOM   283  N ND1   . HIS A 1 40  ? -0.891  -32.705 -22.335 1.00 57.91  ? 40   HIS A ND1   1 
ATOM   284  C CD2   . HIS A 1 40  ? -2.646  -33.026 -23.598 1.00 55.38  ? 40   HIS A CD2   1 
ATOM   285  C CE1   . HIS A 1 40  ? -1.954  -32.623 -21.556 1.00 59.17  ? 40   HIS A CE1   1 
ATOM   286  N NE2   . HIS A 1 40  ? -3.031  -32.813 -22.297 1.00 58.16  ? 40   HIS A NE2   1 
ATOM   287  N N     . PRO A 1 41  ? 1.356   -36.432 -24.457 1.00 58.40  ? 41   PRO A N     1 
ATOM   288  C CA    . PRO A 1 41  ? 2.165   -37.256 -23.556 1.00 63.22  ? 41   PRO A CA    1 
ATOM   289  C C     . PRO A 1 41  ? 3.428   -36.548 -23.104 1.00 63.48  ? 41   PRO A C     1 
ATOM   290  O O     . PRO A 1 41  ? 4.004   -35.774 -23.867 1.00 60.96  ? 41   PRO A O     1 
ATOM   291  C CB    . PRO A 1 41  ? 2.547   -38.459 -24.429 1.00 56.99  ? 41   PRO A CB    1 
ATOM   292  C CG    . PRO A 1 41  ? 1.529   -38.490 -25.510 1.00 55.67  ? 41   PRO A CG    1 
ATOM   293  C CD    . PRO A 1 41  ? 1.188   -37.062 -25.777 1.00 58.08  ? 41   PRO A CD    1 
ATOM   294  N N     . ASP A 1 42  ? 3.847   -36.820 -21.872 1.00 60.38  ? 42   ASP A N     1 
ATOM   295  C CA    . ASP A 1 42  ? 5.148   -36.385 -21.387 1.00 62.71  ? 42   ASP A CA    1 
ATOM   296  C C     . ASP A 1 42  ? 6.242   -37.112 -22.166 1.00 57.87  ? 42   ASP A C     1 
ATOM   297  O O     . ASP A 1 42  ? 6.011   -38.208 -22.690 1.00 52.56  ? 42   ASP A O     1 
ATOM   298  C CB    . ASP A 1 42  ? 5.282   -36.677 -19.891 1.00 72.59  ? 42   ASP A CB    1 
ATOM   299  C CG    . ASP A 1 42  ? 4.335   -35.837 -19.045 1.00 86.63  ? 42   ASP A CG    1 
ATOM   300  O OD1   . ASP A 1 42  ? 4.170   -34.633 -19.343 1.00 89.84  ? 42   ASP A OD1   1 
ATOM   301  O OD2   . ASP A 1 42  ? 3.756   -36.382 -18.081 1.00 90.29  ? 42   ASP A OD2   1 
ATOM   302  N N     . LYS A 1 43  ? 7.420   -36.498 -22.243 1.00 52.16  ? 43   LYS A N     1 
ATOM   303  C CA    . LYS A 1 43  ? 8.544   -37.056 -22.991 1.00 62.40  ? 43   LYS A CA    1 
ATOM   304  C C     . LYS A 1 43  ? 8.099   -37.615 -24.346 1.00 65.82  ? 43   LYS A C     1 
ATOM   305  O O     . LYS A 1 43  ? 8.534   -38.693 -24.758 1.00 66.15  ? 43   LYS A O     1 
ATOM   306  C CB    . LYS A 1 43  ? 9.233   -38.154 -22.178 1.00 70.24  ? 43   LYS A CB    1 
ATOM   307  C CG    . LYS A 1 43  ? 9.785   -37.702 -20.839 1.00 77.35  ? 43   LYS A CG    1 
ATOM   308  C CD    . LYS A 1 43  ? 10.338  -38.893 -20.064 1.00 90.20  ? 43   LYS A CD    1 
ATOM   309  C CE    . LYS A 1 43  ? 10.834  -38.488 -18.682 1.00 98.70  ? 43   LYS A CE    1 
ATOM   310  N NZ    . LYS A 1 43  ? 11.267  -39.664 -17.870 1.00 99.80  ? 43   LYS A NZ    1 
ATOM   311  N N     . LEU A 1 44  ? 7.231   -36.877 -25.031 1.00 63.25  ? 44   LEU A N     1 
ATOM   312  C CA    . LEU A 1 44  ? 6.625   -37.341 -26.277 1.00 60.62  ? 44   LEU A CA    1 
ATOM   313  C C     . LEU A 1 44  ? 7.642   -37.571 -27.399 1.00 56.55  ? 44   LEU A C     1 
ATOM   314  O O     . LEU A 1 44  ? 7.489   -38.485 -28.211 1.00 50.36  ? 44   LEU A O     1 
ATOM   315  C CB    . LEU A 1 44  ? 5.538   -36.355 -26.717 1.00 62.99  ? 44   LEU A CB    1 
ATOM   316  C CG    . LEU A 1 44  ? 5.534   -35.786 -28.132 1.00 60.87  ? 44   LEU A CG    1 
ATOM   317  C CD1   . LEU A 1 44  ? 5.033   -36.830 -29.118 1.00 68.10  ? 44   LEU A CD1   1 
ATOM   318  C CD2   . LEU A 1 44  ? 4.654   -34.553 -28.176 1.00 54.08  ? 44   LEU A CD2   1 
ATOM   319  N N     . GLU A 1 45  ? 8.678   -36.740 -27.441 1.00 56.63  ? 45   GLU A N     1 
ATOM   320  C CA    . GLU A 1 45  ? 9.698   -36.859 -28.474 1.00 56.40  ? 45   GLU A CA    1 
ATOM   321  C C     . GLU A 1 45  ? 10.496  -38.137 -28.272 1.00 57.54  ? 45   GLU A C     1 
ATOM   322  O O     . GLU A 1 45  ? 11.145  -38.628 -29.195 1.00 63.61  ? 45   GLU A O     1 
ATOM   323  C CB    . GLU A 1 45  ? 10.638  -35.652 -28.459 1.00 57.49  ? 45   GLU A CB    1 
ATOM   324  C CG    . GLU A 1 45  ? 11.700  -35.693 -27.364 1.00 60.32  ? 45   GLU A CG    1 
ATOM   325  C CD    . GLU A 1 45  ? 11.207  -35.151 -26.029 1.00 61.77  ? 45   GLU A CD    1 
ATOM   326  O OE1   . GLU A 1 45  ? 9.975   -35.066 -25.830 1.00 52.57  ? 45   GLU A OE1   1 
ATOM   327  O OE2   . GLU A 1 45  ? 12.059  -34.804 -25.180 1.00 65.05  ? 45   GLU A OE2   1 
ATOM   328  N N     . GLU A 1 46  ? 10.448  -38.663 -27.055 1.00 53.21  ? 46   GLU A N     1 
ATOM   329  C CA    . GLU A 1 46  ? 11.140  -39.900 -26.722 1.00 60.96  ? 46   GLU A CA    1 
ATOM   330  C C     . GLU A 1 46  ? 10.226  -41.102 -26.905 1.00 61.10  ? 46   GLU A C     1 
ATOM   331  O O     . GLU A 1 46  ? 10.680  -42.180 -27.281 1.00 58.65  ? 46   GLU A O     1 
ATOM   332  C CB    . GLU A 1 46  ? 11.654  -39.868 -25.280 1.00 58.90  ? 46   GLU A CB    1 
ATOM   333  C CG    . GLU A 1 46  ? 12.778  -38.875 -25.033 1.00 66.55  ? 46   GLU A CG    1 
ATOM   334  C CD    . GLU A 1 46  ? 13.320  -38.968 -23.619 1.00 74.84  ? 46   GLU A CD    1 
ATOM   335  O OE1   . GLU A 1 46  ? 12.943  -39.918 -22.903 1.00 76.63  ? 46   GLU A OE1   1 
ATOM   336  O OE2   . GLU A 1 46  ? 14.118  -38.093 -23.220 1.00 79.15  ? 46   GLU A OE2   1 
ATOM   337  N N     . LYS A 1 47  ? 8.938   -40.909 -26.642 1.00 58.37  ? 47   LYS A N     1 
ATOM   338  C CA    . LYS A 1 47  ? 7.988   -42.011 -26.678 1.00 63.40  ? 47   LYS A CA    1 
ATOM   339  C C     . LYS A 1 47  ? 7.573   -42.398 -28.091 1.00 66.36  ? 47   LYS A C     1 
ATOM   340  O O     . LYS A 1 47  ? 7.317   -43.570 -28.358 1.00 72.63  ? 47   LYS A O     1 
ATOM   341  C CB    . LYS A 1 47  ? 6.761   -41.706 -25.815 1.00 72.01  ? 47   LYS A CB    1 
ATOM   342  C CG    . LYS A 1 47  ? 7.035   -41.796 -24.315 1.00 77.14  ? 47   LYS A CG    1 
ATOM   343  C CD    . LYS A 1 47  ? 5.825   -41.385 -23.489 1.00 82.15  ? 47   LYS A CD    1 
ATOM   344  C CE    . LYS A 1 47  ? 6.164   -41.340 -22.004 1.00 87.75  ? 47   LYS A CE    1 
ATOM   345  N NZ    . LYS A 1 47  ? 5.055   -40.781 -21.179 1.00 86.07  ? 47   LYS A NZ    1 
ATOM   346  N N     . PHE A 1 48  ? 7.511   -41.429 -28.998 1.00 61.59  ? 48   PHE A N     1 
ATOM   347  C CA    . PHE A 1 48  ? 7.124   -41.746 -30.369 1.00 57.67  ? 48   PHE A CA    1 
ATOM   348  C C     . PHE A 1 48  ? 8.065   -42.746 -31.038 1.00 61.71  ? 48   PHE A C     1 
ATOM   349  O O     . PHE A 1 48  ? 7.610   -43.746 -31.585 1.00 65.73  ? 48   PHE A O     1 
ATOM   350  C CB    . PHE A 1 48  ? 6.989   -40.498 -31.245 1.00 51.72  ? 48   PHE A CB    1 
ATOM   351  C CG    . PHE A 1 48  ? 6.748   -40.817 -32.694 1.00 54.60  ? 48   PHE A CG    1 
ATOM   352  C CD1   . PHE A 1 48  ? 5.481   -41.156 -33.141 1.00 55.61  ? 48   PHE A CD1   1 
ATOM   353  C CD2   . PHE A 1 48  ? 7.792   -40.807 -33.605 1.00 49.45  ? 48   PHE A CD2   1 
ATOM   354  C CE1   . PHE A 1 48  ? 5.256   -41.462 -34.470 1.00 56.08  ? 48   PHE A CE1   1 
ATOM   355  C CE2   . PHE A 1 48  ? 7.573   -41.115 -34.938 1.00 50.23  ? 48   PHE A CE2   1 
ATOM   356  C CZ    . PHE A 1 48  ? 6.304   -41.441 -35.372 1.00 52.11  ? 48   PHE A CZ    1 
ATOM   357  N N     . PRO A 1 49  ? 9.381   -42.476 -31.010 1.00 63.08  ? 49   PRO A N     1 
ATOM   358  C CA    . PRO A 1 49  ? 10.292  -43.383 -31.721 1.00 66.22  ? 49   PRO A CA    1 
ATOM   359  C C     . PRO A 1 49  ? 10.257  -44.798 -31.143 1.00 73.64  ? 49   PRO A C     1 
ATOM   360  O O     . PRO A 1 49  ? 10.484  -45.765 -31.873 1.00 75.56  ? 49   PRO A O     1 
ATOM   361  C CB    . PRO A 1 49  ? 11.669  -42.739 -31.515 1.00 55.69  ? 49   PRO A CB    1 
ATOM   362  C CG    . PRO A 1 49  ? 11.511  -41.859 -30.319 1.00 52.55  ? 49   PRO A CG    1 
ATOM   363  C CD    . PRO A 1 49  ? 10.096  -41.376 -30.343 1.00 53.86  ? 49   PRO A CD    1 
ATOM   364  N N     . GLN A 1 50  ? 9.963   -44.909 -29.850 1.00 71.23  ? 50   GLN A N     1 
ATOM   365  C CA    . GLN A 1 50  ? 9.842   -46.207 -29.192 1.00 76.81  ? 50   GLN A CA    1 
ATOM   366  C C     . GLN A 1 50  ? 8.602   -46.964 -29.657 1.00 79.06  ? 50   GLN A C     1 
ATOM   367  O O     . GLN A 1 50  ? 8.705   -48.030 -30.259 1.00 83.04  ? 50   GLN A O     1 
ATOM   368  C CB    . GLN A 1 50  ? 9.807   -46.036 -27.673 1.00 75.01  ? 50   GLN A CB    1 
ATOM   369  C CG    . GLN A 1 50  ? 11.141  -45.639 -27.067 1.00 85.76  ? 50   GLN A CG    1 
ATOM   370  C CD    . GLN A 1 50  ? 11.005  -45.104 -25.654 1.00 99.57  ? 50   GLN A CD    1 
ATOM   371  O OE1   . GLN A 1 50  ? 11.998  -44.928 -24.946 1.00 104.23 ? 50   GLN A OE1   1 
ATOM   372  N NE2   . GLN A 1 50  ? 9.771   -44.834 -25.238 1.00 103.92 ? 50   GLN A NE2   1 
ATOM   373  N N     . VAL A 1 51  ? 7.431   -46.404 -29.377 1.00 79.71  ? 51   VAL A N     1 
ATOM   374  C CA    . VAL A 1 51  ? 6.174   -47.053 -29.732 1.00 78.27  ? 51   VAL A CA    1 
ATOM   375  C C     . VAL A 1 51  ? 6.021   -47.248 -31.241 1.00 75.16  ? 51   VAL A C     1 
ATOM   376  O O     . VAL A 1 51  ? 5.540   -48.286 -31.690 1.00 82.31  ? 51   VAL A O     1 
ATOM   377  C CB    . VAL A 1 51  ? 4.955   -46.275 -29.184 1.00 76.29  ? 51   VAL A CB    1 
ATOM   378  C CG1   . VAL A 1 51  ? 5.015   -46.198 -27.664 1.00 71.19  ? 51   VAL A CG1   1 
ATOM   379  C CG2   . VAL A 1 51  ? 4.893   -44.883 -29.789 1.00 79.18  ? 51   VAL A CG2   1 
ATOM   380  N N     . ALA A 1 52  ? 6.439   -46.254 -32.017 1.00 70.31  ? 52   ALA A N     1 
ATOM   381  C CA    . ALA A 1 52  ? 6.245   -46.274 -33.465 1.00 64.84  ? 52   ALA A CA    1 
ATOM   382  C C     . ALA A 1 52  ? 7.169   -47.260 -34.171 1.00 66.61  ? 52   ALA A C     1 
ATOM   383  O O     . ALA A 1 52  ? 6.970   -47.578 -35.347 1.00 65.87  ? 52   ALA A O     1 
ATOM   384  C CB    . ALA A 1 52  ? 6.424   -44.880 -34.042 1.00 64.32  ? 52   ALA A CB    1 
ATOM   385  N N     . ALA A 1 53  ? 8.188   -47.725 -33.459 1.00 66.54  ? 53   ALA A N     1 
ATOM   386  C CA    . ALA A 1 53  ? 9.097   -48.725 -34.000 1.00 75.91  ? 53   ALA A CA    1 
ATOM   387  C C     . ALA A 1 53  ? 8.421   -50.091 -33.989 1.00 82.73  ? 53   ALA A C     1 
ATOM   388  O O     . ALA A 1 53  ? 8.674   -50.931 -34.856 1.00 81.33  ? 53   ALA A O     1 
ATOM   389  C CB    . ALA A 1 53  ? 10.387  -48.761 -33.197 1.00 77.39  ? 53   ALA A CB    1 
ATOM   390  N N     . THR A 1 54  ? 7.555   -50.297 -33.001 1.00 82.84  ? 54   THR A N     1 
ATOM   391  C CA    . THR A 1 54  ? 6.807   -51.540 -32.871 1.00 81.83  ? 54   THR A CA    1 
ATOM   392  C C     . THR A 1 54  ? 5.435   -51.425 -33.527 1.00 84.99  ? 54   THR A C     1 
ATOM   393  O O     . THR A 1 54  ? 4.528   -52.202 -33.225 1.00 93.79  ? 54   THR A O     1 
ATOM   394  C CB    . THR A 1 54  ? 6.617   -51.929 -31.393 1.00 79.80  ? 54   THR A CB    1 
ATOM   395  O OG1   . THR A 1 54  ? 5.716   -51.010 -30.761 1.00 73.84  ? 54   THR A OG1   1 
ATOM   396  C CG2   . THR A 1 54  ? 7.951   -51.912 -30.664 1.00 81.08  ? 54   THR A CG2   1 
ATOM   397  N N     . GLY A 1 55  ? 5.286   -50.444 -34.413 1.00 78.70  ? 55   GLY A N     1 
ATOM   398  C CA    . GLY A 1 55  ? 4.058   -50.271 -35.168 1.00 82.44  ? 55   GLY A CA    1 
ATOM   399  C C     . GLY A 1 55  ? 2.950   -49.561 -34.413 1.00 84.77  ? 55   GLY A C     1 
ATOM   400  O O     . GLY A 1 55  ? 1.865   -49.347 -34.951 1.00 88.48  ? 55   GLY A O     1 
ATOM   401  N N     . ASP A 1 56  ? 3.216   -49.197 -33.165 1.00 86.60  ? 56   ASP A N     1 
ATOM   402  C CA    . ASP A 1 56  ? 2.232   -48.488 -32.357 1.00 92.51  ? 56   ASP A CA    1 
ATOM   403  C C     . ASP A 1 56  ? 2.468   -46.975 -32.441 1.00 89.53  ? 56   ASP A C     1 
ATOM   404  O O     . ASP A 1 56  ? 3.206   -46.505 -33.308 1.00 85.99  ? 56   ASP A O     1 
ATOM   405  C CB    . ASP A 1 56  ? 2.286   -48.974 -30.904 1.00 98.85  ? 56   ASP A CB    1 
ATOM   406  C CG    . ASP A 1 56  ? 1.036   -48.614 -30.118 1.00 105.08 ? 56   ASP A CG    1 
ATOM   407  O OD1   . ASP A 1 56  ? -0.075  -48.700 -30.683 1.00 109.15 ? 56   ASP A OD1   1 
ATOM   408  O OD2   . ASP A 1 56  ? 1.166   -48.243 -28.932 1.00 103.99 ? 56   ASP A OD2   1 
ATOM   409  N N     . GLY A 1 57  ? 1.837   -46.219 -31.546 1.00 83.67  ? 57   GLY A N     1 
ATOM   410  C CA    . GLY A 1 57  ? 1.967   -44.773 -31.537 1.00 78.19  ? 57   GLY A CA    1 
ATOM   411  C C     . GLY A 1 57  ? 0.850   -44.074 -32.289 1.00 76.38  ? 57   GLY A C     1 
ATOM   412  O O     . GLY A 1 57  ? -0.087  -44.722 -32.753 1.00 77.40  ? 57   GLY A O     1 
ATOM   413  N N     . PRO A 1 58  ? 0.943   -42.739 -32.411 1.00 71.51  ? 58   PRO A N     1 
ATOM   414  C CA    . PRO A 1 58  ? -0.052  -41.914 -33.111 1.00 61.68  ? 58   PRO A CA    1 
ATOM   415  C C     . PRO A 1 58  ? 0.047   -42.019 -34.625 1.00 59.01  ? 58   PRO A C     1 
ATOM   416  O O     . PRO A 1 58  ? 1.052   -42.497 -35.143 1.00 64.09  ? 58   PRO A O     1 
ATOM   417  C CB    . PRO A 1 58  ? 0.315   -40.494 -32.682 1.00 55.33  ? 58   PRO A CB    1 
ATOM   418  C CG    . PRO A 1 58  ? 1.771   -40.561 -32.399 1.00 61.10  ? 58   PRO A CG    1 
ATOM   419  C CD    . PRO A 1 58  ? 1.996   -41.918 -31.790 1.00 66.23  ? 58   PRO A CD    1 
ATOM   420  N N     . ASP A 1 59  ? -0.996  -41.570 -35.318 1.00 50.53  ? 59   ASP A N     1 
ATOM   421  C CA    . ASP A 1 59  ? -0.976  -41.461 -36.763 1.00 54.36  ? 59   ASP A CA    1 
ATOM   422  C C     . ASP A 1 59  ? -0.149  -40.253 -37.156 1.00 60.77  ? 59   ASP A C     1 
ATOM   423  O O     . ASP A 1 59  ? 0.452   -40.217 -38.229 1.00 62.57  ? 59   ASP A O     1 
ATOM   424  C CB    . ASP A 1 59  ? -2.395  -41.279 -37.302 1.00 64.46  ? 59   ASP A CB    1 
ATOM   425  C CG    . ASP A 1 59  ? -3.318  -42.416 -36.915 1.00 71.51  ? 59   ASP A CG    1 
ATOM   426  O OD1   . ASP A 1 59  ? -3.910  -42.350 -35.817 1.00 72.30  ? 59   ASP A OD1   1 
ATOM   427  O OD2   . ASP A 1 59  ? -3.457  -43.373 -37.709 1.00 75.05  ? 59   ASP A OD2   1 
ATOM   428  N N     . ILE A 1 60  ? -0.130  -39.258 -36.278 1.00 67.09  ? 60   ILE A N     1 
ATOM   429  C CA    . ILE A 1 60  ? 0.503   -37.980 -36.577 1.00 60.80  ? 60   ILE A CA    1 
ATOM   430  C C     . ILE A 1 60  ? 1.264   -37.457 -35.376 1.00 60.66  ? 60   ILE A C     1 
ATOM   431  O O     . ILE A 1 60  ? 0.704   -37.340 -34.286 1.00 69.88  ? 60   ILE A O     1 
ATOM   432  C CB    . ILE A 1 60  ? -0.543  -36.930 -36.956 1.00 51.00  ? 60   ILE A CB    1 
ATOM   433  C CG1   . ILE A 1 60  ? -1.311  -37.376 -38.199 1.00 49.92  ? 60   ILE A CG1   1 
ATOM   434  C CG2   . ILE A 1 60  ? 0.117   -35.577 -37.163 1.00 50.45  ? 60   ILE A CG2   1 
ATOM   435  C CD1   . ILE A 1 60  ? -2.354  -36.385 -38.654 1.00 53.80  ? 60   ILE A CD1   1 
ATOM   436  N N     . ILE A 1 61  ? 2.538   -37.140 -35.568 1.00 52.11  ? 61   ILE A N     1 
ATOM   437  C CA    . ILE A 1 61  ? 3.316   -36.545 -34.491 1.00 49.52  ? 61   ILE A CA    1 
ATOM   438  C C     . ILE A 1 61  ? 3.751   -35.122 -34.808 1.00 54.42  ? 61   ILE A C     1 
ATOM   439  O O     . ILE A 1 61  ? 4.282   -34.843 -35.887 1.00 57.26  ? 61   ILE A O     1 
ATOM   440  C CB    . ILE A 1 61  ? 4.546   -37.387 -34.108 1.00 50.42  ? 61   ILE A CB    1 
ATOM   441  C CG1   . ILE A 1 61  ? 5.378   -36.630 -33.070 1.00 50.76  ? 61   ILE A CG1   1 
ATOM   442  C CG2   . ILE A 1 61  ? 5.370   -37.732 -35.339 1.00 50.03  ? 61   ILE A CG2   1 
ATOM   443  C CD1   . ILE A 1 61  ? 6.639   -37.333 -32.650 1.00 52.44  ? 61   ILE A CD1   1 
ATOM   444  N N     . PHE A 1 62  ? 3.503   -34.229 -33.855 1.00 54.76  ? 62   PHE A N     1 
ATOM   445  C CA    . PHE A 1 62  ? 3.927   -32.839 -33.938 1.00 45.48  ? 62   PHE A CA    1 
ATOM   446  C C     . PHE A 1 62  ? 5.178   -32.621 -33.100 1.00 47.63  ? 62   PHE A C     1 
ATOM   447  O O     . PHE A 1 62  ? 5.164   -32.837 -31.890 1.00 49.95  ? 62   PHE A O     1 
ATOM   448  C CB    . PHE A 1 62  ? 2.834   -31.919 -33.393 1.00 50.44  ? 62   PHE A CB    1 
ATOM   449  C CG    . PHE A 1 62  ? 1.737   -31.625 -34.366 1.00 47.91  ? 62   PHE A CG    1 
ATOM   450  C CD1   . PHE A 1 62  ? 0.679   -32.505 -34.526 1.00 46.72  ? 62   PHE A CD1   1 
ATOM   451  C CD2   . PHE A 1 62  ? 1.753   -30.452 -35.105 1.00 46.74  ? 62   PHE A CD2   1 
ATOM   452  C CE1   . PHE A 1 62  ? -0.336  -32.225 -35.419 1.00 52.82  ? 62   PHE A CE1   1 
ATOM   453  C CE2   . PHE A 1 62  ? 0.740   -30.162 -36.001 1.00 44.70  ? 62   PHE A CE2   1 
ATOM   454  C CZ    . PHE A 1 62  ? -0.304  -31.047 -36.162 1.00 49.09  ? 62   PHE A CZ    1 
ATOM   455  N N     . TRP A 1 63  ? 6.256   -32.181 -33.734 1.00 44.25  ? 63   TRP A N     1 
ATOM   456  C CA    . TRP A 1 63  ? 7.443   -31.781 -32.992 1.00 38.12  ? 63   TRP A CA    1 
ATOM   457  C C     . TRP A 1 63  ? 8.284   -30.833 -33.822 1.00 45.10  ? 63   TRP A C     1 
ATOM   458  O O     . TRP A 1 63  ? 8.084   -30.715 -35.034 1.00 49.93  ? 63   TRP A O     1 
ATOM   459  C CB    . TRP A 1 63  ? 8.277   -32.998 -32.598 1.00 40.71  ? 63   TRP A CB    1 
ATOM   460  C CG    . TRP A 1 63  ? 9.306   -32.667 -31.575 1.00 48.88  ? 63   TRP A CG    1 
ATOM   461  C CD1   . TRP A 1 63  ? 10.628  -32.410 -31.789 1.00 49.20  ? 63   TRP A CD1   1 
ATOM   462  C CD2   . TRP A 1 63  ? 9.089   -32.520 -30.167 1.00 48.43  ? 63   TRP A CD2   1 
ATOM   463  N NE1   . TRP A 1 63  ? 11.254  -32.128 -30.597 1.00 45.28  ? 63   TRP A NE1   1 
ATOM   464  C CE2   . TRP A 1 63  ? 10.329  -32.187 -29.586 1.00 48.27  ? 63   TRP A CE2   1 
ATOM   465  C CE3   . TRP A 1 63  ? 7.968   -32.645 -29.341 1.00 45.35  ? 63   TRP A CE3   1 
ATOM   466  C CZ2   . TRP A 1 63  ? 10.478  -31.976 -28.216 1.00 47.58  ? 63   TRP A CZ2   1 
ATOM   467  C CZ3   . TRP A 1 63  ? 8.117   -32.438 -27.977 1.00 47.84  ? 63   TRP A CZ3   1 
ATOM   468  C CH2   . TRP A 1 63  ? 9.362   -32.106 -27.430 1.00 51.85  ? 63   TRP A CH2   1 
ATOM   469  N N     . ALA A 1 64  ? 9.225   -30.155 -33.179 1.00 39.28  ? 64   ALA A N     1 
ATOM   470  C CA    . ALA A 1 64  ? 10.137  -29.294 -33.914 1.00 39.13  ? 64   ALA A CA    1 
ATOM   471  C C     . ALA A 1 64  ? 10.889  -30.157 -34.912 1.00 39.82  ? 64   ALA A C     1 
ATOM   472  O O     . ALA A 1 64  ? 11.134  -31.334 -34.663 1.00 47.78  ? 64   ALA A O     1 
ATOM   473  C CB    . ALA A 1 64  ? 11.095  -28.585 -32.977 1.00 31.36  ? 64   ALA A CB    1 
ATOM   474  N N     . HIS A 1 65  ? 11.249  -29.565 -36.043 1.00 38.12  ? 65   HIS A N     1 
ATOM   475  C CA    . HIS A 1 65  ? 11.824  -30.308 -37.159 1.00 39.04  ? 65   HIS A CA    1 
ATOM   476  C C     . HIS A 1 65  ? 13.096  -31.095 -36.821 1.00 43.63  ? 65   HIS A C     1 
ATOM   477  O O     . HIS A 1 65  ? 13.430  -32.056 -37.512 1.00 42.11  ? 65   HIS A O     1 
ATOM   478  C CB    . HIS A 1 65  ? 12.115  -29.352 -38.309 1.00 37.68  ? 65   HIS A CB    1 
ATOM   479  C CG    . HIS A 1 65  ? 13.275  -28.445 -38.053 1.00 36.73  ? 65   HIS A CG    1 
ATOM   480  N ND1   . HIS A 1 65  ? 13.165  -27.288 -37.312 1.00 39.35  ? 65   HIS A ND1   1 
ATOM   481  C CD2   . HIS A 1 65  ? 14.573  -28.532 -38.427 1.00 37.34  ? 65   HIS A CD2   1 
ATOM   482  C CE1   . HIS A 1 65  ? 14.344  -26.694 -37.249 1.00 43.49  ? 65   HIS A CE1   1 
ATOM   483  N NE2   . HIS A 1 65  ? 15.216  -27.429 -37.916 1.00 46.83  ? 65   HIS A NE2   1 
ATOM   484  N N     . ASP A 1 66  ? 13.801  -30.697 -35.767 1.00 35.26  ? 66   ASP A N     1 
ATOM   485  C CA    . ASP A 1 66  ? 15.120  -31.263 -35.489 1.00 33.58  ? 66   ASP A CA    1 
ATOM   486  C C     . ASP A 1 66  ? 15.091  -32.771 -35.250 1.00 40.19  ? 66   ASP A C     1 
ATOM   487  O O     . ASP A 1 66  ? 16.042  -33.477 -35.595 1.00 44.97  ? 66   ASP A O     1 
ATOM   488  C CB    . ASP A 1 66  ? 15.783  -30.545 -34.309 1.00 40.14  ? 66   ASP A CB    1 
ATOM   489  C CG    . ASP A 1 66  ? 15.071  -30.796 -32.999 1.00 37.30  ? 66   ASP A CG    1 
ATOM   490  O OD1   . ASP A 1 66  ? 13.916  -30.349 -32.843 1.00 39.98  ? 66   ASP A OD1   1 
ATOM   491  O OD2   . ASP A 1 66  ? 15.676  -31.431 -32.118 1.00 45.53  ? 66   ASP A OD2   1 
ATOM   492  N N     . ARG A 1 67  ? 14.000  -33.265 -34.670 1.00 34.72  ? 67   ARG A N     1 
ATOM   493  C CA    . ARG A 1 67  ? 13.867  -34.698 -34.394 1.00 41.60  ? 67   ARG A CA    1 
ATOM   494  C C     . ARG A 1 67  ? 13.567  -35.536 -35.631 1.00 40.43  ? 67   ARG A C     1 
ATOM   495  O O     . ARG A 1 67  ? 13.836  -36.731 -35.652 1.00 44.27  ? 67   ARG A O     1 
ATOM   496  C CB    . ARG A 1 67  ? 12.751  -34.954 -33.379 1.00 44.27  ? 67   ARG A CB    1 
ATOM   497  C CG    . ARG A 1 67  ? 13.012  -34.398 -32.011 1.00 49.94  ? 67   ARG A CG    1 
ATOM   498  C CD    . ARG A 1 67  ? 13.748  -35.377 -31.137 1.00 54.92  ? 67   ARG A CD    1 
ATOM   499  N NE    . ARG A 1 67  ? 14.427  -34.667 -30.061 1.00 57.40  ? 67   ARG A NE    1 
ATOM   500  C CZ    . ARG A 1 67  ? 15.123  -35.253 -29.097 1.00 54.45  ? 67   ARG A CZ    1 
ATOM   501  N NH1   . ARG A 1 67  ? 15.223  -36.576 -29.057 1.00 53.56  ? 67   ARG A NH1   1 
ATOM   502  N NH2   . ARG A 1 67  ? 15.712  -34.509 -28.170 1.00 47.63  ? 67   ARG A NH2   1 
ATOM   503  N N     . PHE A 1 68  ? 12.987  -34.919 -36.651 1.00 44.19  ? 68   PHE A N     1 
ATOM   504  C CA    . PHE A 1 68  ? 12.418  -35.692 -37.746 1.00 47.31  ? 68   PHE A CA    1 
ATOM   505  C C     . PHE A 1 68  ? 13.442  -36.417 -38.615 1.00 47.27  ? 68   PHE A C     1 
ATOM   506  O O     . PHE A 1 68  ? 13.138  -37.458 -39.186 1.00 50.66  ? 68   PHE A O     1 
ATOM   507  C CB    . PHE A 1 68  ? 11.457  -34.841 -38.574 1.00 53.95  ? 68   PHE A CB    1 
ATOM   508  C CG    . PHE A 1 68  ? 10.131  -34.627 -37.906 1.00 58.74  ? 68   PHE A CG    1 
ATOM   509  C CD1   . PHE A 1 68  ? 9.023   -35.358 -38.287 1.00 63.82  ? 68   PHE A CD1   1 
ATOM   510  C CD2   . PHE A 1 68  ? 9.999   -33.719 -36.877 1.00 52.64  ? 68   PHE A CD2   1 
ATOM   511  C CE1   . PHE A 1 68  ? 7.806   -35.170 -37.667 1.00 62.40  ? 68   PHE A CE1   1 
ATOM   512  C CE2   . PHE A 1 68  ? 8.784   -33.527 -36.260 1.00 52.94  ? 68   PHE A CE2   1 
ATOM   513  C CZ    . PHE A 1 68  ? 7.688   -34.253 -36.656 1.00 54.20  ? 68   PHE A CZ    1 
ATOM   514  N N     . GLY A 1 69  ? 14.652  -35.875 -38.701 1.00 43.86  ? 69   GLY A N     1 
ATOM   515  C CA    . GLY A 1 69  ? 15.742  -36.564 -39.363 1.00 36.03  ? 69   GLY A CA    1 
ATOM   516  C C     . GLY A 1 69  ? 15.948  -37.965 -38.808 1.00 48.70  ? 69   GLY A C     1 
ATOM   517  O O     . GLY A 1 69  ? 16.107  -38.930 -39.559 1.00 52.78  ? 69   GLY A O     1 
ATOM   518  N N     . GLY A 1 70  ? 15.940  -38.081 -37.485 1.00 45.37  ? 70   GLY A N     1 
ATOM   519  C CA    . GLY A 1 70  ? 16.173  -39.359 -36.836 1.00 47.61  ? 70   GLY A CA    1 
ATOM   520  C C     . GLY A 1 70  ? 15.001  -40.302 -36.992 1.00 52.74  ? 70   GLY A C     1 
ATOM   521  O O     . GLY A 1 70  ? 15.183  -41.507 -37.151 1.00 58.72  ? 70   GLY A O     1 
ATOM   522  N N     . TYR A 1 71  ? 13.793  -39.748 -36.936 1.00 56.69  ? 71   TYR A N     1 
ATOM   523  C CA    . TYR A 1 71  ? 12.575  -40.522 -37.136 1.00 55.53  ? 71   TYR A CA    1 
ATOM   524  C C     . TYR A 1 71  ? 12.574  -41.145 -38.529 1.00 61.54  ? 71   TYR A C     1 
ATOM   525  O O     . TYR A 1 71  ? 12.346  -42.346 -38.687 1.00 63.01  ? 71   TYR A O     1 
ATOM   526  C CB    . TYR A 1 71  ? 11.341  -39.631 -36.970 1.00 46.99  ? 71   TYR A CB    1 
ATOM   527  C CG    . TYR A 1 71  ? 11.143  -39.085 -35.569 1.00 47.29  ? 71   TYR A CG    1 
ATOM   528  C CD1   . TYR A 1 71  ? 11.857  -39.592 -34.495 1.00 42.28  ? 71   TYR A CD1   1 
ATOM   529  C CD2   . TYR A 1 71  ? 10.231  -38.066 -35.324 1.00 42.92  ? 71   TYR A CD2   1 
ATOM   530  C CE1   . TYR A 1 71  ? 11.673  -39.096 -33.218 1.00 46.06  ? 71   TYR A CE1   1 
ATOM   531  C CE2   . TYR A 1 71  ? 10.042  -37.564 -34.058 1.00 43.92  ? 71   TYR A CE2   1 
ATOM   532  C CZ    . TYR A 1 71  ? 10.763  -38.080 -33.006 1.00 49.92  ? 71   TYR A CZ    1 
ATOM   533  O OH    . TYR A 1 71  ? 10.569  -37.578 -31.739 1.00 51.62  ? 71   TYR A OH    1 
ATOM   534  N N     . ALA A 1 72  ? 12.828  -40.316 -39.536 1.00 56.49  ? 72   ALA A N     1 
ATOM   535  C CA    . ALA A 1 72  ? 12.886  -40.770 -40.921 1.00 56.82  ? 72   ALA A CA    1 
ATOM   536  C C     . ALA A 1 72  ? 13.861  -41.930 -41.098 1.00 64.32  ? 72   ALA A C     1 
ATOM   537  O O     . ALA A 1 72  ? 13.494  -42.981 -41.622 1.00 68.84  ? 72   ALA A O     1 
ATOM   538  C CB    . ALA A 1 72  ? 13.262  -39.619 -41.837 1.00 49.38  ? 72   ALA A CB    1 
ATOM   539  N N     . GLN A 1 73  ? 15.098  -41.737 -40.648 1.00 63.33  ? 73   GLN A N     1 
ATOM   540  C CA    . GLN A 1 73  ? 16.148  -42.739 -40.817 1.00 66.28  ? 73   GLN A CA    1 
ATOM   541  C C     . GLN A 1 73  ? 15.752  -44.098 -40.253 1.00 68.99  ? 73   GLN A C     1 
ATOM   542  O O     . GLN A 1 73  ? 16.242  -45.128 -40.710 1.00 78.03  ? 73   GLN A O     1 
ATOM   543  C CB    . GLN A 1 73  ? 17.458  -42.267 -40.180 1.00 65.99  ? 73   GLN A CB    1 
ATOM   544  C CG    . GLN A 1 73  ? 18.690  -43.068 -40.605 1.00 68.92  ? 73   GLN A CG    1 
ATOM   545  C CD    . GLN A 1 73  ? 19.182  -42.720 -42.011 1.00 72.02  ? 73   GLN A CD    1 
ATOM   546  O OE1   . GLN A 1 73  ? 20.169  -43.280 -42.487 1.00 79.89  ? 73   GLN A OE1   1 
ATOM   547  N NE2   . GLN A 1 73  ? 18.501  -41.788 -42.672 1.00 63.18  ? 73   GLN A NE2   1 
ATOM   548  N N     . SER A 1 74  ? 14.870  -44.096 -39.259 1.00 68.24  ? 74   SER A N     1 
ATOM   549  C CA    . SER A 1 74  ? 14.395  -45.337 -38.651 1.00 68.12  ? 74   SER A CA    1 
ATOM   550  C C     . SER A 1 74  ? 13.098  -45.810 -39.295 1.00 63.49  ? 74   SER A C     1 
ATOM   551  O O     . SER A 1 74  ? 12.408  -46.671 -38.751 1.00 64.50  ? 74   SER A O     1 
ATOM   552  C CB    . SER A 1 74  ? 14.180  -45.155 -37.144 1.00 67.55  ? 74   SER A CB    1 
ATOM   553  O OG    . SER A 1 74  ? 15.409  -44.962 -36.468 1.00 65.04  ? 74   SER A OG    1 
ATOM   554  N N     . GLY A 1 75  ? 12.768  -45.233 -40.446 1.00 64.53  ? 75   GLY A N     1 
ATOM   555  C CA    . GLY A 1 75  ? 11.545  -45.566 -41.152 1.00 67.72  ? 75   GLY A CA    1 
ATOM   556  C C     . GLY A 1 75  ? 10.323  -45.501 -40.257 1.00 72.32  ? 75   GLY A C     1 
ATOM   557  O O     . GLY A 1 75  ? 9.516   -46.432 -40.221 1.00 74.91  ? 75   GLY A O     1 
ATOM   558  N N     . LEU A 1 76  ? 10.190  -44.400 -39.523 1.00 64.51  ? 76   LEU A N     1 
ATOM   559  C CA    . LEU A 1 76  ? 9.043   -44.198 -38.651 1.00 60.67  ? 76   LEU A CA    1 
ATOM   560  C C     . LEU A 1 76  ? 8.054   -43.234 -39.291 1.00 64.47  ? 76   LEU A C     1 
ATOM   561  O O     . LEU A 1 76  ? 6.931   -43.072 -38.812 1.00 75.20  ? 76   LEU A O     1 
ATOM   562  C CB    . LEU A 1 76  ? 9.495   -43.651 -37.300 1.00 57.02  ? 76   LEU A CB    1 
ATOM   563  C CG    . LEU A 1 76  ? 10.522  -44.512 -36.565 1.00 61.19  ? 76   LEU A CG    1 
ATOM   564  C CD1   . LEU A 1 76  ? 10.943  -43.850 -35.266 1.00 61.98  ? 76   LEU A CD1   1 
ATOM   565  C CD2   . LEU A 1 76  ? 9.951   -45.891 -36.306 1.00 59.84  ? 76   LEU A CD2   1 
ATOM   566  N N     . LEU A 1 77  ? 8.482   -42.595 -40.375 1.00 48.19  ? 77   LEU A N     1 
ATOM   567  C CA    . LEU A 1 77  ? 7.687   -41.563 -41.020 1.00 57.77  ? 77   LEU A CA    1 
ATOM   568  C C     . LEU A 1 77  ? 7.420   -41.896 -42.473 1.00 70.18  ? 77   LEU A C     1 
ATOM   569  O O     . LEU A 1 77  ? 8.335   -42.252 -43.213 1.00 75.16  ? 77   LEU A O     1 
ATOM   570  C CB    . LEU A 1 77  ? 8.407   -40.218 -40.960 1.00 54.77  ? 77   LEU A CB    1 
ATOM   571  C CG    . LEU A 1 77  ? 8.622   -39.607 -39.582 1.00 55.88  ? 77   LEU A CG    1 
ATOM   572  C CD1   . LEU A 1 77  ? 9.437   -38.340 -39.725 1.00 59.59  ? 77   LEU A CD1   1 
ATOM   573  C CD2   . LEU A 1 77  ? 7.286   -39.324 -38.913 1.00 47.87  ? 77   LEU A CD2   1 
ATOM   574  N N     . ALA A 1 78  ? 6.160   -41.767 -42.874 1.00 69.58  ? 78   ALA A N     1 
ATOM   575  C CA    . ALA A 1 78  ? 5.784   -41.888 -44.269 1.00 66.93  ? 78   ALA A CA    1 
ATOM   576  C C     . ALA A 1 78  ? 6.261   -40.652 -45.006 1.00 73.57  ? 78   ALA A C     1 
ATOM   577  O O     . ALA A 1 78  ? 6.292   -39.561 -44.437 1.00 79.71  ? 78   ALA A O     1 
ATOM   578  C CB    . ALA A 1 78  ? 4.281   -42.016 -44.394 1.00 63.86  ? 78   ALA A CB    1 
ATOM   579  N N     . GLU A 1 79  ? 6.651   -40.813 -46.266 1.00 70.60  ? 79   GLU A N     1 
ATOM   580  C CA    . GLU A 1 79  ? 6.906   -39.651 -47.095 1.00 70.05  ? 79   GLU A CA    1 
ATOM   581  C C     . GLU A 1 79  ? 5.556   -39.020 -47.378 1.00 68.79  ? 79   GLU A C     1 
ATOM   582  O O     . GLU A 1 79  ? 4.577   -39.719 -47.627 1.00 67.93  ? 79   GLU A O     1 
ATOM   583  C CB    . GLU A 1 79  ? 7.603   -40.027 -48.403 1.00 72.14  ? 79   GLU A CB    1 
ATOM   584  C CG    . GLU A 1 79  ? 7.873   -38.829 -49.311 1.00 73.60  ? 79   GLU A CG    1 
ATOM   585  C CD    . GLU A 1 79  ? 8.391   -39.225 -50.689 1.00 75.98  ? 79   GLU A CD    1 
ATOM   586  O OE1   . GLU A 1 79  ? 8.469   -40.442 -50.974 1.00 76.68  ? 79   GLU A OE1   1 
ATOM   587  O OE2   . GLU A 1 79  ? 8.719   -38.315 -51.486 1.00 60.39  ? 79   GLU A OE2   1 
ATOM   588  N N     . ILE A 1 80  ? 5.495   -37.700 -47.310 1.00 71.12  ? 80   ILE A N     1 
ATOM   589  C CA    . ILE A 1 80  ? 4.252   -37.004 -47.577 1.00 74.17  ? 80   ILE A CA    1 
ATOM   590  C C     . ILE A 1 80  ? 4.233   -36.577 -49.036 1.00 80.54  ? 80   ILE A C     1 
ATOM   591  O O     . ILE A 1 80  ? 5.267   -36.220 -49.600 1.00 80.10  ? 80   ILE A O     1 
ATOM   592  C CB    . ILE A 1 80  ? 4.072   -35.788 -46.651 1.00 74.07  ? 80   ILE A CB    1 
ATOM   593  C CG1   . ILE A 1 80  ? 5.203   -34.787 -46.856 1.00 73.51  ? 80   ILE A CG1   1 
ATOM   594  C CG2   . ILE A 1 80  ? 4.028   -36.230 -45.195 1.00 73.74  ? 80   ILE A CG2   1 
ATOM   595  C CD1   . ILE A 1 80  ? 5.018   -33.524 -46.077 1.00 76.43  ? 80   ILE A CD1   1 
ATOM   596  N N     . THR A 1 81  ? 3.054   -36.619 -49.647 1.00 86.48  ? 81   THR A N     1 
ATOM   597  C CA    . THR A 1 81  ? 2.931   -36.346 -51.073 1.00 87.31  ? 81   THR A CA    1 
ATOM   598  C C     . THR A 1 81  ? 2.012   -35.169 -51.380 1.00 85.92  ? 81   THR A C     1 
ATOM   599  O O     . THR A 1 81  ? 0.976   -35.339 -52.022 1.00 85.61  ? 81   THR A O     1 
ATOM   600  C CB    . THR A 1 81  ? 2.421   -37.584 -51.834 1.00 89.02  ? 81   THR A CB    1 
ATOM   601  O OG1   . THR A 1 81  ? 1.238   -38.084 -51.196 1.00 83.23  ? 81   THR A OG1   1 
ATOM   602  C CG2   . THR A 1 81  ? 3.483   -38.674 -51.849 1.00 91.72  ? 81   THR A CG2   1 
ATOM   603  N N     . PRO A 1 82  ? 2.387   -33.968 -50.918 1.00 84.52  ? 82   PRO A N     1 
ATOM   604  C CA    . PRO A 1 82  ? 1.641   -32.774 -51.317 1.00 84.41  ? 82   PRO A CA    1 
ATOM   605  C C     . PRO A 1 82  ? 2.012   -32.395 -52.744 1.00 84.39  ? 82   PRO A C     1 
ATOM   606  O O     . PRO A 1 82  ? 3.172   -32.549 -53.126 1.00 82.41  ? 82   PRO A O     1 
ATOM   607  C CB    . PRO A 1 82  ? 2.148   -31.714 -50.342 1.00 81.12  ? 82   PRO A CB    1 
ATOM   608  C CG    . PRO A 1 82  ? 3.532   -32.153 -50.016 1.00 78.11  ? 82   PRO A CG    1 
ATOM   609  C CD    . PRO A 1 82  ? 3.483   -33.651 -49.987 1.00 77.70  ? 82   PRO A CD    1 
ATOM   610  N N     . ASP A 1 83  ? 1.045   -31.919 -53.522 1.00 86.59  ? 83   ASP A N     1 
ATOM   611  C CA    . ASP A 1 83  ? 1.303   -31.547 -54.908 1.00 89.44  ? 83   ASP A CA    1 
ATOM   612  C C     . ASP A 1 83  ? 1.763   -30.096 -55.021 1.00 90.57  ? 83   ASP A C     1 
ATOM   613  O O     . ASP A 1 83  ? 1.646   -29.327 -54.067 1.00 90.71  ? 83   ASP A O     1 
ATOM   614  C CB    . ASP A 1 83  ? 0.069   -31.795 -55.783 1.00 94.23  ? 83   ASP A CB    1 
ATOM   615  C CG    . ASP A 1 83  ? -1.177  -31.111 -55.252 1.00 99.05  ? 83   ASP A CG    1 
ATOM   616  O OD1   . ASP A 1 83  ? -1.051  -30.126 -54.492 1.00 101.33 ? 83   ASP A OD1   1 
ATOM   617  O OD2   . ASP A 1 83  ? -2.289  -31.559 -55.603 1.00 99.25  ? 83   ASP A OD2   1 
ATOM   618  N N     . LYS A 1 84  ? 2.287   -29.732 -56.189 1.00 87.20  ? 84   LYS A N     1 
ATOM   619  C CA    . LYS A 1 84  ? 2.819   -28.392 -56.412 1.00 87.78  ? 84   LYS A CA    1 
ATOM   620  C C     . LYS A 1 84  ? 1.850   -27.320 -55.928 1.00 86.58  ? 84   LYS A C     1 
ATOM   621  O O     . LYS A 1 84  ? 2.263   -26.281 -55.413 1.00 82.89  ? 84   LYS A O     1 
ATOM   622  C CB    . LYS A 1 84  ? 3.139   -28.179 -57.895 1.00 88.70  ? 84   LYS A CB    1 
ATOM   623  N N     . ALA A 1 85  ? 0.558   -27.586 -56.096 1.00 86.75  ? 85   ALA A N     1 
ATOM   624  C CA    . ALA A 1 85  ? -0.482  -26.643 -55.702 1.00 83.64  ? 85   ALA A CA    1 
ATOM   625  C C     . ALA A 1 85  ? -0.429  -26.347 -54.209 1.00 77.96  ? 85   ALA A C     1 
ATOM   626  O O     . ALA A 1 85  ? -0.470  -25.188 -53.789 1.00 72.97  ? 85   ALA A O     1 
ATOM   627  C CB    . ALA A 1 85  ? -1.852  -27.181 -56.085 1.00 84.80  ? 85   ALA A CB    1 
ATOM   628  N N     . PHE A 1 86  ? -0.339  -27.400 -53.407 1.00 79.49  ? 86   PHE A N     1 
ATOM   629  C CA    . PHE A 1 86  ? -0.315  -27.233 -51.961 1.00 77.00  ? 86   PHE A CA    1 
ATOM   630  C C     . PHE A 1 86  ? 1.019   -26.678 -51.465 1.00 71.79  ? 86   PHE A C     1 
ATOM   631  O O     . PHE A 1 86  ? 1.047   -25.779 -50.628 1.00 72.08  ? 86   PHE A O     1 
ATOM   632  C CB    . PHE A 1 86  ? -0.639  -28.541 -51.251 1.00 74.31  ? 86   PHE A CB    1 
ATOM   633  C CG    . PHE A 1 86  ? -0.743  -28.395 -49.768 1.00 81.36  ? 86   PHE A CG    1 
ATOM   634  C CD1   . PHE A 1 86  ? -1.889  -27.876 -49.192 1.00 83.20  ? 86   PHE A CD1   1 
ATOM   635  C CD2   . PHE A 1 86  ? 0.310   -28.755 -48.948 1.00 82.55  ? 86   PHE A CD2   1 
ATOM   636  C CE1   . PHE A 1 86  ? -1.987  -27.730 -47.826 1.00 80.38  ? 86   PHE A CE1   1 
ATOM   637  C CE2   . PHE A 1 86  ? 0.217   -28.613 -47.580 1.00 80.33  ? 86   PHE A CE2   1 
ATOM   638  C CZ    . PHE A 1 86  ? -0.933  -28.099 -47.018 1.00 79.54  ? 86   PHE A CZ    1 
ATOM   639  N N     . GLN A 1 87  ? 2.117   -27.216 -51.989 1.00 67.65  ? 87   GLN A N     1 
ATOM   640  C CA    . GLN A 1 87  ? 3.454   -26.757 -51.620 1.00 69.61  ? 87   GLN A CA    1 
ATOM   641  C C     . GLN A 1 87  ? 3.627   -25.247 -51.794 1.00 65.67  ? 87   GLN A C     1 
ATOM   642  O O     . GLN A 1 87  ? 4.363   -24.614 -51.039 1.00 65.78  ? 87   GLN A O     1 
ATOM   643  C CB    . GLN A 1 87  ? 4.527   -27.505 -52.419 1.00 70.38  ? 87   GLN A CB    1 
ATOM   644  C CG    . GLN A 1 87  ? 4.545   -29.009 -52.182 1.00 71.93  ? 87   GLN A CG    1 
ATOM   645  C CD    . GLN A 1 87  ? 5.700   -29.703 -52.887 1.00 73.36  ? 87   GLN A CD    1 
ATOM   646  O OE1   . GLN A 1 87  ? 6.741   -29.096 -53.148 1.00 70.99  ? 87   GLN A OE1   1 
ATOM   647  N NE2   . GLN A 1 87  ? 5.518   -30.981 -53.201 1.00 69.97  ? 87   GLN A NE2   1 
ATOM   648  N N     . ASP A 1 88  ? 2.954   -24.678 -52.789 1.00 61.11  ? 88   ASP A N     1 
ATOM   649  C CA    . ASP A 1 88  ? 3.025   -23.240 -53.040 1.00 61.49  ? 88   ASP A CA    1 
ATOM   650  C C     . ASP A 1 88  ? 2.402   -22.413 -51.920 1.00 61.19  ? 88   ASP A C     1 
ATOM   651  O O     . ASP A 1 88  ? 2.688   -21.223 -51.792 1.00 58.06  ? 88   ASP A O     1 
ATOM   652  C CB    . ASP A 1 88  ? 2.346   -22.881 -54.365 1.00 72.54  ? 88   ASP A CB    1 
ATOM   653  C CG    . ASP A 1 88  ? 3.206   -23.202 -55.567 1.00 86.90  ? 88   ASP A CG    1 
ATOM   654  O OD1   . ASP A 1 88  ? 4.381   -23.579 -55.375 1.00 94.33  ? 88   ASP A OD1   1 
ATOM   655  O OD2   . ASP A 1 88  ? 2.710   -23.064 -56.705 1.00 92.04  ? 88   ASP A OD2   1 
ATOM   656  N N     . LYS A 1 89  ? 1.543   -23.037 -51.119 1.00 60.22  ? 89   LYS A N     1 
ATOM   657  C CA    . LYS A 1 89  ? 0.843   -22.324 -50.054 1.00 65.86  ? 89   LYS A CA    1 
ATOM   658  C C     . LYS A 1 89  ? 1.728   -22.033 -48.840 1.00 65.21  ? 89   LYS A C     1 
ATOM   659  O O     . LYS A 1 89  ? 1.409   -21.159 -48.035 1.00 71.18  ? 89   LYS A O     1 
ATOM   660  C CB    . LYS A 1 89  ? -0.400  -23.098 -49.612 1.00 69.59  ? 89   LYS A CB    1 
ATOM   661  C CG    . LYS A 1 89  ? -1.547  -23.085 -50.606 1.00 73.05  ? 89   LYS A CG    1 
ATOM   662  C CD    . LYS A 1 89  ? -2.666  -23.992 -50.122 1.00 78.99  ? 89   LYS A CD    1 
ATOM   663  C CE    . LYS A 1 89  ? -3.840  -24.013 -51.084 1.00 86.75  ? 89   LYS A CE    1 
ATOM   664  N NZ    . LYS A 1 89  ? -4.889  -24.978 -50.637 1.00 89.51  ? 89   LYS A NZ    1 
ATOM   665  N N     . LEU A 1 90  ? 2.829   -22.768 -48.704 1.00 59.15  ? 90   LEU A N     1 
ATOM   666  C CA    . LEU A 1 90  ? 3.752   -22.563 -47.588 1.00 52.07  ? 90   LEU A CA    1 
ATOM   667  C C     . LEU A 1 90  ? 5.068   -21.965 -48.063 1.00 50.43  ? 90   LEU A C     1 
ATOM   668  O O     . LEU A 1 90  ? 5.461   -22.138 -49.213 1.00 60.54  ? 90   LEU A O     1 
ATOM   669  C CB    . LEU A 1 90  ? 4.033   -23.876 -46.857 1.00 50.93  ? 90   LEU A CB    1 
ATOM   670  C CG    . LEU A 1 90  ? 2.829   -24.735 -46.483 1.00 56.96  ? 90   LEU A CG    1 
ATOM   671  C CD1   . LEU A 1 90  ? 3.231   -25.772 -45.451 1.00 61.12  ? 90   LEU A CD1   1 
ATOM   672  C CD2   . LEU A 1 90  ? 1.704   -23.868 -45.957 1.00 59.66  ? 90   LEU A CD2   1 
ATOM   673  N N     . TYR A 1 91  ? 5.754   -21.269 -47.167 1.00 44.68  ? 91   TYR A N     1 
ATOM   674  C CA    . TYR A 1 91  ? 7.043   -20.677 -47.493 1.00 48.64  ? 91   TYR A CA    1 
ATOM   675  C C     . TYR A 1 91  ? 8.064   -21.763 -47.792 1.00 50.43  ? 91   TYR A C     1 
ATOM   676  O O     . TYR A 1 91  ? 8.109   -22.779 -47.104 1.00 55.28  ? 91   TYR A O     1 
ATOM   677  C CB    . TYR A 1 91  ? 7.531   -19.795 -46.345 1.00 48.30  ? 91   TYR A CB    1 
ATOM   678  C CG    . TYR A 1 91  ? 6.598   -18.650 -46.024 1.00 50.92  ? 91   TYR A CG    1 
ATOM   679  C CD1   . TYR A 1 91  ? 6.527   -17.541 -46.850 1.00 47.11  ? 91   TYR A CD1   1 
ATOM   680  C CD2   . TYR A 1 91  ? 5.792   -18.678 -44.893 1.00 46.14  ? 91   TYR A CD2   1 
ATOM   681  C CE1   . TYR A 1 91  ? 5.678   -16.490 -46.563 1.00 50.69  ? 91   TYR A CE1   1 
ATOM   682  C CE2   . TYR A 1 91  ? 4.937   -17.629 -44.597 1.00 44.72  ? 91   TYR A CE2   1 
ATOM   683  C CZ    . TYR A 1 91  ? 4.884   -16.538 -45.437 1.00 51.43  ? 91   TYR A CZ    1 
ATOM   684  O OH    . TYR A 1 91  ? 4.037   -15.487 -45.157 1.00 55.20  ? 91   TYR A OH    1 
ATOM   685  N N     . PRO A 1 92  ? 8.887   -21.557 -48.828 1.00 54.26  ? 92   PRO A N     1 
ATOM   686  C CA    . PRO A 1 92  ? 9.871   -22.588 -49.180 1.00 54.59  ? 92   PRO A CA    1 
ATOM   687  C C     . PRO A 1 92  ? 10.896  -22.853 -48.072 1.00 51.11  ? 92   PRO A C     1 
ATOM   688  O O     . PRO A 1 92  ? 11.401  -23.970 -47.985 1.00 56.51  ? 92   PRO A O     1 
ATOM   689  C CB    . PRO A 1 92  ? 10.545  -22.035 -50.448 1.00 46.84  ? 92   PRO A CB    1 
ATOM   690  C CG    . PRO A 1 92  ? 10.151  -20.586 -50.522 1.00 49.76  ? 92   PRO A CG    1 
ATOM   691  C CD    . PRO A 1 92  ? 8.837   -20.464 -49.814 1.00 55.56  ? 92   PRO A CD    1 
ATOM   692  N N     . PHE A 1 93  ? 11.189  -21.856 -47.243 1.00 47.54  ? 93   PHE A N     1 
ATOM   693  C CA    . PHE A 1 93  ? 12.099  -22.056 -46.117 1.00 48.86  ? 93   PHE A CA    1 
ATOM   694  C C     . PHE A 1 93  ? 11.603  -23.154 -45.181 1.00 46.10  ? 93   PHE A C     1 
ATOM   695  O O     . PHE A 1 93  ? 12.380  -23.985 -44.711 1.00 45.16  ? 93   PHE A O     1 
ATOM   696  C CB    . PHE A 1 93  ? 12.291  -20.767 -45.313 1.00 45.87  ? 93   PHE A CB    1 
ATOM   697  C CG    . PHE A 1 93  ? 12.924  -20.997 -43.967 1.00 46.36  ? 93   PHE A CG    1 
ATOM   698  C CD1   . PHE A 1 93  ? 12.145  -21.062 -42.818 1.00 43.75  ? 93   PHE A CD1   1 
ATOM   699  C CD2   . PHE A 1 93  ? 14.293  -21.179 -43.854 1.00 48.62  ? 93   PHE A CD2   1 
ATOM   700  C CE1   . PHE A 1 93  ? 12.722  -21.284 -41.584 1.00 49.41  ? 93   PHE A CE1   1 
ATOM   701  C CE2   . PHE A 1 93  ? 14.879  -21.405 -42.621 1.00 54.02  ? 93   PHE A CE2   1 
ATOM   702  C CZ    . PHE A 1 93  ? 14.092  -21.459 -41.483 1.00 53.23  ? 93   PHE A CZ    1 
ATOM   703  N N     . THR A 1 94  ? 10.303  -23.142 -44.910 1.00 46.04  ? 94   THR A N     1 
ATOM   704  C CA    . THR A 1 94  ? 9.702   -24.121 -44.016 1.00 49.21  ? 94   THR A CA    1 
ATOM   705  C C     . THR A 1 94  ? 9.686   -25.539 -44.611 1.00 51.55  ? 94   THR A C     1 
ATOM   706  O O     . THR A 1 94  ? 9.813   -26.520 -43.872 1.00 49.65  ? 94   THR A O     1 
ATOM   707  C CB    . THR A 1 94  ? 8.289   -23.689 -43.556 1.00 46.86  ? 94   THR A CB    1 
ATOM   708  O OG1   . THR A 1 94  ? 7.368   -23.777 -44.647 1.00 54.05  ? 94   THR A OG1   1 
ATOM   709  C CG2   . THR A 1 94  ? 8.313   -22.262 -43.042 1.00 42.77  ? 94   THR A CG2   1 
ATOM   710  N N     . TRP A 1 95  ? 9.539   -25.657 -45.931 1.00 39.40  ? 95   TRP A N     1 
ATOM   711  C CA    . TRP A 1 95  ? 9.646   -26.973 -46.573 1.00 41.36  ? 95   TRP A CA    1 
ATOM   712  C C     . TRP A 1 95  ? 11.067  -27.505 -46.461 1.00 41.22  ? 95   TRP A C     1 
ATOM   713  O O     . TRP A 1 95  ? 11.275  -28.704 -46.302 1.00 45.24  ? 95   TRP A O     1 
ATOM   714  C CB    . TRP A 1 95  ? 9.237   -26.933 -48.055 1.00 45.64  ? 95   TRP A CB    1 
ATOM   715  C CG    . TRP A 1 95  ? 7.764   -26.836 -48.287 1.00 45.42  ? 95   TRP A CG    1 
ATOM   716  C CD1   . TRP A 1 95  ? 7.097   -25.803 -48.873 1.00 49.66  ? 95   TRP A CD1   1 
ATOM   717  C CD2   . TRP A 1 95  ? 6.767   -27.804 -47.924 1.00 44.04  ? 95   TRP A CD2   1 
ATOM   718  N NE1   . TRP A 1 95  ? 5.748   -26.068 -48.907 1.00 53.75  ? 95   TRP A NE1   1 
ATOM   719  C CE2   . TRP A 1 95  ? 5.519   -27.289 -48.329 1.00 47.25  ? 95   TRP A CE2   1 
ATOM   720  C CE3   . TRP A 1 95  ? 6.808   -29.051 -47.296 1.00 45.31  ? 95   TRP A CE3   1 
ATOM   721  C CZ2   . TRP A 1 95  ? 4.325   -27.979 -48.130 1.00 49.72  ? 95   TRP A CZ2   1 
ATOM   722  C CZ3   . TRP A 1 95  ? 5.620   -29.738 -47.101 1.00 51.22  ? 95   TRP A CZ3   1 
ATOM   723  C CH2   . TRP A 1 95  ? 4.395   -29.198 -47.514 1.00 51.98  ? 95   TRP A CH2   1 
ATOM   724  N N     . ASP A 1 96  ? 12.047  -26.611 -46.557 1.00 44.39  ? 96   ASP A N     1 
ATOM   725  C CA    . ASP A 1 96  ? 13.445  -27.010 -46.423 1.00 51.79  ? 96   ASP A CA    1 
ATOM   726  C C     . ASP A 1 96  ? 13.685  -27.688 -45.077 1.00 47.98  ? 96   ASP A C     1 
ATOM   727  O O     . ASP A 1 96  ? 14.432  -28.658 -44.982 1.00 50.17  ? 96   ASP A O     1 
ATOM   728  C CB    . ASP A 1 96  ? 14.374  -25.798 -46.546 1.00 61.29  ? 96   ASP A CB    1 
ATOM   729  C CG    . ASP A 1 96  ? 14.319  -25.143 -47.917 1.00 71.07  ? 96   ASP A CG    1 
ATOM   730  O OD1   . ASP A 1 96  ? 13.758  -25.745 -48.860 1.00 69.14  ? 96   ASP A OD1   1 
ATOM   731  O OD2   . ASP A 1 96  ? 14.854  -24.020 -48.051 1.00 74.47  ? 96   ASP A OD2   1 
ATOM   732  N N     . ALA A 1 97  ? 13.048  -27.163 -44.036 1.00 51.44  ? 97   ALA A N     1 
ATOM   733  C CA    . ALA A 1 97  ? 13.293  -27.619 -42.672 1.00 50.81  ? 97   ALA A CA    1 
ATOM   734  C C     . ALA A 1 97  ? 12.805  -29.041 -42.463 1.00 53.87  ? 97   ALA A C     1 
ATOM   735  O O     . ALA A 1 97  ? 13.309  -29.756 -41.597 1.00 58.84  ? 97   ALA A O     1 
ATOM   736  C CB    . ALA A 1 97  ? 12.635  -26.679 -41.674 1.00 50.04  ? 97   ALA A CB    1 
ATOM   737  N N     . VAL A 1 98  ? 11.823  -29.449 -43.264 1.00 55.28  ? 98   VAL A N     1 
ATOM   738  C CA    . VAL A 1 98  ? 11.264  -30.792 -43.164 1.00 50.67  ? 98   VAL A CA    1 
ATOM   739  C C     . VAL A 1 98  ? 11.735  -31.682 -44.307 1.00 53.93  ? 98   VAL A C     1 
ATOM   740  O O     . VAL A 1 98  ? 11.079  -32.663 -44.657 1.00 50.02  ? 98   VAL A O     1 
ATOM   741  C CB    . VAL A 1 98  ? 9.720   -30.770 -43.129 1.00 50.19  ? 98   VAL A CB    1 
ATOM   742  C CG1   . VAL A 1 98  ? 9.228   -30.099 -41.860 1.00 47.04  ? 98   VAL A CG1   1 
ATOM   743  C CG2   . VAL A 1 98  ? 9.169   -30.061 -44.352 1.00 52.38  ? 98   VAL A CG2   1 
ATOM   744  N N     . ARG A 1 99  ? 12.878  -31.339 -44.886 1.00 58.31  ? 99   ARG A N     1 
ATOM   745  C CA    . ARG A 1 99  ? 13.454  -32.154 -45.948 1.00 60.59  ? 99   ARG A CA    1 
ATOM   746  C C     . ARG A 1 99  ? 14.626  -32.970 -45.412 1.00 56.96  ? 99   ARG A C     1 
ATOM   747  O O     . ARG A 1 99  ? 15.552  -32.431 -44.803 1.00 56.04  ? 99   ARG A O     1 
ATOM   748  C CB    . ARG A 1 99  ? 13.898  -31.288 -47.133 1.00 60.89  ? 99   ARG A CB    1 
ATOM   749  C CG    . ARG A 1 99  ? 13.650  -31.938 -48.489 1.00 67.39  ? 99   ARG A CG    1 
ATOM   750  C CD    . ARG A 1 99  ? 14.328  -31.185 -49.626 1.00 65.49  ? 99   ARG A CD    1 
ATOM   751  N NE    . ARG A 1 99  ? 14.033  -29.755 -49.590 1.00 68.04  ? 99   ARG A NE    1 
ATOM   752  C CZ    . ARG A 1 99  ? 12.906  -29.214 -50.045 1.00 68.02  ? 99   ARG A CZ    1 
ATOM   753  N NH1   . ARG A 1 99  ? 11.961  -29.985 -50.568 1.00 73.66  ? 99   ARG A NH1   1 
ATOM   754  N NH2   . ARG A 1 99  ? 12.722  -27.903 -49.973 1.00 62.65  ? 99   ARG A NH2   1 
ATOM   755  N N     . TYR A 1 100 ? 14.568  -34.277 -45.631 1.00 56.14  ? 100  TYR A N     1 
ATOM   756  C CA    . TYR A 1 100 ? 15.626  -35.174 -45.203 1.00 51.24  ? 100  TYR A CA    1 
ATOM   757  C C     . TYR A 1 100 ? 15.984  -36.145 -46.326 1.00 56.54  ? 100  TYR A C     1 
ATOM   758  O O     . TYR A 1 100 ? 15.112  -36.819 -46.864 1.00 55.93  ? 100  TYR A O     1 
ATOM   759  C CB    . TYR A 1 100 ? 15.192  -35.957 -43.969 1.00 49.87  ? 100  TYR A CB    1 
ATOM   760  C CG    . TYR A 1 100 ? 16.282  -36.854 -43.447 1.00 49.77  ? 100  TYR A CG    1 
ATOM   761  C CD1   . TYR A 1 100 ? 17.465  -36.316 -42.954 1.00 48.98  ? 100  TYR A CD1   1 
ATOM   762  C CD2   . TYR A 1 100 ? 16.142  -38.234 -43.461 1.00 46.65  ? 100  TYR A CD2   1 
ATOM   763  C CE1   . TYR A 1 100 ? 18.474  -37.121 -42.486 1.00 45.11  ? 100  TYR A CE1   1 
ATOM   764  C CE2   . TYR A 1 100 ? 17.151  -39.051 -42.982 1.00 56.57  ? 100  TYR A CE2   1 
ATOM   765  C CZ    . TYR A 1 100 ? 18.314  -38.482 -42.496 1.00 50.17  ? 100  TYR A CZ    1 
ATOM   766  O OH    . TYR A 1 100 ? 19.329  -39.273 -42.026 1.00 57.12  ? 100  TYR A OH    1 
ATOM   767  N N     . ASN A 1 101 ? 17.269  -36.222 -46.661 1.00 61.66  ? 101  ASN A N     1 
ATOM   768  C CA    . ASN A 1 101 ? 17.732  -37.050 -47.774 1.00 67.31  ? 101  ASN A CA    1 
ATOM   769  C C     . ASN A 1 101 ? 16.871  -36.884 -49.029 1.00 66.72  ? 101  ASN A C     1 
ATOM   770  O O     . ASN A 1 101 ? 16.484  -37.867 -49.662 1.00 61.58  ? 101  ASN A O     1 
ATOM   771  C CB    . ASN A 1 101 ? 17.802  -38.529 -47.374 1.00 73.82  ? 101  ASN A CB    1 
ATOM   772  C CG    . ASN A 1 101 ? 19.012  -38.849 -46.506 1.00 79.22  ? 101  ASN A CG    1 
ATOM   773  O OD1   . ASN A 1 101 ? 19.931  -38.038 -46.374 1.00 81.59  ? 101  ASN A OD1   1 
ATOM   774  N ND2   . ASN A 1 101 ? 19.022  -40.046 -45.921 1.00 74.07  ? 101  ASN A ND2   1 
ATOM   775  N N     . GLY A 1 102 ? 16.560  -35.638 -49.371 1.00 59.75  ? 102  GLY A N     1 
ATOM   776  C CA    . GLY A 1 102 ? 15.786  -35.357 -50.564 1.00 66.96  ? 102  GLY A CA    1 
ATOM   777  C C     . GLY A 1 102 ? 14.276  -35.406 -50.406 1.00 71.46  ? 102  GLY A C     1 
ATOM   778  O O     . GLY A 1 102 ? 13.567  -34.598 -51.003 1.00 84.00  ? 102  GLY A O     1 
ATOM   779  N N     . LYS A 1 103 ? 13.782  -36.353 -49.614 1.00 70.10  ? 103  LYS A N     1 
ATOM   780  C CA    . LYS A 1 103 ? 12.341  -36.532 -49.426 1.00 70.47  ? 103  LYS A CA    1 
ATOM   781  C C     . LYS A 1 103 ? 11.741  -35.570 -48.395 1.00 68.94  ? 103  LYS A C     1 
ATOM   782  O O     . LYS A 1 103 ? 12.366  -35.268 -47.377 1.00 66.97  ? 103  LYS A O     1 
ATOM   783  C CB    . LYS A 1 103 ? 12.036  -37.964 -48.980 1.00 71.60  ? 103  LYS A CB    1 
ATOM   784  C CG    . LYS A 1 103 ? 12.540  -39.066 -49.900 1.00 83.28  ? 103  LYS A CG    1 
ATOM   785  C CD    . LYS A 1 103 ? 12.222  -40.441 -49.299 1.00 91.02  ? 103  LYS A CD    1 
ATOM   786  C CE    . LYS A 1 103 ? 12.819  -41.585 -50.115 1.00 94.71  ? 103  LYS A CE    1 
ATOM   787  N NZ    . LYS A 1 103 ? 12.227  -41.684 -51.478 1.00 96.28  ? 103  LYS A NZ    1 
ATOM   788  N N     . LEU A 1 104 ? 10.522  -35.104 -48.654 1.00 62.93  ? 104  LEU A N     1 
ATOM   789  C CA    . LEU A 1 104 ? 9.754   -34.365 -47.656 1.00 55.64  ? 104  LEU A CA    1 
ATOM   790  C C     . LEU A 1 104 ? 9.175   -35.344 -46.645 1.00 59.10  ? 104  LEU A C     1 
ATOM   791  O O     . LEU A 1 104 ? 8.449   -36.263 -47.015 1.00 66.77  ? 104  LEU A O     1 
ATOM   792  C CB    . LEU A 1 104 ? 8.617   -33.588 -48.314 1.00 52.92  ? 104  LEU A CB    1 
ATOM   793  C CG    . LEU A 1 104 ? 8.994   -32.401 -49.198 1.00 57.56  ? 104  LEU A CG    1 
ATOM   794  C CD1   . LEU A 1 104 ? 7.748   -31.807 -49.822 1.00 55.37  ? 104  LEU A CD1   1 
ATOM   795  C CD2   . LEU A 1 104 ? 9.740   -31.353 -48.392 1.00 58.15  ? 104  LEU A CD2   1 
ATOM   796  N N     . ILE A 1 105 ? 9.478   -35.152 -45.367 1.00 59.03  ? 105  ILE A N     1 
ATOM   797  C CA    . ILE A 1 105 ? 9.060   -36.130 -44.366 1.00 55.39  ? 105  ILE A CA    1 
ATOM   798  C C     . ILE A 1 105 ? 8.096   -35.606 -43.295 1.00 53.29  ? 105  ILE A C     1 
ATOM   799  O O     . ILE A 1 105 ? 7.873   -36.271 -42.286 1.00 55.66  ? 105  ILE A O     1 
ATOM   800  C CB    . ILE A 1 105 ? 10.272  -36.852 -43.730 1.00 56.79  ? 105  ILE A CB    1 
ATOM   801  C CG1   . ILE A 1 105 ? 11.394  -35.863 -43.403 1.00 59.93  ? 105  ILE A CG1   1 
ATOM   802  C CG2   . ILE A 1 105 ? 10.806  -37.903 -44.681 1.00 62.39  ? 105  ILE A CG2   1 
ATOM   803  C CD1   . ILE A 1 105 ? 11.145  -35.028 -42.179 1.00 51.64  ? 105  ILE A CD1   1 
ATOM   804  N N     . ALA A 1 106 ? 7.515   -34.432 -43.531 1.00 50.60  ? 106  ALA A N     1 
ATOM   805  C CA    . ALA A 1 106 ? 6.516   -33.863 -42.622 1.00 48.25  ? 106  ALA A CA    1 
ATOM   806  C C     . ALA A 1 106 ? 5.973   -32.545 -43.160 1.00 40.42  ? 106  ALA A C     1 
ATOM   807  O O     . ALA A 1 106 ? 6.585   -31.926 -44.020 1.00 50.29  ? 106  ALA A O     1 
ATOM   808  C CB    . ALA A 1 106 ? 7.102   -33.660 -41.222 1.00 44.84  ? 106  ALA A CB    1 
ATOM   809  N N     . TYR A 1 107 ? 4.820   -32.123 -42.650 1.00 44.98  ? 107  TYR A N     1 
ATOM   810  C CA    . TYR A 1 107 ? 4.258   -30.817 -42.994 1.00 46.06  ? 107  TYR A CA    1 
ATOM   811  C C     . TYR A 1 107 ? 4.740   -29.747 -42.011 1.00 45.49  ? 107  TYR A C     1 
ATOM   812  O O     . TYR A 1 107 ? 4.580   -29.893 -40.800 1.00 51.16  ? 107  TYR A O     1 
ATOM   813  C CB    . TYR A 1 107 ? 2.728   -30.873 -42.978 1.00 51.99  ? 107  TYR A CB    1 
ATOM   814  C CG    . TYR A 1 107 ? 2.123   -31.733 -44.064 1.00 57.47  ? 107  TYR A CG    1 
ATOM   815  C CD1   . TYR A 1 107 ? 1.757   -31.182 -45.288 1.00 59.03  ? 107  TYR A CD1   1 
ATOM   816  C CD2   . TYR A 1 107 ? 1.914   -33.097 -43.867 1.00 58.31  ? 107  TYR A CD2   1 
ATOM   817  C CE1   . TYR A 1 107 ? 1.203   -31.964 -46.289 1.00 61.77  ? 107  TYR A CE1   1 
ATOM   818  C CE2   . TYR A 1 107 ? 1.362   -33.887 -44.863 1.00 58.83  ? 107  TYR A CE2   1 
ATOM   819  C CZ    . TYR A 1 107 ? 1.007   -33.314 -46.071 1.00 60.12  ? 107  TYR A CZ    1 
ATOM   820  O OH    . TYR A 1 107 ? 0.457   -34.087 -47.063 1.00 64.05  ? 107  TYR A OH    1 
ATOM   821  N N     . PRO A 1 108 ? 5.353   -28.673 -42.526 1.00 46.48  ? 108  PRO A N     1 
ATOM   822  C CA    . PRO A 1 108 ? 5.759   -27.570 -41.650 1.00 49.48  ? 108  PRO A CA    1 
ATOM   823  C C     . PRO A 1 108 ? 4.549   -26.763 -41.190 1.00 53.42  ? 108  PRO A C     1 
ATOM   824  O O     . PRO A 1 108 ? 3.597   -26.605 -41.952 1.00 53.40  ? 108  PRO A O     1 
ATOM   825  C CB    . PRO A 1 108 ? 6.662   -26.725 -42.556 1.00 47.32  ? 108  PRO A CB    1 
ATOM   826  C CG    . PRO A 1 108 ? 6.201   -27.030 -43.938 1.00 43.72  ? 108  PRO A CG    1 
ATOM   827  C CD    . PRO A 1 108 ? 5.814   -28.479 -43.910 1.00 40.95  ? 108  PRO A CD    1 
ATOM   828  N N     . ILE A 1 109 ? 4.587   -26.261 -39.959 1.00 56.77  ? 109  ILE A N     1 
ATOM   829  C CA    . ILE A 1 109 ? 3.450   -25.548 -39.386 1.00 44.80  ? 109  ILE A CA    1 
ATOM   830  C C     . ILE A 1 109 ? 3.792   -24.113 -39.011 1.00 46.93  ? 109  ILE A C     1 
ATOM   831  O O     . ILE A 1 109 ? 3.057   -23.183 -39.335 1.00 50.52  ? 109  ILE A O     1 
ATOM   832  C CB    . ILE A 1 109 ? 2.930   -26.256 -38.120 1.00 43.79  ? 109  ILE A CB    1 
ATOM   833  C CG1   . ILE A 1 109 ? 2.675   -27.745 -38.393 1.00 44.84  ? 109  ILE A CG1   1 
ATOM   834  C CG2   . ILE A 1 109 ? 1.683   -25.553 -37.588 1.00 38.32  ? 109  ILE A CG2   1 
ATOM   835  C CD1   . ILE A 1 109 ? 1.576   -28.016 -39.400 1.00 47.82  ? 109  ILE A CD1   1 
ATOM   836  N N     . ALA A 1 110 ? 4.907   -23.934 -38.314 1.00 48.55  ? 110  ALA A N     1 
ATOM   837  C CA    . ALA A 1 110 ? 5.272   -22.619 -37.816 1.00 39.71  ? 110  ALA A CA    1 
ATOM   838  C C     . ALA A 1 110 ? 6.739   -22.540 -37.432 1.00 38.50  ? 110  ALA A C     1 
ATOM   839  O O     . ALA A 1 110 ? 7.350   -23.539 -37.056 1.00 42.60  ? 110  ALA A O     1 
ATOM   840  C CB    . ALA A 1 110 ? 4.390   -22.238 -36.631 1.00 42.95  ? 110  ALA A CB    1 
ATOM   841  N N     . VAL A 1 111 ? 7.293   -21.336 -37.537 1.00 43.83  ? 111  VAL A N     1 
ATOM   842  C CA    . VAL A 1 111 ? 8.679   -21.067 -37.180 1.00 39.76  ? 111  VAL A CA    1 
ATOM   843  C C     . VAL A 1 111 ? 8.747   -20.546 -35.748 1.00 44.44  ? 111  VAL A C     1 
ATOM   844  O O     . VAL A 1 111 ? 8.037   -19.608 -35.381 1.00 43.15  ? 111  VAL A O     1 
ATOM   845  C CB    . VAL A 1 111 ? 9.305   -20.028 -38.127 1.00 39.50  ? 111  VAL A CB    1 
ATOM   846  C CG1   . VAL A 1 111 ? 10.719  -19.693 -37.696 1.00 37.60  ? 111  VAL A CG1   1 
ATOM   847  C CG2   . VAL A 1 111 ? 9.290   -20.540 -39.559 1.00 43.90  ? 111  VAL A CG2   1 
ATOM   848  N N     . GLU A 1 112 ? 9.607   -21.165 -34.948 1.00 44.60  ? 112  GLU A N     1 
ATOM   849  C CA    . GLU A 1 112 ? 9.724   -20.847 -33.531 1.00 42.05  ? 112  GLU A CA    1 
ATOM   850  C C     . GLU A 1 112 ? 11.101  -20.294 -33.219 1.00 39.83  ? 112  GLU A C     1 
ATOM   851  O O     . GLU A 1 112 ? 12.096  -20.703 -33.821 1.00 44.82  ? 112  GLU A O     1 
ATOM   852  C CB    . GLU A 1 112 ? 9.519   -22.103 -32.683 1.00 37.51  ? 112  GLU A CB    1 
ATOM   853  C CG    . GLU A 1 112 ? 8.142   -22.716 -32.755 1.00 42.05  ? 112  GLU A CG    1 
ATOM   854  C CD    . GLU A 1 112 ? 8.078   -24.046 -32.025 1.00 40.08  ? 112  GLU A CD    1 
ATOM   855  O OE1   . GLU A 1 112 ? 9.138   -24.529 -31.578 1.00 37.84  ? 112  GLU A OE1   1 
ATOM   856  O OE2   . GLU A 1 112 ? 6.975   -24.612 -31.905 1.00 38.19  ? 112  GLU A OE2   1 
ATOM   857  N N     . ALA A 1 113 ? 11.151  -19.368 -32.269 1.00 36.32  ? 113  ALA A N     1 
ATOM   858  C CA    . ALA A 1 113 ? 12.412  -18.912 -31.707 1.00 32.09  ? 113  ALA A CA    1 
ATOM   859  C C     . ALA A 1 113 ? 12.155  -18.245 -30.369 1.00 37.75  ? 113  ALA A C     1 
ATOM   860  O O     . ALA A 1 113 ? 11.119  -17.608 -30.164 1.00 37.32  ? 113  ALA A O     1 
ATOM   861  C CB    . ALA A 1 113 ? 13.111  -17.951 -32.651 1.00 32.03  ? 113  ALA A CB    1 
ATOM   862  N N     . LEU A 1 114 ? 13.104  -18.396 -29.457 1.00 36.41  ? 114  LEU A N     1 
ATOM   863  C CA    . LEU A 1 114 ? 13.006  -17.759 -28.160 1.00 34.85  ? 114  LEU A CA    1 
ATOM   864  C C     . LEU A 1 114 ? 13.192  -16.265 -28.310 1.00 31.49  ? 114  LEU A C     1 
ATOM   865  O O     . LEU A 1 114 ? 13.984  -15.817 -29.135 1.00 31.18  ? 114  LEU A O     1 
ATOM   866  C CB    . LEU A 1 114 ? 14.084  -18.302 -27.225 1.00 25.49  ? 114  LEU A CB    1 
ATOM   867  C CG    . LEU A 1 114 ? 13.889  -19.746 -26.778 1.00 30.99  ? 114  LEU A CG    1 
ATOM   868  C CD1   . LEU A 1 114 ? 15.099  -20.214 -25.979 1.00 30.99  ? 114  LEU A CD1   1 
ATOM   869  C CD2   . LEU A 1 114 ? 12.608  -19.863 -25.963 1.00 26.79  ? 114  LEU A CD2   1 
ATOM   870  N N     . SER A 1 115 ? 12.468  -15.506 -27.496 1.00 33.27  ? 115  SER A N     1 
ATOM   871  C CA    . SER A 1 115 ? 12.671  -14.070 -27.378 1.00 36.24  ? 115  SER A CA    1 
ATOM   872  C C     . SER A 1 115 ? 12.815  -13.690 -25.905 1.00 41.35  ? 115  SER A C     1 
ATOM   873  O O     . SER A 1 115 ? 12.530  -14.494 -25.014 1.00 32.58  ? 115  SER A O     1 
ATOM   874  C CB    . SER A 1 115 ? 11.479  -13.319 -27.966 1.00 37.95  ? 115  SER A CB    1 
ATOM   875  O OG    . SER A 1 115 ? 11.316  -13.605 -29.340 1.00 38.56  ? 115  SER A OG    1 
ATOM   876  N N     . LEU A 1 116 ? 13.248  -12.461 -25.653 1.00 39.55  ? 116  LEU A N     1 
ATOM   877  C CA    . LEU A 1 116 ? 13.286  -11.941 -24.296 1.00 31.26  ? 116  LEU A CA    1 
ATOM   878  C C     . LEU A 1 116 ? 11.907  -11.407 -23.938 1.00 34.67  ? 116  LEU A C     1 
ATOM   879  O O     . LEU A 1 116 ? 11.349  -10.583 -24.648 1.00 37.34  ? 116  LEU A O     1 
ATOM   880  C CB    . LEU A 1 116 ? 14.327  -10.823 -24.169 1.00 30.92  ? 116  LEU A CB    1 
ATOM   881  C CG    . LEU A 1 116 ? 14.487  -10.211 -22.774 1.00 32.20  ? 116  LEU A CG    1 
ATOM   882  C CD1   . LEU A 1 116 ? 14.976  -11.259 -21.771 1.00 33.60  ? 116  LEU A CD1   1 
ATOM   883  C CD2   . LEU A 1 116 ? 15.443  -9.029  -22.815 1.00 30.69  ? 116  LEU A CD2   1 
ATOM   884  N N     . ILE A 1 117 ? 11.349  -11.882 -22.835 1.00 35.18  ? 117  ILE A N     1 
ATOM   885  C CA    . ILE A 1 117 ? 10.045  -11.411 -22.407 1.00 30.32  ? 117  ILE A CA    1 
ATOM   886  C C     . ILE A 1 117 ? 10.225  -10.595 -21.135 1.00 42.86  ? 117  ILE A C     1 
ATOM   887  O O     . ILE A 1 117 ? 10.842  -11.062 -20.174 1.00 43.99  ? 117  ILE A O     1 
ATOM   888  C CB    . ILE A 1 117 ? 9.090   -12.595 -22.171 1.00 32.42  ? 117  ILE A CB    1 
ATOM   889  C CG1   . ILE A 1 117 ? 8.999   -13.455 -23.437 1.00 28.34  ? 117  ILE A CG1   1 
ATOM   890  C CG2   . ILE A 1 117 ? 7.717   -12.115 -21.719 1.00 34.73  ? 117  ILE A CG2   1 
ATOM   891  C CD1   . ILE A 1 117 ? 8.047   -14.633 -23.315 1.00 30.99  ? 117  ILE A CD1   1 
ATOM   892  N N     . TYR A 1 118 ? 9.713   -9.367  -21.125 1.00 40.51  ? 118  TYR A N     1 
ATOM   893  C CA    . TYR A 1 118 ? 9.938   -8.512  -19.967 1.00 38.23  ? 118  TYR A CA    1 
ATOM   894  C C     . TYR A 1 118 ? 8.677   -7.838  -19.436 1.00 40.26  ? 118  TYR A C     1 
ATOM   895  O O     . TYR A 1 118 ? 7.723   -7.580  -20.178 1.00 44.17  ? 118  TYR A O     1 
ATOM   896  C CB    . TYR A 1 118 ? 11.037  -7.482  -20.253 1.00 43.99  ? 118  TYR A CB    1 
ATOM   897  C CG    . TYR A 1 118 ? 10.627  -6.386  -21.204 1.00 44.34  ? 118  TYR A CG    1 
ATOM   898  C CD1   . TYR A 1 118 ? 10.637  -6.591  -22.580 1.00 48.26  ? 118  TYR A CD1   1 
ATOM   899  C CD2   . TYR A 1 118 ? 10.237  -5.144  -20.727 1.00 44.25  ? 118  TYR A CD2   1 
ATOM   900  C CE1   . TYR A 1 118 ? 10.265  -5.587  -23.455 1.00 47.89  ? 118  TYR A CE1   1 
ATOM   901  C CE2   . TYR A 1 118 ? 9.862   -4.128  -21.594 1.00 51.63  ? 118  TYR A CE2   1 
ATOM   902  C CZ    . TYR A 1 118 ? 9.879   -4.357  -22.955 1.00 51.80  ? 118  TYR A CZ    1 
ATOM   903  O OH    . TYR A 1 118 ? 9.505   -3.353  -23.812 1.00 55.13  ? 118  TYR A OH    1 
ATOM   904  N N     . ASN A 1 119 ? 8.691   -7.587  -18.132 1.00 42.55  ? 119  ASN A N     1 
ATOM   905  C CA    . ASN A 1 119 ? 7.609   -6.920  -17.420 1.00 45.57  ? 119  ASN A CA    1 
ATOM   906  C C     . ASN A 1 119 ? 7.822   -5.407  -17.492 1.00 47.95  ? 119  ASN A C     1 
ATOM   907  O O     . ASN A 1 119 ? 8.770   -4.879  -16.910 1.00 44.10  ? 119  ASN A O     1 
ATOM   908  C CB    . ASN A 1 119 ? 7.599   -7.397  -15.964 1.00 37.13  ? 119  ASN A CB    1 
ATOM   909  C CG    . ASN A 1 119 ? 6.452   -6.816  -15.154 1.00 49.05  ? 119  ASN A CG    1 
ATOM   910  O OD1   . ASN A 1 119 ? 6.002   -5.694  -15.397 1.00 43.98  ? 119  ASN A OD1   1 
ATOM   911  N ND2   . ASN A 1 119 ? 5.973   -7.585  -14.175 1.00 41.69  ? 119  ASN A ND2   1 
ATOM   912  N N     . LYS A 1 120 ? 6.950   -4.715  -18.218 1.00 50.49  ? 120  LYS A N     1 
ATOM   913  C CA    . LYS A 1 120 ? 7.138   -3.287  -18.480 1.00 50.48  ? 120  LYS A CA    1 
ATOM   914  C C     . LYS A 1 120 ? 6.999   -2.416  -17.229 1.00 52.17  ? 120  LYS A C     1 
ATOM   915  O O     . LYS A 1 120 ? 7.596   -1.345  -17.147 1.00 51.98  ? 120  LYS A O     1 
ATOM   916  C CB    . LYS A 1 120 ? 6.178   -2.814  -19.573 1.00 53.22  ? 120  LYS A CB    1 
ATOM   917  C CG    . LYS A 1 120 ? 6.494   -3.365  -20.952 1.00 57.10  ? 120  LYS A CG    1 
ATOM   918  C CD    . LYS A 1 120 ? 5.392   -3.032  -21.942 1.00 62.30  ? 120  LYS A CD    1 
ATOM   919  C CE    . LYS A 1 120 ? 5.850   -3.275  -23.369 1.00 67.63  ? 120  LYS A CE    1 
ATOM   920  N NZ    . LYS A 1 120 ? 4.730   -3.160  -24.342 1.00 70.05  ? 120  LYS A NZ    1 
ATOM   921  N N     . ASP A 1 121 ? 6.218   -2.880  -16.258 1.00 47.60  ? 121  ASP A N     1 
ATOM   922  C CA    . ASP A 1 121 ? 6.034   -2.142  -15.015 1.00 48.57  ? 121  ASP A CA    1 
ATOM   923  C C     . ASP A 1 121 ? 7.261   -2.216  -14.108 1.00 54.50  ? 121  ASP A C     1 
ATOM   924  O O     . ASP A 1 121 ? 7.585   -1.252  -13.420 1.00 59.72  ? 121  ASP A O     1 
ATOM   925  C CB    . ASP A 1 121 ? 4.794   -2.635  -14.270 1.00 52.26  ? 121  ASP A CB    1 
ATOM   926  C CG    . ASP A 1 121 ? 3.508   -2.337  -15.017 1.00 60.49  ? 121  ASP A CG    1 
ATOM   927  O OD1   . ASP A 1 121 ? 3.521   -1.446  -15.894 1.00 60.28  ? 121  ASP A OD1   1 
ATOM   928  O OD2   . ASP A 1 121 ? 2.483   -2.988  -14.721 1.00 62.56  ? 121  ASP A OD2   1 
ATOM   929  N N     . LEU A 1 122 ? 7.939   -3.359  -14.105 1.00 50.04  ? 122  LEU A N     1 
ATOM   930  C CA    . LEU A 1 122 ? 9.150   -3.520  -13.308 1.00 43.23  ? 122  LEU A CA    1 
ATOM   931  C C     . LEU A 1 122 ? 10.367  -3.020  -14.061 1.00 44.55  ? 122  LEU A C     1 
ATOM   932  O O     . LEU A 1 122 ? 11.346  -2.582  -13.458 1.00 43.85  ? 122  LEU A O     1 
ATOM   933  C CB    . LEU A 1 122 ? 9.373   -4.988  -12.954 1.00 42.13  ? 122  LEU A CB    1 
ATOM   934  C CG    . LEU A 1 122 ? 8.435   -5.624  -11.936 1.00 42.62  ? 122  LEU A CG    1 
ATOM   935  C CD1   . LEU A 1 122 ? 8.733   -7.104  -11.834 1.00 32.75  ? 122  LEU A CD1   1 
ATOM   936  C CD2   . LEU A 1 122 ? 8.574   -4.943  -10.581 1.00 43.41  ? 122  LEU A CD2   1 
ATOM   937  N N     . LEU A 1 123 ? 10.304  -3.100  -15.386 1.00 42.98  ? 123  LEU A N     1 
ATOM   938  C CA    . LEU A 1 123 ? 11.474  -2.865  -16.215 1.00 42.97  ? 123  LEU A CA    1 
ATOM   939  C C     . LEU A 1 123 ? 11.094  -2.175  -17.528 1.00 47.03  ? 123  LEU A C     1 
ATOM   940  O O     . LEU A 1 123 ? 10.969  -2.819  -18.565 1.00 45.79  ? 123  LEU A O     1 
ATOM   941  C CB    . LEU A 1 123 ? 12.164  -4.197  -16.486 1.00 49.37  ? 123  LEU A CB    1 
ATOM   942  C CG    . LEU A 1 123 ? 13.534  -4.169  -17.148 1.00 54.74  ? 123  LEU A CG    1 
ATOM   943  C CD1   . LEU A 1 123 ? 14.532  -3.400  -16.292 1.00 51.31  ? 123  LEU A CD1   1 
ATOM   944  C CD2   . LEU A 1 123 ? 13.999  -5.598  -17.395 1.00 42.72  ? 123  LEU A CD2   1 
ATOM   945  N N     . PRO A 1 124 ? 10.908  -0.850  -17.480 1.00 52.48  ? 124  PRO A N     1 
ATOM   946  C CA    . PRO A 1 124 ? 10.453  -0.056  -18.626 1.00 50.66  ? 124  PRO A CA    1 
ATOM   947  C C     . PRO A 1 124 ? 11.352  -0.255  -19.832 1.00 50.75  ? 124  PRO A C     1 
ATOM   948  O O     . PRO A 1 124 ? 10.861  -0.403  -20.952 1.00 52.22  ? 124  PRO A O     1 
ATOM   949  C CB    . PRO A 1 124 ? 10.575  1.382   -18.119 1.00 51.28  ? 124  PRO A CB    1 
ATOM   950  C CG    . PRO A 1 124 ? 10.434  1.263   -16.635 1.00 55.79  ? 124  PRO A CG    1 
ATOM   951  C CD    . PRO A 1 124 ? 11.124  -0.020  -16.283 1.00 55.28  ? 124  PRO A CD    1 
ATOM   952  N N     . ASN A 1 125 ? 12.659  -0.258  -19.600 1.00 49.81  ? 125  ASN A N     1 
ATOM   953  C CA    . ASN A 1 125 ? 13.609  -0.517  -20.669 1.00 53.42  ? 125  ASN A CA    1 
ATOM   954  C C     . ASN A 1 125 ? 14.447  -1.756  -20.394 1.00 56.01  ? 125  ASN A C     1 
ATOM   955  O O     . ASN A 1 125 ? 15.303  -1.754  -19.510 1.00 58.37  ? 125  ASN A O     1 
ATOM   956  C CB    . ASN A 1 125 ? 14.509  0.695   -20.901 1.00 58.45  ? 125  ASN A CB    1 
ATOM   957  C CG    . ASN A 1 125 ? 13.717  1.953   -21.191 1.00 64.08  ? 125  ASN A CG    1 
ATOM   958  O OD1   . ASN A 1 125 ? 13.090  2.077   -22.245 1.00 67.64  ? 125  ASN A OD1   1 
ATOM   959  N ND2   . ASN A 1 125 ? 13.738  2.891   -20.256 1.00 58.65  ? 125  ASN A ND2   1 
ATOM   960  N N     . PRO A 1 126 ? 14.196  -2.822  -21.160 1.00 57.33  ? 126  PRO A N     1 
ATOM   961  C CA    . PRO A 1 126 ? 14.914  -4.088  -21.010 1.00 57.60  ? 126  PRO A CA    1 
ATOM   962  C C     . PRO A 1 126 ? 16.382  -3.918  -21.364 1.00 54.39  ? 126  PRO A C     1 
ATOM   963  O O     . PRO A 1 126 ? 16.713  -3.121  -22.238 1.00 52.67  ? 126  PRO A O     1 
ATOM   964  C CB    . PRO A 1 126 ? 14.222  -5.001  -22.023 1.00 56.25  ? 126  PRO A CB    1 
ATOM   965  C CG    . PRO A 1 126 ? 13.685  -4.074  -23.055 1.00 63.54  ? 126  PRO A CG    1 
ATOM   966  C CD    . PRO A 1 126 ? 13.271  -2.840  -22.305 1.00 64.91  ? 126  PRO A CD    1 
ATOM   967  N N     . PRO A 1 127 ? 17.258  -4.671  -20.691 1.00 52.12  ? 127  PRO A N     1 
ATOM   968  C CA    . PRO A 1 127 ? 18.706  -4.549  -20.871 1.00 45.41  ? 127  PRO A CA    1 
ATOM   969  C C     . PRO A 1 127 ? 19.114  -4.990  -22.263 1.00 43.70  ? 127  PRO A C     1 
ATOM   970  O O     . PRO A 1 127 ? 18.495  -5.897  -22.818 1.00 46.08  ? 127  PRO A O     1 
ATOM   971  C CB    . PRO A 1 127 ? 19.264  -5.514  -19.826 1.00 43.86  ? 127  PRO A CB    1 
ATOM   972  C CG    . PRO A 1 127 ? 18.199  -6.543  -19.681 1.00 54.22  ? 127  PRO A CG    1 
ATOM   973  C CD    . PRO A 1 127 ? 16.902  -5.805  -19.823 1.00 54.28  ? 127  PRO A CD    1 
ATOM   974  N N     . LYS A 1 128 ? 20.138  -4.346  -22.816 1.00 42.13  ? 128  LYS A N     1 
ATOM   975  C CA    . LYS A 1 128 ? 20.614  -4.645  -24.161 1.00 40.98  ? 128  LYS A CA    1 
ATOM   976  C C     . LYS A 1 128 ? 21.663  -5.748  -24.137 1.00 39.37  ? 128  LYS A C     1 
ATOM   977  O O     . LYS A 1 128 ? 21.835  -6.465  -25.112 1.00 40.96  ? 128  LYS A O     1 
ATOM   978  C CB    . LYS A 1 128 ? 21.203  -3.389  -24.815 1.00 55.99  ? 128  LYS A CB    1 
ATOM   979  C CG    . LYS A 1 128 ? 20.206  -2.563  -25.623 1.00 71.15  ? 128  LYS A CG    1 
ATOM   980  C CD    . LYS A 1 128 ? 18.994  -2.171  -24.791 1.00 83.17  ? 128  LYS A CD    1 
ATOM   981  C CE    . LYS A 1 128 ? 17.894  -1.563  -25.652 1.00 88.47  ? 128  LYS A CE    1 
ATOM   982  N NZ    . LYS A 1 128 ? 16.652  -1.318  -24.861 1.00 88.47  ? 128  LYS A NZ    1 
ATOM   983  N N     . THR A 1 129 ? 22.369  -5.879  -23.018 1.00 42.92  ? 129  THR A N     1 
ATOM   984  C CA    . THR A 1 129 ? 23.422  -6.882  -22.909 1.00 43.74  ? 129  THR A CA    1 
ATOM   985  C C     . THR A 1 129 ? 23.180  -7.846  -21.752 1.00 44.80  ? 129  THR A C     1 
ATOM   986  O O     . THR A 1 129 ? 22.560  -7.496  -20.746 1.00 40.93  ? 129  THR A O     1 
ATOM   987  C CB    . THR A 1 129 ? 24.804  -6.232  -22.713 1.00 43.97  ? 129  THR A CB    1 
ATOM   988  O OG1   . THR A 1 129 ? 24.895  -5.691  -21.389 1.00 51.06  ? 129  THR A OG1   1 
ATOM   989  C CG2   . THR A 1 129 ? 25.024  -5.123  -23.728 1.00 47.10  ? 129  THR A CG2   1 
ATOM   990  N N     . TRP A 1 130 ? 23.679  -9.066  -21.904 1.00 44.52  ? 130  TRP A N     1 
ATOM   991  C CA    . TRP A 1 130 ? 23.687  -10.025 -20.809 1.00 43.49  ? 130  TRP A CA    1 
ATOM   992  C C     . TRP A 1 130 ? 24.511  -9.482  -19.646 1.00 35.60  ? 130  TRP A C     1 
ATOM   993  O O     . TRP A 1 130 ? 24.187  -9.721  -18.489 1.00 34.72  ? 130  TRP A O     1 
ATOM   994  C CB    . TRP A 1 130 ? 24.272  -11.361 -21.273 1.00 39.00  ? 130  TRP A CB    1 
ATOM   995  C CG    . TRP A 1 130 ? 23.286  -12.275 -21.948 1.00 34.96  ? 130  TRP A CG    1 
ATOM   996  C CD1   . TRP A 1 130 ? 23.048  -12.377 -23.281 1.00 30.59  ? 130  TRP A CD1   1 
ATOM   997  C CD2   . TRP A 1 130 ? 22.420  -13.231 -21.310 1.00 36.55  ? 130  TRP A CD2   1 
ATOM   998  N NE1   . TRP A 1 130 ? 22.082  -13.330 -23.522 1.00 38.17  ? 130  TRP A NE1   1 
ATOM   999  C CE2   . TRP A 1 130 ? 21.681  -13.870 -22.327 1.00 38.23  ? 130  TRP A CE2   1 
ATOM   1000 C CE3   . TRP A 1 130 ? 22.194  -13.598 -19.978 1.00 30.79  ? 130  TRP A CE3   1 
ATOM   1001 C CZ2   . TRP A 1 130 ? 20.733  -14.862 -22.058 1.00 34.22  ? 130  TRP A CZ2   1 
ATOM   1002 C CZ3   . TRP A 1 130 ? 21.248  -14.588 -19.708 1.00 35.34  ? 130  TRP A CZ3   1 
ATOM   1003 C CH2   . TRP A 1 130 ? 20.532  -15.206 -20.744 1.00 36.84  ? 130  TRP A CH2   1 
ATOM   1004 N N     . GLU A 1 131 ? 25.570  -8.743  -19.968 1.00 32.10  ? 131  GLU A N     1 
ATOM   1005 C CA    . GLU A 1 131 ? 26.521  -8.251  -18.968 1.00 38.94  ? 131  GLU A CA    1 
ATOM   1006 C C     . GLU A 1 131 ? 25.924  -7.353  -17.877 1.00 42.53  ? 131  GLU A C     1 
ATOM   1007 O O     . GLU A 1 131 ? 26.396  -7.372  -16.744 1.00 47.88  ? 131  GLU A O     1 
ATOM   1008 C CB    . GLU A 1 131 ? 27.694  -7.529  -19.640 1.00 36.26  ? 131  GLU A CB    1 
ATOM   1009 C CG    . GLU A 1 131 ? 28.679  -8.445  -20.375 1.00 43.12  ? 131  GLU A CG    1 
ATOM   1010 C CD    . GLU A 1 131 ? 28.228  -8.823  -21.785 1.00 46.07  ? 131  GLU A CD    1 
ATOM   1011 O OE1   . GLU A 1 131 ? 27.142  -8.386  -22.217 1.00 51.27  ? 131  GLU A OE1   1 
ATOM   1012 O OE2   . GLU A 1 131 ? 28.967  -9.564  -22.464 1.00 41.35  ? 131  GLU A OE2   1 
ATOM   1013 N N     . GLU A 1 132 ? 24.902  -6.570  -18.214 1.00 42.74  ? 132  GLU A N     1 
ATOM   1014 C CA    . GLU A 1 132 ? 24.302  -5.645  -17.251 1.00 40.99  ? 132  GLU A CA    1 
ATOM   1015 C C     . GLU A 1 132 ? 23.225  -6.301  -16.392 1.00 44.77  ? 132  GLU A C     1 
ATOM   1016 O O     . GLU A 1 132 ? 22.631  -5.655  -15.529 1.00 48.67  ? 132  GLU A O     1 
ATOM   1017 C CB    . GLU A 1 132 ? 23.733  -4.408  -17.955 1.00 50.76  ? 132  GLU A CB    1 
ATOM   1018 C CG    . GLU A 1 132 ? 22.562  -4.684  -18.888 1.00 56.96  ? 132  GLU A CG    1 
ATOM   1019 C CD    . GLU A 1 132 ? 22.435  -3.639  -19.997 1.00 54.16  ? 132  GLU A CD    1 
ATOM   1020 O OE1   . GLU A 1 132 ? 21.680  -2.656  -19.826 1.00 51.43  ? 132  GLU A OE1   1 
ATOM   1021 O OE2   . GLU A 1 132 ? 23.087  -3.807  -21.047 1.00 51.34  ? 132  GLU A OE2   1 
ATOM   1022 N N     . ILE A 1 133 ? 22.979  -7.586  -16.619 1.00 39.76  ? 133  ILE A N     1 
ATOM   1023 C CA    . ILE A 1 133 ? 21.939  -8.276  -15.868 1.00 36.44  ? 133  ILE A CA    1 
ATOM   1024 C C     . ILE A 1 133 ? 22.296  -8.441  -14.387 1.00 36.36  ? 133  ILE A C     1 
ATOM   1025 O O     . ILE A 1 133 ? 21.449  -8.231  -13.520 1.00 39.00  ? 133  ILE A O     1 
ATOM   1026 C CB    . ILE A 1 133 ? 21.546  -9.606  -16.533 1.00 39.12  ? 133  ILE A CB    1 
ATOM   1027 C CG1   . ILE A 1 133 ? 20.927  -9.312  -17.903 1.00 41.42  ? 133  ILE A CG1   1 
ATOM   1028 C CG2   . ILE A 1 133 ? 20.574  -10.381 -15.661 1.00 28.15  ? 133  ILE A CG2   1 
ATOM   1029 C CD1   . ILE A 1 133 ? 20.214  -10.487 -18.532 1.00 38.67  ? 133  ILE A CD1   1 
ATOM   1030 N N     . PRO A 1 134 ? 23.558  -8.781  -14.085 1.00 36.14  ? 134  PRO A N     1 
ATOM   1031 C CA    . PRO A 1 134 ? 23.903  -8.854  -12.658 1.00 41.16  ? 134  PRO A CA    1 
ATOM   1032 C C     . PRO A 1 134 ? 23.587  -7.564  -11.897 1.00 38.10  ? 134  PRO A C     1 
ATOM   1033 O O     . PRO A 1 134 ? 22.897  -7.627  -10.877 1.00 41.87  ? 134  PRO A O     1 
ATOM   1034 C CB    . PRO A 1 134 ? 25.409  -9.136  -12.674 1.00 41.36  ? 134  PRO A CB    1 
ATOM   1035 C CG    . PRO A 1 134 ? 25.619  -9.880  -13.980 1.00 41.19  ? 134  PRO A CG    1 
ATOM   1036 C CD    . PRO A 1 134 ? 24.672  -9.212  -14.950 1.00 36.67  ? 134  PRO A CD    1 
ATOM   1037 N N     . ALA A 1 135 ? 24.066  -6.418  -12.375 1.00 41.42  ? 135  ALA A N     1 
ATOM   1038 C CA    . ALA A 1 135 ? 23.775  -5.153  -11.697 1.00 42.16  ? 135  ALA A CA    1 
ATOM   1039 C C     . ALA A 1 135 ? 22.271  -4.918  -11.618 1.00 39.44  ? 135  ALA A C     1 
ATOM   1040 O O     . ALA A 1 135 ? 21.765  -4.475  -10.594 1.00 43.28  ? 135  ALA A O     1 
ATOM   1041 C CB    . ALA A 1 135 ? 24.472  -3.978  -12.393 1.00 42.24  ? 135  ALA A CB    1 
ATOM   1042 N N     . LEU A 1 136 ? 21.553  -5.234  -12.694 1.00 37.91  ? 136  LEU A N     1 
ATOM   1043 C CA    . LEU A 1 136 ? 20.100  -5.074  -12.691 1.00 35.21  ? 136  LEU A CA    1 
ATOM   1044 C C     . LEU A 1 136 ? 19.459  -5.929  -11.607 1.00 38.95  ? 136  LEU A C     1 
ATOM   1045 O O     . LEU A 1 136 ? 18.584  -5.471  -10.869 1.00 39.79  ? 136  LEU A O     1 
ATOM   1046 C CB    . LEU A 1 136 ? 19.510  -5.436  -14.049 1.00 45.37  ? 136  LEU A CB    1 
ATOM   1047 C CG    . LEU A 1 136 ? 17.994  -5.288  -14.146 1.00 47.90  ? 136  LEU A CG    1 
ATOM   1048 C CD1   . LEU A 1 136 ? 17.596  -3.830  -13.946 1.00 50.03  ? 136  LEU A CD1   1 
ATOM   1049 C CD2   . LEU A 1 136 ? 17.511  -5.796  -15.491 1.00 44.27  ? 136  LEU A CD2   1 
ATOM   1050 N N     . ASP A 1 137 ? 19.899  -7.179  -11.511 1.00 37.23  ? 137  ASP A N     1 
ATOM   1051 C CA    . ASP A 1 137 ? 19.335  -8.084  -10.521 1.00 40.48  ? 137  ASP A CA    1 
ATOM   1052 C C     . ASP A 1 137 ? 19.610  -7.582  -9.106  1.00 39.94  ? 137  ASP A C     1 
ATOM   1053 O O     . ASP A 1 137 ? 18.748  -7.663  -8.232  1.00 39.09  ? 137  ASP A O     1 
ATOM   1054 C CB    . ASP A 1 137 ? 19.871  -9.503  -10.701 1.00 42.56  ? 137  ASP A CB    1 
ATOM   1055 C CG    . ASP A 1 137 ? 19.291  -10.466 -9.692  1.00 40.87  ? 137  ASP A CG    1 
ATOM   1056 O OD1   . ASP A 1 137 ? 18.062  -10.687 -9.719  1.00 41.14  ? 137  ASP A OD1   1 
ATOM   1057 O OD2   . ASP A 1 137 ? 20.062  -10.997 -8.870  1.00 38.49  ? 137  ASP A OD2   1 
ATOM   1058 N N     . LYS A 1 138 ? 20.811  -7.058  -8.893  1.00 40.70  ? 138  LYS A N     1 
ATOM   1059 C CA    . LYS A 1 138 ? 21.172  -6.469  -7.609  1.00 43.84  ? 138  LYS A CA    1 
ATOM   1060 C C     . LYS A 1 138 ? 20.197  -5.353  -7.202  1.00 44.06  ? 138  LYS A C     1 
ATOM   1061 O O     . LYS A 1 138 ? 19.755  -5.299  -6.055  1.00 44.30  ? 138  LYS A O     1 
ATOM   1062 C CB    . LYS A 1 138 ? 22.609  -5.946  -7.649  1.00 48.44  ? 138  LYS A CB    1 
ATOM   1063 C CG    . LYS A 1 138 ? 23.161  -5.562  -6.285  1.00 56.81  ? 138  LYS A CG    1 
ATOM   1064 C CD    . LYS A 1 138 ? 24.609  -5.109  -6.378  1.00 60.59  ? 138  LYS A CD    1 
ATOM   1065 C CE    . LYS A 1 138 ? 25.178  -4.803  -4.996  1.00 66.84  ? 138  LYS A CE    1 
ATOM   1066 N NZ    . LYS A 1 138 ? 26.557  -4.244  -5.069  1.00 67.74  ? 138  LYS A NZ    1 
ATOM   1067 N N     . GLU A 1 139 ? 19.855  -4.478  -8.146  1.00 35.29  ? 139  GLU A N     1 
ATOM   1068 C CA    . GLU A 1 139 ? 18.883  -3.410  -7.886  1.00 41.28  ? 139  GLU A CA    1 
ATOM   1069 C C     . GLU A 1 139 ? 17.521  -4.003  -7.558  1.00 43.62  ? 139  GLU A C     1 
ATOM   1070 O O     . GLU A 1 139 ? 16.868  -3.602  -6.599  1.00 50.90  ? 139  GLU A O     1 
ATOM   1071 C CB    . GLU A 1 139 ? 18.702  -2.486  -9.106  1.00 44.14  ? 139  GLU A CB    1 
ATOM   1072 C CG    . GLU A 1 139 ? 19.906  -1.673  -9.550  1.00 60.42  ? 139  GLU A CG    1 
ATOM   1073 C CD    . GLU A 1 139 ? 19.564  -0.750  -10.723 1.00 74.91  ? 139  GLU A CD    1 
ATOM   1074 O OE1   . GLU A 1 139 ? 18.477  -0.128  -10.692 1.00 76.72  ? 139  GLU A OE1   1 
ATOM   1075 O OE2   . GLU A 1 139 ? 20.367  -0.659  -11.681 1.00 74.08  ? 139  GLU A OE2   1 
ATOM   1076 N N     . LEU A 1 140 ? 17.085  -4.946  -8.384  1.00 40.11  ? 140  LEU A N     1 
ATOM   1077 C CA    . LEU A 1 140 ? 15.757  -5.533  -8.239  1.00 39.72  ? 140  LEU A CA    1 
ATOM   1078 C C     . LEU A 1 140 ? 15.598  -6.329  -6.948  1.00 41.27  ? 140  LEU A C     1 
ATOM   1079 O O     . LEU A 1 140 ? 14.509  -6.382  -6.374  1.00 40.42  ? 140  LEU A O     1 
ATOM   1080 C CB    . LEU A 1 140 ? 15.422  -6.395  -9.460  1.00 41.40  ? 140  LEU A CB    1 
ATOM   1081 C CG    . LEU A 1 140 ? 15.054  -5.539  -10.671 1.00 41.00  ? 140  LEU A CG    1 
ATOM   1082 C CD1   . LEU A 1 140 ? 15.118  -6.328  -11.965 1.00 42.16  ? 140  LEU A CD1   1 
ATOM   1083 C CD2   . LEU A 1 140 ? 13.674  -4.940  -10.457 1.00 36.77  ? 140  LEU A CD2   1 
ATOM   1084 N N     . LYS A 1 141 ? 16.685  -6.947  -6.497  1.00 38.11  ? 141  LYS A N     1 
ATOM   1085 C CA    . LYS A 1 141 ? 16.656  -7.736  -5.273  1.00 42.06  ? 141  LYS A CA    1 
ATOM   1086 C C     . LYS A 1 141 ? 16.355  -6.859  -4.050  1.00 47.24  ? 141  LYS A C     1 
ATOM   1087 O O     . LYS A 1 141 ? 15.730  -7.310  -3.088  1.00 45.60  ? 141  LYS A O     1 
ATOM   1088 C CB    . LYS A 1 141 ? 17.974  -8.499  -5.099  1.00 38.95  ? 141  LYS A CB    1 
ATOM   1089 C CG    . LYS A 1 141 ? 18.120  -9.701  -6.033  1.00 42.56  ? 141  LYS A CG    1 
ATOM   1090 C CD    . LYS A 1 141 ? 17.367  -10.909 -5.483  1.00 38.10  ? 141  LYS A CD    1 
ATOM   1091 C CE    . LYS A 1 141 ? 17.280  -12.048 -6.488  1.00 33.37  ? 141  LYS A CE    1 
ATOM   1092 N NZ    . LYS A 1 141 ? 18.631  -12.510 -6.910  1.00 33.87  ? 141  LYS A NZ    1 
ATOM   1093 N N     . ALA A 1 142 ? 16.782  -5.601  -4.098  1.00 44.98  ? 142  ALA A N     1 
ATOM   1094 C CA    . ALA A 1 142 ? 16.534  -4.676  -2.994  1.00 45.66  ? 142  ALA A CA    1 
ATOM   1095 C C     . ALA A 1 142 ? 15.046  -4.359  -2.875  1.00 50.06  ? 142  ALA A C     1 
ATOM   1096 O O     . ALA A 1 142 ? 14.584  -3.898  -1.832  1.00 51.29  ? 142  ALA A O     1 
ATOM   1097 C CB    . ALA A 1 142 ? 17.341  -3.400  -3.175  1.00 41.30  ? 142  ALA A CB    1 
ATOM   1098 N N     . LYS A 1 143 ? 14.303  -4.618  -3.950  1.00 48.42  ? 143  LYS A N     1 
ATOM   1099 C CA    . LYS A 1 143 ? 12.859  -4.397  -3.975  1.00 44.03  ? 143  LYS A CA    1 
ATOM   1100 C C     . LYS A 1 143 ? 12.096  -5.700  -3.755  1.00 39.02  ? 143  LYS A C     1 
ATOM   1101 O O     . LYS A 1 143 ? 10.867  -5.719  -3.836  1.00 47.11  ? 143  LYS A O     1 
ATOM   1102 C CB    . LYS A 1 143 ? 12.423  -3.793  -5.313  1.00 50.78  ? 143  LYS A CB    1 
ATOM   1103 C CG    . LYS A 1 143 ? 13.201  -2.558  -5.741  1.00 65.54  ? 143  LYS A CG    1 
ATOM   1104 C CD    . LYS A 1 143 ? 12.791  -2.093  -7.136  1.00 71.05  ? 143  LYS A CD    1 
ATOM   1105 C CE    . LYS A 1 143 ? 13.817  -1.125  -7.719  1.00 77.03  ? 143  LYS A CE    1 
ATOM   1106 N NZ    . LYS A 1 143 ? 13.516  -0.742  -9.134  1.00 77.60  ? 143  LYS A NZ    1 
ATOM   1107 N N     . GLY A 1 144 ? 12.823  -6.783  -3.488  1.00 33.41  ? 144  GLY A N     1 
ATOM   1108 C CA    . GLY A 1 144 ? 12.214  -8.099  -3.318  1.00 35.14  ? 144  GLY A CA    1 
ATOM   1109 C C     . GLY A 1 144 ? 11.833  -8.780  -4.634  1.00 44.59  ? 144  GLY A C     1 
ATOM   1110 O O     . GLY A 1 144 ? 10.941  -9.633  -4.677  1.00 39.17  ? 144  GLY A O     1 
ATOM   1111 N N     . LYS A 1 145 ? 12.515  -8.396  -5.709  1.00 38.77  ? 145  LYS A N     1 
ATOM   1112 C CA    . LYS A 1 145 ? 12.263  -8.932  -7.038  1.00 35.16  ? 145  LYS A CA    1 
ATOM   1113 C C     . LYS A 1 145 ? 13.574  -9.466  -7.596  1.00 38.78  ? 145  LYS A C     1 
ATOM   1114 O O     . LYS A 1 145 ? 14.625  -9.312  -6.968  1.00 41.23  ? 145  LYS A O     1 
ATOM   1115 C CB    . LYS A 1 145 ? 11.741  -7.821  -7.958  1.00 31.31  ? 145  LYS A CB    1 
ATOM   1116 C CG    . LYS A 1 145 ? 10.439  -7.197  -7.497  1.00 35.93  ? 145  LYS A CG    1 
ATOM   1117 C CD    . LYS A 1 145 ? 9.332   -8.233  -7.468  1.00 41.19  ? 145  LYS A CD    1 
ATOM   1118 C CE    . LYS A 1 145 ? 8.023   -7.624  -6.995  1.00 44.67  ? 145  LYS A CE    1 
ATOM   1119 N NZ    . LYS A 1 145 ? 6.950   -8.654  -6.858  1.00 47.91  ? 145  LYS A NZ    1 
ATOM   1120 N N     . SER A 1 146 ? 13.516  -10.080 -8.779  1.00 40.17  ? 146  SER A N     1 
ATOM   1121 C CA    . SER A 1 146 ? 14.719  -10.534 -9.472  1.00 33.36  ? 146  SER A CA    1 
ATOM   1122 C C     . SER A 1 146 ? 14.710  -10.092 -10.933 1.00 35.40  ? 146  SER A C     1 
ATOM   1123 O O     . SER A 1 146 ? 13.668  -9.735  -11.475 1.00 39.88  ? 146  SER A O     1 
ATOM   1124 C CB    . SER A 1 146 ? 14.848  -12.057 -9.377  1.00 35.59  ? 146  SER A CB    1 
ATOM   1125 O OG    . SER A 1 146 ? 13.877  -12.704 -10.180 1.00 36.43  ? 146  SER A OG    1 
ATOM   1126 N N     . ALA A 1 147 ? 15.872  -10.123 -11.575 1.00 37.89  ? 147  ALA A N     1 
ATOM   1127 C CA    . ALA A 1 147 ? 15.978  -9.701  -12.969 1.00 34.60  ? 147  ALA A CA    1 
ATOM   1128 C C     . ALA A 1 147 ? 15.488  -10.754 -13.970 1.00 38.72  ? 147  ALA A C     1 
ATOM   1129 O O     . ALA A 1 147 ? 14.707  -10.446 -14.870 1.00 35.17  ? 147  ALA A O     1 
ATOM   1130 C CB    . ALA A 1 147 ? 17.408  -9.299  -13.293 1.00 32.22  ? 147  ALA A CB    1 
ATOM   1131 N N     . LEU A 1 148 ? 15.936  -11.995 -13.807 1.00 41.07  ? 148  LEU A N     1 
ATOM   1132 C CA    . LEU A 1 148 ? 15.737  -13.000 -14.849 1.00 36.54  ? 148  LEU A CA    1 
ATOM   1133 C C     . LEU A 1 148 ? 15.530  -14.423 -14.324 1.00 37.62  ? 148  LEU A C     1 
ATOM   1134 O O     . LEU A 1 148 ? 16.334  -14.935 -13.551 1.00 34.58  ? 148  LEU A O     1 
ATOM   1135 C CB    . LEU A 1 148 ? 16.933  -12.975 -15.805 1.00 29.48  ? 148  LEU A CB    1 
ATOM   1136 C CG    . LEU A 1 148 ? 16.997  -13.999 -16.936 1.00 31.75  ? 148  LEU A CG    1 
ATOM   1137 C CD1   . LEU A 1 148 ? 15.827  -13.823 -17.907 1.00 29.93  ? 148  LEU A CD1   1 
ATOM   1138 C CD2   . LEU A 1 148 ? 18.328  -13.857 -17.668 1.00 30.96  ? 148  LEU A CD2   1 
ATOM   1139 N N     . MET A 1 149 ? 14.450  -15.061 -14.757 1.00 38.51  ? 149  MET A N     1 
ATOM   1140 C CA    . MET A 1 149 ? 14.268  -16.489 -14.524 1.00 41.87  ? 149  MET A CA    1 
ATOM   1141 C C     . MET A 1 149 ? 13.789  -17.177 -15.788 1.00 39.37  ? 149  MET A C     1 
ATOM   1142 O O     . MET A 1 149 ? 12.793  -16.762 -16.390 1.00 35.70  ? 149  MET A O     1 
ATOM   1143 C CB    . MET A 1 149 ? 13.273  -16.750 -13.394 1.00 41.00  ? 149  MET A CB    1 
ATOM   1144 C CG    . MET A 1 149 ? 13.751  -16.280 -12.043 1.00 46.82  ? 149  MET A CG    1 
ATOM   1145 S SD    . MET A 1 149 ? 12.515  -16.587 -10.785 1.00 45.77  ? 149  MET A SD    1 
ATOM   1146 C CE    . MET A 1 149 ? 12.540  -18.359 -10.713 1.00 21.48  ? 149  MET A CE    1 
ATOM   1147 N N     . PHE A 1 150 ? 14.509  -18.222 -16.187 1.00 34.73  ? 150  PHE A N     1 
ATOM   1148 C CA    . PHE A 1 150 ? 14.079  -19.075 -17.292 1.00 37.42  ? 150  PHE A CA    1 
ATOM   1149 C C     . PHE A 1 150 ? 14.495  -20.518 -17.068 1.00 37.00  ? 150  PHE A C     1 
ATOM   1150 O O     . PHE A 1 150 ? 15.309  -20.811 -16.189 1.00 33.14  ? 150  PHE A O     1 
ATOM   1151 C CB    . PHE A 1 150 ? 14.593  -18.557 -18.640 1.00 34.13  ? 150  PHE A CB    1 
ATOM   1152 C CG    . PHE A 1 150 ? 16.092  -18.591 -18.788 1.00 30.03  ? 150  PHE A CG    1 
ATOM   1153 C CD1   . PHE A 1 150 ? 16.885  -17.631 -18.185 1.00 27.60  ? 150  PHE A CD1   1 
ATOM   1154 C CD2   . PHE A 1 150 ? 16.701  -19.560 -19.566 1.00 30.75  ? 150  PHE A CD2   1 
ATOM   1155 C CE1   . PHE A 1 150 ? 18.263  -17.649 -18.340 1.00 29.66  ? 150  PHE A CE1   1 
ATOM   1156 C CE2   . PHE A 1 150 ? 18.077  -19.583 -19.729 1.00 35.09  ? 150  PHE A CE2   1 
ATOM   1157 C CZ    . PHE A 1 150 ? 18.859  -18.623 -19.117 1.00 32.91  ? 150  PHE A CZ    1 
ATOM   1158 N N     . ASN A 1 151 ? 13.930  -21.413 -17.869 1.00 39.85  ? 151  ASN A N     1 
ATOM   1159 C CA    . ASN A 1 151 ? 14.134  -22.850 -17.701 1.00 36.89  ? 151  ASN A CA    1 
ATOM   1160 C C     . ASN A 1 151 ? 15.579  -23.274 -17.938 1.00 36.69  ? 151  ASN A C     1 
ATOM   1161 O O     . ASN A 1 151 ? 16.089  -23.165 -19.047 1.00 36.07  ? 151  ASN A O     1 
ATOM   1162 C CB    . ASN A 1 151 ? 13.202  -23.621 -18.637 1.00 37.13  ? 151  ASN A CB    1 
ATOM   1163 C CG    . ASN A 1 151 ? 13.347  -25.136 -18.504 1.00 35.27  ? 151  ASN A CG    1 
ATOM   1164 O OD1   . ASN A 1 151 ? 13.930  -25.644 -17.540 1.00 35.06  ? 151  ASN A OD1   1 
ATOM   1165 N ND2   . ASN A 1 151 ? 12.797  -25.860 -19.468 1.00 28.56  ? 151  ASN A ND2   1 
ATOM   1166 N N     . LEU A 1 152 ? 16.230  -23.776 -16.896 1.00 37.76  ? 152  LEU A N     1 
ATOM   1167 C CA    . LEU A 1 152 ? 17.628  -24.174 -17.008 1.00 38.07  ? 152  LEU A CA    1 
ATOM   1168 C C     . LEU A 1 152 ? 17.800  -25.684 -17.150 1.00 31.57  ? 152  LEU A C     1 
ATOM   1169 O O     . LEU A 1 152 ? 18.922  -26.186 -17.169 1.00 35.60  ? 152  LEU A O     1 
ATOM   1170 C CB    . LEU A 1 152 ? 18.431  -23.651 -15.815 1.00 32.51  ? 152  LEU A CB    1 
ATOM   1171 C CG    . LEU A 1 152 ? 18.466  -22.126 -15.729 1.00 37.55  ? 152  LEU A CG    1 
ATOM   1172 C CD1   . LEU A 1 152 ? 19.232  -21.647 -14.493 1.00 34.07  ? 152  LEU A CD1   1 
ATOM   1173 C CD2   . LEU A 1 152 ? 19.062  -21.553 -17.009 1.00 41.37  ? 152  LEU A CD2   1 
ATOM   1174 N N     . GLN A 1 153 ? 16.687  -26.403 -17.256 1.00 34.22  ? 153  GLN A N     1 
ATOM   1175 C CA    . GLN A 1 153 ? 16.730  -27.862 -17.358 1.00 33.91  ? 153  GLN A CA    1 
ATOM   1176 C C     . GLN A 1 153 ? 16.787  -28.357 -18.812 1.00 39.43  ? 153  GLN A C     1 
ATOM   1177 O O     . GLN A 1 153 ? 17.124  -29.512 -19.064 1.00 40.72  ? 153  GLN A O     1 
ATOM   1178 C CB    . GLN A 1 153 ? 15.531  -28.487 -16.635 1.00 30.00  ? 153  GLN A CB    1 
ATOM   1179 C CG    . GLN A 1 153 ? 15.364  -28.015 -15.200 1.00 32.62  ? 153  GLN A CG    1 
ATOM   1180 C CD    . GLN A 1 153 ? 16.663  -28.094 -14.421 1.00 38.62  ? 153  GLN A CD    1 
ATOM   1181 O OE1   . GLN A 1 153 ? 17.204  -29.178 -14.205 1.00 41.21  ? 153  GLN A OE1   1 
ATOM   1182 N NE2   . GLN A 1 153 ? 17.182  -26.941 -14.014 1.00 39.43  ? 153  GLN A NE2   1 
ATOM   1183 N N     . GLU A 1 154 ? 16.444  -27.489 -19.759 1.00 41.10  ? 154  GLU A N     1 
ATOM   1184 C CA    . GLU A 1 154 ? 16.490  -27.844 -21.179 1.00 38.17  ? 154  GLU A CA    1 
ATOM   1185 C C     . GLU A 1 154 ? 17.496  -26.960 -21.896 1.00 36.88  ? 154  GLU A C     1 
ATOM   1186 O O     . GLU A 1 154 ? 17.333  -25.746 -21.918 1.00 35.75  ? 154  GLU A O     1 
ATOM   1187 C CB    . GLU A 1 154 ? 15.118  -27.667 -21.824 1.00 31.99  ? 154  GLU A CB    1 
ATOM   1188 C CG    . GLU A 1 154 ? 14.093  -28.723 -21.463 1.00 28.88  ? 154  GLU A CG    1 
ATOM   1189 C CD    . GLU A 1 154 ? 14.460  -30.112 -21.984 1.00 36.49  ? 154  GLU A CD    1 
ATOM   1190 O OE1   . GLU A 1 154 ? 15.303  -30.221 -22.902 1.00 36.18  ? 154  GLU A OE1   1 
ATOM   1191 O OE2   . GLU A 1 154 ? 13.902  -31.100 -21.463 1.00 41.03  ? 154  GLU A OE2   1 
ATOM   1192 N N     . PRO A 1 155 ? 18.533  -27.567 -22.496 1.00 31.83  ? 155  PRO A N     1 
ATOM   1193 C CA    . PRO A 1 155 ? 19.619  -26.835 -23.161 1.00 35.19  ? 155  PRO A CA    1 
ATOM   1194 C C     . PRO A 1 155 ? 19.116  -25.845 -24.212 1.00 37.87  ? 155  PRO A C     1 
ATOM   1195 O O     . PRO A 1 155 ? 19.804  -24.878 -24.526 1.00 40.96  ? 155  PRO A O     1 
ATOM   1196 C CB    . PRO A 1 155 ? 20.444  -27.948 -23.824 1.00 28.75  ? 155  PRO A CB    1 
ATOM   1197 C CG    . PRO A 1 155 ? 19.530  -29.130 -23.883 1.00 35.21  ? 155  PRO A CG    1 
ATOM   1198 C CD    . PRO A 1 155 ? 18.684  -29.022 -22.645 1.00 30.02  ? 155  PRO A CD    1 
ATOM   1199 N N     . TYR A 1 156 ? 17.924  -26.096 -24.739 1.00 38.44  ? 156  TYR A N     1 
ATOM   1200 C CA    . TYR A 1 156 ? 17.305  -25.228 -25.735 1.00 36.65  ? 156  TYR A CA    1 
ATOM   1201 C C     . TYR A 1 156 ? 17.269  -23.782 -25.251 1.00 37.53  ? 156  TYR A C     1 
ATOM   1202 O O     . TYR A 1 156 ? 17.482  -22.856 -26.030 1.00 31.85  ? 156  TYR A O     1 
ATOM   1203 C CB    . TYR A 1 156 ? 15.890  -25.727 -26.020 1.00 36.14  ? 156  TYR A CB    1 
ATOM   1204 C CG    . TYR A 1 156 ? 15.078  -24.923 -27.008 1.00 37.32  ? 156  TYR A CG    1 
ATOM   1205 C CD1   . TYR A 1 156 ? 15.307  -25.031 -28.374 1.00 40.67  ? 156  TYR A CD1   1 
ATOM   1206 C CD2   . TYR A 1 156 ? 14.052  -24.086 -26.580 1.00 35.58  ? 156  TYR A CD2   1 
ATOM   1207 C CE1   . TYR A 1 156 ? 14.553  -24.316 -29.283 1.00 31.58  ? 156  TYR A CE1   1 
ATOM   1208 C CE2   . TYR A 1 156 ? 13.289  -23.363 -27.490 1.00 32.77  ? 156  TYR A CE2   1 
ATOM   1209 C CZ    . TYR A 1 156 ? 13.546  -23.488 -28.838 1.00 32.09  ? 156  TYR A CZ    1 
ATOM   1210 O OH    . TYR A 1 156 ? 12.803  -22.783 -29.752 1.00 37.43  ? 156  TYR A OH    1 
ATOM   1211 N N     . PHE A 1 157 ? 17.025  -23.588 -23.957 1.00 30.74  ? 157  PHE A N     1 
ATOM   1212 C CA    . PHE A 1 157 ? 16.865  -22.240 -23.420 1.00 28.29  ? 157  PHE A CA    1 
ATOM   1213 C C     . PHE A 1 157 ? 18.180  -21.514 -23.147 1.00 29.33  ? 157  PHE A C     1 
ATOM   1214 O O     . PHE A 1 157 ? 18.217  -20.284 -23.091 1.00 31.75  ? 157  PHE A O     1 
ATOM   1215 C CB    . PHE A 1 157 ? 15.992  -22.267 -22.167 1.00 33.06  ? 157  PHE A CB    1 
ATOM   1216 C CG    . PHE A 1 157 ? 14.563  -22.602 -22.447 1.00 30.01  ? 157  PHE A CG    1 
ATOM   1217 C CD1   . PHE A 1 157 ? 14.168  -23.919 -22.610 1.00 31.06  ? 157  PHE A CD1   1 
ATOM   1218 C CD2   . PHE A 1 157 ? 13.615  -21.599 -22.556 1.00 27.81  ? 157  PHE A CD2   1 
ATOM   1219 C CE1   . PHE A 1 157 ? 12.845  -24.238 -22.876 1.00 30.35  ? 157  PHE A CE1   1 
ATOM   1220 C CE2   . PHE A 1 157 ? 12.290  -21.906 -22.817 1.00 29.75  ? 157  PHE A CE2   1 
ATOM   1221 C CZ    . PHE A 1 157 ? 11.905  -23.228 -22.984 1.00 29.25  ? 157  PHE A CZ    1 
ATOM   1222 N N     . THR A 1 158 ? 19.253  -22.282 -22.990 1.00 33.52  ? 158  THR A N     1 
ATOM   1223 C CA    A THR A 1 158 ? 20.575  -21.757 -22.654 0.50 31.85  ? 158  THR A CA    1 
ATOM   1224 C CA    B THR A 1 158 ? 20.552  -21.699 -22.669 0.50 31.38  ? 158  THR A CA    1 
ATOM   1225 C C     . THR A 1 158 ? 21.441  -21.616 -23.902 1.00 33.74  ? 158  THR A C     1 
ATOM   1226 O O     . THR A 1 158 ? 22.435  -20.884 -23.920 1.00 36.60  ? 158  THR A O     1 
ATOM   1227 C CB    A THR A 1 158 ? 21.290  -22.711 -21.670 0.50 31.46  ? 158  THR A CB    1 
ATOM   1228 C CB    B THR A 1 158 ? 21.270  -22.506 -21.573 0.50 32.10  ? 158  THR A CB    1 
ATOM   1229 O OG1   A THR A 1 158 ? 20.551  -22.776 -20.443 0.50 29.69  ? 158  THR A OG1   1 
ATOM   1230 O OG1   B THR A 1 158 ? 21.215  -23.899 -21.899 0.50 27.50  ? 158  THR A OG1   1 
ATOM   1231 C CG2   A THR A 1 158 ? 22.714  -22.244 -21.390 0.50 27.95  ? 158  THR A CG2   1 
ATOM   1232 C CG2   B THR A 1 158 ? 20.597  -22.283 -20.226 0.50 32.31  ? 158  THR A CG2   1 
ATOM   1233 N N     . TRP A 1 159 ? 21.071  -22.349 -24.939 1.00 33.98  ? 159  TRP A N     1 
ATOM   1234 C CA    . TRP A 1 159 ? 21.812  -22.316 -26.182 1.00 37.52  ? 159  TRP A CA    1 
ATOM   1235 C C     . TRP A 1 159 ? 21.982  -20.905 -26.769 1.00 32.94  ? 159  TRP A C     1 
ATOM   1236 O O     . TRP A 1 159 ? 23.051  -20.578 -27.284 1.00 34.73  ? 159  TRP A O     1 
ATOM   1237 C CB    . TRP A 1 159 ? 21.173  -23.236 -27.215 1.00 34.66  ? 159  TRP A CB    1 
ATOM   1238 C CG    . TRP A 1 159 ? 22.057  -23.407 -28.371 1.00 36.36  ? 159  TRP A CG    1 
ATOM   1239 C CD1   . TRP A 1 159 ? 21.952  -22.795 -29.588 1.00 30.13  ? 159  TRP A CD1   1 
ATOM   1240 C CD2   . TRP A 1 159 ? 23.239  -24.211 -28.423 1.00 37.40  ? 159  TRP A CD2   1 
ATOM   1241 N NE1   . TRP A 1 159 ? 22.981  -23.194 -30.400 1.00 34.11  ? 159  TRP A NE1   1 
ATOM   1242 C CE2   . TRP A 1 159 ? 23.788  -24.059 -29.710 1.00 31.95  ? 159  TRP A CE2   1 
ATOM   1243 C CE3   . TRP A 1 159 ? 23.876  -25.058 -27.512 1.00 35.96  ? 159  TRP A CE3   1 
ATOM   1244 C CZ2   . TRP A 1 159 ? 24.945  -24.718 -30.107 1.00 36.63  ? 159  TRP A CZ2   1 
ATOM   1245 C CZ3   . TRP A 1 159 ? 25.025  -25.710 -27.905 1.00 37.35  ? 159  TRP A CZ3   1 
ATOM   1246 C CH2   . TRP A 1 159 ? 25.549  -25.538 -29.192 1.00 41.92  ? 159  TRP A CH2   1 
ATOM   1247 N N     . PRO A 1 160 ? 20.941  -20.060 -26.689 1.00 27.34  ? 160  PRO A N     1 
ATOM   1248 C CA    . PRO A 1 160 ? 21.141  -18.744 -27.306 1.00 34.64  ? 160  PRO A CA    1 
ATOM   1249 C C     . PRO A 1 160 ? 22.391  -18.074 -26.751 1.00 36.24  ? 160  PRO A C     1 
ATOM   1250 O O     . PRO A 1 160 ? 23.118  -17.418 -27.499 1.00 36.21  ? 160  PRO A O     1 
ATOM   1251 C CB    . PRO A 1 160 ? 19.895  -17.961 -26.881 1.00 36.27  ? 160  PRO A CB    1 
ATOM   1252 C CG    . PRO A 1 160 ? 18.868  -19.005 -26.590 1.00 34.60  ? 160  PRO A CG    1 
ATOM   1253 C CD    . PRO A 1 160 ? 19.625  -20.173 -26.036 1.00 27.18  ? 160  PRO A CD    1 
ATOM   1254 N N     . LEU A 1 161 ? 22.639  -18.254 -25.455 1.00 35.82  ? 161  LEU A N     1 
ATOM   1255 C CA    . LEU A 1 161 ? 23.781  -17.624 -24.787 1.00 38.47  ? 161  LEU A CA    1 
ATOM   1256 C C     . LEU A 1 161 ? 25.079  -18.349 -25.116 1.00 40.55  ? 161  LEU A C     1 
ATOM   1257 O O     . LEU A 1 161 ? 26.129  -17.724 -25.286 1.00 38.29  ? 161  LEU A O     1 
ATOM   1258 C CB    . LEU A 1 161 ? 23.567  -17.577 -23.268 1.00 31.69  ? 161  LEU A CB    1 
ATOM   1259 C CG    . LEU A 1 161 ? 24.736  -17.087 -22.411 1.00 33.68  ? 161  LEU A CG    1 
ATOM   1260 C CD1   . LEU A 1 161 ? 25.209  -15.720 -22.889 1.00 39.84  ? 161  LEU A CD1   1 
ATOM   1261 C CD2   . LEU A 1 161 ? 24.358  -17.033 -20.928 1.00 32.95  ? 161  LEU A CD2   1 
ATOM   1262 N N     . ILE A 1 162 ? 24.993  -19.672 -25.197 1.00 41.64  ? 162  ILE A N     1 
ATOM   1263 C CA    . ILE A 1 162 ? 26.134  -20.520 -25.527 1.00 41.06  ? 162  ILE A CA    1 
ATOM   1264 C C     . ILE A 1 162 ? 26.628  -20.269 -26.955 1.00 39.87  ? 162  ILE A C     1 
ATOM   1265 O O     . ILE A 1 162 ? 27.829  -20.286 -27.228 1.00 41.11  ? 162  ILE A O     1 
ATOM   1266 C CB    . ILE A 1 162 ? 25.762  -22.015 -25.353 1.00 39.86  ? 162  ILE A CB    1 
ATOM   1267 C CG1   . ILE A 1 162 ? 25.587  -22.351 -23.868 1.00 38.82  ? 162  ILE A CG1   1 
ATOM   1268 C CG2   . ILE A 1 162 ? 26.807  -22.920 -25.989 1.00 35.47  ? 162  ILE A CG2   1 
ATOM   1269 C CD1   . ILE A 1 162 ? 25.070  -23.770 -23.607 1.00 32.93  ? 162  ILE A CD1   1 
ATOM   1270 N N     . ALA A 1 163 ? 25.691  -20.023 -27.861 1.00 36.83  ? 163  ALA A N     1 
ATOM   1271 C CA    . ALA A 1 163 ? 26.023  -19.814 -29.267 1.00 44.52  ? 163  ALA A CA    1 
ATOM   1272 C C     . ALA A 1 163 ? 26.571  -18.415 -29.541 1.00 48.72  ? 163  ALA A C     1 
ATOM   1273 O O     . ALA A 1 163 ? 27.392  -18.230 -30.438 1.00 45.96  ? 163  ALA A O     1 
ATOM   1274 C CB    . ALA A 1 163 ? 24.803  -20.086 -30.147 1.00 36.15  ? 163  ALA A CB    1 
ATOM   1275 N N     . ALA A 1 164 ? 26.121  -17.436 -28.762 1.00 44.28  ? 164  ALA A N     1 
ATOM   1276 C CA    . ALA A 1 164 ? 26.460  -16.029 -29.010 1.00 44.58  ? 164  ALA A CA    1 
ATOM   1277 C C     . ALA A 1 164 ? 27.901  -15.777 -29.471 1.00 45.88  ? 164  ALA A C     1 
ATOM   1278 O O     . ALA A 1 164 ? 28.124  -15.141 -30.503 1.00 45.44  ? 164  ALA A O     1 
ATOM   1279 C CB    . ALA A 1 164 ? 26.130  -15.169 -27.786 1.00 30.52  ? 164  ALA A CB    1 
ATOM   1280 N N     . ASP A 1 165 ? 28.870  -16.270 -28.705 1.00 44.34  ? 165  ASP A N     1 
ATOM   1281 C CA    . ASP A 1 165 ? 30.276  -15.957 -28.952 1.00 39.99  ? 165  ASP A CA    1 
ATOM   1282 C C     . ASP A 1 165 ? 31.002  -17.012 -29.779 1.00 36.79  ? 165  ASP A C     1 
ATOM   1283 O O     . ASP A 1 165 ? 32.222  -16.939 -29.946 1.00 38.79  ? 165  ASP A O     1 
ATOM   1284 C CB    . ASP A 1 165 ? 31.022  -15.717 -27.629 1.00 46.20  ? 165  ASP A CB    1 
ATOM   1285 C CG    . ASP A 1 165 ? 32.385  -15.059 -27.828 1.00 47.46  ? 165  ASP A CG    1 
ATOM   1286 O OD1   . ASP A 1 165 ? 32.465  -14.050 -28.567 1.00 52.64  ? 165  ASP A OD1   1 
ATOM   1287 O OD2   . ASP A 1 165 ? 33.379  -15.552 -27.249 1.00 43.48  ? 165  ASP A OD2   1 
ATOM   1288 N N     . GLY A 1 166 ? 30.272  -17.997 -30.294 1.00 35.68  ? 166  GLY A N     1 
ATOM   1289 C CA    . GLY A 1 166 ? 30.887  -18.948 -31.211 1.00 34.28  ? 166  GLY A CA    1 
ATOM   1290 C C     . GLY A 1 166 ? 30.513  -20.420 -31.078 1.00 45.25  ? 166  GLY A C     1 
ATOM   1291 O O     . GLY A 1 166 ? 30.993  -21.252 -31.852 1.00 46.21  ? 166  GLY A O     1 
ATOM   1292 N N     . GLY A 1 167 ? 29.672  -20.758 -30.105 1.00 35.90  ? 167  GLY A N     1 
ATOM   1293 C CA    . GLY A 1 167 ? 29.219  -22.132 -29.974 1.00 44.49  ? 167  GLY A CA    1 
ATOM   1294 C C     . GLY A 1 167 ? 28.344  -22.539 -31.148 1.00 44.54  ? 167  GLY A C     1 
ATOM   1295 O O     . GLY A 1 167 ? 27.660  -21.701 -31.727 1.00 46.76  ? 167  GLY A O     1 
ATOM   1296 N N     . TYR A 1 168 ? 28.368  -23.816 -31.517 1.00 35.52  ? 168  TYR A N     1 
ATOM   1297 C CA    . TYR A 1 168 ? 27.439  -24.317 -32.529 1.00 37.87  ? 168  TYR A CA    1 
ATOM   1298 C C     . TYR A 1 168 ? 27.278  -25.821 -32.443 1.00 37.00  ? 168  TYR A C     1 
ATOM   1299 O O     . TYR A 1 168 ? 28.169  -26.519 -31.976 1.00 38.88  ? 168  TYR A O     1 
ATOM   1300 C CB    . TYR A 1 168 ? 27.868  -23.908 -33.952 1.00 38.27  ? 168  TYR A CB    1 
ATOM   1301 C CG    . TYR A 1 168 ? 29.231  -24.414 -34.364 1.00 36.90  ? 168  TYR A CG    1 
ATOM   1302 C CD1   . TYR A 1 168 ? 29.385  -25.680 -34.911 1.00 33.17  ? 168  TYR A CD1   1 
ATOM   1303 C CD2   . TYR A 1 168 ? 30.364  -23.622 -34.209 1.00 34.23  ? 168  TYR A CD2   1 
ATOM   1304 C CE1   . TYR A 1 168 ? 30.629  -26.149 -35.286 1.00 29.31  ? 168  TYR A CE1   1 
ATOM   1305 C CE2   . TYR A 1 168 ? 31.616  -24.084 -34.578 1.00 28.17  ? 168  TYR A CE2   1 
ATOM   1306 C CZ    . TYR A 1 168 ? 31.739  -25.346 -35.122 1.00 37.15  ? 168  TYR A CZ    1 
ATOM   1307 O OH    . TYR A 1 168 ? 32.978  -25.816 -35.495 1.00 44.08  ? 168  TYR A OH    1 
ATOM   1308 N N     . ALA A 1 169 ? 26.135  -26.318 -32.900 1.00 37.73  ? 169  ALA A N     1 
ATOM   1309 C CA    . ALA A 1 169 ? 25.890  -27.753 -32.924 1.00 36.83  ? 169  ALA A CA    1 
ATOM   1310 C C     . ALA A 1 169 ? 26.787  -28.458 -33.946 1.00 49.41  ? 169  ALA A C     1 
ATOM   1311 O O     . ALA A 1 169 ? 27.906  -28.862 -33.622 1.00 56.48  ? 169  ALA A O     1 
ATOM   1312 C CB    . ALA A 1 169 ? 24.419  -28.034 -33.198 1.00 34.70  ? 169  ALA A CB    1 
ATOM   1313 N N     . PHE A 1 170 ? 26.295  -28.612 -35.175 1.00 49.21  ? 170  PHE A N     1 
ATOM   1314 C CA    . PHE A 1 170 ? 27.081  -29.233 -36.245 1.00 47.69  ? 170  PHE A CA    1 
ATOM   1315 C C     . PHE A 1 170 ? 27.370  -28.249 -37.381 1.00 51.60  ? 170  PHE A C     1 
ATOM   1316 O O     . PHE A 1 170 ? 26.475  -27.537 -37.839 1.00 47.99  ? 170  PHE A O     1 
ATOM   1317 C CB    . PHE A 1 170 ? 26.356  -30.453 -36.808 1.00 43.00  ? 170  PHE A CB    1 
ATOM   1318 C CG    . PHE A 1 170 ? 26.204  -31.569 -35.832 1.00 41.78  ? 170  PHE A CG    1 
ATOM   1319 C CD1   . PHE A 1 170 ? 27.219  -32.490 -35.652 1.00 37.77  ? 170  PHE A CD1   1 
ATOM   1320 C CD2   . PHE A 1 170 ? 25.040  -31.708 -35.096 1.00 41.74  ? 170  PHE A CD2   1 
ATOM   1321 C CE1   . PHE A 1 170 ? 27.076  -33.525 -34.749 1.00 40.98  ? 170  PHE A CE1   1 
ATOM   1322 C CE2   . PHE A 1 170 ? 24.893  -32.739 -34.199 1.00 36.74  ? 170  PHE A CE2   1 
ATOM   1323 C CZ    . PHE A 1 170 ? 25.911  -33.652 -34.026 1.00 36.09  ? 170  PHE A CZ    1 
ATOM   1324 N N     . LYS A 1 171 ? 28.615  -28.220 -37.846 1.00 55.38  ? 171  LYS A N     1 
ATOM   1325 C CA    . LYS A 1 171 ? 28.997  -27.275 -38.893 1.00 57.32  ? 171  LYS A CA    1 
ATOM   1326 C C     . LYS A 1 171 ? 28.313  -27.576 -40.223 1.00 54.43  ? 171  LYS A C     1 
ATOM   1327 O O     . LYS A 1 171 ? 28.334  -28.704 -40.711 1.00 50.35  ? 171  LYS A O     1 
ATOM   1328 C CB    . LYS A 1 171 ? 30.515  -27.213 -39.074 1.00 57.98  ? 171  LYS A CB    1 
ATOM   1329 C CG    . LYS A 1 171 ? 30.984  -25.943 -39.768 1.00 62.94  ? 171  LYS A CG    1 
ATOM   1330 C CD    . LYS A 1 171 ? 30.192  -24.740 -39.274 1.00 73.75  ? 171  LYS A CD    1 
ATOM   1331 C CE    . LYS A 1 171 ? 30.636  -23.442 -39.943 1.00 86.29  ? 171  LYS A CE    1 
ATOM   1332 N NZ    . LYS A 1 171 ? 31.988  -23.001 -39.494 1.00 89.52  ? 171  LYS A NZ    1 
ATOM   1333 N N     . TYR A 1 172 ? 27.687  -26.548 -40.783 1.00 58.17  ? 172  TYR A N     1 
ATOM   1334 C CA    . TYR A 1 172 ? 27.053  -26.632 -42.087 1.00 60.71  ? 172  TYR A CA    1 
ATOM   1335 C C     . TYR A 1 172 ? 27.980  -25.957 -43.074 1.00 62.73  ? 172  TYR A C     1 
ATOM   1336 O O     . TYR A 1 172 ? 28.198  -24.748 -42.993 1.00 58.02  ? 172  TYR A O     1 
ATOM   1337 C CB    . TYR A 1 172 ? 25.712  -25.902 -42.064 1.00 59.66  ? 172  TYR A CB    1 
ATOM   1338 C CG    . TYR A 1 172 ? 24.821  -26.161 -43.258 1.00 59.90  ? 172  TYR A CG    1 
ATOM   1339 C CD1   . TYR A 1 172 ? 24.199  -27.388 -43.426 1.00 56.63  ? 172  TYR A CD1   1 
ATOM   1340 C CD2   . TYR A 1 172 ? 24.580  -25.166 -44.203 1.00 68.99  ? 172  TYR A CD2   1 
ATOM   1341 C CE1   . TYR A 1 172 ? 23.374  -27.630 -44.507 1.00 62.97  ? 172  TYR A CE1   1 
ATOM   1342 C CE2   . TYR A 1 172 ? 23.756  -25.399 -45.296 1.00 65.75  ? 172  TYR A CE2   1 
ATOM   1343 C CZ    . TYR A 1 172 ? 23.154  -26.632 -45.441 1.00 64.99  ? 172  TYR A CZ    1 
ATOM   1344 O OH    . TYR A 1 172 ? 22.331  -26.879 -46.517 1.00 61.76  ? 172  TYR A OH    1 
ATOM   1345 N N     . GLU A 1 173 ? 28.554  -26.746 -43.977 1.00 70.64  ? 173  GLU A N     1 
ATOM   1346 C CA    . GLU A 1 173 ? 29.377  -26.209 -45.056 1.00 80.26  ? 173  GLU A CA    1 
ATOM   1347 C C     . GLU A 1 173 ? 28.994  -26.874 -46.367 1.00 79.98  ? 173  GLU A C     1 
ATOM   1348 O O     . GLU A 1 173 ? 28.515  -28.014 -46.382 1.00 71.76  ? 173  GLU A O     1 
ATOM   1349 C CB    . GLU A 1 173 ? 30.870  -26.377 -44.764 1.00 91.41  ? 173  GLU A CB    1 
ATOM   1350 C CG    . GLU A 1 173 ? 31.435  -25.301 -43.844 1.00 98.53  ? 173  GLU A CG    1 
ATOM   1351 C CD    . GLU A 1 173 ? 32.892  -25.532 -43.484 1.00 101.83 ? 173  GLU A CD    1 
ATOM   1352 O OE1   . GLU A 1 173 ? 33.386  -26.665 -43.673 1.00 104.36 ? 173  GLU A OE1   1 
ATOM   1353 O OE2   . GLU A 1 173 ? 33.544  -24.578 -43.008 1.00 98.39  ? 173  GLU A OE2   1 
ATOM   1354 N N     . ASN A 1 174 ? 29.210  -26.155 -47.465 1.00 82.85  ? 174  ASN A N     1 
ATOM   1355 C CA    . ASN A 1 174 ? 28.636  -26.541 -48.743 1.00 75.84  ? 174  ASN A CA    1 
ATOM   1356 C C     . ASN A 1 174 ? 27.128  -26.695 -48.596 1.00 73.64  ? 174  ASN A C     1 
ATOM   1357 O O     . ASN A 1 174 ? 26.423  -25.714 -48.347 1.00 75.36  ? 174  ASN A O     1 
ATOM   1358 C CB    . ASN A 1 174 ? 29.274  -27.823 -49.280 1.00 78.56  ? 174  ASN A CB    1 
ATOM   1359 C CG    . ASN A 1 174 ? 30.283  -27.549 -50.386 1.00 84.96  ? 174  ASN A CG    1 
ATOM   1360 O OD1   . ASN A 1 174 ? 31.435  -27.978 -50.313 1.00 89.58  ? 174  ASN A OD1   1 
ATOM   1361 N ND2   . ASN A 1 174 ? 29.850  -26.826 -51.417 1.00 80.91  ? 174  ASN A ND2   1 
ATOM   1362 N N     . GLY A 1 175 ? 26.632  -27.920 -48.731 1.00 68.12  ? 175  GLY A N     1 
ATOM   1363 C CA    . GLY A 1 175 ? 25.204  -28.152 -48.629 1.00 68.10  ? 175  GLY A CA    1 
ATOM   1364 C C     . GLY A 1 175 ? 24.837  -29.149 -47.551 1.00 72.72  ? 175  GLY A C     1 
ATOM   1365 O O     . GLY A 1 175 ? 23.703  -29.628 -47.497 1.00 75.06  ? 175  GLY A O     1 
ATOM   1366 N N     . LYS A 1 176 ? 25.789  -29.465 -46.682 1.00 68.27  ? 176  LYS A N     1 
ATOM   1367 C CA    . LYS A 1 176 ? 25.547  -30.513 -45.703 1.00 71.28  ? 176  LYS A CA    1 
ATOM   1368 C C     . LYS A 1 176 ? 26.098  -30.224 -44.303 1.00 68.99  ? 176  LYS A C     1 
ATOM   1369 O O     . LYS A 1 176 ? 27.002  -29.399 -44.123 1.00 61.05  ? 176  LYS A O     1 
ATOM   1370 C CB    . LYS A 1 176 ? 26.063  -31.856 -46.227 1.00 73.33  ? 176  LYS A CB    1 
ATOM   1371 C CG    . LYS A 1 176 ? 25.480  -33.047 -45.487 1.00 82.94  ? 176  LYS A CG    1 
ATOM   1372 C CD    . LYS A 1 176 ? 24.000  -32.816 -45.193 1.00 83.70  ? 176  LYS A CD    1 
ATOM   1373 C CE    . LYS A 1 176 ? 23.537  -33.589 -43.960 1.00 72.28  ? 176  LYS A CE    1 
ATOM   1374 N NZ    . LYS A 1 176 ? 22.173  -33.165 -43.530 1.00 58.02  ? 176  LYS A NZ    1 
ATOM   1375 N N     . TYR A 1 177 ? 25.517  -30.904 -43.318 1.00 67.80  ? 177  TYR A N     1 
ATOM   1376 C CA    . TYR A 1 177 ? 25.980  -30.855 -41.937 1.00 57.35  ? 177  TYR A CA    1 
ATOM   1377 C C     . TYR A 1 177 ? 27.116  -31.841 -41.753 1.00 53.18  ? 177  TYR A C     1 
ATOM   1378 O O     . TYR A 1 177 ? 26.959  -33.031 -42.009 1.00 55.23  ? 177  TYR A O     1 
ATOM   1379 C CB    . TYR A 1 177 ? 24.841  -31.204 -40.983 1.00 46.69  ? 177  TYR A CB    1 
ATOM   1380 C CG    . TYR A 1 177 ? 23.854  -30.080 -40.797 1.00 46.23  ? 177  TYR A CG    1 
ATOM   1381 C CD1   . TYR A 1 177 ? 24.232  -28.905 -40.160 1.00 42.69  ? 177  TYR A CD1   1 
ATOM   1382 C CD2   . TYR A 1 177 ? 22.544  -30.193 -41.250 1.00 44.02  ? 177  TYR A CD2   1 
ATOM   1383 C CE1   . TYR A 1 177 ? 23.338  -27.869 -39.983 1.00 42.99  ? 177  TYR A CE1   1 
ATOM   1384 C CE2   . TYR A 1 177 ? 21.637  -29.159 -41.073 1.00 44.90  ? 177  TYR A CE2   1 
ATOM   1385 C CZ    . TYR A 1 177 ? 22.041  -28.000 -40.435 1.00 41.32  ? 177  TYR A CZ    1 
ATOM   1386 O OH    . TYR A 1 177 ? 21.153  -26.963 -40.252 1.00 48.97  ? 177  TYR A OH    1 
ATOM   1387 N N     . ASP A 1 178 ? 28.265  -31.341 -41.318 1.00 47.67  ? 178  ASP A N     1 
ATOM   1388 C CA    . ASP A 1 178 ? 29.431  -32.188 -41.114 1.00 45.97  ? 178  ASP A CA    1 
ATOM   1389 C C     . ASP A 1 178 ? 29.426  -32.777 -39.699 1.00 49.06  ? 178  ASP A C     1 
ATOM   1390 O O     . ASP A 1 178 ? 29.711  -32.079 -38.726 1.00 47.22  ? 178  ASP A O     1 
ATOM   1391 C CB    . ASP A 1 178 ? 30.704  -31.380 -41.369 1.00 41.96  ? 178  ASP A CB    1 
ATOM   1392 C CG    . ASP A 1 178 ? 31.959  -32.185 -41.140 1.00 43.98  ? 178  ASP A CG    1 
ATOM   1393 O OD1   . ASP A 1 178 ? 31.844  -33.393 -40.870 1.00 48.53  ? 178  ASP A OD1   1 
ATOM   1394 O OD2   . ASP A 1 178 ? 33.063  -31.608 -41.234 1.00 54.94  ? 178  ASP A OD2   1 
ATOM   1395 N N     . ILE A 1 179 ? 29.109  -34.065 -39.593 1.00 50.14  ? 179  ILE A N     1 
ATOM   1396 C CA    . ILE A 1 179 ? 28.935  -34.707 -38.291 1.00 47.29  ? 179  ILE A CA    1 
ATOM   1397 C C     . ILE A 1 179 ? 30.212  -34.752 -37.455 1.00 48.65  ? 179  ILE A C     1 
ATOM   1398 O O     . ILE A 1 179 ? 30.170  -35.095 -36.279 1.00 51.62  ? 179  ILE A O     1 
ATOM   1399 C CB    . ILE A 1 179 ? 28.418  -36.144 -38.427 1.00 43.45  ? 179  ILE A CB    1 
ATOM   1400 C CG1   . ILE A 1 179 ? 27.781  -36.606 -37.109 1.00 41.21  ? 179  ILE A CG1   1 
ATOM   1401 C CG2   . ILE A 1 179 ? 29.557  -37.067 -38.797 1.00 43.99  ? 179  ILE A CG2   1 
ATOM   1402 C CD1   . ILE A 1 179 ? 27.219  -38.011 -37.152 1.00 44.94  ? 179  ILE A CD1   1 
ATOM   1403 N N     . LYS A 1 180 ? 31.345  -34.424 -38.063 1.00 55.77  ? 180  LYS A N     1 
ATOM   1404 C CA    . LYS A 1 180 ? 32.623  -34.481 -37.362 1.00 54.79  ? 180  LYS A CA    1 
ATOM   1405 C C     . LYS A 1 180 ? 33.082  -33.087 -36.970 1.00 53.19  ? 180  LYS A C     1 
ATOM   1406 O O     . LYS A 1 180 ? 34.201  -32.905 -36.491 1.00 50.45  ? 180  LYS A O     1 
ATOM   1407 C CB    . LYS A 1 180 ? 33.694  -35.135 -38.239 1.00 60.92  ? 180  LYS A CB    1 
ATOM   1408 C CG    . LYS A 1 180 ? 33.417  -36.579 -38.620 1.00 63.97  ? 180  LYS A CG    1 
ATOM   1409 C CD    . LYS A 1 180 ? 34.599  -37.158 -39.379 1.00 61.97  ? 180  LYS A CD    1 
ATOM   1410 C CE    . LYS A 1 180 ? 34.345  -38.595 -39.793 1.00 64.37  ? 180  LYS A CE    1 
ATOM   1411 N NZ    . LYS A 1 180 ? 35.588  -39.252 -40.288 1.00 67.94  ? 180  LYS A NZ    1 
ATOM   1412 N N     . ASP A 1 181 ? 32.223  -32.101 -37.204 1.00 46.48  ? 181  ASP A N     1 
ATOM   1413 C CA    . ASP A 1 181 ? 32.531  -30.729 -36.844 1.00 49.10  ? 181  ASP A CA    1 
ATOM   1414 C C     . ASP A 1 181 ? 31.480  -30.207 -35.871 1.00 43.78  ? 181  ASP A C     1 
ATOM   1415 O O     . ASP A 1 181 ? 30.513  -29.543 -36.261 1.00 37.87  ? 181  ASP A O     1 
ATOM   1416 C CB    . ASP A 1 181 ? 32.612  -29.842 -38.088 1.00 60.23  ? 181  ASP A CB    1 
ATOM   1417 C CG    . ASP A 1 181 ? 33.276  -28.508 -37.807 1.00 66.83  ? 181  ASP A CG    1 
ATOM   1418 O OD1   . ASP A 1 181 ? 33.471  -28.178 -36.616 1.00 67.42  ? 181  ASP A OD1   1 
ATOM   1419 O OD2   . ASP A 1 181 ? 33.596  -27.787 -38.775 1.00 71.53  ? 181  ASP A OD2   1 
ATOM   1420 N N     . VAL A 1 182 ? 31.684  -30.532 -34.600 1.00 48.03  ? 182  VAL A N     1 
ATOM   1421 C CA    . VAL A 1 182 ? 30.786  -30.142 -33.524 1.00 39.61  ? 182  VAL A CA    1 
ATOM   1422 C C     . VAL A 1 182 ? 31.408  -28.941 -32.817 1.00 42.09  ? 182  VAL A C     1 
ATOM   1423 O O     . VAL A 1 182 ? 32.632  -28.863 -32.678 1.00 38.67  ? 182  VAL A O     1 
ATOM   1424 C CB    . VAL A 1 182 ? 30.605  -31.323 -32.541 1.00 42.12  ? 182  VAL A CB    1 
ATOM   1425 C CG1   . VAL A 1 182 ? 29.669  -30.963 -31.394 1.00 42.31  ? 182  VAL A CG1   1 
ATOM   1426 C CG2   . VAL A 1 182 ? 30.099  -32.551 -33.290 1.00 38.61  ? 182  VAL A CG2   1 
ATOM   1427 N N     . GLY A 1 183 ? 30.578  -27.999 -32.382 1.00 41.95  ? 183  GLY A N     1 
ATOM   1428 C CA    . GLY A 1 183 ? 31.091  -26.786 -31.767 1.00 49.45  ? 183  GLY A CA    1 
ATOM   1429 C C     . GLY A 1 183 ? 30.628  -26.477 -30.349 1.00 47.29  ? 183  GLY A C     1 
ATOM   1430 O O     . GLY A 1 183 ? 30.468  -25.304 -30.000 1.00 40.60  ? 183  GLY A O     1 
ATOM   1431 N N     . VAL A 1 184 ? 30.427  -27.505 -29.525 1.00 44.11  ? 184  VAL A N     1 
ATOM   1432 C CA    . VAL A 1 184 ? 29.973  -27.283 -28.149 1.00 45.97  ? 184  VAL A CA    1 
ATOM   1433 C C     . VAL A 1 184 ? 31.144  -27.097 -27.186 1.00 40.82  ? 184  VAL A C     1 
ATOM   1434 O O     . VAL A 1 184 ? 30.953  -26.858 -25.998 1.00 47.08  ? 184  VAL A O     1 
ATOM   1435 C CB    . VAL A 1 184 ? 29.085  -28.437 -27.628 1.00 42.61  ? 184  VAL A CB    1 
ATOM   1436 C CG1   . VAL A 1 184 ? 28.135  -28.922 -28.708 1.00 37.29  ? 184  VAL A CG1   1 
ATOM   1437 C CG2   . VAL A 1 184 ? 29.933  -29.564 -27.127 1.00 42.73  ? 184  VAL A CG2   1 
ATOM   1438 N N     . ASP A 1 185 ? 32.352  -27.173 -27.723 1.00 44.90  ? 185  ASP A N     1 
ATOM   1439 C CA    . ASP A 1 185 ? 33.566  -27.254 -26.927 1.00 43.62  ? 185  ASP A CA    1 
ATOM   1440 C C     . ASP A 1 185 ? 34.498  -26.061 -27.171 1.00 50.07  ? 185  ASP A C     1 
ATOM   1441 O O     . ASP A 1 185 ? 35.567  -25.966 -26.566 1.00 51.90  ? 185  ASP A O     1 
ATOM   1442 C CB    . ASP A 1 185 ? 34.296  -28.544 -27.304 1.00 58.91  ? 185  ASP A CB    1 
ATOM   1443 C CG    . ASP A 1 185 ? 35.367  -28.924 -26.314 1.00 69.91  ? 185  ASP A CG    1 
ATOM   1444 O OD1   . ASP A 1 185 ? 35.327  -28.422 -25.173 1.00 75.04  ? 185  ASP A OD1   1 
ATOM   1445 O OD2   . ASP A 1 185 ? 36.245  -29.734 -26.675 1.00 70.26  ? 185  ASP A OD2   1 
ATOM   1446 N N     . ASN A 1 186 ? 34.103  -25.157 -28.063 1.00 45.50  ? 186  ASN A N     1 
ATOM   1447 C CA    . ASN A 1 186 ? 34.967  -24.034 -28.430 1.00 45.29  ? 186  ASN A CA    1 
ATOM   1448 C C     . ASN A 1 186 ? 34.959  -22.878 -27.427 1.00 44.89  ? 186  ASN A C     1 
ATOM   1449 O O     . ASN A 1 186 ? 34.187  -22.872 -26.466 1.00 48.36  ? 186  ASN A O     1 
ATOM   1450 C CB    . ASN A 1 186 ? 34.649  -23.535 -29.846 1.00 36.89  ? 186  ASN A CB    1 
ATOM   1451 C CG    . ASN A 1 186 ? 33.230  -23.024 -29.981 1.00 43.52  ? 186  ASN A CG    1 
ATOM   1452 O OD1   . ASN A 1 186 ? 32.665  -22.460 -29.041 1.00 41.12  ? 186  ASN A OD1   1 
ATOM   1453 N ND2   . ASN A 1 186 ? 32.642  -23.219 -31.156 1.00 42.66  ? 186  ASN A ND2   1 
ATOM   1454 N N     . ALA A 1 187 ? 35.828  -21.902 -27.661 1.00 40.32  ? 187  ALA A N     1 
ATOM   1455 C CA    . ALA A 1 187 ? 35.979  -20.776 -26.752 1.00 43.49  ? 187  ALA A CA    1 
ATOM   1456 C C     . ALA A 1 187 ? 34.675  -20.007 -26.551 1.00 44.40  ? 187  ALA A C     1 
ATOM   1457 O O     . ALA A 1 187 ? 34.384  -19.551 -25.446 1.00 45.84  ? 187  ALA A O     1 
ATOM   1458 C CB    . ALA A 1 187 ? 37.077  -19.848 -27.245 1.00 47.50  ? 187  ALA A CB    1 
ATOM   1459 N N     . GLY A 1 188 ? 33.896  -19.864 -27.620 1.00 43.91  ? 188  GLY A N     1 
ATOM   1460 C CA    . GLY A 1 188 ? 32.630  -19.154 -27.557 1.00 43.55  ? 188  GLY A CA    1 
ATOM   1461 C C     . GLY A 1 188 ? 31.599  -19.871 -26.697 1.00 41.39  ? 188  GLY A C     1 
ATOM   1462 O O     . GLY A 1 188 ? 30.867  -19.251 -25.929 1.00 45.74  ? 188  GLY A O     1 
ATOM   1463 N N     . ALA A 1 189 ? 31.534  -21.187 -26.842 1.00 40.74  ? 189  ALA A N     1 
ATOM   1464 C CA    . ALA A 1 189 ? 30.656  -22.004 -26.021 1.00 38.83  ? 189  ALA A CA    1 
ATOM   1465 C C     . ALA A 1 189 ? 31.050  -21.859 -24.556 1.00 35.38  ? 189  ALA A C     1 
ATOM   1466 O O     . ALA A 1 189 ? 30.200  -21.627 -23.691 1.00 33.14  ? 189  ALA A O     1 
ATOM   1467 C CB    . ALA A 1 189 ? 30.740  -23.451 -26.446 1.00 29.81  ? 189  ALA A CB    1 
ATOM   1468 N N     . LYS A 1 190 ? 32.347  -21.972 -24.287 1.00 33.92  ? 190  LYS A N     1 
ATOM   1469 C CA    . LYS A 1 190 ? 32.840  -21.901 -22.915 1.00 43.30  ? 190  LYS A CA    1 
ATOM   1470 C C     . LYS A 1 190 ? 32.558  -20.533 -22.306 1.00 43.77  ? 190  LYS A C     1 
ATOM   1471 O O     . LYS A 1 190 ? 32.159  -20.434 -21.150 1.00 45.25  ? 190  LYS A O     1 
ATOM   1472 C CB    . LYS A 1 190 ? 34.338  -22.217 -22.850 1.00 39.71  ? 190  LYS A CB    1 
ATOM   1473 C CG    . LYS A 1 190 ? 34.702  -23.654 -23.198 1.00 39.46  ? 190  LYS A CG    1 
ATOM   1474 C CD    . LYS A 1 190 ? 36.215  -23.815 -23.238 1.00 50.80  ? 190  LYS A CD    1 
ATOM   1475 C CE    . LYS A 1 190 ? 36.645  -25.237 -23.570 1.00 60.75  ? 190  LYS A CE    1 
ATOM   1476 N NZ    . LYS A 1 190 ? 38.134  -25.341 -23.678 1.00 61.71  ? 190  LYS A NZ    1 
ATOM   1477 N N     . ALA A 1 191 ? 32.757  -19.483 -23.093 1.00 44.81  ? 191  ALA A N     1 
ATOM   1478 C CA    . ALA A 1 191 ? 32.530  -18.127 -22.612 1.00 44.98  ? 191  ALA A CA    1 
ATOM   1479 C C     . ALA A 1 191 ? 31.081  -17.917 -22.181 1.00 41.55  ? 191  ALA A C     1 
ATOM   1480 O O     . ALA A 1 191 ? 30.820  -17.314 -21.147 1.00 44.02  ? 191  ALA A O     1 
ATOM   1481 C CB    . ALA A 1 191 ? 32.930  -17.106 -23.673 1.00 48.23  ? 191  ALA A CB    1 
ATOM   1482 N N     . GLY A 1 192 ? 30.143  -18.417 -22.978 1.00 42.84  ? 192  GLY A N     1 
ATOM   1483 C CA    . GLY A 1 192 ? 28.728  -18.241 -22.697 1.00 37.52  ? 192  GLY A CA    1 
ATOM   1484 C C     . GLY A 1 192 ? 28.239  -19.070 -21.523 1.00 38.40  ? 192  GLY A C     1 
ATOM   1485 O O     . GLY A 1 192 ? 27.503  -18.580 -20.666 1.00 34.81  ? 192  GLY A O     1 
ATOM   1486 N N     . LEU A 1 193 ? 28.644  -20.335 -21.483 1.00 38.48  ? 193  LEU A N     1 
ATOM   1487 C CA    . LEU A 1 193 ? 28.279  -21.205 -20.372 1.00 32.91  ? 193  LEU A CA    1 
ATOM   1488 C C     . LEU A 1 193 ? 28.878  -20.685 -19.060 1.00 38.23  ? 193  LEU A C     1 
ATOM   1489 O O     . LEU A 1 193 ? 28.231  -20.734 -18.006 1.00 33.27  ? 193  LEU A O     1 
ATOM   1490 C CB    . LEU A 1 193 ? 28.712  -22.647 -20.646 1.00 33.33  ? 193  LEU A CB    1 
ATOM   1491 C CG    . LEU A 1 193 ? 28.218  -23.676 -19.630 1.00 34.37  ? 193  LEU A CG    1 
ATOM   1492 C CD1   . LEU A 1 193 ? 26.746  -23.453 -19.342 1.00 29.54  ? 193  LEU A CD1   1 
ATOM   1493 C CD2   . LEU A 1 193 ? 28.471  -25.091 -20.135 1.00 34.48  ? 193  LEU A CD2   1 
ATOM   1494 N N     . THR A 1 194 ? 30.101  -20.164 -19.137 1.00 39.04  ? 194  THR A N     1 
ATOM   1495 C CA    . THR A 1 194 ? 30.755  -19.573 -17.974 1.00 37.42  ? 194  THR A CA    1 
ATOM   1496 C C     . THR A 1 194 ? 29.953  -18.383 -17.461 1.00 41.40  ? 194  THR A C     1 
ATOM   1497 O O     . THR A 1 194 ? 29.839  -18.173 -16.246 1.00 38.56  ? 194  THR A O     1 
ATOM   1498 C CB    . THR A 1 194 ? 32.191  -19.116 -18.291 1.00 41.61  ? 194  THR A CB    1 
ATOM   1499 O OG1   . THR A 1 194 ? 33.005  -20.257 -18.585 1.00 45.63  ? 194  THR A OG1   1 
ATOM   1500 C CG2   . THR A 1 194 ? 32.794  -18.388 -17.103 1.00 44.81  ? 194  THR A CG2   1 
ATOM   1501 N N     . PHE A 1 195 ? 29.389  -17.601 -18.379 1.00 34.19  ? 195  PHE A N     1 
ATOM   1502 C CA    . PHE A 1 195 ? 28.586  -16.464 -17.962 1.00 34.08  ? 195  PHE A CA    1 
ATOM   1503 C C     . PHE A 1 195 ? 27.328  -16.926 -17.226 1.00 39.38  ? 195  PHE A C     1 
ATOM   1504 O O     . PHE A 1 195 ? 26.973  -16.386 -16.178 1.00 42.71  ? 195  PHE A O     1 
ATOM   1505 C CB    . PHE A 1 195 ? 28.223  -15.555 -19.134 1.00 36.01  ? 195  PHE A CB    1 
ATOM   1506 C CG    . PHE A 1 195 ? 27.624  -14.254 -18.701 1.00 38.57  ? 195  PHE A CG    1 
ATOM   1507 C CD1   . PHE A 1 195 ? 28.434  -13.220 -18.260 1.00 41.88  ? 195  PHE A CD1   1 
ATOM   1508 C CD2   . PHE A 1 195 ? 26.251  -14.078 -18.685 1.00 32.23  ? 195  PHE A CD2   1 
ATOM   1509 C CE1   . PHE A 1 195 ? 27.887  -12.024 -17.828 1.00 38.49  ? 195  PHE A CE1   1 
ATOM   1510 C CE2   . PHE A 1 195 ? 25.695  -12.884 -18.256 1.00 30.92  ? 195  PHE A CE2   1 
ATOM   1511 C CZ    . PHE A 1 195 ? 26.516  -11.855 -17.828 1.00 36.13  ? 195  PHE A CZ    1 
ATOM   1512 N N     . LEU A 1 196 ? 26.667  -17.934 -17.784 1.00 33.80  ? 196  LEU A N     1 
ATOM   1513 C CA    . LEU A 1 196 ? 25.473  -18.521 -17.188 1.00 36.46  ? 196  LEU A CA    1 
ATOM   1514 C C     . LEU A 1 196 ? 25.770  -19.065 -15.794 1.00 40.52  ? 196  LEU A C     1 
ATOM   1515 O O     . LEU A 1 196 ? 25.002  -18.861 -14.852 1.00 40.10  ? 196  LEU A O     1 
ATOM   1516 C CB    . LEU A 1 196 ? 24.970  -19.670 -18.066 1.00 37.17  ? 196  LEU A CB    1 
ATOM   1517 C CG    . LEU A 1 196 ? 23.653  -20.315 -17.645 1.00 43.31  ? 196  LEU A CG    1 
ATOM   1518 C CD1   . LEU A 1 196 ? 22.500  -19.589 -18.303 1.00 37.83  ? 196  LEU A CD1   1 
ATOM   1519 C CD2   . LEU A 1 196 ? 23.637  -21.782 -18.015 1.00 51.66  ? 196  LEU A CD2   1 
ATOM   1520 N N     . VAL A 1 197 ? 26.889  -19.771 -15.680 1.00 39.25  ? 197  VAL A N     1 
ATOM   1521 C CA    . VAL A 1 197 ? 27.294  -20.367 -14.421 1.00 37.12  ? 197  VAL A CA    1 
ATOM   1522 C C     . VAL A 1 197 ? 27.617  -19.294 -13.371 1.00 40.39  ? 197  VAL A C     1 
ATOM   1523 O O     . VAL A 1 197 ? 27.304  -19.465 -12.202 1.00 38.43  ? 197  VAL A O     1 
ATOM   1524 C CB    . VAL A 1 197 ? 28.479  -21.335 -14.613 1.00 32.71  ? 197  VAL A CB    1 
ATOM   1525 C CG1   . VAL A 1 197 ? 29.005  -21.817 -13.266 1.00 30.61  ? 197  VAL A CG1   1 
ATOM   1526 C CG2   . VAL A 1 197 ? 28.050  -22.523 -15.461 1.00 31.77  ? 197  VAL A CG2   1 
ATOM   1527 N N     . ASP A 1 198 ? 28.224  -18.189 -13.794 1.00 42.95  ? 198  ASP A N     1 
ATOM   1528 C CA    . ASP A 1 198 ? 28.514  -17.082 -12.877 1.00 36.22  ? 198  ASP A CA    1 
ATOM   1529 C C     . ASP A 1 198 ? 27.239  -16.383 -12.402 1.00 33.50  ? 198  ASP A C     1 
ATOM   1530 O O     . ASP A 1 198 ? 27.158  -15.953 -11.256 1.00 40.43  ? 198  ASP A O     1 
ATOM   1531 C CB    . ASP A 1 198 ? 29.479  -16.074 -13.508 1.00 34.23  ? 198  ASP A CB    1 
ATOM   1532 C CG    . ASP A 1 198 ? 30.884  -16.629 -13.656 1.00 41.40  ? 198  ASP A CG    1 
ATOM   1533 O OD1   . ASP A 1 198 ? 31.167  -17.707 -13.090 1.00 48.43  ? 198  ASP A OD1   1 
ATOM   1534 O OD2   . ASP A 1 198 ? 31.710  -15.984 -14.331 1.00 44.50  ? 198  ASP A OD2   1 
ATOM   1535 N N     . LEU A 1 199 ? 26.241  -16.276 -13.273 1.00 36.69  ? 199  LEU A N     1 
ATOM   1536 C CA    . LEU A 1 199 ? 24.942  -15.764 -12.850 1.00 36.78  ? 199  LEU A CA    1 
ATOM   1537 C C     . LEU A 1 199 ? 24.421  -16.619 -11.699 1.00 39.91  ? 199  LEU A C     1 
ATOM   1538 O O     . LEU A 1 199 ? 23.849  -16.118 -10.727 1.00 36.54  ? 199  LEU A O     1 
ATOM   1539 C CB    . LEU A 1 199 ? 23.943  -15.788 -14.010 1.00 36.05  ? 199  LEU A CB    1 
ATOM   1540 C CG    . LEU A 1 199 ? 24.075  -14.691 -15.079 1.00 37.09  ? 199  LEU A CG    1 
ATOM   1541 C CD1   . LEU A 1 199 ? 23.158  -14.950 -16.255 1.00 38.73  ? 199  LEU A CD1   1 
ATOM   1542 C CD2   . LEU A 1 199 ? 23.774  -13.335 -14.481 1.00 32.55  ? 199  LEU A CD2   1 
ATOM   1543 N N     . ILE A 1 200 ? 24.622  -17.925 -11.820 1.00 38.43  ? 200  ILE A N     1 
ATOM   1544 C CA    . ILE A 1 200 ? 24.144  -18.858 -10.815 1.00 36.40  ? 200  ILE A CA    1 
ATOM   1545 C C     . ILE A 1 200 ? 24.998  -18.797 -9.550  1.00 35.21  ? 200  ILE A C     1 
ATOM   1546 O O     . ILE A 1 200 ? 24.470  -18.758 -8.443  1.00 37.87  ? 200  ILE A O     1 
ATOM   1547 C CB    . ILE A 1 200 ? 24.087  -20.288 -11.376 1.00 34.22  ? 200  ILE A CB    1 
ATOM   1548 C CG1   . ILE A 1 200 ? 23.036  -20.356 -12.484 1.00 31.99  ? 200  ILE A CG1   1 
ATOM   1549 C CG2   . ILE A 1 200 ? 23.786  -21.295 -10.260 1.00 26.37  ? 200  ILE A CG2   1 
ATOM   1550 C CD1   . ILE A 1 200 ? 23.091  -21.622 -13.324 1.00 34.05  ? 200  ILE A CD1   1 
ATOM   1551 N N     . LYS A 1 201 ? 26.315  -18.763 -9.721  1.00 36.15  ? 201  LYS A N     1 
ATOM   1552 C CA    . LYS A 1 201 ? 27.230  -18.664 -8.591  1.00 38.43  ? 201  LYS A CA    1 
ATOM   1553 C C     . LYS A 1 201 ? 26.952  -17.424 -7.743  1.00 45.60  ? 201  LYS A C     1 
ATOM   1554 O O     . LYS A 1 201 ? 26.965  -17.491 -6.515  1.00 47.87  ? 201  LYS A O     1 
ATOM   1555 C CB    . LYS A 1 201 ? 28.681  -18.649 -9.072  1.00 44.20  ? 201  LYS A CB    1 
ATOM   1556 C CG    . LYS A 1 201 ? 29.153  -19.960 -9.674  1.00 55.45  ? 201  LYS A CG    1 
ATOM   1557 C CD    . LYS A 1 201 ? 30.655  -19.944 -9.934  1.00 62.25  ? 201  LYS A CD    1 
ATOM   1558 C CE    . LYS A 1 201 ? 31.179  -21.350 -10.210 1.00 59.17  ? 201  LYS A CE    1 
ATOM   1559 N NZ    . LYS A 1 201 ? 32.641  -21.358 -10.490 1.00 58.49  ? 201  LYS A NZ    1 
ATOM   1560 N N     . ASN A 1 202 ? 26.709  -16.292 -8.398  1.00 43.04  ? 202  ASN A N     1 
ATOM   1561 C CA    . ASN A 1 202 ? 26.434  -15.052 -7.680  1.00 39.14  ? 202  ASN A CA    1 
ATOM   1562 C C     . ASN A 1 202 ? 24.963  -14.923 -7.312  1.00 40.03  ? 202  ASN A C     1 
ATOM   1563 O O     . ASN A 1 202 ? 24.504  -13.846 -6.942  1.00 39.50  ? 202  ASN A O     1 
ATOM   1564 C CB    . ASN A 1 202 ? 26.864  -13.845 -8.504  1.00 39.92  ? 202  ASN A CB    1 
ATOM   1565 C CG    . ASN A 1 202 ? 28.319  -13.901 -8.898  1.00 39.36  ? 202  ASN A CG    1 
ATOM   1566 O OD1   . ASN A 1 202 ? 28.676  -13.618 -10.044 1.00 39.57  ? 202  ASN A OD1   1 
ATOM   1567 N ND2   . ASN A 1 202 ? 29.170  -14.279 -7.953  1.00 36.55  ? 202  ASN A ND2   1 
ATOM   1568 N N     . LYS A 1 203 ? 24.228  -16.023 -7.443  1.00 39.08  ? 203  LYS A N     1 
ATOM   1569 C CA    . LYS A 1 203 ? 22.839  -16.090 -6.997  1.00 40.49  ? 203  LYS A CA    1 
ATOM   1570 C C     . LYS A 1 203 ? 21.861  -15.198 -7.772  1.00 38.17  ? 203  LYS A C     1 
ATOM   1571 O O     . LYS A 1 203 ? 20.763  -14.917 -7.297  1.00 45.26  ? 203  LYS A O     1 
ATOM   1572 C CB    . LYS A 1 203 ? 22.736  -15.797 -5.493  1.00 41.32  ? 203  LYS A CB    1 
ATOM   1573 C CG    . LYS A 1 203 ? 22.921  -17.016 -4.599  1.00 49.02  ? 203  LYS A CG    1 
ATOM   1574 C CD    . LYS A 1 203 ? 24.312  -17.606 -4.708  1.00 50.83  ? 203  LYS A CD    1 
ATOM   1575 C CE    . LYS A 1 203 ? 24.479  -18.793 -3.762  1.00 53.35  ? 203  LYS A CE    1 
ATOM   1576 N NZ    . LYS A 1 203 ? 24.379  -18.377 -2.336  1.00 54.13  ? 203  LYS A NZ    1 
ATOM   1577 N N     . HIS A 1 204 ? 22.239  -14.763 -8.966  1.00 36.08  ? 204  HIS A N     1 
ATOM   1578 C CA    . HIS A 1 204 ? 21.277  -14.055 -9.805  1.00 35.95  ? 204  HIS A CA    1 
ATOM   1579 C C     . HIS A 1 204 ? 20.268  -15.039 -10.413 1.00 42.69  ? 204  HIS A C     1 
ATOM   1580 O O     . HIS A 1 204 ? 19.152  -14.655 -10.768 1.00 44.33  ? 204  HIS A O     1 
ATOM   1581 C CB    . HIS A 1 204 ? 21.985  -13.222 -10.870 1.00 31.38  ? 204  HIS A CB    1 
ATOM   1582 C CG    . HIS A 1 204 ? 23.026  -12.304 -10.313 1.00 32.84  ? 204  HIS A CG    1 
ATOM   1583 N ND1   . HIS A 1 204 ? 22.745  -11.357 -9.349  1.00 36.15  ? 204  HIS A ND1   1 
ATOM   1584 C CD2   . HIS A 1 204 ? 24.348  -12.192 -10.577 1.00 36.93  ? 204  HIS A CD2   1 
ATOM   1585 C CE1   . HIS A 1 204 ? 23.851  -10.701 -9.045  1.00 36.12  ? 204  HIS A CE1   1 
ATOM   1586 N NE2   . HIS A 1 204 ? 24.837  -11.184 -9.781  1.00 41.14  ? 204  HIS A NE2   1 
ATOM   1587 N N     . MET A 1 205 ? 20.663  -16.310 -10.504 1.00 37.10  ? 205  MET A N     1 
ATOM   1588 C CA    . MET A 1 205 ? 19.750  -17.388 -10.889 1.00 34.59  ? 205  MET A CA    1 
ATOM   1589 C C     . MET A 1 205 ? 20.042  -18.641 -10.069 1.00 37.93  ? 205  MET A C     1 
ATOM   1590 O O     . MET A 1 205 ? 21.054  -18.717 -9.378  1.00 36.57  ? 205  MET A O     1 
ATOM   1591 C CB    . MET A 1 205 ? 19.870  -17.723 -12.383 1.00 33.59  ? 205  MET A CB    1 
ATOM   1592 C CG    . MET A 1 205 ? 19.430  -16.613 -13.329 1.00 37.71  ? 205  MET A CG    1 
ATOM   1593 S SD    . MET A 1 205 ? 19.286  -17.165 -15.048 1.00 40.15  ? 205  MET A SD    1 
ATOM   1594 C CE    . MET A 1 205 ? 20.918  -17.819 -15.348 1.00 27.44  ? 205  MET A CE    1 
ATOM   1595 N N     . ASN A 1 206 ? 19.162  -19.631 -10.172 1.00 40.29  ? 206  ASN A N     1 
ATOM   1596 C CA    . ASN A 1 206 ? 19.316  -20.883 -9.444  1.00 40.79  ? 206  ASN A CA    1 
ATOM   1597 C C     . ASN A 1 206 ? 19.336  -22.069 -10.406 1.00 36.40  ? 206  ASN A C     1 
ATOM   1598 O O     . ASN A 1 206 ? 18.467  -22.181 -11.262 1.00 36.81  ? 206  ASN A O     1 
ATOM   1599 C CB    . ASN A 1 206 ? 18.187  -21.045 -8.422  1.00 31.35  ? 206  ASN A CB    1 
ATOM   1600 C CG    . ASN A 1 206 ? 18.370  -22.267 -7.528  1.00 40.49  ? 206  ASN A CG    1 
ATOM   1601 O OD1   . ASN A 1 206 ? 18.110  -23.402 -7.941  1.00 35.29  ? 206  ASN A OD1   1 
ATOM   1602 N ND2   . ASN A 1 206 ? 18.802  -22.036 -6.288  1.00 33.06  ? 206  ASN A ND2   1 
ATOM   1603 N N     . ALA A 1 207 ? 20.322  -22.951 -10.242 1.00 32.65  ? 207  ALA A N     1 
ATOM   1604 C CA    . ALA A 1 207 ? 20.510  -24.111 -11.111 1.00 33.86  ? 207  ALA A CA    1 
ATOM   1605 C C     . ALA A 1 207 ? 19.250  -24.958 -11.328 1.00 41.52  ? 207  ALA A C     1 
ATOM   1606 O O     . ALA A 1 207 ? 19.087  -25.565 -12.383 1.00 36.50  ? 207  ALA A O     1 
ATOM   1607 C CB    . ALA A 1 207 ? 21.643  -24.990 -10.576 1.00 26.54  ? 207  ALA A CB    1 
ATOM   1608 N N     . ASP A 1 208 ? 18.369  -25.006 -10.333 1.00 37.05  ? 208  ASP A N     1 
ATOM   1609 C CA    . ASP A 1 208 ? 17.236  -25.934 -10.372 1.00 31.00  ? 208  ASP A CA    1 
ATOM   1610 C C     . ASP A 1 208 ? 15.966  -25.334 -10.955 1.00 33.35  ? 208  ASP A C     1 
ATOM   1611 O O     . ASP A 1 208 ? 14.942  -26.004 -11.036 1.00 38.86  ? 208  ASP A O     1 
ATOM   1612 C CB    . ASP A 1 208 ? 16.938  -26.506 -8.977  1.00 32.52  ? 208  ASP A CB    1 
ATOM   1613 C CG    . ASP A 1 208 ? 18.080  -27.350 -8.433  1.00 40.89  ? 208  ASP A CG    1 
ATOM   1614 O OD1   . ASP A 1 208 ? 18.406  -28.386 -9.043  1.00 44.19  ? 208  ASP A OD1   1 
ATOM   1615 O OD2   . ASP A 1 208 ? 18.653  -26.978 -7.393  1.00 51.30  ? 208  ASP A OD2   1 
ATOM   1616 N N     . THR A 1 209 ? 16.028  -24.073 -11.356 1.00 32.99  ? 209  THR A N     1 
ATOM   1617 C CA    . THR A 1 209 ? 14.878  -23.426 -11.977 1.00 38.50  ? 209  THR A CA    1 
ATOM   1618 C C     . THR A 1 209 ? 14.465  -24.162 -13.255 1.00 34.05  ? 209  THR A C     1 
ATOM   1619 O O     . THR A 1 209 ? 15.288  -24.402 -14.131 1.00 31.80  ? 209  THR A O     1 
ATOM   1620 C CB    . THR A 1 209 ? 15.189  -21.960 -12.322 1.00 35.84  ? 209  THR A CB    1 
ATOM   1621 O OG1   . THR A 1 209 ? 15.318  -21.205 -11.112 1.00 37.44  ? 209  THR A OG1   1 
ATOM   1622 C CG2   . THR A 1 209 ? 14.079  -21.357 -13.188 1.00 34.91  ? 209  THR A CG2   1 
ATOM   1623 N N     . ASP A 1 210 ? 13.187  -24.513 -13.352 1.00 28.14  ? 210  ASP A N     1 
ATOM   1624 C CA    . ASP A 1 210 ? 12.671  -25.203 -14.527 1.00 27.79  ? 210  ASP A CA    1 
ATOM   1625 C C     . ASP A 1 210 ? 11.590  -24.375 -15.222 1.00 37.93  ? 210  ASP A C     1 
ATOM   1626 O O     . ASP A 1 210 ? 11.410  -23.195 -14.921 1.00 41.71  ? 210  ASP A O     1 
ATOM   1627 C CB    . ASP A 1 210 ? 12.129  -26.588 -14.145 1.00 31.10  ? 210  ASP A CB    1 
ATOM   1628 C CG    . ASP A 1 210 ? 11.021  -26.517 -13.112 1.00 37.56  ? 210  ASP A CG    1 
ATOM   1629 O OD1   . ASP A 1 210 ? 10.464  -25.418 -12.906 1.00 39.30  ? 210  ASP A OD1   1 
ATOM   1630 O OD2   . ASP A 1 210 ? 10.701  -27.567 -12.511 1.00 42.91  ? 210  ASP A OD2   1 
ATOM   1631 N N     . TYR A 1 211 ? 10.864  -24.997 -16.143 1.00 37.28  ? 211  TYR A N     1 
ATOM   1632 C CA    . TYR A 1 211 ? 9.866   -24.285 -16.932 1.00 30.87  ? 211  TYR A CA    1 
ATOM   1633 C C     . TYR A 1 211 ? 8.728   -23.723 -16.076 1.00 38.18  ? 211  TYR A C     1 
ATOM   1634 O O     . TYR A 1 211 ? 8.388   -22.542 -16.186 1.00 42.18  ? 211  TYR A O     1 
ATOM   1635 C CB    . TYR A 1 211 ? 9.310   -25.181 -18.045 1.00 30.01  ? 211  TYR A CB    1 
ATOM   1636 C CG    . TYR A 1 211 ? 8.478   -24.417 -19.049 1.00 34.16  ? 211  TYR A CG    1 
ATOM   1637 C CD1   . TYR A 1 211 ? 7.143   -24.133 -18.797 1.00 34.23  ? 211  TYR A CD1   1 
ATOM   1638 C CD2   . TYR A 1 211 ? 9.036   -23.958 -20.240 1.00 34.43  ? 211  TYR A CD2   1 
ATOM   1639 C CE1   . TYR A 1 211 ? 6.379   -23.431 -19.710 1.00 38.24  ? 211  TYR A CE1   1 
ATOM   1640 C CE2   . TYR A 1 211 ? 8.280   -23.252 -21.162 1.00 30.34  ? 211  TYR A CE2   1 
ATOM   1641 C CZ    . TYR A 1 211 ? 6.953   -22.993 -20.891 1.00 37.28  ? 211  TYR A CZ    1 
ATOM   1642 O OH    . TYR A 1 211 ? 6.192   -22.287 -21.789 1.00 35.81  ? 211  TYR A OH    1 
ATOM   1643 N N     . SER A 1 212 ? 8.149   -24.571 -15.228 1.00 33.67  ? 212  SER A N     1 
ATOM   1644 C CA    . SER A 1 212 ? 7.039   -24.178 -14.358 1.00 36.45  ? 212  SER A CA    1 
ATOM   1645 C C     . SER A 1 212 ? 7.416   -23.066 -13.408 1.00 32.12  ? 212  SER A C     1 
ATOM   1646 O O     . SER A 1 212 ? 6.654   -22.120 -13.209 1.00 37.84  ? 212  SER A O     1 
ATOM   1647 C CB    . SER A 1 212 ? 6.551   -25.368 -13.517 1.00 39.88  ? 212  SER A CB    1 
ATOM   1648 O OG    . SER A 1 212 ? 5.787   -26.261 -14.299 1.00 55.85  ? 212  SER A OG    1 
ATOM   1649 N N     . ILE A 1 213 ? 8.584   -23.206 -12.793 1.00 31.44  ? 213  ILE A N     1 
ATOM   1650 C CA    . ILE A 1 213 ? 9.047   -22.233 -11.818 1.00 31.79  ? 213  ILE A CA    1 
ATOM   1651 C C     . ILE A 1 213 ? 9.269   -20.861 -12.459 1.00 36.61  ? 213  ILE A C     1 
ATOM   1652 O O     . ILE A 1 213 ? 8.792   -19.849 -11.948 1.00 38.54  ? 213  ILE A O     1 
ATOM   1653 C CB    . ILE A 1 213 ? 10.318  -22.723 -11.100 1.00 34.66  ? 213  ILE A CB    1 
ATOM   1654 C CG1   . ILE A 1 213 ? 9.966   -23.893 -10.177 1.00 37.45  ? 213  ILE A CG1   1 
ATOM   1655 C CG2   . ILE A 1 213 ? 10.942  -21.593 -10.294 1.00 34.36  ? 213  ILE A CG2   1 
ATOM   1656 C CD1   . ILE A 1 213 ? 11.166  -24.634 -9.636  1.00 32.42  ? 213  ILE A CD1   1 
ATOM   1657 N N     . ALA A 1 214 ? 9.971   -20.829 -13.588 1.00 32.34  ? 214  ALA A N     1 
ATOM   1658 C CA    . ALA A 1 214 ? 10.209  -19.564 -14.281 1.00 30.62  ? 214  ALA A CA    1 
ATOM   1659 C C     . ALA A 1 214 ? 8.894   -18.941 -14.743 1.00 31.18  ? 214  ALA A C     1 
ATOM   1660 O O     . ALA A 1 214 ? 8.698   -17.742 -14.594 1.00 34.44  ? 214  ALA A O     1 
ATOM   1661 C CB    . ALA A 1 214 ? 11.168  -19.745 -15.449 1.00 28.29  ? 214  ALA A CB    1 
ATOM   1662 N N     . GLU A 1 215 ? 7.981   -19.756 -15.268 1.00 34.29  ? 215  GLU A N     1 
ATOM   1663 C CA    . GLU A 1 215 ? 6.710   -19.229 -15.758 1.00 37.32  ? 215  GLU A CA    1 
ATOM   1664 C C     . GLU A 1 215 ? 5.864   -18.592 -14.655 1.00 37.90  ? 215  GLU A C     1 
ATOM   1665 O O     . GLU A 1 215 ? 5.312   -17.506 -14.842 1.00 34.60  ? 215  GLU A O     1 
ATOM   1666 C CB    . GLU A 1 215 ? 5.891   -20.311 -16.470 1.00 34.46  ? 215  GLU A CB    1 
ATOM   1667 C CG    . GLU A 1 215 ? 4.577   -19.788 -17.052 1.00 34.78  ? 215  GLU A CG    1 
ATOM   1668 C CD    . GLU A 1 215 ? 3.811   -20.856 -17.824 1.00 42.36  ? 215  GLU A CD    1 
ATOM   1669 O OE1   . GLU A 1 215 ? 3.810   -22.013 -17.373 1.00 42.97  ? 215  GLU A OE1   1 
ATOM   1670 O OE2   . GLU A 1 215 ? 3.219   -20.546 -18.884 1.00 43.03  ? 215  GLU A OE2   1 
ATOM   1671 N N     . ALA A 1 216 ? 5.735   -19.285 -13.525 1.00 27.61  ? 216  ALA A N     1 
ATOM   1672 C CA    . ALA A 1 216 ? 4.930   -18.783 -12.416 1.00 36.15  ? 216  ALA A CA    1 
ATOM   1673 C C     . ALA A 1 216 ? 5.537   -17.505 -11.847 1.00 37.51  ? 216  ALA A C     1 
ATOM   1674 O O     . ALA A 1 216 ? 4.824   -16.558 -11.534 1.00 39.94  ? 216  ALA A O     1 
ATOM   1675 C CB    . ALA A 1 216 ? 4.787   -19.851 -11.319 1.00 32.11  ? 216  ALA A CB    1 
ATOM   1676 N N     . ALA A 1 217 ? 6.860   -17.486 -11.723 1.00 38.18  ? 217  ALA A N     1 
ATOM   1677 C CA    . ALA A 1 217 ? 7.567   -16.304 -11.256 1.00 30.88  ? 217  ALA A CA    1 
ATOM   1678 C C     . ALA A 1 217 ? 7.292   -15.097 -12.161 1.00 35.74  ? 217  ALA A C     1 
ATOM   1679 O O     . ALA A 1 217 ? 6.930   -14.021 -11.676 1.00 37.92  ? 217  ALA A O     1 
ATOM   1680 C CB    . ALA A 1 217 ? 9.060   -16.578 -11.170 1.00 26.36  ? 217  ALA A CB    1 
ATOM   1681 N N     . PHE A 1 218 ? 7.453   -15.264 -13.473 1.00 35.00  ? 218  PHE A N     1 
ATOM   1682 C CA    . PHE A 1 218 ? 7.198   -14.136 -14.363 1.00 39.79  ? 218  PHE A CA    1 
ATOM   1683 C C     . PHE A 1 218 ? 5.723   -13.765 -14.390 1.00 42.01  ? 218  PHE A C     1 
ATOM   1684 O O     . PHE A 1 218 ? 5.376   -12.588 -14.355 1.00 37.79  ? 218  PHE A O     1 
ATOM   1685 C CB    . PHE A 1 218 ? 7.695   -14.362 -15.789 1.00 40.46  ? 218  PHE A CB    1 
ATOM   1686 C CG    . PHE A 1 218 ? 7.587   -13.128 -16.652 1.00 38.53  ? 218  PHE A CG    1 
ATOM   1687 C CD1   . PHE A 1 218 ? 8.617   -12.197 -16.687 1.00 34.82  ? 218  PHE A CD1   1 
ATOM   1688 C CD2   . PHE A 1 218 ? 6.436   -12.872 -17.383 1.00 37.04  ? 218  PHE A CD2   1 
ATOM   1689 C CE1   . PHE A 1 218 ? 8.512   -11.035 -17.466 1.00 33.33  ? 218  PHE A CE1   1 
ATOM   1690 C CE2   . PHE A 1 218 ? 6.322   -11.719 -18.160 1.00 38.53  ? 218  PHE A CE2   1 
ATOM   1691 C CZ    . PHE A 1 218 ? 7.365   -10.799 -18.202 1.00 30.41  ? 218  PHE A CZ    1 
ATOM   1692 N N     . ASN A 1 219 ? 4.853   -14.767 -14.442 1.00 37.29  ? 219  ASN A N     1 
ATOM   1693 C CA    . ASN A 1 219 ? 3.430   -14.490 -14.573 1.00 41.74  ? 219  ASN A CA    1 
ATOM   1694 C C     . ASN A 1 219 ? 2.807   -13.952 -13.274 1.00 48.91  ? 219  ASN A C     1 
ATOM   1695 O O     . ASN A 1 219 ? 1.676   -13.466 -13.275 1.00 50.42  ? 219  ASN A O     1 
ATOM   1696 C CB    . ASN A 1 219 ? 2.670   -15.711 -15.123 1.00 37.22  ? 219  ASN A CB    1 
ATOM   1697 C CG    . ASN A 1 219 ? 3.119   -16.105 -16.544 1.00 37.42  ? 219  ASN A CG    1 
ATOM   1698 O OD1   . ASN A 1 219 ? 2.569   -17.029 -17.146 1.00 40.96  ? 219  ASN A OD1   1 
ATOM   1699 N ND2   . ASN A 1 219 ? 4.123   -15.415 -17.068 1.00 34.10  ? 219  ASN A ND2   1 
ATOM   1700 N N     . LYS A 1 220 ? 3.555   -14.011 -12.176 1.00 49.00  ? 220  LYS A N     1 
ATOM   1701 C CA    . LYS A 1 220 ? 3.080   -13.463 -10.902 1.00 47.68  ? 220  LYS A CA    1 
ATOM   1702 C C     . LYS A 1 220 ? 3.778   -12.152 -10.535 1.00 46.65  ? 220  LYS A C     1 
ATOM   1703 O O     . LYS A 1 220 ? 3.554   -11.592 -9.459  1.00 50.23  ? 220  LYS A O     1 
ATOM   1704 C CB    . LYS A 1 220 ? 3.242   -14.485 -9.772  1.00 40.17  ? 220  LYS A CB    1 
ATOM   1705 C CG    . LYS A 1 220 ? 2.252   -15.632 -9.842  1.00 41.56  ? 220  LYS A CG    1 
ATOM   1706 C CD    . LYS A 1 220 ? 2.821   -16.914 -9.256  1.00 46.68  ? 220  LYS A CD    1 
ATOM   1707 C CE    . LYS A 1 220 ? 2.414   -17.112 -7.811  1.00 50.98  ? 220  LYS A CE    1 
ATOM   1708 N NZ    . LYS A 1 220 ? 2.876   -18.444 -7.327  1.00 51.98  ? 220  LYS A NZ    1 
ATOM   1709 N N     . GLY A 1 221 ? 4.638   -11.682 -11.427 1.00 40.68  ? 221  GLY A N     1 
ATOM   1710 C CA    . GLY A 1 221 ? 5.309   -10.410 -11.241 1.00 38.09  ? 221  GLY A CA    1 
ATOM   1711 C C     . GLY A 1 221 ? 6.450   -10.454 -10.248 1.00 37.40  ? 221  GLY A C     1 
ATOM   1712 O O     . GLY A 1 221 ? 6.744   -9.459  -9.594  1.00 42.36  ? 221  GLY A O     1 
ATOM   1713 N N     . GLU A 1 222 ? 7.110   -11.600 -10.143 1.00 34.99  ? 222  GLU A N     1 
ATOM   1714 C CA    . GLU A 1 222 ? 8.198   -11.752 -9.185  1.00 39.20  ? 222  GLU A CA    1 
ATOM   1715 C C     . GLU A 1 222 ? 9.555   -11.513 -9.830  1.00 40.46  ? 222  GLU A C     1 
ATOM   1716 O O     . GLU A 1 222 ? 10.514  -11.146 -9.156  1.00 38.45  ? 222  GLU A O     1 
ATOM   1717 C CB    . GLU A 1 222 ? 8.166   -13.144 -8.556  1.00 33.86  ? 222  GLU A CB    1 
ATOM   1718 C CG    . GLU A 1 222 ? 6.822   -13.510 -7.944  1.00 40.76  ? 222  GLU A CG    1 
ATOM   1719 C CD    . GLU A 1 222 ? 6.799   -14.921 -7.379  1.00 39.31  ? 222  GLU A CD    1 
ATOM   1720 O OE1   . GLU A 1 222 ? 5.726   -15.363 -6.910  1.00 41.84  ? 222  GLU A OE1   1 
ATOM   1721 O OE2   . GLU A 1 222 ? 7.857   -15.584 -7.400  1.00 39.34  ? 222  GLU A OE2   1 
ATOM   1722 N N     . THR A 1 223 ? 9.640   -11.752 -11.132 1.00 36.19  ? 223  THR A N     1 
ATOM   1723 C CA    . THR A 1 223 ? 10.880  -11.536 -11.854 1.00 37.84  ? 223  THR A CA    1 
ATOM   1724 C C     . THR A 1 223 ? 10.612  -10.633 -13.052 1.00 36.87  ? 223  THR A C     1 
ATOM   1725 O O     . THR A 1 223 ? 9.523   -10.653 -13.620 1.00 39.80  ? 223  THR A O     1 
ATOM   1726 C CB    . THR A 1 223 ? 11.551  -12.868 -12.286 1.00 33.83  ? 223  THR A CB    1 
ATOM   1727 O OG1   . THR A 1 223 ? 12.858  -12.599 -12.815 1.00 32.38  ? 223  THR A OG1   1 
ATOM   1728 C CG2   . THR A 1 223 ? 10.715  -13.593 -13.335 1.00 26.89  ? 223  THR A CG2   1 
ATOM   1729 N N     . ALA A 1 224 ? 11.600  -9.826  -13.418 1.00 38.94  ? 224  ALA A N     1 
ATOM   1730 C CA    . ALA A 1 224 ? 11.414  -8.809  -14.452 1.00 39.97  ? 224  ALA A CA    1 
ATOM   1731 C C     . ALA A 1 224 ? 11.506  -9.369  -15.874 1.00 43.91  ? 224  ALA A C     1 
ATOM   1732 O O     . ALA A 1 224 ? 10.984  -8.774  -16.821 1.00 44.92  ? 224  ALA A O     1 
ATOM   1733 C CB    . ALA A 1 224 ? 12.414  -7.682  -14.263 1.00 35.26  ? 224  ALA A CB    1 
ATOM   1734 N N     . MET A 1 225 ? 12.169  -10.511 -16.023 1.00 38.15  ? 225  MET A N     1 
ATOM   1735 C CA    . MET A 1 225 ? 12.372  -11.096 -17.346 1.00 40.27  ? 225  MET A CA    1 
ATOM   1736 C C     . MET A 1 225 ? 12.300  -12.615 -17.344 1.00 39.86  ? 225  MET A C     1 
ATOM   1737 O O     . MET A 1 225 ? 12.605  -13.270 -16.350 1.00 40.11  ? 225  MET A O     1 
ATOM   1738 C CB    . MET A 1 225 ? 13.724  -10.675 -17.924 1.00 35.92  ? 225  MET A CB    1 
ATOM   1739 C CG    . MET A 1 225 ? 13.902  -9.176  -18.116 1.00 36.09  ? 225  MET A CG    1 
ATOM   1740 S SD    . MET A 1 225 ? 15.526  -8.812  -18.807 1.00 39.09  ? 225  MET A SD    1 
ATOM   1741 C CE    . MET A 1 225 ? 16.567  -8.985  -17.359 1.00 39.31  ? 225  MET A CE    1 
ATOM   1742 N N     . THR A 1 226 ? 11.898  -13.165 -18.480 1.00 39.77  ? 226  THR A N     1 
ATOM   1743 C CA    . THR A 1 226 ? 11.985  -14.593 -18.718 1.00 34.46  ? 226  THR A CA    1 
ATOM   1744 C C     . THR A 1 226 ? 12.367  -14.770 -20.180 1.00 44.82  ? 226  THR A C     1 
ATOM   1745 O O     . THR A 1 226 ? 12.312  -13.815 -20.965 1.00 46.17  ? 226  THR A O     1 
ATOM   1746 C CB    . THR A 1 226 ? 10.661  -15.315 -18.402 1.00 29.53  ? 226  THR A CB    1 
ATOM   1747 O OG1   . THR A 1 226 ? 10.840  -16.730 -18.504 1.00 37.02  ? 226  THR A OG1   1 
ATOM   1748 C CG2   . THR A 1 226 ? 9.559   -14.879 -19.351 1.00 29.17  ? 226  THR A CG2   1 
ATOM   1749 N N     . ILE A 1 227 ? 12.794  -15.978 -20.529 1.00 38.08  ? 227  ILE A N     1 
ATOM   1750 C CA    . ILE A 1 227 ? 13.099  -16.319 -21.907 1.00 36.37  ? 227  ILE A CA    1 
ATOM   1751 C C     . ILE A 1 227 ? 12.174  -17.454 -22.305 1.00 35.52  ? 227  ILE A C     1 
ATOM   1752 O O     . ILE A 1 227 ? 12.098  -18.465 -21.625 1.00 36.09  ? 227  ILE A O     1 
ATOM   1753 C CB    . ILE A 1 227 ? 14.557  -16.757 -22.069 1.00 35.15  ? 227  ILE A CB    1 
ATOM   1754 C CG1   . ILE A 1 227 ? 15.506  -15.592 -21.752 1.00 34.15  ? 227  ILE A CG1   1 
ATOM   1755 C CG2   . ILE A 1 227 ? 14.805  -17.265 -23.485 1.00 28.85  ? 227  ILE A CG2   1 
ATOM   1756 C CD1   . ILE A 1 227 ? 16.988  -15.969 -21.848 1.00 26.23  ? 227  ILE A CD1   1 
ATOM   1757 N N     . ASN A 1 228 ? 11.452  -17.277 -23.400 1.00 34.71  ? 228  ASN A N     1 
ATOM   1758 C CA    . ASN A 1 228 ? 10.465  -18.259 -23.797 1.00 31.94  ? 228  ASN A CA    1 
ATOM   1759 C C     . ASN A 1 228 ? 9.984   -18.021 -25.225 1.00 36.71  ? 228  ASN A C     1 
ATOM   1760 O O     . ASN A 1 228 ? 10.337  -17.019 -25.845 1.00 36.24  ? 228  ASN A O     1 
ATOM   1761 C CB    . ASN A 1 228 ? 9.295   -18.262 -22.807 1.00 27.64  ? 228  ASN A CB    1 
ATOM   1762 C CG    . ASN A 1 228 ? 8.811   -19.676 -22.477 1.00 39.10  ? 228  ASN A CG    1 
ATOM   1763 O OD1   . ASN A 1 228 ? 8.817   -20.561 -23.333 1.00 35.33  ? 228  ASN A OD1   1 
ATOM   1764 N ND2   . ASN A 1 228 ? 8.393   -19.889 -21.230 1.00 35.67  ? 228  ASN A ND2   1 
ATOM   1765 N N     . GLY A 1 229 ? 9.192   -18.954 -25.747 1.00 40.02  ? 229  GLY A N     1 
ATOM   1766 C CA    . GLY A 1 229 ? 8.670   -18.849 -27.099 1.00 39.62  ? 229  GLY A CA    1 
ATOM   1767 C C     . GLY A 1 229 ? 7.208   -18.437 -27.137 1.00 41.69  ? 229  GLY A C     1 
ATOM   1768 O O     . GLY A 1 229 ? 6.584   -18.228 -26.093 1.00 39.42  ? 229  GLY A O     1 
ATOM   1769 N N     . PRO A 1 230 ? 6.646   -18.329 -28.347 1.00 42.43  ? 230  PRO A N     1 
ATOM   1770 C CA    . PRO A 1 230 ? 5.292   -17.810 -28.578 1.00 41.74  ? 230  PRO A CA    1 
ATOM   1771 C C     . PRO A 1 230 ? 4.212   -18.574 -27.818 1.00 39.67  ? 230  PRO A C     1 
ATOM   1772 O O     . PRO A 1 230 ? 3.217   -17.975 -27.405 1.00 39.37  ? 230  PRO A O     1 
ATOM   1773 C CB    . PRO A 1 230 ? 5.096   -18.007 -30.086 1.00 36.53  ? 230  PRO A CB    1 
ATOM   1774 C CG    . PRO A 1 230 ? 6.482   -18.050 -30.645 1.00 34.03  ? 230  PRO A CG    1 
ATOM   1775 C CD    . PRO A 1 230 ? 7.305   -18.735 -29.600 1.00 39.85  ? 230  PRO A CD    1 
ATOM   1776 N N     . TRP A 1 231 ? 4.405   -19.879 -27.652 1.00 32.79  ? 231  TRP A N     1 
ATOM   1777 C CA    . TRP A 1 231 ? 3.428   -20.727 -26.986 1.00 27.18  ? 231  TRP A CA    1 
ATOM   1778 C C     . TRP A 1 231 ? 3.145   -20.245 -25.555 1.00 41.02  ? 231  TRP A C     1 
ATOM   1779 O O     . TRP A 1 231 ? 2.098   -20.554 -24.981 1.00 44.22  ? 231  TRP A O     1 
ATOM   1780 C CB    . TRP A 1 231 ? 3.935   -22.168 -26.968 1.00 30.72  ? 231  TRP A CB    1 
ATOM   1781 C CG    . TRP A 1 231 ? 5.270   -22.288 -26.301 1.00 42.35  ? 231  TRP A CG    1 
ATOM   1782 C CD1   . TRP A 1 231 ? 5.504   -22.375 -24.965 1.00 40.24  ? 231  TRP A CD1   1 
ATOM   1783 C CD2   . TRP A 1 231 ? 6.559   -22.307 -26.934 1.00 45.30  ? 231  TRP A CD2   1 
ATOM   1784 N NE1   . TRP A 1 231 ? 6.852   -22.454 -24.722 1.00 39.15  ? 231  TRP A NE1   1 
ATOM   1785 C CE2   . TRP A 1 231 ? 7.523   -22.418 -25.913 1.00 34.68  ? 231  TRP A CE2   1 
ATOM   1786 C CE3   . TRP A 1 231 ? 6.989   -22.257 -28.264 1.00 44.61  ? 231  TRP A CE3   1 
ATOM   1787 C CZ2   . TRP A 1 231 ? 8.889   -22.469 -26.174 1.00 34.19  ? 231  TRP A CZ2   1 
ATOM   1788 C CZ3   . TRP A 1 231 ? 8.349   -22.311 -28.522 1.00 41.71  ? 231  TRP A CZ3   1 
ATOM   1789 C CH2   . TRP A 1 231 ? 9.282   -22.413 -27.482 1.00 41.73  ? 231  TRP A CH2   1 
ATOM   1790 N N     . ALA A 1 232 ? 4.077   -19.476 -24.993 1.00 32.16  ? 232  ALA A N     1 
ATOM   1791 C CA    . ALA A 1 232 ? 3.993   -19.033 -23.606 1.00 41.40  ? 232  ALA A CA    1 
ATOM   1792 C C     . ALA A 1 232 ? 3.167   -17.761 -23.395 1.00 45.55  ? 232  ALA A C     1 
ATOM   1793 O O     . ALA A 1 232 ? 2.733   -17.481 -22.275 1.00 44.27  ? 232  ALA A O     1 
ATOM   1794 C CB    . ALA A 1 232 ? 5.396   -18.844 -23.036 1.00 43.58  ? 232  ALA A CB    1 
ATOM   1795 N N     . TRP A 1 233 ? 2.960   -16.995 -24.461 1.00 42.46  ? 233  TRP A N     1 
ATOM   1796 C CA    . TRP A 1 233 ? 2.298   -15.696 -24.363 1.00 41.99  ? 233  TRP A CA    1 
ATOM   1797 C C     . TRP A 1 233 ? 0.881   -15.817 -23.822 1.00 44.88  ? 233  TRP A C     1 
ATOM   1798 O O     . TRP A 1 233 ? 0.425   -14.974 -23.054 1.00 51.21  ? 233  TRP A O     1 
ATOM   1799 C CB    . TRP A 1 233 ? 2.259   -15.012 -25.731 1.00 44.57  ? 233  TRP A CB    1 
ATOM   1800 C CG    . TRP A 1 233 ? 3.613   -14.807 -26.354 1.00 44.48  ? 233  TRP A CG    1 
ATOM   1801 C CD1   . TRP A 1 233 ? 4.814   -14.721 -25.708 1.00 40.54  ? 233  TRP A CD1   1 
ATOM   1802 C CD2   . TRP A 1 233 ? 3.899   -14.673 -27.750 1.00 43.92  ? 233  TRP A CD2   1 
ATOM   1803 N NE1   . TRP A 1 233 ? 5.829   -14.542 -26.617 1.00 32.31  ? 233  TRP A NE1   1 
ATOM   1804 C CE2   . TRP A 1 233 ? 5.292   -14.510 -27.878 1.00 38.31  ? 233  TRP A CE2   1 
ATOM   1805 C CE3   . TRP A 1 233 ? 3.113   -14.682 -28.905 1.00 40.42  ? 233  TRP A CE3   1 
ATOM   1806 C CZ2   . TRP A 1 233 ? 5.911   -14.348 -29.113 1.00 36.57  ? 233  TRP A CZ2   1 
ATOM   1807 C CZ3   . TRP A 1 233 ? 3.729   -14.526 -30.123 1.00 38.97  ? 233  TRP A CZ3   1 
ATOM   1808 C CH2   . TRP A 1 233 ? 5.115   -14.364 -30.219 1.00 41.51  ? 233  TRP A CH2   1 
ATOM   1809 N N     . SER A 1 234 ? 0.189   -16.870 -24.239 1.00 38.51  ? 234  SER A N     1 
ATOM   1810 C CA    . SER A 1 234 ? -1.190  -17.110 -23.835 1.00 44.35  ? 234  SER A CA    1 
ATOM   1811 C C     . SER A 1 234 ? -1.393  -17.034 -22.313 1.00 47.04  ? 234  SER A C     1 
ATOM   1812 O O     . SER A 1 234 ? -2.322  -16.379 -21.831 1.00 45.24  ? 234  SER A O     1 
ATOM   1813 C CB    . SER A 1 234 ? -1.652  -18.468 -24.376 1.00 50.94  ? 234  SER A CB    1 
ATOM   1814 O OG    . SER A 1 234 ? -2.939  -18.810 -23.893 1.00 61.13  ? 234  SER A OG    1 
ATOM   1815 N N     . ASN A 1 235 ? -0.533  -17.708 -21.555 1.00 42.88  ? 235  ASN A N     1 
ATOM   1816 C CA    . ASN A 1 235 ? -0.643  -17.672 -20.096 1.00 40.47  ? 235  ASN A CA    1 
ATOM   1817 C C     . ASN A 1 235 ? -0.280  -16.305 -19.512 1.00 44.63  ? 235  ASN A C     1 
ATOM   1818 O O     . ASN A 1 235 ? -0.871  -15.864 -18.528 1.00 43.40  ? 235  ASN A O     1 
ATOM   1819 C CB    . ASN A 1 235 ? 0.182   -18.786 -19.446 1.00 37.54  ? 235  ASN A CB    1 
ATOM   1820 C CG    . ASN A 1 235 ? -0.419  -20.159 -19.676 1.00 42.68  ? 235  ASN A CG    1 
ATOM   1821 O OD1   . ASN A 1 235 ? -1.564  -20.279 -20.113 1.00 46.03  ? 235  ASN A OD1   1 
ATOM   1822 N ND2   . ASN A 1 235 ? 0.347   -21.203 -19.380 1.00 42.40  ? 235  ASN A ND2   1 
ATOM   1823 N N     . ILE A 1 236 ? 0.681   -15.627 -20.125 1.00 36.37  ? 236  ILE A N     1 
ATOM   1824 C CA    . ILE A 1 236 ? 1.013   -14.290 -19.672 1.00 42.45  ? 236  ILE A CA    1 
ATOM   1825 C C     . ILE A 1 236 ? -0.168  -13.351 -19.904 1.00 48.38  ? 236  ILE A C     1 
ATOM   1826 O O     . ILE A 1 236 ? -0.466  -12.507 -19.062 1.00 51.38  ? 236  ILE A O     1 
ATOM   1827 C CB    . ILE A 1 236 ? 2.256   -13.741 -20.362 1.00 38.45  ? 236  ILE A CB    1 
ATOM   1828 C CG1   . ILE A 1 236 ? 3.351   -14.805 -20.386 1.00 39.65  ? 236  ILE A CG1   1 
ATOM   1829 C CG2   . ILE A 1 236 ? 2.731   -12.488 -19.641 1.00 41.01  ? 236  ILE A CG2   1 
ATOM   1830 C CD1   . ILE A 1 236 ? 4.638   -14.339 -21.026 1.00 36.67  ? 236  ILE A CD1   1 
ATOM   1831 N N     . ASP A 1 237 ? -0.840  -13.504 -21.041 1.00 43.86  ? 237  ASP A N     1 
ATOM   1832 C CA    . ASP A 1 237 ? -2.051  -12.737 -21.307 1.00 48.40  ? 237  ASP A CA    1 
ATOM   1833 C C     . ASP A 1 237 ? -3.018  -12.910 -20.137 1.00 52.05  ? 237  ASP A C     1 
ATOM   1834 O O     . ASP A 1 237 ? -3.491  -11.934 -19.554 1.00 52.54  ? 237  ASP A O     1 
ATOM   1835 C CB    . ASP A 1 237 ? -2.721  -13.184 -22.616 1.00 52.08  ? 237  ASP A CB    1 
ATOM   1836 C CG    . ASP A 1 237 ? -1.967  -12.718 -23.863 1.00 51.39  ? 237  ASP A CG    1 
ATOM   1837 O OD1   . ASP A 1 237 ? -1.098  -11.830 -23.754 1.00 46.58  ? 237  ASP A OD1   1 
ATOM   1838 O OD2   . ASP A 1 237 ? -2.255  -13.240 -24.961 1.00 52.61  ? 237  ASP A OD2   1 
ATOM   1839 N N     . THR A 1 238 ? -3.293  -14.163 -19.794 1.00 50.97  ? 238  THR A N     1 
ATOM   1840 C CA    . THR A 1 238 ? -4.195  -14.494 -18.698 1.00 49.13  ? 238  THR A CA    1 
ATOM   1841 C C     . THR A 1 238 ? -3.749  -13.874 -17.374 1.00 53.27  ? 238  THR A C     1 
ATOM   1842 O O     . THR A 1 238 ? -4.571  -13.575 -16.508 1.00 55.92  ? 238  THR A O     1 
ATOM   1843 C CB    . THR A 1 238 ? -4.292  -16.017 -18.512 1.00 49.45  ? 238  THR A CB    1 
ATOM   1844 O OG1   . THR A 1 238 ? -4.826  -16.613 -19.701 1.00 49.84  ? 238  THR A OG1   1 
ATOM   1845 C CG2   . THR A 1 238 ? -5.186  -16.358 -17.329 1.00 54.73  ? 238  THR A CG2   1 
ATOM   1846 N N     . SER A 1 239 ? -2.444  -13.682 -17.221 1.00 48.25  ? 239  SER A N     1 
ATOM   1847 C CA    . SER A 1 239 ? -1.894  -13.169 -15.976 1.00 48.59  ? 239  SER A CA    1 
ATOM   1848 C C     . SER A 1 239 ? -2.077  -11.654 -15.844 1.00 55.32  ? 239  SER A C     1 
ATOM   1849 O O     . SER A 1 239 ? -1.847  -11.082 -14.774 1.00 54.55  ? 239  SER A O     1 
ATOM   1850 C CB    . SER A 1 239 ? -0.411  -13.524 -15.865 1.00 44.79  ? 239  SER A CB    1 
ATOM   1851 O OG    . SER A 1 239 ? 0.381   -12.604 -16.595 1.00 47.60  ? 239  SER A OG    1 
ATOM   1852 N N     . LYS A 1 240 ? -2.480  -11.007 -16.932 1.00 56.42  ? 240  LYS A N     1 
ATOM   1853 C CA    . LYS A 1 240 ? -2.658  -9.557  -16.935 1.00 66.57  ? 240  LYS A CA    1 
ATOM   1854 C C     . LYS A 1 240 ? -1.365  -8.802  -16.604 1.00 65.81  ? 240  LYS A C     1 
ATOM   1855 O O     . LYS A 1 240 ? -1.398  -7.606  -16.310 1.00 69.15  ? 240  LYS A O     1 
ATOM   1856 C CB    . LYS A 1 240 ? -3.766  -9.138  -15.959 1.00 80.48  ? 240  LYS A CB    1 
ATOM   1857 C CG    . LYS A 1 240 ? -5.111  -9.829  -16.168 1.00 92.04  ? 240  LYS A CG    1 
ATOM   1858 C CD    . LYS A 1 240 ? -5.799  -9.377  -17.448 1.00 99.78  ? 240  LYS A CD    1 
ATOM   1859 C CE    . LYS A 1 240 ? -7.186  -9.995  -17.568 1.00 106.43 ? 240  LYS A CE    1 
ATOM   1860 N NZ    . LYS A 1 240 ? -7.915  -9.519  -18.778 1.00 109.89 ? 240  LYS A NZ    1 
ATOM   1861 N N     . VAL A 1 241 ? -0.230  -9.495  -16.632 1.00 57.76  ? 241  VAL A N     1 
ATOM   1862 C CA    . VAL A 1 241 ? 1.054   -8.816  -16.514 1.00 50.84  ? 241  VAL A CA    1 
ATOM   1863 C C     . VAL A 1 241 ? 1.269   -7.996  -17.777 1.00 51.33  ? 241  VAL A C     1 
ATOM   1864 O O     . VAL A 1 241 ? 1.029   -8.475  -18.887 1.00 55.28  ? 241  VAL A O     1 
ATOM   1865 C CB    . VAL A 1 241 ? 2.238   -9.796  -16.364 1.00 47.45  ? 241  VAL A CB    1 
ATOM   1866 C CG1   . VAL A 1 241 ? 3.556   -9.088  -16.684 1.00 40.03  ? 241  VAL A CG1   1 
ATOM   1867 C CG2   . VAL A 1 241 ? 2.270   -10.412 -14.965 1.00 44.10  ? 241  VAL A CG2   1 
ATOM   1868 N N     . ASN A 1 242 ? 1.713   -6.758  -17.605 1.00 43.59  ? 242  ASN A N     1 
ATOM   1869 C CA    . ASN A 1 242 ? 2.006   -5.891  -18.737 1.00 47.50  ? 242  ASN A CA    1 
ATOM   1870 C C     . ASN A 1 242 ? 3.393   -6.197  -19.291 1.00 44.02  ? 242  ASN A C     1 
ATOM   1871 O O     . ASN A 1 242 ? 4.402   -5.728  -18.757 1.00 47.23  ? 242  ASN A O     1 
ATOM   1872 C CB    . ASN A 1 242 ? 1.892   -4.417  -18.325 1.00 48.79  ? 242  ASN A CB    1 
ATOM   1873 C CG    . ASN A 1 242 ? 2.198   -3.459  -19.471 1.00 63.25  ? 242  ASN A CG    1 
ATOM   1874 O OD1   . ASN A 1 242 ? 2.179   -3.842  -20.644 1.00 65.25  ? 242  ASN A OD1   1 
ATOM   1875 N ND2   . ASN A 1 242 ? 2.481   -2.204  -19.130 1.00 68.05  ? 242  ASN A ND2   1 
ATOM   1876 N N     . TYR A 1 243 ? 3.441   -6.976  -20.368 1.00 42.91  ? 243  TYR A N     1 
ATOM   1877 C CA    . TYR A 1 243 ? 4.710   -7.495  -20.873 1.00 45.14  ? 243  TYR A CA    1 
ATOM   1878 C C     . TYR A 1 243 ? 5.014   -7.133  -22.321 1.00 48.38  ? 243  TYR A C     1 
ATOM   1879 O O     . TYR A 1 243 ? 4.118   -6.893  -23.127 1.00 42.78  ? 243  TYR A O     1 
ATOM   1880 C CB    . TYR A 1 243 ? 4.746   -9.017  -20.742 1.00 40.78  ? 243  TYR A CB    1 
ATOM   1881 C CG    . TYR A 1 243 ? 3.921   -9.741  -21.779 1.00 40.28  ? 243  TYR A CG    1 
ATOM   1882 C CD1   . TYR A 1 243 ? 2.558   -9.935  -21.599 1.00 42.84  ? 243  TYR A CD1   1 
ATOM   1883 C CD2   . TYR A 1 243 ? 4.506   -10.244 -22.934 1.00 41.92  ? 243  TYR A CD2   1 
ATOM   1884 C CE1   . TYR A 1 243 ? 1.797   -10.609 -22.541 1.00 39.18  ? 243  TYR A CE1   1 
ATOM   1885 C CE2   . TYR A 1 243 ? 3.755   -10.921 -23.881 1.00 43.33  ? 243  TYR A CE2   1 
ATOM   1886 C CZ    . TYR A 1 243 ? 2.401   -11.102 -23.678 1.00 45.04  ? 243  TYR A CZ    1 
ATOM   1887 O OH    . TYR A 1 243 ? 1.646   -11.772 -24.619 1.00 40.82  ? 243  TYR A OH    1 
ATOM   1888 N N     . GLY A 1 244 ? 6.300   -7.116  -22.639 1.00 48.12  ? 244  GLY A N     1 
ATOM   1889 C CA    . GLY A 1 244 ? 6.744   -6.916  -24.000 1.00 45.48  ? 244  GLY A CA    1 
ATOM   1890 C C     . GLY A 1 244 ? 7.605   -8.089  -24.413 1.00 46.43  ? 244  GLY A C     1 
ATOM   1891 O O     . GLY A 1 244 ? 8.119   -8.827  -23.566 1.00 43.77  ? 244  GLY A O     1 
ATOM   1892 N N     . VAL A 1 245 ? 7.752   -8.272  -25.718 1.00 40.38  ? 245  VAL A N     1 
ATOM   1893 C CA    . VAL A 1 245 ? 8.588   -9.334  -26.249 1.00 39.45  ? 245  VAL A CA    1 
ATOM   1894 C C     . VAL A 1 245 ? 9.629   -8.678  -27.136 1.00 44.82  ? 245  VAL A C     1 
ATOM   1895 O O     . VAL A 1 245 ? 9.290   -7.866  -27.997 1.00 51.06  ? 245  VAL A O     1 
ATOM   1896 C CB    . VAL A 1 245 ? 7.757   -10.333 -27.054 1.00 37.80  ? 245  VAL A CB    1 
ATOM   1897 C CG1   . VAL A 1 245 ? 8.587   -11.557 -27.414 1.00 34.74  ? 245  VAL A CG1   1 
ATOM   1898 C CG2   . VAL A 1 245 ? 6.524   -10.733 -26.257 1.00 34.20  ? 245  VAL A CG2   1 
ATOM   1899 N N     . THR A 1 246 ? 10.898  -9.003  -26.920 1.00 37.53  ? 246  THR A N     1 
ATOM   1900 C CA    . THR A 1 246 ? 11.954  -8.248  -27.577 1.00 40.73  ? 246  THR A CA    1 
ATOM   1901 C C     . THR A 1 246 ? 13.163  -9.106  -27.936 1.00 44.45  ? 246  THR A C     1 
ATOM   1902 O O     . THR A 1 246 ? 13.233  -10.290 -27.596 1.00 44.93  ? 246  THR A O     1 
ATOM   1903 C CB    . THR A 1 246 ? 12.385  -7.037  -26.708 1.00 38.58  ? 246  THR A CB    1 
ATOM   1904 O OG1   . THR A 1 246 ? 13.160  -6.123  -27.489 1.00 44.24  ? 246  THR A OG1   1 
ATOM   1905 C CG2   . THR A 1 246 ? 13.199  -7.492  -25.503 1.00 31.86  ? 246  THR A CG2   1 
ATOM   1906 N N     . VAL A 1 247 ? 14.107  -8.491  -28.638 1.00 40.08  ? 247  VAL A N     1 
ATOM   1907 C CA    . VAL A 1 247 ? 15.339  -9.147  -29.042 1.00 34.70  ? 247  VAL A CA    1 
ATOM   1908 C C     . VAL A 1 247 ? 16.158  -9.557  -27.818 1.00 33.05  ? 247  VAL A C     1 
ATOM   1909 O O     . VAL A 1 247 ? 16.305  -8.791  -26.860 1.00 35.76  ? 247  VAL A O     1 
ATOM   1910 C CB    . VAL A 1 247 ? 16.170  -8.214  -29.958 1.00 41.64  ? 247  VAL A CB    1 
ATOM   1911 C CG1   . VAL A 1 247 ? 16.555  -6.943  -29.212 1.00 44.31  ? 247  VAL A CG1   1 
ATOM   1912 C CG2   . VAL A 1 247 ? 17.403  -8.922  -30.505 1.00 39.07  ? 247  VAL A CG2   1 
ATOM   1913 N N     . LEU A 1 248 ? 16.676  -10.776 -27.843 1.00 42.38  ? 248  LEU A N     1 
ATOM   1914 C CA    . LEU A 1 248 ? 17.502  -11.266 -26.748 1.00 39.37  ? 248  LEU A CA    1 
ATOM   1915 C C     . LEU A 1 248 ? 18.667  -10.309 -26.516 1.00 41.09  ? 248  LEU A C     1 
ATOM   1916 O O     . LEU A 1 248 ? 19.074  -9.600  -27.432 1.00 38.84  ? 248  LEU A O     1 
ATOM   1917 C CB    . LEU A 1 248 ? 18.018  -12.670 -27.058 1.00 32.54  ? 248  LEU A CB    1 
ATOM   1918 C CG    . LEU A 1 248 ? 16.951  -13.768 -27.025 1.00 38.46  ? 248  LEU A CG    1 
ATOM   1919 C CD1   . LEU A 1 248 ? 17.444  -15.039 -27.700 1.00 34.01  ? 248  LEU A CD1   1 
ATOM   1920 C CD2   . LEU A 1 248 ? 16.520  -14.043 -25.591 1.00 34.56  ? 248  LEU A CD2   1 
ATOM   1921 N N     . PRO A 1 249 ? 19.205  -10.285 -25.283 1.00 41.48  ? 249  PRO A N     1 
ATOM   1922 C CA    . PRO A 1 249 ? 20.356  -9.421  -25.012 1.00 33.72  ? 249  PRO A CA    1 
ATOM   1923 C C     . PRO A 1 249 ? 21.563  -9.940  -25.770 1.00 35.56  ? 249  PRO A C     1 
ATOM   1924 O O     . PRO A 1 249 ? 21.594  -11.120 -26.112 1.00 41.79  ? 249  PRO A O     1 
ATOM   1925 C CB    . PRO A 1 249 ? 20.577  -9.589  -23.498 1.00 43.07  ? 249  PRO A CB    1 
ATOM   1926 C CG    . PRO A 1 249 ? 19.336  -10.250 -22.975 1.00 39.26  ? 249  PRO A CG    1 
ATOM   1927 C CD    . PRO A 1 249 ? 18.820  -11.079 -24.102 1.00 33.20  ? 249  PRO A CD    1 
ATOM   1928 N N     . THR A 1 250 ? 22.532  -9.072  -26.045 1.00 35.35  ? 250  THR A N     1 
ATOM   1929 C CA    . THR A 1 250 ? 23.778  -9.499  -26.668 1.00 32.82  ? 250  THR A CA    1 
ATOM   1930 C C     . THR A 1 250 ? 24.747  -10.021 -25.602 1.00 36.78  ? 250  THR A C     1 
ATOM   1931 O O     . THR A 1 250 ? 24.611  -9.721  -24.415 1.00 28.50  ? 250  THR A O     1 
ATOM   1932 C CB    . THR A 1 250 ? 24.474  -8.335  -27.394 1.00 40.85  ? 250  THR A CB    1 
ATOM   1933 O OG1   . THR A 1 250 ? 24.922  -7.381  -26.429 1.00 42.39  ? 250  THR A OG1   1 
ATOM   1934 C CG2   . THR A 1 250 ? 23.532  -7.643  -28.389 1.00 36.79  ? 250  THR A CG2   1 
ATOM   1935 N N     . PHE A 1 251 ? 25.738  -10.787 -26.040 1.00 34.51  ? 251  PHE A N     1 
ATOM   1936 C CA    . PHE A 1 251 ? 26.805  -11.244 -25.166 1.00 37.54  ? 251  PHE A CA    1 
ATOM   1937 C C     . PHE A 1 251 ? 28.142  -11.004 -25.849 1.00 35.63  ? 251  PHE A C     1 
ATOM   1938 O O     . PHE A 1 251 ? 28.324  -11.388 -26.998 1.00 39.35  ? 251  PHE A O     1 
ATOM   1939 C CB    . PHE A 1 251 ? 26.641  -12.733 -24.854 1.00 33.96  ? 251  PHE A CB    1 
ATOM   1940 C CG    . PHE A 1 251 ? 27.797  -13.321 -24.099 1.00 37.86  ? 251  PHE A CG    1 
ATOM   1941 C CD1   . PHE A 1 251 ? 28.115  -12.867 -22.827 1.00 37.13  ? 251  PHE A CD1   1 
ATOM   1942 C CD2   . PHE A 1 251 ? 28.561  -14.337 -24.652 1.00 34.81  ? 251  PHE A CD2   1 
ATOM   1943 C CE1   . PHE A 1 251 ? 29.178  -13.413 -22.123 1.00 35.12  ? 251  PHE A CE1   1 
ATOM   1944 C CE2   . PHE A 1 251 ? 29.622  -14.883 -23.953 1.00 35.17  ? 251  PHE A CE2   1 
ATOM   1945 C CZ    . PHE A 1 251 ? 29.928  -14.419 -22.683 1.00 33.50  ? 251  PHE A CZ    1 
ATOM   1946 N N     . LYS A 1 252 ? 29.076  -10.371 -25.145 1.00 43.79  ? 252  LYS A N     1 
ATOM   1947 C CA    . LYS A 1 252 ? 30.346  -9.988  -25.749 1.00 43.28  ? 252  LYS A CA    1 
ATOM   1948 C C     . LYS A 1 252 ? 30.094  -9.165  -27.016 1.00 43.32  ? 252  LYS A C     1 
ATOM   1949 O O     . LYS A 1 252 ? 30.826  -9.282  -27.997 1.00 46.82  ? 252  LYS A O     1 
ATOM   1950 C CB    . LYS A 1 252 ? 31.185  -11.224 -26.096 1.00 44.60  ? 252  LYS A CB    1 
ATOM   1951 C CG    . LYS A 1 252 ? 31.920  -11.899 -24.928 1.00 50.82  ? 252  LYS A CG    1 
ATOM   1952 C CD    . LYS A 1 252 ? 33.058  -12.761 -25.487 1.00 54.83  ? 252  LYS A CD    1 
ATOM   1953 C CE    . LYS A 1 252 ? 33.709  -13.660 -24.458 1.00 61.69  ? 252  LYS A CE    1 
ATOM   1954 N NZ    . LYS A 1 252 ? 34.436  -12.921 -23.388 1.00 77.38  ? 252  LYS A NZ    1 
ATOM   1955 N N     . GLY A 1 253 ? 29.039  -8.358  -27.000 1.00 44.36  ? 253  GLY A N     1 
ATOM   1956 C CA    . GLY A 1 253 ? 28.716  -7.493  -28.121 1.00 47.20  ? 253  GLY A CA    1 
ATOM   1957 C C     . GLY A 1 253 ? 28.056  -8.167  -29.317 1.00 50.45  ? 253  GLY A C     1 
ATOM   1958 O O     . GLY A 1 253 ? 27.693  -7.498  -30.286 1.00 45.62  ? 253  GLY A O     1 
ATOM   1959 N N     . GLN A 1 254 ? 27.902  -9.488  -29.258 1.00 48.38  ? 254  GLN A N     1 
ATOM   1960 C CA    . GLN A 1 254 ? 27.255  -10.236 -30.338 1.00 35.95  ? 254  GLN A CA    1 
ATOM   1961 C C     . GLN A 1 254 ? 25.866  -10.687 -29.907 1.00 41.04  ? 254  GLN A C     1 
ATOM   1962 O O     . GLN A 1 254 ? 25.627  -10.909 -28.720 1.00 50.32  ? 254  GLN A O     1 
ATOM   1963 C CB    . GLN A 1 254 ? 28.099  -11.449 -30.722 1.00 34.89  ? 254  GLN A CB    1 
ATOM   1964 C CG    . GLN A 1 254 ? 29.491  -11.103 -31.208 1.00 40.58  ? 254  GLN A CG    1 
ATOM   1965 C CD    . GLN A 1 254 ? 30.526  -12.110 -30.764 1.00 44.66  ? 254  GLN A CD    1 
ATOM   1966 O OE1   . GLN A 1 254 ? 30.894  -13.015 -31.513 1.00 45.06  ? 254  GLN A OE1   1 
ATOM   1967 N NE2   . GLN A 1 254 ? 31.004  -11.959 -29.535 1.00 43.12  ? 254  GLN A NE2   1 
ATOM   1968 N N     . PRO A 1 255 ? 24.941  -10.829 -30.865 1.00 42.96  ? 255  PRO A N     1 
ATOM   1969 C CA    . PRO A 1 255 ? 23.572  -11.210 -30.497 1.00 45.40  ? 255  PRO A CA    1 
ATOM   1970 C C     . PRO A 1 255 ? 23.486  -12.632 -29.930 1.00 41.63  ? 255  PRO A C     1 
ATOM   1971 O O     . PRO A 1 255 ? 24.291  -13.483 -30.295 1.00 36.89  ? 255  PRO A O     1 
ATOM   1972 C CB    . PRO A 1 255 ? 22.818  -11.131 -31.827 1.00 42.37  ? 255  PRO A CB    1 
ATOM   1973 C CG    . PRO A 1 255 ? 23.866  -11.344 -32.872 1.00 48.50  ? 255  PRO A CG    1 
ATOM   1974 C CD    . PRO A 1 255 ? 25.118  -10.721 -32.325 1.00 47.06  ? 255  PRO A CD    1 
ATOM   1975 N N     . SER A 1 256 ? 22.530  -12.874 -29.039 1.00 33.54  ? 256  SER A N     1 
ATOM   1976 C CA    . SER A 1 256 ? 22.220  -14.233 -28.629 1.00 36.16  ? 256  SER A CA    1 
ATOM   1977 C C     . SER A 1 256 ? 21.697  -14.946 -29.859 1.00 36.23  ? 256  SER A C     1 
ATOM   1978 O O     . SER A 1 256 ? 21.021  -14.339 -30.687 1.00 38.44  ? 256  SER A O     1 
ATOM   1979 C CB    . SER A 1 256 ? 21.172  -14.251 -27.512 1.00 34.49  ? 256  SER A CB    1 
ATOM   1980 O OG    . SER A 1 256 ? 21.725  -13.807 -26.288 1.00 35.27  ? 256  SER A OG    1 
ATOM   1981 N N     . LYS A 1 257 ? 22.020  -16.227 -29.990 1.00 37.85  ? 257  LYS A N     1 
ATOM   1982 C CA    . LYS A 1 257 ? 21.665  -16.977 -31.190 1.00 34.58  ? 257  LYS A CA    1 
ATOM   1983 C C     . LYS A 1 257 ? 20.764  -18.157 -30.862 1.00 37.15  ? 257  LYS A C     1 
ATOM   1984 O O     . LYS A 1 257 ? 21.230  -19.285 -30.720 1.00 40.74  ? 257  LYS A O     1 
ATOM   1985 C CB    . LYS A 1 257 ? 22.928  -17.449 -31.914 1.00 39.78  ? 257  LYS A CB    1 
ATOM   1986 C CG    . LYS A 1 257 ? 23.938  -16.332 -32.161 1.00 47.75  ? 257  LYS A CG    1 
ATOM   1987 C CD    . LYS A 1 257 ? 24.602  -16.463 -33.520 1.00 49.93  ? 257  LYS A CD    1 
ATOM   1988 C CE    . LYS A 1 257 ? 25.158  -17.854 -33.723 1.00 52.76  ? 257  LYS A CE    1 
ATOM   1989 N NZ    . LYS A 1 257 ? 25.675  -18.058 -35.102 1.00 49.76  ? 257  LYS A NZ    1 
ATOM   1990 N N     . PRO A 1 258 ? 19.460  -17.899 -30.727 1.00 35.00  ? 258  PRO A N     1 
ATOM   1991 C CA    . PRO A 1 258 ? 18.581  -19.003 -30.343 1.00 33.98  ? 258  PRO A CA    1 
ATOM   1992 C C     . PRO A 1 258 ? 18.466  -19.968 -31.500 1.00 42.29  ? 258  PRO A C     1 
ATOM   1993 O O     . PRO A 1 258 ? 18.655  -19.564 -32.645 1.00 45.11  ? 258  PRO A O     1 
ATOM   1994 C CB    . PRO A 1 258 ? 17.240  -18.314 -30.095 1.00 32.97  ? 258  PRO A CB    1 
ATOM   1995 C CG    . PRO A 1 258 ? 17.293  -17.060 -30.952 1.00 33.21  ? 258  PRO A CG    1 
ATOM   1996 C CD    . PRO A 1 258 ? 18.731  -16.640 -30.969 1.00 31.76  ? 258  PRO A CD    1 
ATOM   1997 N N     . PHE A 1 259 ? 18.185  -21.230 -31.211 1.00 39.13  ? 259  PHE A N     1 
ATOM   1998 C CA    . PHE A 1 259 ? 17.924  -22.171 -32.278 1.00 44.24  ? 259  PHE A CA    1 
ATOM   1999 C C     . PHE A 1 259 ? 16.628  -21.774 -32.952 1.00 48.86  ? 259  PHE A C     1 
ATOM   2000 O O     . PHE A 1 259 ? 15.750  -21.175 -32.331 1.00 48.75  ? 259  PHE A O     1 
ATOM   2001 C CB    . PHE A 1 259 ? 17.827  -23.594 -31.744 1.00 41.89  ? 259  PHE A CB    1 
ATOM   2002 C CG    . PHE A 1 259 ? 19.124  -24.349 -31.807 1.00 49.28  ? 259  PHE A CG    1 
ATOM   2003 C CD1   . PHE A 1 259 ? 19.872  -24.370 -32.975 1.00 55.09  ? 259  PHE A CD1   1 
ATOM   2004 C CD2   . PHE A 1 259 ? 19.603  -25.028 -30.696 1.00 49.82  ? 259  PHE A CD2   1 
ATOM   2005 C CE1   . PHE A 1 259 ? 21.069  -25.064 -33.038 1.00 60.47  ? 259  PHE A CE1   1 
ATOM   2006 C CE2   . PHE A 1 259 ? 20.802  -25.721 -30.753 1.00 52.46  ? 259  PHE A CE2   1 
ATOM   2007 C CZ    . PHE A 1 259 ? 21.535  -25.741 -31.924 1.00 52.96  ? 259  PHE A CZ    1 
ATOM   2008 N N     . VAL A 1 260 ? 16.513  -22.082 -34.235 1.00 36.24  ? 260  VAL A N     1 
ATOM   2009 C CA    . VAL A 1 260 ? 15.252  -21.871 -34.911 1.00 40.87  ? 260  VAL A CA    1 
ATOM   2010 C C     . VAL A 1 260 ? 14.610  -23.219 -35.143 1.00 39.10  ? 260  VAL A C     1 
ATOM   2011 O O     . VAL A 1 260 ? 15.234  -24.132 -35.691 1.00 38.61  ? 260  VAL A O     1 
ATOM   2012 C CB    . VAL A 1 260 ? 15.430  -21.132 -36.245 1.00 41.75  ? 260  VAL A CB    1 
ATOM   2013 C CG1   . VAL A 1 260 ? 14.078  -20.908 -36.896 1.00 43.04  ? 260  VAL A CG1   1 
ATOM   2014 C CG2   . VAL A 1 260 ? 16.137  -19.806 -36.008 1.00 45.40  ? 260  VAL A CG2   1 
ATOM   2015 N N     . GLY A 1 261 ? 13.367  -23.351 -34.704 1.00 36.17  ? 261  GLY A N     1 
ATOM   2016 C CA    . GLY A 1 261 ? 12.642  -24.589 -34.901 1.00 35.99  ? 261  GLY A CA    1 
ATOM   2017 C C     . GLY A 1 261 ? 11.457  -24.418 -35.825 1.00 39.42  ? 261  GLY A C     1 
ATOM   2018 O O     . GLY A 1 261 ? 10.827  -23.360 -35.870 1.00 40.62  ? 261  GLY A O     1 
ATOM   2019 N N     . VAL A 1 262 ? 11.154  -25.460 -36.583 1.00 34.97  ? 262  VAL A N     1 
ATOM   2020 C CA    . VAL A 1 262 ? 9.923   -25.458 -37.350 1.00 38.58  ? 262  VAL A CA    1 
ATOM   2021 C C     . VAL A 1 262 ? 9.007   -26.557 -36.843 1.00 41.74  ? 262  VAL A C     1 
ATOM   2022 O O     . VAL A 1 262 ? 9.254   -27.743 -37.066 1.00 42.22  ? 262  VAL A O     1 
ATOM   2023 C CB    . VAL A 1 262 ? 10.182  -25.630 -38.848 1.00 37.38  ? 262  VAL A CB    1 
ATOM   2024 C CG1   . VAL A 1 262 ? 8.865   -25.624 -39.600 1.00 35.74  ? 262  VAL A CG1   1 
ATOM   2025 C CG2   . VAL A 1 262 ? 11.089  -24.519 -39.344 1.00 31.31  ? 262  VAL A CG2   1 
ATOM   2026 N N     . LEU A 1 263 ? 7.962   -26.157 -36.128 1.00 42.15  ? 263  LEU A N     1 
ATOM   2027 C CA    . LEU A 1 263 ? 6.987   -27.113 -35.648 1.00 38.83  ? 263  LEU A CA    1 
ATOM   2028 C C     . LEU A 1 263 ? 6.438   -27.836 -36.862 1.00 44.44  ? 263  LEU A C     1 
ATOM   2029 O O     . LEU A 1 263 ? 5.927   -27.210 -37.791 1.00 49.51  ? 263  LEU A O     1 
ATOM   2030 C CB    . LEU A 1 263 ? 5.859   -26.415 -34.902 1.00 31.16  ? 263  LEU A CB    1 
ATOM   2031 C CG    . LEU A 1 263 ? 4.789   -27.371 -34.383 1.00 40.24  ? 263  LEU A CG    1 
ATOM   2032 C CD1   . LEU A 1 263 ? 5.383   -28.261 -33.297 1.00 48.59  ? 263  LEU A CD1   1 
ATOM   2033 C CD2   . LEU A 1 263 ? 3.590   -26.607 -33.849 1.00 46.03  ? 263  LEU A CD2   1 
ATOM   2034 N N     . SER A 1 264 ? 6.551   -29.156 -36.849 1.00 41.76  ? 264  SER A N     1 
ATOM   2035 C CA    . SER A 1 264 ? 6.161   -29.969 -37.986 1.00 41.24  ? 264  SER A CA    1 
ATOM   2036 C C     . SER A 1 264 ? 5.223   -31.108 -37.587 1.00 48.85  ? 264  SER A C     1 
ATOM   2037 O O     . SER A 1 264 ? 5.172   -31.517 -36.424 1.00 46.11  ? 264  SER A O     1 
ATOM   2038 C CB    . SER A 1 264 ? 7.413   -30.529 -38.659 1.00 42.32  ? 264  SER A CB    1 
ATOM   2039 O OG    . SER A 1 264 ? 8.304   -29.479 -39.000 1.00 48.57  ? 264  SER A OG    1 
ATOM   2040 N N     . ALA A 1 265 ? 4.474   -31.611 -38.561 1.00 53.17  ? 265  ALA A N     1 
ATOM   2041 C CA    . ALA A 1 265 ? 3.579   -32.735 -38.331 1.00 55.47  ? 265  ALA A CA    1 
ATOM   2042 C C     . ALA A 1 265 ? 3.952   -33.879 -39.262 1.00 50.23  ? 265  ALA A C     1 
ATOM   2043 O O     . ALA A 1 265 ? 3.876   -33.745 -40.483 1.00 53.78  ? 265  ALA A O     1 
ATOM   2044 C CB    . ALA A 1 265 ? 2.136   -32.316 -38.547 1.00 59.67  ? 265  ALA A CB    1 
ATOM   2045 N N     . GLY A 1 266 ? 4.376   -34.994 -38.679 1.00 50.58  ? 266  GLY A N     1 
ATOM   2046 C CA    . GLY A 1 266 ? 4.768   -36.155 -39.456 1.00 54.42  ? 266  GLY A CA    1 
ATOM   2047 C C     . GLY A 1 266 ? 3.764   -37.285 -39.348 1.00 55.77  ? 266  GLY A C     1 
ATOM   2048 O O     . GLY A 1 266 ? 3.088   -37.432 -38.324 1.00 59.63  ? 266  GLY A O     1 
ATOM   2049 N N     . ILE A 1 267 ? 3.664   -38.083 -40.406 1.00 56.48  ? 267  ILE A N     1 
ATOM   2050 C CA    . ILE A 1 267 ? 2.736   -39.209 -40.434 1.00 57.38  ? 267  ILE A CA    1 
ATOM   2051 C C     . ILE A 1 267 ? 3.448   -40.532 -40.157 1.00 55.94  ? 267  ILE A C     1 
ATOM   2052 O O     . ILE A 1 267 ? 4.399   -40.891 -40.849 1.00 64.34  ? 267  ILE A O     1 
ATOM   2053 C CB    . ILE A 1 267 ? 1.992   -39.288 -41.778 1.00 61.89  ? 267  ILE A CB    1 
ATOM   2054 C CG1   . ILE A 1 267 ? 1.178   -38.009 -42.007 1.00 56.64  ? 267  ILE A CG1   1 
ATOM   2055 C CG2   . ILE A 1 267 ? 1.092   -40.522 -41.819 1.00 65.35  ? 267  ILE A CG2   1 
ATOM   2056 C CD1   . ILE A 1 267 ? 0.590   -37.884 -43.409 1.00 54.69  ? 267  ILE A CD1   1 
ATOM   2057 N N     . ASN A 1 268 ? 2.990   -41.244 -39.133 1.00 54.80  ? 268  ASN A N     1 
ATOM   2058 C CA    . ASN A 1 268 ? 3.549   -42.548 -38.783 1.00 60.45  ? 268  ASN A CA    1 
ATOM   2059 C C     . ASN A 1 268 ? 3.587   -43.464 -40.003 1.00 69.05  ? 268  ASN A C     1 
ATOM   2060 O O     . ASN A 1 268 ? 2.635   -43.518 -40.782 1.00 72.47  ? 268  ASN A O     1 
ATOM   2061 C CB    . ASN A 1 268 ? 2.723   -43.188 -37.663 1.00 62.19  ? 268  ASN A CB    1 
ATOM   2062 C CG    . ASN A 1 268 ? 3.504   -44.224 -36.865 1.00 63.31  ? 268  ASN A CG    1 
ATOM   2063 O OD1   . ASN A 1 268 ? 4.270   -45.017 -37.416 1.00 63.73  ? 268  ASN A OD1   1 
ATOM   2064 N ND2   . ASN A 1 268 ? 3.307   -44.219 -35.553 1.00 67.70  ? 268  ASN A ND2   1 
ATOM   2065 N N     . ALA A 1 269 ? 4.694   -44.174 -40.182 1.00 72.57  ? 269  ALA A N     1 
ATOM   2066 C CA    . ALA A 1 269 ? 4.826   -45.072 -41.321 1.00 74.83  ? 269  ALA A CA    1 
ATOM   2067 C C     . ALA A 1 269 ? 3.991   -46.327 -41.102 1.00 77.47  ? 269  ALA A C     1 
ATOM   2068 O O     . ALA A 1 269 ? 3.732   -47.083 -42.035 1.00 81.24  ? 269  ALA A O     1 
ATOM   2069 C CB    . ALA A 1 269 ? 6.283   -45.433 -41.549 1.00 72.56  ? 269  ALA A CB    1 
ATOM   2070 N N     . ALA A 1 270 ? 3.563   -46.539 -39.862 1.00 75.66  ? 270  ALA A N     1 
ATOM   2071 C CA    . ALA A 1 270 ? 2.781   -47.718 -39.517 1.00 73.74  ? 270  ALA A CA    1 
ATOM   2072 C C     . ALA A 1 270 ? 1.293   -47.402 -39.392 1.00 76.13  ? 270  ALA A C     1 
ATOM   2073 O O     . ALA A 1 270 ? 0.521   -48.218 -38.889 1.00 82.71  ? 270  ALA A O     1 
ATOM   2074 C CB    . ALA A 1 270 ? 3.305   -48.343 -38.233 1.00 72.83  ? 270  ALA A CB    1 
ATOM   2075 N N     . SER A 1 271 ? 0.892   -46.222 -39.853 1.00 74.03  ? 271  SER A N     1 
ATOM   2076 C CA    . SER A 1 271 ? -0.509  -45.816 -39.785 1.00 75.62  ? 271  SER A CA    1 
ATOM   2077 C C     . SER A 1 271 ? -1.309  -46.269 -40.998 1.00 72.96  ? 271  SER A C     1 
ATOM   2078 O O     . SER A 1 271 ? -0.908  -46.039 -42.135 1.00 69.33  ? 271  SER A O     1 
ATOM   2079 C CB    . SER A 1 271 ? -0.632  -44.299 -39.651 1.00 75.39  ? 271  SER A CB    1 
ATOM   2080 O OG    . SER A 1 271 ? -1.929  -43.870 -40.035 1.00 72.02  ? 271  SER A OG    1 
ATOM   2081 N N     . PRO A 1 272 ? -2.464  -46.900 -40.752 1.00 76.54  ? 272  PRO A N     1 
ATOM   2082 C CA    . PRO A 1 272 ? -3.372  -47.318 -41.821 1.00 80.59  ? 272  PRO A CA    1 
ATOM   2083 C C     . PRO A 1 272 ? -4.213  -46.147 -42.309 1.00 90.71  ? 272  PRO A C     1 
ATOM   2084 O O     . PRO A 1 272 ? -4.988  -46.294 -43.255 1.00 97.83  ? 272  PRO A O     1 
ATOM   2085 C CB    . PRO A 1 272 ? -4.263  -48.345 -41.125 1.00 80.60  ? 272  PRO A CB    1 
ATOM   2086 C CG    . PRO A 1 272 ? -4.313  -47.880 -39.710 1.00 81.95  ? 272  PRO A CG    1 
ATOM   2087 C CD    . PRO A 1 272 ? -2.959  -47.287 -39.418 1.00 80.44  ? 272  PRO A CD    1 
ATOM   2088 N N     . ASN A 1 273 ? -4.048  -44.991 -41.673 1.00 91.10  ? 273  ASN A N     1 
ATOM   2089 C CA    . ASN A 1 273 ? -4.896  -43.836 -41.945 1.00 89.57  ? 273  ASN A CA    1 
ATOM   2090 C C     . ASN A 1 273 ? -4.161  -42.710 -42.652 1.00 90.67  ? 273  ASN A C     1 
ATOM   2091 O O     . ASN A 1 273 ? -4.521  -41.541 -42.509 1.00 94.95  ? 273  ASN A O     1 
ATOM   2092 C CB    . ASN A 1 273 ? -5.495  -43.314 -40.640 1.00 89.28  ? 273  ASN A CB    1 
ATOM   2093 C CG    . ASN A 1 273 ? -6.316  -44.361 -39.921 1.00 90.71  ? 273  ASN A CG    1 
ATOM   2094 O OD1   . ASN A 1 273 ? -7.181  -45.003 -40.518 1.00 95.23  ? 273  ASN A OD1   1 
ATOM   2095 N ND2   . ASN A 1 273 ? -6.038  -44.554 -38.636 1.00 87.30  ? 273  ASN A ND2   1 
ATOM   2096 N N     . LYS A 1 274 ? -3.141  -43.062 -43.425 1.00 85.34  ? 274  LYS A N     1 
ATOM   2097 C CA    . LYS A 1 274 ? -2.287  -42.059 -44.053 1.00 72.95  ? 274  LYS A CA    1 
ATOM   2098 C C     . LYS A 1 274 ? -3.049  -41.066 -44.920 1.00 71.82  ? 274  LYS A C     1 
ATOM   2099 O O     . LYS A 1 274 ? -2.621  -39.926 -45.081 1.00 79.74  ? 274  LYS A O     1 
ATOM   2100 C CB    . LYS A 1 274 ? -1.176  -42.723 -44.868 1.00 67.96  ? 274  LYS A CB    1 
ATOM   2101 C CG    . LYS A 1 274 ? -0.213  -43.547 -44.033 1.00 66.61  ? 274  LYS A CG    1 
ATOM   2102 C CD    . LYS A 1 274 ? 0.962   -44.021 -44.866 1.00 69.76  ? 274  LYS A CD    1 
ATOM   2103 C CE    . LYS A 1 274 ? 1.973   -44.761 -44.007 1.00 68.53  ? 274  LYS A CE    1 
ATOM   2104 N NZ    . LYS A 1 274 ? 1.401   -46.002 -43.427 1.00 65.92  ? 274  LYS A NZ    1 
ATOM   2105 N N     . GLU A 1 275 ? -4.174  -41.488 -45.481 1.00 72.01  ? 275  GLU A N     1 
ATOM   2106 C CA    . GLU A 1 275 ? -4.883  -40.631 -46.425 1.00 73.68  ? 275  GLU A CA    1 
ATOM   2107 C C     . GLU A 1 275 ? -5.785  -39.641 -45.700 1.00 75.87  ? 275  GLU A C     1 
ATOM   2108 O O     . GLU A 1 275 ? -5.965  -38.504 -46.146 1.00 74.63  ? 275  GLU A O     1 
ATOM   2109 C CB    . GLU A 1 275 ? -5.677  -41.463 -47.434 1.00 78.52  ? 275  GLU A CB    1 
ATOM   2110 C CG    . GLU A 1 275 ? -5.989  -40.716 -48.724 1.00 90.07  ? 275  GLU A CG    1 
ATOM   2111 C CD    . GLU A 1 275 ? -4.735  -40.268 -49.462 1.00 95.22  ? 275  GLU A CD    1 
ATOM   2112 O OE1   . GLU A 1 275 ? -4.846  -39.417 -50.371 1.00 92.25  ? 275  GLU A OE1   1 
ATOM   2113 O OE2   . GLU A 1 275 ? -3.638  -40.772 -49.137 1.00 99.63  ? 275  GLU A OE2   1 
ATOM   2114 N N     . LEU A 1 276 ? -6.344  -40.080 -44.576 1.00 80.93  ? 276  LEU A N     1 
ATOM   2115 C CA    . LEU A 1 276 ? -7.139  -39.208 -43.721 1.00 83.64  ? 276  LEU A CA    1 
ATOM   2116 C C     . LEU A 1 276 ? -6.224  -38.193 -43.053 1.00 82.02  ? 276  LEU A C     1 
ATOM   2117 O O     . LEU A 1 276 ? -6.506  -36.994 -43.044 1.00 83.13  ? 276  LEU A O     1 
ATOM   2118 C CB    . LEU A 1 276 ? -7.870  -40.023 -42.654 1.00 87.16  ? 276  LEU A CB    1 
ATOM   2119 C CG    . LEU A 1 276 ? -8.788  -41.147 -43.137 1.00 87.46  ? 276  LEU A CG    1 
ATOM   2120 C CD1   . LEU A 1 276 ? -9.383  -41.882 -41.950 1.00 84.07  ? 276  LEU A CD1   1 
ATOM   2121 C CD2   . LEU A 1 276 ? -9.882  -40.600 -44.043 1.00 89.32  ? 276  LEU A CD2   1 
ATOM   2122 N N     . ALA A 1 277 ? -5.124  -38.688 -42.492 1.00 76.20  ? 277  ALA A N     1 
ATOM   2123 C CA    . ALA A 1 277 ? -4.128  -37.829 -41.869 1.00 66.42  ? 277  ALA A CA    1 
ATOM   2124 C C     . ALA A 1 277 ? -3.665  -36.755 -42.850 1.00 66.34  ? 277  ALA A C     1 
ATOM   2125 O O     . ALA A 1 277 ? -3.533  -35.587 -42.484 1.00 65.31  ? 277  ALA A O     1 
ATOM   2126 C CB    . ALA A 1 277 ? -2.948  -38.651 -41.370 1.00 54.37  ? 277  ALA A CB    1 
ATOM   2127 N N     . LYS A 1 278 ? -3.433  -37.148 -44.099 1.00 70.05  ? 278  LYS A N     1 
ATOM   2128 C CA    . LYS A 1 278 ? -3.004  -36.191 -45.110 1.00 68.76  ? 278  LYS A CA    1 
ATOM   2129 C C     . LYS A 1 278 ? -4.084  -35.153 -45.365 1.00 77.42  ? 278  LYS A C     1 
ATOM   2130 O O     . LYS A 1 278 ? -3.792  -33.972 -45.543 1.00 83.81  ? 278  LYS A O     1 
ATOM   2131 C CB    . LYS A 1 278 ? -2.634  -36.882 -46.423 1.00 66.82  ? 278  LYS A CB    1 
ATOM   2132 C CG    . LYS A 1 278 ? -2.525  -35.896 -47.588 1.00 69.06  ? 278  LYS A CG    1 
ATOM   2133 C CD    . LYS A 1 278 ? -2.094  -36.557 -48.891 1.00 74.76  ? 278  LYS A CD    1 
ATOM   2134 C CE    . LYS A 1 278 ? -2.100  -35.549 -50.041 1.00 75.55  ? 278  LYS A CE    1 
ATOM   2135 N NZ    . LYS A 1 278 ? -1.610  -36.123 -51.329 1.00 76.05  ? 278  LYS A NZ    1 
ATOM   2136 N N     . GLU A 1 279 ? -5.336  -35.592 -45.388 1.00 83.40  ? 279  GLU A N     1 
ATOM   2137 C CA    . GLU A 1 279 ? -6.424  -34.670 -45.667 1.00 89.09  ? 279  GLU A CA    1 
ATOM   2138 C C     . GLU A 1 279 ? -6.631  -33.729 -44.489 1.00 81.33  ? 279  GLU A C     1 
ATOM   2139 O O     . GLU A 1 279 ? -6.839  -32.528 -44.666 1.00 81.33  ? 279  GLU A O     1 
ATOM   2140 C CB    . GLU A 1 279 ? -7.715  -35.421 -45.984 1.00 96.47  ? 279  GLU A CB    1 
ATOM   2141 C CG    . GLU A 1 279 ? -8.654  -34.625 -46.871 1.00 103.33 ? 279  GLU A CG    1 
ATOM   2142 C CD    . GLU A 1 279 ? -10.091 -34.690 -46.410 1.00 112.69 ? 279  GLU A CD    1 
ATOM   2143 O OE1   . GLU A 1 279 ? -10.436 -35.634 -45.666 1.00 118.88 ? 279  GLU A OE1   1 
ATOM   2144 O OE2   . GLU A 1 279 ? -10.874 -33.793 -46.788 1.00 112.68 ? 279  GLU A OE2   1 
ATOM   2145 N N     . PHE A 1 280 ? -6.569  -34.284 -43.285 1.00 75.05  ? 280  PHE A N     1 
ATOM   2146 C CA    . PHE A 1 280 ? -6.702  -33.492 -42.072 1.00 74.09  ? 280  PHE A CA    1 
ATOM   2147 C C     . PHE A 1 280 ? -5.684  -32.361 -42.036 1.00 76.60  ? 280  PHE A C     1 
ATOM   2148 O O     . PHE A 1 280 ? -5.990  -31.251 -41.602 1.00 77.07  ? 280  PHE A O     1 
ATOM   2149 C CB    . PHE A 1 280 ? -6.531  -34.372 -40.833 1.00 72.81  ? 280  PHE A CB    1 
ATOM   2150 C CG    . PHE A 1 280 ? -6.371  -33.593 -39.564 1.00 72.26  ? 280  PHE A CG    1 
ATOM   2151 C CD1   . PHE A 1 280 ? -7.480  -33.154 -38.860 1.00 77.53  ? 280  PHE A CD1   1 
ATOM   2152 C CD2   . PHE A 1 280 ? -5.111  -33.283 -39.081 1.00 71.99  ? 280  PHE A CD2   1 
ATOM   2153 C CE1   . PHE A 1 280 ? -7.335  -32.425 -37.694 1.00 78.48  ? 280  PHE A CE1   1 
ATOM   2154 C CE2   . PHE A 1 280 ? -4.959  -32.556 -37.919 1.00 71.68  ? 280  PHE A CE2   1 
ATOM   2155 C CZ    . PHE A 1 280 ? -6.072  -32.127 -37.222 1.00 75.89  ? 280  PHE A CZ    1 
ATOM   2156 N N     . LEU A 1 281 ? -4.472  -32.650 -42.498 1.00 75.08  ? 281  LEU A N     1 
ATOM   2157 C CA    . LEU A 1 281 ? -3.372  -31.697 -42.425 1.00 69.62  ? 281  LEU A CA    1 
ATOM   2158 C C     . LEU A 1 281 ? -3.409  -30.624 -43.506 1.00 66.14  ? 281  LEU A C     1 
ATOM   2159 O O     . LEU A 1 281 ? -3.152  -29.454 -43.233 1.00 71.94  ? 281  LEU A O     1 
ATOM   2160 C CB    . LEU A 1 281 ? -2.032  -32.430 -42.458 1.00 65.37  ? 281  LEU A CB    1 
ATOM   2161 C CG    . LEU A 1 281 ? -1.748  -33.229 -41.190 1.00 62.37  ? 281  LEU A CG    1 
ATOM   2162 C CD1   . LEU A 1 281 ? -0.474  -34.038 -41.331 1.00 57.47  ? 281  LEU A CD1   1 
ATOM   2163 C CD2   . LEU A 1 281 ? -1.664  -32.290 -40.000 1.00 67.00  ? 281  LEU A CD2   1 
ATOM   2164 N N     . GLU A 1 282 ? -3.724  -31.013 -44.734 1.00 65.22  ? 282  GLU A N     1 
ATOM   2165 C CA    . GLU A 1 282 ? -3.716  -30.057 -45.837 1.00 65.82  ? 282  GLU A CA    1 
ATOM   2166 C C     . GLU A 1 282 ? -4.994  -29.232 -45.896 1.00 69.77  ? 282  GLU A C     1 
ATOM   2167 O O     . GLU A 1 282 ? -4.974  -28.067 -46.291 1.00 73.58  ? 282  GLU A O     1 
ATOM   2168 C CB    . GLU A 1 282 ? -3.508  -30.769 -47.175 1.00 64.38  ? 282  GLU A CB    1 
ATOM   2169 C CG    . GLU A 1 282 ? -2.218  -31.558 -47.267 1.00 70.22  ? 282  GLU A CG    1 
ATOM   2170 C CD    . GLU A 1 282 ? -1.918  -32.024 -48.679 1.00 75.96  ? 282  GLU A CD    1 
ATOM   2171 O OE1   . GLU A 1 282 ? -2.426  -31.398 -49.636 1.00 82.40  ? 282  GLU A OE1   1 
ATOM   2172 O OE2   . GLU A 1 282 ? -1.171  -33.013 -48.831 1.00 71.59  ? 282  GLU A OE2   1 
ATOM   2173 N N     . ASN A 1 283 ? -6.105  -29.838 -45.499 1.00 72.95  ? 283  ASN A N     1 
ATOM   2174 C CA    . ASN A 1 283 ? -7.407  -29.223 -45.718 1.00 80.70  ? 283  ASN A CA    1 
ATOM   2175 C C     . ASN A 1 283 ? -8.056  -28.638 -44.470 1.00 71.58  ? 283  ASN A C     1 
ATOM   2176 O O     . ASN A 1 283 ? -8.923  -27.773 -44.566 1.00 73.11  ? 283  ASN A O     1 
ATOM   2177 C CB    . ASN A 1 283 ? -8.347  -30.218 -46.401 1.00 91.15  ? 283  ASN A CB    1 
ATOM   2178 C CG    . ASN A 1 283 ? -7.844  -30.644 -47.768 1.00 97.71  ? 283  ASN A CG    1 
ATOM   2179 O OD1   . ASN A 1 283 ? -7.213  -29.862 -48.481 1.00 97.65  ? 283  ASN A OD1   1 
ATOM   2180 N ND2   . ASN A 1 283 ? -8.116  -31.890 -48.138 1.00 99.10  ? 283  ASN A ND2   1 
ATOM   2181 N N     . TYR A 1 284 ? -7.637  -29.099 -43.300 1.00 60.74  ? 284  TYR A N     1 
ATOM   2182 C CA    . TYR A 1 284 ? -8.219  -28.597 -42.060 1.00 65.42  ? 284  TYR A CA    1 
ATOM   2183 C C     . TYR A 1 284 ? -7.247  -27.752 -41.246 1.00 65.69  ? 284  TYR A C     1 
ATOM   2184 O O     . TYR A 1 284 ? -7.478  -26.562 -41.044 1.00 71.42  ? 284  TYR A O     1 
ATOM   2185 C CB    . TYR A 1 284 ? -8.792  -29.745 -41.228 1.00 68.89  ? 284  TYR A CB    1 
ATOM   2186 C CG    . TYR A 1 284 ? -10.034 -30.341 -41.848 1.00 76.03  ? 284  TYR A CG    1 
ATOM   2187 C CD1   . TYR A 1 284 ? -9.952  -31.138 -42.981 1.00 79.84  ? 284  TYR A CD1   1 
ATOM   2188 C CD2   . TYR A 1 284 ? -11.290 -30.093 -41.311 1.00 80.91  ? 284  TYR A CD2   1 
ATOM   2189 C CE1   . TYR A 1 284 ? -11.084 -31.680 -43.557 1.00 86.05  ? 284  TYR A CE1   1 
ATOM   2190 C CE2   . TYR A 1 284 ? -12.428 -30.632 -41.878 1.00 85.85  ? 284  TYR A CE2   1 
ATOM   2191 C CZ    . TYR A 1 284 ? -12.320 -31.424 -43.002 1.00 87.69  ? 284  TYR A CZ    1 
ATOM   2192 O OH    . TYR A 1 284 ? -13.450 -31.962 -43.576 1.00 87.98  ? 284  TYR A OH    1 
ATOM   2193 N N     . LEU A 1 285 ? -6.160  -28.363 -40.788 1.00 60.54  ? 285  LEU A N     1 
ATOM   2194 C CA    . LEU A 1 285 ? -5.174  -27.650 -39.986 1.00 53.41  ? 285  LEU A CA    1 
ATOM   2195 C C     . LEU A 1 285 ? -4.521  -26.513 -40.762 1.00 56.90  ? 285  LEU A C     1 
ATOM   2196 O O     . LEU A 1 285 ? -4.587  -25.353 -40.355 1.00 56.25  ? 285  LEU A O     1 
ATOM   2197 C CB    . LEU A 1 285 ? -4.094  -28.607 -39.487 1.00 51.66  ? 285  LEU A CB    1 
ATOM   2198 C CG    . LEU A 1 285 ? -2.976  -27.912 -38.709 1.00 55.55  ? 285  LEU A CG    1 
ATOM   2199 C CD1   . LEU A 1 285 ? -3.553  -27.136 -37.531 1.00 51.36  ? 285  LEU A CD1   1 
ATOM   2200 C CD2   . LEU A 1 285 ? -1.935  -28.915 -38.243 1.00 57.14  ? 285  LEU A CD2   1 
ATOM   2201 N N     . LEU A 1 286 ? -3.896  -26.857 -41.886 1.00 57.72  ? 286  LEU A N     1 
ATOM   2202 C CA    . LEU A 1 286 ? -3.103  -25.899 -42.647 1.00 53.78  ? 286  LEU A CA    1 
ATOM   2203 C C     . LEU A 1 286 ? -3.935  -24.942 -43.493 1.00 60.03  ? 286  LEU A C     1 
ATOM   2204 O O     . LEU A 1 286 ? -3.683  -24.766 -44.685 1.00 65.52  ? 286  LEU A O     1 
ATOM   2205 C CB    . LEU A 1 286 ? -2.057  -26.617 -43.498 1.00 49.71  ? 286  LEU A CB    1 
ATOM   2206 C CG    . LEU A 1 286 ? -0.771  -26.909 -42.725 1.00 49.00  ? 286  LEU A CG    1 
ATOM   2207 C CD1   . LEU A 1 286 ? 0.203   -27.708 -43.560 1.00 45.63  ? 286  LEU A CD1   1 
ATOM   2208 C CD2   . LEU A 1 286 ? -0.134  -25.602 -42.267 1.00 52.18  ? 286  LEU A CD2   1 
ATOM   2209 N N     . THR A 1 287 ? -4.924  -24.324 -42.855 1.00 61.80  ? 287  THR A N     1 
ATOM   2210 C CA    . THR A 1 287 ? -5.706  -23.255 -43.459 1.00 63.63  ? 287  THR A CA    1 
ATOM   2211 C C     . THR A 1 287 ? -5.732  -22.080 -42.492 1.00 65.71  ? 287  THR A C     1 
ATOM   2212 O O     . THR A 1 287 ? -5.233  -22.181 -41.373 1.00 67.49  ? 287  THR A O     1 
ATOM   2213 C CB    . THR A 1 287 ? -7.149  -23.697 -43.725 1.00 68.79  ? 287  THR A CB    1 
ATOM   2214 O OG1   . THR A 1 287 ? -7.649  -24.400 -42.579 1.00 60.87  ? 287  THR A OG1   1 
ATOM   2215 C CG2   . THR A 1 287 ? -7.212  -24.607 -44.941 1.00 74.92  ? 287  THR A CG2   1 
ATOM   2216 N N     . ASP A 1 288 ? -6.314  -20.968 -42.919 1.00 63.97  ? 288  ASP A N     1 
ATOM   2217 C CA    . ASP A 1 288 ? -6.437  -19.814 -42.045 1.00 68.55  ? 288  ASP A CA    1 
ATOM   2218 C C     . ASP A 1 288 ? -7.290  -20.173 -40.831 1.00 73.98  ? 288  ASP A C     1 
ATOM   2219 O O     . ASP A 1 288 ? -6.909  -19.905 -39.692 1.00 80.10  ? 288  ASP A O     1 
ATOM   2220 C CB    . ASP A 1 288 ? -7.052  -18.627 -42.791 1.00 74.87  ? 288  ASP A CB    1 
ATOM   2221 C CG    . ASP A 1 288 ? -6.221  -18.187 -43.991 1.00 79.38  ? 288  ASP A CG    1 
ATOM   2222 O OD1   . ASP A 1 288 ? -6.805  -17.983 -45.077 1.00 81.89  ? 288  ASP A OD1   1 
ATOM   2223 O OD2   . ASP A 1 288 ? -4.989  -18.035 -43.852 1.00 80.35  ? 288  ASP A OD2   1 
ATOM   2224 N N     . GLU A 1 289 ? -8.437  -20.796 -41.080 1.00 66.69  ? 289  GLU A N     1 
ATOM   2225 C CA    . GLU A 1 289 ? -9.390  -21.105 -40.018 1.00 64.41  ? 289  GLU A CA    1 
ATOM   2226 C C     . GLU A 1 289 ? -8.868  -22.158 -39.037 1.00 68.82  ? 289  GLU A C     1 
ATOM   2227 O O     . GLU A 1 289 ? -9.282  -22.209 -37.875 1.00 65.33  ? 289  GLU A O     1 
ATOM   2228 C CB    . GLU A 1 289 ? -10.720 -21.559 -40.621 1.00 65.14  ? 289  GLU A CB    1 
ATOM   2229 N N     . GLY A 1 290 ? -7.962  -23.003 -39.513 1.00 69.92  ? 290  GLY A N     1 
ATOM   2230 C CA    . GLY A 1 290 ? -7.392  -24.044 -38.680 1.00 64.94  ? 290  GLY A CA    1 
ATOM   2231 C C     . GLY A 1 290 ? -6.237  -23.524 -37.851 1.00 59.55  ? 290  GLY A C     1 
ATOM   2232 O O     . GLY A 1 290 ? -6.152  -23.790 -36.656 1.00 60.26  ? 290  GLY A O     1 
ATOM   2233 N N     . LEU A 1 291 ? -5.341  -22.781 -38.490 1.00 54.93  ? 291  LEU A N     1 
ATOM   2234 C CA    . LEU A 1 291 ? -4.188  -22.229 -37.795 1.00 57.14  ? 291  LEU A CA    1 
ATOM   2235 C C     . LEU A 1 291 ? -4.608  -21.188 -36.764 1.00 62.56  ? 291  LEU A C     1 
ATOM   2236 O O     . LEU A 1 291 ? -3.896  -20.942 -35.794 1.00 64.32  ? 291  LEU A O     1 
ATOM   2237 C CB    . LEU A 1 291 ? -3.192  -21.625 -38.787 1.00 55.03  ? 291  LEU A CB    1 
ATOM   2238 C CG    . LEU A 1 291 ? -2.467  -22.637 -39.676 1.00 54.76  ? 291  LEU A CG    1 
ATOM   2239 C CD1   . LEU A 1 291 ? -1.454  -21.929 -40.561 1.00 51.79  ? 291  LEU A CD1   1 
ATOM   2240 C CD2   . LEU A 1 291 ? -1.791  -23.710 -38.831 1.00 49.18  ? 291  LEU A CD2   1 
ATOM   2241 N N     . GLU A 1 292 ? -5.769  -20.579 -36.970 1.00 65.23  ? 292  GLU A N     1 
ATOM   2242 C CA    . GLU A 1 292 ? -6.271  -19.605 -36.017 1.00 69.54  ? 292  GLU A CA    1 
ATOM   2243 C C     . GLU A 1 292 ? -6.747  -20.314 -34.757 1.00 66.97  ? 292  GLU A C     1 
ATOM   2244 O O     . GLU A 1 292 ? -6.459  -19.882 -33.643 1.00 71.56  ? 292  GLU A O     1 
ATOM   2245 C CB    . GLU A 1 292 ? -7.405  -18.786 -36.622 1.00 79.70  ? 292  GLU A CB    1 
ATOM   2246 C CG    . GLU A 1 292 ? -7.814  -17.596 -35.776 1.00 91.14  ? 292  GLU A CG    1 
ATOM   2247 C CD    . GLU A 1 292 ? -9.050  -16.904 -36.310 1.00 104.32 ? 292  GLU A CD    1 
ATOM   2248 O OE1   . GLU A 1 292 ? -9.648  -17.417 -37.279 1.00 108.56 ? 292  GLU A OE1   1 
ATOM   2249 O OE2   . GLU A 1 292 ? -9.425  -15.848 -35.761 1.00 110.57 ? 292  GLU A OE2   1 
ATOM   2250 N N     . ALA A 1 293 ? -7.475  -21.409 -34.940 1.00 61.11  ? 293  ALA A N     1 
ATOM   2251 C CA    . ALA A 1 293 ? -7.972  -22.183 -33.809 1.00 58.96  ? 293  ALA A CA    1 
ATOM   2252 C C     . ALA A 1 293 ? -6.832  -22.587 -32.883 1.00 58.54  ? 293  ALA A C     1 
ATOM   2253 O O     . ALA A 1 293 ? -6.951  -22.489 -31.662 1.00 60.15  ? 293  ALA A O     1 
ATOM   2254 C CB    . ALA A 1 293 ? -8.733  -23.416 -34.290 1.00 56.61  ? 293  ALA A CB    1 
ATOM   2255 N N     . VAL A 1 294 ? -5.727  -23.043 -33.463 1.00 54.73  ? 294  VAL A N     1 
ATOM   2256 C CA    . VAL A 1 294 ? -4.584  -23.453 -32.658 1.00 53.68  ? 294  VAL A CA    1 
ATOM   2257 C C     . VAL A 1 294 ? -3.927  -22.226 -32.067 1.00 50.86  ? 294  VAL A C     1 
ATOM   2258 O O     . VAL A 1 294 ? -3.591  -22.191 -30.889 1.00 54.55  ? 294  VAL A O     1 
ATOM   2259 C CB    . VAL A 1 294 ? -3.538  -24.218 -33.481 1.00 51.43  ? 294  VAL A CB    1 
ATOM   2260 C CG1   . VAL A 1 294 ? -2.348  -24.576 -32.603 1.00 44.94  ? 294  VAL A CG1   1 
ATOM   2261 C CG2   . VAL A 1 294 ? -4.152  -25.467 -34.081 1.00 50.96  ? 294  VAL A CG2   1 
ATOM   2262 N N     . ASN A 1 295 ? -3.763  -21.210 -32.905 1.00 52.21  ? 295  ASN A N     1 
ATOM   2263 C CA    . ASN A 1 295 ? -3.084  -19.990 -32.513 1.00 47.81  ? 295  ASN A CA    1 
ATOM   2264 C C     . ASN A 1 295 ? -3.788  -19.298 -31.357 1.00 53.56  ? 295  ASN A C     1 
ATOM   2265 O O     . ASN A 1 295 ? -3.140  -18.785 -30.441 1.00 51.33  ? 295  ASN A O     1 
ATOM   2266 C CB    . ASN A 1 295 ? -2.994  -19.045 -33.704 1.00 51.97  ? 295  ASN A CB    1 
ATOM   2267 C CG    . ASN A 1 295 ? -1.925  -18.008 -33.531 1.00 58.25  ? 295  ASN A CG    1 
ATOM   2268 O OD1   . ASN A 1 295 ? -0.738  -18.297 -33.687 1.00 57.91  ? 295  ASN A OD1   1 
ATOM   2269 N ND2   . ASN A 1 295 ? -2.333  -16.786 -33.202 1.00 60.37  ? 295  ASN A ND2   1 
ATOM   2270 N N     . LYS A 1 296 ? -5.116  -19.290 -31.404 1.00 55.14  ? 296  LYS A N     1 
ATOM   2271 C CA    . LYS A 1 296 ? -5.912  -18.614 -30.387 1.00 61.60  ? 296  LYS A CA    1 
ATOM   2272 C C     . LYS A 1 296 ? -5.788  -19.311 -29.043 1.00 61.60  ? 296  LYS A C     1 
ATOM   2273 O O     . LYS A 1 296 ? -5.982  -18.698 -27.994 1.00 60.64  ? 296  LYS A O     1 
ATOM   2274 C CB    . LYS A 1 296 ? -7.378  -18.523 -30.811 1.00 70.68  ? 296  LYS A CB    1 
ATOM   2275 C CG    . LYS A 1 296 ? -7.705  -17.283 -31.634 1.00 80.17  ? 296  LYS A CG    1 
ATOM   2276 C CD    . LYS A 1 296 ? -9.205  -17.144 -31.862 1.00 90.46  ? 296  LYS A CD    1 
ATOM   2277 C CE    . LYS A 1 296 ? -9.994  -17.323 -30.565 1.00 99.50  ? 296  LYS A CE    1 
ATOM   2278 N NZ    . LYS A 1 296 ? -9.602  -16.359 -29.492 1.00 100.10 ? 296  LYS A NZ    1 
ATOM   2279 N N     . ASP A 1 297 ? -5.460  -20.596 -29.085 1.00 58.63  ? 297  ASP A N     1 
ATOM   2280 C CA    . ASP A 1 297 ? -5.235  -21.371 -27.875 1.00 59.59  ? 297  ASP A CA    1 
ATOM   2281 C C     . ASP A 1 297 ? -3.836  -21.074 -27.333 1.00 57.17  ? 297  ASP A C     1 
ATOM   2282 O O     . ASP A 1 297 ? -3.677  -20.622 -26.202 1.00 53.82  ? 297  ASP A O     1 
ATOM   2283 C CB    . ASP A 1 297 ? -5.400  -22.863 -28.169 1.00 57.06  ? 297  ASP A CB    1 
ATOM   2284 C CG    . ASP A 1 297 ? -5.215  -23.719 -26.940 1.00 60.11  ? 297  ASP A CG    1 
ATOM   2285 O OD1   . ASP A 1 297 ? -5.229  -23.154 -25.827 1.00 62.10  ? 297  ASP A OD1   1 
ATOM   2286 O OD2   . ASP A 1 297 ? -5.063  -24.953 -27.085 1.00 58.58  ? 297  ASP A OD2   1 
ATOM   2287 N N     . LYS A 1 298 ? -2.826  -21.330 -28.155 1.00 54.57  ? 298  LYS A N     1 
ATOM   2288 C CA    . LYS A 1 298 ? -1.453  -20.965 -27.836 1.00 49.35  ? 298  LYS A CA    1 
ATOM   2289 C C     . LYS A 1 298 ? -0.789  -20.505 -29.127 1.00 50.43  ? 298  LYS A C     1 
ATOM   2290 O O     . LYS A 1 298 ? -0.733  -21.264 -30.095 1.00 47.45  ? 298  LYS A O     1 
ATOM   2291 C CB    . LYS A 1 298 ? -0.693  -22.164 -27.271 1.00 40.20  ? 298  LYS A CB    1 
ATOM   2292 C CG    . LYS A 1 298 ? -1.381  -22.860 -26.119 1.00 44.32  ? 298  LYS A CG    1 
ATOM   2293 C CD    . LYS A 1 298 ? -0.828  -22.406 -24.781 1.00 55.83  ? 298  LYS A CD    1 
ATOM   2294 C CE    . LYS A 1 298 ? -1.510  -23.142 -23.631 1.00 63.60  ? 298  LYS A CE    1 
ATOM   2295 N NZ    . LYS A 1 298 ? -0.828  -22.900 -22.330 1.00 66.25  ? 298  LYS A NZ    1 
ATOM   2296 N N     . PRO A 1 299 ? -0.288  -19.261 -29.153 1.00 46.26  ? 299  PRO A N     1 
ATOM   2297 C CA    . PRO A 1 299 ? 0.330   -18.735 -30.377 1.00 41.74  ? 299  PRO A CA    1 
ATOM   2298 C C     . PRO A 1 299 ? 1.384   -19.691 -30.917 1.00 43.07  ? 299  PRO A C     1 
ATOM   2299 O O     . PRO A 1 299 ? 2.092   -20.337 -30.137 1.00 39.32  ? 299  PRO A O     1 
ATOM   2300 C CB    . PRO A 1 299 ? 0.975   -17.431 -29.909 1.00 40.98  ? 299  PRO A CB    1 
ATOM   2301 C CG    . PRO A 1 299 ? 0.140   -17.008 -28.732 1.00 45.54  ? 299  PRO A CG    1 
ATOM   2302 C CD    . PRO A 1 299 ? -0.269  -18.283 -28.050 1.00 45.30  ? 299  PRO A CD    1 
ATOM   2303 N N     . LEU A 1 300 ? 1.474   -19.779 -32.242 1.00 46.06  ? 300  LEU A N     1 
ATOM   2304 C CA    . LEU A 1 300 ? 2.350   -20.734 -32.909 1.00 40.26  ? 300  LEU A CA    1 
ATOM   2305 C C     . LEU A 1 300 ? 3.686   -20.125 -33.303 1.00 39.18  ? 300  LEU A C     1 
ATOM   2306 O O     . LEU A 1 300 ? 4.653   -20.843 -33.550 1.00 39.97  ? 300  LEU A O     1 
ATOM   2307 C CB    . LEU A 1 300 ? 1.664   -21.260 -34.169 1.00 46.82  ? 300  LEU A CB    1 
ATOM   2308 C CG    . LEU A 1 300 ? 0.713   -22.447 -34.026 1.00 43.70  ? 300  LEU A CG    1 
ATOM   2309 C CD1   . LEU A 1 300 ? -0.228  -22.504 -35.213 1.00 42.84  ? 300  LEU A CD1   1 
ATOM   2310 C CD2   . LEU A 1 300 ? 1.513   -23.724 -33.916 1.00 38.41  ? 300  LEU A CD2   1 
ATOM   2311 N N     . GLY A 1 301 ? 3.735   -18.798 -33.367 1.00 38.27  ? 301  GLY A N     1 
ATOM   2312 C CA    . GLY A 1 301 ? 4.878   -18.107 -33.939 1.00 41.63  ? 301  GLY A CA    1 
ATOM   2313 C C     . GLY A 1 301 ? 4.573   -17.717 -35.378 1.00 44.80  ? 301  GLY A C     1 
ATOM   2314 O O     . GLY A 1 301 ? 3.416   -17.480 -35.721 1.00 46.04  ? 301  GLY A O     1 
ATOM   2315 N N     . ALA A 1 302 ? 5.600   -17.655 -36.220 1.00 41.50  ? 302  ALA A N     1 
ATOM   2316 C CA    . ALA A 1 302 ? 5.409   -17.279 -37.623 1.00 41.43  ? 302  ALA A CA    1 
ATOM   2317 C C     . ALA A 1 302 ? 5.006   -18.485 -38.466 1.00 39.61  ? 302  ALA A C     1 
ATOM   2318 O O     . ALA A 1 302 ? 5.845   -19.294 -38.869 1.00 42.30  ? 302  ALA A O     1 
ATOM   2319 C CB    . ALA A 1 302 ? 6.661   -16.624 -38.180 1.00 35.56  ? 302  ALA A CB    1 
ATOM   2320 N N     . VAL A 1 303 ? 3.708   -18.595 -38.722 1.00 37.30  ? 303  VAL A N     1 
ATOM   2321 C CA    . VAL A 1 303 ? 3.143   -19.779 -39.355 1.00 44.98  ? 303  VAL A CA    1 
ATOM   2322 C C     . VAL A 1 303 ? 3.620   -19.961 -40.794 1.00 49.75  ? 303  VAL A C     1 
ATOM   2323 O O     . VAL A 1 303 ? 3.979   -19.002 -41.484 1.00 49.36  ? 303  VAL A O     1 
ATOM   2324 C CB    . VAL A 1 303 ? 1.609   -19.751 -39.320 1.00 44.87  ? 303  VAL A CB    1 
ATOM   2325 C CG1   . VAL A 1 303 ? 1.124   -19.564 -37.897 1.00 40.82  ? 303  VAL A CG1   1 
ATOM   2326 C CG2   . VAL A 1 303 ? 1.083   -18.633 -40.207 1.00 41.30  ? 303  VAL A CG2   1 
ATOM   2327 N N     . ALA A 1 304 ? 3.614   -21.211 -41.234 1.00 51.20  ? 304  ALA A N     1 
ATOM   2328 C CA    . ALA A 1 304 ? 4.169   -21.581 -42.522 1.00 49.59  ? 304  ALA A CA    1 
ATOM   2329 C C     . ALA A 1 304 ? 3.228   -21.203 -43.656 1.00 51.44  ? 304  ALA A C     1 
ATOM   2330 O O     . ALA A 1 304 ? 3.653   -21.055 -44.795 1.00 53.31  ? 304  ALA A O     1 
ATOM   2331 C CB    . ALA A 1 304 ? 4.463   -23.075 -42.544 1.00 39.54  ? 304  ALA A CB    1 
ATOM   2332 N N     . LEU A 1 305 ? 1.948   -21.045 -43.335 1.00 52.89  ? 305  LEU A N     1 
ATOM   2333 C CA    . LEU A 1 305 ? 0.930   -20.775 -44.344 1.00 56.17  ? 305  LEU A CA    1 
ATOM   2334 C C     . LEU A 1 305 ? 0.998   -19.331 -44.824 1.00 60.21  ? 305  LEU A C     1 
ATOM   2335 O O     . LEU A 1 305 ? 0.798   -18.399 -44.045 1.00 65.22  ? 305  LEU A O     1 
ATOM   2336 C CB    . LEU A 1 305 ? -0.459  -21.085 -43.787 1.00 55.81  ? 305  LEU A CB    1 
ATOM   2337 C CG    . LEU A 1 305 ? -1.603  -21.201 -44.795 1.00 55.87  ? 305  LEU A CG    1 
ATOM   2338 C CD1   . LEU A 1 305 ? -1.322  -22.305 -45.794 1.00 50.81  ? 305  LEU A CD1   1 
ATOM   2339 C CD2   . LEU A 1 305 ? -2.910  -21.464 -44.073 1.00 57.71  ? 305  LEU A CD2   1 
ATOM   2340 N N     . LYS A 1 306 ? 1.277   -19.151 -46.113 1.00 59.73  ? 306  LYS A N     1 
ATOM   2341 C CA    . LYS A 1 306 ? 1.446   -17.819 -46.687 1.00 61.40  ? 306  LYS A CA    1 
ATOM   2342 C C     . LYS A 1 306 ? 0.258   -16.886 -46.437 1.00 67.16  ? 306  LYS A C     1 
ATOM   2343 O O     . LYS A 1 306 ? 0.442   -15.690 -46.219 1.00 71.88  ? 306  LYS A O     1 
ATOM   2344 C CB    . LYS A 1 306 ? 1.731   -17.912 -48.187 1.00 63.10  ? 306  LYS A CB    1 
ATOM   2345 C CG    . LYS A 1 306 ? 3.091   -18.503 -48.536 1.00 63.15  ? 306  LYS A CG    1 
ATOM   2346 C CD    . LYS A 1 306 ? 3.325   -18.496 -50.046 1.00 59.66  ? 306  LYS A CD    1 
ATOM   2347 C CE    . LYS A 1 306 ? 4.675   -19.102 -50.411 1.00 60.13  ? 306  LYS A CE    1 
ATOM   2348 N NZ    . LYS A 1 306 ? 4.878   -19.211 -51.889 1.00 61.99  ? 306  LYS A NZ    1 
ATOM   2349 N N     . SER A 1 307 ? -0.954  -17.431 -46.465 1.00 69.21  ? 307  SER A N     1 
ATOM   2350 C CA    . SER A 1 307 ? -2.163  -16.610 -46.381 1.00 72.62  ? 307  SER A CA    1 
ATOM   2351 C C     . SER A 1 307 ? -2.414  -16.007 -44.996 1.00 80.14  ? 307  SER A C     1 
ATOM   2352 O O     . SER A 1 307 ? -3.131  -15.013 -44.862 1.00 83.15  ? 307  SER A O     1 
ATOM   2353 C CB    . SER A 1 307 ? -3.386  -17.411 -46.838 1.00 71.01  ? 307  SER A CB    1 
ATOM   2354 O OG    . SER A 1 307 ? -3.551  -18.585 -46.064 1.00 70.50  ? 307  SER A OG    1 
ATOM   2355 N N     . TYR A 1 308 ? -1.827  -16.607 -43.969 1.00 79.82  ? 308  TYR A N     1 
ATOM   2356 C CA    . TYR A 1 308 ? -2.023  -16.133 -42.607 1.00 81.98  ? 308  TYR A CA    1 
ATOM   2357 C C     . TYR A 1 308 ? -1.221  -14.861 -42.357 1.00 92.25  ? 308  TYR A C     1 
ATOM   2358 O O     . TYR A 1 308 ? -1.472  -14.145 -41.390 1.00 96.35  ? 308  TYR A O     1 
ATOM   2359 C CB    . TYR A 1 308 ? -1.613  -17.211 -41.608 1.00 74.26  ? 308  TYR A CB    1 
ATOM   2360 C CG    . TYR A 1 308 ? -2.339  -17.138 -40.284 1.00 80.74  ? 308  TYR A CG    1 
ATOM   2361 C CD1   . TYR A 1 308 ? -3.454  -17.928 -40.041 1.00 79.06  ? 308  TYR A CD1   1 
ATOM   2362 C CD2   . TYR A 1 308 ? -1.909  -16.283 -39.275 1.00 83.92  ? 308  TYR A CD2   1 
ATOM   2363 C CE1   . TYR A 1 308 ? -4.121  -17.870 -38.832 1.00 78.56  ? 308  TYR A CE1   1 
ATOM   2364 C CE2   . TYR A 1 308 ? -2.573  -16.218 -38.060 1.00 79.74  ? 308  TYR A CE2   1 
ATOM   2365 C CZ    . TYR A 1 308 ? -3.679  -17.015 -37.846 1.00 77.91  ? 308  TYR A CZ    1 
ATOM   2366 O OH    . TYR A 1 308 ? -4.350  -16.959 -36.644 1.00 80.13  ? 308  TYR A OH    1 
ATOM   2367 N N     . GLU A 1 309 ? -0.259  -14.591 -43.236 1.00 99.89  ? 309  GLU A N     1 
ATOM   2368 C CA    . GLU A 1 309 ? 0.616   -13.426 -43.115 1.00 108.31 ? 309  GLU A CA    1 
ATOM   2369 C C     . GLU A 1 309 ? -0.128  -12.196 -42.613 1.00 115.94 ? 309  GLU A C     1 
ATOM   2370 O O     . GLU A 1 309 ? 0.447   -11.354 -41.924 1.00 117.65 ? 309  GLU A O     1 
ATOM   2371 C CB    . GLU A 1 309 ? 1.278   -13.110 -44.458 1.00 108.16 ? 309  GLU A CB    1 
ATOM   2372 N N     . GLU A 1 310 ? -1.407  -12.102 -42.967 1.00 120.28 ? 310  GLU A N     1 
ATOM   2373 C CA    . GLU A 1 310 ? -2.261  -11.004 -42.528 1.00 120.88 ? 310  GLU A CA    1 
ATOM   2374 C C     . GLU A 1 310 ? -2.118  -10.731 -41.032 1.00 119.64 ? 310  GLU A C     1 
ATOM   2375 O O     . GLU A 1 310 ? -1.565  -9.707  -40.630 1.00 121.78 ? 310  GLU A O     1 
ATOM   2376 C CB    . GLU A 1 310 ? -3.724  -11.302 -42.867 1.00 120.41 ? 310  GLU A CB    1 
ATOM   2377 N N     . GLU A 1 311 ? -2.613  -11.654 -40.214 1.00 114.84 ? 311  GLU A N     1 
ATOM   2378 C CA    . GLU A 1 311 ? -2.608  -11.475 -38.766 1.00 109.03 ? 311  GLU A CA    1 
ATOM   2379 C C     . GLU A 1 311 ? -1.204  -11.271 -38.190 1.00 111.66 ? 311  GLU A C     1 
ATOM   2380 O O     . GLU A 1 311 ? -1.001  -10.415 -37.329 1.00 113.01 ? 311  GLU A O     1 
ATOM   2381 C CB    . GLU A 1 311 ? -3.297  -12.657 -38.081 1.00 103.44 ? 311  GLU A CB    1 
ATOM   2382 N N     . LEU A 1 312 ? -0.239  -12.049 -38.674 1.00 111.97 ? 312  LEU A N     1 
ATOM   2383 C CA    . LEU A 1 312 ? 1.115   -12.043 -38.114 1.00 109.98 ? 312  LEU A CA    1 
ATOM   2384 C C     . LEU A 1 312 ? 1.849   -10.711 -38.254 1.00 113.83 ? 312  LEU A C     1 
ATOM   2385 O O     . LEU A 1 312 ? 2.676   -10.361 -37.410 1.00 113.46 ? 312  LEU A O     1 
ATOM   2386 C CB    . LEU A 1 312 ? 1.961   -13.163 -38.727 1.00 104.11 ? 312  LEU A CB    1 
ATOM   2387 C CG    . LEU A 1 312 ? 1.515   -14.599 -38.446 1.00 99.46  ? 312  LEU A CG    1 
ATOM   2388 C CD1   . LEU A 1 312 ? 2.650   -15.563 -38.755 1.00 95.50  ? 312  LEU A CD1   1 
ATOM   2389 C CD2   . LEU A 1 312 ? 1.048   -14.766 -36.998 1.00 95.51  ? 312  LEU A CD2   1 
ATOM   2390 N N     . ALA A 1 313 ? 1.556   -9.979  -39.323 1.00 116.03 ? 313  ALA A N     1 
ATOM   2391 C CA    . ALA A 1 313 ? 2.212   -8.699  -39.571 1.00 115.13 ? 313  ALA A CA    1 
ATOM   2392 C C     . ALA A 1 313 ? 1.916   -7.698  -38.458 1.00 109.13 ? 313  ALA A C     1 
ATOM   2393 O O     . ALA A 1 313 ? 2.789   -6.929  -38.048 1.00 109.04 ? 313  ALA A O     1 
ATOM   2394 C CB    . ALA A 1 313 ? 1.784   -8.136  -40.922 1.00 116.39 ? 313  ALA A CB    1 
ATOM   2395 N N     . LYS A 1 314 ? 0.681   -7.719  -37.969 1.00 101.13 ? 314  LYS A N     1 
ATOM   2396 C CA    . LYS A 1 314 ? 0.243   -6.780  -36.943 1.00 96.71  ? 314  LYS A CA    1 
ATOM   2397 C C     . LYS A 1 314 ? 0.914   -7.020  -35.587 1.00 91.52  ? 314  LYS A C     1 
ATOM   2398 O O     . LYS A 1 314 ? 1.163   -6.076  -34.838 1.00 91.66  ? 314  LYS A O     1 
ATOM   2399 C CB    . LYS A 1 314 ? -1.279  -6.837  -36.792 1.00 96.43  ? 314  LYS A CB    1 
ATOM   2400 N N     . ASP A 1 315 ? 1.212   -8.281  -35.285 1.00 82.83  ? 315  ASP A N     1 
ATOM   2401 C CA    . ASP A 1 315 ? 1.689   -8.677  -33.959 1.00 65.05  ? 315  ASP A CA    1 
ATOM   2402 C C     . ASP A 1 315 ? 3.193   -8.472  -33.766 1.00 51.56  ? 315  ASP A C     1 
ATOM   2403 O O     . ASP A 1 315 ? 4.004   -9.220  -34.307 1.00 56.47  ? 315  ASP A O     1 
ATOM   2404 C CB    . ASP A 1 315 ? 1.326   -10.139 -33.697 1.00 64.15  ? 315  ASP A CB    1 
ATOM   2405 C CG    . ASP A 1 315 ? 1.491   -10.530 -32.245 1.00 58.34  ? 315  ASP A CG    1 
ATOM   2406 O OD1   . ASP A 1 315 ? 2.138   -9.773  -31.489 1.00 54.50  ? 315  ASP A OD1   1 
ATOM   2407 O OD2   . ASP A 1 315 ? 0.979   -11.604 -31.866 1.00 55.99  ? 315  ASP A OD2   1 
ATOM   2408 N N     . PRO A 1 316 ? 3.568   -7.460  -32.974 1.00 48.14  ? 316  PRO A N     1 
ATOM   2409 C CA    . PRO A 1 316 ? 4.984   -7.154  -32.730 1.00 49.99  ? 316  PRO A CA    1 
ATOM   2410 C C     . PRO A 1 316 ? 5.719   -8.254  -31.958 1.00 53.30  ? 316  PRO A C     1 
ATOM   2411 O O     . PRO A 1 316 ? 6.950   -8.292  -31.984 1.00 58.14  ? 316  PRO A O     1 
ATOM   2412 C CB    . PRO A 1 316 ? 4.933   -5.853  -31.914 1.00 51.44  ? 316  PRO A CB    1 
ATOM   2413 C CG    . PRO A 1 316 ? 3.574   -5.826  -31.304 1.00 54.32  ? 316  PRO A CG    1 
ATOM   2414 C CD    . PRO A 1 316 ? 2.663   -6.535  -32.268 1.00 52.36  ? 316  PRO A CD    1 
ATOM   2415 N N     . ARG A 1 317 ? 4.983   -9.131  -31.281 1.00 45.50  ? 317  ARG A N     1 
ATOM   2416 C CA    . ARG A 1 317 ? 5.612   -10.264 -30.605 1.00 45.59  ? 317  ARG A CA    1 
ATOM   2417 C C     . ARG A 1 317 ? 6.179   -11.204 -31.648 1.00 43.60  ? 317  ARG A C     1 
ATOM   2418 O O     . ARG A 1 317 ? 7.278   -11.731 -31.487 1.00 43.11  ? 317  ARG A O     1 
ATOM   2419 C CB    . ARG A 1 317 ? 4.613   -11.009 -29.724 1.00 36.69  ? 317  ARG A CB    1 
ATOM   2420 C CG    . ARG A 1 317 ? 3.976   -10.140 -28.676 1.00 34.27  ? 317  ARG A CG    1 
ATOM   2421 C CD    . ARG A 1 317 ? 2.867   -10.887 -27.990 1.00 35.80  ? 317  ARG A CD    1 
ATOM   2422 N NE    . ARG A 1 317 ? 1.826   -11.284 -28.928 1.00 35.15  ? 317  ARG A NE    1 
ATOM   2423 C CZ    . ARG A 1 317 ? 0.783   -12.041 -28.603 1.00 45.25  ? 317  ARG A CZ    1 
ATOM   2424 N NH1   . ARG A 1 317 ? 0.647   -12.492 -27.359 1.00 44.29  ? 317  ARG A NH1   1 
ATOM   2425 N NH2   . ARG A 1 317 ? -0.119  -12.355 -29.523 1.00 44.50  ? 317  ARG A NH2   1 
ATOM   2426 N N     . ILE A 1 318 ? 5.417   -11.403 -32.720 1.00 47.54  ? 318  ILE A N     1 
ATOM   2427 C CA    . ILE A 1 318 ? 5.875   -12.202 -33.848 1.00 49.00  ? 318  ILE A CA    1 
ATOM   2428 C C     . ILE A 1 318 ? 7.081   -11.535 -34.497 1.00 45.77  ? 318  ILE A C     1 
ATOM   2429 O O     . ILE A 1 318 ? 7.986   -12.212 -34.981 1.00 50.56  ? 318  ILE A O     1 
ATOM   2430 C CB    . ILE A 1 318 ? 4.769   -12.383 -34.900 1.00 53.28  ? 318  ILE A CB    1 
ATOM   2431 C CG1   . ILE A 1 318 ? 3.592   -13.154 -34.305 1.00 47.84  ? 318  ILE A CG1   1 
ATOM   2432 C CG2   . ILE A 1 318 ? 5.306   -13.127 -36.108 1.00 45.02  ? 318  ILE A CG2   1 
ATOM   2433 C CD1   . ILE A 1 318 ? 3.886   -14.598 -34.101 1.00 55.02  ? 318  ILE A CD1   1 
ATOM   2434 N N     . ALA A 1 319 ? 7.094   -10.204 -34.488 1.00 44.36  ? 319  ALA A N     1 
ATOM   2435 C CA    . ALA A 1 319 ? 8.207   -9.445  -35.056 1.00 47.76  ? 319  ALA A CA    1 
ATOM   2436 C C     . ALA A 1 319 ? 9.476   -9.678  -34.250 1.00 47.04  ? 319  ALA A C     1 
ATOM   2437 O O     . ALA A 1 319 ? 10.543  -9.927  -34.812 1.00 44.08  ? 319  ALA A O     1 
ATOM   2438 C CB    . ALA A 1 319 ? 7.873   -7.952  -35.109 1.00 47.35  ? 319  ALA A CB    1 
ATOM   2439 N N     . ALA A 1 320 ? 9.355   -9.596  -32.927 1.00 46.40  ? 320  ALA A N     1 
ATOM   2440 C CA    . ALA A 1 320 ? 10.469  -9.925  -32.042 1.00 40.46  ? 320  ALA A CA    1 
ATOM   2441 C C     . ALA A 1 320 ? 10.954  -11.352 -32.305 1.00 34.53  ? 320  ALA A C     1 
ATOM   2442 O O     . ALA A 1 320 ? 12.156  -11.607 -32.410 1.00 37.84  ? 320  ALA A O     1 
ATOM   2443 C CB    . ALA A 1 320 ? 10.059  -9.753  -30.589 1.00 45.84  ? 320  ALA A CB    1 
ATOM   2444 N N     . THR A 1 321 ? 10.007  -12.277 -32.415 1.00 35.76  ? 321  THR A N     1 
ATOM   2445 C CA    . THR A 1 321 ? 10.318  -13.674 -32.699 1.00 41.43  ? 321  THR A CA    1 
ATOM   2446 C C     . THR A 1 321 ? 11.148  -13.789 -33.989 1.00 48.51  ? 321  THR A C     1 
ATOM   2447 O O     . THR A 1 321 ? 12.215  -14.412 -34.004 1.00 45.59  ? 321  THR A O     1 
ATOM   2448 C CB    . THR A 1 321 ? 9.019   -14.505 -32.840 1.00 37.77  ? 321  THR A CB    1 
ATOM   2449 O OG1   . THR A 1 321 ? 8.220   -14.367 -31.660 1.00 39.70  ? 321  THR A OG1   1 
ATOM   2450 C CG2   . THR A 1 321 ? 9.324   -15.978 -33.088 1.00 29.72  ? 321  THR A CG2   1 
ATOM   2451 N N     . MET A 1 322 ? 10.648  -13.180 -35.062 1.00 44.79  ? 322  MET A N     1 
ATOM   2452 C CA    . MET A 1 322 ? 11.339  -13.157 -36.353 1.00 48.05  ? 322  MET A CA    1 
ATOM   2453 C C     . MET A 1 322 ? 12.733  -12.550 -36.240 1.00 38.93  ? 322  MET A C     1 
ATOM   2454 O O     . MET A 1 322 ? 13.703  -13.072 -36.793 1.00 37.02  ? 322  MET A O     1 
ATOM   2455 C CB    . MET A 1 322 ? 10.521  -12.362 -37.375 1.00 55.97  ? 322  MET A CB    1 
ATOM   2456 C CG    . MET A 1 322 ? 9.553   -13.203 -38.191 1.00 62.20  ? 322  MET A CG    1 
ATOM   2457 S SD    . MET A 1 322 ? 10.400  -14.486 -39.136 1.00 117.70 ? 322  MET A SD    1 
ATOM   2458 C CE    . MET A 1 322 ? 9.932   -15.929 -38.201 1.00 45.47  ? 322  MET A CE    1 
ATOM   2459 N N     . GLU A 1 323 ? 12.817  -11.439 -35.518 1.00 36.10  ? 323  GLU A N     1 
ATOM   2460 C CA    . GLU A 1 323 ? 14.084  -10.769 -35.263 1.00 37.67  ? 323  GLU A CA    1 
ATOM   2461 C C     . GLU A 1 323 ? 15.073  -11.726 -34.600 1.00 42.95  ? 323  GLU A C     1 
ATOM   2462 O O     . GLU A 1 323 ? 16.210  -11.863 -35.048 1.00 47.80  ? 323  GLU A O     1 
ATOM   2463 C CB    . GLU A 1 323 ? 13.841  -9.542  -34.382 1.00 40.68  ? 323  GLU A CB    1 
ATOM   2464 C CG    . GLU A 1 323 ? 14.980  -8.538  -34.327 1.00 60.25  ? 323  GLU A CG    1 
ATOM   2465 C CD    . GLU A 1 323 ? 14.569  -7.232  -33.650 1.00 75.65  ? 323  GLU A CD    1 
ATOM   2466 O OE1   . GLU A 1 323 ? 13.349  -6.966  -33.544 1.00 70.79  ? 323  GLU A OE1   1 
ATOM   2467 O OE2   . GLU A 1 323 ? 15.466  -6.474  -33.222 1.00 85.12  ? 323  GLU A OE2   1 
ATOM   2468 N N     . ASN A 1 324 ? 14.635  -12.401 -33.541 1.00 36.67  ? 324  ASN A N     1 
ATOM   2469 C CA    . ASN A 1 324 ? 15.505  -13.355 -32.866 1.00 34.20  ? 324  ASN A CA    1 
ATOM   2470 C C     . ASN A 1 324 ? 15.869  -14.511 -33.774 1.00 37.37  ? 324  ASN A C     1 
ATOM   2471 O O     . ASN A 1 324 ? 17.005  -14.989 -33.757 1.00 38.61  ? 324  ASN A O     1 
ATOM   2472 C CB    . ASN A 1 324 ? 14.871  -13.852 -31.567 1.00 29.46  ? 324  ASN A CB    1 
ATOM   2473 C CG    . ASN A 1 324 ? 14.979  -12.837 -30.452 1.00 35.64  ? 324  ASN A CG    1 
ATOM   2474 O OD1   . ASN A 1 324 ? 16.072  -12.368 -30.132 1.00 38.85  ? 324  ASN A OD1   1 
ATOM   2475 N ND2   . ASN A 1 324 ? 13.844  -12.472 -29.869 1.00 37.40  ? 324  ASN A ND2   1 
ATOM   2476 N N     . ALA A 1 325 ? 14.910  -14.948 -34.585 1.00 36.05  ? 325  ALA A N     1 
ATOM   2477 C CA    . ALA A 1 325 ? 15.161  -16.053 -35.505 1.00 35.25  ? 325  ALA A CA    1 
ATOM   2478 C C     . ALA A 1 325 ? 16.246  -15.714 -36.518 1.00 39.90  ? 325  ALA A C     1 
ATOM   2479 O O     . ALA A 1 325 ? 17.063  -16.573 -36.850 1.00 44.72  ? 325  ALA A O     1 
ATOM   2480 C CB    . ALA A 1 325 ? 13.883  -16.479 -36.206 1.00 37.37  ? 325  ALA A CB    1 
ATOM   2481 N N     . GLN A 1 326 ? 16.260  -14.470 -37.004 1.00 37.05  ? 326  GLN A N     1 
ATOM   2482 C CA    . GLN A 1 326 ? 17.260  -14.056 -37.993 1.00 46.27  ? 326  GLN A CA    1 
ATOM   2483 C C     . GLN A 1 326 ? 18.665  -14.113 -37.408 1.00 42.39  ? 326  GLN A C     1 
ATOM   2484 O O     . GLN A 1 326 ? 19.613  -14.505 -38.082 1.00 51.82  ? 326  GLN A O     1 
ATOM   2485 C CB    . GLN A 1 326 ? 16.995  -12.635 -38.519 1.00 49.31  ? 326  GLN A CB    1 
ATOM   2486 C CG    . GLN A 1 326 ? 15.595  -12.390 -39.056 1.00 66.04  ? 326  GLN A CG    1 
ATOM   2487 C CD    . GLN A 1 326 ? 15.516  -12.428 -40.573 1.00 86.30  ? 326  GLN A CD    1 
ATOM   2488 O OE1   . GLN A 1 326 ? 14.571  -11.903 -41.165 1.00 91.10  ? 326  GLN A OE1   1 
ATOM   2489 N NE2   . GLN A 1 326 ? 16.505  -13.052 -41.208 1.00 89.83  ? 326  GLN A NE2   1 
ATOM   2490 N N     . LYS A 1 327 ? 18.802  -13.706 -36.153 1.00 37.57  ? 327  LYS A N     1 
ATOM   2491 C CA    . LYS A 1 327 ? 20.113  -13.705 -35.512 1.00 49.36  ? 327  LYS A CA    1 
ATOM   2492 C C     . LYS A 1 327 ? 20.548  -15.109 -35.087 1.00 49.92  ? 327  LYS A C     1 
ATOM   2493 O O     . LYS A 1 327 ? 21.733  -15.368 -34.873 1.00 50.36  ? 327  LYS A O     1 
ATOM   2494 C CB    . LYS A 1 327 ? 20.133  -12.721 -34.337 1.00 58.50  ? 327  LYS A CB    1 
ATOM   2495 C CG    . LYS A 1 327 ? 19.801  -11.294 -34.767 1.00 61.84  ? 327  LYS A CG    1 
ATOM   2496 C CD    . LYS A 1 327 ? 20.306  -10.249 -33.788 1.00 69.17  ? 327  LYS A CD    1 
ATOM   2497 C CE    . LYS A 1 327 ? 20.329  -8.852  -34.424 1.00 69.37  ? 327  LYS A CE    1 
ATOM   2498 N NZ    . LYS A 1 327 ? 21.245  -8.765  -35.614 1.00 66.89  ? 327  LYS A NZ    1 
ATOM   2499 N N     . GLY A 1 328 ? 19.585  -16.020 -35.000 1.00 47.88  ? 328  GLY A N     1 
ATOM   2500 C CA    . GLY A 1 328 ? 19.858  -17.374 -34.557 1.00 54.44  ? 328  GLY A CA    1 
ATOM   2501 C C     . GLY A 1 328 ? 20.267  -18.318 -35.670 1.00 50.69  ? 328  GLY A C     1 
ATOM   2502 O O     . GLY A 1 328 ? 20.625  -17.896 -36.764 1.00 53.90  ? 328  GLY A O     1 
ATOM   2503 N N     . GLU A 1 329 ? 20.203  -19.610 -35.379 1.00 46.43  ? 329  GLU A N     1 
ATOM   2504 C CA    . GLU A 1 329 ? 20.656  -20.632 -36.306 1.00 54.05  ? 329  GLU A CA    1 
ATOM   2505 C C     . GLU A 1 329 ? 19.600  -21.720 -36.393 1.00 50.49  ? 329  GLU A C     1 
ATOM   2506 O O     . GLU A 1 329 ? 19.034  -22.131 -35.376 1.00 43.98  ? 329  GLU A O     1 
ATOM   2507 C CB    . GLU A 1 329 ? 21.973  -21.232 -35.817 1.00 66.18  ? 329  GLU A CB    1 
ATOM   2508 C CG    . GLU A 1 329 ? 22.815  -21.890 -36.898 1.00 81.22  ? 329  GLU A CG    1 
ATOM   2509 C CD    . GLU A 1 329 ? 23.977  -21.017 -37.347 1.00 90.44  ? 329  GLU A CD    1 
ATOM   2510 O OE1   . GLU A 1 329 ? 25.137  -21.480 -37.261 1.00 98.25  ? 329  GLU A OE1   1 
ATOM   2511 O OE2   . GLU A 1 329 ? 23.728  -19.871 -37.784 1.00 82.83  ? 329  GLU A OE2   1 
ATOM   2512 N N     . ILE A 1 330 ? 19.324  -22.186 -37.604 1.00 45.43  ? 330  ILE A N     1 
ATOM   2513 C CA    . ILE A 1 330 ? 18.319  -23.220 -37.770 1.00 46.43  ? 330  ILE A CA    1 
ATOM   2514 C C     . ILE A 1 330 ? 18.849  -24.552 -37.253 1.00 45.13  ? 330  ILE A C     1 
ATOM   2515 O O     . ILE A 1 330 ? 19.972  -24.949 -37.568 1.00 53.08  ? 330  ILE A O     1 
ATOM   2516 C CB    . ILE A 1 330 ? 17.866  -23.361 -39.231 1.00 47.68  ? 330  ILE A CB    1 
ATOM   2517 C CG1   . ILE A 1 330 ? 16.513  -24.067 -39.297 1.00 48.56  ? 330  ILE A CG1   1 
ATOM   2518 C CG2   . ILE A 1 330 ? 18.907  -24.100 -40.052 1.00 56.74  ? 330  ILE A CG2   1 
ATOM   2519 C CD1   . ILE A 1 330 ? 16.081  -24.407 -40.702 1.00 63.90  ? 330  ILE A CD1   1 
ATOM   2520 N N     . MET A 1 331 ? 18.046  -25.232 -36.442 1.00 30.98  ? 331  MET A N     1 
ATOM   2521 C CA    . MET A 1 331 ? 18.450  -26.535 -35.929 1.00 42.89  ? 331  MET A CA    1 
ATOM   2522 C C     . MET A 1 331 ? 18.721  -27.506 -37.064 1.00 43.59  ? 331  MET A C     1 
ATOM   2523 O O     . MET A 1 331 ? 17.928  -27.611 -37.990 1.00 38.60  ? 331  MET A O     1 
ATOM   2524 C CB    . MET A 1 331 ? 17.379  -27.117 -35.005 1.00 41.09  ? 331  MET A CB    1 
ATOM   2525 C CG    . MET A 1 331 ? 17.388  -26.530 -33.610 1.00 42.30  ? 331  MET A CG    1 
ATOM   2526 S SD    . MET A 1 331 ? 16.195  -27.323 -32.532 1.00 44.10  ? 331  MET A SD    1 
ATOM   2527 C CE    . MET A 1 331 ? 14.649  -26.719 -33.203 1.00 38.49  ? 331  MET A CE    1 
ATOM   2528 N N     . PRO A 1 332 ? 19.854  -28.214 -36.998 1.00 44.51  ? 332  PRO A N     1 
ATOM   2529 C CA    . PRO A 1 332 ? 20.074  -29.324 -37.926 1.00 40.94  ? 332  PRO A CA    1 
ATOM   2530 C C     . PRO A 1 332 ? 18.998  -30.363 -37.681 1.00 43.93  ? 332  PRO A C     1 
ATOM   2531 O O     . PRO A 1 332 ? 18.402  -30.363 -36.606 1.00 45.09  ? 332  PRO A O     1 
ATOM   2532 C CB    . PRO A 1 332 ? 21.433  -29.876 -37.491 1.00 39.57  ? 332  PRO A CB    1 
ATOM   2533 C CG    . PRO A 1 332 ? 22.103  -28.726 -36.797 1.00 36.04  ? 332  PRO A CG    1 
ATOM   2534 C CD    . PRO A 1 332 ? 20.993  -28.017 -36.088 1.00 37.11  ? 332  PRO A CD    1 
ATOM   2535 N N     . ASN A 1 333 ? 18.739  -31.228 -38.654 1.00 41.98  ? 333  ASN A N     1 
ATOM   2536 C CA    . ASN A 1 333 ? 17.783  -32.306 -38.440 1.00 33.06  ? 333  ASN A CA    1 
ATOM   2537 C C     . ASN A 1 333 ? 18.410  -33.693 -38.574 1.00 37.44  ? 333  ASN A C     1 
ATOM   2538 O O     . ASN A 1 333 ? 17.701  -34.694 -38.665 1.00 38.76  ? 333  ASN A O     1 
ATOM   2539 C CB    . ASN A 1 333 ? 16.567  -32.163 -39.363 1.00 39.54  ? 333  ASN A CB    1 
ATOM   2540 C CG    . ASN A 1 333 ? 16.892  -32.460 -40.831 1.00 48.06  ? 333  ASN A CG    1 
ATOM   2541 O OD1   . ASN A 1 333 ? 18.019  -32.811 -41.181 1.00 47.16  ? 333  ASN A OD1   1 
ATOM   2542 N ND2   . ASN A 1 333 ? 15.890  -32.328 -41.686 1.00 41.24  ? 333  ASN A ND2   1 
ATOM   2543 N N     . ILE A 1 334 ? 19.737  -33.754 -38.578 1.00 38.04  ? 334  ILE A N     1 
ATOM   2544 C CA    . ILE A 1 334 ? 20.413  -35.039 -38.732 1.00 40.66  ? 334  ILE A CA    1 
ATOM   2545 C C     . ILE A 1 334 ? 20.117  -35.983 -37.566 1.00 44.04  ? 334  ILE A C     1 
ATOM   2546 O O     . ILE A 1 334 ? 19.865  -35.538 -36.450 1.00 51.52  ? 334  ILE A O     1 
ATOM   2547 C CB    . ILE A 1 334 ? 21.934  -34.877 -38.959 1.00 44.55  ? 334  ILE A CB    1 
ATOM   2548 C CG1   . ILE A 1 334 ? 22.625  -34.307 -37.727 1.00 46.12  ? 334  ILE A CG1   1 
ATOM   2549 C CG2   . ILE A 1 334 ? 22.205  -34.002 -40.198 1.00 40.83  ? 334  ILE A CG2   1 
ATOM   2550 C CD1   . ILE A 1 334 ? 24.119  -34.150 -37.903 1.00 42.98  ? 334  ILE A CD1   1 
ATOM   2551 N N     . PRO A 1 335 ? 20.118  -37.295 -37.834 1.00 42.53  ? 335  PRO A N     1 
ATOM   2552 C CA    . PRO A 1 335 ? 19.799  -38.280 -36.796 1.00 39.14  ? 335  PRO A CA    1 
ATOM   2553 C C     . PRO A 1 335 ? 20.608  -38.066 -35.519 1.00 46.47  ? 335  PRO A C     1 
ATOM   2554 O O     . PRO A 1 335 ? 20.130  -38.405 -34.441 1.00 41.46  ? 335  PRO A O     1 
ATOM   2555 C CB    . PRO A 1 335 ? 20.183  -39.613 -37.447 1.00 29.87  ? 335  PRO A CB    1 
ATOM   2556 C CG    . PRO A 1 335 ? 19.943  -39.364 -38.933 1.00 39.42  ? 335  PRO A CG    1 
ATOM   2557 C CD    . PRO A 1 335 ? 20.313  -37.914 -39.162 1.00 36.70  ? 335  PRO A CD    1 
ATOM   2558 N N     . GLN A 1 336 ? 21.803  -37.499 -35.645 1.00 43.20  ? 336  GLN A N     1 
ATOM   2559 C CA    . GLN A 1 336 ? 22.718  -37.366 -34.517 1.00 42.70  ? 336  GLN A CA    1 
ATOM   2560 C C     . GLN A 1 336 ? 22.256  -36.311 -33.501 1.00 47.85  ? 336  GLN A C     1 
ATOM   2561 O O     . GLN A 1 336 ? 22.760  -36.265 -32.380 1.00 46.64  ? 336  GLN A O     1 
ATOM   2562 C CB    . GLN A 1 336 ? 24.129  -37.036 -35.020 1.00 39.05  ? 336  GLN A CB    1 
ATOM   2563 C CG    . GLN A 1 336 ? 25.220  -37.084 -33.955 1.00 40.71  ? 336  GLN A CG    1 
ATOM   2564 C CD    . GLN A 1 336 ? 25.465  -38.487 -33.432 1.00 49.92  ? 336  GLN A CD    1 
ATOM   2565 O OE1   . GLN A 1 336 ? 24.980  -39.468 -33.997 1.00 51.41  ? 336  GLN A OE1   1 
ATOM   2566 N NE2   . GLN A 1 336 ? 26.217  -38.588 -32.343 1.00 49.56  ? 336  GLN A NE2   1 
ATOM   2567 N N     . MET A 1 337 ? 21.298  -35.477 -33.895 1.00 40.43  ? 337  MET A N     1 
ATOM   2568 C CA    . MET A 1 337 ? 20.832  -34.394 -33.040 1.00 39.83  ? 337  MET A CA    1 
ATOM   2569 C C     . MET A 1 337 ? 20.364  -34.888 -31.676 1.00 45.95  ? 337  MET A C     1 
ATOM   2570 O O     . MET A 1 337 ? 20.566  -34.213 -30.672 1.00 46.15  ? 337  MET A O     1 
ATOM   2571 C CB    . MET A 1 337 ? 19.705  -33.603 -33.703 1.00 34.93  ? 337  MET A CB    1 
ATOM   2572 C CG    . MET A 1 337 ? 20.172  -32.532 -34.663 1.00 37.39  ? 337  MET A CG    1 
ATOM   2573 S SD    . MET A 1 337 ? 21.322  -31.359 -33.929 1.00 41.50  ? 337  MET A SD    1 
ATOM   2574 C CE    . MET A 1 337 ? 20.214  -30.367 -32.917 1.00 41.10  ? 337  MET A CE    1 
ATOM   2575 N N     . SER A 1 338 ? 19.730  -36.053 -31.641 1.00 46.21  ? 338  SER A N     1 
ATOM   2576 C CA    . SER A 1 338 ? 19.201  -36.570 -30.386 1.00 50.07  ? 338  SER A CA    1 
ATOM   2577 C C     . SER A 1 338 ? 20.317  -36.769 -29.358 1.00 51.09  ? 338  SER A C     1 
ATOM   2578 O O     . SER A 1 338 ? 20.178  -36.387 -28.196 1.00 54.14  ? 338  SER A O     1 
ATOM   2579 C CB    . SER A 1 338 ? 18.447  -37.876 -30.619 1.00 59.16  ? 338  SER A CB    1 
ATOM   2580 O OG    . SER A 1 338 ? 17.844  -38.329 -29.418 1.00 76.10  ? 338  SER A OG    1 
ATOM   2581 N N     . ALA A 1 339 ? 21.422  -37.362 -29.800 1.00 45.46  ? 339  ALA A N     1 
ATOM   2582 C CA    . ALA A 1 339 ? 22.579  -37.584 -28.945 1.00 38.90  ? 339  ALA A CA    1 
ATOM   2583 C C     . ALA A 1 339 ? 23.198  -36.259 -28.544 1.00 39.42  ? 339  ALA A C     1 
ATOM   2584 O O     . ALA A 1 339 ? 23.643  -36.079 -27.411 1.00 40.24  ? 339  ALA A O     1 
ATOM   2585 C CB    . ALA A 1 339 ? 23.603  -38.445 -29.655 1.00 30.56  ? 339  ALA A CB    1 
ATOM   2586 N N     . PHE A 1 340 ? 23.237  -35.339 -29.494 1.00 37.41  ? 340  PHE A N     1 
ATOM   2587 C CA    . PHE A 1 340 ? 23.699  -33.987 -29.235 1.00 35.02  ? 340  PHE A CA    1 
ATOM   2588 C C     . PHE A 1 340 ? 22.920  -33.367 -28.068 1.00 42.14  ? 340  PHE A C     1 
ATOM   2589 O O     . PHE A 1 340 ? 23.504  -32.789 -27.149 1.00 42.18  ? 340  PHE A O     1 
ATOM   2590 C CB    . PHE A 1 340 ? 23.544  -33.138 -30.506 1.00 29.61  ? 340  PHE A CB    1 
ATOM   2591 C CG    . PHE A 1 340 ? 23.641  -31.669 -30.265 1.00 31.87  ? 340  PHE A CG    1 
ATOM   2592 C CD1   . PHE A 1 340 ? 24.869  -31.034 -30.259 1.00 34.68  ? 340  PHE A CD1   1 
ATOM   2593 C CD2   . PHE A 1 340 ? 22.501  -30.918 -30.029 1.00 34.91  ? 340  PHE A CD2   1 
ATOM   2594 C CE1   . PHE A 1 340 ? 24.957  -29.676 -30.026 1.00 37.46  ? 340  PHE A CE1   1 
ATOM   2595 C CE2   . PHE A 1 340 ? 22.584  -29.556 -29.796 1.00 34.83  ? 340  PHE A CE2   1 
ATOM   2596 C CZ    . PHE A 1 340 ? 23.811  -28.937 -29.795 1.00 36.66  ? 340  PHE A CZ    1 
ATOM   2597 N N     . TRP A 1 341 ? 21.598  -33.498 -28.108 1.00 43.68  ? 341  TRP A N     1 
ATOM   2598 C CA    . TRP A 1 341 ? 20.741  -32.909 -27.087 1.00 47.39  ? 341  TRP A CA    1 
ATOM   2599 C C     . TRP A 1 341 ? 20.975  -33.509 -25.700 1.00 45.30  ? 341  TRP A C     1 
ATOM   2600 O O     . TRP A 1 341 ? 21.036  -32.780 -24.712 1.00 39.94  ? 341  TRP A O     1 
ATOM   2601 C CB    . TRP A 1 341 ? 19.265  -33.017 -27.476 1.00 42.47  ? 341  TRP A CB    1 
ATOM   2602 C CG    . TRP A 1 341 ? 18.825  -32.000 -28.503 1.00 38.32  ? 341  TRP A CG    1 
ATOM   2603 C CD1   . TRP A 1 341 ? 18.162  -32.246 -29.675 1.00 42.52  ? 341  TRP A CD1   1 
ATOM   2604 C CD2   . TRP A 1 341 ? 19.017  -30.581 -28.444 1.00 35.78  ? 341  TRP A CD2   1 
ATOM   2605 N NE1   . TRP A 1 341 ? 17.932  -31.067 -30.347 1.00 41.84  ? 341  TRP A NE1   1 
ATOM   2606 C CE2   . TRP A 1 341 ? 18.446  -30.032 -29.611 1.00 40.70  ? 341  TRP A CE2   1 
ATOM   2607 C CE3   . TRP A 1 341 ? 19.616  -29.722 -27.518 1.00 36.47  ? 341  TRP A CE3   1 
ATOM   2608 C CZ2   . TRP A 1 341 ? 18.454  -28.667 -29.871 1.00 41.59  ? 341  TRP A CZ2   1 
ATOM   2609 C CZ3   . TRP A 1 341 ? 19.617  -28.369 -27.772 1.00 42.59  ? 341  TRP A CZ3   1 
ATOM   2610 C CH2   . TRP A 1 341 ? 19.043  -27.853 -28.943 1.00 48.88  ? 341  TRP A CH2   1 
ATOM   2611 N N     . TYR A 1 342 ? 21.099  -34.832 -25.627 1.00 38.51  ? 342  TYR A N     1 
ATOM   2612 C CA    . TYR A 1 342 ? 21.387  -35.493 -24.358 1.00 41.68  ? 342  TYR A CA    1 
ATOM   2613 C C     . TYR A 1 342 ? 22.704  -35.001 -23.772 1.00 38.45  ? 342  TYR A C     1 
ATOM   2614 O O     . TYR A 1 342 ? 22.785  -34.685 -22.590 1.00 34.31  ? 342  TYR A O     1 
ATOM   2615 C CB    . TYR A 1 342 ? 21.421  -37.017 -24.524 1.00 34.37  ? 342  TYR A CB    1 
ATOM   2616 C CG    . TYR A 1 342 ? 20.050  -37.634 -24.645 1.00 41.18  ? 342  TYR A CG    1 
ATOM   2617 C CD1   . TYR A 1 342 ? 19.780  -38.604 -25.604 1.00 47.72  ? 342  TYR A CD1   1 
ATOM   2618 C CD2   . TYR A 1 342 ? 19.022  -37.247 -23.800 1.00 48.22  ? 342  TYR A CD2   1 
ATOM   2619 C CE1   . TYR A 1 342 ? 18.526  -39.165 -25.715 1.00 52.14  ? 342  TYR A CE1   1 
ATOM   2620 C CE2   . TYR A 1 342 ? 17.766  -37.804 -23.901 1.00 53.41  ? 342  TYR A CE2   1 
ATOM   2621 C CZ    . TYR A 1 342 ? 17.522  -38.763 -24.858 1.00 58.81  ? 342  TYR A CZ    1 
ATOM   2622 O OH    . TYR A 1 342 ? 16.267  -39.318 -24.955 1.00 63.54  ? 342  TYR A OH    1 
ATOM   2623 N N     . ALA A 1 343 ? 23.725  -34.929 -24.617 1.00 37.68  ? 343  ALA A N     1 
ATOM   2624 C CA    . ALA A 1 343 ? 25.060  -34.525 -24.198 1.00 37.40  ? 343  ALA A CA    1 
ATOM   2625 C C     . ALA A 1 343 ? 25.109  -33.092 -23.662 1.00 40.14  ? 343  ALA A C     1 
ATOM   2626 O O     . ALA A 1 343 ? 25.765  -32.822 -22.654 1.00 37.82  ? 343  ALA A O     1 
ATOM   2627 C CB    . ALA A 1 343 ? 26.043  -34.687 -25.354 1.00 35.88  ? 343  ALA A CB    1 
ATOM   2628 N N     . VAL A 1 344 ? 24.429  -32.175 -24.343 1.00 37.21  ? 344  VAL A N     1 
ATOM   2629 C CA    . VAL A 1 344 ? 24.464  -30.768 -23.951 1.00 33.17  ? 344  VAL A CA    1 
ATOM   2630 C C     . VAL A 1 344 ? 23.534  -30.502 -22.775 1.00 30.93  ? 344  VAL A C     1 
ATOM   2631 O O     . VAL A 1 344 ? 23.802  -29.638 -21.947 1.00 32.40  ? 344  VAL A O     1 
ATOM   2632 C CB    . VAL A 1 344 ? 24.108  -29.823 -25.136 1.00 28.17  ? 344  VAL A CB    1 
ATOM   2633 C CG1   . VAL A 1 344 ? 24.047  -28.364 -24.676 1.00 26.73  ? 344  VAL A CG1   1 
ATOM   2634 C CG2   . VAL A 1 344 ? 25.121  -29.975 -26.254 1.00 31.91  ? 344  VAL A CG2   1 
ATOM   2635 N N     . ARG A 1 345 ? 22.430  -31.236 -22.722 1.00 38.21  ? 345  ARG A N     1 
ATOM   2636 C CA    . ARG A 1 345 ? 21.534  -31.179 -21.579 1.00 36.66  ? 345  ARG A CA    1 
ATOM   2637 C C     . ARG A 1 345 ? 22.360  -31.513 -20.340 1.00 38.73  ? 345  ARG A C     1 
ATOM   2638 O O     . ARG A 1 345 ? 22.374  -30.776 -19.357 1.00 36.14  ? 345  ARG A O     1 
ATOM   2639 C CB    . ARG A 1 345 ? 20.404  -32.195 -21.745 1.00 38.29  ? 345  ARG A CB    1 
ATOM   2640 C CG    . ARG A 1 345 ? 19.354  -32.147 -20.652 1.00 45.02  ? 345  ARG A CG    1 
ATOM   2641 C CD    . ARG A 1 345 ? 18.971  -33.551 -20.226 1.00 55.97  ? 345  ARG A CD    1 
ATOM   2642 N NE    . ARG A 1 345 ? 17.777  -34.049 -20.903 1.00 69.66  ? 345  ARG A NE    1 
ATOM   2643 C CZ    . ARG A 1 345 ? 17.432  -35.336 -20.950 1.00 66.88  ? 345  ARG A CZ    1 
ATOM   2644 N NH1   . ARG A 1 345 ? 18.206  -36.249 -20.378 1.00 47.48  ? 345  ARG A NH1   1 
ATOM   2645 N NH2   . ARG A 1 345 ? 16.324  -35.713 -21.579 1.00 72.38  ? 345  ARG A NH2   1 
ATOM   2646 N N     . THR A 1 346 ? 23.082  -32.619 -20.419 1.00 34.71  ? 346  THR A N     1 
ATOM   2647 C CA    . THR A 1 346 ? 23.940  -33.057 -19.333 1.00 36.41  ? 346  THR A CA    1 
ATOM   2648 C C     . THR A 1 346 ? 25.002  -32.020 -18.953 1.00 37.35  ? 346  THR A C     1 
ATOM   2649 O O     . THR A 1 346 ? 25.208  -31.744 -17.772 1.00 37.17  ? 346  THR A O     1 
ATOM   2650 C CB    . THR A 1 346 ? 24.590  -34.408 -19.671 1.00 35.43  ? 346  THR A CB    1 
ATOM   2651 O OG1   . THR A 1 346 ? 23.556  -35.382 -19.850 1.00 38.28  ? 346  THR A OG1   1 
ATOM   2652 C CG2   . THR A 1 346 ? 25.506  -34.863 -18.547 1.00 34.32  ? 346  THR A CG2   1 
ATOM   2653 N N     . ALA A 1 347 ? 25.664  -31.439 -19.948 1.00 34.53  ? 347  ALA A N     1 
ATOM   2654 C CA    . ALA A 1 347 ? 26.714  -30.456 -19.682 1.00 37.47  ? 347  ALA A CA    1 
ATOM   2655 C C     . ALA A 1 347 ? 26.198  -29.189 -18.992 1.00 39.32  ? 347  ALA A C     1 
ATOM   2656 O O     . ALA A 1 347 ? 26.814  -28.691 -18.057 1.00 38.88  ? 347  ALA A O     1 
ATOM   2657 C CB    . ALA A 1 347 ? 27.430  -30.096 -20.958 1.00 36.09  ? 347  ALA A CB    1 
ATOM   2658 N N     . VAL A 1 348 ? 25.078  -28.661 -19.472 1.00 33.64  ? 348  VAL A N     1 
ATOM   2659 C CA    . VAL A 1 348 ? 24.496  -27.461 -18.895 1.00 30.95  ? 348  VAL A CA    1 
ATOM   2660 C C     . VAL A 1 348 ? 24.022  -27.726 -17.460 1.00 31.06  ? 348  VAL A C     1 
ATOM   2661 O O     . VAL A 1 348 ? 24.338  -26.975 -16.537 1.00 33.14  ? 348  VAL A O     1 
ATOM   2662 C CB    . VAL A 1 348 ? 23.333  -26.936 -19.761 1.00 29.34  ? 348  VAL A CB    1 
ATOM   2663 C CG1   . VAL A 1 348 ? 22.664  -25.748 -19.092 1.00 29.14  ? 348  VAL A CG1   1 
ATOM   2664 C CG2   . VAL A 1 348 ? 23.842  -26.550 -21.153 1.00 31.67  ? 348  VAL A CG2   1 
ATOM   2665 N N     . ILE A 1 349 ? 23.277  -28.807 -17.272 1.00 31.57  ? 349  ILE A N     1 
ATOM   2666 C CA    . ILE A 1 349 ? 22.838  -29.190 -15.941 1.00 34.24  ? 349  ILE A CA    1 
ATOM   2667 C C     . ILE A 1 349 ? 24.022  -29.412 -15.001 1.00 37.17  ? 349  ILE A C     1 
ATOM   2668 O O     . ILE A 1 349 ? 23.984  -28.993 -13.849 1.00 42.65  ? 349  ILE A O     1 
ATOM   2669 C CB    . ILE A 1 349 ? 21.925  -30.416 -15.981 1.00 42.17  ? 349  ILE A CB    1 
ATOM   2670 C CG1   . ILE A 1 349 ? 20.548  -29.996 -16.507 1.00 40.23  ? 349  ILE A CG1   1 
ATOM   2671 C CG2   . ILE A 1 349 ? 21.812  -31.078 -14.580 1.00 31.17  ? 349  ILE A CG2   1 
ATOM   2672 C CD1   . ILE A 1 349 ? 19.617  -31.164 -16.818 1.00 41.44  ? 349  ILE A CD1   1 
ATOM   2673 N N     . ASN A 1 350 ? 25.078  -30.048 -15.495 1.00 34.67  ? 350  ASN A N     1 
ATOM   2674 C CA    . ASN A 1 350 ? 26.243  -30.321 -14.659 1.00 29.93  ? 350  ASN A CA    1 
ATOM   2675 C C     . ASN A 1 350 ? 27.042  -29.063 -14.344 1.00 35.27  ? 350  ASN A C     1 
ATOM   2676 O O     . ASN A 1 350 ? 27.456  -28.855 -13.203 1.00 37.25  ? 350  ASN A O     1 
ATOM   2677 C CB    . ASN A 1 350 ? 27.150  -31.383 -15.288 1.00 28.34  ? 350  ASN A CB    1 
ATOM   2678 C CG    . ASN A 1 350 ? 26.643  -32.811 -15.061 1.00 36.28  ? 350  ASN A CG    1 
ATOM   2679 O OD1   . ASN A 1 350 ? 25.560  -33.029 -14.521 1.00 32.60  ? 350  ASN A OD1   1 
ATOM   2680 N ND2   . ASN A 1 350 ? 27.432  -33.789 -15.493 1.00 37.32  ? 350  ASN A ND2   1 
ATOM   2681 N N     . ALA A 1 351 ? 27.265  -28.229 -15.356 1.00 30.64  ? 351  ALA A N     1 
ATOM   2682 C CA    . ALA A 1 351 ? 27.950  -26.959 -15.147 1.00 31.75  ? 351  ALA A CA    1 
ATOM   2683 C C     . ALA A 1 351 ? 27.129  -26.060 -14.228 1.00 38.12  ? 351  ALA A C     1 
ATOM   2684 O O     . ALA A 1 351 ? 27.670  -25.387 -13.348 1.00 34.27  ? 351  ALA A O     1 
ATOM   2685 C CB    . ALA A 1 351 ? 28.206  -26.259 -16.483 1.00 31.25  ? 351  ALA A CB    1 
ATOM   2686 N N     . ALA A 1 352 ? 25.817  -26.049 -14.437 1.00 35.00  ? 352  ALA A N     1 
ATOM   2687 C CA    . ALA A 1 352 ? 24.941  -25.190 -13.652 1.00 34.60  ? 352  ALA A CA    1 
ATOM   2688 C C     . ALA A 1 352 ? 24.978  -25.568 -12.174 1.00 39.15  ? 352  ALA A C     1 
ATOM   2689 O O     . ALA A 1 352 ? 25.082  -24.693 -11.312 1.00 35.72  ? 352  ALA A O     1 
ATOM   2690 C CB    . ALA A 1 352 ? 23.516  -25.246 -14.185 1.00 35.47  ? 352  ALA A CB    1 
ATOM   2691 N N     . SER A 1 353 ? 24.906  -26.870 -11.892 1.00 38.49  ? 353  SER A N     1 
ATOM   2692 C CA    . SER A 1 353 ? 24.865  -27.371 -10.518 1.00 39.91  ? 353  SER A CA    1 
ATOM   2693 C C     . SER A 1 353 ? 26.241  -27.393 -9.861  1.00 41.31  ? 353  SER A C     1 
ATOM   2694 O O     . SER A 1 353 ? 26.346  -27.466 -8.646  1.00 39.18  ? 353  SER A O     1 
ATOM   2695 C CB    . SER A 1 353 ? 24.277  -28.785 -10.483 1.00 40.11  ? 353  SER A CB    1 
ATOM   2696 O OG    . SER A 1 353 ? 25.165  -29.710 -11.099 1.00 38.96  ? 353  SER A OG    1 
ATOM   2697 N N     . GLY A 1 354 ? 27.296  -27.353 -10.668 1.00 45.44  ? 354  GLY A N     1 
ATOM   2698 C CA    . GLY A 1 354 ? 28.645  -27.445 -10.141 1.00 44.19  ? 354  GLY A CA    1 
ATOM   2699 C C     . GLY A 1 354 ? 29.171  -28.873 -10.095 1.00 45.86  ? 354  GLY A C     1 
ATOM   2700 O O     . GLY A 1 354 ? 30.297  -29.110 -9.664  1.00 40.90  ? 354  GLY A O     1 
ATOM   2701 N N     . ARG A 1 355 ? 28.359  -29.831 -10.533 1.00 42.42  ? 355  ARG A N     1 
ATOM   2702 C CA    . ARG A 1 355 ? 28.829  -31.208 -10.670 1.00 35.10  ? 355  ARG A CA    1 
ATOM   2703 C C     . ARG A 1 355 ? 30.072  -31.276 -11.564 1.00 31.30  ? 355  ARG A C     1 
ATOM   2704 O O     . ARG A 1 355 ? 30.956  -32.096 -11.347 1.00 35.10  ? 355  ARG A O     1 
ATOM   2705 C CB    . ARG A 1 355 ? 27.724  -32.105 -11.220 1.00 45.65  ? 355  ARG A CB    1 
ATOM   2706 C CG    . ARG A 1 355 ? 28.039  -33.601 -11.144 1.00 65.05  ? 355  ARG A CG    1 
ATOM   2707 C CD    . ARG A 1 355 ? 27.048  -34.418 -11.972 1.00 71.91  ? 355  ARG A CD    1 
ATOM   2708 N NE    . ARG A 1 355 ? 26.233  -35.350 -11.191 1.00 76.78  ? 355  ARG A NE    1 
ATOM   2709 C CZ    . ARG A 1 355 ? 25.743  -35.117 -9.974  1.00 84.38  ? 355  ARG A CZ    1 
ATOM   2710 N NH1   . ARG A 1 355 ? 25.972  -33.967 -9.352  1.00 91.39  ? 355  ARG A NH1   1 
ATOM   2711 N NH2   . ARG A 1 355 ? 25.012  -36.046 -9.373  1.00 84.51  ? 355  ARG A NH2   1 
ATOM   2712 N N     . GLN A 1 356 ? 30.141  -30.408 -12.568 1.00 30.13  ? 356  GLN A N     1 
ATOM   2713 C CA    . GLN A 1 356 ? 31.326  -30.303 -13.419 1.00 35.30  ? 356  GLN A CA    1 
ATOM   2714 C C     . GLN A 1 356 ? 31.694  -28.842 -13.638 1.00 38.61  ? 356  GLN A C     1 
ATOM   2715 O O     . GLN A 1 356 ? 30.834  -27.969 -13.570 1.00 41.39  ? 356  GLN A O     1 
ATOM   2716 C CB    . GLN A 1 356 ? 31.080  -30.956 -14.788 1.00 35.22  ? 356  GLN A CB    1 
ATOM   2717 C CG    . GLN A 1 356 ? 31.005  -32.480 -14.787 1.00 37.49  ? 356  GLN A CG    1 
ATOM   2718 C CD    . GLN A 1 356 ? 30.951  -33.060 -16.206 1.00 41.98  ? 356  GLN A CD    1 
ATOM   2719 O OE1   . GLN A 1 356 ? 29.899  -33.072 -16.844 1.00 36.25  ? 356  GLN A OE1   1 
ATOM   2720 N NE2   . GLN A 1 356 ? 32.092  -33.538 -16.698 1.00 30.91  ? 356  GLN A NE2   1 
ATOM   2721 N N     . THR A 1 357 ? 32.965  -28.575 -13.916 1.00 36.37  ? 357  THR A N     1 
ATOM   2722 C CA    . THR A 1 357 ? 33.354  -27.248 -14.358 1.00 37.68  ? 357  THR A CA    1 
ATOM   2723 C C     . THR A 1 357 ? 32.865  -27.061 -15.791 1.00 39.11  ? 357  THR A C     1 
ATOM   2724 O O     . THR A 1 357 ? 32.531  -28.029 -16.472 1.00 35.96  ? 357  THR A O     1 
ATOM   2725 C CB    . THR A 1 357 ? 34.879  -27.034 -14.316 1.00 38.56  ? 357  THR A CB    1 
ATOM   2726 O OG1   . THR A 1 357 ? 35.503  -27.787 -15.362 1.00 38.84  ? 357  THR A OG1   1 
ATOM   2727 C CG2   . THR A 1 357 ? 35.438  -27.466 -12.972 1.00 39.48  ? 357  THR A CG2   1 
ATOM   2728 N N     . VAL A 1 358 ? 32.817  -25.812 -16.241 1.00 39.83  ? 358  VAL A N     1 
ATOM   2729 C CA    . VAL A 1 358 ? 32.389  -25.504 -17.598 1.00 32.86  ? 358  VAL A CA    1 
ATOM   2730 C C     . VAL A 1 358 ? 33.289  -26.178 -18.628 1.00 36.45  ? 358  VAL A C     1 
ATOM   2731 O O     . VAL A 1 358 ? 32.808  -26.810 -19.566 1.00 43.75  ? 358  VAL A O     1 
ATOM   2732 C CB    . VAL A 1 358 ? 32.377  -23.993 -17.835 1.00 38.11  ? 358  VAL A CB    1 
ATOM   2733 C CG1   . VAL A 1 358 ? 32.263  -23.686 -19.325 1.00 37.37  ? 358  VAL A CG1   1 
ATOM   2734 C CG2   . VAL A 1 358 ? 31.235  -23.359 -17.046 1.00 33.67  ? 358  VAL A CG2   1 
ATOM   2735 N N     . ASP A 1 359 ? 34.597  -26.049 -18.447 1.00 39.76  ? 359  ASP A N     1 
ATOM   2736 C CA    . ASP A 1 359 ? 35.546  -26.678 -19.358 1.00 40.23  ? 359  ASP A CA    1 
ATOM   2737 C C     . ASP A 1 359 ? 35.328  -28.185 -19.432 1.00 42.94  ? 359  ASP A C     1 
ATOM   2738 O O     . ASP A 1 359 ? 35.204  -28.744 -20.523 1.00 44.37  ? 359  ASP A O     1 
ATOM   2739 C CB    . ASP A 1 359 ? 36.987  -26.350 -18.958 1.00 43.71  ? 359  ASP A CB    1 
ATOM   2740 C CG    . ASP A 1 359 ? 37.413  -24.958 -19.409 1.00 59.59  ? 359  ASP A CG    1 
ATOM   2741 O OD1   . ASP A 1 359 ? 36.543  -24.185 -19.876 1.00 55.55  ? 359  ASP A OD1   1 
ATOM   2742 O OD2   . ASP A 1 359 ? 38.614  -24.635 -19.294 1.00 67.28  ? 359  ASP A OD2   1 
ATOM   2743 N N     . GLU A 1 360 ? 35.266  -28.826 -18.267 1.00 46.48  ? 360  GLU A N     1 
ATOM   2744 C CA    . GLU A 1 360 ? 35.073  -30.268 -18.162 1.00 45.74  ? 360  GLU A CA    1 
ATOM   2745 C C     . GLU A 1 360 ? 33.753  -30.688 -18.792 1.00 39.93  ? 360  GLU A C     1 
ATOM   2746 O O     . GLU A 1 360 ? 33.695  -31.659 -19.542 1.00 43.04  ? 360  GLU A O     1 
ATOM   2747 C CB    . GLU A 1 360 ? 35.083  -30.710 -16.687 1.00 55.43  ? 360  GLU A CB    1 
ATOM   2748 C CG    . GLU A 1 360 ? 36.368  -30.405 -15.899 1.00 69.92  ? 360  GLU A CG    1 
ATOM   2749 C CD    . GLU A 1 360 ? 36.214  -30.586 -14.373 1.00 71.94  ? 360  GLU A CD    1 
ATOM   2750 O OE1   . GLU A 1 360 ? 35.084  -30.850 -13.891 1.00 59.29  ? 360  GLU A OE1   1 
ATOM   2751 O OE2   . GLU A 1 360 ? 37.232  -30.460 -13.651 1.00 68.13  ? 360  GLU A OE2   1 
ATOM   2752 N N     . ALA A 1 361 ? 32.690  -29.960 -18.460 1.00 35.32  ? 361  ALA A N     1 
ATOM   2753 C CA    . ALA A 1 361 ? 31.344  -30.285 -18.927 1.00 34.87  ? 361  ALA A CA    1 
ATOM   2754 C C     . ALA A 1 361 ? 31.220  -30.219 -20.451 1.00 40.23  ? 361  ALA A C     1 
ATOM   2755 O O     . ALA A 1 361 ? 30.584  -31.075 -21.064 1.00 39.83  ? 361  ALA A O     1 
ATOM   2756 C CB    . ALA A 1 361 ? 30.326  -29.367 -18.283 1.00 26.10  ? 361  ALA A CB    1 
ATOM   2757 N N     . LEU A 1 362 ? 31.814  -29.198 -21.060 1.00 33.02  ? 362  LEU A N     1 
ATOM   2758 C CA    . LEU A 1 362 ? 31.719  -29.043 -22.508 1.00 41.16  ? 362  LEU A CA    1 
ATOM   2759 C C     . LEU A 1 362 ? 32.655  -30.001 -23.244 1.00 40.44  ? 362  LEU A C     1 
ATOM   2760 O O     . LEU A 1 362 ? 32.299  -30.529 -24.291 1.00 40.76  ? 362  LEU A O     1 
ATOM   2761 C CB    . LEU A 1 362 ? 31.952  -27.589 -22.933 1.00 36.23  ? 362  LEU A CB    1 
ATOM   2762 C CG    . LEU A 1 362 ? 30.837  -26.645 -22.486 1.00 36.92  ? 362  LEU A CG    1 
ATOM   2763 C CD1   . LEU A 1 362 ? 31.188  -25.192 -22.777 1.00 36.37  ? 362  LEU A CD1   1 
ATOM   2764 C CD2   . LEU A 1 362 ? 29.523  -27.026 -23.152 1.00 33.29  ? 362  LEU A CD2   1 
ATOM   2765 N N     . LYS A 1 363 ? 33.843  -30.232 -22.696 1.00 35.98  ? 363  LYS A N     1 
ATOM   2766 C CA    . LYS A 1 363 ? 34.713  -31.266 -23.236 1.00 43.70  ? 363  LYS A CA    1 
ATOM   2767 C C     . LYS A 1 363 ? 33.933  -32.567 -23.416 1.00 46.95  ? 363  LYS A C     1 
ATOM   2768 O O     . LYS A 1 363 ? 33.925  -33.154 -24.499 1.00 43.22  ? 363  LYS A O     1 
ATOM   2769 C CB    . LYS A 1 363 ? 35.899  -31.522 -22.313 1.00 43.10  ? 363  LYS A CB    1 
ATOM   2770 C CG    . LYS A 1 363 ? 36.911  -32.514 -22.884 1.00 46.24  ? 363  LYS A CG    1 
ATOM   2771 C CD    . LYS A 1 363 ? 37.773  -33.087 -21.769 1.00 59.96  ? 363  LYS A CD    1 
ATOM   2772 C CE    . LYS A 1 363 ? 38.955  -33.873 -22.313 1.00 72.10  ? 363  LYS A CE    1 
ATOM   2773 N NZ    . LYS A 1 363 ? 39.811  -34.378 -21.204 1.00 77.03  ? 363  LYS A NZ    1 
ATOM   2774 N N     . ASP A 1 364 ? 33.275  -33.012 -22.350 1.00 39.37  ? 364  ASP A N     1 
ATOM   2775 C CA    . ASP A 1 364 ? 32.519  -34.253 -22.406 1.00 39.14  ? 364  ASP A CA    1 
ATOM   2776 C C     . ASP A 1 364 ? 31.325  -34.161 -23.350 1.00 41.89  ? 364  ASP A C     1 
ATOM   2777 O O     . ASP A 1 364 ? 31.025  -35.119 -24.064 1.00 37.91  ? 364  ASP A O     1 
ATOM   2778 C CB    . ASP A 1 364 ? 32.055  -34.677 -21.015 1.00 39.72  ? 364  ASP A CB    1 
ATOM   2779 C CG    . ASP A 1 364 ? 33.202  -35.158 -20.133 1.00 43.89  ? 364  ASP A CG    1 
ATOM   2780 O OD1   . ASP A 1 364 ? 34.310  -35.404 -20.655 1.00 46.01  ? 364  ASP A OD1   1 
ATOM   2781 O OD2   . ASP A 1 364 ? 32.986  -35.302 -18.913 1.00 38.60  ? 364  ASP A OD2   1 
ATOM   2782 N N     . ALA A 1 365 ? 30.637  -33.020 -23.340 1.00 34.66  ? 365  ALA A N     1 
ATOM   2783 C CA    . ALA A 1 365 ? 29.504  -32.808 -24.235 1.00 39.34  ? 365  ALA A CA    1 
ATOM   2784 C C     . ALA A 1 365 ? 29.948  -32.874 -25.703 1.00 40.72  ? 365  ALA A C     1 
ATOM   2785 O O     . ALA A 1 365 ? 29.241  -33.404 -26.558 1.00 36.08  ? 365  ALA A O     1 
ATOM   2786 C CB    . ALA A 1 365 ? 28.828  -31.473 -23.938 1.00 36.20  ? 365  ALA A CB    1 
ATOM   2787 N N     . GLN A 1 366 ? 31.126  -32.331 -25.981 1.00 40.73  ? 366  GLN A N     1 
ATOM   2788 C CA    . GLN A 1 366 ? 31.706  -32.385 -27.312 1.00 40.25  ? 366  GLN A CA    1 
ATOM   2789 C C     . GLN A 1 366 ? 31.914  -33.833 -27.717 1.00 44.17  ? 366  GLN A C     1 
ATOM   2790 O O     . GLN A 1 366 ? 31.503  -34.261 -28.794 1.00 43.76  ? 366  GLN A O     1 
ATOM   2791 C CB    . GLN A 1 366 ? 33.051  -31.663 -27.320 1.00 42.07  ? 366  GLN A CB    1 
ATOM   2792 C CG    . GLN A 1 366 ? 33.786  -31.714 -28.652 1.00 37.27  ? 366  GLN A CG    1 
ATOM   2793 C CD    . GLN A 1 366 ? 33.181  -30.790 -29.697 1.00 49.78  ? 366  GLN A CD    1 
ATOM   2794 O OE1   . GLN A 1 366 ? 32.413  -29.878 -29.377 1.00 53.30  ? 366  GLN A OE1   1 
ATOM   2795 N NE2   . GLN A 1 366 ? 33.526  -31.024 -30.958 1.00 56.74  ? 366  GLN A NE2   1 
ATOM   2796 N N     . THR A 1 367 ? 32.557  -34.585 -26.836 1.00 43.51  ? 367  THR A N     1 
ATOM   2797 C CA    . THR A 1 367 ? 32.857  -35.980 -27.101 1.00 38.80  ? 367  THR A CA    1 
ATOM   2798 C C     . THR A 1 367 ? 31.577  -36.780 -27.338 1.00 44.10  ? 367  THR A C     1 
ATOM   2799 O O     . THR A 1 367 ? 31.494  -37.558 -28.285 1.00 48.24  ? 367  THR A O     1 
ATOM   2800 C CB    . THR A 1 367 ? 33.679  -36.588 -25.949 1.00 40.22  ? 367  THR A CB    1 
ATOM   2801 O OG1   . THR A 1 367 ? 34.992  -36.016 -25.962 1.00 45.43  ? 367  THR A OG1   1 
ATOM   2802 C CG2   . THR A 1 367 ? 33.792  -38.103 -26.087 1.00 35.07  ? 367  THR A CG2   1 
ATOM   2803 N N     . ASN A 1 368 ? 30.576  -36.566 -26.488 1.00 42.07  ? 368  ASN A N     1 
ATOM   2804 C CA    . ASN A 1 368 ? 29.351  -37.369 -26.511 1.00 39.21  ? 368  ASN A CA    1 
ATOM   2805 C C     . ASN A 1 368 ? 28.316  -36.926 -27.545 1.00 40.74  ? 368  ASN A C     1 
ATOM   2806 O O     . ASN A 1 368 ? 27.464  -37.711 -27.962 1.00 41.47  ? 368  ASN A O     1 
ATOM   2807 C CB    . ASN A 1 368 ? 28.728  -37.460 -25.108 1.00 31.91  ? 368  ASN A CB    1 
ATOM   2808 C CG    . ASN A 1 368 ? 29.404  -38.508 -24.243 1.00 44.16  ? 368  ASN A CG    1 
ATOM   2809 O OD1   . ASN A 1 368 ? 30.110  -39.380 -24.754 1.00 44.33  ? 368  ASN A OD1   1 
ATOM   2810 N ND2   . ASN A 1 368 ? 29.182  -38.441 -22.931 1.00 40.68  ? 368  ASN A ND2   1 
ATOM   2811 N N     . SER A 1 369 ? 28.386  -35.666 -27.951 1.00 38.24  ? 369  SER A N     1 
ATOM   2812 C CA    . SER A 1 369 ? 27.597  -35.197 -29.077 1.00 39.62  ? 369  SER A CA    1 
ATOM   2813 C C     . SER A 1 369 ? 28.082  -35.870 -30.357 1.00 49.21  ? 369  SER A C     1 
ATOM   2814 O O     . SER A 1 369 ? 27.316  -36.057 -31.301 1.00 47.53  ? 369  SER A O     1 
ATOM   2815 C CB    . SER A 1 369 ? 27.731  -33.687 -29.228 1.00 34.30  ? 369  SER A CB    1 
ATOM   2816 O OG    . SER A 1 369 ? 26.981  -33.007 -28.249 1.00 43.87  ? 369  SER A OG    1 
ATOM   2817 N N     . SER A 1 370 ? 29.362  -36.226 -30.385 1.00 48.65  ? 370  SER A N     1 
ATOM   2818 C CA    . SER A 1 370 ? 29.961  -36.797 -31.584 1.00 44.33  ? 370  SER A CA    1 
ATOM   2819 C C     . SER A 1 370 ? 29.512  -38.232 -31.792 1.00 45.42  ? 370  SER A C     1 
ATOM   2820 O O     . SER A 1 370 ? 28.961  -38.860 -30.890 1.00 44.11  ? 370  SER A O     1 
ATOM   2821 C CB    . SER A 1 370 ? 31.486  -36.703 -31.529 1.00 36.75  ? 370  SER A CB    1 
ATOM   2822 O OG    . SER A 1 370 ? 31.882  -35.343 -31.446 1.00 46.51  ? 370  SER A OG    1 
ATOM   2823 N N     . SER A 1 371 ? 29.761  -38.742 -32.991 1.00 45.42  ? 371  SER A N     1 
ATOM   2824 C CA    . SER A 1 371 ? 29.230  -40.033 -33.410 1.00 42.44  ? 371  SER A CA    1 
ATOM   2825 C C     . SER A 1 371 ? 30.018  -41.221 -32.876 1.00 35.07  ? 371  SER A C     1 
ATOM   2826 O O     . SER A 1 371 ? 31.236  -41.292 -33.017 1.00 45.30  ? 371  SER A O     1 
ATOM   2827 C CB    . SER A 1 371 ? 29.162  -40.101 -34.943 1.00 51.09  ? 371  SER A CB    1 
ATOM   2828 O OG    . SER A 1 371 ? 28.813  -41.405 -35.362 1.00 58.07  ? 371  SER A OG    1 
ATOM   2829 N N     . MET A 1 372 ? 29.304  -42.155 -32.261 1.00 36.89  ? 372  MET A N     1 
ATOM   2830 C CA    . MET A 1 372 ? 29.899  -43.396 -31.800 1.00 38.61  ? 372  MET A CA    1 
ATOM   2831 C C     . MET A 1 372 ? 30.453  -44.202 -32.983 1.00 51.26  ? 372  MET A C     1 
ATOM   2832 O O     . MET A 1 372 ? 31.501  -44.842 -32.872 1.00 54.30  ? 372  MET A O     1 
ATOM   2833 C CB    . MET A 1 372 ? 28.858  -44.218 -31.047 1.00 39.46  ? 372  MET A CB    1 
ATOM   2834 C CG    . MET A 1 372 ? 29.420  -45.451 -30.362 1.00 48.55  ? 372  MET A CG    1 
ATOM   2835 S SD    . MET A 1 372 ? 30.538  -45.039 -29.014 1.00 49.53  ? 372  MET A SD    1 
ATOM   2836 C CE    . MET A 1 372 ? 29.390  -44.291 -27.858 1.00 41.63  ? 372  MET A CE    1 
ATOM   2837 N N     . ASP A 1 373 ? 29.742  -44.174 -34.109 1.00 44.39  ? 373  ASP A N     1 
ATOM   2838 C CA    . ASP A 1 373 ? 30.190  -44.882 -35.312 1.00 53.09  ? 373  ASP A CA    1 
ATOM   2839 C C     . ASP A 1 373 ? 31.596  -44.440 -35.701 1.00 50.90  ? 373  ASP A C     1 
ATOM   2840 O O     . ASP A 1 373 ? 32.475  -45.269 -35.943 1.00 52.75  ? 373  ASP A O     1 
ATOM   2841 C CB    . ASP A 1 373 ? 29.216  -44.666 -36.478 1.00 52.50  ? 373  ASP A CB    1 
ATOM   2842 C CG    . ASP A 1 373 ? 27.907  -45.416 -36.289 1.00 65.97  ? 373  ASP A CG    1 
ATOM   2843 O OD1   . ASP A 1 373 ? 27.847  -46.606 -36.653 1.00 69.19  ? 373  ASP A OD1   1 
ATOM   2844 O OD2   . ASP A 1 373 ? 26.938  -44.821 -35.768 1.00 79.52  ? 373  ASP A OD2   1 
ATOM   2845 N N     . VAL A 1 374 ? 31.801  -43.128 -35.745 1.00 47.89  ? 374  VAL A N     1 
ATOM   2846 C CA    . VAL A 1 374 ? 33.118  -42.566 -36.010 1.00 39.61  ? 374  VAL A CA    1 
ATOM   2847 C C     . VAL A 1 374 ? 34.136  -42.975 -34.944 1.00 45.94  ? 374  VAL A C     1 
ATOM   2848 O O     . VAL A 1 374 ? 35.264  -43.336 -35.270 1.00 51.77  ? 374  VAL A O     1 
ATOM   2849 C CB    . VAL A 1 374 ? 33.056  -41.042 -36.126 1.00 47.37  ? 374  VAL A CB    1 
ATOM   2850 C CG1   . VAL A 1 374 ? 34.449  -40.459 -36.268 1.00 49.16  ? 374  VAL A CG1   1 
ATOM   2851 C CG2   . VAL A 1 374 ? 32.189  -40.654 -37.304 1.00 45.44  ? 374  VAL A CG2   1 
ATOM   2852 N N     . PHE A 1 375 ? 33.742  -42.936 -33.673 1.00 40.75  ? 375  PHE A N     1 
ATOM   2853 C CA    . PHE A 1 375 ? 34.645  -43.369 -32.609 1.00 32.93  ? 375  PHE A CA    1 
ATOM   2854 C C     . PHE A 1 375 ? 35.102  -44.802 -32.829 1.00 39.52  ? 375  PHE A C     1 
ATOM   2855 O O     . PHE A 1 375 ? 36.294  -45.101 -32.785 1.00 40.50  ? 375  PHE A O     1 
ATOM   2856 C CB    . PHE A 1 375 ? 33.986  -43.257 -31.226 1.00 26.98  ? 375  PHE A CB    1 
ATOM   2857 C CG    . PHE A 1 375 ? 34.689  -44.056 -30.156 1.00 30.12  ? 375  PHE A CG    1 
ATOM   2858 C CD1   . PHE A 1 375 ? 34.127  -45.217 -29.655 1.00 34.98  ? 375  PHE A CD1   1 
ATOM   2859 C CD2   . PHE A 1 375 ? 35.920  -43.652 -29.662 1.00 35.77  ? 375  PHE A CD2   1 
ATOM   2860 C CE1   . PHE A 1 375 ? 34.771  -45.956 -28.664 1.00 37.03  ? 375  PHE A CE1   1 
ATOM   2861 C CE2   . PHE A 1 375 ? 36.568  -44.384 -28.675 1.00 30.90  ? 375  PHE A CE2   1 
ATOM   2862 C CZ    . PHE A 1 375 ? 35.990  -45.540 -28.176 1.00 36.03  ? 375  PHE A CZ    1 
ATOM   2863 N N     . MET A 1 376 ? 34.134  -45.684 -33.052 1.00 45.88  ? 376  MET A N     1 
ATOM   2864 C CA    . MET A 1 376 ? 34.395  -47.108 -33.215 1.00 48.11  ? 376  MET A CA    1 
ATOM   2865 C C     . MET A 1 376 ? 35.252  -47.388 -34.445 1.00 49.87  ? 376  MET A C     1 
ATOM   2866 O O     . MET A 1 376 ? 36.134  -48.245 -34.415 1.00 55.15  ? 376  MET A O     1 
ATOM   2867 C CB    . MET A 1 376 ? 33.073  -47.880 -33.275 1.00 43.96  ? 376  MET A CB    1 
ATOM   2868 C CG    . MET A 1 376 ? 32.299  -47.879 -31.951 1.00 37.54  ? 376  MET A CG    1 
ATOM   2869 S SD    . MET A 1 376 ? 32.928  -49.124 -30.828 1.00 46.62  ? 376  MET A SD    1 
ATOM   2870 C CE    . MET A 1 376 ? 31.854  -48.917 -29.407 1.00 38.50  ? 376  MET A CE    1 
ATOM   2871 N N     . LYS A 1 377 ? 35.003  -46.655 -35.523 1.00 48.68  ? 377  LYS A N     1 
ATOM   2872 C CA    . LYS A 1 377 ? 35.802  -46.816 -36.729 1.00 49.75  ? 377  LYS A CA    1 
ATOM   2873 C C     . LYS A 1 377 ? 37.237  -46.370 -36.474 1.00 54.92  ? 377  LYS A C     1 
ATOM   2874 O O     . LYS A 1 377 ? 38.185  -46.963 -36.987 1.00 57.91  ? 377  LYS A O     1 
ATOM   2875 C CB    . LYS A 1 377 ? 35.200  -46.025 -37.894 1.00 44.82  ? 377  LYS A CB    1 
ATOM   2876 N N     . GLY A 1 378 ? 37.389  -45.326 -35.668 1.00 53.55  ? 378  GLY A N     1 
ATOM   2877 C CA    . GLY A 1 378 ? 38.699  -44.784 -35.367 1.00 46.29  ? 378  GLY A CA    1 
ATOM   2878 C C     . GLY A 1 378 ? 39.566  -45.788 -34.641 1.00 49.32  ? 378  GLY A C     1 
ATOM   2879 O O     . GLY A 1 378 ? 40.776  -45.842 -34.859 1.00 52.93  ? 378  GLY A O     1 
ATOM   2880 N N     . LEU A 1 379 ? 38.948  -46.584 -33.771 1.00 46.25  ? 379  LEU A N     1 
ATOM   2881 C CA    . LEU A 1 379 ? 39.673  -47.640 -33.081 1.00 48.26  ? 379  LEU A CA    1 
ATOM   2882 C C     . LEU A 1 379 ? 40.205  -48.650 -34.103 1.00 58.93  ? 379  LEU A C     1 
ATOM   2883 O O     . LEU A 1 379 ? 41.190  -49.339 -33.853 1.00 59.52  ? 379  LEU A O     1 
ATOM   2884 C CB    . LEU A 1 379 ? 38.797  -48.325 -32.034 1.00 39.44  ? 379  LEU A CB    1 
ATOM   2885 C CG    . LEU A 1 379 ? 38.263  -47.462 -30.882 1.00 45.32  ? 379  LEU A CG    1 
ATOM   2886 C CD1   . LEU A 1 379 ? 37.444  -48.315 -29.936 1.00 35.51  ? 379  LEU A CD1   1 
ATOM   2887 C CD2   . LEU A 1 379 ? 39.396  -46.789 -30.138 1.00 46.39  ? 379  LEU A CD2   1 
ATOM   2888 N N     . SER A 1 380 ? 39.552  -48.735 -35.257 1.00 66.26  ? 380  SER A N     1 
ATOM   2889 C CA    . SER A 1 380 ? 40.120  -49.477 -36.377 1.00 71.18  ? 380  SER A CA    1 
ATOM   2890 C C     . SER A 1 380 ? 41.236  -48.642 -37.004 1.00 79.81  ? 380  SER A C     1 
ATOM   2891 O O     . SER A 1 380 ? 41.037  -47.913 -37.979 1.00 79.01  ? 380  SER A O     1 
ATOM   2892 C CB    . SER A 1 380 ? 39.051  -49.856 -37.401 1.00 60.89  ? 380  SER A CB    1 
ATOM   2893 O OG    . SER A 1 380 ? 38.180  -50.842 -36.877 1.00 61.07  ? 380  SER A OG    1 
ATOM   2894 N N     . LYS A 1 381 ? 42.409  -48.744 -36.396 1.00 92.51  ? 381  LYS A N     1 
ATOM   2895 C CA    . LYS A 1 381 ? 43.593  -48.016 -36.816 1.00 98.60  ? 381  LYS A CA    1 
ATOM   2896 C C     . LYS A 1 381 ? 44.749  -48.608 -36.025 1.00 102.44 ? 381  LYS A C     1 
ATOM   2897 O O     . LYS A 1 381 ? 45.734  -47.933 -35.726 1.00 104.75 ? 381  LYS A O     1 
ATOM   2898 C CB    . LYS A 1 381 ? 43.449  -46.522 -36.528 1.00 93.73  ? 381  LYS A CB    1 
ATOM   2899 N N     . ALA A 1 382 ? 44.593  -49.881 -35.668 1.00 95.22  ? 382  ALA A N     1 
ATOM   2900 C CA    . ALA A 1 382 ? 45.642  -50.649 -35.017 1.00 80.60  ? 382  ALA A CA    1 
ATOM   2901 C C     . ALA A 1 382 ? 46.754  -50.930 -36.021 1.00 70.37  ? 382  ALA A C     1 
ATOM   2902 O O     . ALA A 1 382 ? 46.764  -50.364 -37.118 1.00 66.49  ? 382  ALA A O     1 
ATOM   2903 C CB    . ALA A 1 382 ? 45.077  -51.953 -34.472 1.00 80.61  ? 382  ALA A CB    1 
ATOM   2904 N N     . LYS B 1 2   ? 38.518  -24.630 -53.730 1.00 91.84  ? 2    LYS C N     1 
ATOM   2905 C CA    . LYS B 1 2   ? 39.473  -24.584 -54.833 1.00 94.91  ? 2    LYS C CA    1 
ATOM   2906 C C     . LYS B 1 2   ? 40.237  -23.263 -54.865 1.00 95.84  ? 2    LYS C C     1 
ATOM   2907 O O     . LYS B 1 2   ? 40.661  -22.809 -55.930 1.00 97.20  ? 2    LYS C O     1 
ATOM   2908 C CB    . LYS B 1 2   ? 38.769  -24.819 -56.174 1.00 92.50  ? 2    LYS C CB    1 
ATOM   2909 N N     . ILE B 1 3   ? 40.407  -22.649 -53.696 1.00 89.23  ? 3    ILE C N     1 
ATOM   2910 C CA    . ILE B 1 3   ? 41.179  -21.414 -53.586 1.00 83.89  ? 3    ILE C CA    1 
ATOM   2911 C C     . ILE B 1 3   ? 42.658  -21.731 -53.393 1.00 83.19  ? 3    ILE C C     1 
ATOM   2912 O O     . ILE B 1 3   ? 43.065  -22.201 -52.332 1.00 84.77  ? 3    ILE C O     1 
ATOM   2913 C CB    . ILE B 1 3   ? 40.703  -20.534 -52.407 1.00 77.83  ? 3    ILE C CB    1 
ATOM   2914 C CG1   . ILE B 1 3   ? 39.236  -20.138 -52.580 1.00 75.69  ? 3    ILE C CG1   1 
ATOM   2915 C CG2   . ILE B 1 3   ? 41.570  -19.288 -52.280 1.00 71.51  ? 3    ILE C CG2   1 
ATOM   2916 C CD1   . ILE B 1 3   ? 38.753  -19.145 -51.544 1.00 72.92  ? 3    ILE C CD1   1 
ATOM   2917 N N     . GLU B 1 4   ? 43.459  -21.474 -54.421 1.00 81.41  ? 4    GLU C N     1 
ATOM   2918 C CA    . GLU B 1 4   ? 44.891  -21.733 -54.347 1.00 80.74  ? 4    GLU C CA    1 
ATOM   2919 C C     . GLU B 1 4   ? 45.528  -21.061 -53.134 1.00 84.55  ? 4    GLU C C     1 
ATOM   2920 O O     . GLU B 1 4   ? 45.317  -19.873 -52.889 1.00 86.78  ? 4    GLU C O     1 
ATOM   2921 C CB    . GLU B 1 4   ? 45.589  -21.268 -55.626 1.00 81.81  ? 4    GLU C CB    1 
ATOM   2922 C CG    . GLU B 1 4   ? 47.106  -21.262 -55.522 1.00 88.60  ? 4    GLU C CG    1 
ATOM   2923 C CD    . GLU B 1 4   ? 47.786  -20.888 -56.824 1.00 94.27  ? 4    GLU C CD    1 
ATOM   2924 O OE1   . GLU B 1 4   ? 47.107  -20.892 -57.873 1.00 96.38  ? 4    GLU C OE1   1 
ATOM   2925 O OE2   . GLU B 1 4   ? 49.000  -20.588 -56.797 1.00 95.56  ? 4    GLU C OE2   1 
ATOM   2926 N N     . GLU B 1 5   ? 46.302  -21.830 -52.372 1.00 84.49  ? 5    GLU C N     1 
ATOM   2927 C CA    . GLU B 1 5   ? 47.064  -21.287 -51.251 1.00 82.77  ? 5    GLU C CA    1 
ATOM   2928 C C     . GLU B 1 5   ? 48.434  -20.809 -51.722 1.00 77.72  ? 5    GLU C C     1 
ATOM   2929 O O     . GLU B 1 5   ? 49.003  -21.365 -52.659 1.00 74.12  ? 5    GLU C O     1 
ATOM   2930 C CB    . GLU B 1 5   ? 47.225  -22.333 -50.143 1.00 89.45  ? 5    GLU C CB    1 
ATOM   2931 C CG    . GLU B 1 5   ? 48.222  -21.935 -49.058 1.00 93.96  ? 5    GLU C CG    1 
ATOM   2932 C CD    . GLU B 1 5   ? 48.150  -22.823 -47.826 1.00 98.85  ? 5    GLU C CD    1 
ATOM   2933 O OE1   . GLU B 1 5   ? 48.802  -22.490 -46.812 1.00 94.45  ? 5    GLU C OE1   1 
ATOM   2934 O OE2   . GLU B 1 5   ? 47.440  -23.849 -47.869 1.00 103.93 ? 5    GLU C OE2   1 
ATOM   2935 N N     . GLY B 1 6   ? 48.958  -19.771 -51.076 1.00 78.34  ? 6    GLY C N     1 
ATOM   2936 C CA    . GLY B 1 6   ? 50.272  -19.254 -51.413 1.00 80.70  ? 6    GLY C CA    1 
ATOM   2937 C C     . GLY B 1 6   ? 50.249  -18.073 -52.367 1.00 82.41  ? 6    GLY C C     1 
ATOM   2938 O O     . GLY B 1 6   ? 51.292  -17.482 -52.659 1.00 84.25  ? 6    GLY C O     1 
ATOM   2939 N N     . LYS B 1 7   ? 49.063  -17.727 -52.859 1.00 82.68  ? 7    LYS C N     1 
ATOM   2940 C CA    . LYS B 1 7   ? 48.915  -16.562 -53.726 1.00 81.05  ? 7    LYS C CA    1 
ATOM   2941 C C     . LYS B 1 7   ? 47.590  -15.845 -53.476 1.00 80.88  ? 7    LYS C C     1 
ATOM   2942 O O     . LYS B 1 7   ? 46.579  -16.478 -53.162 1.00 81.28  ? 7    LYS C O     1 
ATOM   2943 C CB    . LYS B 1 7   ? 49.040  -16.956 -55.201 1.00 84.28  ? 7    LYS C CB    1 
ATOM   2944 C CG    . LYS B 1 7   ? 47.725  -17.319 -55.881 1.00 88.41  ? 7    LYS C CG    1 
ATOM   2945 C CD    . LYS B 1 7   ? 47.795  -17.024 -57.379 1.00 91.42  ? 7    LYS C CD    1 
ATOM   2946 C CE    . LYS B 1 7   ? 46.426  -17.105 -58.042 1.00 88.19  ? 7    LYS C CE    1 
ATOM   2947 N NZ    . LYS B 1 7   ? 46.433  -16.486 -59.398 1.00 85.34  ? 7    LYS C NZ    1 
ATOM   2948 N N     . LEU B 1 8   ? 47.603  -14.521 -53.620 1.00 78.39  ? 8    LEU C N     1 
ATOM   2949 C CA    . LEU B 1 8   ? 46.413  -13.707 -53.377 1.00 69.31  ? 8    LEU C CA    1 
ATOM   2950 C C     . LEU B 1 8   ? 45.615  -13.394 -54.644 1.00 61.07  ? 8    LEU C C     1 
ATOM   2951 O O     . LEU B 1 8   ? 46.176  -13.060 -55.687 1.00 62.33  ? 8    LEU C O     1 
ATOM   2952 C CB    . LEU B 1 8   ? 46.782  -12.407 -52.657 1.00 65.84  ? 8    LEU C CB    1 
ATOM   2953 C CG    . LEU B 1 8   ? 47.171  -12.537 -51.186 1.00 67.39  ? 8    LEU C CG    1 
ATOM   2954 C CD1   . LEU B 1 8   ? 47.596  -11.189 -50.624 1.00 68.74  ? 8    LEU C CD1   1 
ATOM   2955 C CD2   . LEU B 1 8   ? 46.021  -13.123 -50.377 1.00 67.01  ? 8    LEU C CD2   1 
ATOM   2956 N N     . VAL B 1 9   ? 44.297  -13.508 -54.530 1.00 60.37  ? 9    VAL C N     1 
ATOM   2957 C CA    . VAL B 1 9   ? 43.380  -13.188 -55.615 1.00 60.17  ? 9    VAL C CA    1 
ATOM   2958 C C     . VAL B 1 9   ? 42.346  -12.177 -55.128 1.00 64.06  ? 9    VAL C C     1 
ATOM   2959 O O     . VAL B 1 9   ? 41.632  -12.428 -54.152 1.00 61.62  ? 9    VAL C O     1 
ATOM   2960 C CB    . VAL B 1 9   ? 42.668  -14.447 -56.129 1.00 58.79  ? 9    VAL C CB    1 
ATOM   2961 C CG1   . VAL B 1 9   ? 41.451  -14.079 -56.959 1.00 46.91  ? 9    VAL C CG1   1 
ATOM   2962 C CG2   . VAL B 1 9   ? 43.635  -15.301 -56.933 1.00 68.82  ? 9    VAL C CG2   1 
ATOM   2963 N N     . ILE B 1 10  ? 42.270  -11.039 -55.814 1.00 58.82  ? 10   ILE C N     1 
ATOM   2964 C CA    . ILE B 1 10  ? 41.464  -9.912  -55.361 1.00 55.17  ? 10   ILE C CA    1 
ATOM   2965 C C     . ILE B 1 10  ? 40.402  -9.512  -56.375 1.00 57.70  ? 10   ILE C C     1 
ATOM   2966 O O     . ILE B 1 10  ? 40.702  -9.272  -57.545 1.00 54.18  ? 10   ILE C O     1 
ATOM   2967 C CB    . ILE B 1 10  ? 42.348  -8.679  -55.088 1.00 58.63  ? 10   ILE C CB    1 
ATOM   2968 C CG1   . ILE B 1 10  ? 43.457  -9.023  -54.092 1.00 60.14  ? 10   ILE C CG1   1 
ATOM   2969 C CG2   . ILE B 1 10  ? 41.505  -7.516  -54.588 1.00 57.22  ? 10   ILE C CG2   1 
ATOM   2970 C CD1   . ILE B 1 10  ? 44.425  -7.891  -53.850 1.00 59.69  ? 10   ILE C CD1   1 
ATOM   2971 N N     . TRP B 1 11  ? 39.158  -9.435  -55.918 1.00 58.06  ? 11   TRP C N     1 
ATOM   2972 C CA    . TRP B 1 11  ? 38.079  -8.923  -56.748 1.00 55.21  ? 11   TRP C CA    1 
ATOM   2973 C C     . TRP B 1 11  ? 37.733  -7.490  -56.351 1.00 56.33  ? 11   TRP C C     1 
ATOM   2974 O O     . TRP B 1 11  ? 37.483  -7.204  -55.180 1.00 59.38  ? 11   TRP C O     1 
ATOM   2975 C CB    . TRP B 1 11  ? 36.841  -9.807  -56.634 1.00 53.68  ? 11   TRP C CB    1 
ATOM   2976 C CG    . TRP B 1 11  ? 36.979  -11.127 -57.312 1.00 51.96  ? 11   TRP C CG    1 
ATOM   2977 C CD1   . TRP B 1 11  ? 38.098  -11.632 -57.916 1.00 53.25  ? 11   TRP C CD1   1 
ATOM   2978 C CD2   . TRP B 1 11  ? 35.957  -12.118 -57.465 1.00 49.51  ? 11   TRP C CD2   1 
ATOM   2979 N NE1   . TRP B 1 11  ? 37.832  -12.881 -58.432 1.00 49.52  ? 11   TRP C NE1   1 
ATOM   2980 C CE2   . TRP B 1 11  ? 36.526  -13.201 -58.166 1.00 50.37  ? 11   TRP C CE2   1 
ATOM   2981 C CE3   . TRP B 1 11  ? 34.617  -12.196 -57.074 1.00 51.68  ? 11   TRP C CE3   1 
ATOM   2982 C CZ2   . TRP B 1 11  ? 35.799  -14.345 -58.483 1.00 53.42  ? 11   TRP C CZ2   1 
ATOM   2983 C CZ3   . TRP B 1 11  ? 33.898  -13.333 -57.391 1.00 57.40  ? 11   TRP C CZ3   1 
ATOM   2984 C CH2   . TRP B 1 11  ? 34.490  -14.391 -58.088 1.00 58.36  ? 11   TRP C CH2   1 
ATOM   2985 N N     . ILE B 1 12  ? 37.733  -6.596  -57.333 1.00 48.05  ? 12   ILE C N     1 
ATOM   2986 C CA    . ILE B 1 12  ? 37.357  -5.206  -57.125 1.00 47.49  ? 12   ILE C CA    1 
ATOM   2987 C C     . ILE B 1 12  ? 36.582  -4.757  -58.359 1.00 52.37  ? 12   ILE C C     1 
ATOM   2988 O O     . ILE B 1 12  ? 36.837  -5.246  -59.457 1.00 50.57  ? 12   ILE C O     1 
ATOM   2989 C CB    . ILE B 1 12  ? 38.599  -4.313  -56.901 1.00 43.46  ? 12   ILE C CB    1 
ATOM   2990 C CG1   . ILE B 1 12  ? 38.187  -2.912  -56.440 1.00 44.10  ? 12   ILE C CG1   1 
ATOM   2991 C CG2   . ILE B 1 12  ? 39.458  -4.250  -58.157 1.00 41.70  ? 12   ILE C CG2   1 
ATOM   2992 C CD1   . ILE B 1 12  ? 39.336  -2.091  -55.878 1.00 35.73  ? 12   ILE C CD1   1 
ATOM   2993 N N     . ASN B 1 13  ? 35.626  -3.849  -58.185 1.00 47.84  ? 13   ASN C N     1 
ATOM   2994 C CA    . ASN B 1 13  ? 34.738  -3.482  -59.288 1.00 44.59  ? 13   ASN C CA    1 
ATOM   2995 C C     . ASN B 1 13  ? 35.463  -2.805  -60.453 1.00 41.50  ? 13   ASN C C     1 
ATOM   2996 O O     . ASN B 1 13  ? 36.524  -2.212  -60.277 1.00 43.04  ? 13   ASN C O     1 
ATOM   2997 C CB    . ASN B 1 13  ? 33.572  -2.617  -58.800 1.00 55.75  ? 13   ASN C CB    1 
ATOM   2998 C CG    . ASN B 1 13  ? 32.335  -2.760  -59.674 1.00 62.39  ? 13   ASN C CG    1 
ATOM   2999 O OD1   . ASN B 1 13  ? 32.105  -3.813  -60.274 1.00 71.72  ? 13   ASN C OD1   1 
ATOM   3000 N ND2   . ASN B 1 13  ? 31.534  -1.702  -59.750 1.00 52.09  ? 13   ASN C ND2   1 
ATOM   3001 N N     . GLY B 1 14  ? 34.885  -2.915  -61.647 1.00 41.19  ? 14   GLY C N     1 
ATOM   3002 C CA    . GLY B 1 14  ? 35.523  -2.421  -62.855 1.00 39.73  ? 14   GLY C CA    1 
ATOM   3003 C C     . GLY B 1 14  ? 35.590  -0.907  -62.938 1.00 48.79  ? 14   GLY C C     1 
ATOM   3004 O O     . GLY B 1 14  ? 36.379  -0.362  -63.710 1.00 42.64  ? 14   GLY C O     1 
ATOM   3005 N N     . ASP B 1 15  ? 34.768  -0.221  -62.146 1.00 48.02  ? 15   ASP C N     1 
ATOM   3006 C CA    . ASP B 1 15  ? 34.779  1.236   -62.159 1.00 50.45  ? 15   ASP C CA    1 
ATOM   3007 C C     . ASP B 1 15  ? 35.890  1.816   -61.274 1.00 48.00  ? 15   ASP C C     1 
ATOM   3008 O O     . ASP B 1 15  ? 36.230  2.992   -61.387 1.00 44.88  ? 15   ASP C O     1 
ATOM   3009 C CB    . ASP B 1 15  ? 33.391  1.832   -61.836 1.00 48.67  ? 15   ASP C CB    1 
ATOM   3010 C CG    . ASP B 1 15  ? 32.836  1.384   -60.479 1.00 53.54  ? 15   ASP C CG    1 
ATOM   3011 O OD1   . ASP B 1 15  ? 33.565  0.739   -59.697 1.00 57.27  ? 15   ASP C OD1   1 
ATOM   3012 O OD2   . ASP B 1 15  ? 31.657  1.695   -60.191 1.00 41.00  ? 15   ASP C OD2   1 
ATOM   3013 N N     . LYS B 1 16  ? 36.477  0.974   -60.427 1.00 43.75  ? 16   LYS C N     1 
ATOM   3014 C CA    . LYS B 1 16  ? 37.506  1.421   -59.488 1.00 41.21  ? 16   LYS C CA    1 
ATOM   3015 C C     . LYS B 1 16  ? 38.916  1.240   -60.056 1.00 40.91  ? 16   LYS C C     1 
ATOM   3016 O O     . LYS B 1 16  ? 39.097  0.664   -61.127 1.00 41.93  ? 16   LYS C O     1 
ATOM   3017 C CB    . LYS B 1 16  ? 37.376  0.685   -58.150 1.00 45.59  ? 16   LYS C CB    1 
ATOM   3018 C CG    . LYS B 1 16  ? 35.966  0.674   -57.553 1.00 42.43  ? 16   LYS C CG    1 
ATOM   3019 C CD    . LYS B 1 16  ? 35.398  2.079   -57.435 1.00 39.29  ? 16   LYS C CD    1 
ATOM   3020 C CE    . LYS B 1 16  ? 34.361  2.173   -56.320 1.00 38.24  ? 16   LYS C CE    1 
ATOM   3021 N NZ    . LYS B 1 16  ? 33.178  1.304   -56.528 1.00 38.40  ? 16   LYS C NZ    1 
ATOM   3022 N N     . GLY B 1 17  ? 39.913  1.721   -59.324 1.00 35.95  ? 17   GLY C N     1 
ATOM   3023 C CA    . GLY B 1 17  ? 41.284  1.713   -59.797 1.00 42.56  ? 17   GLY C CA    1 
ATOM   3024 C C     . GLY B 1 17  ? 42.010  0.389   -59.646 1.00 47.32  ? 17   GLY C C     1 
ATOM   3025 O O     . GLY B 1 17  ? 42.992  0.292   -58.909 1.00 48.27  ? 17   GLY C O     1 
ATOM   3026 N N     . TYR B 1 18  ? 41.544  -0.631  -60.360 1.00 46.01  ? 18   TYR C N     1 
ATOM   3027 C CA    . TYR B 1 18  ? 42.146  -1.957  -60.257 1.00 47.22  ? 18   TYR C CA    1 
ATOM   3028 C C     . TYR B 1 18  ? 43.598  -2.005  -60.729 1.00 48.47  ? 18   TYR C C     1 
ATOM   3029 O O     . TYR B 1 18  ? 44.406  -2.752  -60.176 1.00 49.81  ? 18   TYR C O     1 
ATOM   3030 C CB    . TYR B 1 18  ? 41.297  -3.026  -60.955 1.00 47.99  ? 18   TYR C CB    1 
ATOM   3031 C CG    . TYR B 1 18  ? 40.940  -2.740  -62.396 1.00 54.43  ? 18   TYR C CG    1 
ATOM   3032 C CD1   . TYR B 1 18  ? 41.881  -2.885  -63.409 1.00 59.80  ? 18   TYR C CD1   1 
ATOM   3033 C CD2   . TYR B 1 18  ? 39.649  -2.362  -62.747 1.00 56.47  ? 18   TYR C CD2   1 
ATOM   3034 C CE1   . TYR B 1 18  ? 41.553  -2.636  -64.729 1.00 61.79  ? 18   TYR C CE1   1 
ATOM   3035 C CE2   . TYR B 1 18  ? 39.311  -2.112  -64.060 1.00 60.83  ? 18   TYR C CE2   1 
ATOM   3036 C CZ    . TYR B 1 18  ? 40.267  -2.252  -65.050 1.00 61.76  ? 18   TYR C CZ    1 
ATOM   3037 O OH    . TYR B 1 18  ? 39.933  -2.007  -66.362 1.00 56.96  ? 18   TYR C OH    1 
ATOM   3038 N N     . ASN B 1 19  ? 43.933  -1.200  -61.732 1.00 44.75  ? 19   ASN C N     1 
ATOM   3039 C CA    . ASN B 1 19  ? 45.308  -1.138  -62.205 1.00 49.91  ? 19   ASN C CA    1 
ATOM   3040 C C     . ASN B 1 19  ? 46.262  -0.612  -61.146 1.00 48.55  ? 19   ASN C C     1 
ATOM   3041 O O     . ASN B 1 19  ? 47.375  -1.110  -61.001 1.00 55.47  ? 19   ASN C O     1 
ATOM   3042 C CB    . ASN B 1 19  ? 45.410  -0.298  -63.478 1.00 61.65  ? 19   ASN C CB    1 
ATOM   3043 C CG    . ASN B 1 19  ? 44.883  -1.028  -64.698 1.00 61.38  ? 19   ASN C CG    1 
ATOM   3044 O OD1   . ASN B 1 19  ? 45.063  -2.237  -64.835 1.00 54.92  ? 19   ASN C OD1   1 
ATOM   3045 N ND2   . ASN B 1 19  ? 44.219  -0.298  -65.585 1.00 63.40  ? 19   ASN C ND2   1 
ATOM   3046 N N     . GLY B 1 20  ? 45.828  0.405   -60.412 1.00 53.06  ? 20   GLY C N     1 
ATOM   3047 C CA    . GLY B 1 20  ? 46.637  0.959   -59.343 1.00 49.04  ? 20   GLY C CA    1 
ATOM   3048 C C     . GLY B 1 20  ? 46.787  -0.051  -58.221 1.00 47.07  ? 20   GLY C C     1 
ATOM   3049 O O     . GLY B 1 20  ? 47.858  -0.184  -57.628 1.00 51.23  ? 20   GLY C O     1 
ATOM   3050 N N     . LEU B 1 21  ? 45.702  -0.766  -57.932 1.00 39.78  ? 21   LEU C N     1 
ATOM   3051 C CA    . LEU B 1 21  ? 45.710  -1.787  -56.894 1.00 44.92  ? 21   LEU C CA    1 
ATOM   3052 C C     . LEU B 1 21  ? 46.663  -2.909  -57.277 1.00 54.10  ? 21   LEU C C     1 
ATOM   3053 O O     . LEU B 1 21  ? 47.390  -3.425  -56.431 1.00 54.45  ? 21   LEU C O     1 
ATOM   3054 C CB    . LEU B 1 21  ? 44.303  -2.338  -56.666 1.00 41.85  ? 21   LEU C CB    1 
ATOM   3055 C CG    . LEU B 1 21  ? 44.179  -3.378  -55.551 1.00 45.25  ? 21   LEU C CG    1 
ATOM   3056 C CD1   . LEU B 1 21  ? 44.699  -2.834  -54.217 1.00 45.86  ? 21   LEU C CD1   1 
ATOM   3057 C CD2   . LEU B 1 21  ? 42.742  -3.836  -55.419 1.00 45.45  ? 21   LEU C CD2   1 
ATOM   3058 N N     . ALA B 1 22  ? 46.656  -3.271  -58.559 1.00 50.30  ? 22   ALA C N     1 
ATOM   3059 C CA    . ALA B 1 22  ? 47.593  -4.251  -59.097 1.00 52.43  ? 22   ALA C CA    1 
ATOM   3060 C C     . ALA B 1 22  ? 49.029  -3.799  -58.877 1.00 53.53  ? 22   ALA C C     1 
ATOM   3061 O O     . ALA B 1 22  ? 49.906  -4.612  -58.590 1.00 60.38  ? 22   ALA C O     1 
ATOM   3062 C CB    . ALA B 1 22  ? 47.333  -4.477  -60.583 1.00 50.40  ? 22   ALA C CB    1 
ATOM   3063 N N     . GLU B 1 23  ? 49.270  -2.502  -59.019 1.00 52.27  ? 23   GLU C N     1 
ATOM   3064 C CA    . GLU B 1 23  ? 50.590  -1.951  -58.749 1.00 57.29  ? 23   GLU C CA    1 
ATOM   3065 C C     . GLU B 1 23  ? 50.960  -2.140  -57.277 1.00 66.62  ? 23   GLU C C     1 
ATOM   3066 O O     . GLU B 1 23  ? 52.130  -2.338  -56.947 1.00 73.10  ? 23   GLU C O     1 
ATOM   3067 C CB    . GLU B 1 23  ? 50.660  -0.478  -59.146 1.00 58.23  ? 23   GLU C CB    1 
ATOM   3068 C CG    . GLU B 1 23  ? 50.466  -0.240  -60.637 1.00 71.42  ? 23   GLU C CG    1 
ATOM   3069 C CD    . GLU B 1 23  ? 50.673  1.210   -61.032 1.00 80.73  ? 23   GLU C CD    1 
ATOM   3070 O OE1   . GLU B 1 23  ? 50.877  2.047   -60.125 1.00 82.23  ? 23   GLU C OE1   1 
ATOM   3071 O OE2   . GLU B 1 23  ? 50.634  1.510   -62.248 1.00 81.96  ? 23   GLU C OE2   1 
ATOM   3072 N N     . VAL B 1 24  ? 49.968  -2.086  -56.393 1.00 59.47  ? 24   VAL C N     1 
ATOM   3073 C CA    . VAL B 1 24  ? 50.222  -2.385  -54.989 1.00 57.93  ? 24   VAL C CA    1 
ATOM   3074 C C     . VAL B 1 24  ? 50.538  -3.871  -54.851 1.00 58.67  ? 24   VAL C C     1 
ATOM   3075 O O     . VAL B 1 24  ? 51.372  -4.269  -54.042 1.00 55.24  ? 24   VAL C O     1 
ATOM   3076 C CB    . VAL B 1 24  ? 49.035  -2.019  -54.073 1.00 51.44  ? 24   VAL C CB    1 
ATOM   3077 C CG1   . VAL B 1 24  ? 49.419  -2.224  -52.617 1.00 57.69  ? 24   VAL C CG1   1 
ATOM   3078 C CG2   . VAL B 1 24  ? 48.613  -0.582  -54.296 1.00 47.77  ? 24   VAL C CG2   1 
ATOM   3079 N N     . GLY B 1 25  ? 49.869  -4.688  -55.656 1.00 63.38  ? 25   GLY C N     1 
ATOM   3080 C CA    . GLY B 1 25  ? 50.127  -6.114  -55.676 1.00 69.16  ? 25   GLY C CA    1 
ATOM   3081 C C     . GLY B 1 25  ? 51.535  -6.426  -56.146 1.00 74.99  ? 25   GLY C C     1 
ATOM   3082 O O     . GLY B 1 25  ? 52.136  -7.412  -55.715 1.00 79.94  ? 25   GLY C O     1 
ATOM   3083 N N     . LYS B 1 26  ? 52.066  -5.582  -57.027 1.00 70.22  ? 26   LYS C N     1 
ATOM   3084 C CA    . LYS B 1 26  ? 53.414  -5.778  -57.548 1.00 75.25  ? 26   LYS C CA    1 
ATOM   3085 C C     . LYS B 1 26  ? 54.481  -5.642  -56.467 1.00 75.73  ? 26   LYS C C     1 
ATOM   3086 O O     . LYS B 1 26  ? 55.350  -6.505  -56.343 1.00 83.22  ? 26   LYS C O     1 
ATOM   3087 C CB    . LYS B 1 26  ? 53.699  -4.827  -58.713 1.00 81.56  ? 26   LYS C CB    1 
ATOM   3088 C CG    . LYS B 1 26  ? 52.923  -5.169  -59.971 1.00 91.24  ? 26   LYS C CG    1 
ATOM   3089 C CD    . LYS B 1 26  ? 53.092  -6.640  -60.320 1.00 99.34  ? 26   LYS C CD    1 
ATOM   3090 C CE    . LYS B 1 26  ? 52.209  -7.047  -61.488 1.00 103.85 ? 26   LYS C CE    1 
ATOM   3091 N NZ    . LYS B 1 26  ? 52.355  -8.496  -61.801 1.00 105.53 ? 26   LYS C NZ    1 
ATOM   3092 N N     . LYS B 1 27  ? 54.420  -4.567  -55.687 1.00 64.63  ? 27   LYS C N     1 
ATOM   3093 C CA    . LYS B 1 27  ? 55.368  -4.392  -54.590 1.00 70.52  ? 27   LYS C CA    1 
ATOM   3094 C C     . LYS B 1 27  ? 55.257  -5.526  -53.570 1.00 70.61  ? 27   LYS C C     1 
ATOM   3095 O O     . LYS B 1 27  ? 56.264  -5.991  -53.038 1.00 74.28  ? 27   LYS C O     1 
ATOM   3096 C CB    . LYS B 1 27  ? 55.192  -3.037  -53.897 1.00 75.34  ? 27   LYS C CB    1 
ATOM   3097 C CG    . LYS B 1 27  ? 55.993  -2.919  -52.604 1.00 79.47  ? 27   LYS C CG    1 
ATOM   3098 C CD    . LYS B 1 27  ? 56.791  -1.625  -52.531 1.00 83.59  ? 27   LYS C CD    1 
ATOM   3099 C CE    . LYS B 1 27  ? 57.836  -1.696  -51.420 1.00 84.20  ? 27   LYS C CE    1 
ATOM   3100 N NZ    . LYS B 1 27  ? 58.629  -0.441  -51.286 1.00 83.50  ? 27   LYS C NZ    1 
ATOM   3101 N N     . PHE B 1 28  ? 54.033  -5.970  -53.304 1.00 67.99  ? 28   PHE C N     1 
ATOM   3102 C CA    . PHE B 1 28  ? 53.816  -7.068  -52.372 1.00 72.73  ? 28   PHE C CA    1 
ATOM   3103 C C     . PHE B 1 28  ? 54.584  -8.301  -52.826 1.00 82.31  ? 28   PHE C C     1 
ATOM   3104 O O     . PHE B 1 28  ? 55.172  -9.014  -52.012 1.00 90.42  ? 28   PHE C O     1 
ATOM   3105 C CB    . PHE B 1 28  ? 52.327  -7.391  -52.244 1.00 69.51  ? 28   PHE C CB    1 
ATOM   3106 C CG    . PHE B 1 28  ? 52.009  -8.365  -51.141 1.00 71.03  ? 28   PHE C CG    1 
ATOM   3107 C CD1   . PHE B 1 28  ? 52.037  -7.964  -49.815 1.00 67.68  ? 28   PHE C CD1   1 
ATOM   3108 C CD2   . PHE B 1 28  ? 51.675  -9.679  -51.430 1.00 70.80  ? 28   PHE C CD2   1 
ATOM   3109 C CE1   . PHE B 1 28  ? 51.741  -8.856  -48.798 1.00 64.03  ? 28   PHE C CE1   1 
ATOM   3110 C CE2   . PHE B 1 28  ? 51.376  -10.575 -50.418 1.00 63.67  ? 28   PHE C CE2   1 
ATOM   3111 C CZ    . PHE B 1 28  ? 51.410  -10.162 -49.101 1.00 63.91  ? 28   PHE C CZ    1 
ATOM   3112 N N     . GLU B 1 29  ? 54.579  -8.544  -54.131 1.00 81.82  ? 29   GLU C N     1 
ATOM   3113 C CA    . GLU B 1 29  ? 55.289  -9.682  -54.694 1.00 86.53  ? 29   GLU C CA    1 
ATOM   3114 C C     . GLU B 1 29  ? 56.795  -9.447  -54.618 1.00 90.41  ? 29   GLU C C     1 
ATOM   3115 O O     . GLU B 1 29  ? 57.552  -10.339 -54.241 1.00 97.25  ? 29   GLU C O     1 
ATOM   3116 C CB    . GLU B 1 29  ? 54.850  -9.921  -56.140 1.00 91.65  ? 29   GLU C CB    1 
ATOM   3117 C CG    . GLU B 1 29  ? 55.173  -11.307 -56.679 1.00 97.98  ? 29   GLU C CG    1 
ATOM   3118 C CD    . GLU B 1 29  ? 54.540  -11.563 -58.035 1.00 100.80 ? 29   GLU C CD    1 
ATOM   3119 O OE1   . GLU B 1 29  ? 53.984  -10.607 -58.614 1.00 103.53 ? 29   GLU C OE1   1 
ATOM   3120 O OE2   . GLU B 1 29  ? 54.590  -12.715 -58.519 1.00 99.40  ? 29   GLU C OE2   1 
ATOM   3121 N N     . LYS B 1 30  ? 57.222  -8.238  -54.967 1.00 89.52  ? 30   LYS C N     1 
ATOM   3122 C CA    . LYS B 1 30  ? 58.633  -7.870  -54.902 1.00 89.35  ? 30   LYS C CA    1 
ATOM   3123 C C     . LYS B 1 30  ? 59.189  -8.041  -53.490 1.00 87.85  ? 30   LYS C C     1 
ATOM   3124 O O     . LYS B 1 30  ? 60.397  -8.170  -53.299 1.00 91.67  ? 30   LYS C O     1 
ATOM   3125 C CB    . LYS B 1 30  ? 58.831  -6.426  -55.378 1.00 91.65  ? 30   LYS C CB    1 
ATOM   3126 C CG    . LYS B 1 30  ? 60.195  -5.832  -55.051 1.00 96.29  ? 30   LYS C CG    1 
ATOM   3127 C CD    . LYS B 1 30  ? 60.185  -4.317  -55.194 1.00 101.02 ? 30   LYS C CD    1 
ATOM   3128 C CE    . LYS B 1 30  ? 61.445  -3.688  -54.615 1.00 102.67 ? 30   LYS C CE    1 
ATOM   3129 N NZ    . LYS B 1 30  ? 61.366  -2.199  -54.604 1.00 100.81 ? 30   LYS C NZ    1 
ATOM   3130 N N     . ASP B 1 31  ? 58.300  -8.052  -52.503 1.00 81.98  ? 31   ASP C N     1 
ATOM   3131 C CA    . ASP B 1 31  ? 58.712  -8.142  -51.107 1.00 80.51  ? 31   ASP C CA    1 
ATOM   3132 C C     . ASP B 1 31  ? 58.508  -9.535  -50.523 1.00 79.34  ? 31   ASP C C     1 
ATOM   3133 O O     . ASP B 1 31  ? 59.316  -10.002 -49.723 1.00 79.19  ? 31   ASP C O     1 
ATOM   3134 C CB    . ASP B 1 31  ? 57.952  -7.118  -50.260 1.00 77.81  ? 31   ASP C CB    1 
ATOM   3135 C CG    . ASP B 1 31  ? 58.434  -5.699  -50.483 1.00 75.40  ? 31   ASP C CG    1 
ATOM   3136 O OD1   . ASP B 1 31  ? 59.234  -5.476  -51.418 1.00 75.75  ? 31   ASP C OD1   1 
ATOM   3137 O OD2   . ASP B 1 31  ? 58.005  -4.805  -49.723 1.00 74.47  ? 31   ASP C OD2   1 
ATOM   3138 N N     . THR B 1 32  ? 57.426  -10.195 -50.924 1.00 77.38  ? 32   THR C N     1 
ATOM   3139 C CA    . THR B 1 32  ? 57.048  -11.467 -50.320 1.00 80.02  ? 32   THR C CA    1 
ATOM   3140 C C     . THR B 1 32  ? 57.181  -12.648 -51.273 1.00 79.23  ? 32   THR C C     1 
ATOM   3141 O O     . THR B 1 32  ? 57.191  -13.801 -50.843 1.00 76.77  ? 32   THR C O     1 
ATOM   3142 C CB    . THR B 1 32  ? 55.595  -11.432 -49.822 1.00 83.25  ? 32   THR C CB    1 
ATOM   3143 O OG1   . THR B 1 32  ? 54.708  -11.339 -50.944 1.00 74.64  ? 32   THR C OG1   1 
ATOM   3144 C CG2   . THR B 1 32  ? 55.378  -10.243 -48.891 1.00 86.39  ? 32   THR C CG2   1 
ATOM   3145 N N     . GLY B 1 33  ? 57.273  -12.360 -52.565 1.00 78.13  ? 33   GLY C N     1 
ATOM   3146 C CA    . GLY B 1 33  ? 57.277  -13.410 -53.564 1.00 79.58  ? 33   GLY C CA    1 
ATOM   3147 C C     . GLY B 1 33  ? 55.894  -14.012 -53.716 1.00 83.31  ? 33   GLY C C     1 
ATOM   3148 O O     . GLY B 1 33  ? 55.712  -15.020 -54.400 1.00 83.44  ? 33   GLY C O     1 
ATOM   3149 N N     . ILE B 1 34  ? 54.912  -13.396 -53.068 1.00 85.02  ? 34   ILE C N     1 
ATOM   3150 C CA    . ILE B 1 34  ? 53.528  -13.824 -53.218 1.00 83.69  ? 34   ILE C CA    1 
ATOM   3151 C C     . ILE B 1 34  ? 52.907  -13.137 -54.427 1.00 82.53  ? 34   ILE C C     1 
ATOM   3152 O O     . ILE B 1 34  ? 52.860  -11.911 -54.503 1.00 78.41  ? 34   ILE C O     1 
ATOM   3153 C CB    . ILE B 1 34  ? 52.691  -13.520 -51.963 1.00 81.57  ? 34   ILE C CB    1 
ATOM   3154 C CG1   . ILE B 1 34  ? 53.383  -14.074 -50.719 1.00 84.28  ? 34   ILE C CG1   1 
ATOM   3155 C CG2   . ILE B 1 34  ? 51.296  -14.117 -52.098 1.00 76.78  ? 34   ILE C CG2   1 
ATOM   3156 C CD1   . ILE B 1 34  ? 53.557  -15.578 -50.743 1.00 85.98  ? 34   ILE C CD1   1 
ATOM   3157 N N     . LYS B 1 35  ? 52.444  -13.941 -55.375 1.00 87.18  ? 35   LYS C N     1 
ATOM   3158 C CA    . LYS B 1 35  ? 51.833  -13.432 -56.596 1.00 93.29  ? 35   LYS C CA    1 
ATOM   3159 C C     . LYS B 1 35  ? 50.451  -12.855 -56.306 1.00 88.74  ? 35   LYS C C     1 
ATOM   3160 O O     . LYS B 1 35  ? 49.569  -13.551 -55.801 1.00 84.65  ? 35   LYS C O     1 
ATOM   3161 C CB    . LYS B 1 35  ? 51.741  -14.554 -57.632 1.00 102.28 ? 35   LYS C CB    1 
ATOM   3162 C CG    . LYS B 1 35  ? 51.021  -14.201 -58.922 1.00 108.21 ? 35   LYS C CG    1 
ATOM   3163 C CD    . LYS B 1 35  ? 51.011  -15.408 -59.852 1.00 113.36 ? 35   LYS C CD    1 
ATOM   3164 C CE    . LYS B 1 35  ? 50.142  -15.187 -61.077 1.00 114.79 ? 35   LYS C CE    1 
ATOM   3165 N NZ    . LYS B 1 35  ? 50.093  -16.413 -61.925 1.00 115.25 ? 35   LYS C NZ    1 
ATOM   3166 N N     . VAL B 1 36  ? 50.266  -11.578 -56.626 1.00 84.97  ? 36   VAL C N     1 
ATOM   3167 C CA    . VAL B 1 36  ? 48.995  -10.910 -56.369 1.00 77.35  ? 36   VAL C CA    1 
ATOM   3168 C C     . VAL B 1 36  ? 48.218  -10.667 -57.658 1.00 69.92  ? 36   VAL C C     1 
ATOM   3169 O O     . VAL B 1 36  ? 48.681  -9.955  -58.551 1.00 66.42  ? 36   VAL C O     1 
ATOM   3170 C CB    . VAL B 1 36  ? 49.201  -9.576  -55.635 1.00 79.20  ? 36   VAL C CB    1 
ATOM   3171 C CG1   . VAL B 1 36  ? 47.861  -8.894  -55.394 1.00 78.18  ? 36   VAL C CG1   1 
ATOM   3172 C CG2   . VAL B 1 36  ? 49.934  -9.807  -54.323 1.00 75.29  ? 36   VAL C CG2   1 
ATOM   3173 N N     . THR B 1 37  ? 47.030  -11.259 -57.740 1.00 64.33  ? 37   THR C N     1 
ATOM   3174 C CA    . THR B 1 37  ? 46.214  -11.186 -58.946 1.00 65.31  ? 37   THR C CA    1 
ATOM   3175 C C     . THR B 1 37  ? 44.902  -10.428 -58.735 1.00 60.81  ? 37   THR C C     1 
ATOM   3176 O O     . THR B 1 37  ? 44.022  -10.888 -58.011 1.00 60.92  ? 37   THR C O     1 
ATOM   3177 C CB    . THR B 1 37  ? 45.904  -12.595 -59.495 1.00 67.41  ? 37   THR C CB    1 
ATOM   3178 O OG1   . THR B 1 37  ? 47.088  -13.149 -60.081 1.00 73.44  ? 37   THR C OG1   1 
ATOM   3179 C CG2   . THR B 1 37  ? 44.811  -12.531 -60.551 1.00 65.54  ? 37   THR C CG2   1 
ATOM   3180 N N     . VAL B 1 38  ? 44.778  -9.275  -59.389 1.00 60.11  ? 38   VAL C N     1 
ATOM   3181 C CA    . VAL B 1 38  ? 43.583  -8.441  -59.289 1.00 58.53  ? 38   VAL C CA    1 
ATOM   3182 C C     . VAL B 1 38  ? 42.620  -8.681  -60.451 1.00 58.34  ? 38   VAL C C     1 
ATOM   3183 O O     . VAL B 1 38  ? 43.014  -8.613  -61.610 1.00 60.79  ? 38   VAL C O     1 
ATOM   3184 C CB    . VAL B 1 38  ? 43.955  -6.945  -59.272 1.00 54.89  ? 38   VAL C CB    1 
ATOM   3185 C CG1   . VAL B 1 38  ? 42.707  -6.089  -59.100 1.00 46.99  ? 38   VAL C CG1   1 
ATOM   3186 C CG2   . VAL B 1 38  ? 44.966  -6.660  -58.168 1.00 53.40  ? 38   VAL C CG2   1 
ATOM   3187 N N     . GLU B 1 39  ? 41.356  -8.952  -60.138 1.00 57.97  ? 39   GLU C N     1 
ATOM   3188 C CA    . GLU B 1 39  ? 40.343  -9.168  -61.169 1.00 60.94  ? 39   GLU C CA    1 
ATOM   3189 C C     . GLU B 1 39  ? 39.101  -8.309  -60.945 1.00 57.67  ? 39   GLU C C     1 
ATOM   3190 O O     . GLU B 1 39  ? 38.772  -7.959  -59.813 1.00 63.51  ? 39   GLU C O     1 
ATOM   3191 C CB    . GLU B 1 39  ? 39.947  -10.645 -61.228 1.00 67.87  ? 39   GLU C CB    1 
ATOM   3192 C CG    . GLU B 1 39  ? 41.067  -11.566 -61.681 1.00 78.40  ? 39   GLU C CG    1 
ATOM   3193 C CD    . GLU B 1 39  ? 40.765  -13.032 -61.423 1.00 87.46  ? 39   GLU C CD    1 
ATOM   3194 O OE1   . GLU B 1 39  ? 39.881  -13.330 -60.588 1.00 85.35  ? 39   GLU C OE1   1 
ATOM   3195 O OE2   . GLU B 1 39  ? 41.417  -13.888 -62.059 1.00 93.60  ? 39   GLU C OE2   1 
ATOM   3196 N N     . HIS B 1 40  ? 38.410  -7.983  -62.031 1.00 50.48  ? 40   HIS C N     1 
ATOM   3197 C CA    . HIS B 1 40  ? 37.182  -7.199  -61.956 1.00 51.28  ? 40   HIS C CA    1 
ATOM   3198 C C     . HIS B 1 40  ? 36.056  -7.849  -62.750 1.00 54.42  ? 40   HIS C C     1 
ATOM   3199 O O     . HIS B 1 40  ? 35.714  -7.399  -63.843 1.00 56.46  ? 40   HIS C O     1 
ATOM   3200 C CB    . HIS B 1 40  ? 37.410  -5.754  -62.425 1.00 40.78  ? 40   HIS C CB    1 
ATOM   3201 C CG    . HIS B 1 40  ? 38.076  -5.640  -63.765 1.00 44.57  ? 40   HIS C CG    1 
ATOM   3202 N ND1   . HIS B 1 40  ? 37.367  -5.523  -64.943 1.00 53.69  ? 40   HIS C ND1   1 
ATOM   3203 C CD2   . HIS B 1 40  ? 39.386  -5.601  -64.110 1.00 49.25  ? 40   HIS C CD2   1 
ATOM   3204 C CE1   . HIS B 1 40  ? 38.211  -5.425  -65.956 1.00 52.42  ? 40   HIS C CE1   1 
ATOM   3205 N NE2   . HIS B 1 40  ? 39.442  -5.468  -65.478 1.00 55.76  ? 40   HIS C NE2   1 
ATOM   3206 N N     . PRO B 1 41  ? 35.481  -8.923  -62.199 1.00 52.04  ? 41   PRO C N     1 
ATOM   3207 C CA    . PRO B 1 41  ? 34.373  -9.637  -62.842 1.00 56.07  ? 41   PRO C CA    1 
ATOM   3208 C C     . PRO B 1 41  ? 33.109  -8.782  -62.903 1.00 59.86  ? 41   PRO C C     1 
ATOM   3209 O O     . PRO B 1 41  ? 33.006  -7.783  -62.192 1.00 67.27  ? 41   PRO C O     1 
ATOM   3210 C CB    . PRO B 1 41  ? 34.140  -10.834 -61.913 1.00 54.66  ? 41   PRO C CB    1 
ATOM   3211 C CG    . PRO B 1 41  ? 35.392  -10.950 -61.094 1.00 55.54  ? 41   PRO C CG    1 
ATOM   3212 C CD    . PRO B 1 41  ? 35.901  -9.561  -60.942 1.00 50.42  ? 41   PRO C CD    1 
ATOM   3213 N N     . ASP B 1 42  ? 32.162  -9.173  -63.748 1.00 53.57  ? 42   ASP C N     1 
ATOM   3214 C CA    . ASP B 1 42  ? 30.853  -8.539  -63.772 1.00 55.23  ? 42   ASP C CA    1 
ATOM   3215 C C     . ASP B 1 42  ? 30.012  -9.075  -62.624 1.00 53.88  ? 42   ASP C C     1 
ATOM   3216 O O     . ASP B 1 42  ? 30.237  -10.189 -62.153 1.00 54.49  ? 42   ASP C O     1 
ATOM   3217 C CB    . ASP B 1 42  ? 30.139  -8.811  -65.098 1.00 62.63  ? 42   ASP C CB    1 
ATOM   3218 C CG    . ASP B 1 42  ? 30.874  -8.227  -66.291 1.00 73.56  ? 42   ASP C CG    1 
ATOM   3219 O OD1   . ASP B 1 42  ? 31.687  -7.294  -66.098 1.00 69.87  ? 42   ASP C OD1   1 
ATOM   3220 O OD2   . ASP B 1 42  ? 30.633  -8.701  -67.423 1.00 79.36  ? 42   ASP C OD2   1 
ATOM   3221 N N     . LYS B 1 43  ? 29.042  -8.281  -62.184 1.00 54.75  ? 43   LYS C N     1 
ATOM   3222 C CA    . LYS B 1 43  ? 28.155  -8.676  -61.098 1.00 64.64  ? 43   LYS C CA    1 
ATOM   3223 C C     . LYS B 1 43  ? 28.922  -9.337  -59.951 1.00 63.69  ? 43   LYS C C     1 
ATOM   3224 O O     . LYS B 1 43  ? 28.460  -10.323 -59.377 1.00 61.17  ? 43   LYS C O     1 
ATOM   3225 C CB    . LYS B 1 43  ? 27.079  -9.632  -61.615 1.00 71.36  ? 43   LYS C CB    1 
ATOM   3226 C CG    . LYS B 1 43  ? 26.324  -9.128  -62.834 1.00 79.77  ? 43   LYS C CG    1 
ATOM   3227 C CD    . LYS B 1 43  ? 25.282  -10.143 -63.284 1.00 87.85  ? 43   LYS C CD    1 
ATOM   3228 C CE    . LYS B 1 43  ? 24.576  -9.699  -64.554 1.00 94.43  ? 43   LYS C CE    1 
ATOM   3229 N NZ    . LYS B 1 43  ? 23.517  -10.665 -64.962 1.00 96.29  ? 43   LYS C NZ    1 
ATOM   3230 N N     . LEU B 1 44  ? 30.087  -8.791  -59.615 1.00 59.95  ? 44   LEU C N     1 
ATOM   3231 C CA    . LEU B 1 44  ? 30.953  -9.426  -58.629 1.00 58.67  ? 44   LEU C CA    1 
ATOM   3232 C C     . LEU B 1 44  ? 30.311  -9.502  -57.244 1.00 66.29  ? 44   LEU C C     1 
ATOM   3233 O O     . LEU B 1 44  ? 30.655  -10.373 -56.446 1.00 71.12  ? 44   LEU C O     1 
ATOM   3234 C CB    . LEU B 1 44  ? 32.335  -8.755  -58.581 1.00 57.29  ? 44   LEU C CB    1 
ATOM   3235 C CG    . LEU B 1 44  ? 32.651  -7.573  -57.661 1.00 54.98  ? 44   LEU C CG    1 
ATOM   3236 C CD1   . LEU B 1 44  ? 32.780  -8.022  -56.220 1.00 56.71  ? 44   LEU C CD1   1 
ATOM   3237 C CD2   . LEU B 1 44  ? 33.943  -6.921  -58.100 1.00 50.78  ? 44   LEU C CD2   1 
ATOM   3238 N N     . GLU B 1 45  ? 29.375  -8.601  -56.960 1.00 66.82  ? 45   GLU C N     1 
ATOM   3239 C CA    . GLU B 1 45  ? 28.711  -8.596  -55.660 1.00 61.82  ? 45   GLU C CA    1 
ATOM   3240 C C     . GLU B 1 45  ? 27.659  -9.693  -55.579 1.00 61.79  ? 45   GLU C C     1 
ATOM   3241 O O     . GLU B 1 45  ? 27.168  -10.016 -54.495 1.00 59.03  ? 45   GLU C O     1 
ATOM   3242 C CB    . GLU B 1 45  ? 28.069  -7.241  -55.365 1.00 59.38  ? 45   GLU C CB    1 
ATOM   3243 C CG    . GLU B 1 45  ? 26.689  -7.052  -55.972 1.00 57.52  ? 45   GLU C CG    1 
ATOM   3244 C CD    . GLU B 1 45  ? 26.745  -6.648  -57.429 1.00 56.57  ? 45   GLU C CD    1 
ATOM   3245 O OE1   . GLU B 1 45  ? 27.859  -6.615  -57.992 1.00 60.83  ? 45   GLU C OE1   1 
ATOM   3246 O OE2   . GLU B 1 45  ? 25.676  -6.361  -58.010 1.00 53.06  ? 45   GLU C OE2   1 
ATOM   3247 N N     . GLU B 1 46  ? 27.310  -10.253 -56.733 1.00 61.31  ? 46   GLU C N     1 
ATOM   3248 C CA    . GLU B 1 46  ? 26.390  -11.384 -56.792 1.00 68.41  ? 46   GLU C CA    1 
ATOM   3249 C C     . GLU B 1 46  ? 27.170  -12.689 -56.960 1.00 68.64  ? 46   GLU C C     1 
ATOM   3250 O O     . GLU B 1 46  ? 26.785  -13.728 -56.424 1.00 67.29  ? 46   GLU C O     1 
ATOM   3251 C CB    . GLU B 1 46  ? 25.371  -11.200 -57.920 1.00 74.86  ? 46   GLU C CB    1 
ATOM   3252 C CG    . GLU B 1 46  ? 24.425  -10.026 -57.700 1.00 84.23  ? 46   GLU C CG    1 
ATOM   3253 C CD    . GLU B 1 46  ? 23.397  -9.876  -58.806 1.00 93.09  ? 46   GLU C CD    1 
ATOM   3254 O OE1   . GLU B 1 46  ? 23.789  -9.861  -59.993 1.00 92.31  ? 46   GLU C OE1   1 
ATOM   3255 O OE2   . GLU B 1 46  ? 22.193  -9.773  -58.485 1.00 97.96  ? 46   GLU C OE2   1 
ATOM   3256 N N     . LYS B 1 47  ? 28.273  -12.612 -57.701 1.00 68.38  ? 47   LYS C N     1 
ATOM   3257 C CA    . LYS B 1 47  ? 29.201  -13.724 -57.862 1.00 67.80  ? 47   LYS C CA    1 
ATOM   3258 C C     . LYS B 1 47  ? 29.729  -14.194 -56.507 1.00 72.65  ? 47   LYS C C     1 
ATOM   3259 O O     . LYS B 1 47  ? 29.515  -15.337 -56.105 1.00 73.75  ? 47   LYS C O     1 
ATOM   3260 C CB    . LYS B 1 47  ? 30.382  -13.295 -58.735 1.00 68.65  ? 47   LYS C CB    1 
ATOM   3261 C CG    . LYS B 1 47  ? 30.727  -14.249 -59.860 1.00 77.46  ? 47   LYS C CG    1 
ATOM   3262 C CD    . LYS B 1 47  ? 29.745  -14.128 -61.011 1.00 89.03  ? 47   LYS C CD    1 
ATOM   3263 C CE    . LYS B 1 47  ? 29.988  -15.212 -62.056 1.00 100.74 ? 47   LYS C CE    1 
ATOM   3264 N NZ    . LYS B 1 47  ? 29.755  -16.583 -61.508 1.00 102.39 ? 47   LYS C NZ    1 
ATOM   3265 N N     . PHE B 1 48  ? 30.418  -13.298 -55.806 1.00 65.15  ? 48   PHE C N     1 
ATOM   3266 C CA    . PHE B 1 48  ? 31.115  -13.652 -54.574 1.00 61.44  ? 48   PHE C CA    1 
ATOM   3267 C C     . PHE B 1 48  ? 30.354  -14.600 -53.643 1.00 62.41  ? 48   PHE C C     1 
ATOM   3268 O O     . PHE B 1 48  ? 30.911  -15.593 -53.190 1.00 65.80  ? 48   PHE C O     1 
ATOM   3269 C CB    . PHE B 1 48  ? 31.551  -12.405 -53.801 1.00 56.27  ? 48   PHE C CB    1 
ATOM   3270 C CG    . PHE B 1 48  ? 32.142  -12.717 -52.458 1.00 53.38  ? 48   PHE C CG    1 
ATOM   3271 C CD1   . PHE B 1 48  ? 33.437  -13.196 -52.354 1.00 53.57  ? 48   PHE C CD1   1 
ATOM   3272 C CD2   . PHE B 1 48  ? 31.394  -12.553 -51.302 1.00 55.43  ? 48   PHE C CD2   1 
ATOM   3273 C CE1   . PHE B 1 48  ? 33.983  -13.498 -51.123 1.00 56.86  ? 48   PHE C CE1   1 
ATOM   3274 C CE2   . PHE B 1 48  ? 31.934  -12.853 -50.060 1.00 61.03  ? 48   PHE C CE2   1 
ATOM   3275 C CZ    . PHE B 1 48  ? 33.230  -13.325 -49.969 1.00 60.43  ? 48   PHE C CZ    1 
ATOM   3276 N N     . PRO B 1 49  ? 29.088  -14.286 -53.330 1.00 59.80  ? 49   PRO C N     1 
ATOM   3277 C CA    . PRO B 1 49  ? 28.355  -15.187 -52.435 1.00 59.52  ? 49   PRO C CA    1 
ATOM   3278 C C     . PRO B 1 49  ? 28.037  -16.540 -53.081 1.00 70.90  ? 49   PRO C C     1 
ATOM   3279 O O     . PRO B 1 49  ? 27.944  -17.545 -52.371 1.00 66.99  ? 49   PRO C O     1 
ATOM   3280 C CB    . PRO B 1 49  ? 27.071  -14.408 -52.122 1.00 56.53  ? 49   PRO C CB    1 
ATOM   3281 C CG    . PRO B 1 49  ? 26.932  -13.430 -53.231 1.00 56.78  ? 49   PRO C CG    1 
ATOM   3282 C CD    . PRO B 1 49  ? 28.324  -13.066 -53.639 1.00 58.55  ? 49   PRO C CD    1 
ATOM   3283 N N     . GLN B 1 50  ? 27.872  -16.565 -54.401 1.00 80.16  ? 50   GLN C N     1 
ATOM   3284 C CA    . GLN B 1 50  ? 27.687  -17.823 -55.118 1.00 84.44  ? 50   GLN C CA    1 
ATOM   3285 C C     . GLN B 1 50  ? 28.889  -18.717 -54.879 1.00 78.63  ? 50   GLN C C     1 
ATOM   3286 O O     . GLN B 1 50  ? 28.755  -19.847 -54.411 1.00 86.74  ? 50   GLN C O     1 
ATOM   3287 C CB    . GLN B 1 50  ? 27.543  -17.590 -56.625 1.00 95.90  ? 50   GLN C CB    1 
ATOM   3288 C CG    . GLN B 1 50  ? 26.204  -17.041 -57.084 1.00 104.85 ? 50   GLN C CG    1 
ATOM   3289 C CD    . GLN B 1 50  ? 26.158  -16.840 -58.593 1.00 112.14 ? 50   GLN C CD    1 
ATOM   3290 O OE1   . GLN B 1 50  ? 25.308  -16.114 -59.110 1.00 116.31 ? 50   GLN C OE1   1 
ATOM   3291 N NE2   . GLN B 1 50  ? 27.077  -17.486 -59.304 1.00 109.96 ? 50   GLN C NE2   1 
ATOM   3292 N N     . VAL B 1 51  ? 30.069  -18.197 -55.197 1.00 67.99  ? 51   VAL C N     1 
ATOM   3293 C CA    . VAL B 1 51  ? 31.291  -18.985 -55.119 1.00 66.33  ? 51   VAL C CA    1 
ATOM   3294 C C     . VAL B 1 51  ? 31.785  -19.195 -53.683 1.00 72.36  ? 51   VAL C C     1 
ATOM   3295 O O     . VAL B 1 51  ? 32.326  -20.250 -53.362 1.00 81.85  ? 51   VAL C O     1 
ATOM   3296 C CB    . VAL B 1 51  ? 32.415  -18.386 -55.989 1.00 62.43  ? 51   VAL C CB    1 
ATOM   3297 C CG1   . VAL B 1 51  ? 31.896  -18.091 -57.394 1.00 62.29  ? 51   VAL C CG1   1 
ATOM   3298 C CG2   . VAL B 1 51  ? 32.959  -17.130 -55.357 1.00 58.76  ? 51   VAL C CG2   1 
ATOM   3299 N N     . ALA B 1 52  ? 31.593  -18.205 -52.818 1.00 65.93  ? 52   ALA C N     1 
ATOM   3300 C CA    . ALA B 1 52  ? 32.076  -18.315 -51.445 1.00 63.11  ? 52   ALA C CA    1 
ATOM   3301 C C     . ALA B 1 52  ? 31.256  -19.316 -50.645 1.00 67.28  ? 52   ALA C C     1 
ATOM   3302 O O     . ALA B 1 52  ? 31.756  -19.920 -49.695 1.00 60.77  ? 52   ALA C O     1 
ATOM   3303 C CB    . ALA B 1 52  ? 32.078  -16.964 -50.758 1.00 55.99  ? 52   ALA C CB    1 
ATOM   3304 N N     . ALA B 1 53  ? 29.995  -19.489 -51.027 1.00 73.17  ? 53   ALA C N     1 
ATOM   3305 C CA    . ALA B 1 53  ? 29.127  -20.436 -50.337 1.00 79.24  ? 53   ALA C CA    1 
ATOM   3306 C C     . ALA B 1 53  ? 29.522  -21.874 -50.669 1.00 81.25  ? 53   ALA C C     1 
ATOM   3307 O O     . ALA B 1 53  ? 29.049  -22.816 -50.031 1.00 77.52  ? 53   ALA C O     1 
ATOM   3308 C CB    . ALA B 1 53  ? 27.669  -20.181 -50.685 1.00 79.87  ? 53   ALA C CB    1 
ATOM   3309 N N     . THR B 1 54  ? 30.391  -22.033 -51.667 1.00 82.08  ? 54   THR C N     1 
ATOM   3310 C CA    . THR B 1 54  ? 30.909  -23.349 -52.041 1.00 79.86  ? 54   THR C CA    1 
ATOM   3311 C C     . THR B 1 54  ? 32.383  -23.497 -51.672 1.00 79.37  ? 54   THR C C     1 
ATOM   3312 O O     . THR B 1 54  ? 33.047  -24.433 -52.114 1.00 79.07  ? 54   THR C O     1 
ATOM   3313 C CB    . THR B 1 54  ? 30.763  -23.622 -53.551 1.00 74.50  ? 54   THR C CB    1 
ATOM   3314 O OG1   . THR B 1 54  ? 31.767  -22.898 -54.274 1.00 73.31  ? 54   THR C OG1   1 
ATOM   3315 C CG2   . THR B 1 54  ? 29.383  -23.215 -54.043 1.00 72.39  ? 54   THR C CG2   1 
ATOM   3316 N N     . GLY B 1 55  ? 32.890  -22.564 -50.870 1.00 73.86  ? 55   GLY C N     1 
ATOM   3317 C CA    . GLY B 1 55  ? 34.271  -22.609 -50.422 1.00 68.54  ? 55   GLY C CA    1 
ATOM   3318 C C     . GLY B 1 55  ? 35.262  -22.032 -51.416 1.00 74.77  ? 55   GLY C C     1 
ATOM   3319 O O     . GLY B 1 55  ? 36.467  -22.017 -51.162 1.00 75.70  ? 55   GLY C O     1 
ATOM   3320 N N     . ASP B 1 56  ? 34.755  -21.554 -52.549 1.00 81.74  ? 56   ASP C N     1 
ATOM   3321 C CA    . ASP B 1 56  ? 35.602  -20.955 -53.580 1.00 91.72  ? 56   ASP C CA    1 
ATOM   3322 C C     . ASP B 1 56  ? 35.549  -19.423 -53.584 1.00 90.10  ? 56   ASP C C     1 
ATOM   3323 O O     . ASP B 1 56  ? 34.942  -18.806 -52.705 1.00 85.27  ? 56   ASP C O     1 
ATOM   3324 C CB    . ASP B 1 56  ? 35.223  -21.494 -54.963 1.00 98.39  ? 56   ASP C CB    1 
ATOM   3325 C CG    . ASP B 1 56  ? 36.188  -22.549 -55.460 1.00 105.86 ? 56   ASP C CG    1 
ATOM   3326 O OD1   . ASP B 1 56  ? 36.019  -23.730 -55.088 1.00 109.83 ? 56   ASP C OD1   1 
ATOM   3327 O OD2   . ASP B 1 56  ? 37.115  -22.194 -56.223 1.00 105.98 ? 56   ASP C OD2   1 
ATOM   3328 N N     . GLY B 1 57  ? 36.195  -18.820 -54.580 1.00 86.91  ? 57   GLY C N     1 
ATOM   3329 C CA    . GLY B 1 57  ? 36.198  -17.378 -54.738 1.00 79.99  ? 57   GLY C CA    1 
ATOM   3330 C C     . GLY B 1 57  ? 37.563  -16.740 -54.555 1.00 74.43  ? 57   GLY C C     1 
ATOM   3331 O O     . GLY B 1 57  ? 38.575  -17.438 -54.489 1.00 73.67  ? 57   GLY C O     1 
ATOM   3332 N N     . PRO B 1 58  ? 37.595  -15.399 -54.476 1.00 64.82  ? 58   PRO C N     1 
ATOM   3333 C CA    . PRO B 1 58  ? 38.827  -14.634 -54.272 1.00 57.22  ? 58   PRO C CA    1 
ATOM   3334 C C     . PRO B 1 58  ? 39.235  -14.674 -52.812 1.00 57.70  ? 58   PRO C C     1 
ATOM   3335 O O     . PRO B 1 58  ? 38.440  -15.086 -51.965 1.00 59.09  ? 58   PRO C O     1 
ATOM   3336 C CB    . PRO B 1 58  ? 38.400  -13.212 -54.630 1.00 55.31  ? 58   PRO C CB    1 
ATOM   3337 C CG    . PRO B 1 58  ? 36.973  -13.162 -54.202 1.00 51.59  ? 58   PRO C CG    1 
ATOM   3338 C CD    . PRO B 1 58  ? 36.412  -14.520 -54.549 1.00 52.61  ? 58   PRO C CD    1 
ATOM   3339 N N     . ASP B 1 59  ? 40.459  -14.251 -52.519 1.00 55.62  ? 59   ASP C N     1 
ATOM   3340 C CA    . ASP B 1 59  ? 40.914  -14.161 -51.139 1.00 54.06  ? 59   ASP C CA    1 
ATOM   3341 C C     . ASP B 1 59  ? 40.336  -12.913 -50.491 1.00 62.67  ? 59   ASP C C     1 
ATOM   3342 O O     . ASP B 1 59  ? 39.919  -12.930 -49.327 1.00 71.10  ? 59   ASP C O     1 
ATOM   3343 C CB    . ASP B 1 59  ? 42.439  -14.119 -51.079 1.00 56.53  ? 59   ASP C CB    1 
ATOM   3344 C CG    . ASP B 1 59  ? 43.078  -15.397 -51.590 1.00 65.47  ? 59   ASP C CG    1 
ATOM   3345 O OD1   . ASP B 1 59  ? 43.636  -15.377 -52.709 1.00 62.86  ? 59   ASP C OD1   1 
ATOM   3346 O OD2   . ASP B 1 59  ? 43.018  -16.421 -50.872 1.00 65.59  ? 59   ASP C OD2   1 
ATOM   3347 N N     . ILE B 1 60  ? 40.312  -11.837 -51.270 1.00 58.84  ? 60   ILE C N     1 
ATOM   3348 C CA    . ILE B 1 60  ? 39.884  -10.524 -50.816 1.00 52.98  ? 60   ILE C CA    1 
ATOM   3349 C C     . ILE B 1 60  ? 38.859  -9.961  -51.788 1.00 52.86  ? 60   ILE C C     1 
ATOM   3350 O O     . ILE B 1 60  ? 39.118  -9.869  -52.989 1.00 55.30  ? 60   ILE C O     1 
ATOM   3351 C CB    . ILE B 1 60  ? 41.073  -9.552  -50.778 1.00 51.55  ? 60   ILE C CB    1 
ATOM   3352 C CG1   . ILE B 1 60  ? 42.216  -10.142 -49.950 1.00 43.84  ? 60   ILE C CG1   1 
ATOM   3353 C CG2   . ILE B 1 60  ? 40.643  -8.192  -50.248 1.00 52.07  ? 60   ILE C CG2   1 
ATOM   3354 C CD1   . ILE B 1 60  ? 43.465  -9.289  -49.950 1.00 41.39  ? 60   ILE C CD1   1 
ATOM   3355 N N     . ILE B 1 61  ? 37.695  -9.591  -51.272 1.00 47.94  ? 61   ILE C N     1 
ATOM   3356 C CA    . ILE B 1 61  ? 36.673  -8.964  -52.089 1.00 44.43  ? 61   ILE C CA    1 
ATOM   3357 C C     . ILE B 1 61  ? 36.462  -7.506  -51.688 1.00 48.55  ? 61   ILE C C     1 
ATOM   3358 O O     . ILE B 1 61  ? 36.272  -7.201  -50.506 1.00 44.73  ? 61   ILE C O     1 
ATOM   3359 C CB    . ILE B 1 61  ? 35.335  -9.696  -51.991 1.00 44.93  ? 61   ILE C CB    1 
ATOM   3360 C CG1   . ILE B 1 61  ? 34.280  -8.940  -52.803 1.00 48.96  ? 61   ILE C CG1   1 
ATOM   3361 C CG2   . ILE B 1 61  ? 34.921  -9.858  -50.527 1.00 43.00  ? 61   ILE C CG2   1 
ATOM   3362 C CD1   . ILE B 1 61  ? 32.858  -9.363  -52.532 1.00 54.71  ? 61   ILE C CD1   1 
ATOM   3363 N N     . PHE B 1 62  ? 36.506  -6.615  -52.679 1.00 43.45  ? 62   PHE C N     1 
ATOM   3364 C CA    . PHE B 1 62  ? 36.250  -5.188  -52.474 1.00 39.93  ? 62   PHE C CA    1 
ATOM   3365 C C     . PHE B 1 62  ? 34.830  -4.827  -52.880 1.00 41.26  ? 62   PHE C C     1 
ATOM   3366 O O     . PHE B 1 62  ? 34.382  -5.181  -53.969 1.00 42.72  ? 62   PHE C O     1 
ATOM   3367 C CB    . PHE B 1 62  ? 37.204  -4.353  -53.318 1.00 40.75  ? 62   PHE C CB    1 
ATOM   3368 C CG    . PHE B 1 62  ? 38.562  -4.171  -52.714 1.00 42.99  ? 62   PHE C CG    1 
ATOM   3369 C CD1   . PHE B 1 62  ? 39.498  -5.191  -52.751 1.00 44.28  ? 62   PHE C CD1   1 
ATOM   3370 C CD2   . PHE B 1 62  ? 38.915  -2.964  -52.139 1.00 37.26  ? 62   PHE C CD2   1 
ATOM   3371 C CE1   . PHE B 1 62  ? 40.758  -5.017  -52.205 1.00 37.60  ? 62   PHE C CE1   1 
ATOM   3372 C CE2   . PHE B 1 62  ? 40.173  -2.785  -51.596 1.00 43.32  ? 62   PHE C CE2   1 
ATOM   3373 C CZ    . PHE B 1 62  ? 41.096  -3.813  -51.629 1.00 37.97  ? 62   PHE C CZ    1 
ATOM   3374 N N     . TRP B 1 63  ? 34.127  -4.116  -52.008 1.00 41.99  ? 63   TRP C N     1 
ATOM   3375 C CA    . TRP B 1 63  ? 32.813  -3.577  -52.340 1.00 41.41  ? 63   TRP C CA    1 
ATOM   3376 C C     . TRP B 1 63  ? 32.402  -2.552  -51.295 1.00 44.29  ? 63   TRP C C     1 
ATOM   3377 O O     . TRP B 1 63  ? 33.010  -2.471  -50.226 1.00 40.01  ? 63   TRP C O     1 
ATOM   3378 C CB    . TRP B 1 63  ? 31.770  -4.691  -52.404 1.00 37.82  ? 63   TRP C CB    1 
ATOM   3379 C CG    . TRP B 1 63  ? 30.497  -4.252  -53.054 1.00 37.04  ? 63   TRP C CG    1 
ATOM   3380 C CD1   . TRP B 1 63  ? 29.351  -3.849  -52.434 1.00 36.25  ? 63   TRP C CD1   1 
ATOM   3381 C CD2   . TRP B 1 63  ? 30.247  -4.163  -54.460 1.00 35.81  ? 63   TRP C CD2   1 
ATOM   3382 N NE1   . TRP B 1 63  ? 28.398  -3.516  -53.371 1.00 33.75  ? 63   TRP C NE1   1 
ATOM   3383 C CE2   . TRP B 1 63  ? 28.926  -3.699  -54.622 1.00 37.88  ? 63   TRP C CE2   1 
ATOM   3384 C CE3   . TRP B 1 63  ? 31.014  -4.425  -55.598 1.00 40.59  ? 63   TRP C CE3   1 
ATOM   3385 C CZ2   . TRP B 1 63  ? 28.353  -3.500  -55.879 1.00 45.35  ? 63   TRP C CZ2   1 
ATOM   3386 C CZ3   . TRP B 1 63  ? 30.445  -4.223  -56.844 1.00 44.18  ? 63   TRP C CZ3   1 
ATOM   3387 C CH2   . TRP B 1 63  ? 29.127  -3.765  -56.973 1.00 43.81  ? 63   TRP C CH2   1 
ATOM   3388 N N     . ALA B 1 64  ? 31.374  -1.766  -51.597 1.00 37.92  ? 64   ALA C N     1 
ATOM   3389 C CA    . ALA B 1 64  ? 30.854  -0.835  -50.603 1.00 37.41  ? 64   ALA C CA    1 
ATOM   3390 C C     . ALA B 1 64  ? 30.330  -1.645  -49.425 1.00 41.49  ? 64   ALA C C     1 
ATOM   3391 O O     . ALA B 1 64  ? 29.842  -2.758  -49.602 1.00 42.02  ? 64   ALA C O     1 
ATOM   3392 C CB    . ALA B 1 64  ? 29.755  0.019   -51.187 1.00 27.86  ? 64   ALA C CB    1 
ATOM   3393 N N     . HIS B 1 65  ? 30.423  -1.073  -48.232 1.00 43.23  ? 65   HIS C N     1 
ATOM   3394 C CA    . HIS B 1 65  ? 30.102  -1.775  -46.991 1.00 39.89  ? 65   HIS C CA    1 
ATOM   3395 C C     . HIS B 1 65  ? 28.686  -2.355  -46.911 1.00 44.39  ? 65   HIS C C     1 
ATOM   3396 O O     . HIS B 1 65  ? 28.445  -3.286  -46.146 1.00 46.75  ? 65   HIS C O     1 
ATOM   3397 C CB    . HIS B 1 65  ? 30.321  -0.837  -45.804 1.00 42.62  ? 65   HIS C CB    1 
ATOM   3398 C CG    . HIS B 1 65  ? 29.213  0.152   -45.609 1.00 43.13  ? 65   HIS C CG    1 
ATOM   3399 N ND1   . HIS B 1 65  ? 29.102  1.304   -46.357 1.00 42.84  ? 65   HIS C ND1   1 
ATOM   3400 C CD2   . HIS B 1 65  ? 28.161  0.154   -44.757 1.00 43.13  ? 65   HIS C CD2   1 
ATOM   3401 C CE1   . HIS B 1 65  ? 28.032  1.976   -45.973 1.00 42.56  ? 65   HIS C CE1   1 
ATOM   3402 N NE2   . HIS B 1 65  ? 27.445  1.303   -45.000 1.00 48.32  ? 65   HIS C NE2   1 
ATOM   3403 N N     . ASP B 1 66  ? 27.748  -1.811  -47.681 1.00 41.09  ? 66   ASP C N     1 
ATOM   3404 C CA    . ASP B 1 66  ? 26.340  -2.210  -47.549 1.00 37.18  ? 66   ASP C CA    1 
ATOM   3405 C C     . ASP B 1 66  ? 26.062  -3.705  -47.717 1.00 44.48  ? 66   ASP C C     1 
ATOM   3406 O O     . ASP B 1 66  ? 25.094  -4.220  -47.157 1.00 46.63  ? 66   ASP C O     1 
ATOM   3407 C CB    . ASP B 1 66  ? 25.438  -1.418  -48.503 1.00 36.04  ? 66   ASP C CB    1 
ATOM   3408 C CG    . ASP B 1 66  ? 25.745  -1.691  -49.966 1.00 37.77  ? 66   ASP C CG    1 
ATOM   3409 O OD1   . ASP B 1 66  ? 26.921  -1.578  -50.363 1.00 42.37  ? 66   ASP C OD1   1 
ATOM   3410 O OD2   . ASP B 1 66  ? 24.808  -2.023  -50.718 1.00 40.53  ? 66   ASP C OD2   1 
ATOM   3411 N N     . ARG B 1 67  ? 26.888  -4.399  -48.491 1.00 42.53  ? 67   ARG C N     1 
ATOM   3412 C CA    . ARG B 1 67  ? 26.618  -5.807  -48.791 1.00 46.72  ? 67   ARG C CA    1 
ATOM   3413 C C     . ARG B 1 67  ? 27.342  -6.802  -47.886 1.00 46.38  ? 67   ARG C C     1 
ATOM   3414 O O     . ARG B 1 67  ? 27.116  -8.005  -47.969 1.00 50.93  ? 67   ARG C O     1 
ATOM   3415 C CB    . ARG B 1 67  ? 26.918  -6.118  -50.260 1.00 38.70  ? 67   ARG C CB    1 
ATOM   3416 C CG    . ARG B 1 67  ? 25.742  -5.788  -51.162 1.00 48.01  ? 67   ARG C CG    1 
ATOM   3417 C CD    . ARG B 1 67  ? 25.942  -6.212  -52.600 1.00 51.86  ? 67   ARG C CD    1 
ATOM   3418 N NE    . ARG B 1 67  ? 24.900  -5.631  -53.444 1.00 62.42  ? 67   ARG C NE    1 
ATOM   3419 C CZ    . ARG B 1 67  ? 23.708  -6.182  -53.647 1.00 65.00  ? 67   ARG C CZ    1 
ATOM   3420 N NH1   . ARG B 1 67  ? 23.404  -7.340  -53.076 1.00 71.38  ? 67   ARG C NH1   1 
ATOM   3421 N NH2   . ARG B 1 67  ? 22.820  -5.577  -54.425 1.00 51.43  ? 67   ARG C NH2   1 
ATOM   3422 N N     . PHE B 1 68  ? 28.212  -6.296  -47.028 1.00 35.76  ? 68   PHE C N     1 
ATOM   3423 C CA    . PHE B 1 68  ? 29.048  -7.159  -46.221 1.00 48.41  ? 68   PHE C CA    1 
ATOM   3424 C C     . PHE B 1 68  ? 28.273  -7.794  -45.072 1.00 50.79  ? 68   PHE C C     1 
ATOM   3425 O O     . PHE B 1 68  ? 28.671  -8.827  -44.550 1.00 52.73  ? 68   PHE C O     1 
ATOM   3426 C CB    . PHE B 1 68  ? 30.268  -6.390  -45.717 1.00 50.41  ? 68   PHE C CB    1 
ATOM   3427 C CG    . PHE B 1 68  ? 31.375  -6.313  -46.721 1.00 55.09  ? 68   PHE C CG    1 
ATOM   3428 C CD1   . PHE B 1 68  ? 32.622  -6.835  -46.441 1.00 61.29  ? 68   PHE C CD1   1 
ATOM   3429 C CD2   . PHE B 1 68  ? 31.159  -5.749  -47.961 1.00 58.70  ? 68   PHE C CD2   1 
ATOM   3430 C CE1   . PHE B 1 68  ? 33.636  -6.776  -47.372 1.00 60.02  ? 68   PHE C CE1   1 
ATOM   3431 C CE2   . PHE B 1 68  ? 32.171  -5.691  -48.895 1.00 57.02  ? 68   PHE C CE2   1 
ATOM   3432 C CZ    . PHE B 1 68  ? 33.409  -6.204  -48.599 1.00 53.81  ? 68   PHE C CZ    1 
ATOM   3433 N N     . GLY B 1 69  ? 27.161  -7.174  -44.692 1.00 50.51  ? 69   GLY C N     1 
ATOM   3434 C CA    . GLY B 1 69  ? 26.301  -7.729  -43.666 1.00 52.94  ? 69   GLY C CA    1 
ATOM   3435 C C     . GLY B 1 69  ? 25.656  -9.031  -44.102 1.00 52.29  ? 69   GLY C C     1 
ATOM   3436 O O     . GLY B 1 69  ? 25.630  -10.003 -43.352 1.00 53.04  ? 69   GLY C O     1 
ATOM   3437 N N     . GLY B 1 70  ? 25.129  -9.047  -45.321 1.00 54.31  ? 70   GLY C N     1 
ATOM   3438 C CA    . GLY B 1 70  ? 24.557  -10.254 -45.884 1.00 48.31  ? 70   GLY C CA    1 
ATOM   3439 C C     . GLY B 1 70  ? 25.607  -11.345 -45.956 1.00 52.44  ? 70   GLY C C     1 
ATOM   3440 O O     . GLY B 1 70  ? 25.339  -12.498 -45.628 1.00 58.97  ? 70   GLY C O     1 
ATOM   3441 N N     . TYR B 1 71  ? 26.809  -10.968 -46.382 1.00 49.39  ? 71   TYR C N     1 
ATOM   3442 C CA    . TYR B 1 71  ? 27.925  -11.896 -46.482 1.00 49.06  ? 71   TYR C CA    1 
ATOM   3443 C C     . TYR B 1 71  ? 28.258  -12.491 -45.118 1.00 54.77  ? 71   TYR C C     1 
ATOM   3444 O O     . TYR B 1 71  ? 28.373  -13.705 -44.963 1.00 58.63  ? 71   TYR C O     1 
ATOM   3445 C CB    . TYR B 1 71  ? 29.160  -11.182 -47.027 1.00 46.92  ? 71   TYR C CB    1 
ATOM   3446 C CG    . TYR B 1 71  ? 29.024  -10.669 -48.446 1.00 52.04  ? 71   TYR C CG    1 
ATOM   3447 C CD1   . TYR B 1 71  ? 27.940  -11.027 -49.241 1.00 50.06  ? 71   TYR C CD1   1 
ATOM   3448 C CD2   . TYR B 1 71  ? 29.988  -9.829  -48.993 1.00 47.06  ? 71   TYR C CD2   1 
ATOM   3449 C CE1   . TYR B 1 71  ? 27.824  -10.563 -50.538 1.00 51.55  ? 71   TYR C CE1   1 
ATOM   3450 C CE2   . TYR B 1 71  ? 29.880  -9.361  -50.288 1.00 46.76  ? 71   TYR C CE2   1 
ATOM   3451 C CZ    . TYR B 1 71  ? 28.797  -9.728  -51.054 1.00 49.98  ? 71   TYR C CZ    1 
ATOM   3452 O OH    . TYR B 1 71  ? 28.689  -9.260  -52.339 1.00 46.64  ? 71   TYR C OH    1 
ATOM   3453 N N     . ALA B 1 72  ? 28.423  -11.620 -44.132 1.00 52.50  ? 72   ALA C N     1 
ATOM   3454 C CA    . ALA B 1 72  ? 28.762  -12.048 -42.788 1.00 55.38  ? 72   ALA C CA    1 
ATOM   3455 C C     . ALA B 1 72  ? 27.667  -12.952 -42.222 1.00 63.51  ? 72   ALA C C     1 
ATOM   3456 O O     . ALA B 1 72  ? 27.954  -13.963 -41.588 1.00 63.56  ? 72   ALA C O     1 
ATOM   3457 C CB    . ALA B 1 72  ? 28.978  -10.839 -41.893 1.00 54.60  ? 72   ALA C CB    1 
ATOM   3458 N N     . GLN B 1 73  ? 26.415  -12.577 -42.469 1.00 66.05  ? 73   GLN C N     1 
ATOM   3459 C CA    . GLN B 1 73  ? 25.261  -13.335 -42.004 1.00 66.71  ? 73   GLN C CA    1 
ATOM   3460 C C     . GLN B 1 73  ? 25.303  -14.773 -42.501 1.00 70.10  ? 73   GLN C C     1 
ATOM   3461 O O     . GLN B 1 73  ? 24.830  -15.687 -41.827 1.00 69.47  ? 73   GLN C O     1 
ATOM   3462 C CB    . GLN B 1 73  ? 23.966  -12.671 -42.473 1.00 70.27  ? 73   GLN C CB    1 
ATOM   3463 C CG    . GLN B 1 73  ? 22.696  -13.290 -41.906 1.00 77.70  ? 73   GLN C CG    1 
ATOM   3464 C CD    . GLN B 1 73  ? 22.517  -13.005 -40.422 1.00 85.67  ? 73   GLN C CD    1 
ATOM   3465 O OE1   . GLN B 1 73  ? 23.464  -13.089 -39.637 1.00 82.48  ? 73   GLN C OE1   1 
ATOM   3466 N NE2   . GLN B 1 73  ? 21.295  -12.657 -40.034 1.00 91.83  ? 73   GLN C NE2   1 
ATOM   3467 N N     . SER B 1 74  ? 25.865  -14.965 -43.689 1.00 68.79  ? 74   SER C N     1 
ATOM   3468 C CA    . SER B 1 74  ? 25.989  -16.293 -44.274 1.00 67.94  ? 74   SER C CA    1 
ATOM   3469 C C     . SER B 1 74  ? 27.365  -16.880 -43.992 1.00 64.99  ? 74   SER C C     1 
ATOM   3470 O O     . SER B 1 74  ? 27.808  -17.805 -44.674 1.00 69.75  ? 74   SER C O     1 
ATOM   3471 C CB    . SER B 1 74  ? 25.758  -16.226 -45.784 1.00 65.57  ? 74   SER C CB    1 
ATOM   3472 O OG    . SER B 1 74  ? 24.476  -15.707 -46.075 1.00 61.89  ? 74   SER C OG    1 
ATOM   3473 N N     . GLY B 1 75  ? 28.042  -16.320 -42.994 1.00 61.42  ? 75   GLY C N     1 
ATOM   3474 C CA    . GLY B 1 75  ? 29.367  -16.766 -42.602 1.00 61.82  ? 75   GLY C CA    1 
ATOM   3475 C C     . GLY B 1 75  ? 30.377  -16.841 -43.732 1.00 63.24  ? 75   GLY C C     1 
ATOM   3476 O O     . GLY B 1 75  ? 31.260  -17.696 -43.721 1.00 61.18  ? 75   GLY C O     1 
ATOM   3477 N N     . LEU B 1 76  ? 30.262  -15.942 -44.705 1.00 61.03  ? 76   LEU C N     1 
ATOM   3478 C CA    . LEU B 1 76  ? 31.143  -15.976 -45.867 1.00 58.72  ? 76   LEU C CA    1 
ATOM   3479 C C     . LEU B 1 76  ? 32.410  -15.161 -45.656 1.00 58.78  ? 76   LEU C C     1 
ATOM   3480 O O     . LEU B 1 76  ? 33.332  -15.217 -46.468 1.00 55.24  ? 76   LEU C O     1 
ATOM   3481 C CB    . LEU B 1 76  ? 30.412  -15.469 -47.109 1.00 59.42  ? 76   LEU C CB    1 
ATOM   3482 C CG    . LEU B 1 76  ? 29.035  -16.083 -47.356 1.00 72.09  ? 76   LEU C CG    1 
ATOM   3483 C CD1   . LEU B 1 76  ? 28.357  -15.416 -48.542 1.00 77.81  ? 76   LEU C CD1   1 
ATOM   3484 C CD2   . LEU B 1 76  ? 29.149  -17.583 -47.569 1.00 78.67  ? 76   LEU C CD2   1 
ATOM   3485 N N     . LEU B 1 77  ? 32.455  -14.403 -44.565 1.00 59.63  ? 77   LEU C N     1 
ATOM   3486 C CA    . LEU B 1 77  ? 33.572  -13.496 -44.322 1.00 58.07  ? 77   LEU C CA    1 
ATOM   3487 C C     . LEU B 1 77  ? 34.340  -13.840 -43.054 1.00 58.89  ? 77   LEU C C     1 
ATOM   3488 O O     . LEU B 1 77  ? 33.749  -14.088 -42.001 1.00 56.26  ? 77   LEU C O     1 
ATOM   3489 C CB    . LEU B 1 77  ? 33.081  -12.048 -44.236 1.00 50.58  ? 77   LEU C CB    1 
ATOM   3490 C CG    . LEU B 1 77  ? 32.543  -11.419 -45.521 1.00 49.00  ? 77   LEU C CG    1 
ATOM   3491 C CD1   . LEU B 1 77  ? 31.915  -10.067 -45.220 1.00 51.12  ? 77   LEU C CD1   1 
ATOM   3492 C CD2   . LEU B 1 77  ? 33.656  -11.290 -46.554 1.00 38.70  ? 77   LEU C CD2   1 
ATOM   3493 N N     . ALA B 1 78  ? 35.663  -13.840 -43.167 1.00 56.89  ? 78   ALA C N     1 
ATOM   3494 C CA    . ALA B 1 78  ? 36.531  -14.011 -42.015 1.00 54.03  ? 78   ALA C CA    1 
ATOM   3495 C C     . ALA B 1 78  ? 36.515  -12.754 -41.157 1.00 58.28  ? 78   ALA C C     1 
ATOM   3496 O O     . ALA B 1 78  ? 36.422  -11.641 -41.671 1.00 54.76  ? 78   ALA C O     1 
ATOM   3497 C CB    . ALA B 1 78  ? 37.946  -14.321 -42.462 1.00 52.55  ? 78   ALA C CB    1 
ATOM   3498 N N     . GLU B 1 79  ? 36.599  -12.939 -39.845 1.00 56.14  ? 79   GLU C N     1 
ATOM   3499 C CA    . GLU B 1 79  ? 36.725  -11.821 -38.924 1.00 58.11  ? 79   GLU C CA    1 
ATOM   3500 C C     . GLU B 1 79  ? 38.143  -11.271 -39.020 1.00 57.59  ? 79   GLU C C     1 
ATOM   3501 O O     . GLU B 1 79  ? 39.108  -12.028 -39.019 1.00 55.91  ? 79   GLU C O     1 
ATOM   3502 C CB    . GLU B 1 79  ? 36.422  -12.283 -37.498 1.00 62.30  ? 79   GLU C CB    1 
ATOM   3503 C CG    . GLU B 1 79  ? 36.346  -11.169 -36.470 1.00 68.99  ? 79   GLU C CG    1 
ATOM   3504 C CD    . GLU B 1 79  ? 35.893  -11.671 -35.112 1.00 74.04  ? 79   GLU C CD    1 
ATOM   3505 O OE1   . GLU B 1 79  ? 35.999  -12.892 -34.862 1.00 74.59  ? 79   GLU C OE1   1 
ATOM   3506 O OE2   . GLU B 1 79  ? 35.423  -10.845 -34.299 1.00 74.06  ? 79   GLU C OE2   1 
ATOM   3507 N N     . ILE B 1 80  ? 38.273  -9.953  -39.120 1.00 61.87  ? 80   ILE C N     1 
ATOM   3508 C CA    . ILE B 1 80  ? 39.593  -9.346  -39.254 1.00 59.46  ? 80   ILE C CA    1 
ATOM   3509 C C     . ILE B 1 80  ? 40.134  -8.950  -37.889 1.00 60.40  ? 80   ILE C C     1 
ATOM   3510 O O     . ILE B 1 80  ? 39.366  -8.630  -36.982 1.00 54.50  ? 80   ILE C O     1 
ATOM   3511 C CB    . ILE B 1 80  ? 39.564  -8.129  -40.188 1.00 54.20  ? 80   ILE C CB    1 
ATOM   3512 C CG1   . ILE B 1 80  ? 38.468  -7.162  -39.749 1.00 56.58  ? 80   ILE C CG1   1 
ATOM   3513 C CG2   . ILE B 1 80  ? 39.331  -8.574  -41.628 1.00 44.97  ? 80   ILE C CG2   1 
ATOM   3514 C CD1   . ILE B 1 80  ? 38.785  -5.725  -40.042 1.00 60.04  ? 80   ILE C CD1   1 
ATOM   3515 N N     . THR B 1 81  ? 41.458  -8.957  -37.754 1.00 67.56  ? 81   THR C N     1 
ATOM   3516 C CA    . THR B 1 81  ? 42.087  -8.855  -36.439 1.00 73.94  ? 81   THR C CA    1 
ATOM   3517 C C     . THR B 1 81  ? 43.118  -7.732  -36.308 1.00 74.62  ? 81   THR C C     1 
ATOM   3518 O O     . THR B 1 81  ? 44.252  -7.974  -35.892 1.00 73.85  ? 81   THR C O     1 
ATOM   3519 C CB    . THR B 1 81  ? 42.778  -10.181 -36.078 1.00 73.03  ? 81   THR C CB    1 
ATOM   3520 O OG1   . THR B 1 81  ? 43.862  -10.417 -36.988 1.00 67.23  ? 81   THR C OG1   1 
ATOM   3521 C CG2   . THR B 1 81  ? 41.788  -11.335 -36.171 1.00 71.59  ? 81   THR C CG2   1 
ATOM   3522 N N     . PRO B 1 82  ? 42.725  -6.495  -36.643 1.00 70.44  ? 82   PRO C N     1 
ATOM   3523 C CA    . PRO B 1 82  ? 43.672  -5.379  -36.544 1.00 66.91  ? 82   PRO C CA    1 
ATOM   3524 C C     . PRO B 1 82  ? 43.982  -5.034  -35.089 1.00 67.35  ? 82   PRO C C     1 
ATOM   3525 O O     . PRO B 1 82  ? 43.054  -4.842  -34.304 1.00 67.26  ? 82   PRO C O     1 
ATOM   3526 C CB    . PRO B 1 82  ? 42.908  -4.227  -37.200 1.00 57.97  ? 82   PRO C CB    1 
ATOM   3527 C CG    . PRO B 1 82  ? 41.469  -4.556  -36.955 1.00 53.11  ? 82   PRO C CG    1 
ATOM   3528 C CD    . PRO B 1 82  ? 41.384  -6.049  -37.060 1.00 59.12  ? 82   PRO C CD    1 
ATOM   3529 N N     . ASP B 1 83  ? 45.259  -4.952  -34.728 1.00 67.82  ? 83   ASP C N     1 
ATOM   3530 C CA    . ASP B 1 83  ? 45.608  -4.557  -33.365 1.00 73.49  ? 83   ASP C CA    1 
ATOM   3531 C C     . ASP B 1 83  ? 45.208  -3.104  -33.121 1.00 71.92  ? 83   ASP C C     1 
ATOM   3532 O O     . ASP B 1 83  ? 44.929  -2.366  -34.065 1.00 71.64  ? 83   ASP C O     1 
ATOM   3533 C CB    . ASP B 1 83  ? 47.098  -4.787  -33.062 1.00 75.79  ? 83   ASP C CB    1 
ATOM   3534 C CG    . ASP B 1 83  ? 48.018  -3.928  -33.915 1.00 80.25  ? 83   ASP C CG    1 
ATOM   3535 O OD1   . ASP B 1 83  ? 47.532  -2.975  -34.561 1.00 81.42  ? 83   ASP C OD1   1 
ATOM   3536 O OD2   . ASP B 1 83  ? 49.238  -4.203  -33.929 1.00 77.97  ? 83   ASP C OD2   1 
ATOM   3537 N N     . LYS B 1 84  ? 45.177  -2.699  -31.856 1.00 66.58  ? 84   LYS C N     1 
ATOM   3538 C CA    . LYS B 1 84  ? 44.734  -1.357  -31.495 1.00 66.03  ? 84   LYS C CA    1 
ATOM   3539 C C     . LYS B 1 84  ? 45.521  -0.281  -32.235 1.00 68.50  ? 84   LYS C C     1 
ATOM   3540 O O     . LYS B 1 84  ? 44.987  0.778   -32.559 1.00 66.00  ? 84   LYS C O     1 
ATOM   3541 C CB    . LYS B 1 84  ? 44.853  -1.135  -29.987 1.00 67.86  ? 84   LYS C CB    1 
ATOM   3542 C CG    . LYS B 1 84  ? 44.411  0.248   -29.526 1.00 77.07  ? 84   LYS C CG    1 
ATOM   3543 C CD    . LYS B 1 84  ? 42.916  0.457   -29.737 1.00 85.58  ? 84   LYS C CD    1 
ATOM   3544 C CE    . LYS B 1 84  ? 42.487  1.858   -29.315 1.00 89.54  ? 84   LYS C CE    1 
ATOM   3545 N NZ    . LYS B 1 84  ? 41.013  2.052   -29.436 1.00 88.79  ? 84   LYS C NZ    1 
ATOM   3546 N N     . ALA B 1 85  ? 46.794  -0.556  -32.492 1.00 65.83  ? 85   ALA C N     1 
ATOM   3547 C CA    . ALA B 1 85  ? 47.650  0.398   -33.179 1.00 65.30  ? 85   ALA C CA    1 
ATOM   3548 C C     . ALA B 1 85  ? 47.085  0.720   -34.560 1.00 73.61  ? 85   ALA C C     1 
ATOM   3549 O O     . ALA B 1 85  ? 46.921  1.888   -34.923 1.00 75.46  ? 85   ALA C O     1 
ATOM   3550 C CB    . ALA B 1 85  ? 49.064  -0.150  -33.296 1.00 64.48  ? 85   ALA C CB    1 
ATOM   3551 N N     . PHE B 1 86  ? 46.779  -0.327  -35.319 1.00 67.47  ? 86   PHE C N     1 
ATOM   3552 C CA    . PHE B 1 86  ? 46.279  -0.159  -36.670 1.00 62.48  ? 86   PHE C CA    1 
ATOM   3553 C C     . PHE B 1 86  ? 44.889  0.464   -36.710 1.00 59.59  ? 86   PHE C C     1 
ATOM   3554 O O     . PHE B 1 86  ? 44.600  1.270   -37.590 1.00 57.05  ? 86   PHE C O     1 
ATOM   3555 C CB    . PHE B 1 86  ? 46.275  -1.483  -37.428 1.00 62.14  ? 86   PHE C CB    1 
ATOM   3556 C CG    . PHE B 1 86  ? 45.874  -1.340  -38.861 1.00 63.06  ? 86   PHE C CG    1 
ATOM   3557 C CD1   . PHE B 1 86  ? 46.804  -0.972  -39.818 1.00 62.64  ? 86   PHE C CD1   1 
ATOM   3558 C CD2   . PHE B 1 86  ? 44.562  -1.543  -39.251 1.00 63.98  ? 86   PHE C CD2   1 
ATOM   3559 C CE1   . PHE B 1 86  ? 46.437  -0.825  -41.140 1.00 57.70  ? 86   PHE C CE1   1 
ATOM   3560 C CE2   . PHE B 1 86  ? 44.189  -1.396  -40.573 1.00 62.76  ? 86   PHE C CE2   1 
ATOM   3561 C CZ    . PHE B 1 86  ? 45.128  -1.036  -41.517 1.00 55.48  ? 86   PHE C CZ    1 
ATOM   3562 N N     . GLN B 1 87  ? 44.027  0.093   -35.767 1.00 52.49  ? 87   GLN C N     1 
ATOM   3563 C CA    . GLN B 1 87  ? 42.689  0.673   -35.727 1.00 54.14  ? 87   GLN C CA    1 
ATOM   3564 C C     . GLN B 1 87  ? 42.776  2.181   -35.551 1.00 58.86  ? 87   GLN C C     1 
ATOM   3565 O O     . GLN B 1 87  ? 41.956  2.928   -36.090 1.00 60.25  ? 87   GLN C O     1 
ATOM   3566 C CB    . GLN B 1 87  ? 41.857  0.073   -34.599 1.00 58.49  ? 87   GLN C CB    1 
ATOM   3567 C CG    . GLN B 1 87  ? 41.619  -1.417  -34.728 1.00 67.54  ? 87   GLN C CG    1 
ATOM   3568 C CD    . GLN B 1 87  ? 40.614  -1.931  -33.716 1.00 69.62  ? 87   GLN C CD    1 
ATOM   3569 O OE1   . GLN B 1 87  ? 39.650  -1.244  -33.377 1.00 71.34  ? 87   GLN C OE1   1 
ATOM   3570 N NE2   . GLN B 1 87  ? 40.838  -3.144  -33.226 1.00 65.83  ? 87   GLN C NE2   1 
ATOM   3571 N N     . ASP B 1 88  ? 43.778  2.624   -34.796 1.00 52.56  ? 88   ASP C N     1 
ATOM   3572 C CA    . ASP B 1 88  ? 43.979  4.047   -34.551 1.00 59.94  ? 88   ASP C CA    1 
ATOM   3573 C C     . ASP B 1 88  ? 44.450  4.794   -35.802 1.00 58.96  ? 88   ASP C C     1 
ATOM   3574 O O     . ASP B 1 88  ? 44.590  6.018   -35.775 1.00 54.95  ? 88   ASP C O     1 
ATOM   3575 C CB    . ASP B 1 88  ? 44.963  4.273   -33.398 1.00 67.09  ? 88   ASP C CB    1 
ATOM   3576 C CG    . ASP B 1 88  ? 44.372  3.919   -32.038 1.00 74.59  ? 88   ASP C CG    1 
ATOM   3577 O OD1   . ASP B 1 88  ? 43.128  3.844   -31.913 1.00 71.29  ? 88   ASP C OD1   1 
ATOM   3578 O OD2   . ASP B 1 88  ? 45.160  3.725   -31.088 1.00 81.47  ? 88   ASP C OD2   1 
ATOM   3579 N N     . LYS B 1 89  ? 44.690  4.059   -36.889 1.00 53.89  ? 89   LYS C N     1 
ATOM   3580 C CA    . LYS B 1 89  ? 45.099  4.664   -38.160 1.00 49.94  ? 89   LYS C CA    1 
ATOM   3581 C C     . LYS B 1 89  ? 43.910  5.024   -39.057 1.00 47.02  ? 89   LYS C C     1 
ATOM   3582 O O     . LYS B 1 89  ? 44.056  5.785   -40.015 1.00 52.79  ? 89   LYS C O     1 
ATOM   3583 C CB    . LYS B 1 89  ? 46.048  3.741   -38.926 1.00 49.78  ? 89   LYS C CB    1 
ATOM   3584 C CG    . LYS B 1 89  ? 47.425  3.589   -38.309 1.00 59.15  ? 89   LYS C CG    1 
ATOM   3585 C CD    . LYS B 1 89  ? 48.277  2.648   -39.151 1.00 68.10  ? 89   LYS C CD    1 
ATOM   3586 C CE    . LYS B 1 89  ? 49.694  2.541   -38.615 1.00 77.39  ? 89   LYS C CE    1 
ATOM   3587 N NZ    . LYS B 1 89  ? 50.552  1.686   -39.482 1.00 79.11  ? 89   LYS C NZ    1 
ATOM   3588 N N     . LEU B 1 90  ? 42.740  4.472   -38.749 1.00 40.31  ? 90   LEU C N     1 
ATOM   3589 C CA    . LEU B 1 90  ? 41.541  4.743   -39.529 1.00 42.93  ? 90   LEU C CA    1 
ATOM   3590 C C     . LEU B 1 90  ? 40.510  5.515   -38.702 1.00 48.78  ? 90   LEU C C     1 
ATOM   3591 O O     . LEU B 1 90  ? 40.471  5.393   -37.484 1.00 50.79  ? 90   LEU C O     1 
ATOM   3592 C CB    . LEU B 1 90  ? 40.932  3.437   -40.049 1.00 43.83  ? 90   LEU C CB    1 
ATOM   3593 C CG    . LEU B 1 90  ? 41.845  2.432   -40.769 1.00 47.83  ? 90   LEU C CG    1 
ATOM   3594 C CD1   . LEU B 1 90  ? 41.010  1.351   -41.440 1.00 48.09  ? 90   LEU C CD1   1 
ATOM   3595 C CD2   . LEU B 1 90  ? 42.744  3.099   -41.791 1.00 39.54  ? 90   LEU C CD2   1 
ATOM   3596 N N     . TYR B 1 91  ? 39.679  6.316   -39.362 1.00 50.56  ? 91   TYR C N     1 
ATOM   3597 C CA    . TYR B 1 91  ? 38.638  7.050   -38.650 1.00 47.62  ? 91   TYR C CA    1 
ATOM   3598 C C     . TYR B 1 91  ? 37.605  6.088   -38.071 1.00 51.39  ? 91   TYR C C     1 
ATOM   3599 O O     . TYR B 1 91  ? 37.154  5.168   -38.750 1.00 47.56  ? 91   TYR C O     1 
ATOM   3600 C CB    . TYR B 1 91  ? 37.959  8.080   -39.556 1.00 43.13  ? 91   TYR C CB    1 
ATOM   3601 C CG    . TYR B 1 91  ? 38.911  9.111   -40.135 1.00 50.43  ? 91   TYR C CG    1 
ATOM   3602 C CD1   . TYR B 1 91  ? 39.371  10.175  -39.364 1.00 46.63  ? 91   TYR C CD1   1 
ATOM   3603 C CD2   . TYR B 1 91  ? 39.345  9.023   -41.453 1.00 35.74  ? 91   TYR C CD2   1 
ATOM   3604 C CE1   . TYR B 1 91  ? 40.240  11.118  -39.886 1.00 40.33  ? 91   TYR C CE1   1 
ATOM   3605 C CE2   . TYR B 1 91  ? 40.217  9.960   -41.981 1.00 39.74  ? 91   TYR C CE2   1 
ATOM   3606 C CZ    . TYR B 1 91  ? 40.659  11.007  -41.195 1.00 46.41  ? 91   TYR C CZ    1 
ATOM   3607 O OH    . TYR B 1 91  ? 41.528  11.946  -41.715 1.00 45.30  ? 91   TYR C OH    1 
ATOM   3608 N N     . PRO B 1 92  ? 37.219  6.307   -36.807 1.00 47.94  ? 92   PRO C N     1 
ATOM   3609 C CA    . PRO B 1 92  ? 36.281  5.393   -36.147 1.00 44.97  ? 92   PRO C CA    1 
ATOM   3610 C C     . PRO B 1 92  ? 34.989  5.202   -36.947 1.00 44.87  ? 92   PRO C C     1 
ATOM   3611 O O     . PRO B 1 92  ? 34.446  4.095   -36.963 1.00 42.46  ? 92   PRO C O     1 
ATOM   3612 C CB    . PRO B 1 92  ? 36.014  6.062   -34.785 1.00 44.82  ? 92   PRO C CB    1 
ATOM   3613 C CG    . PRO B 1 92  ? 36.531  7.450   -34.909 1.00 56.70  ? 92   PRO C CG    1 
ATOM   3614 C CD    . PRO B 1 92  ? 37.620  7.423   -35.942 1.00 47.05  ? 92   PRO C CD    1 
ATOM   3615 N N     . PHE B 1 93  ? 34.512  6.247   -37.617 1.00 45.39  ? 93   PHE C N     1 
ATOM   3616 C CA    . PHE B 1 93  ? 33.321  6.093   -38.448 1.00 43.70  ? 93   PHE C CA    1 
ATOM   3617 C C     . PHE B 1 93  ? 33.487  4.975   -39.464 1.00 38.60  ? 93   PHE C C     1 
ATOM   3618 O O     . PHE B 1 93  ? 32.526  4.287   -39.809 1.00 40.25  ? 93   PHE C O     1 
ATOM   3619 C CB    . PHE B 1 93  ? 32.973  7.368   -39.213 1.00 44.50  ? 93   PHE C CB    1 
ATOM   3620 C CG    . PHE B 1 93  ? 31.963  7.140   -40.302 1.00 47.00  ? 93   PHE C CG    1 
ATOM   3621 C CD1   . PHE B 1 93  ? 30.613  7.060   -40.005 1.00 44.86  ? 93   PHE C CD1   1 
ATOM   3622 C CD2   . PHE B 1 93  ? 32.367  6.962   -41.619 1.00 43.74  ? 93   PHE C CD2   1 
ATOM   3623 C CE1   . PHE B 1 93  ? 29.682  6.830   -41.003 1.00 48.46  ? 93   PHE C CE1   1 
ATOM   3624 C CE2   . PHE B 1 93  ? 31.440  6.728   -42.620 1.00 37.47  ? 93   PHE C CE2   1 
ATOM   3625 C CZ    . PHE B 1 93  ? 30.100  6.663   -42.317 1.00 40.95  ? 93   PHE C CZ    1 
ATOM   3626 N N     . THR B 1 94  ? 34.706  4.807   -39.959 1.00 34.30  ? 94   THR C N     1 
ATOM   3627 C CA    . THR B 1 94  ? 34.922  3.878   -41.057 1.00 43.44  ? 94   THR C CA    1 
ATOM   3628 C C     . THR B 1 94  ? 34.938  2.437   -40.554 1.00 43.80  ? 94   THR C C     1 
ATOM   3629 O O     . THR B 1 94  ? 34.396  1.541   -41.201 1.00 45.55  ? 94   THR C O     1 
ATOM   3630 C CB    . THR B 1 94  ? 36.163  4.250   -41.918 1.00 35.66  ? 94   THR C CB    1 
ATOM   3631 O OG1   . THR B 1 94  ? 37.358  4.164   -41.140 1.00 38.42  ? 94   THR C OG1   1 
ATOM   3632 C CG2   . THR B 1 94  ? 36.026  5.674   -42.449 1.00 36.92  ? 94   THR C CG2   1 
ATOM   3633 N N     . TRP B 1 95  ? 35.536  2.226   -39.386 1.00 44.11  ? 95   TRP C N     1 
ATOM   3634 C CA    . TRP B 1 95  ? 35.433  0.940   -38.709 1.00 42.49  ? 95   TRP C CA    1 
ATOM   3635 C C     . TRP B 1 95  ? 33.967  0.594   -38.430 1.00 40.62  ? 95   TRP C C     1 
ATOM   3636 O O     . TRP B 1 95  ? 33.536  -0.534  -38.660 1.00 40.38  ? 95   TRP C O     1 
ATOM   3637 C CB    . TRP B 1 95  ? 36.223  0.944   -37.402 1.00 42.84  ? 95   TRP C CB    1 
ATOM   3638 C CG    . TRP B 1 95  ? 37.712  0.962   -37.561 1.00 37.81  ? 95   TRP C CG    1 
ATOM   3639 C CD1   . TRP B 1 95  ? 38.576  1.904   -37.075 1.00 38.66  ? 95   TRP C CD1   1 
ATOM   3640 C CD2   . TRP B 1 95  ? 38.520  -0.015  -38.233 1.00 33.25  ? 95   TRP C CD2   1 
ATOM   3641 N NE1   . TRP B 1 95  ? 39.872  1.573   -37.402 1.00 40.96  ? 95   TRP C NE1   1 
ATOM   3642 C CE2   . TRP B 1 95  ? 39.865  0.402   -38.115 1.00 38.51  ? 95   TRP C CE2   1 
ATOM   3643 C CE3   . TRP B 1 95  ? 38.239  -1.196  -38.926 1.00 30.29  ? 95   TRP C CE3   1 
ATOM   3644 C CZ2   . TRP B 1 95  ? 40.924  -0.323  -38.666 1.00 40.70  ? 95   TRP C CZ2   1 
ATOM   3645 C CZ3   . TRP B 1 95  ? 39.294  -1.915  -39.473 1.00 30.66  ? 95   TRP C CZ3   1 
ATOM   3646 C CH2   . TRP B 1 95  ? 40.618  -1.476  -39.340 1.00 34.08  ? 95   TRP C CH2   1 
ATOM   3647 N N     . ASP B 1 96  ? 33.201  1.566   -37.938 1.00 40.11  ? 96   ASP C N     1 
ATOM   3648 C CA    . ASP B 1 96  ? 31.788  1.336   -37.635 1.00 40.90  ? 96   ASP C CA    1 
ATOM   3649 C C     . ASP B 1 96  ? 31.044  0.773   -38.839 1.00 47.87  ? 96   ASP C C     1 
ATOM   3650 O O     . ASP B 1 96  ? 30.161  -0.076  -38.696 1.00 48.34  ? 96   ASP C O     1 
ATOM   3651 C CB    . ASP B 1 96  ? 31.102  2.624   -37.163 1.00 48.25  ? 96   ASP C CB    1 
ATOM   3652 C CG    . ASP B 1 96  ? 31.664  3.144   -35.854 1.00 59.88  ? 96   ASP C CG    1 
ATOM   3653 O OD1   . ASP B 1 96  ? 32.284  2.352   -35.109 1.00 56.38  ? 96   ASP C OD1   1 
ATOM   3654 O OD2   . ASP B 1 96  ? 31.479  4.347   -35.567 1.00 65.94  ? 96   ASP C OD2   1 
ATOM   3655 N N     . ALA B 1 97  ? 31.401  1.255   -40.027 1.00 47.79  ? 97   ALA C N     1 
ATOM   3656 C CA    . ALA B 1 97  ? 30.730  0.845   -41.253 1.00 44.60  ? 97   ALA C CA    1 
ATOM   3657 C C     . ALA B 1 97  ? 30.972  -0.628  -41.569 1.00 40.26  ? 97   ALA C C     1 
ATOM   3658 O O     . ALA B 1 97  ? 30.144  -1.278  -42.203 1.00 41.10  ? 97   ALA C O     1 
ATOM   3659 C CB    . ALA B 1 97  ? 31.171  1.723   -42.419 1.00 43.74  ? 97   ALA C CB    1 
ATOM   3660 N N     . VAL B 1 98  ? 32.113  -1.148  -41.129 1.00 39.38  ? 98   VAL C N     1 
ATOM   3661 C CA    . VAL B 1 98  ? 32.460  -2.546  -41.371 1.00 41.37  ? 98   VAL C CA    1 
ATOM   3662 C C     . VAL B 1 98  ? 32.281  -3.421  -40.117 1.00 51.48  ? 98   VAL C C     1 
ATOM   3663 O O     . VAL B 1 98  ? 32.967  -4.431  -39.939 1.00 47.34  ? 98   VAL C O     1 
ATOM   3664 C CB    . VAL B 1 98  ? 33.903  -2.667  -41.878 1.00 43.37  ? 98   VAL C CB    1 
ATOM   3665 C CG1   . VAL B 1 98  ? 34.007  -2.116  -43.296 1.00 41.30  ? 98   VAL C CG1   1 
ATOM   3666 C CG2   . VAL B 1 98  ? 34.857  -1.939  -40.927 1.00 40.80  ? 98   VAL C CG2   1 
ATOM   3667 N N     . ARG B 1 99  ? 31.355  -3.028  -39.251 1.00 54.91  ? 99   ARG C N     1 
ATOM   3668 C CA    . ARG B 1 99  ? 31.084  -3.784  -38.036 1.00 51.11  ? 99   ARG C CA    1 
ATOM   3669 C C     . ARG B 1 99  ? 29.717  -4.442  -38.151 1.00 51.24  ? 99   ARG C C     1 
ATOM   3670 O O     . ARG B 1 99  ? 28.712  -3.758  -38.312 1.00 51.94  ? 99   ARG C O     1 
ATOM   3671 C CB    . ARG B 1 99  ? 31.124  -2.859  -36.820 1.00 46.22  ? 99   ARG C CB    1 
ATOM   3672 C CG    . ARG B 1 99  ? 31.316  -3.570  -35.494 1.00 63.40  ? 99   ARG C CG    1 
ATOM   3673 C CD    . ARG B 1 99  ? 31.137  -2.609  -34.325 1.00 68.65  ? 99   ARG C CD    1 
ATOM   3674 N NE    . ARG B 1 99  ? 32.007  -1.438  -34.430 1.00 67.64  ? 99   ARG C NE    1 
ATOM   3675 C CZ    . ARG B 1 99  ? 33.265  -1.409  -34.001 1.00 60.92  ? 99   ARG C CZ    1 
ATOM   3676 N NH1   . ARG B 1 99  ? 33.804  -2.489  -33.444 1.00 60.28  ? 99   ARG C NH1   1 
ATOM   3677 N NH2   . ARG B 1 99  ? 33.987  -0.307  -34.128 1.00 50.12  ? 99   ARG C NH2   1 
ATOM   3678 N N     . TYR B 1 100 ? 29.679  -5.768  -38.083 1.00 47.82  ? 100  TYR C N     1 
ATOM   3679 C CA    . TYR B 1 100 ? 28.411  -6.481  -38.153 1.00 46.63  ? 100  TYR C CA    1 
ATOM   3680 C C     . TYR B 1 100 ? 28.238  -7.499  -37.013 1.00 49.64  ? 100  TYR C C     1 
ATOM   3681 O O     . TYR B 1 100 ? 29.125  -8.311  -36.757 1.00 48.70  ? 100  TYR C O     1 
ATOM   3682 C CB    . TYR B 1 100 ? 28.263  -7.170  -39.506 1.00 37.22  ? 100  TYR C CB    1 
ATOM   3683 C CG    . TYR B 1 100 ? 26.911  -7.799  -39.680 1.00 44.21  ? 100  TYR C CG    1 
ATOM   3684 C CD1   . TYR B 1 100 ? 25.782  -7.013  -39.859 1.00 47.26  ? 100  TYR C CD1   1 
ATOM   3685 C CD2   . TYR B 1 100 ? 26.753  -9.180  -39.637 1.00 45.35  ? 100  TYR C CD2   1 
ATOM   3686 C CE1   . TYR B 1 100 ? 24.532  -7.585  -40.004 1.00 58.66  ? 100  TYR C CE1   1 
ATOM   3687 C CE2   . TYR B 1 100 ? 25.508  -9.760  -39.782 1.00 41.77  ? 100  TYR C CE2   1 
ATOM   3688 C CZ    . TYR B 1 100 ? 24.403  -8.962  -39.964 1.00 56.04  ? 100  TYR C CZ    1 
ATOM   3689 O OH    . TYR B 1 100 ? 23.164  -9.539  -40.106 1.00 61.66  ? 100  TYR C OH    1 
ATOM   3690 N N     . ASN B 1 101 ? 27.088  -7.452  -36.340 1.00 54.98  ? 101  ASN C N     1 
ATOM   3691 C CA    . ASN B 1 101 ? 26.819  -8.318  -35.184 1.00 50.81  ? 101  ASN C CA    1 
ATOM   3692 C C     . ASN B 1 101 ? 27.966  -8.342  -34.179 1.00 51.52  ? 101  ASN C C     1 
ATOM   3693 O O     . ASN B 1 101 ? 28.344  -9.408  -33.687 1.00 57.28  ? 101  ASN C O     1 
ATOM   3694 C CB    . ASN B 1 101 ? 26.512  -9.757  -35.622 1.00 41.14  ? 101  ASN C CB    1 
ATOM   3695 C CG    . ASN B 1 101 ? 25.129  -9.910  -36.221 1.00 41.91  ? 101  ASN C CG    1 
ATOM   3696 O OD1   . ASN B 1 101 ? 24.851  -10.892 -36.911 1.00 43.63  ? 101  ASN C OD1   1 
ATOM   3697 N ND2   . ASN B 1 101 ? 24.248  -8.945  -35.955 1.00 43.32  ? 101  ASN C ND2   1 
ATOM   3698 N N     . GLY B 1 102 ? 28.529  -7.173  -33.895 1.00 45.49  ? 102  GLY C N     1 
ATOM   3699 C CA    . GLY B 1 102 ? 29.576  -7.046  -32.896 1.00 48.55  ? 102  GLY C CA    1 
ATOM   3700 C C     . GLY B 1 102 ? 30.982  -7.390  -33.356 1.00 51.14  ? 102  GLY C C     1 
ATOM   3701 O O     . GLY B 1 102 ? 31.932  -7.283  -32.574 1.00 50.21  ? 102  GLY C O     1 
ATOM   3702 N N     . LYS B 1 103 ? 31.124  -7.792  -34.618 1.00 44.54  ? 103  LYS C N     1 
ATOM   3703 C CA    . LYS B 1 103 ? 32.435  -8.154  -35.158 1.00 53.00  ? 103  LYS C CA    1 
ATOM   3704 C C     . LYS B 1 103 ? 32.850  -7.293  -36.362 1.00 57.54  ? 103  LYS C C     1 
ATOM   3705 O O     . LYS B 1 103 ? 32.011  -6.911  -37.182 1.00 53.96  ? 103  LYS C O     1 
ATOM   3706 C CB    . LYS B 1 103 ? 32.464  -9.643  -35.540 1.00 60.37  ? 103  LYS C CB    1 
ATOM   3707 C CG    . LYS B 1 103 ? 32.240  -10.607 -34.371 1.00 67.25  ? 103  LYS C CG    1 
ATOM   3708 C CD    . LYS B 1 103 ? 32.581  -12.059 -34.737 1.00 74.26  ? 103  LYS C CD    1 
ATOM   3709 C CE    . LYS B 1 103 ? 31.395  -12.814 -35.335 1.00 77.03  ? 103  LYS C CE    1 
ATOM   3710 N NZ    . LYS B 1 103 ? 30.340  -13.147 -34.328 1.00 75.14  ? 103  LYS C NZ    1 
ATOM   3711 N N     . LEU B 1 104 ? 34.143  -6.987  -36.461 1.00 54.55  ? 104  LEU C N     1 
ATOM   3712 C CA    . LEU B 1 104 ? 34.689  -6.342  -37.655 1.00 51.16  ? 104  LEU C CA    1 
ATOM   3713 C C     . LEU B 1 104 ? 34.740  -7.350  -38.792 1.00 49.51  ? 104  LEU C C     1 
ATOM   3714 O O     . LEU B 1 104 ? 35.397  -8.382  -38.671 1.00 56.13  ? 104  LEU C O     1 
ATOM   3715 C CB    . LEU B 1 104 ? 36.101  -5.817  -37.400 1.00 44.73  ? 104  LEU C CB    1 
ATOM   3716 C CG    . LEU B 1 104 ? 36.255  -4.686  -36.390 1.00 49.58  ? 104  LEU C CG    1 
ATOM   3717 C CD1   . LEU B 1 104 ? 37.705  -4.217  -36.340 1.00 48.49  ? 104  LEU C CD1   1 
ATOM   3718 C CD2   . LEU B 1 104 ? 35.319  -3.537  -36.740 1.00 44.88  ? 104  LEU C CD2   1 
ATOM   3719 N N     . ILE B 1 105 ? 34.068  -7.048  -39.900 1.00 44.79  ? 105  ILE C N     1 
ATOM   3720 C CA    . ILE B 1 105 ? 33.971  -8.001  -41.003 1.00 43.26  ? 105  ILE C CA    1 
ATOM   3721 C C     . ILE B 1 105 ? 34.720  -7.586  -42.267 1.00 51.82  ? 105  ILE C C     1 
ATOM   3722 O O     . ILE B 1 105 ? 34.643  -8.275  -43.289 1.00 48.27  ? 105  ILE C O     1 
ATOM   3723 C CB    . ILE B 1 105 ? 32.496  -8.367  -41.329 1.00 39.57  ? 105  ILE C CB    1 
ATOM   3724 C CG1   . ILE B 1 105 ? 31.624  -7.114  -41.495 1.00 39.30  ? 105  ILE C CG1   1 
ATOM   3725 C CG2   . ILE B 1 105 ? 31.915  -9.227  -40.203 1.00 40.60  ? 105  ILE C CG2   1 
ATOM   3726 C CD1   . ILE B 1 105 ? 32.041  -6.190  -42.610 1.00 48.59  ? 105  ILE C CD1   1 
ATOM   3727 N N     . ALA B 1 106 ? 35.451  -6.474  -42.192 1.00 55.58  ? 106  ALA C N     1 
ATOM   3728 C CA    . ALA B 1 106 ? 36.217  -5.979  -43.339 1.00 47.56  ? 106  ALA C CA    1 
ATOM   3729 C C     . ALA B 1 106 ? 37.117  -4.791  -42.998 1.00 47.31  ? 106  ALA C C     1 
ATOM   3730 O O     . ALA B 1 106 ? 36.936  -4.128  -41.978 1.00 45.01  ? 106  ALA C O     1 
ATOM   3731 C CB    . ALA B 1 106 ? 35.278  -5.611  -44.481 1.00 43.42  ? 106  ALA C CB    1 
ATOM   3732 N N     . TYR B 1 107 ? 38.088  -4.527  -43.866 1.00 44.99  ? 107  TYR C N     1 
ATOM   3733 C CA    . TYR B 1 107 ? 38.888  -3.316  -43.760 1.00 47.38  ? 107  TYR C CA    1 
ATOM   3734 C C     . TYR B 1 107 ? 38.247  -2.209  -44.600 1.00 48.12  ? 107  TYR C C     1 
ATOM   3735 O O     . TYR B 1 107 ? 37.974  -2.404  -45.787 1.00 44.41  ? 107  TYR C O     1 
ATOM   3736 C CB    . TYR B 1 107 ? 40.316  -3.568  -44.243 1.00 47.29  ? 107  TYR C CB    1 
ATOM   3737 C CG    . TYR B 1 107 ? 41.135  -4.473  -43.355 1.00 50.57  ? 107  TYR C CG    1 
ATOM   3738 C CD1   . TYR B 1 107 ? 41.864  -3.959  -42.286 1.00 52.85  ? 107  TYR C CD1   1 
ATOM   3739 C CD2   . TYR B 1 107 ? 41.194  -5.840  -43.591 1.00 50.20  ? 107  TYR C CD2   1 
ATOM   3740 C CE1   . TYR B 1 107 ? 42.624  -4.790  -41.472 1.00 59.88  ? 107  TYR C CE1   1 
ATOM   3741 C CE2   . TYR B 1 107 ? 41.948  -6.674  -42.787 1.00 52.42  ? 107  TYR C CE2   1 
ATOM   3742 C CZ    . TYR B 1 107 ? 42.660  -6.148  -41.730 1.00 60.14  ? 107  TYR C CZ    1 
ATOM   3743 O OH    . TYR B 1 107 ? 43.408  -6.987  -40.932 1.00 64.26  ? 107  TYR C OH    1 
ATOM   3744 N N     . PRO B 1 108 ? 38.006  -1.040  -43.989 1.00 48.10  ? 108  PRO C N     1 
ATOM   3745 C CA    . PRO B 1 108 ? 37.411  0.079   -44.724 1.00 47.28  ? 108  PRO C CA    1 
ATOM   3746 C C     . PRO B 1 108 ? 38.486  0.842   -45.485 1.00 45.65  ? 108  PRO C C     1 
ATOM   3747 O O     . PRO B 1 108 ? 39.587  1.012   -44.966 1.00 41.57  ? 108  PRO C O     1 
ATOM   3748 C CB    . PRO B 1 108 ? 36.821  0.946   -43.613 1.00 48.29  ? 108  PRO C CB    1 
ATOM   3749 C CG    . PRO B 1 108 ? 37.619  0.586   -42.357 1.00 49.74  ? 108  PRO C CG    1 
ATOM   3750 C CD    . PRO B 1 108 ? 38.461  -0.632  -42.652 1.00 48.77  ? 108  PRO C CD    1 
ATOM   3751 N N     . ILE B 1 109 ? 38.172  1.277   -46.703 1.00 43.96  ? 109  ILE C N     1 
ATOM   3752 C CA    . ILE B 1 109 ? 39.151  1.942   -47.559 1.00 42.56  ? 109  ILE C CA    1 
ATOM   3753 C C     . ILE B 1 109 ? 38.876  3.437   -47.735 1.00 37.92  ? 109  ILE C C     1 
ATOM   3754 O O     . ILE B 1 109 ? 39.764  4.264   -47.544 1.00 39.76  ? 109  ILE C O     1 
ATOM   3755 C CB    . ILE B 1 109 ? 39.201  1.299   -48.962 1.00 39.83  ? 109  ILE C CB    1 
ATOM   3756 C CG1   . ILE B 1 109 ? 39.336  -0.223  -48.858 1.00 38.14  ? 109  ILE C CG1   1 
ATOM   3757 C CG2   . ILE B 1 109 ? 40.342  1.900   -49.781 1.00 35.31  ? 109  ILE C CG2   1 
ATOM   3758 C CD1   . ILE B 1 109 ? 40.627  -0.667  -48.229 1.00 42.51  ? 109  ILE C CD1   1 
ATOM   3759 N N     . ALA B 1 110 ? 37.650  3.783   -48.114 1.00 34.60  ? 110  ALA C N     1 
ATOM   3760 C CA    . ALA B 1 110 ? 37.328  5.174   -48.413 1.00 38.97  ? 110  ALA C CA    1 
ATOM   3761 C C     . ALA B 1 110 ? 35.830  5.450   -48.380 1.00 37.07  ? 110  ALA C C     1 
ATOM   3762 O O     . ALA B 1 110 ? 35.018  4.571   -48.676 1.00 32.75  ? 110  ALA C O     1 
ATOM   3763 C CB    . ALA B 1 110 ? 37.904  5.561   -49.776 1.00 38.99  ? 110  ALA C CB    1 
ATOM   3764 N N     . VAL B 1 111 ? 35.474  6.682   -48.029 1.00 36.50  ? 111  VAL C N     1 
ATOM   3765 C CA    . VAL B 1 111 ? 34.078  7.113   -48.014 1.00 31.85  ? 111  VAL C CA    1 
ATOM   3766 C C     . VAL B 1 111 ? 33.649  7.681   -49.371 1.00 33.00  ? 111  VAL C C     1 
ATOM   3767 O O     . VAL B 1 111 ? 34.264  8.614   -49.898 1.00 32.17  ? 111  VAL C O     1 
ATOM   3768 C CB    . VAL B 1 111 ? 33.823  8.157   -46.897 1.00 38.14  ? 111  VAL C CB    1 
ATOM   3769 C CG1   . VAL B 1 111 ? 32.445  8.797   -47.044 1.00 33.27  ? 111  VAL C CG1   1 
ATOM   3770 C CG2   . VAL B 1 111 ? 33.967  7.510   -45.527 1.00 37.03  ? 111  VAL C CG2   1 
ATOM   3771 N N     . GLU B 1 112 ? 32.580  7.116   -49.920 1.00 31.82  ? 112  GLU C N     1 
ATOM   3772 C CA    . GLU B 1 112 ? 32.088  7.481   -51.235 1.00 33.05  ? 112  GLU C CA    1 
ATOM   3773 C C     . GLU B 1 112 ? 30.738  8.160   -51.139 1.00 35.84  ? 112  GLU C C     1 
ATOM   3774 O O     . GLU B 1 112 ? 29.912  7.788   -50.315 1.00 35.24  ? 112  GLU C O     1 
ATOM   3775 C CB    . GLU B 1 112 ? 31.925  6.236   -52.105 1.00 32.92  ? 112  GLU C CB    1 
ATOM   3776 C CG    . GLU B 1 112 ? 33.210  5.517   -52.450 1.00 37.75  ? 112  GLU C CG    1 
ATOM   3777 C CD    . GLU B 1 112 ? 32.951  4.197   -53.151 1.00 34.86  ? 112  GLU C CD    1 
ATOM   3778 O OE1   . GLU B 1 112 ? 31.771  3.858   -53.366 1.00 35.09  ? 112  GLU C OE1   1 
ATOM   3779 O OE2   . GLU B 1 112 ? 33.923  3.497   -53.489 1.00 42.61  ? 112  GLU C OE2   1 
ATOM   3780 N N     . ALA B 1 113 ? 30.514  9.141   -52.007 1.00 32.98  ? 113  ALA C N     1 
ATOM   3781 C CA    . ALA B 1 113 ? 29.203  9.752   -52.162 1.00 30.67  ? 113  ALA C CA    1 
ATOM   3782 C C     . ALA B 1 113 ? 29.111  10.347  -53.556 1.00 32.43  ? 113  ALA C C     1 
ATOM   3783 O O     . ALA B 1 113 ? 30.114  10.817  -54.101 1.00 34.50  ? 113  ALA C O     1 
ATOM   3784 C CB    . ALA B 1 113 ? 28.983  10.834  -51.112 1.00 32.33  ? 113  ALA C CB    1 
ATOM   3785 N N     . LEU B 1 114 ? 27.912  10.325  -54.128 1.00 31.08  ? 114  LEU C N     1 
ATOM   3786 C CA    . LEU B 1 114 ? 27.675  10.911  -55.438 1.00 35.55  ? 114  LEU C CA    1 
ATOM   3787 C C     . LEU B 1 114 ? 27.741  12.433  -55.361 1.00 41.09  ? 114  LEU C C     1 
ATOM   3788 O O     . LEU B 1 114 ? 27.428  13.022  -54.326 1.00 33.91  ? 114  LEU C O     1 
ATOM   3789 C CB    . LEU B 1 114 ? 26.310  10.480  -55.978 1.00 27.75  ? 114  LEU C CB    1 
ATOM   3790 C CG    . LEU B 1 114 ? 26.194  9.017   -56.399 1.00 29.53  ? 114  LEU C CG    1 
ATOM   3791 C CD1   . LEU B 1 114 ? 24.766  8.691   -56.783 1.00 26.25  ? 114  LEU C CD1   1 
ATOM   3792 C CD2   . LEU B 1 114 ? 27.151  8.707   -57.548 1.00 27.81  ? 114  LEU C CD2   1 
ATOM   3793 N N     . SER B 1 115 ? 28.164  13.061  -56.455 1.00 37.09  ? 115  SER C N     1 
ATOM   3794 C CA    . SER B 1 115 ? 28.122  14.513  -56.576 1.00 26.69  ? 115  SER C CA    1 
ATOM   3795 C C     . SER B 1 115 ? 27.563  14.924  -57.930 1.00 28.80  ? 115  SER C C     1 
ATOM   3796 O O     . SER B 1 115 ? 27.454  14.105  -58.848 1.00 28.23  ? 115  SER C O     1 
ATOM   3797 C CB    . SER B 1 115 ? 29.513  15.122  -56.403 1.00 32.46  ? 115  SER C CB    1 
ATOM   3798 O OG    . SER B 1 115 ? 29.998  14.957  -55.086 1.00 32.16  ? 115  SER C OG    1 
ATOM   3799 N N     . LEU B 1 116 ? 27.211  16.200  -58.050 1.00 33.17  ? 116  LEU C N     1 
ATOM   3800 C CA    . LEU B 1 116 ? 26.854  16.773  -59.340 1.00 32.24  ? 116  LEU C CA    1 
ATOM   3801 C C     . LEU B 1 116 ? 28.136  17.144  -60.064 1.00 34.89  ? 116  LEU C C     1 
ATOM   3802 O O     . LEU B 1 116 ? 28.948  17.921  -59.556 1.00 30.86  ? 116  LEU C O     1 
ATOM   3803 C CB    . LEU B 1 116 ? 25.977  18.011  -59.172 1.00 34.10  ? 116  LEU C CB    1 
ATOM   3804 C CG    . LEU B 1 116 ? 25.462  18.662  -60.460 1.00 35.95  ? 116  LEU C CG    1 
ATOM   3805 C CD1   . LEU B 1 116 ? 24.486  17.733  -61.146 1.00 32.66  ? 116  LEU C CD1   1 
ATOM   3806 C CD2   . LEU B 1 116 ? 24.795  20.009  -60.147 1.00 28.28  ? 116  LEU C CD2   1 
ATOM   3807 N N     . ILE B 1 117 ? 28.332  16.565  -61.242 1.00 36.32  ? 117  ILE C N     1 
ATOM   3808 C CA    . ILE B 1 117 ? 29.483  16.905  -62.060 1.00 28.81  ? 117  ILE C CA    1 
ATOM   3809 C C     . ILE B 1 117 ? 28.970  17.696  -63.260 1.00 34.60  ? 117  ILE C C     1 
ATOM   3810 O O     . ILE B 1 117 ? 27.958  17.325  -63.859 1.00 36.10  ? 117  ILE C O     1 
ATOM   3811 C CB    . ILE B 1 117 ? 30.239  15.641  -62.478 1.00 27.73  ? 117  ILE C CB    1 
ATOM   3812 C CG1   . ILE B 1 117 ? 30.579  14.816  -61.232 1.00 29.19  ? 117  ILE C CG1   1 
ATOM   3813 C CG2   . ILE B 1 117 ? 31.498  15.992  -63.262 1.00 29.13  ? 117  ILE C CG2   1 
ATOM   3814 C CD1   . ILE B 1 117 ? 31.360  13.537  -61.504 1.00 25.56  ? 117  ILE C CD1   1 
ATOM   3815 N N     . TYR B 1 118 ? 29.635  18.799  -63.599 1.00 29.94  ? 118  TYR C N     1 
ATOM   3816 C CA    . TYR B 1 118 ? 29.110  19.658  -64.659 1.00 23.63  ? 118  TYR C CA    1 
ATOM   3817 C C     . TYR B 1 118 ? 30.173  20.261  -65.573 1.00 30.75  ? 118  TYR C C     1 
ATOM   3818 O O     . TYR B 1 118 ? 31.335  20.428  -65.189 1.00 32.05  ? 118  TYR C O     1 
ATOM   3819 C CB    . TYR B 1 118 ? 28.214  20.755  -64.076 1.00 37.73  ? 118  TYR C CB    1 
ATOM   3820 C CG    . TYR B 1 118 ? 28.953  21.821  -63.301 1.00 36.63  ? 118  TYR C CG    1 
ATOM   3821 C CD1   . TYR B 1 118 ? 29.417  21.578  -62.013 1.00 37.32  ? 118  TYR C CD1   1 
ATOM   3822 C CD2   . TYR B 1 118 ? 29.181  23.076  -63.854 1.00 39.77  ? 118  TYR C CD2   1 
ATOM   3823 C CE1   . TYR B 1 118 ? 30.092  22.556  -61.298 1.00 36.39  ? 118  TYR C CE1   1 
ATOM   3824 C CE2   . TYR B 1 118 ? 29.851  24.065  -63.143 1.00 42.29  ? 118  TYR C CE2   1 
ATOM   3825 C CZ    . TYR B 1 118 ? 30.303  23.796  -61.865 1.00 43.73  ? 118  TYR C CZ    1 
ATOM   3826 O OH    . TYR B 1 118 ? 30.974  24.768  -61.159 1.00 49.89  ? 118  TYR C OH    1 
ATOM   3827 N N     . ASN B 1 119 ? 29.751  20.575  -66.794 1.00 29.57  ? 119  ASN C N     1 
ATOM   3828 C CA    . ASN B 1 119 ? 30.641  21.096  -67.823 1.00 28.22  ? 119  ASN C CA    1 
ATOM   3829 C C     . ASN B 1 119 ? 30.615  22.608  -67.742 1.00 36.54  ? 119  ASN C C     1 
ATOM   3830 O O     . ASN B 1 119 ? 29.594  23.225  -68.035 1.00 47.57  ? 119  ASN C O     1 
ATOM   3831 C CB    . ASN B 1 119 ? 30.177  20.634  -69.212 1.00 31.87  ? 119  ASN C CB    1 
ATOM   3832 C CG    . ASN B 1 119 ? 31.180  20.961  -70.316 1.00 34.63  ? 119  ASN C CG    1 
ATOM   3833 O OD1   . ASN B 1 119 ? 31.897  21.961  -70.257 1.00 37.21  ? 119  ASN C OD1   1 
ATOM   3834 N ND2   . ASN B 1 119 ? 31.224  20.115  -71.334 1.00 42.84  ? 119  ASN C ND2   1 
ATOM   3835 N N     . LYS B 1 120 ? 31.732  23.197  -67.325 1.00 30.71  ? 120  LYS C N     1 
ATOM   3836 C CA    . LYS B 1 120 ? 31.794  24.633  -67.091 1.00 37.85  ? 120  LYS C CA    1 
ATOM   3837 C C     . LYS B 1 120 ? 31.662  25.455  -68.369 1.00 39.56  ? 120  LYS C C     1 
ATOM   3838 O O     . LYS B 1 120 ? 31.099  26.545  -68.352 1.00 44.75  ? 120  LYS C O     1 
ATOM   3839 C CB    . LYS B 1 120 ? 33.074  24.996  -66.349 1.00 46.24  ? 120  LYS C CB    1 
ATOM   3840 C CG    . LYS B 1 120 ? 33.094  24.491  -64.919 1.00 47.02  ? 120  LYS C CG    1 
ATOM   3841 C CD    . LYS B 1 120 ? 34.356  24.920  -64.217 1.00 49.14  ? 120  LYS C CD    1 
ATOM   3842 C CE    . LYS B 1 120 ? 34.365  24.430  -62.786 1.00 55.82  ? 120  LYS C CE    1 
ATOM   3843 N NZ    . LYS B 1 120 ? 35.483  25.029  -62.024 1.00 52.03  ? 120  LYS C NZ    1 
ATOM   3844 N N     . ASP B 1 121 ? 32.171  24.931  -69.477 1.00 41.90  ? 121  ASP C N     1 
ATOM   3845 C CA    . ASP B 1 121 ? 32.029  25.622  -70.753 1.00 37.66  ? 121  ASP C CA    1 
ATOM   3846 C C     . ASP B 1 121 ? 30.577  25.615  -71.224 1.00 37.44  ? 121  ASP C C     1 
ATOM   3847 O O     . ASP B 1 121 ? 30.122  26.573  -71.823 1.00 45.20  ? 121  ASP C O     1 
ATOM   3848 C CB    . ASP B 1 121 ? 32.956  25.020  -71.808 1.00 33.91  ? 121  ASP C CB    1 
ATOM   3849 C CG    . ASP B 1 121 ? 34.416  25.174  -71.441 1.00 41.76  ? 121  ASP C CG    1 
ATOM   3850 O OD1   . ASP B 1 121 ? 34.736  26.130  -70.706 1.00 52.15  ? 121  ASP C OD1   1 
ATOM   3851 O OD2   . ASP B 1 121 ? 35.242  24.343  -71.872 1.00 47.77  ? 121  ASP C OD2   1 
ATOM   3852 N N     . LEU B 1 122 ? 29.839  24.547  -70.934 1.00 38.55  ? 122  LEU C N     1 
ATOM   3853 C CA    . LEU B 1 122 ? 28.421  24.523  -71.283 1.00 32.70  ? 122  LEU C CA    1 
ATOM   3854 C C     . LEU B 1 122 ? 27.556  25.176  -70.218 1.00 36.81  ? 122  LEU C C     1 
ATOM   3855 O O     . LEU B 1 122 ? 26.458  25.648  -70.503 1.00 37.41  ? 122  LEU C O     1 
ATOM   3856 C CB    . LEU B 1 122 ? 27.925  23.094  -71.494 1.00 28.10  ? 122  LEU C CB    1 
ATOM   3857 C CG    . LEU B 1 122 ? 28.467  22.296  -72.671 1.00 33.78  ? 122  LEU C CG    1 
ATOM   3858 C CD1   . LEU B 1 122 ? 27.860  20.906  -72.657 1.00 32.11  ? 122  LEU C CD1   1 
ATOM   3859 C CD2   . LEU B 1 122 ? 28.180  23.013  -73.999 1.00 30.89  ? 122  LEU C CD2   1 
ATOM   3860 N N     . LEU B 1 123 ? 28.043  25.194  -68.985 1.00 32.78  ? 123  LEU C N     1 
ATOM   3861 C CA    . LEU B 1 123 ? 27.194  25.563  -67.863 1.00 31.26  ? 123  LEU C CA    1 
ATOM   3862 C C     . LEU B 1 123 ? 28.031  26.181  -66.750 1.00 40.99  ? 123  LEU C C     1 
ATOM   3863 O O     . LEU B 1 123 ? 28.371  25.509  -65.779 1.00 44.48  ? 123  LEU C O     1 
ATOM   3864 C CB    . LEU B 1 123 ? 26.464  24.313  -67.358 1.00 37.11  ? 123  LEU C CB    1 
ATOM   3865 C CG    . LEU B 1 123 ? 25.391  24.426  -66.277 1.00 44.21  ? 123  LEU C CG    1 
ATOM   3866 C CD1   . LEU B 1 123 ? 24.269  25.369  -66.682 1.00 42.12  ? 123  LEU C CD1   1 
ATOM   3867 C CD2   . LEU B 1 123 ? 24.845  23.045  -65.988 1.00 33.85  ? 123  LEU C CD2   1 
ATOM   3868 N N     . PRO B 1 124 ? 28.370  27.471  -66.895 1.00 45.89  ? 124  PRO C N     1 
ATOM   3869 C CA    . PRO B 1 124 ? 29.231  28.184  -65.948 1.00 41.37  ? 124  PRO C CA    1 
ATOM   3870 C C     . PRO B 1 124 ? 28.680  28.101  -64.534 1.00 37.24  ? 124  PRO C C     1 
ATOM   3871 O O     . PRO B 1 124 ? 29.453  27.958  -63.586 1.00 42.47  ? 124  PRO C O     1 
ATOM   3872 C CB    . PRO B 1 124 ? 29.177  29.631  -66.450 1.00 43.50  ? 124  PRO C CB    1 
ATOM   3873 C CG    . PRO B 1 124 ? 28.831  29.514  -67.892 1.00 47.57  ? 124  PRO C CG    1 
ATOM   3874 C CD    . PRO B 1 124 ? 27.895  28.351  -67.976 1.00 46.79  ? 124  PRO C CD    1 
ATOM   3875 N N     . ASN B 1 125 ? 27.358  28.186  -64.404 1.00 35.53  ? 125  ASN C N     1 
ATOM   3876 C CA    . ASN B 1 125 ? 26.699  28.086  -63.105 1.00 37.80  ? 125  ASN C CA    1 
ATOM   3877 C C     . ASN B 1 125 ? 25.715  26.934  -63.031 1.00 43.30  ? 125  ASN C C     1 
ATOM   3878 O O     . ASN B 1 125 ? 24.655  26.971  -63.661 1.00 40.51  ? 125  ASN C O     1 
ATOM   3879 C CB    . ASN B 1 125 ? 25.988  29.391  -62.747 1.00 47.68  ? 125  ASN C CB    1 
ATOM   3880 C CG    . ASN B 1 125 ? 26.885  30.596  -62.902 1.00 56.60  ? 125  ASN C CG    1 
ATOM   3881 O OD1   . ASN B 1 125 ? 27.836  30.777  -62.140 1.00 63.83  ? 125  ASN C OD1   1 
ATOM   3882 N ND2   . ASN B 1 125 ? 26.598  31.421  -63.901 1.00 53.85  ? 125  ASN C ND2   1 
ATOM   3883 N N     . PRO B 1 126 ? 26.051  25.916  -62.228 1.00 45.10  ? 126  PRO C N     1 
ATOM   3884 C CA    . PRO B 1 126 ? 25.212  24.726  -62.119 1.00 47.04  ? 126  PRO C CA    1 
ATOM   3885 C C     . PRO B 1 126 ? 23.925  25.087  -61.389 1.00 45.95  ? 126  PRO C C     1 
ATOM   3886 O O     . PRO B 1 126 ? 23.938  25.990  -60.568 1.00 40.13  ? 126  PRO C O     1 
ATOM   3887 C CB    . PRO B 1 126 ? 26.070  23.787  -61.275 1.00 51.14  ? 126  PRO C CB    1 
ATOM   3888 C CG    . PRO B 1 126 ? 26.851  24.712  -60.391 1.00 48.95  ? 126  PRO C CG    1 
ATOM   3889 C CD    . PRO B 1 126 ? 27.136  25.926  -61.230 1.00 44.91  ? 126  PRO C CD    1 
ATOM   3890 N N     . PRO B 1 127 ? 22.829  24.381  -61.685 1.00 50.72  ? 127  PRO C N     1 
ATOM   3891 C CA    . PRO B 1 127 ? 21.520  24.672  -61.103 1.00 48.06  ? 127  PRO C CA    1 
ATOM   3892 C C     . PRO B 1 127 ? 21.473  24.266  -59.639 1.00 50.11  ? 127  PRO C C     1 
ATOM   3893 O O     . PRO B 1 127 ? 22.003  23.217  -59.273 1.00 42.79  ? 127  PRO C O     1 
ATOM   3894 C CB    . PRO B 1 127 ? 20.588  23.771  -61.909 1.00 50.02  ? 127  PRO C CB    1 
ATOM   3895 C CG    . PRO B 1 127 ? 21.439  22.587  -62.231 1.00 47.09  ? 127  PRO C CG    1 
ATOM   3896 C CD    . PRO B 1 127 ? 22.806  23.156  -62.503 1.00 46.50  ? 127  PRO C CD    1 
ATOM   3897 N N     . LYS B 1 128 ? 20.831  25.092  -58.818 1.00 49.65  ? 128  LYS C N     1 
ATOM   3898 C CA    . LYS B 1 128 ? 20.727  24.844  -57.387 1.00 51.88  ? 128  LYS C CA    1 
ATOM   3899 C C     . LYS B 1 128 ? 19.632  23.835  -57.070 1.00 41.31  ? 128  LYS C C     1 
ATOM   3900 O O     . LYS B 1 128 ? 19.664  23.179  -56.034 1.00 45.42  ? 128  LYS C O     1 
ATOM   3901 C CB    . LYS B 1 128 ? 20.448  26.153  -56.642 1.00 63.19  ? 128  LYS C CB    1 
ATOM   3902 C CG    . LYS B 1 128 ? 21.687  26.822  -56.063 1.00 77.66  ? 128  LYS C CG    1 
ATOM   3903 C CD    . LYS B 1 128 ? 22.726  27.127  -57.132 1.00 87.05  ? 128  LYS C CD    1 
ATOM   3904 C CE    . LYS B 1 128 ? 24.074  27.463  -56.509 1.00 92.09  ? 128  LYS C CE    1 
ATOM   3905 N NZ    . LYS B 1 128 ? 24.648  26.300  -55.769 1.00 95.95  ? 128  LYS C NZ    1 
ATOM   3906 N N     . THR B 1 129 ? 18.665  23.720  -57.971 1.00 33.94  ? 129  THR C N     1 
ATOM   3907 C CA    . THR B 1 129 ? 17.485  22.901  -57.740 1.00 31.02  ? 129  THR C CA    1 
ATOM   3908 C C     . THR B 1 129 ? 17.243  21.924  -58.893 1.00 39.17  ? 129  THR C C     1 
ATOM   3909 O O     . THR B 1 129 ? 17.607  22.196  -60.041 1.00 44.70  ? 129  THR C O     1 
ATOM   3910 C CB    . THR B 1 129 ? 16.232  23.790  -57.618 1.00 41.20  ? 129  THR C CB    1 
ATOM   3911 O OG1   . THR B 1 129 ? 15.881  24.293  -58.913 1.00 46.41  ? 129  THR C OG1   1 
ATOM   3912 C CG2   . THR B 1 129 ? 16.484  24.969  -56.672 1.00 39.88  ? 129  THR C CG2   1 
ATOM   3913 N N     . TRP B 1 130 ? 16.623  20.790  -58.584 1.00 40.46  ? 130  TRP C N     1 
ATOM   3914 C CA    . TRP B 1 130 ? 16.166  19.870  -59.615 1.00 38.91  ? 130  TRP C CA    1 
ATOM   3915 C C     . TRP B 1 130 ? 15.081  20.537  -60.453 1.00 39.92  ? 130  TRP C C     1 
ATOM   3916 O O     . TRP B 1 130 ? 14.988  20.309  -61.653 1.00 42.62  ? 130  TRP C O     1 
ATOM   3917 C CB    . TRP B 1 130 ? 15.604  18.585  -58.996 1.00 37.39  ? 130  TRP C CB    1 
ATOM   3918 C CG    . TRP B 1 130 ? 16.640  17.589  -58.570 1.00 44.39  ? 130  TRP C CG    1 
ATOM   3919 C CD1   . TRP B 1 130 ? 17.237  17.499  -57.346 1.00 41.75  ? 130  TRP C CD1   1 
ATOM   3920 C CD2   . TRP B 1 130 ? 17.194  16.528  -59.365 1.00 49.06  ? 130  TRP C CD2   1 
ATOM   3921 N NE1   . TRP B 1 130 ? 18.136  16.455  -57.333 1.00 38.61  ? 130  TRP C NE1   1 
ATOM   3922 C CE2   . TRP B 1 130 ? 18.124  15.840  -58.557 1.00 43.80  ? 130  TRP C CE2   1 
ATOM   3923 C CE3   . TRP B 1 130 ? 17.000  16.099  -60.683 1.00 42.27  ? 130  TRP C CE3   1 
ATOM   3924 C CZ2   . TRP B 1 130 ? 18.855  14.743  -59.024 1.00 35.89  ? 130  TRP C CZ2   1 
ATOM   3925 C CZ3   . TRP B 1 130 ? 17.727  15.014  -61.142 1.00 38.61  ? 130  TRP C CZ3   1 
ATOM   3926 C CH2   . TRP B 1 130 ? 18.641  14.347  -60.313 1.00 31.89  ? 130  TRP C CH2   1 
ATOM   3927 N N     . GLU B 1 131 ? 14.258  21.357  -59.807 1.00 43.31  ? 131  GLU C N     1 
ATOM   3928 C CA    . GLU B 1 131 ? 13.102  21.960  -60.459 1.00 50.13  ? 131  GLU C CA    1 
ATOM   3929 C C     . GLU B 1 131 ? 13.444  22.793  -61.698 1.00 49.60  ? 131  GLU C C     1 
ATOM   3930 O O     . GLU B 1 131 ? 12.652  22.859  -62.638 1.00 50.36  ? 131  GLU C O     1 
ATOM   3931 C CB    . GLU B 1 131 ? 12.303  22.814  -59.468 1.00 54.48  ? 131  GLU C CB    1 
ATOM   3932 C CG    . GLU B 1 131 ? 11.434  22.010  -58.515 1.00 52.93  ? 131  GLU C CG    1 
ATOM   3933 C CD    . GLU B 1 131 ? 12.137  21.659  -57.219 1.00 51.91  ? 131  GLU C CD    1 
ATOM   3934 O OE1   . GLU B 1 131 ? 13.380  21.739  -57.166 1.00 53.28  ? 131  GLU C OE1   1 
ATOM   3935 O OE2   . GLU B 1 131 ? 11.436  21.312  -56.248 1.00 52.15  ? 131  GLU C OE2   1 
ATOM   3936 N N     . GLU B 1 132 ? 14.614  23.423  -61.705 1.00 38.48  ? 132  GLU C N     1 
ATOM   3937 C CA    . GLU B 1 132 ? 14.970  24.292  -62.822 1.00 43.55  ? 132  GLU C CA    1 
ATOM   3938 C C     . GLU B 1 132 ? 15.587  23.537  -63.992 1.00 46.25  ? 132  GLU C C     1 
ATOM   3939 O O     . GLU B 1 132 ? 15.785  24.108  -65.065 1.00 43.16  ? 132  GLU C O     1 
ATOM   3940 C CB    . GLU B 1 132 ? 15.896  25.421  -62.367 1.00 44.41  ? 132  GLU C CB    1 
ATOM   3941 C CG    . GLU B 1 132 ? 17.280  24.979  -61.980 1.00 47.62  ? 132  GLU C CG    1 
ATOM   3942 C CD    . GLU B 1 132 ? 17.969  25.987  -61.081 1.00 53.64  ? 132  GLU C CD    1 
ATOM   3943 O OE1   . GLU B 1 132 ? 18.747  26.813  -61.602 1.00 58.11  ? 132  GLU C OE1   1 
ATOM   3944 O OE2   . GLU B 1 132 ? 17.731  25.954  -59.854 1.00 48.14  ? 132  GLU C OE2   1 
ATOM   3945 N N     . ILE B 1 133 ? 15.864  22.250  -63.795 1.00 42.05  ? 133  ILE C N     1 
ATOM   3946 C CA    . ILE B 1 133 ? 16.543  21.459  -64.818 1.00 34.68  ? 133  ILE C CA    1 
ATOM   3947 C C     . ILE B 1 133 ? 15.764  21.299  -66.138 1.00 38.83  ? 133  ILE C C     1 
ATOM   3948 O O     . ILE B 1 133 ? 16.350  21.406  -67.211 1.00 37.64  ? 133  ILE C O     1 
ATOM   3949 C CB    . ILE B 1 133 ? 17.039  20.098  -64.263 1.00 37.26  ? 133  ILE C CB    1 
ATOM   3950 C CG1   . ILE B 1 133 ? 18.164  20.347  -63.259 1.00 39.58  ? 133  ILE C CG1   1 
ATOM   3951 C CG2   . ILE B 1 133 ? 17.546  19.214  -65.383 1.00 30.63  ? 133  ILE C CG2   1 
ATOM   3952 C CD1   . ILE B 1 133 ? 18.738  19.115  -62.647 1.00 33.77  ? 133  ILE C CD1   1 
ATOM   3953 N N     . PRO B 1 134 ? 14.444  21.069  -66.068 1.00 40.65  ? 134  PRO C N     1 
ATOM   3954 C CA    . PRO B 1 134 ? 13.682  20.961  -67.318 1.00 41.99  ? 134  PRO C CA    1 
ATOM   3955 C C     . PRO B 1 134 ? 13.874  22.187  -68.206 1.00 44.29  ? 134  PRO C C     1 
ATOM   3956 O O     . PRO B 1 134 ? 14.195  22.051  -69.390 1.00 45.12  ? 134  PRO C O     1 
ATOM   3957 C CB    . PRO B 1 134 ? 12.231  20.888  -66.834 1.00 46.15  ? 134  PRO C CB    1 
ATOM   3958 C CG    . PRO B 1 134 ? 12.325  20.313  -65.465 1.00 38.79  ? 134  PRO C CG    1 
ATOM   3959 C CD    . PRO B 1 134 ? 13.588  20.883  -64.883 1.00 38.26  ? 134  PRO C CD    1 
ATOM   3960 N N     . ALA B 1 135 ? 13.682  23.375  -67.639 1.00 38.45  ? 135  ALA C N     1 
ATOM   3961 C CA    . ALA B 1 135 ? 13.866  24.605  -68.396 1.00 41.79  ? 135  ALA C CA    1 
ATOM   3962 C C     . ALA B 1 135 ? 15.304  24.723  -68.881 1.00 39.80  ? 135  ALA C C     1 
ATOM   3963 O O     . ALA B 1 135 ? 15.560  25.224  -69.969 1.00 40.14  ? 135  ALA C O     1 
ATOM   3964 C CB    . ALA B 1 135 ? 13.474  25.827  -67.557 1.00 42.66  ? 135  ALA C CB    1 
ATOM   3965 N N     . LEU B 1 136 ? 16.247  24.254  -68.071 1.00 36.50  ? 136  LEU C N     1 
ATOM   3966 C CA    . LEU B 1 136 ? 17.651  24.323  -68.453 1.00 36.10  ? 136  LEU C CA    1 
ATOM   3967 C C     . LEU B 1 136 ? 17.928  23.433  -69.665 1.00 41.42  ? 136  LEU C C     1 
ATOM   3968 O O     . LEU B 1 136 ? 18.692  23.802  -70.559 1.00 42.56  ? 136  LEU C O     1 
ATOM   3969 C CB    . LEU B 1 136 ? 18.540  23.917  -67.279 1.00 35.39  ? 136  LEU C CB    1 
ATOM   3970 C CG    . LEU B 1 136 ? 20.042  23.835  -67.543 1.00 38.66  ? 136  LEU C CG    1 
ATOM   3971 C CD1   . LEU B 1 136 ? 20.557  25.161  -68.083 1.00 44.03  ? 136  LEU C CD1   1 
ATOM   3972 C CD2   . LEU B 1 136 ? 20.773  23.453  -66.261 1.00 36.61  ? 136  LEU C CD2   1 
ATOM   3973 N N     . ASP B 1 137 ? 17.301  22.260  -69.686 1.00 44.59  ? 137  ASP C N     1 
ATOM   3974 C CA    . ASP B 1 137 ? 17.459  21.320  -70.795 1.00 41.95  ? 137  ASP C CA    1 
ATOM   3975 C C     . ASP B 1 137 ? 16.893  21.905  -72.086 1.00 32.38  ? 137  ASP C C     1 
ATOM   3976 O O     . ASP B 1 137 ? 17.519  21.830  -73.139 1.00 35.27  ? 137  ASP C O     1 
ATOM   3977 C CB    . ASP B 1 137 ? 16.792  19.976  -70.477 1.00 34.33  ? 137  ASP C CB    1 
ATOM   3978 C CG    . ASP B 1 137 ? 16.990  18.959  -71.584 1.00 41.08  ? 137  ASP C CG    1 
ATOM   3979 O OD1   . ASP B 1 137 ? 18.146  18.547  -71.810 1.00 39.24  ? 137  ASP C OD1   1 
ATOM   3980 O OD2   . ASP B 1 137 ? 15.994  18.566  -72.224 1.00 42.61  ? 137  ASP C OD2   1 
ATOM   3981 N N     . LYS B 1 138 ? 15.716  22.509  -71.989 1.00 39.12  ? 138  LYS C N     1 
ATOM   3982 C CA    . LYS B 1 138 ? 15.085  23.147  -73.137 1.00 40.63  ? 138  LYS C CA    1 
ATOM   3983 C C     . LYS B 1 138 ? 16.032  24.143  -73.801 1.00 44.38  ? 138  LYS C C     1 
ATOM   3984 O O     . LYS B 1 138 ? 16.144  24.177  -75.027 1.00 42.60  ? 138  LYS C O     1 
ATOM   3985 C CB    . LYS B 1 138 ? 13.784  23.834  -72.722 1.00 41.59  ? 138  LYS C CB    1 
ATOM   3986 C CG    . LYS B 1 138 ? 12.953  24.349  -73.879 1.00 51.63  ? 138  LYS C CG    1 
ATOM   3987 C CD    . LYS B 1 138 ? 11.559  24.747  -73.410 1.00 58.03  ? 138  LYS C CD    1 
ATOM   3988 C CE    . LYS B 1 138 ? 10.716  25.281  -74.561 1.00 60.30  ? 138  LYS C CE    1 
ATOM   3989 N NZ    . LYS B 1 138 ? 9.280   25.413  -74.177 1.00 66.92  ? 138  LYS C NZ    1 
ATOM   3990 N N     . GLU B 1 139 ? 16.730  24.938  -72.994 1.00 38.73  ? 139  GLU C N     1 
ATOM   3991 C CA    . GLU B 1 139 ? 17.682  25.905  -73.541 1.00 40.13  ? 139  GLU C CA    1 
ATOM   3992 C C     . GLU B 1 139 ? 18.860  25.200  -74.197 1.00 37.96  ? 139  GLU C C     1 
ATOM   3993 O O     . GLU B 1 139 ? 19.311  25.604  -75.264 1.00 38.07  ? 139  GLU C O     1 
ATOM   3994 C CB    . GLU B 1 139 ? 18.220  26.846  -72.462 1.00 44.89  ? 139  GLU C CB    1 
ATOM   3995 C CG    . GLU B 1 139 ? 17.201  27.765  -71.833 1.00 67.28  ? 139  GLU C CG    1 
ATOM   3996 C CD    . GLU B 1 139 ? 17.826  28.634  -70.762 1.00 86.86  ? 139  GLU C CD    1 
ATOM   3997 O OE1   . GLU B 1 139 ? 19.070  28.770  -70.769 1.00 89.46  ? 139  GLU C OE1   1 
ATOM   3998 O OE2   . GLU B 1 139 ? 17.082  29.168  -69.910 1.00 94.98  ? 139  GLU C OE2   1 
ATOM   3999 N N     . LEU B 1 140 ? 19.379  24.163  -73.548 1.00 30.85  ? 140  LEU C N     1 
ATOM   4000 C CA    . LEU B 1 140 ? 20.521  23.464  -74.113 1.00 32.89  ? 140  LEU C CA    1 
ATOM   4001 C C     . LEU B 1 140 ? 20.127  22.656  -75.361 1.00 35.97  ? 140  LEU C C     1 
ATOM   4002 O O     . LEU B 1 140 ? 20.945  22.443  -76.248 1.00 30.61  ? 140  LEU C O     1 
ATOM   4003 C CB    . LEU B 1 140 ? 21.200  22.583  -73.058 1.00 35.10  ? 140  LEU C CB    1 
ATOM   4004 C CG    . LEU B 1 140 ? 21.956  23.362  -71.971 1.00 37.63  ? 140  LEU C CG    1 
ATOM   4005 C CD1   . LEU B 1 140 ? 22.222  22.504  -70.724 1.00 28.82  ? 140  LEU C CD1   1 
ATOM   4006 C CD2   . LEU B 1 140 ? 23.254  23.940  -72.524 1.00 32.53  ? 140  LEU C CD2   1 
ATOM   4007 N N     . LYS B 1 141 ? 18.877  22.209  -75.429 1.00 34.04  ? 141  LYS C N     1 
ATOM   4008 C CA    . LYS B 1 141 ? 18.435  21.446  -76.590 1.00 38.71  ? 141  LYS C CA    1 
ATOM   4009 C C     . LYS B 1 141 ? 18.572  22.300  -77.860 1.00 43.72  ? 141  LYS C C     1 
ATOM   4010 O O     . LYS B 1 141 ? 18.951  21.796  -78.920 1.00 32.54  ? 141  LYS C O     1 
ATOM   4011 C CB    . LYS B 1 141 ? 17.000  20.936  -76.409 1.00 40.27  ? 141  LYS C CB    1 
ATOM   4012 C CG    . LYS B 1 141 ? 16.856  19.757  -75.425 1.00 37.53  ? 141  LYS C CG    1 
ATOM   4013 C CD    . LYS B 1 141 ? 17.944  18.730  -75.665 1.00 41.98  ? 141  LYS C CD    1 
ATOM   4014 C CE    . LYS B 1 141 ? 17.428  17.299  -75.643 1.00 36.70  ? 141  LYS C CE    1 
ATOM   4015 N NZ    . LYS B 1 141 ? 16.876  16.857  -74.334 1.00 32.56  ? 141  LYS C NZ    1 
ATOM   4016 N N     . ALA B 1 142 ? 18.301  23.599  -77.733 1.00 36.04  ? 142  ALA C N     1 
ATOM   4017 C CA    . ALA B 1 142 ? 18.404  24.527  -78.856 1.00 34.94  ? 142  ALA C CA    1 
ATOM   4018 C C     . ALA B 1 142 ? 19.837  24.658  -79.360 1.00 39.51  ? 142  ALA C C     1 
ATOM   4019 O O     . ALA B 1 142 ? 20.072  25.146  -80.467 1.00 42.21  ? 142  ALA C O     1 
ATOM   4020 C CB    . ALA B 1 142 ? 17.838  25.902  -78.475 1.00 26.03  ? 142  ALA C CB    1 
ATOM   4021 N N     . LYS B 1 143 ? 20.792  24.217  -78.546 1.00 39.14  ? 143  LYS C N     1 
ATOM   4022 C CA    . LYS B 1 143 ? 22.203  24.275  -78.910 1.00 36.97  ? 143  LYS C CA    1 
ATOM   4023 C C     . LYS B 1 143 ? 22.687  22.886  -79.269 1.00 35.55  ? 143  LYS C C     1 
ATOM   4024 O O     . LYS B 1 143 ? 23.885  22.654  -79.426 1.00 39.49  ? 143  LYS C O     1 
ATOM   4025 C CB    . LYS B 1 143 ? 23.040  24.822  -77.750 1.00 43.58  ? 143  LYS C CB    1 
ATOM   4026 C CG    . LYS B 1 143 ? 22.654  26.221  -77.297 1.00 56.80  ? 143  LYS C CG    1 
ATOM   4027 C CD    . LYS B 1 143 ? 23.329  26.582  -75.981 1.00 62.67  ? 143  LYS C CD    1 
ATOM   4028 C CE    . LYS B 1 143 ? 22.835  27.920  -75.454 1.00 72.47  ? 143  LYS C CE    1 
ATOM   4029 N NZ    . LYS B 1 143 ? 23.257  28.143  -74.037 1.00 80.03  ? 143  LYS C NZ    1 
ATOM   4030 N N     . GLY B 1 144 ? 21.749  21.956  -79.391 1.00 37.19  ? 144  GLY C N     1 
ATOM   4031 C CA    . GLY B 1 144 ? 22.093  20.573  -79.676 1.00 39.23  ? 144  GLY C CA    1 
ATOM   4032 C C     . GLY B 1 144 ? 22.773  19.871  -78.512 1.00 34.96  ? 144  GLY C C     1 
ATOM   4033 O O     . GLY B 1 144 ? 23.533  18.936  -78.709 1.00 36.80  ? 144  GLY C O     1 
ATOM   4034 N N     . LYS B 1 145 ? 22.510  20.336  -77.296 1.00 39.03  ? 145  LYS C N     1 
ATOM   4035 C CA    . LYS B 1 145 ? 23.066  19.713  -76.096 1.00 40.72  ? 145  LYS C CA    1 
ATOM   4036 C C     . LYS B 1 145 ? 21.920  19.274  -75.195 1.00 38.84  ? 145  LYS C C     1 
ATOM   4037 O O     . LYS B 1 145 ? 20.756  19.453  -75.537 1.00 44.71  ? 145  LYS C O     1 
ATOM   4038 C CB    . LYS B 1 145 ? 23.968  20.701  -75.345 1.00 29.95  ? 145  LYS C CB    1 
ATOM   4039 C CG    . LYS B 1 145 ? 25.176  21.174  -76.149 1.00 34.11  ? 145  LYS C CG    1 
ATOM   4040 C CD    . LYS B 1 145 ? 26.040  19.993  -76.598 1.00 34.82  ? 145  LYS C CD    1 
ATOM   4041 C CE    . LYS B 1 145 ? 27.186  20.446  -77.511 1.00 33.75  ? 145  LYS C CE    1 
ATOM   4042 N NZ    . LYS B 1 145 ? 28.092  19.307  -77.865 1.00 32.41  ? 145  LYS C NZ    1 
ATOM   4043 N N     . SER B 1 146 ? 22.248  18.701  -74.046 1.00 37.46  ? 146  SER C N     1 
ATOM   4044 C CA    . SER B 1 146 ? 21.238  18.399  -73.043 1.00 36.01  ? 146  SER C CA    1 
ATOM   4045 C C     . SER B 1 146 ? 21.736  18.800  -71.658 1.00 34.98  ? 146  SER C C     1 
ATOM   4046 O O     . SER B 1 146 ? 22.932  18.981  -71.443 1.00 33.62  ? 146  SER C O     1 
ATOM   4047 C CB    . SER B 1 146 ? 20.889  16.912  -73.059 1.00 32.22  ? 146  SER C CB    1 
ATOM   4048 O OG    . SER B 1 146 ? 21.934  16.153  -72.490 1.00 35.39  ? 146  SER C OG    1 
ATOM   4049 N N     . ALA B 1 147 ? 20.811  18.934  -70.718 1.00 31.01  ? 147  ALA C N     1 
ATOM   4050 C CA    . ALA B 1 147 ? 21.162  19.319  -69.362 1.00 31.01  ? 147  ALA C CA    1 
ATOM   4051 C C     . ALA B 1 147 ? 21.865  18.200  -68.588 1.00 33.22  ? 147  ALA C C     1 
ATOM   4052 O O     . ALA B 1 147 ? 22.920  18.411  -67.986 1.00 38.17  ? 147  ALA C O     1 
ATOM   4053 C CB    . ALA B 1 147 ? 19.917  19.769  -68.615 1.00 25.70  ? 147  ALA C CB    1 
ATOM   4054 N N     . LEU B 1 148 ? 21.287  17.005  -68.606 1.00 34.99  ? 148  LEU C N     1 
ATOM   4055 C CA    . LEU B 1 148 ? 21.677  16.003  -67.619 1.00 31.69  ? 148  LEU C CA    1 
ATOM   4056 C C     . LEU B 1 148 ? 21.551  14.552  -68.072 1.00 35.39  ? 148  LEU C C     1 
ATOM   4057 O O     . LEU B 1 148 ? 20.484  14.105  -68.485 1.00 43.56  ? 148  LEU C O     1 
ATOM   4058 C CB    . LEU B 1 148 ? 20.856  16.213  -66.347 1.00 27.54  ? 148  LEU C CB    1 
ATOM   4059 C CG    . LEU B 1 148 ? 20.908  15.098  -65.300 1.00 29.46  ? 148  LEU C CG    1 
ATOM   4060 C CD1   . LEU B 1 148 ? 22.249  15.093  -64.608 1.00 26.84  ? 148  LEU C CD1   1 
ATOM   4061 C CD2   . LEU B 1 148 ? 19.794  15.300  -64.308 1.00 24.49  ? 148  LEU C CD2   1 
ATOM   4062 N N     . MET B 1 149 ? 22.650  13.815  -67.973 1.00 34.34  ? 149  MET C N     1 
ATOM   4063 C CA    . MET B 1 149 ? 22.616  12.375  -68.199 1.00 37.83  ? 149  MET C CA    1 
ATOM   4064 C C     . MET B 1 149 ? 23.336  11.625  -67.091 1.00 35.84  ? 149  MET C C     1 
ATOM   4065 O O     . MET B 1 149 ? 24.467  11.945  -66.729 1.00 37.17  ? 149  MET C O     1 
ATOM   4066 C CB    . MET B 1 149 ? 23.225  12.004  -69.552 1.00 35.30  ? 149  MET C CB    1 
ATOM   4067 C CG    . MET B 1 149 ? 22.428  12.488  -70.742 1.00 36.18  ? 149  MET C CG    1 
ATOM   4068 S SD    . MET B 1 149 ? 23.135  11.920  -72.294 1.00 51.89  ? 149  MET C SD    1 
ATOM   4069 C CE    . MET B 1 149 ? 22.739  10.173  -72.227 1.00 31.47  ? 149  MET C CE    1 
ATOM   4070 N N     . PHE B 1 150 ? 22.675  10.614  -66.554 1.00 37.00  ? 150  PHE C N     1 
ATOM   4071 C CA    . PHE B 1 150 ? 23.308  9.774   -65.556 1.00 37.41  ? 150  PHE C CA    1 
ATOM   4072 C C     . PHE B 1 150 ? 22.660  8.400   -65.544 1.00 33.86  ? 150  PHE C C     1 
ATOM   4073 O O     . PHE B 1 150 ? 21.569  8.222   -66.072 1.00 38.66  ? 150  PHE C O     1 
ATOM   4074 C CB    . PHE B 1 150 ? 23.259  10.434  -64.175 1.00 32.65  ? 150  PHE C CB    1 
ATOM   4075 C CG    . PHE B 1 150 ? 21.881  10.519  -63.581 1.00 33.19  ? 150  PHE C CG    1 
ATOM   4076 C CD1   . PHE B 1 150 ? 21.058  11.598  -63.852 1.00 33.56  ? 150  PHE C CD1   1 
ATOM   4077 C CD2   . PHE B 1 150 ? 21.426  9.540   -62.715 1.00 36.03  ? 150  PHE C CD2   1 
ATOM   4078 C CE1   . PHE B 1 150 ? 19.798  11.688  -63.289 1.00 33.02  ? 150  PHE C CE1   1 
ATOM   4079 C CE2   . PHE B 1 150 ? 20.167  9.621   -62.149 1.00 35.87  ? 150  PHE C CE2   1 
ATOM   4080 C CZ    . PHE B 1 150 ? 19.350  10.694  -62.437 1.00 33.30  ? 150  PHE C CZ    1 
ATOM   4081 N N     . ASN B 1 151 ? 23.352  7.439   -64.946 1.00 31.30  ? 151  ASN C N     1 
ATOM   4082 C CA    . ASN B 1 151 ? 22.940  6.040   -64.961 1.00 30.06  ? 151  ASN C CA    1 
ATOM   4083 C C     . ASN B 1 151 ? 21.571  5.802   -64.331 1.00 37.99  ? 151  ASN C C     1 
ATOM   4084 O O     . ASN B 1 151 ? 21.412  5.920   -63.114 1.00 40.37  ? 151  ASN C O     1 
ATOM   4085 C CB    . ASN B 1 151 ? 24.003  5.200   -64.252 1.00 29.12  ? 151  ASN C CB    1 
ATOM   4086 C CG    . ASN B 1 151 ? 23.725  3.700   -64.324 1.00 37.01  ? 151  ASN C CG    1 
ATOM   4087 O OD1   . ASN B 1 151 ? 22.868  3.237   -65.087 1.00 36.16  ? 151  ASN C OD1   1 
ATOM   4088 N ND2   . ASN B 1 151 ? 24.466  2.934   -63.530 1.00 25.28  ? 151  ASN C ND2   1 
ATOM   4089 N N     . LEU B 1 152 ? 20.585  5.456   -65.156 1.00 33.52  ? 152  LEU C N     1 
ATOM   4090 C CA    . LEU B 1 152 ? 19.238  5.195   -64.649 1.00 37.82  ? 152  LEU C CA    1 
ATOM   4091 C C     . LEU B 1 152 ? 18.946  3.705   -64.415 1.00 42.62  ? 152  LEU C C     1 
ATOM   4092 O O     . LEU B 1 152 ? 17.816  3.334   -64.093 1.00 36.99  ? 152  LEU C O     1 
ATOM   4093 C CB    . LEU B 1 152 ? 18.189  5.787   -65.590 1.00 37.77  ? 152  LEU C CB    1 
ATOM   4094 C CG    . LEU B 1 152 ? 18.274  7.295   -65.829 1.00 42.07  ? 152  LEU C CG    1 
ATOM   4095 C CD1   . LEU B 1 152 ? 17.134  7.765   -66.724 1.00 37.30  ? 152  LEU C CD1   1 
ATOM   4096 C CD2   . LEU B 1 152 ? 18.264  8.036   -64.499 1.00 35.82  ? 152  LEU C CD2   1 
ATOM   4097 N N     . GLN B 1 153 ? 19.956  2.855   -64.572 1.00 42.07  ? 153  GLN C N     1 
ATOM   4098 C CA    . GLN B 1 153 ? 19.751  1.415   -64.415 1.00 41.61  ? 153  GLN C CA    1 
ATOM   4099 C C     . GLN B 1 153 ? 20.008  0.959   -62.984 1.00 48.17  ? 153  GLN C C     1 
ATOM   4100 O O     . GLN B 1 153 ? 19.580  -0.121  -62.590 1.00 49.21  ? 153  GLN C O     1 
ATOM   4101 C CB    . GLN B 1 153 ? 20.629  0.622   -65.385 1.00 37.40  ? 153  GLN C CB    1 
ATOM   4102 C CG    . GLN B 1 153 ? 20.448  1.006   -66.853 1.00 35.60  ? 153  GLN C CG    1 
ATOM   4103 C CD    . GLN B 1 153 ? 18.989  1.199   -67.220 1.00 44.88  ? 153  GLN C CD    1 
ATOM   4104 O OE1   . GLN B 1 153 ? 18.157  0.328   -66.974 1.00 56.16  ? 153  GLN C OE1   1 
ATOM   4105 N NE2   . GLN B 1 153 ? 18.668  2.355   -67.792 1.00 45.14  ? 153  GLN C NE2   1 
ATOM   4106 N N     . GLU B 1 154 ? 20.701  1.787   -62.209 1.00 47.46  ? 154  GLU C N     1 
ATOM   4107 C CA    . GLU B 1 154 ? 21.001  1.466   -60.818 1.00 39.77  ? 154  GLU C CA    1 
ATOM   4108 C C     . GLU B 1 154 ? 20.345  2.470   -59.883 1.00 43.27  ? 154  GLU C C     1 
ATOM   4109 O O     . GLU B 1 154 ? 20.508  3.673   -60.055 1.00 51.71  ? 154  GLU C O     1 
ATOM   4110 C CB    . GLU B 1 154 ? 22.509  1.449   -60.586 1.00 32.42  ? 154  GLU C CB    1 
ATOM   4111 C CG    . GLU B 1 154 ? 23.237  0.306   -61.280 1.00 34.38  ? 154  GLU C CG    1 
ATOM   4112 C CD    . GLU B 1 154 ? 22.971  -1.053  -60.633 1.00 46.74  ? 154  GLU C CD    1 
ATOM   4113 O OE1   . GLU B 1 154 ? 22.506  -1.086  -59.473 1.00 46.48  ? 154  GLU C OE1   1 
ATOM   4114 O OE2   . GLU B 1 154 ? 23.224  -2.087  -61.290 1.00 48.36  ? 154  GLU C OE2   1 
ATOM   4115 N N     . PRO B 1 155 ? 19.606  1.973   -58.877 1.00 45.10  ? 155  PRO C N     1 
ATOM   4116 C CA    . PRO B 1 155 ? 18.893  2.858   -57.948 1.00 32.43  ? 155  PRO C CA    1 
ATOM   4117 C C     . PRO B 1 155 ? 19.852  3.733   -57.135 1.00 34.54  ? 155  PRO C C     1 
ATOM   4118 O O     . PRO B 1 155 ? 19.448  4.769   -56.613 1.00 37.61  ? 155  PRO C O     1 
ATOM   4119 C CB    . PRO B 1 155 ? 18.129  1.882   -57.046 1.00 38.48  ? 155  PRO C CB    1 
ATOM   4120 C CG    . PRO B 1 155 ? 18.886  0.594   -57.142 1.00 39.49  ? 155  PRO C CG    1 
ATOM   4121 C CD    . PRO B 1 155 ? 19.445  0.547   -58.531 1.00 39.78  ? 155  PRO C CD    1 
ATOM   4122 N N     . TYR B 1 156 ? 21.110  3.320   -57.043 1.00 35.16  ? 156  TYR C N     1 
ATOM   4123 C CA    . TYR B 1 156 ? 22.142  4.119   -56.390 1.00 37.14  ? 156  TYR C CA    1 
ATOM   4124 C C     . TYR B 1 156 ? 22.139  5.562   -56.891 1.00 37.69  ? 156  TYR C C     1 
ATOM   4125 O O     . TYR B 1 156 ? 22.289  6.497   -56.107 1.00 33.82  ? 156  TYR C O     1 
ATOM   4126 C CB    . TYR B 1 156 ? 23.521  3.500   -56.652 1.00 38.36  ? 156  TYR C CB    1 
ATOM   4127 C CG    . TYR B 1 156 ? 24.673  4.185   -55.937 1.00 38.78  ? 156  TYR C CG    1 
ATOM   4128 C CD1   . TYR B 1 156 ? 24.786  4.135   -54.559 1.00 32.22  ? 156  TYR C CD1   1 
ATOM   4129 C CD2   . TYR B 1 156 ? 25.658  4.855   -56.643 1.00 40.44  ? 156  TYR C CD2   1 
ATOM   4130 C CE1   . TYR B 1 156 ? 25.838  4.741   -53.903 1.00 36.82  ? 156  TYR C CE1   1 
ATOM   4131 C CE2   . TYR B 1 156 ? 26.716  5.468   -55.990 1.00 39.85  ? 156  TYR C CE2   1 
ATOM   4132 C CZ    . TYR B 1 156 ? 26.802  5.405   -54.620 1.00 40.17  ? 156  TYR C CZ    1 
ATOM   4133 O OH    . TYR B 1 156 ? 27.851  6.012   -53.956 1.00 38.48  ? 156  TYR C OH    1 
ATOM   4134 N N     . PHE B 1 157 ? 21.974  5.733   -58.201 1.00 37.29  ? 157  PHE C N     1 
ATOM   4135 C CA    . PHE B 1 157 ? 22.113  7.045   -58.830 1.00 35.98  ? 157  PHE C CA    1 
ATOM   4136 C C     . PHE B 1 157 ? 20.850  7.888   -58.722 1.00 40.02  ? 157  PHE C C     1 
ATOM   4137 O O     . PHE B 1 157 ? 20.919  9.115   -58.726 1.00 46.40  ? 157  PHE C O     1 
ATOM   4138 C CB    . PHE B 1 157 ? 22.556  6.898   -60.291 1.00 28.95  ? 157  PHE C CB    1 
ATOM   4139 C CG    . PHE B 1 157 ? 23.937  6.326   -60.442 1.00 23.89  ? 157  PHE C CG    1 
ATOM   4140 C CD1   . PHE B 1 157 ? 24.147  4.960   -60.376 1.00 33.48  ? 157  PHE C CD1   1 
ATOM   4141 C CD2   . PHE B 1 157 ? 25.025  7.153   -60.615 1.00 28.95  ? 157  PHE C CD2   1 
ATOM   4142 C CE1   . PHE B 1 157 ? 25.418  4.428   -60.500 1.00 36.94  ? 157  PHE C CE1   1 
ATOM   4143 C CE2   . PHE B 1 157 ? 26.297  6.629   -60.743 1.00 32.26  ? 157  PHE C CE2   1 
ATOM   4144 C CZ    . PHE B 1 157 ? 26.493  5.266   -60.690 1.00 33.83  ? 157  PHE C CZ    1 
ATOM   4145 N N     . THR B 1 158 ? 19.706  7.219   -58.609 1.00 40.38  ? 158  THR C N     1 
ATOM   4146 C CA    . THR B 1 158 ? 18.404  7.878   -58.530 1.00 34.53  ? 158  THR C CA    1 
ATOM   4147 C C     . THR B 1 158 ? 18.027  8.204   -57.089 1.00 42.21  ? 158  THR C C     1 
ATOM   4148 O O     . THR B 1 158 ? 17.260  9.128   -56.826 1.00 44.66  ? 158  THR C O     1 
ATOM   4149 C CB    . THR B 1 158 ? 17.313  6.967   -59.107 1.00 44.49  ? 158  THR C CB    1 
ATOM   4150 O OG1   . THR B 1 158 ? 17.540  6.779   -60.507 1.00 51.85  ? 158  THR C OG1   1 
ATOM   4151 C CG2   . THR B 1 158 ? 15.944  7.576   -58.898 1.00 47.49  ? 158  THR C CG2   1 
ATOM   4152 N N     . TRP B 1 159 ? 18.576  7.432   -56.159 1.00 40.70  ? 159  TRP C N     1 
ATOM   4153 C CA    . TRP B 1 159 ? 18.243  7.554   -54.747 1.00 39.42  ? 159  TRP C CA    1 
ATOM   4154 C C     . TRP B 1 159 ? 18.393  8.963   -54.173 1.00 42.97  ? 159  TRP C C     1 
ATOM   4155 O O     . TRP B 1 159 ? 17.568  9.388   -53.362 1.00 44.84  ? 159  TRP C O     1 
ATOM   4156 C CB    . TRP B 1 159 ? 19.058  6.566   -53.903 1.00 35.80  ? 159  TRP C CB    1 
ATOM   4157 C CG    . TRP B 1 159 ? 18.607  6.549   -52.476 1.00 47.95  ? 159  TRP C CG    1 
ATOM   4158 C CD1   . TRP B 1 159 ? 19.202  7.171   -51.418 1.00 52.88  ? 159  TRP C CD1   1 
ATOM   4159 C CD2   . TRP B 1 159 ? 17.442  5.902   -51.958 1.00 47.71  ? 159  TRP C CD2   1 
ATOM   4160 N NE1   . TRP B 1 159 ? 18.483  6.943   -50.270 1.00 52.70  ? 159  TRP C NE1   1 
ATOM   4161 C CE2   . TRP B 1 159 ? 17.397  6.167   -50.576 1.00 50.63  ? 159  TRP C CE2   1 
ATOM   4162 C CE3   . TRP B 1 159 ? 16.433  5.121   -52.528 1.00 46.62  ? 159  TRP C CE3   1 
ATOM   4163 C CZ2   . TRP B 1 159 ? 16.385  5.675   -49.755 1.00 47.22  ? 159  TRP C CZ2   1 
ATOM   4164 C CZ3   . TRP B 1 159 ? 15.430  4.638   -51.714 1.00 43.06  ? 159  TRP C CZ3   1 
ATOM   4165 C CH2   . TRP B 1 159 ? 15.413  4.916   -50.343 1.00 46.07  ? 159  TRP C CH2   1 
ATOM   4166 N N     . PRO B 1 160 ? 19.447  9.690   -54.576 1.00 46.23  ? 160  PRO C N     1 
ATOM   4167 C CA    . PRO B 1 160 ? 19.618  11.025  -53.983 1.00 46.15  ? 160  PRO C CA    1 
ATOM   4168 C C     . PRO B 1 160 ? 18.343  11.862  -54.116 1.00 42.93  ? 160  PRO C C     1 
ATOM   4169 O O     . PRO B 1 160 ? 17.972  12.598  -53.196 1.00 38.30  ? 160  PRO C O     1 
ATOM   4170 C CB    . PRO B 1 160 ? 20.746  11.632  -54.821 1.00 46.80  ? 160  PRO C CB    1 
ATOM   4171 C CG    . PRO B 1 160 ? 21.521  10.437  -55.323 1.00 43.75  ? 160  PRO C CG    1 
ATOM   4172 C CD    . PRO B 1 160 ? 20.488  9.385   -55.577 1.00 35.49  ? 160  PRO C CD    1 
ATOM   4173 N N     . LEU B 1 161 ? 17.676  11.722  -55.257 1.00 40.39  ? 161  LEU C N     1 
ATOM   4174 C CA    . LEU B 1 161 ? 16.473  12.481  -55.568 1.00 41.66  ? 161  LEU C CA    1 
ATOM   4175 C C     . LEU B 1 161 ? 15.243  11.909  -54.874 1.00 52.15  ? 161  LEU C C     1 
ATOM   4176 O O     . LEU B 1 161 ? 14.359  12.651  -54.443 1.00 54.64  ? 161  LEU C O     1 
ATOM   4177 C CB    . LEU B 1 161 ? 16.259  12.513  -57.082 1.00 40.22  ? 161  LEU C CB    1 
ATOM   4178 C CG    . LEU B 1 161 ? 14.919  13.028  -57.601 1.00 38.08  ? 161  LEU C CG    1 
ATOM   4179 C CD1   . LEU B 1 161 ? 14.686  14.444  -57.130 1.00 39.79  ? 161  LEU C CD1   1 
ATOM   4180 C CD2   . LEU B 1 161 ? 14.872  12.945  -59.115 1.00 36.21  ? 161  LEU C CD2   1 
ATOM   4181 N N     . ILE B 1 162 ? 15.190  10.585  -54.775 1.00 52.35  ? 162  ILE C N     1 
ATOM   4182 C CA    . ILE B 1 162 ? 14.082  9.904   -54.123 1.00 46.59  ? 162  ILE C CA    1 
ATOM   4183 C C     . ILE B 1 162 ? 14.061  10.193  -52.619 1.00 51.57  ? 162  ILE C C     1 
ATOM   4184 O O     . ILE B 1 162 ? 13.002  10.415  -52.036 1.00 47.60  ? 162  ILE C O     1 
ATOM   4185 C CB    . ILE B 1 162 ? 14.142  8.384   -54.369 1.00 51.97  ? 162  ILE C CB    1 
ATOM   4186 C CG1   . ILE B 1 162 ? 13.830  8.071   -55.831 1.00 52.09  ? 162  ILE C CG1   1 
ATOM   4187 C CG2   . ILE B 1 162 ? 13.168  7.650   -53.466 1.00 53.50  ? 162  ILE C CG2   1 
ATOM   4188 C CD1   . ILE B 1 162 ? 13.915  6.603   -56.164 1.00 56.72  ? 162  ILE C CD1   1 
ATOM   4189 N N     . ALA B 1 163 ? 15.234  10.209  -51.997 1.00 49.77  ? 163  ALA C N     1 
ATOM   4190 C CA    . ALA B 1 163 ? 15.317  10.441  -50.561 1.00 48.13  ? 163  ALA C CA    1 
ATOM   4191 C C     . ALA B 1 163 ? 15.164  11.914  -50.181 1.00 55.29  ? 163  ALA C C     1 
ATOM   4192 O O     . ALA B 1 163 ? 14.844  12.233  -49.034 1.00 57.09  ? 163  ALA C O     1 
ATOM   4193 C CB    . ALA B 1 163 ? 16.618  9.882   -50.008 1.00 48.20  ? 163  ALA C CB    1 
ATOM   4194 N N     . ALA B 1 164 ? 15.390  12.808  -51.139 1.00 53.70  ? 164  ALA C N     1 
ATOM   4195 C CA    . ALA B 1 164 ? 15.391  14.246  -50.862 1.00 44.31  ? 164  ALA C CA    1 
ATOM   4196 C C     . ALA B 1 164 ? 14.201  14.723  -50.022 1.00 49.38  ? 164  ALA C C     1 
ATOM   4197 O O     . ALA B 1 164 ? 14.383  15.444  -49.041 1.00 47.49  ? 164  ALA C O     1 
ATOM   4198 C CB    . ALA B 1 164 ? 15.483  15.056  -52.171 1.00 38.94  ? 164  ALA C CB    1 
ATOM   4199 N N     . ASP B 1 165 ? 12.987  14.334  -50.401 1.00 53.25  ? 165  ASP C N     1 
ATOM   4200 C CA    . ASP B 1 165 ? 11.803  14.868  -49.730 1.00 60.26  ? 165  ASP C CA    1 
ATOM   4201 C C     . ASP B 1 165 ? 11.252  13.951  -48.645 1.00 66.75  ? 165  ASP C C     1 
ATOM   4202 O O     . ASP B 1 165 ? 10.094  14.077  -48.251 1.00 68.53  ? 165  ASP C O     1 
ATOM   4203 C CB    . ASP B 1 165 ? 10.698  15.200  -50.734 1.00 61.75  ? 165  ASP C CB    1 
ATOM   4204 C CG    . ASP B 1 165 ? 9.665   16.161  -50.165 1.00 62.42  ? 165  ASP C CG    1 
ATOM   4205 O OD1   . ASP B 1 165 ? 10.060  17.080  -49.409 1.00 65.01  ? 165  ASP C OD1   1 
ATOM   4206 O OD2   . ASP B 1 165 ? 8.463   16.000  -50.475 1.00 54.12  ? 165  ASP C OD2   1 
ATOM   4207 N N     . GLY B 1 166 ? 12.079  13.028  -48.167 1.00 66.43  ? 166  GLY C N     1 
ATOM   4208 C CA    . GLY B 1 166 ? 11.675  12.160  -47.078 1.00 58.58  ? 166  GLY C CA    1 
ATOM   4209 C C     . GLY B 1 166 ? 11.651  10.685  -47.423 1.00 57.19  ? 166  GLY C C     1 
ATOM   4210 O O     . GLY B 1 166 ? 10.992  9.901   -46.752 1.00 61.50  ? 166  GLY C O     1 
ATOM   4211 N N     . GLY B 1 167 ? 12.357  10.302  -48.479 1.00 57.34  ? 167  GLY C N     1 
ATOM   4212 C CA    . GLY B 1 167 ? 12.548  8.895   -48.766 1.00 48.17  ? 167  GLY C CA    1 
ATOM   4213 C C     . GLY B 1 167 ? 13.588  8.346   -47.810 1.00 46.91  ? 167  GLY C C     1 
ATOM   4214 O O     . GLY B 1 167 ? 14.486  9.069   -47.386 1.00 53.95  ? 167  GLY C O     1 
ATOM   4215 N N     . TYR B 1 168 ? 13.462  7.077   -47.445 1.00 47.09  ? 168  TYR C N     1 
ATOM   4216 C CA    . TYR B 1 168 ? 14.480  6.420   -46.629 1.00 50.83  ? 168  TYR C CA    1 
ATOM   4217 C C     . TYR B 1 168 ? 14.451  4.914   -46.837 1.00 45.88  ? 168  TYR C C     1 
ATOM   4218 O O     . TYR B 1 168 ? 13.431  4.361   -47.235 1.00 49.81  ? 168  TYR C O     1 
ATOM   4219 C CB    . TYR B 1 168 ? 14.344  6.781   -45.138 1.00 59.59  ? 168  TYR C CB    1 
ATOM   4220 C CG    . TYR B 1 168 ? 13.045  6.366   -44.471 1.00 65.40  ? 168  TYR C CG    1 
ATOM   4221 C CD1   . TYR B 1 168 ? 12.952  5.168   -43.769 1.00 68.57  ? 168  TYR C CD1   1 
ATOM   4222 C CD2   . TYR B 1 168 ? 11.922  7.182   -44.519 1.00 66.92  ? 168  TYR C CD2   1 
ATOM   4223 C CE1   . TYR B 1 168 ? 11.774  4.789   -43.150 1.00 68.27  ? 168  TYR C CE1   1 
ATOM   4224 C CE2   . TYR B 1 168 ? 10.739  6.810   -43.904 1.00 71.11  ? 168  TYR C CE2   1 
ATOM   4225 C CZ    . TYR B 1 168 ? 10.670  5.612   -43.222 1.00 72.59  ? 168  TYR C CZ    1 
ATOM   4226 O OH    . TYR B 1 168 ? 9.495   5.237   -42.609 1.00 71.91  ? 168  TYR C OH    1 
ATOM   4227 N N     . ALA B 1 169 ? 15.581  4.257   -46.602 1.00 40.47  ? 169  ALA C N     1 
ATOM   4228 C CA    . ALA B 1 169 ? 15.632  2.806   -46.701 1.00 56.92  ? 169  ALA C CA    1 
ATOM   4229 C C     . ALA B 1 169 ? 15.025  2.181   -45.437 1.00 62.42  ? 169  ALA C C     1 
ATOM   4230 O O     . ALA B 1 169 ? 13.817  1.933   -45.381 1.00 59.48  ? 169  ALA C O     1 
ATOM   4231 C CB    . ALA B 1 169 ? 17.065  2.328   -46.925 1.00 54.63  ? 169  ALA C CB    1 
ATOM   4232 N N     . PHE B 1 170 ? 15.854  1.945   -44.423 1.00 59.46  ? 170  PHE C N     1 
ATOM   4233 C CA    . PHE B 1 170 ? 15.370  1.375   -43.163 1.00 58.02  ? 170  PHE C CA    1 
ATOM   4234 C C     . PHE B 1 170 ? 15.492  2.364   -42.011 1.00 62.35  ? 170  PHE C C     1 
ATOM   4235 O O     . PHE B 1 170 ? 16.557  2.946   -41.792 1.00 56.81  ? 170  PHE C O     1 
ATOM   4236 C CB    . PHE B 1 170 ? 16.115  0.083   -42.821 1.00 50.44  ? 170  PHE C CB    1 
ATOM   4237 C CG    . PHE B 1 170 ? 15.875  -1.027  -43.798 1.00 52.16  ? 170  PHE C CG    1 
ATOM   4238 C CD1   . PHE B 1 170 ? 14.674  -1.717  -43.802 1.00 57.07  ? 170  PHE C CD1   1 
ATOM   4239 C CD2   . PHE B 1 170 ? 16.848  -1.382  -44.716 1.00 54.95  ? 170  PHE C CD2   1 
ATOM   4240 C CE1   . PHE B 1 170 ? 14.450  -2.742  -44.705 1.00 60.09  ? 170  PHE C CE1   1 
ATOM   4241 C CE2   . PHE B 1 170 ? 16.628  -2.407  -45.629 1.00 51.46  ? 170  PHE C CE2   1 
ATOM   4242 C CZ    . PHE B 1 170 ? 15.430  -3.086  -45.623 1.00 56.98  ? 170  PHE C CZ    1 
ATOM   4243 N N     . LYS B 1 171 ? 14.400  2.548   -41.274 1.00 63.42  ? 171  LYS C N     1 
ATOM   4244 C CA    . LYS B 1 171 ? 14.400  3.475   -40.150 1.00 62.93  ? 171  LYS C CA    1 
ATOM   4245 C C     . LYS B 1 171 ? 15.447  3.063   -39.122 1.00 61.74  ? 171  LYS C C     1 
ATOM   4246 O O     . LYS B 1 171 ? 15.689  1.874   -38.912 1.00 58.87  ? 171  LYS C O     1 
ATOM   4247 C CB    . LYS B 1 171 ? 13.015  3.545   -39.501 1.00 65.03  ? 171  LYS C CB    1 
ATOM   4248 C CG    . LYS B 1 171 ? 12.819  4.747   -38.583 1.00 67.54  ? 171  LYS C CG    1 
ATOM   4249 C CD    . LYS B 1 171 ? 13.150  6.049   -39.304 1.00 80.26  ? 171  LYS C CD    1 
ATOM   4250 C CE    . LYS B 1 171 ? 12.194  7.174   -38.921 1.00 89.98  ? 171  LYS C CE    1 
ATOM   4251 N NZ    . LYS B 1 171 ? 10.828  6.969   -39.490 1.00 94.19  ? 171  LYS C NZ    1 
ATOM   4252 N N     . TYR B 1 172 ? 16.078  4.048   -38.492 1.00 58.10  ? 172  TYR C N     1 
ATOM   4253 C CA    . TYR B 1 172 ? 17.071  3.763   -37.470 1.00 66.86  ? 172  TYR C CA    1 
ATOM   4254 C C     . TYR B 1 172 ? 16.589  4.281   -36.121 1.00 78.99  ? 172  TYR C C     1 
ATOM   4255 O O     . TYR B 1 172 ? 16.539  5.487   -35.892 1.00 81.42  ? 172  TYR C O     1 
ATOM   4256 C CB    . TYR B 1 172 ? 18.421  4.378   -37.835 1.00 65.08  ? 172  TYR C CB    1 
ATOM   4257 C CG    . TYR B 1 172 ? 19.564  3.888   -36.974 1.00 68.79  ? 172  TYR C CG    1 
ATOM   4258 C CD1   . TYR B 1 172 ? 20.166  2.662   -37.221 1.00 64.69  ? 172  TYR C CD1   1 
ATOM   4259 C CD2   . TYR B 1 172 ? 20.042  4.652   -35.916 1.00 77.45  ? 172  TYR C CD2   1 
ATOM   4260 C CE1   . TYR B 1 172 ? 21.211  2.207   -36.439 1.00 70.18  ? 172  TYR C CE1   1 
ATOM   4261 C CE2   . TYR B 1 172 ? 21.087  4.206   -35.127 1.00 80.25  ? 172  TYR C CE2   1 
ATOM   4262 C CZ    . TYR B 1 172 ? 21.668  2.982   -35.394 1.00 79.40  ? 172  TYR C CZ    1 
ATOM   4263 O OH    . TYR B 1 172 ? 22.709  2.531   -34.614 1.00 82.72  ? 172  TYR C OH    1 
ATOM   4264 N N     . GLU B 1 173 ? 16.220  3.360   -35.238 1.00 88.84  ? 173  GLU C N     1 
ATOM   4265 C CA    . GLU B 1 173 ? 15.714  3.718   -33.922 1.00 100.49 ? 173  GLU C CA    1 
ATOM   4266 C C     . GLU B 1 173 ? 16.365  2.868   -32.846 1.00 106.12 ? 173  GLU C C     1 
ATOM   4267 O O     . GLU B 1 173 ? 16.648  1.691   -33.061 1.00 108.55 ? 173  GLU C O     1 
ATOM   4268 C CB    . GLU B 1 173 ? 14.194  3.544   -33.863 1.00 107.70 ? 173  GLU C CB    1 
ATOM   4269 C CG    . GLU B 1 173 ? 13.416  4.529   -34.719 1.00 116.13 ? 173  GLU C CG    1 
ATOM   4270 C CD    . GLU B 1 173 ? 13.559  5.964   -34.244 1.00 122.52 ? 173  GLU C CD    1 
ATOM   4271 O OE1   . GLU B 1 173 ? 14.186  6.185   -33.185 1.00 125.05 ? 173  GLU C OE1   1 
ATOM   4272 O OE2   . GLU B 1 173 ? 13.042  6.872   -34.930 1.00 123.67 ? 173  GLU C OE2   1 
ATOM   4273 N N     . ASN B 1 174 ? 16.598  3.472   -31.686 1.00 111.63 ? 174  ASN C N     1 
ATOM   4274 C CA    . ASN B 1 174 ? 17.133  2.747   -30.541 1.00 115.56 ? 174  ASN C CA    1 
ATOM   4275 C C     . ASN B 1 174 ? 18.375  1.942   -30.904 1.00 106.75 ? 174  ASN C C     1 
ATOM   4276 O O     . ASN B 1 174 ? 18.524  0.790   -30.494 1.00 104.22 ? 174  ASN C O     1 
ATOM   4277 C CB    . ASN B 1 174 ? 16.065  1.822   -29.950 1.00 124.21 ? 174  ASN C CB    1 
ATOM   4278 C CG    . ASN B 1 174 ? 14.682  2.448   -29.962 1.00 130.21 ? 174  ASN C CG    1 
ATOM   4279 O OD1   . ASN B 1 174 ? 13.710  1.824   -30.391 1.00 132.35 ? 174  ASN C OD1   1 
ATOM   4280 N ND2   . ASN B 1 174 ? 14.589  3.690   -29.500 1.00 130.42 ? 174  ASN C ND2   1 
ATOM   4281 N N     . GLY B 1 175 ? 19.256  2.554   -31.689 1.00 98.72  ? 175  GLY C N     1 
ATOM   4282 C CA    . GLY B 1 175 ? 20.523  1.943   -32.043 1.00 88.40  ? 175  GLY C CA    1 
ATOM   4283 C C     . GLY B 1 175 ? 20.427  0.756   -32.983 1.00 80.05  ? 175  GLY C C     1 
ATOM   4284 O O     . GLY B 1 175 ? 21.383  -0.007  -33.117 1.00 81.22  ? 175  GLY C O     1 
ATOM   4285 N N     . LYS B 1 176 ? 19.283  0.592   -33.640 1.00 71.83  ? 176  LYS C N     1 
ATOM   4286 C CA    . LYS B 1 176 ? 19.128  -0.492  -34.606 1.00 70.54  ? 176  LYS C CA    1 
ATOM   4287 C C     . LYS B 1 176 ? 18.269  -0.090  -35.803 1.00 57.80  ? 176  LYS C C     1 
ATOM   4288 O O     . LYS B 1 176 ? 17.465  0.833   -35.720 1.00 52.51  ? 176  LYS C O     1 
ATOM   4289 C CB    . LYS B 1 176 ? 18.526  -1.731  -33.937 1.00 74.91  ? 176  LYS C CB    1 
ATOM   4290 C CG    . LYS B 1 176 ? 17.050  -1.603  -33.588 1.00 82.13  ? 176  LYS C CG    1 
ATOM   4291 C CD    . LYS B 1 176 ? 16.442  -2.970  -33.293 1.00 93.75  ? 176  LYS C CD    1 
ATOM   4292 C CE    . LYS B 1 176 ? 15.028  -2.849  -32.745 1.00 103.51 ? 176  LYS C CE    1 
ATOM   4293 N NZ    . LYS B 1 176 ? 14.999  -2.194  -31.402 1.00 106.96 ? 176  LYS C NZ    1 
ATOM   4294 N N     . TYR B 1 177 ? 18.432  -0.798  -36.914 1.00 55.19  ? 177  TYR C N     1 
ATOM   4295 C CA    . TYR B 1 177 ? 17.562  -0.587  -38.061 1.00 59.87  ? 177  TYR C CA    1 
ATOM   4296 C C     . TYR B 1 177 ? 16.284  -1.408  -37.925 1.00 63.39  ? 177  TYR C C     1 
ATOM   4297 O O     . TYR B 1 177 ? 16.320  -2.637  -37.956 1.00 66.37  ? 177  TYR C O     1 
ATOM   4298 C CB    . TYR B 1 177 ? 18.277  -0.941  -39.371 1.00 65.70  ? 177  TYR C CB    1 
ATOM   4299 C CG    . TYR B 1 177 ? 19.396  0.008   -39.748 1.00 66.37  ? 177  TYR C CG    1 
ATOM   4300 C CD1   . TYR B 1 177 ? 19.126  1.226   -40.364 1.00 68.72  ? 177  TYR C CD1   1 
ATOM   4301 C CD2   . TYR B 1 177 ? 20.721  -0.318  -39.497 1.00 63.35  ? 177  TYR C CD2   1 
ATOM   4302 C CE1   . TYR B 1 177 ? 20.147  2.093   -40.708 1.00 65.66  ? 177  TYR C CE1   1 
ATOM   4303 C CE2   . TYR B 1 177 ? 21.746  0.540   -39.835 1.00 61.96  ? 177  TYR C CE2   1 
ATOM   4304 C CZ    . TYR B 1 177 ? 21.456  1.743   -40.441 1.00 65.22  ? 177  TYR C CZ    1 
ATOM   4305 O OH    . TYR B 1 177 ? 22.484  2.594   -40.776 1.00 63.38  ? 177  TYR C OH    1 
ATOM   4306 N N     . ASP B 1 178 ? 15.157  -0.723  -37.763 1.00 65.29  ? 178  ASP C N     1 
ATOM   4307 C CA    . ASP B 1 178 ? 13.855  -1.377  -37.777 1.00 64.03  ? 178  ASP C CA    1 
ATOM   4308 C C     . ASP B 1 178 ? 13.605  -1.975  -39.153 1.00 57.48  ? 178  ASP C C     1 
ATOM   4309 O O     . ASP B 1 178 ? 13.182  -1.278  -40.072 1.00 59.04  ? 178  ASP C O     1 
ATOM   4310 C CB    . ASP B 1 178 ? 12.748  -0.379  -37.435 1.00 70.36  ? 178  ASP C CB    1 
ATOM   4311 C CG    . ASP B 1 178 ? 11.361  -1.000  -37.493 1.00 71.22  ? 178  ASP C CG    1 
ATOM   4312 O OD1   . ASP B 1 178 ? 11.238  -2.159  -37.948 1.00 63.88  ? 178  ASP C OD1   1 
ATOM   4313 O OD2   . ASP B 1 178 ? 10.390  -0.321  -37.093 1.00 72.30  ? 178  ASP C OD2   1 
ATOM   4314 N N     . ILE B 1 179 ? 13.850  -3.275  -39.275 1.00 56.91  ? 179  ILE C N     1 
ATOM   4315 C CA    . ILE B 1 179 ? 13.779  -3.977  -40.553 1.00 55.90  ? 179  ILE C CA    1 
ATOM   4316 C C     . ILE B 1 179 ? 12.364  -4.099  -41.128 1.00 60.41  ? 179  ILE C C     1 
ATOM   4317 O O     . ILE B 1 179 ? 12.145  -4.821  -42.107 1.00 62.70  ? 179  ILE C O     1 
ATOM   4318 C CB    . ILE B 1 179 ? 14.385  -5.382  -40.434 1.00 61.83  ? 179  ILE C CB    1 
ATOM   4319 C CG1   . ILE B 1 179 ? 13.422  -6.321  -39.699 1.00 66.55  ? 179  ILE C CG1   1 
ATOM   4320 C CG2   . ILE B 1 179 ? 15.722  -5.314  -39.711 1.00 64.80  ? 179  ILE C CG2   1 
ATOM   4321 C CD1   . ILE B 1 179 ? 13.324  -7.707  -40.314 1.00 67.31  ? 179  ILE C CD1   1 
ATOM   4322 N N     . LYS B 1 180 ? 11.408  -3.400  -40.525 1.00 60.10  ? 180  LYS C N     1 
ATOM   4323 C CA    . LYS B 1 180 ? 10.032  -3.417  -41.016 1.00 67.18  ? 180  LYS C CA    1 
ATOM   4324 C C     . LYS B 1 180 ? 9.499   -2.013  -41.280 1.00 65.90  ? 180  LYS C C     1 
ATOM   4325 O O     . LYS B 1 180 ? 8.404   -1.849  -41.816 1.00 66.63  ? 180  LYS C O     1 
ATOM   4326 C CB    . LYS B 1 180 ? 9.104   -4.168  -40.053 1.00 76.73  ? 180  LYS C CB    1 
ATOM   4327 C CG    . LYS B 1 180 ? 9.134   -5.685  -40.221 1.00 88.62  ? 180  LYS C CG    1 
ATOM   4328 C CD    . LYS B 1 180 ? 7.765   -6.313  -39.965 1.00 96.55  ? 180  LYS C CD    1 
ATOM   4329 C CE    . LYS B 1 180 ? 7.273   -6.055  -38.543 1.00 96.73  ? 180  LYS C CE    1 
ATOM   4330 N NZ    . LYS B 1 180 ? 5.929   -6.658  -38.294 1.00 96.28  ? 180  LYS C NZ    1 
ATOM   4331 N N     . ASP B 1 181 ? 10.271  -1.003  -40.894 1.00 67.88  ? 181  ASP C N     1 
ATOM   4332 C CA    . ASP B 1 181 ? 9.931   0.376   -41.219 1.00 70.86  ? 181  ASP C CA    1 
ATOM   4333 C C     . ASP B 1 181 ? 10.728  0.826   -42.441 1.00 71.88  ? 181  ASP C C     1 
ATOM   4334 O O     . ASP B 1 181 ? 11.808  1.406   -42.318 1.00 71.26  ? 181  ASP C O     1 
ATOM   4335 C CB    . ASP B 1 181 ? 10.194  1.298   -40.029 1.00 71.13  ? 181  ASP C CB    1 
ATOM   4336 C CG    . ASP B 1 181 ? 9.641   2.690   -40.240 1.00 71.79  ? 181  ASP C CG    1 
ATOM   4337 O OD1   . ASP B 1 181 ? 8.873   2.884   -41.208 1.00 77.60  ? 181  ASP C OD1   1 
ATOM   4338 O OD2   . ASP B 1 181 ? 9.964   3.587   -39.435 1.00 65.30  ? 181  ASP C OD2   1 
ATOM   4339 N N     . VAL B 1 182 ? 10.188  0.532   -43.619 1.00 72.80  ? 182  VAL C N     1 
ATOM   4340 C CA    . VAL B 1 182 ? 10.829  0.872   -44.885 1.00 69.94  ? 182  VAL C CA    1 
ATOM   4341 C C     . VAL B 1 182 ? 10.226  2.137   -45.490 1.00 65.04  ? 182  VAL C C     1 
ATOM   4342 O O     . VAL B 1 182 ? 9.013   2.228   -45.677 1.00 66.45  ? 182  VAL C O     1 
ATOM   4343 C CB    . VAL B 1 182 ? 10.688  -0.282  -45.893 1.00 66.87  ? 182  VAL C CB    1 
ATOM   4344 C CG1   . VAL B 1 182 ? 11.109  0.167   -47.274 1.00 64.87  ? 182  VAL C CG1   1 
ATOM   4345 C CG2   . VAL B 1 182 ? 11.510  -1.473  -45.441 1.00 67.76  ? 182  VAL C CG2   1 
ATOM   4346 N N     . GLY B 1 183 ? 11.075  3.108   -45.807 1.00 62.47  ? 183  GLY C N     1 
ATOM   4347 C CA    . GLY B 1 183 ? 10.597  4.381   -46.319 1.00 66.32  ? 183  GLY C CA    1 
ATOM   4348 C C     . GLY B 1 183 ? 10.749  4.600   -47.816 1.00 61.56  ? 183  GLY C C     1 
ATOM   4349 O O     . GLY B 1 183 ? 11.234  5.648   -48.246 1.00 63.79  ? 183  GLY C O     1 
ATOM   4350 N N     . VAL B 1 184 ? 10.325  3.626   -48.613 1.00 52.34  ? 184  VAL C N     1 
ATOM   4351 C CA    . VAL B 1 184 ? 10.443  3.735   -50.060 1.00 51.69  ? 184  VAL C CA    1 
ATOM   4352 C C     . VAL B 1 184 ? 9.085   3.987   -50.704 1.00 58.62  ? 184  VAL C C     1 
ATOM   4353 O O     . VAL B 1 184 ? 8.964   4.027   -51.929 1.00 60.23  ? 184  VAL C O     1 
ATOM   4354 C CB    . VAL B 1 184 ? 11.074  2.471   -50.684 1.00 55.32  ? 184  VAL C CB    1 
ATOM   4355 C CG1   . VAL B 1 184 ? 12.337  2.083   -49.935 1.00 54.78  ? 184  VAL C CG1   1 
ATOM   4356 C CG2   . VAL B 1 184 ? 10.085  1.325   -50.682 1.00 54.06  ? 184  VAL C CG2   1 
ATOM   4357 N N     . ASP B 1 185 ? 8.064   4.169   -49.877 1.00 62.49  ? 185  ASP C N     1 
ATOM   4358 C CA    . ASP B 1 185 ? 6.712   4.331   -50.389 1.00 67.53  ? 185  ASP C CA    1 
ATOM   4359 C C     . ASP B 1 185 ? 5.973   5.483   -49.716 1.00 63.57  ? 185  ASP C C     1 
ATOM   4360 O O     . ASP B 1 185 ? 4.775   5.668   -49.931 1.00 57.97  ? 185  ASP C O     1 
ATOM   4361 C CB    . ASP B 1 185 ? 5.924   3.032   -50.218 1.00 79.64  ? 185  ASP C CB    1 
ATOM   4362 C CG    . ASP B 1 185 ? 4.837   2.870   -51.261 1.00 89.28  ? 185  ASP C CG    1 
ATOM   4363 O OD1   . ASP B 1 185 ? 4.436   3.883   -51.873 1.00 91.34  ? 185  ASP C OD1   1 
ATOM   4364 O OD2   . ASP B 1 185 ? 4.383   1.726   -51.470 1.00 93.93  ? 185  ASP C OD2   1 
ATOM   4365 N N     . ASN B 1 186 ? 6.677   6.254   -48.895 1.00 63.86  ? 186  ASN C N     1 
ATOM   4366 C CA    . ASN B 1 186 ? 6.064   7.432   -48.298 1.00 68.34  ? 186  ASN C CA    1 
ATOM   4367 C C     . ASN B 1 186 ? 5.901   8.546   -49.331 1.00 68.44  ? 186  ASN C C     1 
ATOM   4368 O O     . ASN B 1 186 ? 6.177   8.347   -50.513 1.00 69.70  ? 186  ASN C O     1 
ATOM   4369 C CB    . ASN B 1 186 ? 6.849   7.912   -47.077 1.00 68.18  ? 186  ASN C CB    1 
ATOM   4370 C CG    . ASN B 1 186 ? 8.305   8.153   -47.379 1.00 72.54  ? 186  ASN C CG    1 
ATOM   4371 O OD1   . ASN B 1 186 ? 8.677   8.430   -48.518 1.00 79.21  ? 186  ASN C OD1   1 
ATOM   4372 N ND2   . ASN B 1 186 ? 9.145   8.044   -46.356 1.00 66.90  ? 186  ASN C ND2   1 
ATOM   4373 N N     . ALA B 1 187 ? 5.446   9.711   -48.885 1.00 67.52  ? 187  ALA C N     1 
ATOM   4374 C CA    . ALA B 1 187 ? 5.131   10.803  -49.799 1.00 69.02  ? 187  ALA C CA    1 
ATOM   4375 C C     . ALA B 1 187 ? 6.370   11.366  -50.491 1.00 63.48  ? 187  ALA C C     1 
ATOM   4376 O O     . ALA B 1 187 ? 6.314   11.752  -51.657 1.00 59.96  ? 187  ALA C O     1 
ATOM   4377 C CB    . ALA B 1 187 ? 4.386   11.907  -49.066 1.00 71.16  ? 187  ALA C CB    1 
ATOM   4378 N N     . GLY B 1 188 ? 7.480   11.421  -49.762 1.00 62.82  ? 188  GLY C N     1 
ATOM   4379 C CA    . GLY B 1 188 ? 8.716   11.965  -50.292 1.00 63.63  ? 188  GLY C CA    1 
ATOM   4380 C C     . GLY B 1 188 ? 9.229   11.151  -51.462 1.00 64.90  ? 188  GLY C C     1 
ATOM   4381 O O     . GLY B 1 188 ? 9.532   11.689  -52.527 1.00 67.84  ? 188  GLY C O     1 
ATOM   4382 N N     . ALA B 1 189 ? 9.322   9.843   -51.262 1.00 62.90  ? 189  ALA C N     1 
ATOM   4383 C CA    . ALA B 1 189 ? 9.754   8.943   -52.319 1.00 59.49  ? 189  ALA C CA    1 
ATOM   4384 C C     . ALA B 1 189 ? 8.901   9.116   -53.574 1.00 60.33  ? 189  ALA C C     1 
ATOM   4385 O O     . ALA B 1 189 ? 9.430   9.277   -54.674 1.00 61.45  ? 189  ALA C O     1 
ATOM   4386 C CB    . ALA B 1 189 ? 9.718   7.501   -51.836 1.00 57.46  ? 189  ALA C CB    1 
ATOM   4387 N N     . LYS B 1 190 ? 7.583   9.086   -53.409 1.00 57.01  ? 190  LYS C N     1 
ATOM   4388 C CA    . LYS B 1 190 ? 6.677   9.205   -54.548 1.00 61.26  ? 190  LYS C CA    1 
ATOM   4389 C C     . LYS B 1 190 ? 6.935   10.499  -55.320 1.00 61.49  ? 190  LYS C C     1 
ATOM   4390 O O     . LYS B 1 190 ? 6.843   10.540  -56.550 1.00 54.17  ? 190  LYS C O     1 
ATOM   4391 C CB    . LYS B 1 190 ? 5.220   9.164   -54.083 1.00 68.34  ? 190  LYS C CB    1 
ATOM   4392 C CG    . LYS B 1 190 ? 4.802   7.859   -53.432 1.00 77.70  ? 190  LYS C CG    1 
ATOM   4393 C CD    . LYS B 1 190 ? 3.316   7.862   -53.117 1.00 84.33  ? 190  LYS C CD    1 
ATOM   4394 C CE    . LYS B 1 190 ? 2.836   6.482   -52.700 1.00 90.75  ? 190  LYS C CE    1 
ATOM   4395 N NZ    . LYS B 1 190 ? 1.354   6.428   -52.563 1.00 95.17  ? 190  LYS C NZ    1 
ATOM   4396 N N     . ALA B 1 191 ? 7.259   11.554  -54.583 1.00 57.21  ? 191  ALA C N     1 
ATOM   4397 C CA    . ALA B 1 191 ? 7.501   12.855  -55.179 1.00 57.03  ? 191  ALA C CA    1 
ATOM   4398 C C     . ALA B 1 191 ? 8.817   12.862  -55.954 1.00 58.46  ? 191  ALA C C     1 
ATOM   4399 O O     . ALA B 1 191 ? 8.881   13.344  -57.086 1.00 58.21  ? 191  ALA C O     1 
ATOM   4400 C CB    . ALA B 1 191 ? 7.504   13.930  -54.098 1.00 60.21  ? 191  ALA C CB    1 
ATOM   4401 N N     . GLY B 1 192 ? 9.862   12.323  -55.335 1.00 54.17  ? 192  GLY C N     1 
ATOM   4402 C CA    . GLY B 1 192 ? 11.166  12.251  -55.966 1.00 56.03  ? 192  GLY C CA    1 
ATOM   4403 C C     . GLY B 1 192 ? 11.161  11.423  -57.238 1.00 55.42  ? 192  GLY C C     1 
ATOM   4404 O O     . GLY B 1 192 ? 11.742  11.811  -58.251 1.00 54.51  ? 192  GLY C O     1 
ATOM   4405 N N     . LEU B 1 193 ? 10.499  10.275  -57.186 1.00 53.52  ? 193  LEU C N     1 
ATOM   4406 C CA    . LEU B 1 193 ? 10.455  9.369   -58.326 1.00 51.39  ? 193  LEU C CA    1 
ATOM   4407 C C     . LEU B 1 193 ? 9.524   9.893   -59.411 1.00 56.79  ? 193  LEU C C     1 
ATOM   4408 O O     . LEU B 1 193 ? 9.732   9.639   -60.598 1.00 60.36  ? 193  LEU C O     1 
ATOM   4409 C CB    . LEU B 1 193 ? 10.032  7.969   -57.876 1.00 54.05  ? 193  LEU C CB    1 
ATOM   4410 C CG    . LEU B 1 193 ? 9.986   6.858   -58.925 1.00 53.14  ? 193  LEU C CG    1 
ATOM   4411 C CD1   . LEU B 1 193 ? 11.226  6.870   -59.803 1.00 40.10  ? 193  LEU C CD1   1 
ATOM   4412 C CD2   . LEU B 1 193 ? 9.827   5.511   -58.235 1.00 52.39  ? 193  LEU C CD2   1 
ATOM   4413 N N     . THR B 1 194 ? 8.498   10.629  -59.003 1.00 55.92  ? 194  THR C N     1 
ATOM   4414 C CA    . THR B 1 194 ? 7.585   11.230  -59.962 1.00 53.83  ? 194  THR C CA    1 
ATOM   4415 C C     . THR B 1 194 ? 8.291   12.321  -60.769 1.00 53.96  ? 194  THR C C     1 
ATOM   4416 O O     . THR B 1 194 ? 8.079   12.446  -61.976 1.00 56.15  ? 194  THR C O     1 
ATOM   4417 C CB    . THR B 1 194 ? 6.338   11.805  -59.268 1.00 61.45  ? 194  THR C CB    1 
ATOM   4418 O OG1   . THR B 1 194 ? 5.581   10.735  -58.685 1.00 63.13  ? 194  THR C OG1   1 
ATOM   4419 C CG2   . THR B 1 194 ? 5.463   12.555  -60.268 1.00 58.84  ? 194  THR C CG2   1 
ATOM   4420 N N     . PHE B 1 195 ? 9.136   13.106  -60.105 1.00 54.07  ? 195  PHE C N     1 
ATOM   4421 C CA    . PHE B 1 195 ? 9.887   14.145  -60.797 1.00 51.17  ? 195  PHE C CA    1 
ATOM   4422 C C     . PHE B 1 195 ? 10.853  13.507  -61.784 1.00 53.27  ? 195  PHE C C     1 
ATOM   4423 O O     . PHE B 1 195 ? 11.058  14.019  -62.883 1.00 55.43  ? 195  PHE C O     1 
ATOM   4424 C CB    . PHE B 1 195 ? 10.657  15.041  -59.823 1.00 49.81  ? 195  PHE C CB    1 
ATOM   4425 C CG    . PHE B 1 195 ? 11.305  16.227  -60.488 1.00 50.58  ? 195  PHE C CG    1 
ATOM   4426 C CD1   . PHE B 1 195 ? 10.585  17.389  -60.713 1.00 53.41  ? 195  PHE C CD1   1 
ATOM   4427 C CD2   . PHE B 1 195 ? 12.623  16.170  -60.910 1.00 44.45  ? 195  PHE C CD2   1 
ATOM   4428 C CE1   . PHE B 1 195 ? 11.171  18.480  -61.336 1.00 53.47  ? 195  PHE C CE1   1 
ATOM   4429 C CE2   . PHE B 1 195 ? 13.215  17.250  -61.532 1.00 47.42  ? 195  PHE C CE2   1 
ATOM   4430 C CZ    . PHE B 1 195 ? 12.488  18.411  -61.747 1.00 52.89  ? 195  PHE C CZ    1 
ATOM   4431 N N     . LEU B 1 196 ? 11.439  12.383  -61.384 1.00 52.31  ? 196  LEU C N     1 
ATOM   4432 C CA    . LEU B 1 196 ? 12.351  11.654  -62.254 1.00 51.23  ? 196  LEU C CA    1 
ATOM   4433 C C     . LEU B 1 196 ? 11.622  11.137  -63.484 1.00 48.28  ? 196  LEU C C     1 
ATOM   4434 O O     . LEU B 1 196 ? 12.135  11.221  -64.600 1.00 53.79  ? 196  LEU C O     1 
ATOM   4435 C CB    . LEU B 1 196 ? 13.001  10.489  -61.515 1.00 43.65  ? 196  LEU C CB    1 
ATOM   4436 C CG    . LEU B 1 196 ? 13.941  9.650   -62.379 1.00 48.59  ? 196  LEU C CG    1 
ATOM   4437 C CD1   . LEU B 1 196 ? 15.348  10.207  -62.329 1.00 50.35  ? 196  LEU C CD1   1 
ATOM   4438 C CD2   . LEU B 1 196 ? 13.938  8.208   -61.920 1.00 56.01  ? 196  LEU C CD2   1 
ATOM   4439 N N     . VAL B 1 197 ? 10.423  10.606  -63.276 1.00 46.99  ? 197  VAL C N     1 
ATOM   4440 C CA    . VAL B 1 197 ? 9.645   10.040  -64.372 1.00 48.23  ? 197  VAL C CA    1 
ATOM   4441 C C     . VAL B 1 197 ? 9.140   11.131  -65.321 1.00 47.82  ? 197  VAL C C     1 
ATOM   4442 O O     . VAL B 1 197 ? 9.126   10.941  -66.538 1.00 49.40  ? 197  VAL C O     1 
ATOM   4443 C CB    . VAL B 1 197 ? 8.469   9.170   -63.859 1.00 53.88  ? 197  VAL C CB    1 
ATOM   4444 C CG1   . VAL B 1 197 ? 7.564   8.760   -65.011 1.00 48.69  ? 197  VAL C CG1   1 
ATOM   4445 C CG2   . VAL B 1 197 ? 8.996   7.932   -63.125 1.00 47.68  ? 197  VAL C CG2   1 
ATOM   4446 N N     . ASP B 1 198 ? 8.744   12.275  -64.769 1.00 49.39  ? 198  ASP C N     1 
ATOM   4447 C CA    . ASP B 1 198 ? 8.348   13.413  -65.604 1.00 52.57  ? 198  ASP C CA    1 
ATOM   4448 C C     . ASP B 1 198 ? 9.508   13.903  -66.475 1.00 51.95  ? 198  ASP C C     1 
ATOM   4449 O O     . ASP B 1 198 ? 9.321   14.212  -67.653 1.00 53.60  ? 198  ASP C O     1 
ATOM   4450 C CB    . ASP B 1 198 ? 7.786   14.560  -64.761 1.00 51.97  ? 198  ASP C CB    1 
ATOM   4451 C CG    . ASP B 1 198 ? 6.426   14.238  -64.169 1.00 59.74  ? 198  ASP C CG    1 
ATOM   4452 O OD1   . ASP B 1 198 ? 5.763   13.303  -64.671 1.00 58.92  ? 198  ASP C OD1   1 
ATOM   4453 O OD2   . ASP B 1 198 ? 6.021   14.921  -63.202 1.00 62.94  ? 198  ASP C OD2   1 
ATOM   4454 N N     . LEU B 1 199 ? 10.704  13.974  -65.895 1.00 46.44  ? 199  LEU C N     1 
ATOM   4455 C CA    . LEU B 1 199 ? 11.897  14.303  -66.667 1.00 43.59  ? 199  LEU C CA    1 
ATOM   4456 C C     . LEU B 1 199 ? 11.981  13.414  -67.908 1.00 46.49  ? 199  LEU C C     1 
ATOM   4457 O O     . LEU B 1 199 ? 12.320  13.876  -68.998 1.00 42.95  ? 199  LEU C O     1 
ATOM   4458 C CB    . LEU B 1 199 ? 13.163  14.136  -65.817 1.00 39.16  ? 199  LEU C CB    1 
ATOM   4459 C CG    . LEU B 1 199 ? 13.532  15.190  -64.771 1.00 40.83  ? 199  LEU C CG    1 
ATOM   4460 C CD1   . LEU B 1 199 ? 14.819  14.796  -64.057 1.00 36.11  ? 199  LEU C CD1   1 
ATOM   4461 C CD2   . LEU B 1 199 ? 13.691  16.563  -65.409 1.00 45.57  ? 199  LEU C CD2   1 
ATOM   4462 N N     . ILE B 1 200 ? 11.661  12.134  -67.733 1.00 49.82  ? 200  ILE C N     1 
ATOM   4463 C CA    . ILE B 1 200 ? 11.719  11.166  -68.824 1.00 44.63  ? 200  ILE C CA    1 
ATOM   4464 C C     . ILE B 1 200 ? 10.513  11.294  -69.754 1.00 47.97  ? 200  ILE C C     1 
ATOM   4465 O O     . ILE B 1 200 ? 10.636  11.123  -70.969 1.00 49.23  ? 200  ILE C O     1 
ATOM   4466 C CB    . ILE B 1 200 ? 11.822  9.710   -68.293 1.00 47.15  ? 200  ILE C CB    1 
ATOM   4467 C CG1   . ILE B 1 200 ? 13.046  9.549   -67.392 1.00 43.34  ? 200  ILE C CG1   1 
ATOM   4468 C CG2   . ILE B 1 200 ? 11.900  8.723   -69.444 1.00 41.52  ? 200  ILE C CG2   1 
ATOM   4469 C CD1   . ILE B 1 200 ? 13.089  8.230   -66.639 1.00 42.59  ? 200  ILE C CD1   1 
ATOM   4470 N N     . LYS B 1 201 ? 9.347   11.586  -69.183 1.00 51.01  ? 201  LYS C N     1 
ATOM   4471 C CA    . LYS B 1 201 ? 8.142   11.793  -69.980 1.00 54.10  ? 201  LYS C CA    1 
ATOM   4472 C C     . LYS B 1 201 ? 8.332   12.970  -70.926 1.00 54.78  ? 201  LYS C C     1 
ATOM   4473 O O     . LYS B 1 201 ? 7.909   12.932  -72.080 1.00 59.52  ? 201  LYS C O     1 
ATOM   4474 C CB    . LYS B 1 201 ? 6.931   12.057  -69.083 1.00 56.95  ? 201  LYS C CB    1 
ATOM   4475 C CG    . LYS B 1 201 ? 6.378   10.833  -68.375 1.00 69.91  ? 201  LYS C CG    1 
ATOM   4476 C CD    . LYS B 1 201 ? 5.147   11.191  -67.544 1.00 74.77  ? 201  LYS C CD    1 
ATOM   4477 C CE    . LYS B 1 201 ? 4.561   9.969   -66.848 1.00 72.25  ? 201  LYS C CE    1 
ATOM   4478 N NZ    . LYS B 1 201 ? 3.431   10.336  -65.947 1.00 72.95  ? 201  LYS C NZ    1 
ATOM   4479 N N     . ASN B 1 202 ? 8.981   14.015  -70.426 1.00 52.38  ? 202  ASN C N     1 
ATOM   4480 C CA    . ASN B 1 202 ? 9.146   15.246  -71.182 1.00 48.61  ? 202  ASN C CA    1 
ATOM   4481 C C     . ASN B 1 202 ? 10.414  15.253  -72.021 1.00 54.15  ? 202  ASN C C     1 
ATOM   4482 O O     . ASN B 1 202 ? 10.826  16.296  -72.533 1.00 54.69  ? 202  ASN C O     1 
ATOM   4483 C CB    . ASN B 1 202 ? 9.113   16.439  -70.237 1.00 46.01  ? 202  ASN C CB    1 
ATOM   4484 C CG    . ASN B 1 202 ? 7.812   16.526  -69.467 1.00 52.56  ? 202  ASN C CG    1 
ATOM   4485 O OD1   . ASN B 1 202 ? 7.803   16.708  -68.249 1.00 56.57  ? 202  ASN C OD1   1 
ATOM   4486 N ND2   . ASN B 1 202 ? 6.700   16.376  -70.176 1.00 49.12  ? 202  ASN C ND2   1 
ATOM   4487 N N     . LYS B 1 203 ? 11.026  14.078  -72.149 1.00 46.96  ? 203  LYS C N     1 
ATOM   4488 C CA    . LYS B 1 203 ? 12.179  13.881  -73.024 1.00 44.37  ? 203  LYS C CA    1 
ATOM   4489 C C     . LYS B 1 203 ? 13.430  14.662  -72.604 1.00 41.69  ? 203  LYS C C     1 
ATOM   4490 O O     . LYS B 1 203 ? 14.298  14.937  -73.432 1.00 41.54  ? 203  LYS C O     1 
ATOM   4491 C CB    . LYS B 1 203 ? 11.823  14.214  -74.476 1.00 51.47  ? 203  LYS C CB    1 
ATOM   4492 C CG    . LYS B 1 203 ? 10.599  13.489  -75.024 1.00 53.96  ? 203  LYS C CG    1 
ATOM   4493 C CD    . LYS B 1 203 ? 10.831  11.997  -75.162 1.00 59.92  ? 203  LYS C CD    1 
ATOM   4494 C CE    . LYS B 1 203 ? 9.998   11.411  -76.294 1.00 58.93  ? 203  LYS C CE    1 
ATOM   4495 N NZ    . LYS B 1 203 ? 8.561   11.766  -76.171 1.00 61.65  ? 203  LYS C NZ    1 
ATOM   4496 N N     . HIS B 1 204 ? 13.532  15.012  -71.326 1.00 37.27  ? 204  HIS C N     1 
ATOM   4497 C CA    . HIS B 1 204 ? 14.767  15.603  -70.818 1.00 35.62  ? 204  HIS C CA    1 
ATOM   4498 C C     . HIS B 1 204 ? 15.775  14.503  -70.468 1.00 42.50  ? 204  HIS C C     1 
ATOM   4499 O O     . HIS B 1 204 ? 16.978  14.748  -70.386 1.00 44.65  ? 204  HIS C O     1 
ATOM   4500 C CB    . HIS B 1 204 ? 14.499  16.499  -69.608 1.00 31.05  ? 204  HIS C CB    1 
ATOM   4501 C CG    . HIS B 1 204 ? 13.481  17.568  -69.855 1.00 39.16  ? 204  HIS C CG    1 
ATOM   4502 N ND1   . HIS B 1 204 ? 13.642  18.546  -70.815 1.00 45.43  ? 204  HIS C ND1   1 
ATOM   4503 C CD2   . HIS B 1 204 ? 12.294  17.825  -69.254 1.00 41.36  ? 204  HIS C CD2   1 
ATOM   4504 C CE1   . HIS B 1 204 ? 12.596  19.354  -70.799 1.00 38.11  ? 204  HIS C CE1   1 
ATOM   4505 N NE2   . HIS B 1 204 ? 11.765  18.940  -69.859 1.00 44.79  ? 204  HIS C NE2   1 
ATOM   4506 N N     . MET B 1 205 ? 15.271  13.289  -70.251 1.00 45.38  ? 205  MET C N     1 
ATOM   4507 C CA    . MET B 1 205 ? 16.122  12.112  -70.100 1.00 39.39  ? 205  MET C CA    1 
ATOM   4508 C C     . MET B 1 205 ? 15.486  10.912  -70.789 1.00 46.91  ? 205  MET C C     1 
ATOM   4509 O O     . MET B 1 205 ? 14.320  10.952  -71.177 1.00 43.54  ? 205  MET C O     1 
ATOM   4510 C CB    . MET B 1 205 ? 16.390  11.795  -68.627 1.00 35.95  ? 205  MET C CB    1 
ATOM   4511 C CG    . MET B 1 205 ? 17.127  12.896  -67.875 1.00 38.79  ? 205  MET C CG    1 
ATOM   4512 S SD    . MET B 1 205 ? 17.899  12.373  -66.340 1.00 43.32  ? 205  MET C SD    1 
ATOM   4513 C CE    . MET B 1 205 ? 16.482  11.807  -65.413 1.00 38.77  ? 205  MET C CE    1 
ATOM   4514 N N     . ASN B 1 206 ? 16.260  9.846   -70.942 1.00 49.97  ? 206  ASN C N     1 
ATOM   4515 C CA    . ASN B 1 206 ? 15.754  8.617   -71.532 1.00 45.02  ? 206  ASN C CA    1 
ATOM   4516 C C     . ASN B 1 206 ? 15.888  7.445   -70.558 1.00 38.22  ? 206  ASN C C     1 
ATOM   4517 O O     . ASN B 1 206 ? 16.912  7.303   -69.893 1.00 32.95  ? 206  ASN C O     1 
ATOM   4518 C CB    . ASN B 1 206 ? 16.491  8.315   -72.835 1.00 41.37  ? 206  ASN C CB    1 
ATOM   4519 C CG    . ASN B 1 206 ? 15.890  7.145   -73.581 1.00 38.57  ? 206  ASN C CG    1 
ATOM   4520 O OD1   . ASN B 1 206 ? 16.067  5.996   -73.188 1.00 34.74  ? 206  ASN C OD1   1 
ATOM   4521 N ND2   . ASN B 1 206 ? 15.182  7.433   -74.673 1.00 39.28  ? 206  ASN C ND2   1 
ATOM   4522 N N     . ALA B 1 207 ? 14.855  6.610   -70.492 1.00 37.57  ? 207  ALA C N     1 
ATOM   4523 C CA    . ALA B 1 207 ? 14.797  5.505   -69.536 1.00 44.82  ? 207  ALA C CA    1 
ATOM   4524 C C     . ALA B 1 207 ? 15.933  4.501   -69.678 1.00 45.55  ? 207  ALA C C     1 
ATOM   4525 O O     . ALA B 1 207 ? 16.291  3.821   -68.716 1.00 46.15  ? 207  ALA C O     1 
ATOM   4526 C CB    . ALA B 1 207 ? 13.457  4.791   -69.632 1.00 42.34  ? 207  ALA C CB    1 
ATOM   4527 N N     . ASP B 1 208 ? 16.504  4.403   -70.872 1.00 38.46  ? 208  ASP C N     1 
ATOM   4528 C CA    . ASP B 1 208 ? 17.499  3.367   -71.122 1.00 43.01  ? 208  ASP C CA    1 
ATOM   4529 C C     . ASP B 1 208 ? 18.934  3.829   -70.902 1.00 41.06  ? 208  ASP C C     1 
ATOM   4530 O O     . ASP B 1 208 ? 19.874  3.063   -71.104 1.00 37.42  ? 208  ASP C O     1 
ATOM   4531 C CB    . ASP B 1 208 ? 17.313  2.777   -72.524 1.00 41.91  ? 208  ASP C CB    1 
ATOM   4532 C CG    . ASP B 1 208 ? 16.007  2.020   -72.658 1.00 54.84  ? 208  ASP C CG    1 
ATOM   4533 O OD1   . ASP B 1 208 ? 15.719  1.166   -71.791 1.00 60.08  ? 208  ASP C OD1   1 
ATOM   4534 O OD2   . ASP B 1 208 ? 15.253  2.292   -73.609 1.00 63.47  ? 208  ASP C OD2   1 
ATOM   4535 N N     . THR B 1 209 ? 19.106  5.077   -70.481 1.00 41.73  ? 209  THR C N     1 
ATOM   4536 C CA    . THR B 1 209 ? 20.449  5.589   -70.246 1.00 40.82  ? 209  THR C CA    1 
ATOM   4537 C C     . THR B 1 209 ? 21.116  4.780   -69.147 1.00 36.32  ? 209  THR C C     1 
ATOM   4538 O O     . THR B 1 209 ? 20.532  4.539   -68.096 1.00 39.12  ? 209  THR C O     1 
ATOM   4539 C CB    . THR B 1 209 ? 20.448  7.085   -69.867 1.00 37.85  ? 209  THR C CB    1 
ATOM   4540 O OG1   . THR B 1 209 ? 19.981  7.848   -70.979 1.00 38.27  ? 209  THR C OG1   1 
ATOM   4541 C CG2   . THR B 1 209 ? 21.850  7.557   -69.522 1.00 27.23  ? 209  THR C CG2   1 
ATOM   4542 N N     . ASP B 1 210 ? 22.342  4.352   -69.405 1.00 37.27  ? 210  ASP C N     1 
ATOM   4543 C CA    . ASP B 1 210 ? 23.098  3.598   -68.422 1.00 37.38  ? 210  ASP C CA    1 
ATOM   4544 C C     . ASP B 1 210 ? 24.438  4.279   -68.145 1.00 36.30  ? 210  ASP C C     1 
ATOM   4545 O O     . ASP B 1 210 ? 24.713  5.369   -68.659 1.00 40.75  ? 210  ASP C O     1 
ATOM   4546 C CB    . ASP B 1 210 ? 23.292  2.156   -68.900 1.00 38.76  ? 210  ASP C CB    1 
ATOM   4547 C CG    . ASP B 1 210 ? 24.104  2.063   -70.174 1.00 40.25  ? 210  ASP C CG    1 
ATOM   4548 O OD1   . ASP B 1 210 ? 24.738  3.069   -70.551 1.00 39.01  ? 210  ASP C OD1   1 
ATOM   4549 O OD2   . ASP B 1 210 ? 24.122  0.974   -70.791 1.00 45.11  ? 210  ASP C OD2   1 
ATOM   4550 N N     . TYR B 1 211 ? 25.267  3.633   -67.336 1.00 29.23  ? 211  TYR C N     1 
ATOM   4551 C CA    . TYR B 1 211 ? 26.553  4.191   -66.935 1.00 34.11  ? 211  TYR C CA    1 
ATOM   4552 C C     . TYR B 1 211 ? 27.435  4.596   -68.118 1.00 36.77  ? 211  TYR C C     1 
ATOM   4553 O O     . TYR B 1 211 ? 27.930  5.721   -68.165 1.00 34.40  ? 211  TYR C O     1 
ATOM   4554 C CB    . TYR B 1 211 ? 27.315  3.209   -66.036 1.00 26.45  ? 211  TYR C CB    1 
ATOM   4555 C CG    . TYR B 1 211 ? 28.480  3.852   -65.317 1.00 34.64  ? 211  TYR C CG    1 
ATOM   4556 C CD1   . TYR B 1 211 ? 29.732  3.931   -65.911 1.00 33.36  ? 211  TYR C CD1   1 
ATOM   4557 C CD2   . TYR B 1 211 ? 28.320  4.399   -64.046 1.00 35.11  ? 211  TYR C CD2   1 
ATOM   4558 C CE1   . TYR B 1 211 ? 30.797  4.528   -65.258 1.00 35.79  ? 211  TYR C CE1   1 
ATOM   4559 C CE2   . TYR B 1 211 ? 29.381  4.989   -63.380 1.00 31.51  ? 211  TYR C CE2   1 
ATOM   4560 C CZ    . TYR B 1 211 ? 30.614  5.053   -63.988 1.00 39.29  ? 211  TYR C CZ    1 
ATOM   4561 O OH    . TYR B 1 211 ? 31.666  5.642   -63.327 1.00 39.01  ? 211  TYR C OH    1 
ATOM   4562 N N     . SER B 1 212 ? 27.641  3.671   -69.055 1.00 33.27  ? 212  SER C N     1 
ATOM   4563 C CA    . SER B 1 212 ? 28.527  3.911   -70.196 1.00 34.76  ? 212  SER C CA    1 
ATOM   4564 C C     . SER B 1 212 ? 28.022  5.031   -71.070 1.00 28.23  ? 212  SER C C     1 
ATOM   4565 O O     . SER B 1 212 ? 28.798  5.856   -71.542 1.00 32.53  ? 212  SER C O     1 
ATOM   4566 C CB    . SER B 1 212 ? 28.673  2.651   -71.058 1.00 42.16  ? 212  SER C CB    1 
ATOM   4567 O OG    . SER B 1 212 ? 29.161  1.567   -70.288 1.00 54.77  ? 212  SER C OG    1 
ATOM   4568 N N     . ILE B 1 213 ? 26.716  5.037   -71.308 1.00 34.64  ? 213  ILE C N     1 
ATOM   4569 C CA    . ILE B 1 213 ? 26.105  6.022   -72.191 1.00 33.06  ? 213  ILE C CA    1 
ATOM   4570 C C     . ILE B 1 213 ? 26.214  7.427   -71.593 1.00 37.24  ? 213  ILE C C     1 
ATOM   4571 O O     . ILE B 1 213 ? 26.657  8.364   -72.261 1.00 36.09  ? 213  ILE C O     1 
ATOM   4572 C CB    . ILE B 1 213 ? 24.632  5.665   -72.496 1.00 30.64  ? 213  ILE C CB    1 
ATOM   4573 C CG1   . ILE B 1 213 ? 24.574  4.434   -73.411 1.00 37.05  ? 213  ILE C CG1   1 
ATOM   4574 C CG2   . ILE B 1 213 ? 23.920  6.836   -73.151 1.00 30.03  ? 213  ILE C CG2   1 
ATOM   4575 C CD1   . ILE B 1 213 ? 23.173  3.882   -73.631 1.00 35.13  ? 213  ILE C CD1   1 
ATOM   4576 N N     . ALA B 1 214 ? 25.832  7.558   -70.327 1.00 30.40  ? 214  ALA C N     1 
ATOM   4577 C CA    . ALA B 1 214 ? 25.907  8.840   -69.633 1.00 30.75  ? 214  ALA C CA    1 
ATOM   4578 C C     . ALA B 1 214 ? 27.341  9.333   -69.570 1.00 33.39  ? 214  ALA C C     1 
ATOM   4579 O O     . ALA B 1 214 ? 27.608  10.513  -69.790 1.00 33.70  ? 214  ALA C O     1 
ATOM   4580 C CB    . ALA B 1 214 ? 25.334  8.726   -68.242 1.00 25.91  ? 214  ALA C CB    1 
ATOM   4581 N N     . GLU B 1 215 ? 28.267  8.428   -69.276 1.00 32.80  ? 215  GLU C N     1 
ATOM   4582 C CA    . GLU B 1 215 ? 29.662  8.813   -69.132 1.00 29.98  ? 215  GLU C CA    1 
ATOM   4583 C C     . GLU B 1 215 ? 30.240  9.299   -70.460 1.00 39.55  ? 215  GLU C C     1 
ATOM   4584 O O     . GLU B 1 215 ? 30.925  10.331  -70.517 1.00 41.67  ? 215  GLU C O     1 
ATOM   4585 C CB    . GLU B 1 215 ? 30.487  7.653   -68.579 1.00 26.43  ? 215  GLU C CB    1 
ATOM   4586 C CG    . GLU B 1 215 ? 31.983  7.925   -68.553 1.00 26.80  ? 215  GLU C CG    1 
ATOM   4587 C CD    . GLU B 1 215 ? 32.785  6.696   -68.161 1.00 39.09  ? 215  GLU C CD    1 
ATOM   4588 O OE1   . GLU B 1 215 ? 32.428  5.584   -68.607 1.00 44.35  ? 215  GLU C OE1   1 
ATOM   4589 O OE2   . GLU B 1 215 ? 33.768  6.841   -67.403 1.00 38.40  ? 215  GLU C OE2   1 
ATOM   4590 N N     . ALA B 1 216 ? 29.963  8.557   -71.529 1.00 37.71  ? 216  ALA C N     1 
ATOM   4591 C CA    . ALA B 1 216 ? 30.424  8.945   -72.858 1.00 37.55  ? 216  ALA C CA    1 
ATOM   4592 C C     . ALA B 1 216 ? 29.861  10.310  -73.235 1.00 30.61  ? 216  ALA C C     1 
ATOM   4593 O O     . ALA B 1 216 ? 30.578  11.173  -73.739 1.00 36.35  ? 216  ALA C O     1 
ATOM   4594 C CB    . ALA B 1 216 ? 30.029  7.891   -73.902 1.00 36.09  ? 216  ALA C CB    1 
ATOM   4595 N N     . ALA B 1 217 ? 28.571  10.498  -72.992 1.00 30.42  ? 217  ALA C N     1 
ATOM   4596 C CA    . ALA B 1 217 ? 27.917  11.750  -73.339 1.00 30.22  ? 217  ALA C CA    1 
ATOM   4597 C C     . ALA B 1 217 ? 28.534  12.927  -72.579 1.00 40.01  ? 217  ALA C C     1 
ATOM   4598 O O     . ALA B 1 217 ? 28.775  13.987  -73.161 1.00 37.52  ? 217  ALA C O     1 
ATOM   4599 C CB    . ALA B 1 217 ? 26.429  11.664  -73.079 1.00 27.78  ? 217  ALA C CB    1 
ATOM   4600 N N     . PHE B 1 218 ? 28.810  12.743  -71.289 1.00 35.17  ? 218  PHE C N     1 
ATOM   4601 C CA    . PHE B 1 218 ? 29.419  13.830  -70.529 1.00 32.11  ? 218  PHE C CA    1 
ATOM   4602 C C     . PHE B 1 218 ? 30.864  14.073  -70.943 1.00 29.52  ? 218  PHE C C     1 
ATOM   4603 O O     . PHE B 1 218 ? 31.289  15.215  -71.075 1.00 28.92  ? 218  PHE C O     1 
ATOM   4604 C CB    . PHE B 1 218 ? 29.358  13.621  -69.006 1.00 27.51  ? 218  PHE C CB    1 
ATOM   4605 C CG    . PHE B 1 218 ? 29.914  14.792  -68.234 1.00 26.33  ? 218  PHE C CG    1 
ATOM   4606 C CD1   . PHE B 1 218 ? 29.134  15.921  -68.001 1.00 28.69  ? 218  PHE C CD1   1 
ATOM   4607 C CD2   . PHE B 1 218 ? 31.229  14.799  -67.815 1.00 21.82  ? 218  PHE C CD2   1 
ATOM   4608 C CE1   . PHE B 1 218 ? 29.653  17.030  -67.333 1.00 28.42  ? 218  PHE C CE1   1 
ATOM   4609 C CE2   . PHE B 1 218 ? 31.753  15.894  -67.139 1.00 26.09  ? 218  PHE C CE2   1 
ATOM   4610 C CZ    . PHE B 1 218 ? 30.963  17.015  -66.902 1.00 24.78  ? 218  PHE C CZ    1 
ATOM   4611 N N     . ASN B 1 219 ? 31.619  12.999  -71.133 1.00 26.26  ? 219  ASN C N     1 
ATOM   4612 C CA    . ASN B 1 219 ? 33.046  13.126  -71.403 1.00 31.11  ? 219  ASN C CA    1 
ATOM   4613 C C     . ASN B 1 219 ? 33.343  13.559  -72.839 1.00 34.23  ? 219  ASN C C     1 
ATOM   4614 O O     . ASN B 1 219 ? 34.475  13.920  -73.162 1.00 34.12  ? 219  ASN C O     1 
ATOM   4615 C CB    . ASN B 1 219 ? 33.798  11.830  -71.057 1.00 31.50  ? 219  ASN C CB    1 
ATOM   4616 C CG    . ASN B 1 219 ? 33.782  11.516  -69.558 1.00 32.23  ? 219  ASN C CG    1 
ATOM   4617 O OD1   . ASN B 1 219 ? 34.389  10.542  -69.110 1.00 33.09  ? 219  ASN C OD1   1 
ATOM   4618 N ND2   . ASN B 1 219 ? 33.085  12.336  -68.787 1.00 24.47  ? 219  ASN C ND2   1 
ATOM   4619 N N     . LYS B 1 220 ? 32.326  13.527  -73.692 1.00 34.14  ? 220  LYS C N     1 
ATOM   4620 C CA    . LYS B 1 220 ? 32.477  14.018  -75.062 1.00 41.80  ? 220  LYS C CA    1 
ATOM   4621 C C     . LYS B 1 220 ? 31.750  15.336  -75.259 1.00 39.32  ? 220  LYS C C     1 
ATOM   4622 O O     . LYS B 1 220 ? 31.606  15.811  -76.384 1.00 40.21  ? 220  LYS C O     1 
ATOM   4623 C CB    . LYS B 1 220 ? 31.994  12.981  -76.077 1.00 37.54  ? 220  LYS C CB    1 
ATOM   4624 C CG    . LYS B 1 220 ? 32.928  11.791  -76.186 1.00 40.87  ? 220  LYS C CG    1 
ATOM   4625 C CD    . LYS B 1 220 ? 32.179  10.499  -76.426 1.00 47.43  ? 220  LYS C CD    1 
ATOM   4626 C CE    . LYS B 1 220 ? 31.647  10.402  -77.834 1.00 47.68  ? 220  LYS C CE    1 
ATOM   4627 N NZ    . LYS B 1 220 ? 31.127  9.020   -78.074 1.00 52.01  ? 220  LYS C NZ    1 
ATOM   4628 N N     . GLY B 1 221 ? 31.281  15.908  -74.156 1.00 33.89  ? 221  GLY C N     1 
ATOM   4629 C CA    . GLY B 1 221 ? 30.719  17.245  -74.162 1.00 34.89  ? 221  GLY C CA    1 
ATOM   4630 C C     . GLY B 1 221 ? 29.327  17.396  -74.740 1.00 33.96  ? 221  GLY C C     1 
ATOM   4631 O O     . GLY B 1 221 ? 28.987  18.467  -75.233 1.00 31.04  ? 221  GLY C O     1 
ATOM   4632 N N     . GLU B 1 222 ? 28.514  16.344  -74.668 1.00 34.04  ? 222  GLU C N     1 
ATOM   4633 C CA    . GLU B 1 222 ? 27.173  16.383  -75.253 1.00 29.56  ? 222  GLU C CA    1 
ATOM   4634 C C     . GLU B 1 222 ? 26.140  16.830  -74.242 1.00 28.40  ? 222  GLU C C     1 
ATOM   4635 O O     . GLU B 1 222 ? 25.063  17.296  -74.597 1.00 29.18  ? 222  GLU C O     1 
ATOM   4636 C CB    . GLU B 1 222 ? 26.773  15.004  -75.786 1.00 29.78  ? 222  GLU C CB    1 
ATOM   4637 C CG    . GLU B 1 222 ? 27.746  14.396  -76.765 1.00 30.34  ? 222  GLU C CG    1 
ATOM   4638 C CD    . GLU B 1 222 ? 27.409  12.950  -77.085 1.00 40.66  ? 222  GLU C CD    1 
ATOM   4639 O OE1   . GLU B 1 222 ? 28.286  12.247  -77.624 1.00 43.56  ? 222  GLU C OE1   1 
ATOM   4640 O OE2   . GLU B 1 222 ? 26.271  12.517  -76.795 1.00 42.36  ? 222  GLU C OE2   1 
ATOM   4641 N N     . THR B 1 223 ? 26.457  16.660  -72.968 1.00 29.28  ? 223  THR C N     1 
ATOM   4642 C CA    . THR B 1 223 ? 25.501  16.982  -71.928 1.00 31.16  ? 223  THR C CA    1 
ATOM   4643 C C     . THR B 1 223 ? 26.204  17.807  -70.866 1.00 29.96  ? 223  THR C C     1 
ATOM   4644 O O     . THR B 1 223 ? 27.396  17.621  -70.627 1.00 32.25  ? 223  THR C O     1 
ATOM   4645 C CB    . THR B 1 223 ? 24.875  15.699  -71.339 1.00 29.90  ? 223  THR C CB    1 
ATOM   4646 O OG1   . THR B 1 223 ? 23.715  16.038  -70.572 1.00 33.95  ? 223  THR C OG1   1 
ATOM   4647 C CG2   . THR B 1 223 ? 25.885  14.951  -70.486 1.00 27.16  ? 223  THR C CG2   1 
ATOM   4648 N N     . ALA B 1 224 ? 25.473  18.735  -70.256 1.00 26.88  ? 224  ALA C N     1 
ATOM   4649 C CA    . ALA B 1 224 ? 26.075  19.709  -69.356 1.00 32.27  ? 224  ALA C CA    1 
ATOM   4650 C C     . ALA B 1 224 ? 26.375  19.135  -67.969 1.00 36.29  ? 224  ALA C C     1 
ATOM   4651 O O     . ALA B 1 224 ? 27.264  19.633  -67.276 1.00 34.92  ? 224  ALA C O     1 
ATOM   4652 C CB    . ALA B 1 224 ? 25.192  20.962  -69.242 1.00 25.18  ? 224  ALA C CB    1 
ATOM   4653 N N     . MET B 1 225 ? 25.634  18.101  -67.570 1.00 30.06  ? 225  MET C N     1 
ATOM   4654 C CA    . MET B 1 225 ? 25.788  17.512  -66.235 1.00 32.22  ? 225  MET C CA    1 
ATOM   4655 C C     . MET B 1 225 ? 25.685  15.997  -66.215 1.00 34.32  ? 225  MET C C     1 
ATOM   4656 O O     . MET B 1 225 ? 25.000  15.387  -67.038 1.00 40.00  ? 225  MET C O     1 
ATOM   4657 C CB    . MET B 1 225 ? 24.737  18.059  -65.267 1.00 33.13  ? 225  MET C CB    1 
ATOM   4658 C CG    . MET B 1 225 ? 24.805  19.557  -65.030 1.00 34.13  ? 225  MET C CG    1 
ATOM   4659 S SD    . MET B 1 225 ? 23.386  20.137  -64.074 1.00 30.29  ? 225  MET C SD    1 
ATOM   4660 C CE    . MET B 1 225 ? 22.025  19.681  -65.139 1.00 38.82  ? 225  MET C CE    1 
ATOM   4661 N N     . THR B 1 226 ? 26.374  15.394  -65.256 1.00 28.94  ? 226  THR C N     1 
ATOM   4662 C CA    . THR B 1 226 ? 26.162  13.999  -64.936 1.00 27.02  ? 226  THR C CA    1 
ATOM   4663 C C     . THR B 1 226 ? 26.193  13.854  -63.411 1.00 36.61  ? 226  THR C C     1 
ATOM   4664 O O     . THR B 1 226 ? 26.525  14.805  -62.696 1.00 26.76  ? 226  THR C O     1 
ATOM   4665 C CB    . THR B 1 226 ? 27.217  13.082  -65.594 1.00 27.50  ? 226  THR C CB    1 
ATOM   4666 O OG1   . THR B 1 226 ? 26.810  11.714  -65.471 1.00 30.98  ? 226  THR C OG1   1 
ATOM   4667 C CG2   . THR B 1 226 ? 28.581  13.250  -64.936 1.00 29.56  ? 226  THR C CG2   1 
ATOM   4668 N N     . ILE B 1 227 ? 25.829  12.669  -62.927 1.00 30.88  ? 227  ILE C N     1 
ATOM   4669 C CA    . ILE B 1 227 ? 25.863  12.363  -61.510 1.00 31.49  ? 227  ILE C CA    1 
ATOM   4670 C C     . ILE B 1 227 ? 26.725  11.123  -61.306 1.00 32.15  ? 227  ILE C C     1 
ATOM   4671 O O     . ILE B 1 227 ? 26.409  10.044  -61.802 1.00 28.97  ? 227  ILE C O     1 
ATOM   4672 C CB    . ILE B 1 227 ? 24.451  12.120  -60.962 1.00 31.78  ? 227  ILE C CB    1 
ATOM   4673 C CG1   . ILE B 1 227 ? 23.645  13.418  -60.998 1.00 28.13  ? 227  ILE C CG1   1 
ATOM   4674 C CG2   . ILE B 1 227 ? 24.514  11.565  -59.537 1.00 26.42  ? 227  ILE C CG2   1 
ATOM   4675 C CD1   . ILE B 1 227 ? 22.206  13.256  -60.545 1.00 30.58  ? 227  ILE C CD1   1 
ATOM   4676 N N     . ASN B 1 228 ? 27.833  11.283  -60.598 1.00 30.19  ? 228  ASN C N     1 
ATOM   4677 C CA    . ASN B 1 228 ? 28.771  10.183  -60.445 1.00 30.26  ? 228  ASN C CA    1 
ATOM   4678 C C     . ASN B 1 228 ? 29.680  10.376  -59.238 1.00 33.72  ? 228  ASN C C     1 
ATOM   4679 O O     . ASN B 1 228 ? 29.631  11.419  -58.578 1.00 28.72  ? 228  ASN C O     1 
ATOM   4680 C CB    . ASN B 1 228 ? 29.589  10.002  -61.726 1.00 31.13  ? 228  ASN C CB    1 
ATOM   4681 C CG    . ASN B 1 228 ? 29.757  8.538   -62.105 1.00 35.65  ? 228  ASN C CG    1 
ATOM   4682 O OD1   . ASN B 1 228 ? 29.976  7.689   -61.243 1.00 30.48  ? 228  ASN C OD1   1 
ATOM   4683 N ND2   . ASN B 1 228 ? 29.640  8.235   -63.397 1.00 29.95  ? 228  ASN C ND2   1 
ATOM   4684 N N     . GLY B 1 229 ? 30.500  9.368   -58.947 1.00 30.10  ? 229  GLY C N     1 
ATOM   4685 C CA    . GLY B 1 229 ? 31.376  9.400   -57.789 1.00 29.19  ? 229  GLY C CA    1 
ATOM   4686 C C     . GLY B 1 229 ? 32.826  9.673   -58.127 1.00 36.02  ? 229  GLY C C     1 
ATOM   4687 O O     . GLY B 1 229 ? 33.175  9.890   -59.294 1.00 28.59  ? 229  GLY C O     1 
ATOM   4688 N N     . PRO B 1 230 ? 33.690  9.665   -57.104 1.00 30.58  ? 230  PRO C N     1 
ATOM   4689 C CA    . PRO B 1 230 ? 35.098  10.031  -57.299 1.00 33.66  ? 230  PRO C CA    1 
ATOM   4690 C C     . PRO B 1 230 ? 35.809  9.148   -58.327 1.00 35.75  ? 230  PRO C C     1 
ATOM   4691 O O     . PRO B 1 230 ? 36.729  9.617   -58.999 1.00 35.45  ? 230  PRO C O     1 
ATOM   4692 C CB    . PRO B 1 230 ? 35.708  9.848   -55.908 1.00 30.24  ? 230  PRO C CB    1 
ATOM   4693 C CG    . PRO B 1 230 ? 34.545  10.013  -54.969 1.00 33.99  ? 230  PRO C CG    1 
ATOM   4694 C CD    . PRO B 1 230 ? 33.370  9.415   -55.692 1.00 30.48  ? 230  PRO C CD    1 
ATOM   4695 N N     . TRP B 1 231 ? 35.385  7.896   -58.448 1.00 34.12  ? 231  TRP C N     1 
ATOM   4696 C CA    . TRP B 1 231 ? 36.009  6.976   -59.388 1.00 37.53  ? 231  TRP C CA    1 
ATOM   4697 C C     . TRP B 1 231 ? 35.952  7.511   -60.829 1.00 34.71  ? 231  TRP C C     1 
ATOM   4698 O O     . TRP B 1 231 ? 36.833  7.232   -61.636 1.00 32.31  ? 231  TRP C O     1 
ATOM   4699 C CB    . TRP B 1 231 ? 35.354  5.595   -59.299 1.00 28.89  ? 231  TRP C CB    1 
ATOM   4700 C CG    . TRP B 1 231 ? 33.871  5.646   -59.459 1.00 28.53  ? 231  TRP C CG    1 
ATOM   4701 C CD1   . TRP B 1 231 ? 33.169  5.595   -60.628 1.00 26.98  ? 231  TRP C CD1   1 
ATOM   4702 C CD2   . TRP B 1 231 ? 32.900  5.778   -58.411 1.00 34.49  ? 231  TRP C CD2   1 
ATOM   4703 N NE1   . TRP B 1 231 ? 31.818  5.686   -60.373 1.00 30.83  ? 231  TRP C NE1   1 
ATOM   4704 C CE2   . TRP B 1 231 ? 31.627  5.798   -59.020 1.00 32.29  ? 231  TRP C CE2   1 
ATOM   4705 C CE3   . TRP B 1 231 ? 32.984  5.866   -57.016 1.00 30.90  ? 231  TRP C CE3   1 
ATOM   4706 C CZ2   . TRP B 1 231 ? 30.450  5.910   -58.285 1.00 30.40  ? 231  TRP C CZ2   1 
ATOM   4707 C CZ3   . TRP B 1 231 ? 31.812  5.976   -56.289 1.00 27.50  ? 231  TRP C CZ3   1 
ATOM   4708 C CH2   . TRP B 1 231 ? 30.564  5.996   -56.922 1.00 25.45  ? 231  TRP C CH2   1 
ATOM   4709 N N     . ALA B 1 232 ? 34.924  8.301   -61.125 1.00 28.36  ? 232  ALA C N     1 
ATOM   4710 C CA    . ALA B 1 232 ? 34.647  8.761   -62.484 1.00 31.95  ? 232  ALA C CA    1 
ATOM   4711 C C     . ALA B 1 232 ? 35.525  9.917   -62.947 1.00 33.65  ? 232  ALA C C     1 
ATOM   4712 O O     . ALA B 1 232 ? 35.614  10.189  -64.137 1.00 36.50  ? 232  ALA C O     1 
ATOM   4713 C CB    . ALA B 1 232 ? 33.173  9.140   -62.628 1.00 29.29  ? 232  ALA C CB    1 
ATOM   4714 N N     . TRP B 1 233 ? 36.169  10.597  -62.010 1.00 34.40  ? 233  TRP C N     1 
ATOM   4715 C CA    . TRP B 1 233 ? 36.883  11.826  -62.336 1.00 33.98  ? 233  TRP C CA    1 
ATOM   4716 C C     . TRP B 1 233 ? 38.058  11.595  -63.277 1.00 33.35  ? 233  TRP C C     1 
ATOM   4717 O O     . TRP B 1 233 ? 38.398  12.461  -64.074 1.00 36.68  ? 233  TRP C O     1 
ATOM   4718 C CB    . TRP B 1 233 ? 37.388  12.511  -61.069 1.00 25.20  ? 233  TRP C CB    1 
ATOM   4719 C CG    . TRP B 1 233 ? 36.312  12.848  -60.072 1.00 33.82  ? 233  TRP C CG    1 
ATOM   4720 C CD1   . TRP B 1 233 ? 34.980  13.032  -60.320 1.00 29.26  ? 233  TRP C CD1   1 
ATOM   4721 C CD2   . TRP B 1 233 ? 36.489  13.039  -58.661 1.00 27.09  ? 233  TRP C CD2   1 
ATOM   4722 N NE1   . TRP B 1 233 ? 34.321  13.328  -59.146 1.00 29.71  ? 233  TRP C NE1   1 
ATOM   4723 C CE2   . TRP B 1 233 ? 35.226  13.338  -58.116 1.00 27.85  ? 233  TRP C CE2   1 
ATOM   4724 C CE3   . TRP B 1 233 ? 37.596  12.978  -57.806 1.00 31.11  ? 233  TRP C CE3   1 
ATOM   4725 C CZ2   . TRP B 1 233 ? 35.037  13.577  -56.753 1.00 28.19  ? 233  TRP C CZ2   1 
ATOM   4726 C CZ3   . TRP B 1 233 ? 37.405  13.213  -56.444 1.00 25.67  ? 233  TRP C CZ3   1 
ATOM   4727 C CH2   . TRP B 1 233 ? 36.138  13.514  -55.938 1.00 26.57  ? 233  TRP C CH2   1 
ATOM   4728 N N     . SER B 1 234 ? 38.693  10.438  -63.159 1.00 29.55  ? 234  SER C N     1 
ATOM   4729 C CA    . SER B 1 234 ? 39.902  10.145  -63.921 1.00 35.93  ? 234  SER C CA    1 
ATOM   4730 C C     . SER B 1 234 ? 39.649  10.148  -65.433 1.00 32.57  ? 234  SER C C     1 
ATOM   4731 O O     . SER B 1 234 ? 40.445  10.679  -66.207 1.00 30.96  ? 234  SER C O     1 
ATOM   4732 C CB    . SER B 1 234 ? 40.485  8.800   -63.483 1.00 43.24  ? 234  SER C CB    1 
ATOM   4733 O OG    . SER B 1 234 ? 41.760  8.592   -64.063 1.00 57.41  ? 234  SER C OG    1 
ATOM   4734 N N     . ASN B 1 235 ? 38.539  9.550   -65.846 1.00 31.92  ? 235  ASN C N     1 
ATOM   4735 C CA    . ASN B 1 235 ? 38.178  9.524   -67.253 1.00 34.51  ? 235  ASN C CA    1 
ATOM   4736 C C     . ASN B 1 235 ? 37.798  10.907  -67.747 1.00 41.68  ? 235  ASN C C     1 
ATOM   4737 O O     . ASN B 1 235 ? 37.979  11.221  -68.924 1.00 39.06  ? 235  ASN C O     1 
ATOM   4738 C CB    . ASN B 1 235 ? 37.060  8.516   -67.526 1.00 29.97  ? 235  ASN C CB    1 
ATOM   4739 C CG    . ASN B 1 235 ? 37.537  7.080   -67.410 1.00 31.02  ? 235  ASN C CG    1 
ATOM   4740 O OD1   . ASN B 1 235 ? 38.736  6.814   -67.387 1.00 32.97  ? 235  ASN C OD1   1 
ATOM   4741 N ND2   . ASN B 1 235 ? 36.599  6.149   -67.330 1.00 29.52  ? 235  ASN C ND2   1 
ATOM   4742 N N     . ILE B 1 236 ? 37.282  11.739  -66.847 1.00 34.90  ? 236  ILE C N     1 
ATOM   4743 C CA    . ILE B 1 236 ? 36.984  13.115  -67.214 1.00 36.20  ? 236  ILE C CA    1 
ATOM   4744 C C     . ILE B 1 236 ? 38.280  13.913  -67.355 1.00 39.79  ? 236  ILE C C     1 
ATOM   4745 O O     . ILE B 1 236 ? 38.426  14.699  -68.296 1.00 34.59  ? 236  ILE C O     1 
ATOM   4746 C CB    . ILE B 1 236 ? 36.022  13.794  -66.222 1.00 32.30  ? 236  ILE C CB    1 
ATOM   4747 C CG1   . ILE B 1 236 ? 34.879  12.846  -65.856 1.00 28.27  ? 236  ILE C CG1   1 
ATOM   4748 C CG2   . ILE B 1 236 ? 35.459  15.078  -66.811 1.00 30.21  ? 236  ILE C CG2   1 
ATOM   4749 C CD1   . ILE B 1 236 ? 33.898  13.444  -64.865 1.00 25.38  ? 236  ILE C CD1   1 
ATOM   4750 N N     . ASP B 1 237 ? 39.225  13.709  -66.435 1.00 30.04  ? 237  ASP C N     1 
ATOM   4751 C CA    . ASP B 1 237 ? 40.547  14.305  -66.602 1.00 37.29  ? 237  ASP C CA    1 
ATOM   4752 C C     . ASP B 1 237 ? 41.071  14.014  -68.021 1.00 46.14  ? 237  ASP C C     1 
ATOM   4753 O O     . ASP B 1 237 ? 41.576  14.902  -68.699 1.00 39.41  ? 237  ASP C O     1 
ATOM   4754 C CB    . ASP B 1 237 ? 41.548  13.758  -65.586 1.00 41.83  ? 237  ASP C CB    1 
ATOM   4755 C CG    . ASP B 1 237 ? 41.279  14.231  -64.157 1.00 45.58  ? 237  ASP C CG    1 
ATOM   4756 O OD1   . ASP B 1 237 ? 40.477  15.167  -63.941 1.00 38.98  ? 237  ASP C OD1   1 
ATOM   4757 O OD2   . ASP B 1 237 ? 41.899  13.655  -63.243 1.00 40.20  ? 237  ASP C OD2   1 
ATOM   4758 N N     . THR B 1 238 ? 40.947  12.762  -68.453 1.00 41.48  ? 238  THR C N     1 
ATOM   4759 C CA    . THR B 1 238 ? 41.455  12.334  -69.754 1.00 43.81  ? 238  THR C CA    1 
ATOM   4760 C C     . THR B 1 238 ? 40.721  13.015  -70.912 1.00 46.24  ? 238  THR C C     1 
ATOM   4761 O O     . THR B 1 238 ? 41.306  13.270  -71.956 1.00 43.61  ? 238  THR C O     1 
ATOM   4762 C CB    . THR B 1 238 ? 41.351  10.800  -69.918 1.00 46.98  ? 238  THR C CB    1 
ATOM   4763 O OG1   . THR B 1 238 ? 42.241  10.153  -69.000 1.00 46.05  ? 238  THR C OG1   1 
ATOM   4764 C CG2   . THR B 1 238 ? 41.715  10.373  -71.337 1.00 52.05  ? 238  THR C CG2   1 
ATOM   4765 N N     . SER B 1 239 ? 39.443  13.316  -70.708 1.00 45.89  ? 239  SER C N     1 
ATOM   4766 C CA    . SER B 1 239 ? 38.594  13.898  -71.741 1.00 35.57  ? 239  SER C CA    1 
ATOM   4767 C C     . SER B 1 239 ? 38.898  15.376  -71.971 1.00 41.74  ? 239  SER C C     1 
ATOM   4768 O O     . SER B 1 239 ? 38.465  15.970  -72.965 1.00 41.62  ? 239  SER C O     1 
ATOM   4769 C CB    . SER B 1 239 ? 37.125  13.758  -71.345 1.00 34.17  ? 239  SER C CB    1 
ATOM   4770 O OG    . SER B 1 239 ? 36.750  14.819  -70.475 1.00 40.07  ? 239  SER C OG    1 
ATOM   4771 N N     . LYS B 1 240 ? 39.624  15.974  -71.037 1.00 37.70  ? 240  LYS C N     1 
ATOM   4772 C CA    . LYS B 1 240 ? 39.937  17.395  -71.114 1.00 56.68  ? 240  LYS C CA    1 
ATOM   4773 C C     . LYS B 1 240 ? 38.688  18.290  -71.057 1.00 57.24  ? 240  LYS C C     1 
ATOM   4774 O O     . LYS B 1 240 ? 38.753  19.484  -71.359 1.00 53.52  ? 240  LYS C O     1 
ATOM   4775 C CB    . LYS B 1 240 ? 40.750  17.700  -72.379 1.00 70.44  ? 240  LYS C CB    1 
ATOM   4776 C CG    . LYS B 1 240 ? 41.932  16.762  -72.605 1.00 81.90  ? 240  LYS C CG    1 
ATOM   4777 C CD    . LYS B 1 240 ? 42.783  16.610  -71.350 1.00 92.24  ? 240  LYS C CD    1 
ATOM   4778 C CE    . LYS B 1 240 ? 43.871  15.560  -71.545 1.00 99.75  ? 240  LYS C CE    1 
ATOM   4779 N NZ    . LYS B 1 240 ? 44.595  15.234  -70.281 1.00 101.39 ? 240  LYS C NZ    1 
ATOM   4780 N N     . VAL B 1 241 ? 37.547  17.721  -70.683 1.00 48.81  ? 241  VAL C N     1 
ATOM   4781 C CA    . VAL B 1 241 ? 36.375  18.547  -70.430 1.00 45.33  ? 241  VAL C CA    1 
ATOM   4782 C C     . VAL B 1 241 ? 36.653  19.401  -69.195 1.00 43.80  ? 241  VAL C C     1 
ATOM   4783 O O     . VAL B 1 241 ? 37.218  18.921  -68.213 1.00 44.37  ? 241  VAL C O     1 
ATOM   4784 C CB    . VAL B 1 241 ? 35.101  17.699  -70.219 1.00 44.42  ? 241  VAL C CB    1 
ATOM   4785 C CG1   . VAL B 1 241 ? 34.006  18.520  -69.548 1.00 35.77  ? 241  VAL C CG1   1 
ATOM   4786 C CG2   . VAL B 1 241 ? 34.616  17.131  -71.547 1.00 40.69  ? 241  VAL C CG2   1 
ATOM   4787 N N     . ASN B 1 242 ? 36.286  20.672  -69.260 1.00 40.01  ? 242  ASN C N     1 
ATOM   4788 C CA    . ASN B 1 242 ? 36.437  21.569  -68.123 1.00 41.48  ? 242  ASN C CA    1 
ATOM   4789 C C     . ASN B 1 242 ? 35.285  21.358  -67.137 1.00 37.75  ? 242  ASN C C     1 
ATOM   4790 O O     . ASN B 1 242 ? 34.201  21.924  -67.303 1.00 37.91  ? 242  ASN C O     1 
ATOM   4791 C CB    . ASN B 1 242 ? 36.505  23.025  -68.607 1.00 43.72  ? 242  ASN C CB    1 
ATOM   4792 C CG    . ASN B 1 242 ? 36.673  24.024  -67.465 1.00 63.34  ? 242  ASN C CG    1 
ATOM   4793 O OD1   . ASN B 1 242 ? 36.985  23.648  -66.333 1.00 70.27  ? 242  ASN C OD1   1 
ATOM   4794 N ND2   . ASN B 1 242 ? 36.473  25.308  -67.766 1.00 61.44  ? 242  ASN C ND2   1 
ATOM   4795 N N     . TYR B 1 243 ? 35.518  20.530  -66.121 1.00 33.01  ? 243  TYR C N     1 
ATOM   4796 C CA    . TYR B 1 243 ? 34.449  20.155  -65.190 1.00 32.81  ? 243  TYR C CA    1 
ATOM   4797 C C     . TYR B 1 243 ? 34.653  20.628  -63.768 1.00 32.86  ? 243  TYR C C     1 
ATOM   4798 O O     . TYR B 1 243 ? 35.781  20.793  -63.298 1.00 27.38  ? 243  TYR C O     1 
ATOM   4799 C CB    . TYR B 1 243 ? 34.250  18.639  -65.161 1.00 31.32  ? 243  TYR C CB    1 
ATOM   4800 C CG    . TYR B 1 243 ? 35.339  17.870  -64.453 1.00 31.72  ? 243  TYR C CG    1 
ATOM   4801 C CD1   . TYR B 1 243 ? 36.561  17.637  -65.066 1.00 28.93  ? 243  TYR C CD1   1 
ATOM   4802 C CD2   . TYR B 1 243 ? 35.135  17.351  -63.176 1.00 33.17  ? 243  TYR C CD2   1 
ATOM   4803 C CE1   . TYR B 1 243 ? 37.558  16.916  -64.434 1.00 26.31  ? 243  TYR C CE1   1 
ATOM   4804 C CE2   . TYR B 1 243 ? 36.125  16.630  -62.530 1.00 31.73  ? 243  TYR C CE2   1 
ATOM   4805 C CZ    . TYR B 1 243 ? 37.334  16.412  -63.161 1.00 36.63  ? 243  TYR C CZ    1 
ATOM   4806 O OH    . TYR B 1 243 ? 38.321  15.690  -62.522 1.00 31.47  ? 243  TYR C OH    1 
ATOM   4807 N N     . GLY B 1 244 ? 33.532  20.835  -63.091 1.00 35.53  ? 244  GLY C N     1 
ATOM   4808 C CA    . GLY B 1 244 ? 33.522  21.132  -61.675 1.00 34.43  ? 244  GLY C CA    1 
ATOM   4809 C C     . GLY B 1 244 ? 32.773  20.023  -60.956 1.00 39.17  ? 244  GLY C C     1 
ATOM   4810 O O     . GLY B 1 244 ? 32.020  19.269  -61.579 1.00 40.27  ? 244  GLY C O     1 
ATOM   4811 N N     . VAL B 1 245 ? 32.990  19.912  -59.652 1.00 38.06  ? 245  VAL C N     1 
ATOM   4812 C CA    . VAL B 1 245 ? 32.270  18.947  -58.837 1.00 34.93  ? 245  VAL C CA    1 
ATOM   4813 C C     . VAL B 1 245 ? 31.627  19.694  -57.676 1.00 38.12  ? 245  VAL C C     1 
ATOM   4814 O O     . VAL B 1 245 ? 32.300  20.381  -56.915 1.00 32.54  ? 245  VAL C O     1 
ATOM   4815 C CB    . VAL B 1 245 ? 33.199  17.857  -58.312 1.00 29.19  ? 245  VAL C CB    1 
ATOM   4816 C CG1   . VAL B 1 245 ? 32.399  16.792  -57.595 1.00 28.05  ? 245  VAL C CG1   1 
ATOM   4817 C CG2   . VAL B 1 245 ? 33.994  17.243  -59.462 1.00 25.98  ? 245  VAL C CG2   1 
ATOM   4818 N N     . THR B 1 246 ? 30.315  19.575  -57.546 1.00 30.71  ? 246  THR C N     1 
ATOM   4819 C CA    . THR B 1 246 ? 29.613  20.425  -56.614 1.00 32.90  ? 246  THR C CA    1 
ATOM   4820 C C     . THR B 1 246 ? 28.465  19.687  -55.923 1.00 40.97  ? 246  THR C C     1 
ATOM   4821 O O     . THR B 1 246 ? 28.226  18.494  -56.166 1.00 34.53  ? 246  THR C O     1 
ATOM   4822 C CB    . THR B 1 246 ? 29.120  21.709  -57.319 1.00 35.09  ? 246  THR C CB    1 
ATOM   4823 O OG1   . THR B 1 246 ? 28.689  22.668  -56.347 1.00 38.26  ? 246  THR C OG1   1 
ATOM   4824 C CG2   . THR B 1 246 ? 27.984  21.402  -58.295 1.00 31.85  ? 246  THR C CG2   1 
ATOM   4825 N N     . VAL B 1 247 ? 27.781  20.404  -55.040 1.00 36.57  ? 247  VAL C N     1 
ATOM   4826 C CA    . VAL B 1 247 ? 26.679  19.854  -54.269 1.00 34.27  ? 247  VAL C CA    1 
ATOM   4827 C C     . VAL B 1 247 ? 25.535  19.497  -55.212 1.00 35.86  ? 247  VAL C C     1 
ATOM   4828 O O     . VAL B 1 247 ? 25.306  20.190  -56.211 1.00 35.90  ? 247  VAL C O     1 
ATOM   4829 C CB    . VAL B 1 247 ? 26.196  20.875  -53.198 1.00 42.49  ? 247  VAL C CB    1 
ATOM   4830 C CG1   . VAL B 1 247 ? 25.693  22.169  -53.866 1.00 33.70  ? 247  VAL C CG1   1 
ATOM   4831 C CG2   . VAL B 1 247 ? 25.125  20.271  -52.306 1.00 41.21  ? 247  VAL C CG2   1 
ATOM   4832 N N     . LEU B 1 248 ? 24.833  18.411  -54.904 1.00 36.49  ? 248  LEU C N     1 
ATOM   4833 C CA    . LEU B 1 248 ? 23.682  17.986  -55.694 1.00 37.38  ? 248  LEU C CA    1 
ATOM   4834 C C     . LEU B 1 248 ? 22.558  19.015  -55.606 1.00 39.00  ? 248  LEU C C     1 
ATOM   4835 O O     . LEU B 1 248 ? 22.464  19.754  -54.630 1.00 41.85  ? 248  LEU C O     1 
ATOM   4836 C CB    . LEU B 1 248 ? 23.192  16.616  -55.225 1.00 40.13  ? 248  LEU C CB    1 
ATOM   4837 C CG    . LEU B 1 248 ? 24.043  15.413  -55.633 1.00 35.83  ? 248  LEU C CG    1 
ATOM   4838 C CD1   . LEU B 1 248 ? 23.734  14.214  -54.764 1.00 30.99  ? 248  LEU C CD1   1 
ATOM   4839 C CD2   . LEU B 1 248 ? 23.838  15.082  -57.107 1.00 26.96  ? 248  LEU C CD2   1 
ATOM   4840 N N     . PRO B 1 249 ? 21.699  19.069  -56.630 1.00 41.86  ? 249  PRO C N     1 
ATOM   4841 C CA    . PRO B 1 249 ? 20.637  20.080  -56.622 1.00 37.30  ? 249  PRO C CA    1 
ATOM   4842 C C     . PRO B 1 249 ? 19.617  19.739  -55.546 1.00 40.96  ? 249  PRO C C     1 
ATOM   4843 O O     . PRO B 1 249 ? 19.511  18.570  -55.184 1.00 38.99  ? 249  PRO C O     1 
ATOM   4844 C CB    . PRO B 1 249 ? 20.008  19.942  -58.011 1.00 33.85  ? 249  PRO C CB    1 
ATOM   4845 C CG    . PRO B 1 249 ? 20.993  19.109  -58.823 1.00 33.53  ? 249  PRO C CG    1 
ATOM   4846 C CD    . PRO B 1 249 ? 21.647  18.217  -57.828 1.00 31.63  ? 249  PRO C CD    1 
ATOM   4847 N N     . THR B 1 250 ? 18.890  20.732  -55.040 1.00 42.70  ? 250  THR C N     1 
ATOM   4848 C CA    . THR B 1 250 ? 17.883  20.485  -54.013 1.00 42.01  ? 250  THR C CA    1 
ATOM   4849 C C     . THR B 1 250 ? 16.584  20.083  -54.674 1.00 43.60  ? 250  THR C C     1 
ATOM   4850 O O     . THR B 1 250 ? 16.333  20.425  -55.826 1.00 42.29  ? 250  THR C O     1 
ATOM   4851 C CB    . THR B 1 250 ? 17.595  21.739  -53.141 1.00 38.79  ? 250  THR C CB    1 
ATOM   4852 O OG1   . THR B 1 250 ? 17.174  22.820  -53.978 1.00 35.77  ? 250  THR C OG1   1 
ATOM   4853 C CG2   . THR B 1 250 ? 18.824  22.166  -52.359 1.00 42.34  ? 250  THR C CG2   1 
ATOM   4854 N N     . PHE B 1 251 ? 15.753  19.363  -53.936 1.00 45.92  ? 251  PHE C N     1 
ATOM   4855 C CA    . PHE B 1 251 ? 14.419  19.042  -54.406 1.00 49.30  ? 251  PHE C CA    1 
ATOM   4856 C C     . PHE B 1 251 ? 13.401  19.484  -53.359 1.00 46.91  ? 251  PHE C C     1 
ATOM   4857 O O     . PHE B 1 251 ? 13.575  19.223  -52.174 1.00 50.75  ? 251  PHE C O     1 
ATOM   4858 C CB    . PHE B 1 251 ? 14.309  17.549  -54.681 1.00 47.68  ? 251  PHE C CB    1 
ATOM   4859 C CG    . PHE B 1 251 ? 12.971  17.128  -55.188 1.00 48.08  ? 251  PHE C CG    1 
ATOM   4860 C CD1   . PHE B 1 251 ? 12.444  17.695  -56.331 1.00 48.02  ? 251  PHE C CD1   1 
ATOM   4861 C CD2   . PHE B 1 251 ? 12.244  16.150  -54.529 1.00 47.31  ? 251  PHE C CD2   1 
ATOM   4862 C CE1   . PHE B 1 251 ? 11.212  17.303  -56.801 1.00 50.91  ? 251  PHE C CE1   1 
ATOM   4863 C CE2   . PHE B 1 251 ? 11.013  15.753  -54.993 1.00 43.95  ? 251  PHE C CE2   1 
ATOM   4864 C CZ    . PHE B 1 251 ? 10.493  16.327  -56.127 1.00 46.84  ? 251  PHE C CZ    1 
ATOM   4865 N N     . LYS B 1 252 ? 12.348  20.164  -53.799 1.00 52.54  ? 252  LYS C N     1 
ATOM   4866 C CA    . LYS B 1 252 ? 11.390  20.775  -52.884 1.00 52.68  ? 252  LYS C CA    1 
ATOM   4867 C C     . LYS B 1 252 ? 12.084  21.512  -51.737 1.00 49.95  ? 252  LYS C C     1 
ATOM   4868 O O     . LYS B 1 252 ? 11.647  21.424  -50.599 1.00 46.50  ? 252  LYS C O     1 
ATOM   4869 C CB    . LYS B 1 252 ? 10.444  19.728  -52.296 1.00 55.39  ? 252  LYS C CB    1 
ATOM   4870 C CG    . LYS B 1 252 ? 9.425   19.142  -53.259 1.00 63.17  ? 252  LYS C CG    1 
ATOM   4871 C CD    . LYS B 1 252 ? 8.409   18.313  -52.472 1.00 76.50  ? 252  LYS C CD    1 
ATOM   4872 C CE    . LYS B 1 252 ? 7.492   17.487  -53.365 1.00 86.74  ? 252  LYS C CE    1 
ATOM   4873 N NZ    . LYS B 1 252 ? 6.469   18.306  -54.073 1.00 90.85  ? 252  LYS C NZ    1 
ATOM   4874 N N     . GLY B 1 253 ? 13.166  22.226  -52.035 1.00 47.86  ? 253  GLY C N     1 
ATOM   4875 C CA    . GLY B 1 253 ? 13.895  22.972  -51.020 1.00 47.81  ? 253  GLY C CA    1 
ATOM   4876 C C     . GLY B 1 253 ? 14.780  22.115  -50.129 1.00 52.05  ? 253  GLY C C     1 
ATOM   4877 O O     . GLY B 1 253 ? 15.559  22.632  -49.318 1.00 49.42  ? 253  GLY C O     1 
ATOM   4878 N N     . GLN B 1 254 ? 14.658  20.800  -50.285 1.00 51.80  ? 254  GLN C N     1 
ATOM   4879 C CA    . GLN B 1 254 ? 15.420  19.834  -49.502 1.00 49.57  ? 254  GLN C CA    1 
ATOM   4880 C C     . GLN B 1 254 ? 16.649  19.368  -50.270 1.00 54.13  ? 254  GLN C C     1 
ATOM   4881 O O     . GLN B 1 254 ? 16.589  19.182  -51.483 1.00 45.80  ? 254  GLN C O     1 
ATOM   4882 C CB    . GLN B 1 254 ? 14.558  18.608  -49.206 1.00 50.65  ? 254  GLN C CB    1 
ATOM   4883 C CG    . GLN B 1 254 ? 13.111  18.910  -48.899 1.00 56.80  ? 254  GLN C CG    1 
ATOM   4884 C CD    . GLN B 1 254 ? 12.958  19.702  -47.629 1.00 74.94  ? 254  GLN C CD    1 
ATOM   4885 O OE1   . GLN B 1 254 ? 13.910  19.855  -46.860 1.00 76.09  ? 254  GLN C OE1   1 
ATOM   4886 N NE2   . GLN B 1 254 ? 11.758  20.223  -47.400 1.00 87.14  ? 254  GLN C NE2   1 
ATOM   4887 N N     . PRO B 1 255 ? 17.759  19.135  -49.557 1.00 60.35  ? 255  PRO C N     1 
ATOM   4888 C CA    . PRO B 1 255 ? 18.980  18.660  -50.212 1.00 50.50  ? 255  PRO C CA    1 
ATOM   4889 C C     . PRO B 1 255 ? 18.776  17.265  -50.783 1.00 49.05  ? 255  PRO C C     1 
ATOM   4890 O O     . PRO B 1 255 ? 18.033  16.482  -50.200 1.00 53.19  ? 255  PRO C O     1 
ATOM   4891 C CB    . PRO B 1 255 ? 19.997  18.590  -49.066 1.00 54.52  ? 255  PRO C CB    1 
ATOM   4892 C CG    . PRO B 1 255 ? 19.354  19.282  -47.895 1.00 63.32  ? 255  PRO C CG    1 
ATOM   4893 C CD    . PRO B 1 255 ? 17.884  19.150  -48.091 1.00 63.23  ? 255  PRO C CD    1 
ATOM   4894 N N     . SER B 1 256 ? 19.414  16.971  -51.913 1.00 42.61  ? 256  SER C N     1 
ATOM   4895 C CA    . SER B 1 256 ? 19.507  15.601  -52.404 1.00 40.92  ? 256  SER C CA    1 
ATOM   4896 C C     . SER B 1 256 ? 20.237  14.771  -51.362 1.00 38.37  ? 256  SER C C     1 
ATOM   4897 O O     . SER B 1 256 ? 21.162  15.263  -50.707 1.00 33.13  ? 256  SER C O     1 
ATOM   4898 C CB    . SER B 1 256 ? 20.268  15.551  -53.733 1.00 36.98  ? 256  SER C CB    1 
ATOM   4899 O OG    . SER B 1 256 ? 19.413  15.848  -54.823 1.00 39.94  ? 256  SER C OG    1 
ATOM   4900 N N     . LYS B 1 257 ? 19.829  13.515  -51.208 1.00 40.82  ? 257  LYS C N     1 
ATOM   4901 C CA    . LYS B 1 257 ? 20.394  12.665  -50.162 1.00 44.68  ? 257  LYS C CA    1 
ATOM   4902 C C     . LYS B 1 257 ? 21.024  11.399  -50.725 1.00 43.61  ? 257  LYS C C     1 
ATOM   4903 O O     . LYS B 1 257 ? 20.395  10.347  -50.762 1.00 39.93  ? 257  LYS C O     1 
ATOM   4904 C CB    . LYS B 1 257 ? 19.336  12.312  -49.115 1.00 41.10  ? 257  LYS C CB    1 
ATOM   4905 C CG    . LYS B 1 257 ? 18.770  13.525  -48.386 1.00 57.10  ? 257  LYS C CG    1 
ATOM   4906 C CD    . LYS B 1 257 ? 18.662  13.294  -46.880 1.00 63.32  ? 257  LYS C CD    1 
ATOM   4907 C CE    . LYS B 1 257 ? 17.669  12.197  -46.545 1.00 69.56  ? 257  LYS C CE    1 
ATOM   4908 N NZ    . LYS B 1 257 ? 17.437  12.079  -45.078 1.00 67.94  ? 257  LYS C NZ    1 
ATOM   4909 N N     . PRO B 1 258 ? 22.277  11.502  -51.173 1.00 45.60  ? 258  PRO C N     1 
ATOM   4910 C CA    . PRO B 1 258 ? 22.949  10.327  -51.726 1.00 43.40  ? 258  PRO C CA    1 
ATOM   4911 C C     . PRO B 1 258 ? 23.315  9.345   -50.616 1.00 45.80  ? 258  PRO C C     1 
ATOM   4912 O O     . PRO B 1 258 ? 23.715  9.765   -49.530 1.00 42.85  ? 258  PRO C O     1 
ATOM   4913 C CB    . PRO B 1 258 ? 24.219  10.920  -52.335 1.00 32.41  ? 258  PRO C CB    1 
ATOM   4914 C CG    . PRO B 1 258 ? 24.511  12.104  -51.480 1.00 36.09  ? 258  PRO C CG    1 
ATOM   4915 C CD    . PRO B 1 258 ? 23.160  12.682  -51.135 1.00 39.78  ? 258  PRO C CD    1 
ATOM   4916 N N     . PHE B 1 259 ? 23.163  8.053   -50.885 1.00 37.16  ? 259  PHE C N     1 
ATOM   4917 C CA    . PHE B 1 259 ? 23.659  7.029   -49.984 1.00 43.24  ? 259  PHE C CA    1 
ATOM   4918 C C     . PHE B 1 259 ? 25.159  7.179   -49.804 1.00 42.98  ? 259  PHE C C     1 
ATOM   4919 O O     . PHE B 1 259 ? 25.880  7.408   -50.767 1.00 56.24  ? 259  PHE C O     1 
ATOM   4920 C CB    . PHE B 1 259 ? 23.339  5.646   -50.540 1.00 49.09  ? 259  PHE C CB    1 
ATOM   4921 C CG    . PHE B 1 259 ? 22.069  5.066   -50.004 1.00 57.73  ? 259  PHE C CG    1 
ATOM   4922 C CD1   . PHE B 1 259 ? 21.815  5.073   -48.642 1.00 60.87  ? 259  PHE C CD1   1 
ATOM   4923 C CD2   . PHE B 1 259 ? 21.121  4.534   -50.857 1.00 61.41  ? 259  PHE C CD2   1 
ATOM   4924 C CE1   . PHE B 1 259 ? 20.643  4.540   -48.138 1.00 70.07  ? 259  PHE C CE1   1 
ATOM   4925 C CE2   . PHE B 1 259 ? 19.945  4.004   -50.360 1.00 63.62  ? 259  PHE C CE2   1 
ATOM   4926 C CZ    . PHE B 1 259 ? 19.705  4.004   -49.000 1.00 66.28  ? 259  PHE C CZ    1 
ATOM   4927 N N     . VAL B 1 260 ? 25.630  7.071   -48.570 1.00 36.13  ? 260  VAL C N     1 
ATOM   4928 C CA    . VAL B 1 260 ? 27.059  7.130   -48.314 1.00 36.17  ? 260  VAL C CA    1 
ATOM   4929 C C     . VAL B 1 260 ? 27.605  5.713   -48.236 1.00 44.81  ? 260  VAL C C     1 
ATOM   4930 O O     . VAL B 1 260 ? 27.123  4.893   -47.457 1.00 44.96  ? 260  VAL C O     1 
ATOM   4931 C CB    . VAL B 1 260 ? 27.379  7.885   -47.011 1.00 37.17  ? 260  VAL C CB    1 
ATOM   4932 C CG1   . VAL B 1 260 ? 28.883  7.929   -46.771 1.00 38.05  ? 260  VAL C CG1   1 
ATOM   4933 C CG2   . VAL B 1 260 ? 26.808  9.285   -47.065 1.00 41.36  ? 260  VAL C CG2   1 
ATOM   4934 N N     . GLY B 1 261 ? 28.607  5.421   -49.053 1.00 39.71  ? 261  GLY C N     1 
ATOM   4935 C CA    . GLY B 1 261 ? 29.169  4.088   -49.092 1.00 36.81  ? 261  GLY C CA    1 
ATOM   4936 C C     . GLY B 1 261 ? 30.604  4.082   -48.626 1.00 41.16  ? 261  GLY C C     1 
ATOM   4937 O O     . GLY B 1 261 ? 31.344  5.026   -48.878 1.00 45.46  ? 261  GLY C O     1 
ATOM   4938 N N     . VAL B 1 262 ? 31.003  3.026   -47.929 1.00 33.30  ? 262  VAL C N     1 
ATOM   4939 C CA    . VAL B 1 262 ? 32.394  2.893   -47.543 1.00 39.10  ? 262  VAL C CA    1 
ATOM   4940 C C     . VAL B 1 262 ? 33.018  1.709   -48.275 1.00 44.14  ? 262  VAL C C     1 
ATOM   4941 O O     . VAL B 1 262 ? 32.770  0.548   -47.929 1.00 42.06  ? 262  VAL C O     1 
ATOM   4942 C CB    . VAL B 1 262 ? 32.549  2.718   -46.026 1.00 35.02  ? 262  VAL C CB    1 
ATOM   4943 C CG1   . VAL B 1 262 ? 34.025  2.698   -45.651 1.00 33.43  ? 262  VAL C CG1   1 
ATOM   4944 C CG2   . VAL B 1 262 ? 31.810  3.832   -45.291 1.00 28.16  ? 262  VAL C CG2   1 
ATOM   4945 N N     . LEU B 1 263 ? 33.800  2.002   -49.309 1.00 43.71  ? 263  LEU C N     1 
ATOM   4946 C CA    . LEU B 1 263 ? 34.499  0.954   -50.032 1.00 39.14  ? 263  LEU C CA    1 
ATOM   4947 C C     . LEU B 1 263 ? 35.313  0.169   -49.020 1.00 42.59  ? 263  LEU C C     1 
ATOM   4948 O O     . LEU B 1 263 ? 36.109  0.748   -48.279 1.00 38.75  ? 263  LEU C O     1 
ATOM   4949 C CB    . LEU B 1 263 ? 35.418  1.540   -51.100 1.00 34.68  ? 263  LEU C CB    1 
ATOM   4950 C CG    . LEU B 1 263 ? 36.177  0.505   -51.936 1.00 41.65  ? 263  LEU C CG    1 
ATOM   4951 C CD1   . LEU B 1 263 ? 35.220  -0.296  -52.803 1.00 45.26  ? 263  LEU C CD1   1 
ATOM   4952 C CD2   . LEU B 1 263 ? 37.233  1.173   -52.795 1.00 38.19  ? 263  LEU C CD2   1 
ATOM   4953 N N     . SER B 1 264 ? 35.108  -1.145  -48.994 1.00 43.19  ? 264  SER C N     1 
ATOM   4954 C CA    . SER B 1 264 ? 35.720  -2.001  -47.987 1.00 44.76  ? 264  SER C CA    1 
ATOM   4955 C C     . SER B 1 264 ? 36.284  -3.283  -48.584 1.00 43.03  ? 264  SER C C     1 
ATOM   4956 O O     . SER B 1 264 ? 35.829  -3.748  -49.629 1.00 39.29  ? 264  SER C O     1 
ATOM   4957 C CB    . SER B 1 264 ? 34.694  -2.343  -46.912 1.00 41.82  ? 264  SER C CB    1 
ATOM   4958 O OG    . SER B 1 264 ? 34.048  -1.169  -46.460 1.00 44.10  ? 264  SER C OG    1 
ATOM   4959 N N     . ALA B 1 265 ? 37.279  -3.845  -47.905 1.00 38.93  ? 265  ALA C N     1 
ATOM   4960 C CA    . ALA B 1 265 ? 37.940  -5.068  -48.345 1.00 37.82  ? 265  ALA C CA    1 
ATOM   4961 C C     . ALA B 1 265 ? 37.720  -6.201  -47.333 1.00 44.43  ? 265  ALA C C     1 
ATOM   4962 O O     . ALA B 1 265 ? 38.244  -6.166  -46.219 1.00 47.23  ? 265  ALA C O     1 
ATOM   4963 C CB    . ALA B 1 265 ? 39.417  -4.819  -48.535 1.00 33.16  ? 265  ALA C CB    1 
ATOM   4964 N N     . GLY B 1 266 ? 36.937  -7.197  -47.729 1.00 40.08  ? 266  GLY C N     1 
ATOM   4965 C CA    . GLY B 1 266 ? 36.636  -8.326  -46.873 1.00 44.23  ? 266  GLY C CA    1 
ATOM   4966 C C     . GLY B 1 266 ? 37.468  -9.544  -47.223 1.00 52.73  ? 266  GLY C C     1 
ATOM   4967 O O     . GLY B 1 266 ? 37.882  -9.720  -48.377 1.00 46.92  ? 266  GLY C O     1 
ATOM   4968 N N     . ILE B 1 267 ? 37.713  -10.388 -46.224 1.00 51.94  ? 267  ILE C N     1 
ATOM   4969 C CA    . ILE B 1 267 ? 38.506  -11.598 -46.416 1.00 54.21  ? 267  ILE C CA    1 
ATOM   4970 C C     . ILE B 1 267 ? 37.623  -12.849 -46.468 1.00 54.29  ? 267  ILE C C     1 
ATOM   4971 O O     . ILE B 1 267 ? 36.853  -13.128 -45.540 1.00 51.54  ? 267  ILE C O     1 
ATOM   4972 C CB    . ILE B 1 267 ? 39.599  -11.730 -45.333 1.00 51.93  ? 267  ILE C CB    1 
ATOM   4973 C CG1   . ILE B 1 267 ? 40.598  -10.574 -45.467 1.00 44.47  ? 267  ILE C CG1   1 
ATOM   4974 C CG2   . ILE B 1 267 ? 40.309  -13.076 -45.439 1.00 48.03  ? 267  ILE C CG2   1 
ATOM   4975 C CD1   . ILE B 1 267 ? 41.670  -10.550 -44.407 1.00 40.90  ? 267  ILE C CD1   1 
ATOM   4976 N N     . ASN B 1 268 ? 37.730  -13.581 -47.575 1.00 54.55  ? 268  ASN C N     1 
ATOM   4977 C CA    . ASN B 1 268 ? 36.943  -14.790 -47.793 1.00 54.45  ? 268  ASN C CA    1 
ATOM   4978 C C     . ASN B 1 268 ? 37.076  -15.765 -46.626 1.00 57.04  ? 268  ASN C C     1 
ATOM   4979 O O     . ASN B 1 268 ? 38.187  -16.118 -46.224 1.00 58.89  ? 268  ASN C O     1 
ATOM   4980 C CB    . ASN B 1 268 ? 37.372  -15.471 -49.094 1.00 55.61  ? 268  ASN C CB    1 
ATOM   4981 C CG    . ASN B 1 268 ? 36.363  -16.495 -49.580 1.00 56.07  ? 268  ASN C CG    1 
ATOM   4982 O OD1   . ASN B 1 268 ? 35.594  -17.052 -48.797 1.00 57.20  ? 268  ASN C OD1   1 
ATOM   4983 N ND2   . ASN B 1 268 ? 36.363  -16.747 -50.880 1.00 58.20  ? 268  ASN C ND2   1 
ATOM   4984 N N     . ALA B 1 269 ? 35.939  -16.189 -46.081 1.00 58.05  ? 269  ALA C N     1 
ATOM   4985 C CA    . ALA B 1 269 ? 35.922  -17.138 -44.970 1.00 61.64  ? 269  ALA C CA    1 
ATOM   4986 C C     . ALA B 1 269 ? 36.673  -18.416 -45.324 1.00 59.46  ? 269  ALA C C     1 
ATOM   4987 O O     . ALA B 1 269 ? 37.292  -19.036 -44.467 1.00 64.01  ? 269  ALA C O     1 
ATOM   4988 C CB    . ALA B 1 269 ? 34.486  -17.462 -44.561 1.00 56.06  ? 269  ALA C CB    1 
ATOM   4989 N N     . ALA B 1 270 ? 36.625  -18.797 -46.595 1.00 61.59  ? 270  ALA C N     1 
ATOM   4990 C CA    . ALA B 1 270 ? 37.237  -20.041 -47.046 1.00 66.10  ? 270  ALA C CA    1 
ATOM   4991 C C     . ALA B 1 270 ? 38.669  -19.861 -47.549 1.00 64.62  ? 270  ALA C C     1 
ATOM   4992 O O     . ALA B 1 270 ? 39.259  -20.791 -48.102 1.00 64.00  ? 270  ALA C O     1 
ATOM   4993 C CB    . ALA B 1 270 ? 36.377  -20.686 -48.126 1.00 68.02  ? 270  ALA C CB    1 
ATOM   4994 N N     . SER B 1 271 ? 39.232  -18.672 -47.364 1.00 61.06  ? 271  SER C N     1 
ATOM   4995 C CA    . SER B 1 271 ? 40.583  -18.416 -47.853 1.00 60.28  ? 271  SER C CA    1 
ATOM   4996 C C     . SER B 1 271 ? 41.640  -19.078 -46.982 1.00 62.43  ? 271  SER C C     1 
ATOM   4997 O O     . SER B 1 271 ? 41.581  -19.007 -45.755 1.00 57.07  ? 271  SER C O     1 
ATOM   4998 C CB    . SER B 1 271 ? 40.864  -16.919 -47.952 1.00 59.52  ? 271  SER C CB    1 
ATOM   4999 O OG    . SER B 1 271 ? 42.220  -16.690 -48.305 1.00 58.45  ? 271  SER C OG    1 
ATOM   5000 N N     . PRO B 1 272 ? 42.612  -19.733 -47.622 1.00 64.49  ? 272  PRO C N     1 
ATOM   5001 C CA    . PRO B 1 272 ? 43.745  -20.339 -46.918 1.00 70.26  ? 272  PRO C CA    1 
ATOM   5002 C C     . PRO B 1 272 ? 44.833  -19.313 -46.637 1.00 69.44  ? 272  PRO C C     1 
ATOM   5003 O O     . PRO B 1 272 ? 45.823  -19.636 -45.985 1.00 67.51  ? 272  PRO C O     1 
ATOM   5004 C CB    . PRO B 1 272 ? 44.260  -21.367 -47.926 1.00 71.74  ? 272  PRO C CB    1 
ATOM   5005 C CG    . PRO B 1 272 ? 43.923  -20.762 -49.265 1.00 64.02  ? 272  PRO C CG    1 
ATOM   5006 C CD    . PRO B 1 272 ? 42.605  -20.061 -49.060 1.00 59.29  ? 272  PRO C CD    1 
ATOM   5007 N N     . ASN B 1 273 ? 44.650  -18.093 -47.130 1.00 68.59  ? 273  ASN C N     1 
ATOM   5008 C CA    . ASN B 1 273 ? 45.682  -17.067 -47.023 1.00 71.00  ? 273  ASN C CA    1 
ATOM   5009 C C     . ASN B 1 273 ? 45.286  -15.905 -46.126 1.00 68.89  ? 273  ASN C C     1 
ATOM   5010 O O     . ASN B 1 273 ? 45.775  -14.788 -46.297 1.00 74.21  ? 273  ASN C O     1 
ATOM   5011 C CB    . ASN B 1 273 ? 46.044  -16.535 -48.405 1.00 68.74  ? 273  ASN C CB    1 
ATOM   5012 C CG    . ASN B 1 273 ? 46.470  -17.630 -49.349 1.00 76.53  ? 273  ASN C CG    1 
ATOM   5013 O OD1   . ASN B 1 273 ? 47.531  -18.228 -49.178 1.00 84.43  ? 273  ASN C OD1   1 
ATOM   5014 N ND2   . ASN B 1 273 ? 45.649  -17.901 -50.356 1.00 75.47  ? 273  ASN C ND2   1 
ATOM   5015 N N     . LYS B 1 274 ? 44.406  -16.172 -45.167 1.00 55.55  ? 274  LYS C N     1 
ATOM   5016 C CA    . LYS B 1 274 ? 43.891  -15.123 -44.302 1.00 56.49  ? 274  LYS C CA    1 
ATOM   5017 C C     . LYS B 1 274 ? 44.986  -14.240 -43.697 1.00 68.09  ? 274  LYS C C     1 
ATOM   5018 O O     . LYS B 1 274 ? 44.755  -13.063 -43.419 1.00 74.27  ? 274  LYS C O     1 
ATOM   5019 C CB    . LYS B 1 274 ? 43.011  -15.714 -43.204 1.00 58.55  ? 274  LYS C CB    1 
ATOM   5020 C CG    . LYS B 1 274 ? 41.715  -16.321 -43.714 1.00 61.55  ? 274  LYS C CG    1 
ATOM   5021 C CD    . LYS B 1 274 ? 40.813  -16.707 -42.552 1.00 60.96  ? 274  LYS C CD    1 
ATOM   5022 C CE    . LYS B 1 274 ? 39.492  -17.281 -43.033 1.00 60.28  ? 274  LYS C CE    1 
ATOM   5023 N NZ    . LYS B 1 274 ? 39.695  -18.459 -43.909 1.00 58.26  ? 274  LYS C NZ    1 
ATOM   5024 N N     . GLU B 1 275 ? 46.175  -14.802 -43.500 1.00 69.11  ? 275  GLU C N     1 
ATOM   5025 C CA    . GLU B 1 275 ? 47.282  -14.045 -42.921 1.00 70.12  ? 275  GLU C CA    1 
ATOM   5026 C C     . GLU B 1 275 ? 48.007  -13.180 -43.946 1.00 63.63  ? 275  GLU C C     1 
ATOM   5027 O O     . GLU B 1 275 ? 48.474  -12.088 -43.629 1.00 62.46  ? 275  GLU C O     1 
ATOM   5028 C CB    . GLU B 1 275 ? 48.272  -14.971 -42.214 1.00 77.42  ? 275  GLU C CB    1 
ATOM   5029 C CG    . GLU B 1 275 ? 48.125  -14.966 -40.704 1.00 88.30  ? 275  GLU C CG    1 
ATOM   5030 C CD    . GLU B 1 275 ? 48.218  -13.567 -40.123 1.00 92.47  ? 275  GLU C CD    1 
ATOM   5031 O OE1   . GLU B 1 275 ? 47.391  -13.228 -39.247 1.00 90.19  ? 275  GLU C OE1   1 
ATOM   5032 O OE2   . GLU B 1 275 ? 49.119  -12.809 -40.545 1.00 93.38  ? 275  GLU C OE2   1 
ATOM   5033 N N     . LEU B 1 276 ? 48.113  -13.674 -45.173 1.00 64.17  ? 276  LEU C N     1 
ATOM   5034 C CA    . LEU B 1 276 ? 48.729  -12.897 -46.238 1.00 64.25  ? 276  LEU C CA    1 
ATOM   5035 C C     . LEU B 1 276 ? 47.831  -11.724 -46.601 1.00 60.70  ? 276  LEU C C     1 
ATOM   5036 O O     . LEU B 1 276 ? 48.303  -10.611 -46.833 1.00 62.12  ? 276  LEU C O     1 
ATOM   5037 C CB    . LEU B 1 276 ? 48.975  -13.770 -47.468 1.00 71.97  ? 276  LEU C CB    1 
ATOM   5038 C CG    . LEU B 1 276 ? 50.158  -14.738 -47.417 1.00 75.80  ? 276  LEU C CG    1 
ATOM   5039 C CD1   . LEU B 1 276 ? 50.164  -15.617 -48.655 1.00 76.09  ? 276  LEU C CD1   1 
ATOM   5040 C CD2   . LEU B 1 276 ? 51.472  -13.978 -47.286 1.00 73.71  ? 276  LEU C CD2   1 
ATOM   5041 N N     . ALA B 1 277 ? 46.529  -11.985 -46.649 1.00 56.27  ? 277  ALA C N     1 
ATOM   5042 C CA    . ALA B 1 277 ? 45.558  -10.946 -46.956 1.00 54.12  ? 277  ALA C CA    1 
ATOM   5043 C C     . ALA B 1 277 ? 45.690  -9.810  -45.957 1.00 58.74  ? 277  ALA C C     1 
ATOM   5044 O O     . ALA B 1 277 ? 45.713  -8.641  -46.338 1.00 65.25  ? 277  ALA C O     1 
ATOM   5045 C CB    . ALA B 1 277 ? 44.150  -11.510 -46.939 1.00 48.10  ? 277  ALA C CB    1 
ATOM   5046 N N     . LYS B 1 278 ? 45.795  -10.163 -44.679 1.00 55.39  ? 278  LYS C N     1 
ATOM   5047 C CA    . LYS B 1 278 ? 45.890  -9.174  -43.611 1.00 57.06  ? 278  LYS C CA    1 
ATOM   5048 C C     . LYS B 1 278 ? 47.128  -8.282  -43.728 1.00 56.35  ? 278  LYS C C     1 
ATOM   5049 O O     . LYS B 1 278 ? 47.055  -7.080  -43.470 1.00 58.29  ? 278  LYS C O     1 
ATOM   5050 C CB    . LYS B 1 278 ? 45.845  -9.846  -42.234 1.00 63.42  ? 278  LYS C CB    1 
ATOM   5051 C CG    . LYS B 1 278 ? 46.032  -8.872  -41.077 1.00 71.87  ? 278  LYS C CG    1 
ATOM   5052 C CD    . LYS B 1 278 ? 46.045  -9.574  -39.724 1.00 73.58  ? 278  LYS C CD    1 
ATOM   5053 C CE    . LYS B 1 278 ? 46.531  -8.633  -38.625 1.00 73.03  ? 278  LYS C CE    1 
ATOM   5054 N NZ    . LYS B 1 278 ? 46.418  -9.226  -37.264 1.00 74.49  ? 278  LYS C NZ    1 
ATOM   5055 N N     . GLU B 1 279 ? 48.262  -8.859  -44.117 1.00 56.14  ? 279  GLU C N     1 
ATOM   5056 C CA    . GLU B 1 279 ? 49.489  -8.072  -44.236 1.00 58.88  ? 279  GLU C CA    1 
ATOM   5057 C C     . GLU B 1 279 ? 49.465  -7.187  -45.479 1.00 57.41  ? 279  GLU C C     1 
ATOM   5058 O O     . GLU B 1 279 ? 50.030  -6.092  -45.491 1.00 53.17  ? 279  GLU C O     1 
ATOM   5059 C CB    . GLU B 1 279 ? 50.726  -8.969  -44.263 1.00 61.77  ? 279  GLU C CB    1 
ATOM   5060 C CG    . GLU B 1 279 ? 52.031  -8.191  -44.357 1.00 68.15  ? 279  GLU C CG    1 
ATOM   5061 C CD    . GLU B 1 279 ? 53.214  -9.068  -44.718 1.00 81.79  ? 279  GLU C CD    1 
ATOM   5062 O OE1   . GLU B 1 279 ? 53.117  -10.304 -44.541 1.00 85.30  ? 279  GLU C OE1   1 
ATOM   5063 O OE2   . GLU B 1 279 ? 54.237  -8.518  -45.185 1.00 82.52  ? 279  GLU C OE2   1 
ATOM   5064 N N     . PHE B 1 280 ? 48.817  -7.671  -46.530 1.00 62.19  ? 280  PHE C N     1 
ATOM   5065 C CA    . PHE B 1 280 ? 48.694  -6.894  -47.754 1.00 59.73  ? 280  PHE C CA    1 
ATOM   5066 C C     . PHE B 1 280 ? 47.818  -5.666  -47.518 1.00 58.72  ? 280  PHE C C     1 
ATOM   5067 O O     . PHE B 1 280 ? 48.202  -4.541  -47.844 1.00 55.46  ? 280  PHE C O     1 
ATOM   5068 C CB    . PHE B 1 280 ? 48.116  -7.751  -48.878 1.00 59.09  ? 280  PHE C CB    1 
ATOM   5069 C CG    . PHE B 1 280 ? 47.721  -6.966  -50.090 1.00 60.53  ? 280  PHE C CG    1 
ATOM   5070 C CD1   . PHE B 1 280 ? 48.668  -6.600  -51.032 1.00 60.20  ? 280  PHE C CD1   1 
ATOM   5071 C CD2   . PHE B 1 280 ? 46.406  -6.587  -50.285 1.00 59.37  ? 280  PHE C CD2   1 
ATOM   5072 C CE1   . PHE B 1 280 ? 48.309  -5.873  -52.146 1.00 62.32  ? 280  PHE C CE1   1 
ATOM   5073 C CE2   . PHE B 1 280 ? 46.042  -5.860  -51.399 1.00 60.94  ? 280  PHE C CE2   1 
ATOM   5074 C CZ    . PHE B 1 280 ? 46.995  -5.503  -52.331 1.00 62.12  ? 280  PHE C CZ    1 
ATOM   5075 N N     . LEU B 1 281 ? 46.645  -5.892  -46.936 1.00 56.30  ? 281  LEU C N     1 
ATOM   5076 C CA    . LEU B 1 281 ? 45.699  -4.819  -46.655 1.00 52.85  ? 281  LEU C CA    1 
ATOM   5077 C C     . LEU B 1 281 ? 46.240  -3.800  -45.648 1.00 55.15  ? 281  LEU C C     1 
ATOM   5078 O O     . LEU B 1 281 ? 46.218  -2.596  -45.904 1.00 60.96  ? 281  LEU C O     1 
ATOM   5079 C CB    . LEU B 1 281 ? 44.365  -5.399  -46.178 1.00 46.30  ? 281  LEU C CB    1 
ATOM   5080 C CG    . LEU B 1 281 ? 43.639  -6.217  -47.250 1.00 43.49  ? 281  LEU C CG    1 
ATOM   5081 C CD1   . LEU B 1 281 ? 42.360  -6.846  -46.710 1.00 39.43  ? 281  LEU C CD1   1 
ATOM   5082 C CD2   . LEU B 1 281 ? 43.338  -5.347  -48.471 1.00 41.92  ? 281  LEU C CD2   1 
ATOM   5083 N N     . GLU B 1 282 ? 46.739  -4.284  -44.515 1.00 51.95  ? 282  GLU C N     1 
ATOM   5084 C CA    . GLU B 1 282 ? 47.212  -3.401  -43.449 1.00 49.99  ? 282  GLU C CA    1 
ATOM   5085 C C     . GLU B 1 282 ? 48.548  -2.733  -43.744 1.00 47.83  ? 282  GLU C C     1 
ATOM   5086 O O     . GLU B 1 282 ? 48.738  -1.552  -43.453 1.00 55.23  ? 282  GLU C O     1 
ATOM   5087 C CB    . GLU B 1 282 ? 47.321  -4.156  -42.121 1.00 45.58  ? 282  GLU C CB    1 
ATOM   5088 C CG    . GLU B 1 282 ? 46.000  -4.628  -41.551 1.00 54.22  ? 282  GLU C CG    1 
ATOM   5089 C CD    . GLU B 1 282 ? 46.138  -5.167  -40.135 1.00 56.03  ? 282  GLU C CD    1 
ATOM   5090 O OE1   . GLU B 1 282 ? 47.217  -4.994  -39.524 1.00 50.46  ? 282  GLU C OE1   1 
ATOM   5091 O OE2   . GLU B 1 282 ? 45.162  -5.759  -39.633 1.00 57.56  ? 282  GLU C OE2   1 
ATOM   5092 N N     . ASN B 1 283 ? 49.481  -3.491  -44.302 1.00 51.39  ? 283  ASN C N     1 
ATOM   5093 C CA    . ASN B 1 283 ? 50.841  -2.993  -44.477 1.00 64.01  ? 283  ASN C CA    1 
ATOM   5094 C C     . ASN B 1 283 ? 51.142  -2.441  -45.865 1.00 62.01  ? 283  ASN C C     1 
ATOM   5095 O O     . ASN B 1 283 ? 52.093  -1.676  -46.035 1.00 66.77  ? 283  ASN C O     1 
ATOM   5096 C CB    . ASN B 1 283 ? 51.857  -4.077  -44.115 1.00 72.69  ? 283  ASN C CB    1 
ATOM   5097 C CG    . ASN B 1 283 ? 51.838  -4.419  -42.640 1.00 79.00  ? 283  ASN C CG    1 
ATOM   5098 O OD1   . ASN B 1 283 ? 51.599  -3.554  -41.796 1.00 79.80  ? 283  ASN C OD1   1 
ATOM   5099 N ND2   . ASN B 1 283 ? 52.086  -5.685  -42.321 1.00 80.52  ? 283  ASN C ND2   1 
ATOM   5100 N N     . TYR B 1 284 ? 50.335  -2.824  -46.849 1.00 56.57  ? 284  TYR C N     1 
ATOM   5101 C CA    . TYR B 1 284 ? 50.586  -2.419  -48.233 1.00 59.65  ? 284  TYR C CA    1 
ATOM   5102 C C     . TYR B 1 284 ? 49.533  -1.474  -48.811 1.00 57.95  ? 284  TYR C C     1 
ATOM   5103 O O     . TYR B 1 284 ? 49.869  -0.395  -49.296 1.00 53.90  ? 284  TYR C O     1 
ATOM   5104 C CB    . TYR B 1 284 ? 50.775  -3.646  -49.129 1.00 59.36  ? 284  TYR C CB    1 
ATOM   5105 C CG    . TYR B 1 284 ? 52.120  -4.298  -48.929 1.00 69.44  ? 284  TYR C CG    1 
ATOM   5106 C CD1   . TYR B 1 284 ? 52.403  -5.002  -47.767 1.00 73.79  ? 284  TYR C CD1   1 
ATOM   5107 C CD2   . TYR B 1 284 ? 53.114  -4.189  -49.888 1.00 73.01  ? 284  TYR C CD2   1 
ATOM   5108 C CE1   . TYR B 1 284 ? 53.635  -5.587  -47.573 1.00 77.15  ? 284  TYR C CE1   1 
ATOM   5109 C CE2   . TYR B 1 284 ? 54.348  -4.772  -49.703 1.00 76.21  ? 284  TYR C CE2   1 
ATOM   5110 C CZ    . TYR B 1 284 ? 54.604  -5.470  -48.543 1.00 78.33  ? 284  TYR C CZ    1 
ATOM   5111 O OH    . TYR B 1 284 ? 55.833  -6.054  -48.353 1.00 80.30  ? 284  TYR C OH    1 
ATOM   5112 N N     . LEU B 1 285 ? 48.266  -1.874  -48.756 1.00 56.52  ? 285  LEU C N     1 
ATOM   5113 C CA    . LEU B 1 285 ? 47.201  -1.052  -49.315 1.00 50.98  ? 285  LEU C CA    1 
ATOM   5114 C C     . LEU B 1 285 ? 46.886  0.159   -48.452 1.00 49.46  ? 285  LEU C C     1 
ATOM   5115 O O     . LEU B 1 285 ? 46.915  1.288   -48.931 1.00 48.41  ? 285  LEU C O     1 
ATOM   5116 C CB    . LEU B 1 285 ? 45.923  -1.857  -49.533 1.00 46.93  ? 285  LEU C CB    1 
ATOM   5117 C CG    . LEU B 1 285 ? 44.790  -0.938  -49.987 1.00 42.56  ? 285  LEU C CG    1 
ATOM   5118 C CD1   . LEU B 1 285 ? 45.130  -0.320  -51.338 1.00 49.24  ? 285  LEU C CD1   1 
ATOM   5119 C CD2   . LEU B 1 285 ? 43.463  -1.663  -50.051 1.00 38.44  ? 285  LEU C CD2   1 
ATOM   5120 N N     . LEU B 1 286 ? 46.571  -0.081  -47.182 1.00 55.32  ? 286  LEU C N     1 
ATOM   5121 C CA    . LEU B 1 286 ? 46.191  1.005   -46.284 1.00 51.34  ? 286  LEU C CA    1 
ATOM   5122 C C     . LEU B 1 286 ? 47.410  1.778   -45.794 1.00 51.88  ? 286  LEU C C     1 
ATOM   5123 O O     . LEU B 1 286 ? 47.698  1.837   -44.600 1.00 56.22  ? 286  LEU C O     1 
ATOM   5124 C CB    . LEU B 1 286 ? 45.339  0.487   -45.125 1.00 48.46  ? 286  LEU C CB    1 
ATOM   5125 C CG    . LEU B 1 286 ? 43.911  0.134   -45.557 1.00 46.47  ? 286  LEU C CG    1 
ATOM   5126 C CD1   . LEU B 1 286 ? 43.166  -0.608  -44.460 1.00 43.65  ? 286  LEU C CD1   1 
ATOM   5127 C CD2   . LEU B 1 286 ? 43.148  1.387   -45.979 1.00 39.95  ? 286  LEU C CD2   1 
ATOM   5128 N N     . THR B 1 287 ? 48.120  2.368   -46.749 1.00 50.02  ? 287  THR C N     1 
ATOM   5129 C CA    . THR B 1 287 ? 49.270  3.211   -46.474 1.00 50.86  ? 287  THR C CA    1 
ATOM   5130 C C     . THR B 1 287 ? 49.174  4.434   -47.375 1.00 52.10  ? 287  THR C C     1 
ATOM   5131 O O     . THR B 1 287 ? 48.355  4.466   -48.291 1.00 51.34  ? 287  THR C O     1 
ATOM   5132 C CB    . THR B 1 287 ? 50.580  2.466   -46.761 1.00 57.96  ? 287  THR C CB    1 
ATOM   5133 O OG1   . THR B 1 287 ? 50.558  1.964   -48.101 1.00 59.80  ? 287  THR C OG1   1 
ATOM   5134 C CG2   . THR B 1 287 ? 50.750  1.298   -45.795 1.00 58.07  ? 287  THR C CG2   1 
ATOM   5135 N N     . ASP B 1 288 ? 49.993  5.446   -47.114 1.00 52.28  ? 288  ASP C N     1 
ATOM   5136 C CA    . ASP B 1 288 ? 49.973  6.640   -47.944 1.00 53.98  ? 288  ASP C CA    1 
ATOM   5137 C C     . ASP B 1 288 ? 50.302  6.281   -49.393 1.00 58.33  ? 288  ASP C C     1 
ATOM   5138 O O     . ASP B 1 288 ? 49.548  6.608   -50.308 1.00 55.84  ? 288  ASP C O     1 
ATOM   5139 C CB    . ASP B 1 288 ? 50.940  7.699   -47.413 1.00 51.58  ? 288  ASP C CB    1 
ATOM   5140 C CG    . ASP B 1 288 ? 50.386  8.441   -46.212 1.00 55.12  ? 288  ASP C CG    1 
ATOM   5141 O OD1   . ASP B 1 288 ? 51.167  9.120   -45.516 1.00 55.98  ? 288  ASP C OD1   1 
ATOM   5142 O OD2   . ASP B 1 288 ? 49.168  8.345   -45.965 1.00 58.73  ? 288  ASP C OD2   1 
ATOM   5143 N N     . GLU B 1 289 ? 51.421  5.588   -49.587 1.00 61.25  ? 289  GLU C N     1 
ATOM   5144 C CA    . GLU B 1 289 ? 51.866  5.188   -50.919 1.00 65.87  ? 289  GLU C CA    1 
ATOM   5145 C C     . GLU B 1 289 ? 50.868  4.246   -51.577 1.00 59.52  ? 289  GLU C C     1 
ATOM   5146 O O     . GLU B 1 289 ? 50.583  4.367   -52.761 1.00 63.72  ? 289  GLU C O     1 
ATOM   5147 C CB    . GLU B 1 289 ? 53.241  4.515   -50.852 1.00 74.06  ? 289  GLU C CB    1 
ATOM   5148 C CG    . GLU B 1 289 ? 54.299  5.309   -50.092 1.00 83.74  ? 289  GLU C CG    1 
ATOM   5149 C CD    . GLU B 1 289 ? 54.130  5.236   -48.577 1.00 88.73  ? 289  GLU C CD    1 
ATOM   5150 O OE1   . GLU B 1 289 ? 54.707  6.095   -47.877 1.00 89.00  ? 289  GLU C OE1   1 
ATOM   5151 O OE2   . GLU B 1 289 ? 53.431  4.321   -48.086 1.00 86.28  ? 289  GLU C OE2   1 
ATOM   5152 N N     . GLY B 1 290 ? 50.340  3.310   -50.798 1.00 61.48  ? 290  GLY C N     1 
ATOM   5153 C CA    . GLY B 1 290 ? 49.391  2.339   -51.307 1.00 56.99  ? 290  GLY C CA    1 
ATOM   5154 C C     . GLY B 1 290 ? 48.125  2.977   -51.839 1.00 54.98  ? 290  GLY C C     1 
ATOM   5155 O O     . GLY B 1 290 ? 47.741  2.753   -52.988 1.00 55.23  ? 290  GLY C O     1 
ATOM   5156 N N     . LEU B 1 291 ? 47.467  3.771   -51.004 1.00 50.29  ? 291  LEU C N     1 
ATOM   5157 C CA    . LEU B 1 291 ? 46.232  4.426   -51.410 1.00 51.94  ? 291  LEU C CA    1 
ATOM   5158 C C     . LEU B 1 291 ? 46.474  5.412   -52.545 1.00 50.68  ? 291  LEU C C     1 
ATOM   5159 O O     . LEU B 1 291 ? 45.634  5.576   -53.425 1.00 51.91  ? 291  LEU C O     1 
ATOM   5160 C CB    . LEU B 1 291 ? 45.577  5.134   -50.227 1.00 49.06  ? 291  LEU C CB    1 
ATOM   5161 C CG    . LEU B 1 291 ? 45.015  4.211   -49.146 1.00 50.01  ? 291  LEU C CG    1 
ATOM   5162 C CD1   . LEU B 1 291 ? 44.386  5.029   -48.028 1.00 49.25  ? 291  LEU C CD1   1 
ATOM   5163 C CD2   . LEU B 1 291 ? 44.009  3.237   -49.741 1.00 46.36  ? 291  LEU C CD2   1 
ATOM   5164 N N     . GLU B 1 292 ? 47.620  6.080   -52.517 1.00 50.07  ? 292  GLU C N     1 
ATOM   5165 C CA    . GLU B 1 292 ? 47.958  7.000   -53.589 1.00 48.41  ? 292  GLU C CA    1 
ATOM   5166 C C     . GLU B 1 292 ? 47.973  6.291   -54.936 1.00 47.04  ? 292  GLU C C     1 
ATOM   5167 O O     . GLU B 1 292 ? 47.408  6.778   -55.908 1.00 54.71  ? 292  GLU C O     1 
ATOM   5168 C CB    . GLU B 1 292 ? 49.314  7.645   -53.353 1.00 50.71  ? 292  GLU C CB    1 
ATOM   5169 C CG    . GLU B 1 292 ? 49.830  8.353   -54.589 1.00 59.77  ? 292  GLU C CG    1 
ATOM   5170 C CD    . GLU B 1 292 ? 50.882  9.378   -54.269 1.00 73.05  ? 292  GLU C CD    1 
ATOM   5171 O OE1   . GLU B 1 292 ? 52.039  8.978   -54.014 1.00 74.52  ? 292  GLU C OE1   1 
ATOM   5172 O OE2   . GLU B 1 292 ? 50.546  10.583  -54.267 1.00 81.42  ? 292  GLU C OE2   1 
ATOM   5173 N N     . ALA B 1 293 ? 48.631  5.140   -54.985 1.00 42.79  ? 293  ALA C N     1 
ATOM   5174 C CA    . ALA B 1 293 ? 48.726  4.372   -56.217 1.00 50.61  ? 293  ALA C CA    1 
ATOM   5175 C C     . ALA B 1 293 ? 47.338  4.076   -56.763 1.00 48.74  ? 293  ALA C C     1 
ATOM   5176 O O     . ALA B 1 293 ? 47.107  4.152   -57.967 1.00 52.24  ? 293  ALA C O     1 
ATOM   5177 C CB    . ALA B 1 293 ? 49.487  3.076   -55.977 1.00 54.92  ? 293  ALA C CB    1 
ATOM   5178 N N     . VAL B 1 294 ? 46.414  3.731   -55.873 1.00 44.30  ? 294  VAL C N     1 
ATOM   5179 C CA    . VAL B 1 294 ? 45.056  3.423   -56.293 1.00 40.35  ? 294  VAL C CA    1 
ATOM   5180 C C     . VAL B 1 294 ? 44.322  4.700   -56.680 1.00 45.23  ? 294  VAL C C     1 
ATOM   5181 O O     . VAL B 1 294 ? 43.654  4.760   -57.717 1.00 45.30  ? 294  VAL C O     1 
ATOM   5182 C CB    . VAL B 1 294 ? 44.283  2.673   -55.204 1.00 38.43  ? 294  VAL C CB    1 
ATOM   5183 C CG1   . VAL B 1 294 ? 42.854  2.423   -55.651 1.00 39.31  ? 294  VAL C CG1   1 
ATOM   5184 C CG2   . VAL B 1 294 ? 44.978  1.355   -54.885 1.00 35.35  ? 294  VAL C CG2   1 
ATOM   5185 N N     . ASN B 1 295 ? 44.469  5.725   -55.846 1.00 40.01  ? 295  ASN C N     1 
ATOM   5186 C CA    . ASN B 1 295 ? 43.853  7.018   -56.096 1.00 45.94  ? 295  ASN C CA    1 
ATOM   5187 C C     . ASN B 1 295 ? 44.280  7.638   -57.436 1.00 47.72  ? 295  ASN C C     1 
ATOM   5188 O O     . ASN B 1 295 ? 43.467  8.264   -58.113 1.00 42.42  ? 295  ASN C O     1 
ATOM   5189 C CB    . ASN B 1 295 ? 44.144  7.973   -54.934 1.00 42.72  ? 295  ASN C CB    1 
ATOM   5190 C CG    . ASN B 1 295 ? 43.102  9.057   -54.802 1.00 41.98  ? 295  ASN C CG    1 
ATOM   5191 O OD1   . ASN B 1 295 ? 41.980  8.802   -54.363 1.00 45.46  ? 295  ASN C OD1   1 
ATOM   5192 N ND2   . ASN B 1 295 ? 43.461  10.276  -55.184 1.00 41.84  ? 295  ASN C ND2   1 
ATOM   5193 N N     . LYS B 1 296 ? 45.546  7.454   -57.815 1.00 49.21  ? 296  LYS C N     1 
ATOM   5194 C CA    . LYS B 1 296 ? 46.060  7.955   -59.095 1.00 50.45  ? 296  LYS C CA    1 
ATOM   5195 C C     . LYS B 1 296 ? 45.368  7.286   -60.270 1.00 46.22  ? 296  LYS C C     1 
ATOM   5196 O O     . LYS B 1 296 ? 45.127  7.916   -61.294 1.00 52.90  ? 296  LYS C O     1 
ATOM   5197 C CB    . LYS B 1 296 ? 47.569  7.737   -59.218 1.00 60.06  ? 296  LYS C CB    1 
ATOM   5198 C CG    . LYS B 1 296 ? 48.415  8.604   -58.304 1.00 75.69  ? 296  LYS C CG    1 
ATOM   5199 C CD    . LYS B 1 296 ? 49.876  8.163   -58.335 1.00 90.23  ? 296  LYS C CD    1 
ATOM   5200 C CE    . LYS B 1 296 ? 50.550  8.505   -59.657 1.00 97.77  ? 296  LYS C CE    1 
ATOM   5201 N NZ    . LYS B 1 296 ? 50.953  9.939   -59.723 1.00 101.94 ? 296  LYS C NZ    1 
ATOM   5202 N N     . ASP B 1 297 ? 45.063  6.001   -60.125 1.00 42.10  ? 297  ASP C N     1 
ATOM   5203 C CA    . ASP B 1 297 ? 44.302  5.292   -61.140 1.00 41.88  ? 297  ASP C CA    1 
ATOM   5204 C C     . ASP B 1 297 ? 42.861  5.815   -61.168 1.00 44.51  ? 297  ASP C C     1 
ATOM   5205 O O     . ASP B 1 297 ? 42.440  6.429   -62.150 1.00 45.62  ? 297  ASP C O     1 
ATOM   5206 C CB    . ASP B 1 297 ? 44.348  3.780   -60.891 1.00 48.09  ? 297  ASP C CB    1 
ATOM   5207 C CG    . ASP B 1 297 ? 43.734  2.982   -62.028 1.00 49.93  ? 297  ASP C CG    1 
ATOM   5208 O OD1   . ASP B 1 297 ? 43.398  3.592   -63.068 1.00 48.36  ? 297  ASP C OD1   1 
ATOM   5209 O OD2   . ASP B 1 297 ? 43.599  1.746   -61.887 1.00 44.99  ? 297  ASP C OD2   1 
ATOM   5210 N N     . LYS B 1 298 ? 42.116  5.585   -60.087 1.00 38.01  ? 298  LYS C N     1 
ATOM   5211 C CA    . LYS B 1 298 ? 40.766  6.129   -59.945 1.00 37.99  ? 298  LYS C CA    1 
ATOM   5212 C C     . LYS B 1 298 ? 40.562  6.662   -58.528 1.00 46.72  ? 298  LYS C C     1 
ATOM   5213 O O     . LYS B 1 298 ? 40.674  5.904   -57.566 1.00 43.97  ? 298  LYS C O     1 
ATOM   5214 C CB    . LYS B 1 298 ? 39.712  5.060   -60.238 1.00 44.09  ? 298  LYS C CB    1 
ATOM   5215 C CG    . LYS B 1 298 ? 39.818  4.415   -61.603 1.00 51.42  ? 298  LYS C CG    1 
ATOM   5216 C CD    . LYS B 1 298 ? 39.641  5.434   -62.705 1.00 64.48  ? 298  LYS C CD    1 
ATOM   5217 C CE    . LYS B 1 298 ? 39.910  4.816   -64.062 1.00 74.56  ? 298  LYS C CE    1 
ATOM   5218 N NZ    . LYS B 1 298 ? 39.010  3.658   -64.299 1.00 87.05  ? 298  LYS C NZ    1 
ATOM   5219 N N     . PRO B 1 299 ? 40.260  7.968   -58.395 1.00 41.17  ? 299  PRO C N     1 
ATOM   5220 C CA    . PRO B 1 299 ? 40.087  8.599   -57.081 1.00 38.22  ? 299  PRO C CA    1 
ATOM   5221 C C     . PRO B 1 299 ? 39.131  7.827   -56.177 1.00 42.14  ? 299  PRO C C     1 
ATOM   5222 O O     . PRO B 1 299 ? 38.056  7.402   -56.615 1.00 41.67  ? 299  PRO C O     1 
ATOM   5223 C CB    . PRO B 1 299 ? 39.509  9.973   -57.428 1.00 41.20  ? 299  PRO C CB    1 
ATOM   5224 C CG    . PRO B 1 299 ? 40.064  10.270  -58.798 1.00 37.18  ? 299  PRO C CG    1 
ATOM   5225 C CD    . PRO B 1 299 ? 40.082  8.929   -59.500 1.00 43.11  ? 299  PRO C CD    1 
ATOM   5226 N N     . LEU B 1 300 ? 39.531  7.661   -54.918 1.00 41.34  ? 300  LEU C N     1 
ATOM   5227 C CA    . LEU B 1 300 ? 38.813  6.814   -53.963 1.00 36.17  ? 300  LEU C CA    1 
ATOM   5228 C C     . LEU B 1 300 ? 37.696  7.526   -53.207 1.00 36.09  ? 300  LEU C C     1 
ATOM   5229 O O     . LEU B 1 300 ? 36.727  6.893   -52.793 1.00 34.27  ? 300  LEU C O     1 
ATOM   5230 C CB    . LEU B 1 300 ? 39.797  6.230   -52.952 1.00 35.74  ? 300  LEU C CB    1 
ATOM   5231 C CG    . LEU B 1 300 ? 40.710  5.099   -53.416 1.00 38.07  ? 300  LEU C CG    1 
ATOM   5232 C CD1   . LEU B 1 300 ? 41.879  4.966   -52.463 1.00 36.43  ? 300  LEU C CD1   1 
ATOM   5233 C CD2   . LEU B 1 300 ? 39.927  3.790   -53.524 1.00 32.27  ? 300  LEU C CD2   1 
ATOM   5234 N N     . GLY B 1 301 ? 37.834  8.837   -53.026 1.00 36.11  ? 301  GLY C N     1 
ATOM   5235 C CA    . GLY B 1 301 ? 36.934  9.589   -52.159 1.00 38.90  ? 301  GLY C CA    1 
ATOM   5236 C C     . GLY B 1 301 ? 37.654  9.998   -50.883 1.00 40.12  ? 301  GLY C C     1 
ATOM   5237 O O     . GLY B 1 301 ? 38.878  10.139  -50.882 1.00 36.31  ? 301  GLY C O     1 
ATOM   5238 N N     . ALA B 1 302 ? 36.910  10.196  -49.797 1.00 40.13  ? 302  ALA C N     1 
ATOM   5239 C CA    . ALA B 1 302 ? 37.526  10.527  -48.512 1.00 40.89  ? 302  ALA C CA    1 
ATOM   5240 C C     . ALA B 1 302 ? 38.040  9.249   -47.851 1.00 35.24  ? 302  ALA C C     1 
ATOM   5241 O O     . ALA B 1 302 ? 37.269  8.515   -47.240 1.00 35.77  ? 302  ALA C O     1 
ATOM   5242 C CB    . ALA B 1 302 ? 36.531  11.239  -47.602 1.00 38.91  ? 302  ALA C CB    1 
ATOM   5243 N N     . VAL B 1 303 ? 39.336  8.982   -47.984 1.00 32.75  ? 303  VAL C N     1 
ATOM   5244 C CA    . VAL B 1 303 ? 39.876  7.687   -47.589 1.00 35.38  ? 303  VAL C CA    1 
ATOM   5245 C C     . VAL B 1 303 ? 39.836  7.477   -46.076 1.00 39.93  ? 303  VAL C C     1 
ATOM   5246 O O     . VAL B 1 303 ? 39.799  8.434   -45.303 1.00 46.03  ? 303  VAL C O     1 
ATOM   5247 C CB    . VAL B 1 303 ? 41.310  7.459   -48.116 1.00 37.89  ? 303  VAL C CB    1 
ATOM   5248 C CG1   . VAL B 1 303 ? 41.378  7.699   -49.636 1.00 32.36  ? 303  VAL C CG1   1 
ATOM   5249 C CG2   . VAL B 1 303 ? 42.297  8.342   -47.378 1.00 34.51  ? 303  VAL C CG2   1 
ATOM   5250 N N     . ALA B 1 304 ? 39.847  6.213   -45.665 1.00 40.83  ? 304  ALA C N     1 
ATOM   5251 C CA    . ALA B 1 304 ? 39.688  5.864   -44.259 1.00 42.60  ? 304  ALA C CA    1 
ATOM   5252 C C     . ALA B 1 304 ? 40.939  6.203   -43.456 1.00 42.21  ? 304  ALA C C     1 
ATOM   5253 O O     . ALA B 1 304 ? 40.868  6.428   -42.254 1.00 39.01  ? 304  ALA C O     1 
ATOM   5254 C CB    . ALA B 1 304 ? 39.334  4.387   -44.117 1.00 37.12  ? 304  ALA C CB    1 
ATOM   5255 N N     . LEU B 1 305 ? 42.080  6.254   -44.137 1.00 42.26  ? 305  LEU C N     1 
ATOM   5256 C CA    . LEU B 1 305 ? 43.364  6.469   -43.481 1.00 38.27  ? 305  LEU C CA    1 
ATOM   5257 C C     . LEU B 1 305 ? 43.555  7.921   -43.041 1.00 49.25  ? 305  LEU C C     1 
ATOM   5258 O O     . LEU B 1 305 ? 43.614  8.834   -43.870 1.00 53.88  ? 305  LEU C O     1 
ATOM   5259 C CB    . LEU B 1 305 ? 44.502  6.037   -44.405 1.00 40.77  ? 305  LEU C CB    1 
ATOM   5260 C CG    . LEU B 1 305 ? 45.915  5.948   -43.824 1.00 44.20  ? 305  LEU C CG    1 
ATOM   5261 C CD1   . LEU B 1 305 ? 46.031  4.788   -42.842 1.00 40.47  ? 305  LEU C CD1   1 
ATOM   5262 C CD2   . LEU B 1 305 ? 46.936  5.803   -44.952 1.00 41.69  ? 305  LEU C CD2   1 
ATOM   5263 N N     . LYS B 1 306 ? 43.660  8.117   -41.729 1.00 48.86  ? 306  LYS C N     1 
ATOM   5264 C CA    . LYS B 1 306 ? 43.797  9.442   -41.134 1.00 48.01  ? 306  LYS C CA    1 
ATOM   5265 C C     . LYS B 1 306 ? 44.915  10.273  -41.746 1.00 44.23  ? 306  LYS C C     1 
ATOM   5266 O O     . LYS B 1 306 ? 44.789  11.489  -41.876 1.00 42.42  ? 306  LYS C O     1 
ATOM   5267 C CB    . LYS B 1 306 ? 44.059  9.324   -39.629 1.00 46.07  ? 306  LYS C CB    1 
ATOM   5268 C CG    . LYS B 1 306 ? 42.894  8.794   -38.812 1.00 53.37  ? 306  LYS C CG    1 
ATOM   5269 C CD    . LYS B 1 306 ? 43.227  8.827   -37.329 1.00 56.94  ? 306  LYS C CD    1 
ATOM   5270 C CE    . LYS B 1 306 ? 42.067  8.344   -36.474 1.00 63.90  ? 306  LYS C CE    1 
ATOM   5271 N NZ    . LYS B 1 306 ? 42.430  8.332   -35.026 1.00 68.27  ? 306  LYS C NZ    1 
ATOM   5272 N N     . SER B 1 307 ? 46.016  9.616   -42.091 1.00 43.42  ? 307  SER C N     1 
ATOM   5273 C CA    . SER B 1 307 ? 47.232  10.315  -42.492 1.00 47.20  ? 307  SER C CA    1 
ATOM   5274 C C     . SER B 1 307 ? 47.130  10.938  -43.882 1.00 44.37  ? 307  SER C C     1 
ATOM   5275 O O     . SER B 1 307 ? 47.989  11.726  -44.286 1.00 44.27  ? 307  SER C O     1 
ATOM   5276 C CB    . SER B 1 307 ? 48.425  9.364   -42.436 1.00 48.68  ? 307  SER C CB    1 
ATOM   5277 O OG    . SER B 1 307 ? 48.161  8.189   -43.178 1.00 50.52  ? 307  SER C OG    1 
ATOM   5278 N N     . TYR B 1 308 ? 46.079  10.587  -44.608 1.00 41.47  ? 308  TYR C N     1 
ATOM   5279 C CA    . TYR B 1 308 ? 45.927  11.072  -45.969 1.00 51.96  ? 308  TYR C CA    1 
ATOM   5280 C C     . TYR B 1 308 ? 45.248  12.442  -46.026 1.00 49.35  ? 308  TYR C C     1 
ATOM   5281 O O     . TYR B 1 308 ? 45.076  13.005  -47.102 1.00 44.84  ? 308  TYR C O     1 
ATOM   5282 C CB    . TYR B 1 308 ? 45.161  10.055  -46.823 1.00 50.53  ? 308  TYR C CB    1 
ATOM   5283 C CG    . TYR B 1 308 ? 45.655  10.001  -48.250 1.00 48.97  ? 308  TYR C CG    1 
ATOM   5284 C CD1   . TYR B 1 308 ? 46.878  9.425   -48.551 1.00 53.86  ? 308  TYR C CD1   1 
ATOM   5285 C CD2   . TYR B 1 308 ? 44.911  10.540  -49.289 1.00 49.75  ? 308  TYR C CD2   1 
ATOM   5286 C CE1   . TYR B 1 308 ? 47.346  9.382   -49.840 1.00 58.05  ? 308  TYR C CE1   1 
ATOM   5287 C CE2   . TYR B 1 308 ? 45.373  10.501  -50.592 1.00 48.28  ? 308  TYR C CE2   1 
ATOM   5288 C CZ    . TYR B 1 308 ? 46.591  9.919   -50.857 1.00 54.14  ? 308  TYR C CZ    1 
ATOM   5289 O OH    . TYR B 1 308 ? 47.070  9.870   -52.138 1.00 58.32  ? 308  TYR C OH    1 
ATOM   5290 N N     . GLU B 1 309 ? 44.876  12.980  -44.869 1.00 48.58  ? 309  GLU C N     1 
ATOM   5291 C CA    . GLU B 1 309 ? 44.065  14.196  -44.836 1.00 45.58  ? 309  GLU C CA    1 
ATOM   5292 C C     . GLU B 1 309 ? 44.705  15.404  -45.513 1.00 42.20  ? 309  GLU C C     1 
ATOM   5293 O O     . GLU B 1 309 ? 44.031  16.144  -46.222 1.00 47.67  ? 309  GLU C O     1 
ATOM   5294 C CB    . GLU B 1 309 ? 43.654  14.572  -43.412 1.00 35.54  ? 309  GLU C CB    1 
ATOM   5295 C CG    . GLU B 1 309 ? 42.850  15.871  -43.367 1.00 36.61  ? 309  GLU C CG    1 
ATOM   5296 C CD    . GLU B 1 309 ? 42.410  16.252  -41.967 1.00 42.36  ? 309  GLU C CD    1 
ATOM   5297 O OE1   . GLU B 1 309 ? 41.711  17.276  -41.818 1.00 40.87  ? 309  GLU C OE1   1 
ATOM   5298 O OE2   . GLU B 1 309 ? 42.756  15.523  -41.017 1.00 41.26  ? 309  GLU C OE2   1 
ATOM   5299 N N     . GLU B 1 310 ? 45.990  15.624  -45.271 1.00 43.82  ? 310  GLU C N     1 
ATOM   5300 C CA    . GLU B 1 310 ? 46.686  16.731  -45.910 1.00 41.82  ? 310  GLU C CA    1 
ATOM   5301 C C     . GLU B 1 310 ? 46.596  16.610  -47.428 1.00 42.54  ? 310  GLU C C     1 
ATOM   5302 O O     . GLU B 1 310 ? 46.242  17.568  -48.116 1.00 44.08  ? 310  GLU C O     1 
ATOM   5303 C CB    . GLU B 1 310 ? 48.152  16.766  -45.492 1.00 45.69  ? 310  GLU C CB    1 
ATOM   5304 C CG    . GLU B 1 310 ? 48.395  17.214  -44.071 1.00 53.18  ? 310  GLU C CG    1 
ATOM   5305 C CD    . GLU B 1 310 ? 49.813  16.931  -43.632 1.00 62.69  ? 310  GLU C CD    1 
ATOM   5306 O OE1   . GLU B 1 310 ? 50.697  17.777  -43.877 1.00 68.70  ? 310  GLU C OE1   1 
ATOM   5307 O OE2   . GLU B 1 310 ? 50.048  15.850  -43.059 1.00 68.88  ? 310  GLU C OE2   1 
ATOM   5308 N N     . GLU B 1 311 ? 46.923  15.429  -47.945 1.00 43.18  ? 311  GLU C N     1 
ATOM   5309 C CA    . GLU B 1 311 ? 46.916  15.206  -49.386 1.00 44.42  ? 311  GLU C CA    1 
ATOM   5310 C C     . GLU B 1 311 ? 45.535  15.474  -49.956 1.00 37.29  ? 311  GLU C C     1 
ATOM   5311 O O     . GLU B 1 311 ? 45.409  16.114  -50.994 1.00 38.85  ? 311  GLU C O     1 
ATOM   5312 C CB    . GLU B 1 311 ? 47.387  13.791  -49.739 1.00 46.12  ? 311  GLU C CB    1 
ATOM   5313 C CG    . GLU B 1 311 ? 47.397  13.490  -51.242 1.00 45.17  ? 311  GLU C CG    1 
ATOM   5314 C CD    . GLU B 1 311 ? 48.400  14.337  -52.027 1.00 55.83  ? 311  GLU C CD    1 
ATOM   5315 O OE1   . GLU B 1 311 ? 48.286  14.393  -53.274 1.00 60.77  ? 311  GLU C OE1   1 
ATOM   5316 O OE2   . GLU B 1 311 ? 49.305  14.939  -51.408 1.00 52.32  ? 311  GLU C OE2   1 
ATOM   5317 N N     . LEU B 1 312 ? 44.493  15.024  -49.264 1.00 33.28  ? 312  LEU C N     1 
ATOM   5318 C CA    . LEU B 1 312 ? 43.140  15.240  -49.770 1.00 37.65  ? 312  LEU C CA    1 
ATOM   5319 C C     . LEU B 1 312 ? 42.752  16.709  -49.732 1.00 41.94  ? 312  LEU C C     1 
ATOM   5320 O O     . LEU B 1 312 ? 41.897  17.154  -50.502 1.00 38.29  ? 312  LEU C O     1 
ATOM   5321 C CB    . LEU B 1 312 ? 42.111  14.413  -49.000 1.00 29.96  ? 312  LEU C CB    1 
ATOM   5322 C CG    . LEU B 1 312 ? 42.185  12.901  -49.194 1.00 35.56  ? 312  LEU C CG    1 
ATOM   5323 C CD1   . LEU B 1 312 ? 41.017  12.235  -48.499 1.00 35.28  ? 312  LEU C CD1   1 
ATOM   5324 C CD2   . LEU B 1 312 ? 42.214  12.540  -50.675 1.00 37.64  ? 312  LEU C CD2   1 
ATOM   5325 N N     . ALA B 1 313 ? 43.377  17.459  -48.829 1.00 41.68  ? 313  ALA C N     1 
ATOM   5326 C CA    . ALA B 1 313 ? 43.036  18.863  -48.654 1.00 43.72  ? 313  ALA C CA    1 
ATOM   5327 C C     . ALA B 1 313 ? 43.409  19.704  -49.881 1.00 43.23  ? 313  ALA C C     1 
ATOM   5328 O O     . ALA B 1 313 ? 42.990  20.851  -49.996 1.00 44.13  ? 313  ALA C O     1 
ATOM   5329 C CB    . ALA B 1 313 ? 43.684  19.422  -47.385 1.00 35.66  ? 313  ALA C CB    1 
ATOM   5330 N N     . LYS B 1 314 ? 44.184  19.132  -50.801 1.00 46.56  ? 314  LYS C N     1 
ATOM   5331 C CA    . LYS B 1 314 ? 44.541  19.844  -52.032 1.00 44.83  ? 314  LYS C CA    1 
ATOM   5332 C C     . LYS B 1 314 ? 43.487  19.631  -53.118 1.00 46.45  ? 314  LYS C C     1 
ATOM   5333 O O     . LYS B 1 314 ? 43.605  20.169  -54.217 1.00 49.63  ? 314  LYS C O     1 
ATOM   5334 C CB    . LYS B 1 314 ? 45.919  19.413  -52.546 1.00 38.95  ? 314  LYS C CB    1 
ATOM   5335 C CG    . LYS B 1 314 ? 46.778  18.714  -51.503 1.00 53.49  ? 314  LYS C CG    1 
ATOM   5336 C CD    . LYS B 1 314 ? 48.264  18.997  -51.679 1.00 55.66  ? 314  LYS C CD    1 
ATOM   5337 C CE    . LYS B 1 314 ? 49.017  17.790  -52.214 1.00 55.51  ? 314  LYS C CE    1 
ATOM   5338 N NZ    . LYS B 1 314 ? 50.466  17.816  -51.844 1.00 51.15  ? 314  LYS C NZ    1 
ATOM   5339 N N     . ASP B 1 315 ? 42.447  18.863  -52.799 1.00 38.86  ? 315  ASP C N     1 
ATOM   5340 C CA    . ASP B 1 315 ? 41.460  18.454  -53.795 1.00 34.25  ? 315  ASP C CA    1 
ATOM   5341 C C     . ASP B 1 315 ? 40.050  18.984  -53.528 1.00 30.79  ? 315  ASP C C     1 
ATOM   5342 O O     . ASP B 1 315 ? 39.309  18.416  -52.731 1.00 37.20  ? 315  ASP C O     1 
ATOM   5343 C CB    . ASP B 1 315 ? 41.431  16.928  -53.892 1.00 33.89  ? 315  ASP C CB    1 
ATOM   5344 C CG    . ASP B 1 315 ? 40.697  16.434  -55.120 1.00 33.82  ? 315  ASP C CG    1 
ATOM   5345 O OD1   . ASP B 1 315 ? 40.929  15.278  -55.511 1.00 35.63  ? 315  ASP C OD1   1 
ATOM   5346 O OD2   . ASP B 1 315 ? 39.894  17.196  -55.697 1.00 38.60  ? 315  ASP C OD2   1 
ATOM   5347 N N     . PRO B 1 316 ? 39.663  20.067  -54.217 1.00 30.60  ? 316  PRO C N     1 
ATOM   5348 C CA    . PRO B 1 316 ? 38.331  20.644  -53.993 1.00 27.62  ? 316  PRO C CA    1 
ATOM   5349 C C     . PRO B 1 316 ? 37.208  19.669  -54.326 1.00 31.41  ? 316  PRO C C     1 
ATOM   5350 O O     . PRO B 1 316 ? 36.108  19.809  -53.798 1.00 34.32  ? 316  PRO C O     1 
ATOM   5351 C CB    . PRO B 1 316 ? 38.293  21.840  -54.961 1.00 31.71  ? 316  PRO C CB    1 
ATOM   5352 C CG    . PRO B 1 316 ? 39.738  22.186  -55.199 1.00 33.33  ? 316  PRO C CG    1 
ATOM   5353 C CD    . PRO B 1 316 ? 40.470  20.869  -55.159 1.00 34.67  ? 316  PRO C CD    1 
ATOM   5354 N N     . ARG B 1 317 ? 37.480  18.702  -55.200 1.00 30.89  ? 317  ARG C N     1 
ATOM   5355 C CA    . ARG B 1 317 ? 36.483  17.696  -55.550 1.00 31.30  ? 317  ARG C CA    1 
ATOM   5356 C C     . ARG B 1 317 ? 36.053  16.900  -54.312 1.00 29.42  ? 317  ARG C C     1 
ATOM   5357 O O     . ARG B 1 317 ? 34.879  16.565  -54.159 1.00 35.12  ? 317  ARG C O     1 
ATOM   5358 C CB    . ARG B 1 317 ? 37.012  16.769  -56.660 1.00 27.53  ? 317  ARG C CB    1 
ATOM   5359 C CG    . ARG B 1 317 ? 37.380  17.526  -57.962 1.00 32.43  ? 317  ARG C CG    1 
ATOM   5360 C CD    . ARG B 1 317 ? 38.163  16.644  -58.940 1.00 29.65  ? 317  ARG C CD    1 
ATOM   5361 N NE    . ARG B 1 317 ? 39.293  15.995  -58.283 1.00 26.54  ? 317  ARG C NE    1 
ATOM   5362 C CZ    . ARG B 1 317 ? 40.069  15.076  -58.845 1.00 31.08  ? 317  ARG C CZ    1 
ATOM   5363 N NH1   . ARG B 1 317 ? 39.861  14.690  -60.101 1.00 33.05  ? 317  ARG C NH1   1 
ATOM   5364 N NH2   . ARG B 1 317 ? 41.059  14.543  -58.151 1.00 29.91  ? 317  ARG C NH2   1 
ATOM   5365 N N     . ILE B 1 318 ? 37.002  16.613  -53.425 1.00 33.66  ? 318  ILE C N     1 
ATOM   5366 C CA    . ILE B 1 318 ? 36.699  15.891  -52.184 1.00 32.61  ? 318  ILE C CA    1 
ATOM   5367 C C     . ILE B 1 318 ? 35.820  16.748  -51.267 1.00 36.48  ? 318  ILE C C     1 
ATOM   5368 O O     . ILE B 1 318 ? 34.950  16.231  -50.563 1.00 35.06  ? 318  ILE C O     1 
ATOM   5369 C CB    . ILE B 1 318 ? 37.988  15.435  -51.459 1.00 27.69  ? 318  ILE C CB    1 
ATOM   5370 C CG1   . ILE B 1 318 ? 38.759  14.447  -52.332 1.00 26.12  ? 318  ILE C CG1   1 
ATOM   5371 C CG2   . ILE B 1 318 ? 37.677  14.823  -50.082 1.00 25.10  ? 318  ILE C CG2   1 
ATOM   5372 C CD1   . ILE B 1 318 ? 38.016  13.158  -52.613 1.00 29.15  ? 318  ILE C CD1   1 
ATOM   5373 N N     . ALA B 1 319 ? 36.035  18.062  -51.292 1.00 34.03  ? 319  ALA C N     1 
ATOM   5374 C CA    . ALA B 1 319 ? 35.172  18.971  -50.545 1.00 30.43  ? 319  ALA C CA    1 
ATOM   5375 C C     . ALA B 1 319 ? 33.712  18.785  -50.963 1.00 35.48  ? 319  ALA C C     1 
ATOM   5376 O O     . ALA B 1 319 ? 32.831  18.648  -50.117 1.00 36.06  ? 319  ALA C O     1 
ATOM   5377 C CB    . ALA B 1 319 ? 35.619  20.432  -50.723 1.00 26.09  ? 319  ALA C CB    1 
ATOM   5378 N N     . ALA B 1 320 ? 33.460  18.772  -52.270 1.00 33.60  ? 320  ALA C N     1 
ATOM   5379 C CA    . ALA B 1 320 ? 32.119  18.508  -52.790 1.00 33.79  ? 320  ALA C CA    1 
ATOM   5380 C C     . ALA B 1 320 ? 31.607  17.118  -52.387 1.00 29.61  ? 320  ALA C C     1 
ATOM   5381 O O     . ALA B 1 320 ? 30.423  16.932  -52.095 1.00 32.97  ? 320  ALA C O     1 
ATOM   5382 C CB    . ALA B 1 320 ? 32.098  18.657  -54.319 1.00 31.86  ? 320  ALA C CB    1 
ATOM   5383 N N     . THR B 1 321 ? 32.498  16.138  -52.388 1.00 29.66  ? 321  THR C N     1 
ATOM   5384 C CA    . THR B 1 321 ? 32.117  14.788  -51.983 1.00 30.72  ? 321  THR C CA    1 
ATOM   5385 C C     . THR B 1 321 ? 31.675  14.784  -50.520 1.00 36.10  ? 321  THR C C     1 
ATOM   5386 O O     . THR B 1 321 ? 30.662  14.178  -50.170 1.00 32.62  ? 321  THR C O     1 
ATOM   5387 C CB    . THR B 1 321 ? 33.277  13.795  -52.169 1.00 32.68  ? 321  THR C CB    1 
ATOM   5388 O OG1   . THR B 1 321 ? 33.658  13.755  -53.549 1.00 34.29  ? 321  THR C OG1   1 
ATOM   5389 C CG2   . THR B 1 321 ? 32.867  12.394  -51.726 1.00 31.99  ? 321  THR C CG2   1 
ATOM   5390 N N     . MET B 1 322 ? 32.431  15.474  -49.671 1.00 37.33  ? 322  MET C N     1 
ATOM   5391 C CA    . MET B 1 322 ? 32.111  15.525  -48.250 1.00 40.24  ? 322  MET C CA    1 
ATOM   5392 C C     . MET B 1 322 ? 30.784  16.229  -48.008 1.00 39.38  ? 322  MET C C     1 
ATOM   5393 O O     . MET B 1 322 ? 29.982  15.803  -47.177 1.00 35.66  ? 322  MET C O     1 
ATOM   5394 C CB    . MET B 1 322 ? 33.234  16.192  -47.459 1.00 38.57  ? 322  MET C CB    1 
ATOM   5395 C CG    . MET B 1 322 ? 34.441  15.289  -47.260 1.00 35.70  ? 322  MET C CG    1 
ATOM   5396 S SD    . MET B 1 322 ? 35.676  15.993  -46.152 1.00 51.90  ? 322  MET C SD    1 
ATOM   5397 C CE    . MET B 1 322 ? 36.331  17.321  -47.166 1.00 39.93  ? 322  MET C CE    1 
ATOM   5398 N N     . GLU B 1 323 ? 30.538  17.285  -48.769 1.00 36.79  ? 323  GLU C N     1 
ATOM   5399 C CA    . GLU B 1 323 ? 29.319  18.059  -48.609 1.00 35.64  ? 323  GLU C CA    1 
ATOM   5400 C C     . GLU B 1 323 ? 28.097  17.237  -48.980 1.00 38.46  ? 323  GLU C C     1 
ATOM   5401 O O     . GLU B 1 323 ? 27.081  17.284  -48.288 1.00 42.31  ? 323  GLU C O     1 
ATOM   5402 C CB    . GLU B 1 323 ? 29.391  19.335  -49.443 1.00 45.32  ? 323  GLU C CB    1 
ATOM   5403 C CG    . GLU B 1 323 ? 28.224  20.278  -49.253 1.00 50.31  ? 323  GLU C CG    1 
ATOM   5404 C CD    . GLU B 1 323 ? 28.370  21.547  -50.075 1.00 58.74  ? 323  GLU C CD    1 
ATOM   5405 O OE1   . GLU B 1 323 ? 29.438  21.741  -50.710 1.00 50.26  ? 323  GLU C OE1   1 
ATOM   5406 O OE2   . GLU B 1 323 ? 27.412  22.348  -50.086 1.00 68.74  ? 323  GLU C OE2   1 
ATOM   5407 N N     . ASN B 1 324 ? 28.188  16.474  -50.065 1.00 40.06  ? 324  ASN C N     1 
ATOM   5408 C CA    . ASN B 1 324 ? 27.089  15.586  -50.433 1.00 40.38  ? 324  ASN C CA    1 
ATOM   5409 C C     . ASN B 1 324 ? 26.938  14.406  -49.469 1.00 39.56  ? 324  ASN C C     1 
ATOM   5410 O O     . ASN B 1 324 ? 25.829  13.935  -49.222 1.00 38.34  ? 324  ASN C O     1 
ATOM   5411 C CB    . ASN B 1 324 ? 27.226  15.097  -51.880 1.00 37.89  ? 324  ASN C CB    1 
ATOM   5412 C CG    . ASN B 1 324 ? 26.819  16.150  -52.887 1.00 40.73  ? 324  ASN C CG    1 
ATOM   5413 O OD1   . ASN B 1 324 ? 25.700  16.659  -52.848 1.00 44.50  ? 324  ASN C OD1   1 
ATOM   5414 N ND2   . ASN B 1 324 ? 27.727  16.487  -53.795 1.00 37.04  ? 324  ASN C ND2   1 
ATOM   5415 N N     . ALA B 1 325 ? 28.051  13.935  -48.921 1.00 38.52  ? 325  ALA C N     1 
ATOM   5416 C CA    . ALA B 1 325 ? 27.998  12.855  -47.938 1.00 40.36  ? 325  ALA C CA    1 
ATOM   5417 C C     . ALA B 1 325 ? 27.265  13.297  -46.661 1.00 39.22  ? 325  ALA C C     1 
ATOM   5418 O O     . ALA B 1 325 ? 26.374  12.602  -46.178 1.00 35.57  ? 325  ALA C O     1 
ATOM   5419 C CB    . ALA B 1 325 ? 29.401  12.356  -47.613 1.00 39.01  ? 325  ALA C CB    1 
ATOM   5420 N N     . GLN B 1 326 ? 27.635  14.461  -46.133 1.00 40.00  ? 326  GLN C N     1 
ATOM   5421 C CA    . GLN B 1 326 ? 26.982  15.010  -44.943 1.00 44.32  ? 326  GLN C CA    1 
ATOM   5422 C C     . GLN B 1 326 ? 25.476  15.125  -45.112 1.00 45.66  ? 326  GLN C C     1 
ATOM   5423 O O     . GLN B 1 326 ? 24.727  15.023  -44.143 1.00 46.89  ? 326  GLN C O     1 
ATOM   5424 C CB    . GLN B 1 326 ? 27.533  16.391  -44.607 1.00 44.08  ? 326  GLN C CB    1 
ATOM   5425 C CG    . GLN B 1 326 ? 28.839  16.377  -43.869 1.00 56.20  ? 326  GLN C CG    1 
ATOM   5426 C CD    . GLN B 1 326 ? 29.305  17.772  -43.536 1.00 64.17  ? 326  GLN C CD    1 
ATOM   5427 O OE1   . GLN B 1 326 ? 29.060  18.708  -44.294 1.00 73.74  ? 326  GLN C OE1   1 
ATOM   5428 N NE2   . GLN B 1 326 ? 29.967  17.927  -42.393 1.00 63.73  ? 326  GLN C NE2   1 
ATOM   5429 N N     . LYS B 1 327 ? 25.031  15.353  -46.340 1.00 43.34  ? 327  LYS C N     1 
ATOM   5430 C CA    . LYS B 1 327 ? 23.608  15.533  -46.583 1.00 41.58  ? 327  LYS C CA    1 
ATOM   5431 C C     . LYS B 1 327 ? 22.890  14.219  -46.831 1.00 37.23  ? 327  LYS C C     1 
ATOM   5432 O O     . LYS B 1 327 ? 21.666  14.168  -46.807 1.00 43.32  ? 327  LYS C O     1 
ATOM   5433 C CB    . LYS B 1 327 ? 23.371  16.514  -47.736 1.00 43.69  ? 327  LYS C CB    1 
ATOM   5434 C CG    . LYS B 1 327 ? 23.557  17.965  -47.313 1.00 51.03  ? 327  LYS C CG    1 
ATOM   5435 C CD    . LYS B 1 327 ? 23.677  18.901  -48.505 1.00 53.51  ? 327  LYS C CD    1 
ATOM   5436 C CE    . LYS B 1 327 ? 23.802  20.354  -48.043 1.00 51.48  ? 327  LYS C CE    1 
ATOM   5437 N NZ    . LYS B 1 327 ? 23.964  21.282  -49.199 1.00 58.37  ? 327  LYS C NZ    1 
ATOM   5438 N N     . GLY B 1 328 ? 23.654  13.157  -47.064 1.00 36.64  ? 328  GLY C N     1 
ATOM   5439 C CA    . GLY B 1 328 ? 23.069  11.865  -47.369 1.00 40.00  ? 328  GLY C CA    1 
ATOM   5440 C C     . GLY B 1 328 ? 22.888  10.995  -46.140 1.00 48.11  ? 328  GLY C C     1 
ATOM   5441 O O     . GLY B 1 328 ? 23.060  11.453  -45.008 1.00 52.79  ? 328  GLY C O     1 
ATOM   5442 N N     . GLU B 1 329 ? 22.533  9.734   -46.364 1.00 53.96  ? 329  GLU C N     1 
ATOM   5443 C CA    . GLU B 1 329 ? 22.396  8.774   -45.271 1.00 55.28  ? 329  GLU C CA    1 
ATOM   5444 C C     . GLU B 1 329 ? 23.339  7.600   -45.463 1.00 49.95  ? 329  GLU C C     1 
ATOM   5445 O O     . GLU B 1 329 ? 23.447  7.050   -46.570 1.00 44.92  ? 329  GLU C O     1 
ATOM   5446 C CB    . GLU B 1 329 ? 20.955  8.270   -45.167 1.00 60.98  ? 329  GLU C CB    1 
ATOM   5447 C CG    . GLU B 1 329 ? 19.961  9.324   -44.697 1.00 70.89  ? 329  GLU C CG    1 
ATOM   5448 C CD    . GLU B 1 329 ? 20.326  9.919   -43.345 1.00 75.75  ? 329  GLU C CD    1 
ATOM   5449 O OE1   . GLU B 1 329 ? 20.981  9.217   -42.538 1.00 78.91  ? 329  GLU C OE1   1 
ATOM   5450 O OE2   . GLU B 1 329 ? 19.961  11.091  -43.095 1.00 65.88  ? 329  GLU C OE2   1 
ATOM   5451 N N     . ILE B 1 330 ? 24.024  7.216   -44.388 1.00 44.14  ? 330  ILE C N     1 
ATOM   5452 C CA    . ILE B 1 330 ? 24.907  6.060   -44.435 1.00 48.47  ? 330  ILE C CA    1 
ATOM   5453 C C     . ILE B 1 330 ? 24.097  4.817   -44.786 1.00 44.98  ? 330  ILE C C     1 
ATOM   5454 O O     . ILE B 1 330 ? 23.044  4.578   -44.202 1.00 51.80  ? 330  ILE C O     1 
ATOM   5455 C CB    . ILE B 1 330 ? 25.615  5.829   -43.099 1.00 52.49  ? 330  ILE C CB    1 
ATOM   5456 C CG1   . ILE B 1 330 ? 26.034  7.160   -42.478 1.00 58.53  ? 330  ILE C CG1   1 
ATOM   5457 C CG2   . ILE B 1 330 ? 26.821  4.925   -43.299 1.00 52.15  ? 330  ILE C CG2   1 
ATOM   5458 C CD1   . ILE B 1 330 ? 27.076  7.896   -43.284 1.00 58.55  ? 330  ILE C CD1   1 
ATOM   5459 N N     . MET B 1 331 ? 24.573  4.044   -45.756 1.00 36.65  ? 331  MET C N     1 
ATOM   5460 C CA    . MET B 1 331 ? 23.907  2.799   -46.113 1.00 40.78  ? 331  MET C CA    1 
ATOM   5461 C C     . MET B 1 331 ? 23.976  1.824   -44.947 1.00 43.00  ? 331  MET C C     1 
ATOM   5462 O O     . MET B 1 331 ? 25.039  1.632   -44.358 1.00 41.30  ? 331  MET C O     1 
ATOM   5463 C CB    . MET B 1 331 ? 24.558  2.152   -47.335 1.00 43.62  ? 331  MET C CB    1 
ATOM   5464 C CG    . MET B 1 331 ? 24.296  2.874   -48.636 1.00 47.58  ? 331  MET C CG    1 
ATOM   5465 S SD    . MET B 1 331 ? 24.883  1.936   -50.050 1.00 45.94  ? 331  MET C SD    1 
ATOM   5466 C CE    . MET B 1 331 ? 26.643  1.969   -49.769 1.00 30.01  ? 331  MET C CE    1 
ATOM   5467 N N     . PRO B 1 332 ? 22.839  1.212   -44.601 1.00 47.60  ? 332  PRO C N     1 
ATOM   5468 C CA    . PRO B 1 332 ? 22.876  0.118   -43.625 1.00 51.81  ? 332  PRO C CA    1 
ATOM   5469 C C     . PRO B 1 332 ? 23.608  -1.071  -44.237 1.00 50.04  ? 332  PRO C C     1 
ATOM   5470 O O     . PRO B 1 332 ? 23.637  -1.183  -45.465 1.00 46.83  ? 332  PRO C O     1 
ATOM   5471 C CB    . PRO B 1 332 ? 21.397  -0.227  -43.425 1.00 50.26  ? 332  PRO C CB    1 
ATOM   5472 C CG    . PRO B 1 332 ? 20.635  0.976   -43.918 1.00 56.73  ? 332  PRO C CG    1 
ATOM   5473 C CD    . PRO B 1 332 ? 21.469  1.544   -45.024 1.00 49.45  ? 332  PRO C CD    1 
ATOM   5474 N N     . ASN B 1 333 ? 24.199  -1.930  -43.408 1.00 49.54  ? 333  ASN C N     1 
ATOM   5475 C CA    . ASN B 1 333 ? 24.841  -3.150  -43.902 1.00 45.13  ? 333  ASN C CA    1 
ATOM   5476 C C     . ASN B 1 333 ? 24.055  -4.428  -43.589 1.00 48.27  ? 333  ASN C C     1 
ATOM   5477 O O     . ASN B 1 333 ? 24.558  -5.530  -43.778 1.00 48.01  ? 333  ASN C O     1 
ATOM   5478 C CB    . ASN B 1 333 ? 26.277  -3.275  -43.379 1.00 42.45  ? 333  ASN C CB    1 
ATOM   5479 C CG    . ASN B 1 333 ? 26.340  -3.475  -41.867 1.00 48.40  ? 333  ASN C CG    1 
ATOM   5480 O OD1   . ASN B 1 333 ? 25.317  -3.444  -41.181 1.00 39.21  ? 333  ASN C OD1   1 
ATOM   5481 N ND2   . ASN B 1 333 ? 27.546  -3.686  -41.345 1.00 41.24  ? 333  ASN C ND2   1 
ATOM   5482 N N     . ILE B 1 334 ? 22.821  -4.276  -43.118 1.00 54.66  ? 334  ILE C N     1 
ATOM   5483 C CA    . ILE B 1 334 ? 22.004  -5.431  -42.755 1.00 55.04  ? 334  ILE C CA    1 
ATOM   5484 C C     . ILE B 1 334 ? 21.700  -6.295  -43.979 1.00 54.40  ? 334  ILE C C     1 
ATOM   5485 O O     . ILE B 1 334 ? 21.685  -5.799  -45.104 1.00 47.71  ? 334  ILE C O     1 
ATOM   5486 C CB    . ILE B 1 334 ? 20.698  -5.014  -42.042 1.00 51.00  ? 334  ILE C CB    1 
ATOM   5487 C CG1   . ILE B 1 334 ? 19.734  -4.335  -43.015 1.00 52.86  ? 334  ILE C CG1   1 
ATOM   5488 C CG2   . ILE B 1 334 ? 21.003  -4.105  -40.852 1.00 47.10  ? 334  ILE C CG2   1 
ATOM   5489 C CD1   . ILE B 1 334 ? 18.495  -3.748  -42.342 1.00 48.18  ? 334  ILE C CD1   1 
ATOM   5490 N N     . PRO B 1 335 ? 21.473  -7.601  -43.757 1.00 48.72  ? 335  PRO C N     1 
ATOM   5491 C CA    . PRO B 1 335 ? 21.271  -8.588  -44.824 1.00 48.33  ? 335  PRO C CA    1 
ATOM   5492 C C     . PRO B 1 335 ? 20.097  -8.259  -45.742 1.00 47.91  ? 335  PRO C C     1 
ATOM   5493 O O     . PRO B 1 335 ? 20.088  -8.680  -46.903 1.00 44.24  ? 335  PRO C O     1 
ATOM   5494 C CB    . PRO B 1 335 ? 20.967  -9.880  -44.051 1.00 53.42  ? 335  PRO C CB    1 
ATOM   5495 C CG    . PRO B 1 335 ? 21.609  -9.691  -42.727 1.00 55.17  ? 335  PRO C CG    1 
ATOM   5496 C CD    . PRO B 1 335 ? 21.465  -8.225  -42.421 1.00 57.62  ? 335  PRO C CD    1 
ATOM   5497 N N     . GLN B 1 336 ? 19.109  -7.537  -45.224 1.00 43.64  ? 336  GLN C N     1 
ATOM   5498 C CA    . GLN B 1 336 ? 17.925  -7.230  -46.016 1.00 56.72  ? 336  GLN C CA    1 
ATOM   5499 C C     . GLN B 1 336 ? 18.194  -6.095  -46.997 1.00 57.51  ? 336  GLN C C     1 
ATOM   5500 O O     . GLN B 1 336 ? 17.283  -5.609  -47.658 1.00 58.55  ? 336  GLN C O     1 
ATOM   5501 C CB    . GLN B 1 336 ? 16.728  -6.899  -45.120 1.00 62.26  ? 336  GLN C CB    1 
ATOM   5502 C CG    . GLN B 1 336 ? 17.093  -6.442  -43.727 1.00 63.86  ? 336  GLN C CG    1 
ATOM   5503 C CD    . GLN B 1 336 ? 17.199  -7.587  -42.739 1.00 64.13  ? 336  GLN C CD    1 
ATOM   5504 O OE1   . GLN B 1 336 ? 16.532  -7.590  -41.707 1.00 66.17  ? 336  GLN C OE1   1 
ATOM   5505 N NE2   . GLN B 1 336 ? 18.044  -8.563  -43.047 1.00 64.82  ? 336  GLN C NE2   1 
ATOM   5506 N N     . MET B 1 337 ? 19.454  -5.685  -47.084 1.00 52.84  ? 337  MET C N     1 
ATOM   5507 C CA    . MET B 1 337 ? 19.860  -4.625  -47.996 1.00 58.12  ? 337  MET C CA    1 
ATOM   5508 C C     . MET B 1 337 ? 19.845  -5.165  -49.425 1.00 62.59  ? 337  MET C C     1 
ATOM   5509 O O     . MET B 1 337 ? 19.393  -4.494  -50.353 1.00 59.41  ? 337  MET C O     1 
ATOM   5510 C CB    . MET B 1 337 ? 21.255  -4.123  -47.622 1.00 52.78  ? 337  MET C CB    1 
ATOM   5511 C CG    . MET B 1 337 ? 21.465  -2.637  -47.805 1.00 67.68  ? 337  MET C CG    1 
ATOM   5512 S SD    . MET B 1 337 ? 20.178  -1.629  -47.054 1.00 57.56  ? 337  MET C SD    1 
ATOM   5513 C CE    . MET B 1 337 ? 20.122  -2.334  -45.418 1.00 201.19 ? 337  MET C CE    1 
ATOM   5514 N N     . SER B 1 338 ? 20.320  -6.396  -49.584 1.00 62.51  ? 338  SER C N     1 
ATOM   5515 C CA    . SER B 1 338 ? 20.394  -7.039  -50.890 1.00 63.63  ? 338  SER C CA    1 
ATOM   5516 C C     . SER B 1 338 ? 19.039  -7.103  -51.592 1.00 62.52  ? 338  SER C C     1 
ATOM   5517 O O     . SER B 1 338 ? 18.959  -7.007  -52.817 1.00 64.91  ? 338  SER C O     1 
ATOM   5518 C CB    . SER B 1 338 ? 20.968  -8.448  -50.746 1.00 67.92  ? 338  SER C CB    1 
ATOM   5519 O OG    . SER B 1 338 ? 20.891  -9.150  -51.971 1.00 69.32  ? 338  SER C OG    1 
ATOM   5520 N N     . ALA B 1 339 ? 17.977  -7.271  -50.813 1.00 58.52  ? 339  ALA C N     1 
ATOM   5521 C CA    . ALA B 1 339 ? 16.634  -7.386  -51.368 1.00 61.02  ? 339  ALA C CA    1 
ATOM   5522 C C     . ALA B 1 339 ? 16.019  -6.009  -51.554 1.00 57.96  ? 339  ALA C C     1 
ATOM   5523 O O     . ALA B 1 339 ? 15.180  -5.800  -52.431 1.00 56.39  ? 339  ALA C O     1 
ATOM   5524 C CB    . ALA B 1 339 ? 15.757  -8.241  -50.466 1.00 64.31  ? 339  ALA C CB    1 
ATOM   5525 N N     . PHE B 1 340 ? 16.438  -5.082  -50.699 1.00 59.71  ? 340  PHE C N     1 
ATOM   5526 C CA    . PHE B 1 340 ? 16.069  -3.679  -50.808 1.00 54.42  ? 340  PHE C CA    1 
ATOM   5527 C C     . PHE B 1 340 ? 16.494  -3.132  -52.171 1.00 57.39  ? 340  PHE C C     1 
ATOM   5528 O O     . PHE B 1 340 ? 15.681  -2.584  -52.918 1.00 56.75  ? 340  PHE C O     1 
ATOM   5529 C CB    . PHE B 1 340 ? 16.741  -2.888  -49.681 1.00 51.84  ? 340  PHE C CB    1 
ATOM   5530 C CG    . PHE B 1 340 ? 16.677  -1.398  -49.858 1.00 54.18  ? 340  PHE C CG    1 
ATOM   5531 C CD1   . PHE B 1 340 ? 15.539  -0.694  -49.507 1.00 58.41  ? 340  PHE C CD1   1 
ATOM   5532 C CD2   . PHE B 1 340 ? 17.763  -0.698  -50.369 1.00 45.49  ? 340  PHE C CD2   1 
ATOM   5533 C CE1   . PHE B 1 340 ? 15.481  0.683   -49.668 1.00 56.69  ? 340  PHE C CE1   1 
ATOM   5534 C CE2   . PHE B 1 340 ? 17.708  0.671   -50.533 1.00 45.85  ? 340  PHE C CE2   1 
ATOM   5535 C CZ    . PHE B 1 340 ? 16.567  1.362   -50.184 1.00 50.48  ? 340  PHE C CZ    1 
ATOM   5536 N N     . TRP B 1 341 ? 17.773  -3.301  -52.492 1.00 55.70  ? 341  TRP C N     1 
ATOM   5537 C CA    . TRP B 1 341 ? 18.316  -2.819  -53.757 1.00 52.80  ? 341  TRP C CA    1 
ATOM   5538 C C     . TRP B 1 341 ? 17.566  -3.391  -54.948 1.00 59.23  ? 341  TRP C C     1 
ATOM   5539 O O     . TRP B 1 341 ? 17.108  -2.646  -55.816 1.00 60.78  ? 341  TRP C O     1 
ATOM   5540 C CB    . TRP B 1 341 ? 19.807  -3.141  -53.874 1.00 40.05  ? 341  TRP C CB    1 
ATOM   5541 C CG    . TRP B 1 341 ? 20.682  -2.255  -53.034 1.00 40.40  ? 341  TRP C CG    1 
ATOM   5542 C CD1   . TRP B 1 341 ? 21.650  -2.650  -52.155 1.00 44.89  ? 341  TRP C CD1   1 
ATOM   5543 C CD2   . TRP B 1 341 ? 20.662  -0.823  -52.989 1.00 34.77  ? 341  TRP C CD2   1 
ATOM   5544 N NE1   . TRP B 1 341 ? 22.237  -1.553  -51.575 1.00 45.34  ? 341  TRP C NE1   1 
ATOM   5545 C CE2   . TRP B 1 341 ? 21.647  -0.420  -52.068 1.00 37.96  ? 341  TRP C CE2   1 
ATOM   5546 C CE3   . TRP B 1 341 ? 19.909  0.156   -53.643 1.00 41.25  ? 341  TRP C CE3   1 
ATOM   5547 C CZ2   . TRP B 1 341 ? 21.898  0.921   -51.782 1.00 40.77  ? 341  TRP C CZ2   1 
ATOM   5548 C CZ3   . TRP B 1 341 ? 20.161  1.484   -53.363 1.00 46.54  ? 341  TRP C CZ3   1 
ATOM   5549 C CH2   . TRP B 1 341 ? 21.148  1.854   -52.441 1.00 48.60  ? 341  TRP C CH2   1 
ATOM   5550 N N     . TYR B 1 342 ? 17.444  -4.713  -54.992 1.00 62.45  ? 342  TYR C N     1 
ATOM   5551 C CA    . TYR B 1 342 ? 16.759  -5.363  -56.101 1.00 68.46  ? 342  TYR C CA    1 
ATOM   5552 C C     . TYR B 1 342 ? 15.326  -4.856  -56.231 1.00 65.19  ? 342  TYR C C     1 
ATOM   5553 O O     . TYR B 1 342 ? 14.807  -4.705  -57.339 1.00 61.06  ? 342  TYR C O     1 
ATOM   5554 C CB    . TYR B 1 342 ? 16.767  -6.882  -55.943 1.00 75.22  ? 342  TYR C CB    1 
ATOM   5555 C CG    . TYR B 1 342 ? 16.068  -7.589  -57.079 1.00 85.72  ? 342  TYR C CG    1 
ATOM   5556 C CD1   . TYR B 1 342 ? 16.769  -7.980  -58.213 1.00 90.95  ? 342  TYR C CD1   1 
ATOM   5557 C CD2   . TYR B 1 342 ? 14.704  -7.848  -57.026 1.00 90.43  ? 342  TYR C CD2   1 
ATOM   5558 C CE1   . TYR B 1 342 ? 16.132  -8.620  -59.261 1.00 94.77  ? 342  TYR C CE1   1 
ATOM   5559 C CE2   . TYR B 1 342 ? 14.058  -8.486  -58.069 1.00 96.28  ? 342  TYR C CE2   1 
ATOM   5560 C CZ    . TYR B 1 342 ? 14.778  -8.871  -59.184 1.00 96.56  ? 342  TYR C CZ    1 
ATOM   5561 O OH    . TYR B 1 342 ? 14.143  -9.508  -60.225 1.00 96.55  ? 342  TYR C OH    1 
ATOM   5562 N N     . ALA B 1 343 ? 14.696  -4.594  -55.090 1.00 62.33  ? 343  ALA C N     1 
ATOM   5563 C CA    . ALA B 1 343 ? 13.335  -4.074  -55.066 1.00 62.06  ? 343  ALA C CA    1 
ATOM   5564 C C     . ALA B 1 343 ? 13.261  -2.668  -55.657 1.00 56.55  ? 343  ALA C C     1 
ATOM   5565 O O     . ALA B 1 343 ? 12.412  -2.381  -56.498 1.00 52.94  ? 343  ALA C O     1 
ATOM   5566 C CB    . ALA B 1 343 ? 12.801  -4.071  -53.644 1.00 63.21  ? 343  ALA C CB    1 
ATOM   5567 N N     . VAL B 1 344 ? 14.146  -1.790  -55.199 1.00 54.20  ? 344  VAL C N     1 
ATOM   5568 C CA    . VAL B 1 344 ? 14.144  -0.410  -55.657 1.00 49.44  ? 344  VAL C CA    1 
ATOM   5569 C C     . VAL B 1 344 ? 14.619  -0.323  -57.100 1.00 48.01  ? 344  VAL C C     1 
ATOM   5570 O O     . VAL B 1 344 ? 14.124  0.496   -57.874 1.00 58.06  ? 344  VAL C O     1 
ATOM   5571 C CB    . VAL B 1 344 ? 15.016  0.482   -54.761 1.00 49.02  ? 344  VAL C CB    1 
ATOM   5572 C CG1   . VAL B 1 344 ? 15.008  1.912   -55.276 1.00 43.85  ? 344  VAL C CG1   1 
ATOM   5573 C CG2   . VAL B 1 344 ? 14.508  0.434   -53.333 1.00 51.12  ? 344  VAL C CG2   1 
ATOM   5574 N N     . ARG B 1 345 ? 15.570  -1.179  -57.463 1.00 45.06  ? 345  ARG C N     1 
ATOM   5575 C CA    . ARG B 1 345 ? 16.057  -1.221  -58.832 1.00 45.57  ? 345  ARG C CA    1 
ATOM   5576 C C     . ARG B 1 345 ? 14.902  -1.477  -59.778 1.00 54.72  ? 345  ARG C C     1 
ATOM   5577 O O     . ARG B 1 345 ? 14.755  -0.807  -60.804 1.00 56.89  ? 345  ARG C O     1 
ATOM   5578 C CB    . ARG B 1 345 ? 17.112  -2.310  -59.013 1.00 42.45  ? 345  ARG C CB    1 
ATOM   5579 C CG    . ARG B 1 345 ? 17.501  -2.508  -60.472 1.00 43.89  ? 345  ARG C CG    1 
ATOM   5580 C CD    . ARG B 1 345 ? 18.742  -3.362  -60.626 1.00 56.57  ? 345  ARG C CD    1 
ATOM   5581 N NE    . ARG B 1 345 ? 18.786  -3.978  -61.952 1.00 80.25  ? 345  ARG C NE    1 
ATOM   5582 C CZ    . ARG B 1 345 ? 19.592  -3.598  -62.940 1.00 90.89  ? 345  ARG C CZ    1 
ATOM   5583 N NH1   . ARG B 1 345 ? 20.452  -2.604  -62.761 1.00 95.02  ? 345  ARG C NH1   1 
ATOM   5584 N NH2   . ARG B 1 345 ? 19.546  -4.224  -64.109 1.00 90.45  ? 345  ARG C NH2   1 
ATOM   5585 N N     . THR B 1 346 ? 14.083  -2.455  -59.419 1.00 55.22  ? 346  THR C N     1 
ATOM   5586 C CA    . THR B 1 346 ? 12.974  -2.877  -60.256 1.00 57.69  ? 346  THR C CA    1 
ATOM   5587 C C     . THR B 1 346 ? 11.915  -1.784  -60.328 1.00 56.22  ? 346  THR C C     1 
ATOM   5588 O O     . THR B 1 346 ? 11.296  -1.571  -61.368 1.00 55.34  ? 346  THR C O     1 
ATOM   5589 C CB    . THR B 1 346 ? 12.366  -4.204  -59.738 1.00 54.89  ? 346  THR C CB    1 
ATOM   5590 O OG1   . THR B 1 346 ? 13.292  -5.272  -59.978 1.00 48.71  ? 346  THR C OG1   1 
ATOM   5591 C CG2   . THR B 1 346 ? 11.059  -4.518  -60.447 1.00 51.04  ? 346  THR C CG2   1 
ATOM   5592 N N     . ALA B 1 347 ? 11.725  -1.079  -59.219 1.00 52.27  ? 347  ALA C N     1 
ATOM   5593 C CA    . ALA B 1 347 ? 10.752  0.004   -59.165 1.00 51.70  ? 347  ALA C CA    1 
ATOM   5594 C C     . ALA B 1 347 ? 11.163  1.184   -60.042 1.00 61.45  ? 347  ALA C C     1 
ATOM   5595 O O     . ALA B 1 347 ? 10.370  1.674   -60.849 1.00 66.43  ? 347  ALA C O     1 
ATOM   5596 C CB    . ALA B 1 347 ? 10.550  0.457   -57.735 1.00 48.62  ? 347  ALA C CB    1 
ATOM   5597 N N     . VAL B 1 348 ? 12.399  1.646   -59.877 1.00 57.40  ? 348  VAL C N     1 
ATOM   5598 C CA    . VAL B 1 348 ? 12.882  2.778   -60.665 1.00 54.28  ? 348  VAL C CA    1 
ATOM   5599 C C     . VAL B 1 348 ? 12.792  2.466   -62.151 1.00 54.50  ? 348  VAL C C     1 
ATOM   5600 O O     . VAL B 1 348 ? 12.308  3.276   -62.936 1.00 57.10  ? 348  VAL C O     1 
ATOM   5601 C CB    . VAL B 1 348 ? 14.337  3.150   -60.318 1.00 43.82  ? 348  VAL C CB    1 
ATOM   5602 C CG1   . VAL B 1 348 ? 14.833  4.253   -61.232 1.00 39.26  ? 348  VAL C CG1   1 
ATOM   5603 C CG2   . VAL B 1 348 ? 14.444  3.571   -58.860 1.00 33.96  ? 348  VAL C CG2   1 
ATOM   5604 N N     . ILE B 1 349 ? 13.250  1.280   -62.535 1.00 52.11  ? 349  ILE C N     1 
ATOM   5605 C CA    . ILE B 1 349 ? 13.260  0.906   -63.941 1.00 46.93  ? 349  ILE C CA    1 
ATOM   5606 C C     . ILE B 1 349 ? 11.849  0.771   -64.496 1.00 52.86  ? 349  ILE C C     1 
ATOM   5607 O O     . ILE B 1 349 ? 11.597  1.116   -65.648 1.00 64.28  ? 349  ILE C O     1 
ATOM   5608 C CB    . ILE B 1 349 ? 14.048  -0.392  -64.170 1.00 55.32  ? 349  ILE C CB    1 
ATOM   5609 C CG1   . ILE B 1 349 ? 15.537  -0.147  -63.916 1.00 54.32  ? 349  ILE C CG1   1 
ATOM   5610 C CG2   . ILE B 1 349 ? 13.831  -0.911  -65.582 1.00 59.25  ? 349  ILE C CG2   1 
ATOM   5611 C CD1   . ILE B 1 349 ? 16.411  -1.351  -64.196 1.00 52.36  ? 349  ILE C CD1   1 
ATOM   5612 N N     . ASN B 1 350 ? 10.924  0.285   -63.675 1.00 51.64  ? 350  ASN C N     1 
ATOM   5613 C CA    . ASN B 1 350 ? 9.552   0.087   -64.132 1.00 53.21  ? 350  ASN C CA    1 
ATOM   5614 C C     . ASN B 1 350 ? 8.784   1.387   -64.259 1.00 46.05  ? 350  ASN C C     1 
ATOM   5615 O O     . ASN B 1 350 ? 7.986   1.560   -65.176 1.00 49.90  ? 350  ASN C O     1 
ATOM   5616 C CB    . ASN B 1 350 ? 8.794   -0.862  -63.203 1.00 53.72  ? 350  ASN C CB    1 
ATOM   5617 C CG    . ASN B 1 350 ? 9.082   -2.310  -63.496 1.00 54.72  ? 350  ASN C CG    1 
ATOM   5618 O OD1   . ASN B 1 350 ? 9.833   -2.628  -64.415 1.00 51.27  ? 350  ASN C OD1   1 
ATOM   5619 N ND2   . ASN B 1 350 ? 8.493   -3.205  -62.706 1.00 62.18  ? 350  ASN C ND2   1 
ATOM   5620 N N     . ALA B 1 351 ? 9.005   2.289   -63.316 1.00 49.37  ? 351  ALA C N     1 
ATOM   5621 C CA    . ALA B 1 351 ? 8.384   3.603   -63.382 1.00 51.04  ? 351  ALA C CA    1 
ATOM   5622 C C     . ALA B 1 351 ? 8.931   4.358   -64.593 1.00 53.77  ? 351  ALA C C     1 
ATOM   5623 O O     . ALA B 1 351 ? 8.175   4.946   -65.371 1.00 52.24  ? 351  ALA C O     1 
ATOM   5624 C CB    . ALA B 1 351 ? 8.651   4.373   -62.102 1.00 48.51  ? 351  ALA C CB    1 
ATOM   5625 N N     . ALA B 1 352 ? 10.251  4.305   -64.753 1.00 52.21  ? 352  ALA C N     1 
ATOM   5626 C CA    . ALA B 1 352 ? 10.950  4.993   -65.836 1.00 52.73  ? 352  ALA C CA    1 
ATOM   5627 C C     . ALA B 1 352 ? 10.457  4.578   -67.215 1.00 56.50  ? 352  ALA C C     1 
ATOM   5628 O O     . ALA B 1 352 ? 10.267  5.420   -68.095 1.00 62.34  ? 352  ALA C O     1 
ATOM   5629 C CB    . ALA B 1 352 ? 12.449  4.758   -65.724 1.00 46.11  ? 352  ALA C CB    1 
ATOM   5630 N N     . SER B 1 353 ? 10.263  3.276   -67.400 1.00 56.88  ? 353  SER C N     1 
ATOM   5631 C CA    . SER B 1 353 ? 9.836   2.736   -68.688 1.00 56.36  ? 353  SER C CA    1 
ATOM   5632 C C     . SER B 1 353 ? 8.323   2.800   -68.823 1.00 56.75  ? 353  SER C C     1 
ATOM   5633 O O     . SER B 1 353 ? 7.777   2.565   -69.902 1.00 53.07  ? 353  SER C O     1 
ATOM   5634 C CB    . SER B 1 353 ? 10.303  1.290   -68.843 1.00 58.28  ? 353  SER C CB    1 
ATOM   5635 O OG    . SER B 1 353 ? 9.749   0.482   -67.820 1.00 65.01  ? 353  SER C OG    1 
ATOM   5636 N N     . GLY B 1 354 ? 7.651   3.113   -67.720 1.00 57.40  ? 354  GLY C N     1 
ATOM   5637 C CA    . GLY B 1 354 ? 6.207   3.243   -67.725 1.00 65.34  ? 354  GLY C CA    1 
ATOM   5638 C C     . GLY B 1 354 ? 5.464   1.923   -67.623 1.00 76.00  ? 354  GLY C C     1 
ATOM   5639 O O     . GLY B 1 354 ? 4.235   1.898   -67.670 1.00 78.69  ? 354  GLY C O     1 
ATOM   5640 N N     . ARG B 1 355 ? 6.197   0.823   -67.487 1.00 79.14  ? 355  ARG C N     1 
ATOM   5641 C CA    . ARG B 1 355 ? 5.559   -0.476  -67.301 1.00 87.02  ? 355  ARG C CA    1 
ATOM   5642 C C     . ARG B 1 355 ? 4.685   -0.453  -66.053 1.00 81.16  ? 355  ARG C C     1 
ATOM   5643 O O     . ARG B 1 355 ? 3.676   -1.149  -65.979 1.00 81.41  ? 355  ARG C O     1 
ATOM   5644 C CB    . ARG B 1 355 ? 6.595   -1.597  -67.213 1.00 95.52  ? 355  ARG C CB    1 
ATOM   5645 C CG    . ARG B 1 355 ? 6.536   -2.570  -68.379 1.00 105.09 ? 355  ARG C CG    1 
ATOM   5646 C CD    . ARG B 1 355 ? 7.602   -3.644  -68.264 1.00 111.95 ? 355  ARG C CD    1 
ATOM   5647 N NE    . ARG B 1 355 ? 7.475   -4.413  -67.030 1.00 118.23 ? 355  ARG C NE    1 
ATOM   5648 C CZ    . ARG B 1 355 ? 8.208   -5.483  -66.740 1.00 125.63 ? 355  ARG C CZ    1 
ATOM   5649 N NH1   . ARG B 1 355 ? 9.120   -5.913  -67.602 1.00 127.96 ? 355  ARG C NH1   1 
ATOM   5650 N NH2   . ARG B 1 355 ? 8.030   -6.126  -65.592 1.00 127.09 ? 355  ARG C NH2   1 
ATOM   5651 N N     . GLN B 1 356 ? 5.084   0.359   -65.079 1.00 77.21  ? 356  GLN C N     1 
ATOM   5652 C CA    . GLN B 1 356 ? 4.315   0.561   -63.858 1.00 72.89  ? 356  GLN C CA    1 
ATOM   5653 C C     . GLN B 1 356 ? 4.203   2.047   -63.552 1.00 69.46  ? 356  GLN C C     1 
ATOM   5654 O O     . GLN B 1 356 ? 5.088   2.826   -63.903 1.00 72.08  ? 356  GLN C O     1 
ATOM   5655 C CB    . GLN B 1 356 ? 4.995   -0.121  -62.670 1.00 70.10  ? 356  GLN C CB    1 
ATOM   5656 C CG    . GLN B 1 356 ? 4.779   -1.611  -62.564 1.00 65.13  ? 356  GLN C CG    1 
ATOM   5657 C CD    . GLN B 1 356 ? 5.209   -2.143  -61.208 1.00 67.64  ? 356  GLN C CD    1 
ATOM   5658 O OE1   . GLN B 1 356 ? 6.402   -2.227  -60.909 1.00 61.45  ? 356  GLN C OE1   1 
ATOM   5659 N NE2   . GLN B 1 356 ? 4.235   -2.491  -60.373 1.00 71.27  ? 356  GLN C NE2   1 
ATOM   5660 N N     . THR B 1 357 ? 3.123   2.439   -62.887 1.00 66.44  ? 357  THR C N     1 
ATOM   5661 C CA    . THR B 1 357 ? 3.011   3.806   -62.400 1.00 68.96  ? 357  THR C CA    1 
ATOM   5662 C C     . THR B 1 357 ? 3.922   3.958   -61.188 1.00 70.68  ? 357  THR C C     1 
ATOM   5663 O O     . THR B 1 357 ? 4.455   2.972   -60.677 1.00 70.96  ? 357  THR C O     1 
ATOM   5664 C CB    . THR B 1 357 ? 1.560   4.174   -62.022 1.00 71.62  ? 357  THR C CB    1 
ATOM   5665 O OG1   . THR B 1 357 ? 1.185   3.500   -60.818 1.00 74.16  ? 357  THR C OG1   1 
ATOM   5666 C CG2   . THR B 1 357 ? 0.600   3.786   -63.137 1.00 77.65  ? 357  THR C CG2   1 
ATOM   5667 N N     . VAL B 1 358 ? 4.112   5.192   -60.737 1.00 70.19  ? 358  VAL C N     1 
ATOM   5668 C CA    . VAL B 1 358 ? 4.957   5.448   -59.580 1.00 65.79  ? 358  VAL C CA    1 
ATOM   5669 C C     . VAL B 1 358 ? 4.348   4.845   -58.322 1.00 73.36  ? 358  VAL C C     1 
ATOM   5670 O O     . VAL B 1 358 ? 5.055   4.258   -57.499 1.00 73.66  ? 358  VAL C O     1 
ATOM   5671 C CB    . VAL B 1 358 ? 5.185   6.952   -59.363 1.00 60.39  ? 358  VAL C CB    1 
ATOM   5672 C CG1   . VAL B 1 358 ? 5.714   7.213   -57.955 1.00 54.87  ? 358  VAL C CG1   1 
ATOM   5673 C CG2   . VAL B 1 358 ? 6.137   7.504   -60.419 1.00 62.34  ? 358  VAL C CG2   1 
ATOM   5674 N N     . ASP B 1 359 ? 3.035   4.993   -58.175 1.00 77.15  ? 359  ASP C N     1 
ATOM   5675 C CA    . ASP B 1 359 ? 2.334   4.434   -57.026 1.00 81.16  ? 359  ASP C CA    1 
ATOM   5676 C C     . ASP B 1 359 ? 2.478   2.917   -56.983 1.00 74.99  ? 359  ASP C C     1 
ATOM   5677 O O     . ASP B 1 359 ? 2.778   2.347   -55.936 1.00 73.33  ? 359  ASP C O     1 
ATOM   5678 C CB    . ASP B 1 359 ? 0.857   4.832   -57.042 1.00 90.24  ? 359  ASP C CB    1 
ATOM   5679 C CG    . ASP B 1 359 ? 0.619   6.219   -56.468 1.00 95.61  ? 359  ASP C CG    1 
ATOM   5680 O OD1   . ASP B 1 359 ? 1.393   6.640   -55.582 1.00 95.89  ? 359  ASP C OD1   1 
ATOM   5681 O OD2   . ASP B 1 359 ? -0.346  6.885   -56.899 1.00 98.61  ? 359  ASP C OD2   1 
ATOM   5682 N N     . GLU B 1 360 ? 2.273   2.275   -58.129 1.00 73.00  ? 360  GLU C N     1 
ATOM   5683 C CA    . GLU B 1 360 ? 2.400   0.827   -58.237 1.00 73.22  ? 360  GLU C CA    1 
ATOM   5684 C C     . GLU B 1 360 ? 3.818   0.362   -57.931 1.00 73.85  ? 360  GLU C C     1 
ATOM   5685 O O     . GLU B 1 360 ? 4.038   -0.421  -57.004 1.00 78.69  ? 360  GLU C O     1 
ATOM   5686 C CB    . GLU B 1 360 ? 1.993   0.355   -59.635 1.00 75.08  ? 360  GLU C CB    1 
ATOM   5687 C CG    . GLU B 1 360 ? 0.505   0.473   -59.922 1.00 81.71  ? 360  GLU C CG    1 
ATOM   5688 C CD    . GLU B 1 360 ? 0.187   0.382   -61.404 1.00 88.75  ? 360  GLU C CD    1 
ATOM   5689 O OE1   . GLU B 1 360 ? 1.131   0.443   -62.221 1.00 89.10  ? 360  GLU C OE1   1 
ATOM   5690 O OE2   . GLU B 1 360 ? -1.006  0.253   -61.752 1.00 91.30  ? 360  GLU C OE2   1 
ATOM   5691 N N     . ALA B 1 361 ? 4.774   0.850   -58.716 1.00 64.46  ? 361  ALA C N     1 
ATOM   5692 C CA    . ALA B 1 361 ? 6.166   0.425   -58.605 1.00 55.15  ? 361  ALA C CA    1 
ATOM   5693 C C     . ALA B 1 361 ? 6.695   0.498   -57.174 1.00 50.09  ? 361  ALA C C     1 
ATOM   5694 O O     . ALA B 1 361 ? 7.386   -0.415  -56.710 1.00 50.89  ? 361  ALA C O     1 
ATOM   5695 C CB    . ALA B 1 361 ? 7.043   1.247   -59.539 1.00 60.77  ? 361  ALA C CB    1 
ATOM   5696 N N     . LEU B 1 362 ? 6.368   1.582   -56.476 1.00 48.58  ? 362  LEU C N     1 
ATOM   5697 C CA    . LEU B 1 362 ? 6.861   1.782   -55.120 1.00 57.46  ? 362  LEU C CA    1 
ATOM   5698 C C     . LEU B 1 362 ? 6.121   0.931   -54.087 1.00 62.82  ? 362  LEU C C     1 
ATOM   5699 O O     . LEU B 1 362 ? 6.680   0.601   -53.044 1.00 64.45  ? 362  LEU C O     1 
ATOM   5700 C CB    . LEU B 1 362 ? 6.837   3.263   -54.728 1.00 58.79  ? 362  LEU C CB    1 
ATOM   5701 C CG    . LEU B 1 362 ? 7.913   4.142   -55.372 1.00 61.10  ? 362  LEU C CG    1 
ATOM   5702 C CD1   . LEU B 1 362 ? 7.924   5.522   -54.739 1.00 61.35  ? 362  LEU C CD1   1 
ATOM   5703 C CD2   . LEU B 1 362 ? 9.281   3.495   -55.242 1.00 57.26  ? 362  LEU C CD2   1 
ATOM   5704 N N     . LYS B 1 363 ? 4.870   0.580   -54.371 1.00 65.16  ? 363  LYS C N     1 
ATOM   5705 C CA    . LYS B 1 363 ? 4.146   -0.343  -53.507 1.00 74.47  ? 363  LYS C CA    1 
ATOM   5706 C C     . LYS B 1 363 ? 4.849   -1.695  -53.511 1.00 68.11  ? 363  LYS C C     1 
ATOM   5707 O O     . LYS B 1 363 ? 5.260   -2.195  -52.465 1.00 61.86  ? 363  LYS C O     1 
ATOM   5708 C CB    . LYS B 1 363 ? 2.685   -0.480  -53.941 1.00 89.08  ? 363  LYS C CB    1 
ATOM   5709 C CG    . LYS B 1 363 ? 1.804   0.667   -53.465 1.00 104.74 ? 363  LYS C CG    1 
ATOM   5710 C CD    . LYS B 1 363 ? 0.431   0.646   -54.122 1.00 116.65 ? 363  LYS C CD    1 
ATOM   5711 C CE    . LYS B 1 363 ? -0.376  1.883   -53.739 1.00 121.62 ? 363  LYS C CE    1 
ATOM   5712 N NZ    . LYS B 1 363 ? -1.588  2.060   -54.587 1.00 122.04 ? 363  LYS C NZ    1 
ATOM   5713 N N     . ASP B 1 364 ? 5.001   -2.266  -54.701 1.00 65.39  ? 364  ASP C N     1 
ATOM   5714 C CA    . ASP B 1 364 ? 5.714   -3.524  -54.876 1.00 59.06  ? 364  ASP C CA    1 
ATOM   5715 C C     . ASP B 1 364 ? 7.131   -3.449  -54.316 1.00 62.06  ? 364  ASP C C     1 
ATOM   5716 O O     . ASP B 1 364 ? 7.702   -4.460  -53.916 1.00 64.14  ? 364  ASP C O     1 
ATOM   5717 C CB    . ASP B 1 364 ? 5.768   -3.900  -56.357 1.00 62.28  ? 364  ASP C CB    1 
ATOM   5718 C CG    . ASP B 1 364 ? 4.396   -4.176  -56.940 1.00 71.89  ? 364  ASP C CG    1 
ATOM   5719 O OD1   . ASP B 1 364 ? 3.390   -3.980  -56.223 1.00 72.25  ? 364  ASP C OD1   1 
ATOM   5720 O OD2   . ASP B 1 364 ? 4.323   -4.579  -58.121 1.00 74.44  ? 364  ASP C OD2   1 
ATOM   5721 N N     . ALA B 1 365 ? 7.703   -2.250  -54.297 1.00 65.09  ? 365  ALA C N     1 
ATOM   5722 C CA    . ALA B 1 365 ? 9.067   -2.083  -53.816 1.00 64.03  ? 365  ALA C CA    1 
ATOM   5723 C C     . ALA B 1 365 ? 9.121   -2.259  -52.311 1.00 65.47  ? 365  ALA C C     1 
ATOM   5724 O O     . ALA B 1 365 ? 10.053  -2.863  -51.781 1.00 66.60  ? 365  ALA C O     1 
ATOM   5725 C CB    . ALA B 1 365 ? 9.613   -0.724  -54.209 1.00 66.40  ? 365  ALA C CB    1 
ATOM   5726 N N     . GLN B 1 366 ? 8.120   -1.723  -51.622 1.00 67.19  ? 366  GLN C N     1 
ATOM   5727 C CA    . GLN B 1 366 ? 8.075   -1.814  -50.171 1.00 73.55  ? 366  GLN C CA    1 
ATOM   5728 C C     . GLN B 1 366 ? 7.676   -3.222  -49.747 1.00 74.63  ? 366  GLN C C     1 
ATOM   5729 O O     . GLN B 1 366 ? 8.147   -3.736  -48.731 1.00 75.86  ? 366  GLN C O     1 
ATOM   5730 C CB    . GLN B 1 366 ? 7.097   -0.795  -49.592 1.00 80.98  ? 366  GLN C CB    1 
ATOM   5731 C CG    . GLN B 1 366 ? 7.436   -0.394  -48.174 1.00 91.37  ? 366  GLN C CG    1 
ATOM   5732 C CD    . GLN B 1 366 ? 6.226   0.047   -47.390 1.00 99.70  ? 366  GLN C CD    1 
ATOM   5733 O OE1   . GLN B 1 366 ? 5.138   0.213   -47.943 1.00 101.64 ? 366  GLN C OE1   1 
ATOM   5734 N NE2   . GLN B 1 366 ? 6.403   0.232   -46.087 1.00 103.30 ? 366  GLN C NE2   1 
ATOM   5735 N N     . THR B 1 367 ? 6.810   -3.842  -50.539 1.00 72.12  ? 367  THR C N     1 
ATOM   5736 C CA    . THR B 1 367 ? 6.376   -5.206  -50.283 1.00 72.20  ? 367  THR C CA    1 
ATOM   5737 C C     . THR B 1 367 ? 7.541   -6.182  -50.416 1.00 69.99  ? 367  THR C C     1 
ATOM   5738 O O     . THR B 1 367 ? 7.669   -7.122  -49.633 1.00 69.95  ? 367  THR C O     1 
ATOM   5739 C CB    . THR B 1 367 ? 5.261   -5.630  -51.259 1.00 75.16  ? 367  THR C CB    1 
ATOM   5740 O OG1   . THR B 1 367 ? 4.156   -4.723  -51.157 1.00 71.64  ? 367  THR C OG1   1 
ATOM   5741 C CG2   . THR B 1 367 ? 4.787   -7.039  -50.942 1.00 77.18  ? 367  THR C CG2   1 
ATOM   5742 N N     . ASN B 1 368 ? 8.393   -5.952  -51.409 1.00 68.25  ? 368  ASN C N     1 
ATOM   5743 C CA    . ASN B 1 368 ? 9.480   -6.879  -51.709 1.00 67.11  ? 368  ASN C CA    1 
ATOM   5744 C C     . ASN B 1 368 ? 10.756  -6.618  -50.918 1.00 59.22  ? 368  ASN C C     1 
ATOM   5745 O O     . ASN B 1 368 ? 11.760  -7.306  -51.103 1.00 60.48  ? 368  ASN C O     1 
ATOM   5746 C CB    . ASN B 1 368 ? 9.786   -6.881  -53.207 1.00 68.04  ? 368  ASN C CB    1 
ATOM   5747 C CG    . ASN B 1 368 ? 8.617   -7.364  -54.036 1.00 76.59  ? 368  ASN C CG    1 
ATOM   5748 O OD1   . ASN B 1 368 ? 7.494   -7.468  -53.542 1.00 80.88  ? 368  ASN C OD1   1 
ATOM   5749 N ND2   . ASN B 1 368 ? 8.873   -7.662  -55.305 1.00 78.70  ? 368  ASN C ND2   1 
ATOM   5750 N N     . SER B 1 369 ? 10.721  -5.623  -50.042 1.00 52.82  ? 369  SER C N     1 
ATOM   5751 C CA    . SER B 1 369 ? 11.883  -5.333  -49.211 1.00 65.78  ? 369  SER C CA    1 
ATOM   5752 C C     . SER B 1 369 ? 11.599  -5.557  -47.724 1.00 70.79  ? 369  SER C C     1 
ATOM   5753 O O     . SER B 1 369 ? 12.521  -5.714  -46.924 1.00 75.52  ? 369  SER C O     1 
ATOM   5754 C CB    . SER B 1 369 ? 12.416  -3.917  -49.476 1.00 70.05  ? 369  SER C CB    1 
ATOM   5755 O OG    . SER B 1 369 ? 11.373  -2.961  -49.514 1.00 73.98  ? 369  SER C OG    1 
ATOM   5756 N N     . SER B 1 370 ? 10.323  -5.584  -47.357 1.00 67.58  ? 370  SER C N     1 
ATOM   5757 C CA    . SER B 1 370 ? 9.953   -5.889  -45.982 1.00 72.02  ? 370  SER C CA    1 
ATOM   5758 C C     . SER B 1 370 ? 8.610   -6.604  -45.933 1.00 77.66  ? 370  SER C C     1 
ATOM   5759 O O     . SER B 1 370 ? 7.564   -5.992  -46.149 1.00 85.08  ? 370  SER C O     1 
ATOM   5760 C CB    . SER B 1 370 ? 9.918   -4.619  -45.130 1.00 74.40  ? 370  SER C CB    1 
ATOM   5761 O OG    . SER B 1 370 ? 9.976   -4.927  -43.747 1.00 74.95  ? 370  SER C OG    1 
ATOM   5762 N N     . SER B 1 371 ? 8.652   -7.903  -45.652 1.00 66.98  ? 371  SER C N     1 
ATOM   5763 C CA    . SER B 1 371 ? 7.449   -8.726  -45.599 1.00 60.27  ? 371  SER C CA    1 
ATOM   5764 C C     . SER B 1 371 ? 7.779   -10.091 -44.999 1.00 60.20  ? 371  SER C C     1 
ATOM   5765 O O     . SER B 1 371 ? 8.950   -10.427 -44.813 1.00 55.62  ? 371  SER C O     1 
ATOM   5766 C CB    . SER B 1 371 ? 6.864   -8.900  -47.003 1.00 46.23  ? 371  SER C CB    1 
ATOM   5767 O OG    . SER B 1 371 ? 7.735   -9.668  -47.818 1.00 48.20  ? 371  SER C OG    1 
ATOM   5768 N N     . MET B 1 372 ? 6.757   -10.886 -44.701 1.00 57.72  ? 372  MET C N     1 
ATOM   5769 C CA    . MET B 1 372 ? 7.008   -12.222 -44.177 1.00 55.94  ? 372  MET C CA    1 
ATOM   5770 C C     . MET B 1 372 ? 7.786   -13.052 -45.191 1.00 61.16  ? 372  MET C C     1 
ATOM   5771 O O     . MET B 1 372 ? 8.702   -13.792 -44.826 1.00 59.89  ? 372  MET C O     1 
ATOM   5772 C CB    . MET B 1 372 ? 5.713   -12.933 -43.785 1.00 50.66  ? 372  MET C CB    1 
ATOM   5773 C CG    . MET B 1 372 ? 5.960   -14.267 -43.087 1.00 51.80  ? 372  MET C CG    1 
ATOM   5774 S SD    . MET B 1 372 ? 6.982   -14.097 -41.607 1.00 58.68  ? 372  MET C SD    1 
ATOM   5775 C CE    . MET B 1 372 ? 5.798   -13.410 -40.450 1.00 39.71  ? 372  MET C CE    1 
ATOM   5776 N N     . ASP B 1 373 ? 7.430   -12.913 -46.466 1.00 65.27  ? 373  ASP C N     1 
ATOM   5777 C CA    . ASP B 1 373 ? 8.109   -13.644 -47.534 1.00 68.65  ? 373  ASP C CA    1 
ATOM   5778 C C     . ASP B 1 373 ? 9.605   -13.354 -47.546 1.00 61.62  ? 373  ASP C C     1 
ATOM   5779 O O     . ASP B 1 373 ? 10.422  -14.266 -47.687 1.00 56.98  ? 373  ASP C O     1 
ATOM   5780 C CB    . ASP B 1 373 ? 7.498   -13.310 -48.898 1.00 73.37  ? 373  ASP C CB    1 
ATOM   5781 C CG    . ASP B 1 373 ? 7.013   -14.547 -49.635 1.00 87.52  ? 373  ASP C CG    1 
ATOM   5782 O OD1   . ASP B 1 373 ? 7.860   -15.298 -50.166 1.00 90.38  ? 373  ASP C OD1   1 
ATOM   5783 O OD2   . ASP B 1 373 ? 5.783   -14.771 -49.678 1.00 92.98  ? 373  ASP C OD2   1 
ATOM   5784 N N     . VAL B 1 374 ? 9.953   -12.079 -47.395 1.00 58.09  ? 374  VAL C N     1 
ATOM   5785 C CA    . VAL B 1 374 ? 11.346  -11.654 -47.351 1.00 56.70  ? 374  VAL C CA    1 
ATOM   5786 C C     . VAL B 1 374 ? 12.077  -12.259 -46.152 1.00 54.50  ? 374  VAL C C     1 
ATOM   5787 O O     . VAL B 1 374 ? 13.125  -12.894 -46.307 1.00 48.70  ? 374  VAL C O     1 
ATOM   5788 C CB    . VAL B 1 374 ? 11.457  -10.116 -47.287 1.00 62.43  ? 374  VAL C CB    1 
ATOM   5789 C CG1   . VAL B 1 374 ? 12.915  -9.689  -47.227 1.00 61.15  ? 374  VAL C CG1   1 
ATOM   5790 C CG2   . VAL B 1 374 ? 10.759  -9.483  -48.481 1.00 62.69  ? 374  VAL C CG2   1 
ATOM   5791 N N     . PHE B 1 375 ? 11.522  -12.055 -44.959 1.00 50.52  ? 375  PHE C N     1 
ATOM   5792 C CA    . PHE B 1 375 ? 12.115  -12.587 -43.735 1.00 49.93  ? 375  PHE C CA    1 
ATOM   5793 C C     . PHE B 1 375 ? 12.362  -14.087 -43.866 1.00 50.36  ? 375  PHE C C     1 
ATOM   5794 O O     . PHE B 1 375 ? 13.438  -14.581 -43.536 1.00 52.57  ? 375  PHE C O     1 
ATOM   5795 C CB    . PHE B 1 375 ? 11.218  -12.298 -42.525 1.00 45.37  ? 375  PHE C CB    1 
ATOM   5796 N N     . MET B 1 376 ? 11.360  -14.800 -44.370 1.00 46.88  ? 376  MET C N     1 
ATOM   5797 C CA    . MET B 1 376 ? 11.444  -16.246 -44.522 1.00 51.05  ? 376  MET C CA    1 
ATOM   5798 C C     . MET B 1 376 ? 12.599  -16.644 -45.448 1.00 54.51  ? 376  MET C C     1 
ATOM   5799 O O     . MET B 1 376 ? 13.403  -17.511 -45.107 1.00 51.27  ? 376  MET C O     1 
ATOM   5800 C CB    . MET B 1 376 ? 10.110  -16.804 -45.028 1.00 48.55  ? 376  MET C CB    1 
ATOM   5801 C CG    . MET B 1 376 ? 9.776   -18.181 -44.497 1.00 63.73  ? 376  MET C CG    1 
ATOM   5802 S SD    . MET B 1 376 ? 9.385   -18.198 -42.737 1.00 47.68  ? 376  MET C SD    1 
ATOM   5803 C CE    . MET B 1 376 ? 7.961   -17.122 -42.708 1.00 70.80  ? 376  MET C CE    1 
ATOM   5804 N N     . LYS B 1 377 ? 12.686  -16.004 -46.613 1.00 60.24  ? 377  LYS C N     1 
ATOM   5805 C CA    . LYS B 1 377 ? 13.815  -16.228 -47.512 1.00 65.47  ? 377  LYS C CA    1 
ATOM   5806 C C     . LYS B 1 377 ? 15.120  -15.833 -46.827 1.00 61.43  ? 377  LYS C C     1 
ATOM   5807 O O     . LYS B 1 377 ? 16.174  -16.411 -47.090 1.00 61.71  ? 377  LYS C O     1 
ATOM   5808 C CB    . LYS B 1 377 ? 13.649  -15.445 -48.818 1.00 67.47  ? 377  LYS C CB    1 
ATOM   5809 C CG    . LYS B 1 377 ? 12.612  -16.020 -49.770 1.00 74.79  ? 377  LYS C CG    1 
ATOM   5810 C CD    . LYS B 1 377 ? 12.515  -15.177 -51.035 1.00 84.29  ? 377  LYS C CD    1 
ATOM   5811 C CE    . LYS B 1 377 ? 11.404  -15.657 -51.957 1.00 90.07  ? 377  LYS C CE    1 
ATOM   5812 N NZ    . LYS B 1 377 ? 11.260  -14.762 -53.143 1.00 90.50  ? 377  LYS C NZ    1 
ATOM   5813 N N     . GLY B 1 378 ? 15.042  -14.844 -45.946 1.00 55.44  ? 378  GLY C N     1 
ATOM   5814 C CA    . GLY B 1 378 ? 16.191  -14.442 -45.159 1.00 57.70  ? 378  GLY C CA    1 
ATOM   5815 C C     . GLY B 1 378 ? 16.693  -15.566 -44.272 1.00 58.10  ? 378  GLY C C     1 
ATOM   5816 O O     . GLY B 1 378 ? 17.899  -15.720 -44.075 1.00 57.39  ? 378  GLY C O     1 
ATOM   5817 N N     . LEU B 1 379 ? 15.770  -16.358 -43.733 1.00 51.21  ? 379  LEU C N     1 
ATOM   5818 C CA    . LEU B 1 379 ? 16.156  -17.461 -42.860 1.00 53.77  ? 379  LEU C CA    1 
ATOM   5819 C C     . LEU B 1 379 ? 16.899  -18.552 -43.624 1.00 61.11  ? 379  LEU C C     1 
ATOM   5820 O O     . LEU B 1 379 ? 17.833  -19.152 -43.098 1.00 62.92  ? 379  LEU C O     1 
ATOM   5821 C CB    . LEU B 1 379 ? 14.944  -18.045 -42.129 1.00 51.99  ? 379  LEU C CB    1 
ATOM   5822 C CG    . LEU B 1 379 ? 14.258  -17.123 -41.116 1.00 49.91  ? 379  LEU C CG    1 
ATOM   5823 C CD1   . LEU B 1 379 ? 13.159  -17.871 -40.385 1.00 40.94  ? 379  LEU C CD1   1 
ATOM   5824 C CD2   . LEU B 1 379 ? 15.264  -16.552 -40.128 1.00 47.30  ? 379  LEU C CD2   1 
ATOM   5825 N N     . SER B 1 380 ? 16.489  -18.810 -44.863 1.00 64.70  ? 380  SER C N     1 
ATOM   5826 C CA    . SER B 1 380 ? 17.174  -19.815 -45.671 1.00 65.42  ? 380  SER C CA    1 
ATOM   5827 C C     . SER B 1 380 ? 18.451  -19.250 -46.280 1.00 64.88  ? 380  SER C C     1 
ATOM   5828 O O     . SER B 1 380 ? 19.429  -19.973 -46.455 1.00 63.42  ? 380  SER C O     1 
ATOM   5829 C CB    . SER B 1 380 ? 16.255  -20.398 -46.751 1.00 70.84  ? 380  SER C CB    1 
ATOM   5830 O OG    . SER B 1 380 ? 15.542  -19.383 -47.430 1.00 77.05  ? 380  SER C OG    1 
ATOM   5831 N N     . LYS B 1 381 ? 18.441  -17.953 -46.585 1.00 74.18  ? 381  LYS C N     1 
ATOM   5832 C CA    . LYS B 1 381 ? 19.615  -17.278 -47.144 1.00 82.00  ? 381  LYS C CA    1 
ATOM   5833 C C     . LYS B 1 381 ? 20.750  -17.210 -46.123 1.00 87.90  ? 381  LYS C C     1 
ATOM   5834 O O     . LYS B 1 381 ? 21.928  -17.279 -46.479 1.00 90.84  ? 381  LYS C O     1 
ATOM   5835 C CB    . LYS B 1 381 ? 19.258  -15.870 -47.633 1.00 75.78  ? 381  LYS C CB    1 
ATOM   5836 N N     . ALA B 1 382 ? 20.387  -17.072 -44.852 1.00 86.38  ? 382  ALA C N     1 
ATOM   5837 C CA    . ALA B 1 382 ? 21.368  -17.065 -43.778 1.00 87.33  ? 382  ALA C CA    1 
ATOM   5838 C C     . ALA B 1 382 ? 21.991  -18.450 -43.619 1.00 84.91  ? 382  ALA C C     1 
ATOM   5839 O O     . ALA B 1 382 ? 23.091  -18.587 -43.081 1.00 80.58  ? 382  ALA C O     1 
ATOM   5840 C CB    . ALA B 1 382 ? 20.727  -16.610 -42.473 1.00 89.66  ? 382  ALA C CB    1 
ATOM   5841 N N     . LYS B 1 383 ? 21.286  -19.473 -44.098 1.00 85.99  ? 383  LYS C N     1 
ATOM   5842 C CA    . LYS B 1 383 ? 21.766  -20.852 -44.008 1.00 83.85  ? 383  LYS C CA    1 
ATOM   5843 C C     . LYS B 1 383 ? 22.571  -21.270 -45.244 1.00 90.53  ? 383  LYS C C     1 
ATOM   5844 O O     . LYS B 1 383 ? 23.342  -22.227 -45.189 1.00 91.04  ? 383  LYS C O     1 
ATOM   5845 C CB    . LYS B 1 383 ? 20.601  -21.826 -43.772 1.00 72.77  ? 383  LYS C CB    1 
ATOM   5846 C CG    . LYS B 1 383 ? 21.030  -23.283 -43.586 1.00 71.26  ? 383  LYS C CG    1 
ATOM   5847 C CD    . LYS B 1 383 ? 19.835  -24.237 -43.526 1.00 72.88  ? 383  LYS C CD    1 
ATOM   5848 C CE    . LYS B 1 383 ? 20.284  -25.694 -43.389 1.00 74.18  ? 383  LYS C CE    1 
ATOM   5849 N NZ    . LYS B 1 383 ? 19.149  -26.667 -43.311 1.00 72.50  ? 383  LYS C NZ    1 
ATOM   5850 N N     . GLU B 1 384 ? 22.395  -20.552 -46.352 1.00 96.62  ? 384  GLU C N     1 
ATOM   5851 C CA    . GLU B 1 384 ? 23.105  -20.879 -47.592 1.00 98.50  ? 384  GLU C CA    1 
ATOM   5852 C C     . GLU B 1 384 ? 23.682  -19.668 -48.335 1.00 103.04 ? 384  GLU C C     1 
ATOM   5853 O O     . GLU B 1 384 ? 24.888  -19.594 -48.571 1.00 103.52 ? 384  GLU C O     1 
ATOM   5854 C CB    . GLU B 1 384 ? 22.211  -21.694 -48.532 1.00 97.04  ? 384  GLU C CB    1 
ATOM   5855 C CG    . GLU B 1 384 ? 22.312  -23.196 -48.335 1.00 99.82  ? 384  GLU C CG    1 
ATOM   5856 C CD    . GLU B 1 384 ? 21.046  -23.795 -47.762 1.00 102.02 ? 384  GLU C CD    1 
ATOM   5857 O OE1   . GLU B 1 384 ? 20.170  -23.024 -47.316 1.00 103.23 ? 384  GLU C OE1   1 
ATOM   5858 O OE2   . GLU B 1 384 ? 20.924  -25.038 -47.763 1.00 101.57 ? 384  GLU C OE2   1 
ATOM   5859 N N     . GLY B 1 385 ? 22.818  -18.731 -48.715 1.00 105.57 ? 385  GLY C N     1 
ATOM   5860 C CA    . GLY B 1 385 ? 23.245  -17.554 -49.454 1.00 101.06 ? 385  GLY C CA    1 
ATOM   5861 C C     . GLY B 1 385 ? 22.680  -17.513 -50.861 1.00 96.34  ? 385  GLY C C     1 
ATOM   5862 O O     . GLY B 1 385 ? 21.531  -17.893 -51.090 1.00 92.85  ? 385  GLY C O     1 
HETATM 5863 C C1    . MAL C 2 .   ? 14.123  -28.305 -28.571 1.00 40.60  ? 5044 MAL A C1    1 
HETATM 5864 C C2    . MAL C 2 .   ? 14.273  -29.402 -29.617 1.00 37.26  ? 5044 MAL A C2    1 
HETATM 5865 C C3    . MAL C 2 .   ? 14.147  -30.747 -28.915 1.00 33.00  ? 5044 MAL A C3    1 
HETATM 5866 C C4    . MAL C 2 .   ? 15.207  -30.853 -27.821 1.00 37.42  ? 5044 MAL A C4    1 
HETATM 5867 C C5    . MAL C 2 .   ? 15.199  -29.617 -26.915 1.00 34.64  ? 5044 MAL A C5    1 
HETATM 5868 C C6    . MAL C 2 .   ? 16.425  -29.600 -26.009 1.00 34.29  ? 5044 MAL A C6    1 
HETATM 5869 O O1    . MAL C 2 .   ? 12.878  -28.456 -27.916 1.00 40.73  ? 5044 MAL A O1    1 
HETATM 5870 O O2    . MAL C 2 .   ? 13.262  -29.274 -30.591 1.00 35.35  ? 5044 MAL A O2    1 
HETATM 5871 O O3    . MAL C 2 .   ? 14.265  -31.797 -29.852 1.00 36.06  ? 5044 MAL A O3    1 
HETATM 5872 O O4    . MAL C 2 .   ? 14.959  -32.014 -27.044 1.00 40.75  ? 5044 MAL A O4    1 
HETATM 5873 O O5    . MAL C 2 .   ? 15.187  -28.408 -27.646 1.00 37.89  ? 5044 MAL A O5    1 
HETATM 5874 O O6    . MAL C 2 .   ? 16.213  -28.671 -24.965 1.00 30.93  ? 5044 MAL A O6    1 
HETATM 5875 C "C1'" . MAL C 2 .   ? 9.482   -26.147 -27.254 1.00 40.14  ? 5044 MAL A "C1'" 1 
HETATM 5876 C "C2'" . MAL C 2 .   ? 10.050  -26.127 -28.675 1.00 39.34  ? 5044 MAL A "C2'" 1 
HETATM 5877 C "C3'" . MAL C 2 .   ? 11.046  -27.248 -28.924 1.00 39.45  ? 5044 MAL A "C3'" 1 
HETATM 5878 C "C4'" . MAL C 2 .   ? 12.066  -27.305 -27.788 1.00 38.24  ? 5044 MAL A "C4'" 1 
HETATM 5879 C "C5'" . MAL C 2 .   ? 11.373  -27.316 -26.428 1.00 34.69  ? 5044 MAL A "C5'" 1 
HETATM 5880 C "C6'" . MAL C 2 .   ? 12.413  -27.257 -25.313 1.00 34.56  ? 5044 MAL A "C6'" 1 
HETATM 5881 O "O1'" . MAL C 2 .   ? 8.640   -27.265 -27.090 1.00 51.28  ? 5044 MAL A "O1'" 1 
HETATM 5882 O "O2'" . MAL C 2 .   ? 9.005   -26.248 -29.604 1.00 38.15  ? 5044 MAL A "O2'" 1 
HETATM 5883 O "O3'" . MAL C 2 .   ? 11.687  -27.009 -30.164 1.00 39.74  ? 5044 MAL A "O3'" 1 
HETATM 5884 O "O5'" . MAL C 2 .   ? 10.533  -26.192 -26.309 1.00 36.55  ? 5044 MAL A "O5'" 1 
HETATM 5885 O "O6'" . MAL C 2 .   ? 11.905  -27.838 -24.135 1.00 36.26  ? 5044 MAL A "O6'" 1 
HETATM 5886 S S     . SO4 D 3 .   ? 11.283  -28.836 -17.439 0.50 45.01  ? 391  SO4 A S     1 
HETATM 5887 O O1    . SO4 D 3 .   ? 11.837  -28.391 -18.718 0.50 37.11  ? 391  SO4 A O1    1 
HETATM 5888 O O2    . SO4 D 3 .   ? 10.100  -29.655 -17.690 0.50 55.02  ? 391  SO4 A O2    1 
HETATM 5889 O O3    . SO4 D 3 .   ? 12.279  -29.618 -16.707 0.50 49.56  ? 391  SO4 A O3    1 
HETATM 5890 O O4    . SO4 D 3 .   ? 10.894  -27.691 -16.629 0.50 30.18  ? 391  SO4 A O4    1 
HETATM 5891 S S     . SO4 E 3 .   ? 1.252   -39.269 -20.163 1.00 110.32 ? 392  SO4 A S     1 
HETATM 5892 O O1    . SO4 E 3 .   ? 1.673   -40.313 -21.095 1.00 102.46 ? 392  SO4 A O1    1 
HETATM 5893 O O2    . SO4 E 3 .   ? 0.190   -38.471 -20.772 1.00 109.56 ? 392  SO4 A O2    1 
HETATM 5894 O O3    . SO4 E 3 .   ? 0.753   -39.876 -18.931 1.00 115.80 ? 392  SO4 A O3    1 
HETATM 5895 O O4    . SO4 E 3 .   ? 2.392   -38.413 -19.843 1.00 110.34 ? 392  SO4 A O4    1 
HETATM 5896 S S     . SO4 F 3 .   ? 1.619   -31.840 -59.343 0.50 74.64  ? 393  SO4 A S     1 
HETATM 5897 O O1    . SO4 F 3 .   ? 2.696   -31.376 -60.212 0.50 76.81  ? 393  SO4 A O1    1 
HETATM 5898 O O2    . SO4 F 3 .   ? 0.728   -32.720 -60.096 0.50 77.39  ? 393  SO4 A O2    1 
HETATM 5899 O O3    . SO4 F 3 .   ? 2.190   -32.579 -58.222 0.50 67.53  ? 393  SO4 A O3    1 
HETATM 5900 O O4    . SO4 F 3 .   ? 0.864   -30.692 -58.848 0.50 72.90  ? 393  SO4 A O4    1 
HETATM 5901 S S     . SO4 G 3 .   ? 38.399  -22.033 -30.475 0.50 71.83  ? 394  SO4 A S     1 
HETATM 5902 O O1    . SO4 G 3 .   ? 38.536  -22.676 -31.780 0.50 72.54  ? 394  SO4 A O1    1 
HETATM 5903 O O2    . SO4 G 3 .   ? 37.117  -21.340 -30.428 0.50 77.24  ? 394  SO4 A O2    1 
HETATM 5904 O O3    . SO4 G 3 .   ? 38.461  -23.040 -29.419 0.50 58.81  ? 394  SO4 A O3    1 
HETATM 5905 O O4    . SO4 G 3 .   ? 39.476  -21.065 -30.286 0.50 71.76  ? 394  SO4 A O4    1 
HETATM 5906 S S     . SO4 H 3 .   ? -6.878  -28.789 -20.365 0.50 65.28  ? 395  SO4 A S     1 
HETATM 5907 O O1    . SO4 H 3 .   ? -7.223  -29.600 -21.531 0.50 59.50  ? 395  SO4 A O1    1 
HETATM 5908 O O2    . SO4 H 3 .   ? -8.002  -28.785 -19.434 0.50 65.59  ? 395  SO4 A O2    1 
HETATM 5909 O O3    . SO4 H 3 .   ? -5.694  -29.340 -19.708 0.50 59.92  ? 395  SO4 A O3    1 
HETATM 5910 O O4    . SO4 H 3 .   ? -6.592  -27.421 -20.786 0.50 66.79  ? 395  SO4 A O4    1 
HETATM 5911 C C1    . GOL I 4 .   ? 22.081  -42.569 -33.529 1.00 77.06  ? 1    GOL A C1    1 
HETATM 5912 O O1    . GOL I 4 .   ? 21.543  -43.789 -33.068 1.00 71.84  ? 1    GOL A O1    1 
HETATM 5913 C C2    . GOL I 4 .   ? 22.021  -41.553 -32.393 1.00 81.73  ? 1    GOL A C2    1 
HETATM 5914 O O2    . GOL I 4 .   ? 23.267  -40.906 -32.251 1.00 76.02  ? 1    GOL A O2    1 
HETATM 5915 C C3    . GOL I 4 .   ? 20.922  -40.537 -32.690 1.00 82.91  ? 1    GOL A C3    1 
HETATM 5916 O O3    . GOL I 4 .   ? 20.987  -39.460 -31.782 1.00 71.88  ? 1    GOL A O3    1 
HETATM 5917 C C1    . GOL J 4 .   ? 9.468   -19.183 -8.408  1.00 54.36  ? 396  GOL A C1    1 
HETATM 5918 O O1    . GOL J 4 .   ? 10.239  -18.004 -8.359  1.00 47.57  ? 396  GOL A O1    1 
HETATM 5919 C C2    . GOL J 4 .   ? 8.043   -18.889 -8.862  1.00 58.47  ? 396  GOL A C2    1 
HETATM 5920 O O2    . GOL J 4 .   ? 7.591   -20.028 -9.557  1.00 48.51  ? 396  GOL A O2    1 
HETATM 5921 C C3    . GOL J 4 .   ? 7.151   -18.636 -7.641  1.00 66.01  ? 396  GOL A C3    1 
HETATM 5922 O O3    . GOL J 4 .   ? 5.946   -17.979 -7.989  1.00 53.86  ? 396  GOL A O3    1 
HETATM 5923 C C1    . MAL K 2 .   ? 25.540  0.657   -54.558 1.00 39.62  ? 5044 MAL C C1    1 
HETATM 5924 C C2    . MAL K 2 .   ? 25.593  -0.425  -53.481 1.00 30.77  ? 5044 MAL C C2    1 
HETATM 5925 C C3    . MAL K 2 .   ? 25.306  -1.763  -54.143 1.00 38.17  ? 5044 MAL C C3    1 
HETATM 5926 C C4    . MAL K 2 .   ? 23.915  -1.668  -54.748 1.00 41.12  ? 5044 MAL C C4    1 
HETATM 5927 C C5    . MAL K 2 .   ? 23.829  -0.508  -55.751 1.00 38.13  ? 5044 MAL C C5    1 
HETATM 5928 C C6    . MAL K 2 .   ? 22.391  -0.356  -56.231 1.00 32.06  ? 5044 MAL C C6    1 
HETATM 5929 O O1    . MAL K 2 .   ? 26.503  0.361   -55.545 1.00 39.48  ? 5044 MAL C O1    1 
HETATM 5930 O O2    . MAL K 2 .   ? 26.859  -0.477  -52.862 1.00 32.68  ? 5044 MAL C O2    1 
HETATM 5931 O O3    . MAL K 2 .   ? 25.376  -2.795  -53.186 1.00 51.96  ? 5044 MAL C O3    1 
HETATM 5932 O O4    . MAL K 2 .   ? 23.579  -2.873  -55.386 1.00 37.02  ? 5044 MAL C O4    1 
HETATM 5933 O O5    . MAL K 2 .   ? 24.246  0.699   -55.142 1.00 38.46  ? 5044 MAL C O5    1 
HETATM 5934 O O6    . MAL K 2 .   ? 22.327  0.501   -57.345 1.00 41.22  ? 5044 MAL C O6    1 
HETATM 5935 C "C1'" . MAL K 2 .   ? 29.685  2.416   -57.293 1.00 36.60  ? 5044 MAL C "C1'" 1 
HETATM 5936 C "C2'" . MAL K 2 .   ? 29.631  2.372   -55.769 1.00 36.89  ? 5044 MAL C "C2'" 1 
HETATM 5937 C "C3'" . MAL K 2 .   ? 28.666  1.327   -55.238 1.00 34.55  ? 5044 MAL C "C3'" 1 
HETATM 5938 C "C4'" . MAL K 2 .   ? 27.340  1.413   -55.960 1.00 42.75  ? 5044 MAL C "C4'" 1 
HETATM 5939 C "C5'" . MAL K 2 .   ? 27.555  1.328   -57.462 1.00 38.22  ? 5044 MAL C "C5'" 1 
HETATM 5940 C "C6'" . MAL K 2 .   ? 26.216  1.476   -58.164 1.00 31.00  ? 5044 MAL C "C6'" 1 
HETATM 5941 O "O1'" . MAL K 2 .   ? 30.491  1.368   -57.759 1.00 40.79  ? 5044 MAL C "O1'" 1 
HETATM 5942 O "O2'" . MAL K 2 .   ? 30.922  2.091   -55.292 1.00 42.52  ? 5044 MAL C "O2'" 1 
HETATM 5943 O "O3'" . MAL K 2 .   ? 28.429  1.589   -53.881 1.00 40.23  ? 5044 MAL C "O3'" 1 
HETATM 5944 O "O5'" . MAL K 2 .   ? 28.398  2.368   -57.887 1.00 39.29  ? 5044 MAL C "O5'" 1 
HETATM 5945 O "O6'" . MAL K 2 .   ? 26.356  1.047   -59.496 1.00 37.27  ? 5044 MAL C "O6'" 1 
HETATM 5946 S S     . SO4 L 3 .   ? 24.866  -0.295  -66.047 1.00 101.91 ? 1    SO4 C S     1 
HETATM 5947 O O1    . SO4 L 3 .   ? 24.950  0.880   -66.904 1.00 98.14  ? 1    SO4 C O1    1 
HETATM 5948 O O2    . SO4 L 3 .   ? 23.576  -0.956  -66.244 1.00 98.30  ? 1    SO4 C O2    1 
HETATM 5949 O O3    . SO4 L 3 .   ? 25.943  -1.217  -66.401 1.00 110.02 ? 1    SO4 C O3    1 
HETATM 5950 O O4    . SO4 L 3 .   ? 25.009  0.121   -64.654 1.00 94.77  ? 1    SO4 C O4    1 
HETATM 5951 S S     . SO4 M 3 .   ? 33.892  -11.486 -66.102 1.00 98.92  ? 391  SO4 C S     1 
HETATM 5952 O O1    . SO4 M 3 .   ? 35.146  -12.149 -65.756 1.00 100.51 ? 391  SO4 C O1    1 
HETATM 5953 O O2    . SO4 M 3 .   ? 33.548  -11.782 -67.491 1.00 102.40 ? 391  SO4 C O2    1 
HETATM 5954 O O3    . SO4 M 3 .   ? 32.826  -11.971 -65.228 1.00 93.50  ? 391  SO4 C O3    1 
HETATM 5955 O O4    . SO4 M 3 .   ? 34.059  -10.044 -65.939 1.00 101.39 ? 391  SO4 C O4    1 
HETATM 5956 S S     . SO4 N 3 .   ? 42.610  -2.096  -68.972 0.70 86.95  ? 392  SO4 C S     1 
HETATM 5957 O O1    . SO4 N 3 .   ? 42.826  -2.069  -70.417 0.70 86.66  ? 392  SO4 C O1    1 
HETATM 5958 O O2    . SO4 N 3 .   ? 41.433  -2.907  -68.664 0.70 85.82  ? 392  SO4 C O2    1 
HETATM 5959 O O3    . SO4 N 3 .   ? 43.780  -2.674  -68.314 0.70 84.79  ? 392  SO4 C O3    1 
HETATM 5960 O O4    . SO4 N 3 .   ? 42.397  -0.733  -68.493 0.70 82.84  ? 392  SO4 C O4    1 
HETATM 5961 S S     . SO4 O 3 .   ? 46.155  -4.898  -29.003 0.80 98.92  ? 393  SO4 C S     1 
HETATM 5962 O O1    . SO4 O 3 .   ? 47.034  -5.575  -29.954 0.80 94.78  ? 393  SO4 C O1    1 
HETATM 5963 O O2    . SO4 O 3 .   ? 44.871  -4.612  -29.636 0.80 92.88  ? 393  SO4 C O2    1 
HETATM 5964 O O3    . SO4 O 3 .   ? 45.941  -5.762  -27.843 0.80 102.50 ? 393  SO4 C O3    1 
HETATM 5965 O O4    . SO4 O 3 .   ? 46.773  -3.650  -28.561 0.80 94.76  ? 393  SO4 C O4    1 
HETATM 5966 S S     . SO4 P 3 .   ? 51.610  19.410  -54.846 0.80 97.36  ? 394  SO4 C S     1 
HETATM 5967 O O1    . SO4 P 3 .   ? 52.520  19.904  -55.876 0.80 99.82  ? 394  SO4 C O1    1 
HETATM 5968 O O2    . SO4 P 3 .   ? 50.257  19.884  -55.123 0.80 96.03  ? 394  SO4 C O2    1 
HETATM 5969 O O3    . SO4 P 3 .   ? 51.618  17.949  -54.856 0.80 97.78  ? 394  SO4 C O3    1 
HETATM 5970 O O4    . SO4 P 3 .   ? 52.042  19.905  -53.539 0.80 91.72  ? 394  SO4 C O4    1 
HETATM 5971 S S     . SO4 Q 3 .   ? 8.651   21.557  -74.188 0.50 67.13  ? 395  SO4 C S     1 
HETATM 5972 O O1    . SO4 Q 3 .   ? 9.380   21.861  -75.417 0.50 62.53  ? 395  SO4 C O1    1 
HETATM 5973 O O2    . SO4 Q 3 .   ? 7.573   20.616  -74.485 0.50 62.25  ? 395  SO4 C O2    1 
HETATM 5974 O O3    . SO4 Q 3 .   ? 9.565   20.966  -73.210 0.50 54.12  ? 395  SO4 C O3    1 
HETATM 5975 O O4    . SO4 Q 3 .   ? 8.080   22.793  -73.651 0.50 67.19  ? 395  SO4 C O4    1 
HETATM 5976 C C1    . GOL R 4 .   ? 34.060  23.228  -59.001 1.00 64.09  ? 396  GOL C C1    1 
HETATM 5977 O O1    . GOL R 4 .   ? 34.006  24.563  -58.518 1.00 60.56  ? 396  GOL C O1    1 
HETATM 5978 C C2    . GOL R 4 .   ? 35.432  22.577  -58.768 1.00 61.03  ? 396  GOL C C2    1 
HETATM 5979 O O2    . GOL R 4 .   ? 35.310  21.176  -58.571 1.00 34.61  ? 396  GOL C O2    1 
HETATM 5980 C C3    . GOL R 4 .   ? 36.368  22.851  -59.949 1.00 61.66  ? 396  GOL C C3    1 
HETATM 5981 O O3    . GOL R 4 .   ? 37.697  22.478  -59.635 1.00 61.24  ? 396  GOL C O3    1 
HETATM 5982 C C1    . GOL S 4 .   ? 31.920  20.286  -43.010 1.00 78.46  ? 397  GOL C C1    1 
HETATM 5983 O O1    . GOL S 4 .   ? 31.831  21.694  -42.955 1.00 76.30  ? 397  GOL C O1    1 
HETATM 5984 C C2    . GOL S 4 .   ? 32.552  19.841  -44.330 1.00 71.98  ? 397  GOL C C2    1 
HETATM 5985 O O2    . GOL S 4 .   ? 31.551  19.500  -45.268 1.00 70.74  ? 397  GOL C O2    1 
HETATM 5986 C C3    . GOL S 4 .   ? 33.485  18.652  -44.106 1.00 58.18  ? 397  GOL C C3    1 
HETATM 5987 O O3    . GOL S 4 .   ? 34.783  19.100  -43.749 1.00 55.41  ? 397  GOL C O3    1 
HETATM 5988 O O     . HOH T 5 .   ? 17.195  -21.791 -28.551 1.00 32.54  ? 397  HOH A O     1 
HETATM 5989 O O     . HOH T 5 .   ? 28.796  -17.550 -26.357 1.00 42.19  ? 398  HOH A O     1 
HETATM 5990 O O     . HOH T 5 .   ? 6.904   -10.289 -13.987 1.00 41.27  ? 399  HOH A O     1 
HETATM 5991 O O     . HOH T 5 .   ? 8.452   -15.020 -26.975 1.00 35.27  ? 400  HOH A O     1 
HETATM 5992 O O     . HOH T 5 .   ? 29.077  -32.942 -19.560 1.00 38.27  ? 401  HOH A O     1 
HETATM 5993 O O     . HOH T 5 .   ? 27.128  -7.623  -24.961 1.00 43.03  ? 402  HOH A O     1 
HETATM 5994 O O     . HOH T 5 .   ? 19.907  -19.163 -5.320  1.00 30.37  ? 403  HOH A O     1 
HETATM 5995 O O     . HOH T 5 .   ? 11.786  -24.715 -31.555 1.00 29.23  ? 404  HOH A O     1 
HETATM 5996 O O     . HOH T 5 .   ? 9.282   -20.829 -18.367 1.00 29.06  ? 405  HOH A O     1 
HETATM 5997 O O     . HOH T 5 .   ? 17.148  -36.042 -35.901 1.00 41.69  ? 406  HOH A O     1 
HETATM 5998 O O     . HOH T 5 .   ? 18.890  -12.488 -30.534 1.00 39.43  ? 407  HOH A O     1 
HETATM 5999 O O     . HOH T 5 .   ? 16.894  -19.044 -11.679 1.00 37.50  ? 408  HOH A O     1 
HETATM 6000 O O     . HOH T 5 .   ? 30.169  -25.371 -13.053 1.00 30.70  ? 409  HOH A O     1 
HETATM 6001 O O     . HOH T 5 .   ? 3.803   -18.155 -19.783 1.00 32.83  ? 410  HOH A O     1 
HETATM 6002 O O     . HOH T 5 .   ? 0.606   -18.731 -15.696 1.00 43.61  ? 411  HOH A O     1 
HETATM 6003 O O     . HOH T 5 .   ? 20.605  -10.616 -29.407 1.00 34.27  ? 412  HOH A O     1 
HETATM 6004 O O     . HOH T 5 .   ? 18.251  -12.293 -12.050 1.00 29.62  ? 413  HOH A O     1 
HETATM 6005 O O     . HOH T 5 .   ? 27.621  -13.637 -15.068 1.00 41.95  ? 414  HOH A O     1 
HETATM 6006 O O     . HOH T 5 .   ? 6.153   -16.941 -18.772 1.00 39.94  ? 415  HOH A O     1 
HETATM 6007 O O     . HOH T 5 .   ? 27.489  -10.433 -9.574  1.00 42.75  ? 416  HOH A O     1 
HETATM 6008 O O     . HOH T 5 .   ? 16.714  -19.031 -14.578 1.00 34.34  ? 417  HOH A O     1 
HETATM 6009 O O     . HOH T 5 .   ? 11.749  -20.375 -19.384 1.00 34.05  ? 418  HOH A O     1 
HETATM 6010 O O     . HOH T 5 .   ? 8.558   -18.169 -18.892 1.00 33.97  ? 419  HOH A O     1 
HETATM 6011 O O     . HOH T 5 .   ? 27.888  -34.254 -21.714 1.00 29.77  ? 420  HOH A O     1 
HETATM 6012 O O     . HOH T 5 .   ? 14.765  -20.820 -29.877 1.00 35.61  ? 421  HOH A O     1 
HETATM 6013 O O     . HOH T 5 .   ? 32.490  -15.693 -19.998 1.00 40.75  ? 422  HOH A O     1 
HETATM 6014 O O     . HOH T 5 .   ? -1.528  -17.588 -16.449 1.00 47.17  ? 423  HOH A O     1 
HETATM 6015 O O     . HOH T 5 .   ? 3.675   -22.373 -13.955 1.00 51.40  ? 424  HOH A O     1 
HETATM 6016 O O     . HOH T 5 .   ? 26.192  -13.714 -32.164 1.00 40.87  ? 425  HOH A O     1 
HETATM 6017 O O     . HOH T 5 .   ? 33.677  -39.484 -32.455 1.00 43.92  ? 426  HOH A O     1 
HETATM 6018 O O     . HOH T 5 .   ? 20.362  -26.426 -14.592 1.00 37.28  ? 427  HOH A O     1 
HETATM 6019 O O     . HOH T 5 .   ? 4.604   -30.825 -30.425 1.00 50.04  ? 428  HOH A O     1 
HETATM 6020 O O     . HOH T 5 .   ? 4.804   -23.412 -32.273 1.00 51.30  ? 429  HOH A O     1 
HETATM 6021 O O     . HOH T 5 .   ? 21.429  -28.074 -12.672 1.00 44.86  ? 430  HOH A O     1 
HETATM 6022 O O     . HOH T 5 .   ? 3.697   -21.870 -21.292 1.00 45.22  ? 431  HOH A O     1 
HETATM 6023 O O     . HOH T 5 .   ? 9.652   -15.583 -29.454 1.00 40.10  ? 432  HOH A O     1 
HETATM 6024 O O     . HOH T 5 .   ? 22.236  -20.184 -7.072  1.00 29.86  ? 433  HOH A O     1 
HETATM 6025 O O     . HOH T 5 .   ? 26.872  -4.105  -20.461 1.00 40.16  ? 434  HOH A O     1 
HETATM 6026 O O     . HOH T 5 .   ? 13.359  -32.252 -40.531 1.00 50.16  ? 435  HOH A O     1 
HETATM 6027 O O     . HOH T 5 .   ? 0.282   -23.786 -30.128 1.00 45.99  ? 436  HOH A O     1 
HETATM 6028 O O     . HOH T 5 .   ? 25.971  -6.003  -14.289 1.00 38.56  ? 437  HOH A O     1 
HETATM 6029 O O     . HOH T 5 .   ? 19.672  -23.582 -3.886  1.00 34.51  ? 438  HOH A O     1 
HETATM 6030 O O     . HOH T 5 .   ? 16.779  -32.625 -23.529 1.00 53.57  ? 439  HOH A O     1 
HETATM 6031 O O     . HOH T 5 .   ? 27.856  -40.342 -28.955 1.00 46.26  ? 440  HOH A O     1 
HETATM 6032 O O     . HOH T 5 .   ? 12.995  -27.458 -7.941  1.00 41.97  ? 441  HOH A O     1 
HETATM 6033 O O     . HOH T 5 .   ? 5.759   -38.335 -42.100 1.00 52.66  ? 442  HOH A O     1 
HETATM 6034 O O     . HOH T 5 .   ? 8.707   -27.628 -15.470 1.00 38.40  ? 443  HOH A O     1 
HETATM 6035 O O     . HOH T 5 .   ? 0.664   -19.992 -22.748 1.00 52.71  ? 444  HOH A O     1 
HETATM 6036 O O     . HOH T 5 .   ? 20.793  -21.123 -3.025  1.00 48.15  ? 445  HOH A O     1 
HETATM 6037 O O     . HOH T 5 .   ? 27.063  -13.030 -12.456 1.00 37.80  ? 446  HOH A O     1 
HETATM 6038 O O     . HOH T 5 .   ? 29.002  -8.706  -16.187 1.00 44.67  ? 447  HOH A O     1 
HETATM 6039 O O     . HOH T 5 .   ? 3.134   -22.946 -30.064 1.00 52.03  ? 448  HOH A O     1 
HETATM 6040 O O     . HOH T 5 .   ? 31.685  -37.244 -35.018 1.00 36.22  ? 449  HOH A O     1 
HETATM 6041 O O     . HOH T 5 .   ? 1.716   -31.654 -19.980 1.00 59.56  ? 450  HOH A O     1 
HETATM 6042 O O     . HOH T 5 .   ? 23.365  -37.928 -38.121 1.00 48.69  ? 451  HOH A O     1 
HETATM 6043 O O     . HOH T 5 .   ? 22.763  -12.157 -5.864  1.00 45.76  ? 452  HOH A O     1 
HETATM 6044 O O     . HOH T 5 .   ? 20.122  -1.325  -21.702 1.00 45.07  ? 453  HOH A O     1 
HETATM 6045 O O     . HOH T 5 .   ? 8.478   -10.919 -5.818  1.00 40.24  ? 454  HOH A O     1 
HETATM 6046 O O     . HOH T 5 .   ? 10.466  -15.552 -7.618  1.00 42.01  ? 455  HOH A O     1 
HETATM 6047 O O     . HOH T 5 .   ? 1.917   -23.165 -22.859 1.00 63.26  ? 456  HOH A O     1 
HETATM 6048 O O     . HOH T 5 .   ? 17.407  -14.839 -8.189  1.00 33.79  ? 457  HOH A O     1 
HETATM 6049 O O     . HOH T 5 .   ? 25.006  -20.537 -6.184  1.00 48.33  ? 458  HOH A O     1 
HETATM 6050 O O     . HOH T 5 .   ? 1.581   -16.702 -33.500 1.00 47.05  ? 459  HOH A O     1 
HETATM 6051 O O     . HOH T 5 .   ? 26.463  -36.649 -14.882 1.00 38.37  ? 460  HOH A O     1 
HETATM 6052 O O     . HOH T 5 .   ? 36.424  -18.969 -23.648 1.00 48.10  ? 461  HOH A O     1 
HETATM 6053 O O     . HOH T 5 .   ? 15.161  -38.140 -33.647 1.00 51.40  ? 462  HOH A O     1 
HETATM 6054 O O     . HOH T 5 .   ? 18.726  -24.499 -20.110 1.00 69.27  ? 463  HOH A O     1 
HETATM 6055 O O     . HOH T 5 .   ? 21.853  -22.865 -7.879  1.00 43.04  ? 464  HOH A O     1 
HETATM 6056 O O     . HOH T 5 .   ? 6.534   -21.952 -8.307  1.00 41.79  ? 465  HOH A O     1 
HETATM 6057 O O     . HOH T 5 .   ? 4.507   -20.863 -6.821  1.00 43.27  ? 466  HOH A O     1 
HETATM 6058 O O     . HOH T 5 .   ? 24.766  -24.198 -8.163  1.00 38.13  ? 467  HOH A O     1 
HETATM 6059 O O     . HOH T 5 .   ? 26.739  -23.388 -38.358 1.00 64.11  ? 468  HOH A O     1 
HETATM 6060 O O     . HOH T 5 .   ? 30.807  -41.240 -29.471 1.00 42.13  ? 469  HOH A O     1 
HETATM 6061 O O     . HOH T 5 .   ? 24.395  -24.700 -34.644 1.00 52.71  ? 470  HOH A O     1 
HETATM 6062 O O     . HOH T 5 .   ? 14.247  -28.776 -11.343 1.00 45.77  ? 471  HOH A O     1 
HETATM 6063 O O     . HOH T 5 .   ? 14.096  -38.637 -30.534 1.00 57.38  ? 472  HOH A O     1 
HETATM 6064 O O     . HOH T 5 .   ? 7.436   -28.923 -13.545 1.00 57.19  ? 473  HOH A O     1 
HETATM 6065 O O     . HOH T 5 .   ? 16.121  -31.824 -18.081 1.00 47.41  ? 474  HOH A O     1 
HETATM 6066 O O     . HOH T 5 .   ? 16.566  -29.449 -41.739 1.00 55.47  ? 475  HOH A O     1 
HETATM 6067 O O     . HOH T 5 .   ? 16.382  -15.673 -10.745 1.00 58.26  ? 476  HOH A O     1 
HETATM 6068 O O     . HOH T 5 .   ? 0.715   -37.020 -47.404 1.00 76.95  ? 477  HOH A O     1 
HETATM 6069 O O     . HOH T 5 .   ? 32.654  -23.943 -13.935 1.00 46.31  ? 478  HOH A O     1 
HETATM 6070 O O     . HOH T 5 .   ? 35.816  -24.262 -16.627 1.00 43.19  ? 479  HOH A O     1 
HETATM 6071 O O     . HOH T 5 .   ? 34.280  -15.836 -14.244 1.00 53.20  ? 480  HOH A O     1 
HETATM 6072 O O     . HOH T 5 .   ? 34.609  -19.759 -30.596 1.00 50.49  ? 481  HOH A O     1 
HETATM 6073 O O     . HOH T 5 .   ? 24.110  -32.319 -11.623 1.00 50.99  ? 482  HOH A O     1 
HETATM 6074 O O     . HOH T 5 .   ? 15.995  -31.388 -14.754 1.00 45.94  ? 483  HOH A O     1 
HETATM 6075 O O     . HOH T 5 .   ? 6.034   -27.307 -17.154 1.00 60.59  ? 484  HOH A O     1 
HETATM 6076 O O     . HOH T 5 .   ? -1.049  -24.472 -19.625 1.00 59.92  ? 485  HOH A O     1 
HETATM 6077 O O     . HOH T 5 .   ? 2.885   -5.761  -14.970 1.00 53.73  ? 486  HOH A O     1 
HETATM 6078 O O     . HOH T 5 .   ? 17.368  -6.728  -25.490 1.00 52.80  ? 487  HOH A O     1 
HETATM 6079 O O     . HOH T 5 .   ? 20.472  -25.330 -6.667  1.00 46.94  ? 488  HOH A O     1 
HETATM 6080 O O     . HOH T 5 .   ? 12.038  -13.455 -8.395  1.00 65.06  ? 489  HOH A O     1 
HETATM 6081 O O     . HOH T 5 .   ? -1.529  -19.696 -48.161 1.00 58.59  ? 490  HOH A O     1 
HETATM 6082 O O     . HOH T 5 .   ? 5.258   -6.981  -9.144  1.00 56.11  ? 491  HOH A O     1 
HETATM 6083 O O     . HOH U 5 .   ? 31.785  13.198  -58.055 1.00 27.01  ? 398  HOH C O     1 
HETATM 6084 O O     . HOH U 5 .   ? 30.077  17.597  -70.922 1.00 32.82  ? 399  HOH C O     1 
HETATM 6085 O O     . HOH U 5 .   ? 29.581  15.265  -41.011 1.00 42.06  ? 400  HOH C O     1 
HETATM 6086 O O     . HOH U 5 .   ? 26.332  8.148   -53.117 1.00 36.92  ? 401  HOH C O     1 
HETATM 6087 O O     . HOH U 5 .   ? 33.909  9.499   -66.202 1.00 30.65  ? 402  HOH C O     1 
HETATM 6088 O O     . HOH U 5 .   ? 23.712  7.468   -53.540 1.00 32.38  ? 403  HOH C O     1 
HETATM 6089 O O     . HOH U 5 .   ? 31.614  12.845  -55.180 1.00 28.44  ? 404  HOH C O     1 
HETATM 6090 O O     . HOH U 5 .   ? 31.564  10.973  -66.567 1.00 35.44  ? 405  HOH C O     1 
HETATM 6091 O O     . HOH U 5 .   ? 25.911  8.079   -64.118 1.00 35.21  ? 406  HOH C O     1 
HETATM 6092 O O     . HOH U 5 .   ? 18.650  16.880  -69.359 1.00 38.30  ? 407  HOH C O     1 
HETATM 6093 O O     . HOH U 5 .   ? 37.276  7.309   -64.322 1.00 35.92  ? 408  HOH C O     1 
HETATM 6094 O O     . HOH U 5 .   ? 40.243  10.715  -53.442 1.00 39.67  ? 409  HOH C O     1 
HETATM 6095 O O     . HOH U 5 .   ? 23.975  -6.733  -46.525 1.00 49.11  ? 410  HOH C O     1 
HETATM 6096 O O     . HOH U 5 .   ? 13.888  27.276  -71.018 1.00 43.57  ? 411  HOH C O     1 
HETATM 6097 O O     . HOH U 5 .   ? 29.092  10.036  -65.726 1.00 28.37  ? 412  HOH C O     1 
HETATM 6098 O O     . HOH U 5 .   ? 19.896  10.094  -67.485 1.00 37.99  ? 413  HOH C O     1 
HETATM 6099 O O     . HOH U 5 .   ? 27.936  7.516   -65.801 1.00 35.07  ? 414  HOH C O     1 
HETATM 6100 O O     . HOH U 5 .   ? 19.016  10.034  -69.974 1.00 41.40  ? 415  HOH C O     1 
HETATM 6101 O O     . HOH U 5 .   ? 12.036  13.027  -52.846 1.00 49.44  ? 416  HOH C O     1 
HETATM 6102 O O     . HOH U 5 .   ? 41.083  21.843  -51.815 1.00 36.84  ? 417  HOH C O     1 
HETATM 6103 O O     . HOH U 5 .   ? 29.933  13.590  -79.099 1.00 43.55  ? 418  HOH C O     1 
HETATM 6104 O O     . HOH U 5 .   ? 43.734  11.947  -64.005 1.00 45.86  ? 419  HOH C O     1 
HETATM 6105 O O     . HOH U 5 .   ? 20.673  27.913  -59.758 1.00 41.54  ? 420  HOH C O     1 
HETATM 6106 O O     . HOH U 5 .   ? 14.586  22.513  -54.524 1.00 45.09  ? 421  HOH C O     1 
HETATM 6107 O O     . HOH U 5 .   ? 34.156  6.138   -64.528 1.00 44.14  ? 422  HOH C O     1 
HETATM 6108 O O     . HOH U 5 .   ? 24.659  -9.017  -49.267 1.00 54.15  ? 423  HOH C O     1 
HETATM 6109 O O     . HOH U 5 .   ? 12.493  24.000  -65.164 1.00 47.16  ? 424  HOH C O     1 
HETATM 6110 O O     . HOH U 5 .   ? 36.230  4.593   -53.798 1.00 33.92  ? 425  HOH C O     1 
HETATM 6111 O O     . HOH U 5 .   ? 34.455  21.820  -71.281 1.00 42.97  ? 426  HOH C O     1 
HETATM 6112 O O     . HOH U 5 .   ? 29.801  17.083  -78.205 1.00 39.17  ? 427  HOH C O     1 
HETATM 6113 O O     . HOH U 5 .   ? 41.430  16.597  -46.361 1.00 40.99  ? 428  HOH C O     1 
HETATM 6114 O O     . HOH U 5 .   ? 29.129  4.090   -52.474 1.00 31.90  ? 429  HOH C O     1 
HETATM 6115 O O     . HOH U 5 .   ? 39.592  17.559  -67.945 1.00 45.82  ? 430  HOH C O     1 
HETATM 6116 O O     . HOH U 5 .   ? 37.146  4.678   -56.333 1.00 30.75  ? 431  HOH C O     1 
HETATM 6117 O O     . HOH U 5 .   ? 36.030  4.253   -63.778 1.00 52.64  ? 432  HOH C O     1 
HETATM 6118 O O     . HOH U 5 .   ? 45.200  15.486  -53.640 1.00 41.76  ? 433  HOH C O     1 
HETATM 6119 O O     . HOH U 5 .   ? 39.513  3.474   -57.071 1.00 41.86  ? 434  HOH C O     1 
HETATM 6120 O O     . HOH U 5 .   ? 34.562  -2.874  -55.623 1.00 49.01  ? 435  HOH C O     1 
HETATM 6121 O O     . HOH U 5 .   ? 3.704   -9.917  -44.972 1.00 53.27  ? 436  HOH C O     1 
HETATM 6122 O O     . HOH U 5 .   ? 34.458  21.507  -55.917 1.00 37.58  ? 437  HOH C O     1 
HETATM 6123 O O     . HOH U 5 .   ? 48.616  13.524  -46.434 1.00 36.99  ? 438  HOH C O     1 
HETATM 6124 O O     . HOH U 5 .   ? 39.664  16.976  -48.532 1.00 49.29  ? 439  HOH C O     1 
HETATM 6125 O O     . HOH U 5 .   ? 32.921  20.953  -73.802 1.00 45.26  ? 440  HOH C O     1 
HETATM 6126 O O     . HOH U 5 .   ? 29.482  10.589  -80.385 1.00 47.74  ? 441  HOH C O     1 
HETATM 6127 O O     . HOH U 5 .   ? 32.525  8.644   -35.037 1.00 47.05  ? 442  HOH C O     1 
HETATM 6128 O O     . HOH U 5 .   ? 32.715  13.616  -79.865 1.00 48.12  ? 443  HOH C O     1 
HETATM 6129 O O     . HOH U 5 .   ? 26.984  0.666   -68.476 1.00 44.17  ? 444  HOH C O     1 
HETATM 6130 O O     . HOH U 5 .   ? 34.675  -4.340  -66.014 1.00 56.52  ? 445  HOH C O     1 
HETATM 6131 O O     . HOH U 5 .   ? 41.843  12.824  -54.446 1.00 40.12  ? 446  HOH C O     1 
HETATM 6132 O O     . HOH U 5 .   ? 17.839  14.495  -73.301 1.00 34.82  ? 447  HOH C O     1 
HETATM 6133 O O     . HOH U 5 .   ? 14.466  10.461  -75.499 1.00 42.25  ? 448  HOH C O     1 
HETATM 6134 O O     . HOH U 5 .   ? 27.607  2.091   -61.974 1.00 49.46  ? 449  HOH C O     1 
HETATM 6135 O O     . HOH U 5 .   ? 36.545  -10.079 -43.751 1.00 41.68  ? 450  HOH C O     1 
HETATM 6136 O O     . HOH U 5 .   ? 43.296  10.432  -66.346 1.00 52.06  ? 451  HOH C O     1 
HETATM 6137 O O     . HOH U 5 .   ? 40.975  12.327  -61.238 1.00 38.42  ? 452  HOH C O     1 
HETATM 6138 O O     . HOH U 5 .   ? 29.267  7.181   -78.147 1.00 46.90  ? 453  HOH C O     1 
HETATM 6139 O O     . HOH U 5 .   ? 12.346  9.590   -73.157 1.00 47.40  ? 454  HOH C O     1 
HETATM 6140 O O     . HOH U 5 .   ? 49.297  4.314   -59.992 1.00 49.39  ? 455  HOH C O     1 
HETATM 6141 O O     . HOH U 5 .   ? 26.532  17.217  -78.357 1.00 38.37  ? 456  HOH C O     1 
HETATM 6142 O O     . HOH U 5 .   ? 35.540  8.540   -71.039 1.00 41.94  ? 457  HOH C O     1 
HETATM 6143 O O     . HOH U 5 .   ? 16.569  15.912  -47.895 1.00 50.82  ? 458  HOH C O     1 
HETATM 6144 O O     . HOH U 5 .   ? 39.624  11.282  -45.400 1.00 41.96  ? 459  HOH C O     1 
HETATM 6145 O O     . HOH U 5 .   ? 16.767  9.271   -46.306 1.00 52.12  ? 460  HOH C O     1 
HETATM 6146 O O     . HOH U 5 .   ? 47.510  14.350  -43.131 1.00 45.57  ? 461  HOH C O     1 
HETATM 6147 O O     . HOH U 5 .   ? 8.987   20.083  -68.894 1.00 53.39  ? 462  HOH C O     1 
HETATM 6148 O O     . HOH U 5 .   ? 26.626  8.586   -75.106 1.00 41.64  ? 463  HOH C O     1 
HETATM 6149 O O     . HOH U 5 .   ? 23.373  16.831  -51.386 1.00 43.42  ? 464  HOH C O     1 
HETATM 6150 O O     . HOH U 5 .   ? 33.735  -5.137  -62.826 1.00 58.73  ? 465  HOH C O     1 
HETATM 6151 O O     . HOH U 5 .   ? 13.929  12.561  -77.814 1.00 54.63  ? 466  HOH C O     1 
HETATM 6152 O O     . HOH U 5 .   ? 19.965  7.471   -73.452 1.00 54.43  ? 467  HOH C O     1 
HETATM 6153 O O     . HOH U 5 .   ? 12.705  6.764   -72.067 1.00 57.07  ? 468  HOH C O     1 
HETATM 6154 O O     . HOH U 5 .   ? 25.996  24.715  -51.076 1.00 51.85  ? 469  HOH C O     1 
HETATM 6155 O O     . HOH U 5 .   ? 14.494  17.032  -75.720 1.00 43.44  ? 470  HOH C O     1 
HETATM 6156 O O     . HOH U 5 .   ? 28.611  9.689   -76.845 1.00 40.84  ? 471  HOH C O     1 
HETATM 6157 O O     . HOH U 5 .   ? 25.564  11.586  -43.648 1.00 46.77  ? 472  HOH C O     1 
HETATM 6158 O O     . HOH U 5 .   ? 31.552  5.122   -71.399 1.00 48.43  ? 473  HOH C O     1 
HETATM 6159 O O     . HOH U 5 .   ? 17.792  5.415   -45.365 1.00 56.29  ? 474  HOH C O     1 
HETATM 6160 O O     . HOH U 5 .   ? 25.028  -9.794  -52.422 1.00 63.29  ? 475  HOH C O     1 
HETATM 6161 O O     . HOH U 5 .   ? 10.361  17.505  -66.705 1.00 50.56  ? 476  HOH C O     1 
HETATM 6162 O O     . HOH U 5 .   ? 46.414  11.416  -53.958 1.00 43.91  ? 477  HOH C O     1 
HETATM 6163 O O     . HOH U 5 .   ? 19.883  0.022   -70.758 1.00 49.32  ? 478  HOH C O     1 
HETATM 6164 O O     . HOH U 5 .   ? 32.342  -1.180  -55.094 1.00 61.65  ? 479  HOH C O     1 
HETATM 6165 O O     . HOH U 5 .   ? 38.483  1.037   -63.839 1.00 63.09  ? 480  HOH C O     1 
HETATM 6166 O O     . HOH U 5 .   ? 29.394  -3.555  -43.388 1.00 57.23  ? 481  HOH C O     1 
HETATM 6167 O O     . HOH U 5 .   ? 42.118  11.187  -44.514 1.00 46.82  ? 482  HOH C O     1 
HETATM 6168 O O     . HOH U 5 .   ? 24.565  10.322  -75.774 1.00 47.94  ? 483  HOH C O     1 
HETATM 6169 O O     . HOH U 5 .   ? 12.580  17.701  -74.032 1.00 46.77  ? 484  HOH C O     1 
HETATM 6170 O O     . HOH U 5 .   ? 38.008  9.656   -71.107 1.00 45.24  ? 485  HOH C O     1 
HETATM 6171 O O     . HOH U 5 .   ? 21.522  18.950  -52.310 1.00 44.39  ? 486  HOH C O     1 
HETATM 6172 O O     . HOH U 5 .   ? 26.395  23.750  -79.562 1.00 45.05  ? 487  HOH C O     1 
HETATM 6173 O O     . HOH U 5 .   ? 43.967  13.472  -40.092 1.00 53.98  ? 488  HOH C O     1 
HETATM 6174 O O     . HOH U 5 .   ? 10.435  16.673  -63.947 1.00 52.03  ? 489  HOH C O     1 
HETATM 6175 O O     . HOH U 5 .   ? 22.090  22.841  -54.543 1.00 53.97  ? 490  HOH C O     1 
HETATM 6176 O O     . HOH U 5 .   ? 17.016  26.837  -65.379 1.00 43.48  ? 491  HOH C O     1 
HETATM 6177 O O     . HOH U 5 .   ? 30.814  20.643  -75.970 1.00 45.59  ? 492  HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 2   ? 1.3839 1.0821 0.9183 -0.1623 0.0752  0.0186  2    LYS A N     
2    C CA    . LYS A 2   ? 1.3742 1.0881 0.9313 -0.1582 0.0731  0.0160  2    LYS A CA    
3    C C     . LYS A 2   ? 1.4061 1.1481 0.9975 -0.1579 0.0655  0.0205  2    LYS A C     
4    O O     . LYS A 2   ? 1.3430 1.0998 0.9576 -0.1523 0.0637  0.0193  2    LYS A O     
5    C CB    . LYS A 2   ? 1.3221 1.0290 0.8818 -0.1437 0.0786  0.0114  2    LYS A CB    
6    N N     . ILE A 3   ? 1.4493 1.1977 1.0432 -0.1638 0.0614  0.0259  3    ILE A N     
7    C CA    . ILE A 3   ? 1.3953 1.1696 1.0192 -0.1647 0.0542  0.0309  3    ILE A CA    
8    C C     . ILE A 3   ? 1.4569 1.2391 1.0767 -0.1801 0.0493  0.0350  3    ILE A C     
9    O O     . ILE A 3   ? 1.4784 1.2508 1.0791 -0.1889 0.0488  0.0376  3    ILE A O     
10   C CB    . ILE A 3   ? 1.2933 1.0723 0.9276 -0.1584 0.0527  0.0345  3    ILE A CB    
11   C CG1   . ILE A 3   ? 1.2416 1.0188 0.8863 -0.1430 0.0563  0.0315  3    ILE A CG1   
12   C CG2   . ILE A 3   ? 1.2097 1.0137 0.8704 -0.1618 0.0454  0.0403  3    ILE A CG2   
13   C CD1   . ILE A 3   ? 1.2437 1.0250 0.8981 -0.1364 0.0552  0.0348  3    ILE A CD1   
14   N N     . GLU A 4   ? 1.4843 1.2842 1.1220 -0.1834 0.0457  0.0358  4    GLU A N     
15   C CA    . GLU A 4   ? 1.5334 1.3424 1.1678 -0.1982 0.0411  0.0398  4    GLU A CA    
16   C C     . GLU A 4   ? 1.4501 1.2738 1.0957 -0.2034 0.0351  0.0470  4    GLU A C     
17   O O     . GLU A 4   ? 1.4094 1.2491 1.0805 -0.1952 0.0324  0.0498  4    GLU A O     
18   C CB    . GLU A 4   ? 1.5895 1.4153 1.2428 -0.1988 0.0390  0.0394  4    GLU A CB    
19   C CG    . GLU A 4   ? 1.6575 1.4946 1.3086 -0.2140 0.0344  0.0437  4    GLU A CG    
20   C CD    . GLU A 4   ? 1.7052 1.5547 1.3705 -0.2143 0.0338  0.0426  4    GLU A CD    
21   O OE1   . GLU A 4   ? 1.6985 1.5346 1.3542 -0.2100 0.0387  0.0361  4    GLU A OE1   
22   O OE2   . GLU A 4   ? 1.7185 1.5913 1.4047 -0.2186 0.0285  0.0483  4    GLU A OE2   
23   N N     . GLU A 5   ? 1.4709 1.2884 1.0964 -0.2173 0.0333  0.0499  5    GLU A N     
24   C CA    . GLU A 5   ? 1.5232 1.3540 1.1568 -0.2240 0.0274  0.0570  5    GLU A CA    
25   C C     . GLU A 5   ? 1.5322 1.3890 1.1861 -0.2318 0.0211  0.0623  5    GLU A C     
26   O O     . GLU A 5   ? 1.5572 1.4150 1.2045 -0.2395 0.0211  0.0612  5    GLU A O     
27   C CB    . GLU A 5   ? 1.5738 1.3850 1.1752 -0.2359 0.0282  0.0581  5    GLU A CB    
28   C CG    . GLU A 5   ? 1.5697 1.3940 1.1775 -0.2444 0.0219  0.0656  5    GLU A CG    
29   C CD    . GLU A 5   ? 1.5975 1.4027 1.1720 -0.2586 0.0224  0.0670  5    GLU A CD    
30   O OE1   . GLU A 5   ? 1.5932 1.4032 1.1683 -0.2642 0.0183  0.0724  5    GLU A OE1   
31   O OE2   . GLU A 5   ? 1.6135 1.3982 1.1603 -0.2644 0.0270  0.0628  5    GLU A OE2   
32   N N     . GLY A 6   ? 1.5030 1.3808 1.1811 -0.2298 0.0160  0.0683  6    GLY A N     
33   C CA    . GLY A 6   ? 1.4925 1.3967 1.1913 -0.2363 0.0101  0.0745  6    GLY A CA    
34   C C     . GLY A 6   ? 1.4907 1.4157 1.2236 -0.2239 0.0091  0.0759  6    GLY A C     
35   O O     . GLY A 6   ? 1.5658 1.5144 1.3201 -0.2261 0.0041  0.0826  6    GLY A O     
36   N N     . LYS A 7   ? 1.3657 1.2821 1.1033 -0.2110 0.0139  0.0699  7    LYS A N     
37   C CA    . LYS A 7   ? 1.3036 1.2368 1.0714 -0.1988 0.0136  0.0707  7    LYS A CA    
38   C C     . LYS A 7   ? 1.2830 1.2067 1.0548 -0.1853 0.0169  0.0671  7    LYS A C     
39   O O     . LYS A 7   ? 1.3403 1.2428 1.0907 -0.1840 0.0205  0.0628  7    LYS A O     
40   C CB    . LYS A 7   ? 1.3425 1.2786 1.1166 -0.1966 0.0159  0.0674  7    LYS A CB    
41   C CG    . LYS A 7   ? 1.3723 1.2857 1.1293 -0.1907 0.0220  0.0588  7    LYS A CG    
42   C CD    . LYS A 7   ? 1.3908 1.3106 1.1651 -0.1819 0.0243  0.0558  7    LYS A CD    
43   C CE    . LYS A 7   ? 1.3838 1.2817 1.1414 -0.1760 0.0303  0.0475  7    LYS A CE    
44   N NZ    . LYS A 7   ? 1.3505 1.2541 1.1258 -0.1666 0.0325  0.0445  7    LYS A NZ    
45   N N     . LEU A 8   ? 1.1792 1.1184 0.9777 -0.1754 0.0159  0.0691  8    LEU A N     
46   C CA    . LEU A 8   ? 1.0124 0.9454 0.8171 -0.1629 0.0184  0.0664  8    LEU A CA    
47   C C     . LEU A 8   ? 0.9829 0.9148 0.7989 -0.1516 0.0222  0.0616  8    LEU A C     
48   O O     . LEU A 8   ? 1.0480 0.9949 0.8837 -0.1490 0.0213  0.0634  8    LEU A O     
49   C CB    . LEU A 8   ? 0.9477 0.8972 0.7722 -0.1600 0.0145  0.0724  8    LEU A CB    
50   C CG    . LEU A 8   ? 1.0084 0.9556 0.8213 -0.1682 0.0113  0.0765  8    LEU A CG    
51   C CD1   . LEU A 8   ? 0.9182 0.8834 0.7530 -0.1647 0.0075  0.0824  8    LEU A CD1   
52   C CD2   . LEU A 8   ? 1.0632 0.9867 0.8529 -0.1663 0.0150  0.0719  8    LEU A CD2   
53   N N     . VAL A 9   ? 0.8792 0.7928 0.6821 -0.1449 0.0268  0.0557  9    VAL A N     
54   C CA    . VAL A 9   ? 0.8991 0.8111 0.7126 -0.1335 0.0302  0.0513  9    VAL A CA    
55   C C     . VAL A 9   ? 1.0172 0.9306 0.8416 -0.1235 0.0307  0.0517  9    VAL A C     
56   O O     . VAL A 9   ? 1.1115 1.0133 0.9224 -0.1225 0.0318  0.0509  9    VAL A O     
57   C CB    . VAL A 9   ? 1.0388 0.9305 0.8314 -0.1322 0.0353  0.0444  9    VAL A CB    
58   C CG1   . VAL A 9   ? 1.0382 0.9270 0.8405 -0.1197 0.0388  0.0401  9    VAL A CG1   
59   C CG2   . VAL A 9   ? 1.0963 0.9881 0.8818 -0.1407 0.0353  0.0434  9    VAL A CG2   
60   N N     . ILE A 10  ? 0.9462 0.8734 0.7943 -0.1161 0.0300  0.0530  10   ILE A N     
61   C CA    . ILE A 10  ? 0.8198 0.7499 0.6796 -0.1070 0.0302  0.0536  10   ILE A CA    
62   C C     . ILE A 10  ? 0.8747 0.8010 0.7417 -0.0967 0.0338  0.0490  10   ILE A C     
63   O O     . ILE A 10  ? 0.9086 0.8403 0.7854 -0.0953 0.0346  0.0481  10   ILE A O     
64   C CB    . ILE A 10  ? 0.7492 0.6991 0.6308 -0.1070 0.0262  0.0599  10   ILE A CB    
65   C CG1   . ILE A 10  ? 0.6768 0.6322 0.5523 -0.1178 0.0222  0.0650  10   ILE A CG1   
66   C CG2   . ILE A 10  ? 0.7781 0.7298 0.6699 -0.0983 0.0265  0.0604  10   ILE A CG2   
67   C CD1   . ILE A 10  ? 0.6959 0.6711 0.5920 -0.1181 0.0183  0.0718  10   ILE A CD1   
68   N N     . TRP A 11  ? 0.8236 0.7405 0.6853 -0.0899 0.0361  0.0465  11   TRP A N     
69   C CA    . TRP A 11  ? 0.7784 0.6928 0.6474 -0.0802 0.0391  0.0427  11   TRP A CA    
70   C C     . TRP A 11  ? 0.7852 0.7104 0.6731 -0.0735 0.0377  0.0454  11   TRP A C     
71   O O     . TRP A 11  ? 0.7213 0.6483 0.6091 -0.0737 0.0360  0.0482  11   TRP A O     
72   C CB    . TRP A 11  ? 0.8640 0.7604 0.7137 -0.0766 0.0431  0.0379  11   TRP A CB    
73   C CG    . TRP A 11  ? 0.9879 0.8723 0.8199 -0.0810 0.0457  0.0341  11   TRP A CG    
74   C CD1   . TRP A 11  ? 1.0570 0.9446 0.8875 -0.0888 0.0444  0.0346  11   TRP A CD1   
75   C CD2   . TRP A 11  ? 0.9593 0.8263 0.7723 -0.0777 0.0502  0.0292  11   TRP A CD2   
76   N NE1   . TRP A 11  ? 1.0240 0.8967 0.8350 -0.0910 0.0478  0.0300  11   TRP A NE1   
77   C CE2   . TRP A 11  ? 1.0112 0.8707 0.8110 -0.0840 0.0516  0.0267  11   TRP A CE2   
78   C CE3   . TRP A 11  ? 0.8858 0.7433 0.6915 -0.0699 0.0535  0.0272  11   TRP A CE3   
79   C CZ2   . TRP A 11  ? 1.0242 0.8661 0.8033 -0.0825 0.0563  0.0218  11   TRP A CZ2   
80   C CZ3   . TRP A 11  ? 0.9053 0.7463 0.6912 -0.0682 0.0581  0.0229  11   TRP A CZ3   
81   C CH2   . TRP A 11  ? 0.9952 0.8281 0.7676 -0.0744 0.0596  0.0201  11   TRP A CH2   
82   N N     . ILE A 12  ? 0.7317 0.6631 0.6347 -0.0679 0.0387  0.0446  12   ILE A N     
83   C CA    . ILE A 12  ? 0.7164 0.6566 0.6361 -0.0614 0.0381  0.0466  12   ILE A CA    
84   C C     . ILE A 12  ? 0.7260 0.6646 0.6532 -0.0547 0.0409  0.0432  12   ILE A C     
85   O O     . ILE A 12  ? 0.7554 0.6920 0.6819 -0.0559 0.0423  0.0411  12   ILE A O     
86   C CB    . ILE A 12  ? 0.6849 0.6411 0.6208 -0.0642 0.0349  0.0525  12   ILE A CB    
87   C CG1   . ILE A 12  ? 0.6399 0.6032 0.5907 -0.0574 0.0347  0.0543  12   ILE A CG1   
88   C CG2   . ILE A 12  ? 0.7285 0.6920 0.6731 -0.0668 0.0349  0.0536  12   ILE A CG2   
89   C CD1   . ILE A 12  ? 0.6540 0.6324 0.6202 -0.0591 0.0320  0.0603  12   ILE A CD1   
90   N N     . ASN A 13  ? 0.7228 0.6623 0.6569 -0.0480 0.0417  0.0428  13   ASN A N     
91   C CA    . ASN A 13  ? 0.7461 0.6828 0.6854 -0.0420 0.0444  0.0396  13   ASN A CA    
92   C C     . ASN A 13  ? 0.7515 0.6961 0.7052 -0.0419 0.0446  0.0409  13   ASN A C     
93   O O     . ASN A 13  ? 0.7406 0.6962 0.7057 -0.0441 0.0427  0.0455  13   ASN A O     
94   C CB    . ASN A 13  ? 0.8311 0.7685 0.7753 -0.0357 0.0448  0.0396  13   ASN A CB    
95   C CG    . ASN A 13  ? 0.8573 0.7865 0.7971 -0.0304 0.0477  0.0352  13   ASN A CG    
96   O OD1   . ASN A 13  ? 0.9151 0.8346 0.8422 -0.0310 0.0496  0.0316  13   ASN A OD1   
97   N ND2   . ASN A 13  ? 0.7963 0.7292 0.7461 -0.0255 0.0482  0.0354  13   ASN A ND2   
98   N N     . GLY A 14  ? 0.7384 0.6770 0.6914 -0.0391 0.0473  0.0372  14   GLY A N     
99   C CA    . GLY A 14  ? 0.6651 0.6087 0.6296 -0.0390 0.0482  0.0380  14   GLY A CA    
100  C C     . GLY A 14  ? 0.7272 0.6791 0.7079 -0.0349 0.0484  0.0412  14   GLY A C     
101  O O     . GLY A 14  ? 0.7190 0.6760 0.7102 -0.0346 0.0495  0.0432  14   GLY A O     
102  N N     . ASP A 15  ? 0.7780 0.7307 0.7601 -0.0316 0.0478  0.0418  15   ASP A N     
103  C CA    . ASP A 15  ? 0.7771 0.7370 0.7731 -0.0280 0.0481  0.0448  15   ASP A CA    
104  C C     . ASP A 15  ? 0.6159 0.5870 0.6201 -0.0303 0.0456  0.0505  15   ASP A C     
105  O O     . ASP A 15  ? 0.6450 0.6226 0.6608 -0.0276 0.0461  0.0537  15   ASP A O     
106  C CB    . ASP A 15  ? 0.7965 0.7519 0.7909 -0.0232 0.0490  0.0426  15   ASP A CB    
107  C CG    . ASP A 15  ? 0.8464 0.7998 0.8315 -0.0235 0.0472  0.0422  15   ASP A CG    
108  O OD1   . ASP A 15  ? 0.8768 0.8321 0.8572 -0.0276 0.0452  0.0440  15   ASP A OD1   
109  O OD2   . ASP A 15  ? 0.7183 0.6682 0.7007 -0.0197 0.0479  0.0404  15   ASP A OD2   
110  N N     . LYS A 16  ? 0.6544 0.6273 0.6519 -0.0353 0.0432  0.0518  16   LYS A N     
111  C CA    . LYS A 16  ? 0.6466 0.6303 0.6510 -0.0381 0.0404  0.0573  16   LYS A CA    
112  C C     . LYS A 16  ? 0.6496 0.6421 0.6612 -0.0420 0.0399  0.0612  16   LYS A C     
113  O O     . LYS A 16  ? 0.5773 0.5668 0.5879 -0.0428 0.0417  0.0594  16   LYS A O     
114  C CB    . LYS A 16  ? 0.6050 0.5859 0.5976 -0.0421 0.0378  0.0573  16   LYS A CB    
115  C CG    . LYS A 16  ? 0.6189 0.5896 0.6009 -0.0389 0.0387  0.0533  16   LYS A CG    
116  C CD    . LYS A 16  ? 0.5920 0.5655 0.5825 -0.0333 0.0392  0.0540  16   LYS A CD    
117  C CE    . LYS A 16  ? 0.5620 0.5268 0.5417 -0.0306 0.0397  0.0508  16   LYS A CE    
118  N NZ    . LYS A 16  ? 0.6033 0.5709 0.5907 -0.0256 0.0402  0.0514  16   LYS A NZ    
119  N N     . GLY A 17  ? 0.6225 0.6260 0.6410 -0.0446 0.0374  0.0668  17   GLY A N     
120  C CA    . GLY A 17  ? 0.6499 0.6645 0.6771 -0.0481 0.0368  0.0718  17   GLY A CA    
121  C C     . GLY A 17  ? 0.7006 0.7149 0.7178 -0.0558 0.0346  0.0717  17   GLY A C     
122  O O     . GLY A 17  ? 0.6367 0.6601 0.6552 -0.0611 0.0316  0.0764  17   GLY A O     
123  N N     . TYR A 18  ? 0.7444 0.7482 0.7513 -0.0569 0.0363  0.0665  18   TYR A N     
124  C CA    . TYR A 18  ? 0.7528 0.7540 0.7474 -0.0646 0.0346  0.0657  18   TYR A CA    
125  C C     . TYR A 18  ? 0.7910 0.8047 0.7940 -0.0695 0.0335  0.0708  18   TYR A C     
126  O O     . TYR A 18  ? 0.8123 0.8292 0.8081 -0.0773 0.0308  0.0728  18   TYR A O     
127  C CB    . TYR A 18  ? 0.7512 0.7369 0.7310 -0.0643 0.0370  0.0586  18   TYR A CB    
128  C CG    . TYR A 18  ? 0.7256 0.7079 0.7111 -0.0598 0.0404  0.0558  18   TYR A CG    
129  C CD1   . TYR A 18  ? 0.7471 0.7341 0.7369 -0.0628 0.0411  0.0572  18   TYR A CD1   
130  C CD2   . TYR A 18  ? 0.7256 0.6997 0.7115 -0.0528 0.0431  0.0517  18   TYR A CD2   
131  C CE1   . TYR A 18  ? 0.7461 0.7287 0.7404 -0.0587 0.0444  0.0545  18   TYR A CE1   
132  C CE2   . TYR A 18  ? 0.7582 0.7282 0.7483 -0.0491 0.0462  0.0491  18   TYR A CE2   
133  C CZ    . TYR A 18  ? 0.7919 0.7657 0.7861 -0.0519 0.0470  0.0504  18   TYR A CZ    
134  O OH    . TYR A 18  ? 0.8311 0.7997 0.8290 -0.0482 0.0503  0.0478  18   TYR A OH    
135  N N     . ASN A 19  ? 0.7998 0.8206 0.8176 -0.0650 0.0357  0.0734  19   ASN A N     
136  C CA    . ASN A 19  ? 0.7465 0.7812 0.7746 -0.0685 0.0350  0.0795  19   ASN A CA    
137  C C     . ASN A 19  ? 0.6662 0.7156 0.7027 -0.0710 0.0317  0.0868  19   ASN A C     
138  O O     . ASN A 19  ? 0.6397 0.6993 0.6766 -0.0779 0.0289  0.0915  19   ASN A O     
139  C CB    . ASN A 19  ? 0.7860 0.8232 0.8271 -0.0624 0.0389  0.0807  19   ASN A CB    
140  C CG    . ASN A 19  ? 0.8736 0.8992 0.9071 -0.0622 0.0416  0.0747  19   ASN A CG    
141  O OD1   . ASN A 19  ? 0.8682 0.8885 0.8891 -0.0683 0.0404  0.0717  19   ASN A OD1   
142  N ND2   . ASN A 19  ? 0.9377 0.9585 0.9779 -0.0555 0.0456  0.0731  19   ASN A ND2   
143  N N     . GLY A 20  ? 0.6848 0.7354 0.7276 -0.0654 0.0320  0.0880  20   GLY A N     
144  C CA    . GLY A 20  ? 0.6994 0.7620 0.7485 -0.0673 0.0288  0.0942  20   GLY A CA    
145  C C     . GLY A 20  ? 0.7500 0.8107 0.7854 -0.0759 0.0247  0.0938  20   GLY A C     
146  O O     . GLY A 20  ? 0.7886 0.8614 0.8268 -0.0820 0.0214  0.0996  20   GLY A O     
147  N N     . LEU A 21  ? 0.7455 0.7907 0.7654 -0.0763 0.0249  0.0871  21   LEU A N     
148  C CA    . LEU A 21  ? 0.7553 0.7952 0.7592 -0.0842 0.0218  0.0861  21   LEU A CA    
149  C C     . LEU A 21  ? 0.7959 0.8403 0.7946 -0.0931 0.0202  0.0881  21   LEU A C     
150  O O     . LEU A 21  ? 0.8831 0.9337 0.8772 -0.1010 0.0165  0.0920  21   LEU A O     
151  C CB    . LEU A 21  ? 0.7282 0.7493 0.7155 -0.0823 0.0236  0.0786  21   LEU A CB    
152  C CG    . LEU A 21  ? 0.7060 0.7188 0.6751 -0.0893 0.0212  0.0775  21   LEU A CG    
153  C CD1   . LEU A 21  ? 0.5809 0.6012 0.5545 -0.0904 0.0181  0.0822  21   LEU A CD1   
154  C CD2   . LEU A 21  ? 0.6751 0.6694 0.6283 -0.0862 0.0239  0.0705  21   LEU A CD2   
155  N N     . ALA A 22  ? 0.6827 0.7240 0.6820 -0.0919 0.0229  0.0853  22   ALA A N     
156  C CA    . ALA A 22  ? 0.6966 0.7421 0.6914 -0.1000 0.0218  0.0868  22   ALA A CA    
157  C C     . ALA A 22  ? 0.7848 0.8505 0.7921 -0.1049 0.0185  0.0958  22   ALA A C     
158  O O     . ALA A 22  ? 0.8444 0.9146 0.8439 -0.1146 0.0154  0.0984  22   ALA A O     
159  C CB    . ALA A 22  ? 0.7043 0.7454 0.7021 -0.0963 0.0256  0.0833  22   ALA A CB    
160  N N     . GLU A 23  ? 0.8031 0.8810 0.8291 -0.0982 0.0194  0.1008  23   GLU A N     
161  C CA    . GLU A 23  ? 0.8008 0.8991 0.8402 -0.1015 0.0167  0.1101  23   GLU A CA    
162  C C     . GLU A 23  ? 0.8311 0.9330 0.8631 -0.1086 0.0119  0.1131  23   GLU A C     
163  O O     . GLU A 23  ? 0.9301 1.0444 0.9627 -0.1170 0.0084  0.1189  23   GLU A O     
164  C CB    . GLU A 23  ? 0.8988 1.0069 0.9577 -0.0918 0.0193  0.1145  23   GLU A CB    
165  C CG    . GLU A 23  ? 1.0122 1.1193 1.0799 -0.0856 0.0240  0.1135  23   GLU A CG    
166  C CD    . GLU A 23  ? 1.1037 1.2175 1.1882 -0.0759 0.0273  0.1176  23   GLU A CD    
167  O OE1   . GLU A 23  ? 1.1321 1.2538 1.2226 -0.0745 0.0256  0.1220  23   GLU A OE1   
168  O OE2   . GLU A 23  ? 1.1612 1.2715 1.2520 -0.0698 0.0318  0.1164  23   GLU A OE2   
169  N N     . VAL A 24  ? 0.7888 0.8800 0.8139 -0.1056 0.0117  0.1094  24   VAL A N     
170  C CA    . VAL A 24  ? 0.7792 0.8708 0.7953 -0.1122 0.0076  0.1115  24   VAL A CA    
171  C C     . VAL A 24  ? 0.8392 0.9248 0.8369 -0.1238 0.0052  0.1100  24   VAL A C     
172  O O     . VAL A 24  ? 0.9120 1.0052 0.9057 -0.1325 0.0010  0.1149  24   VAL A O     
173  C CB    . VAL A 24  ? 0.7273 0.8050 0.7362 -0.1069 0.0085  0.1065  24   VAL A CB    
174  C CG1   . VAL A 24  ? 0.6343 0.7123 0.6342 -0.1138 0.0043  0.1092  24   VAL A CG1   
175  C CG2   . VAL A 24  ? 0.7263 0.8087 0.7518 -0.0960 0.0110  0.1075  24   VAL A CG2   
176  N N     . GLY A 25  ? 0.9294 1.0008 0.9152 -0.1240 0.0079  0.1034  25   GLY A N     
177  C CA    . GLY A 25  ? 1.0724 1.1362 1.0392 -0.1347 0.0065  0.1013  25   GLY A CA    
178  C C     . GLY A 25  ? 1.1972 1.2771 1.1705 -0.1424 0.0043  0.1073  25   GLY A C     
179  O O     . GLY A 25  ? 1.2923 1.3715 1.2518 -0.1537 0.0015  0.1085  25   GLY A O     
180  N N     . LYS A 26  ? 1.1868 1.2811 1.1804 -0.1365 0.0057  0.1113  26   LYS A N     
181  C CA    . LYS A 26  ? 1.1030 1.2152 1.1057 -0.1427 0.0039  0.1181  26   LYS A CA    
182  C C     . LYS A 26  ? 1.0759 1.2061 1.0850 -0.1492 -0.0011 0.1271  26   LYS A C     
183  O O     . LYS A 26  ? 1.1341 1.2750 1.1404 -0.1596 -0.0044 0.1320  26   LYS A O     
184  C CB    . LYS A 26  ? 1.0650 1.1865 1.0874 -0.1335 0.0076  0.1202  26   LYS A CB    
185  N N     . LYS A 27  ? 0.9885 1.1220 1.0057 -0.1435 -0.0018 0.1294  27   LYS A N     
186  C CA    . LYS A 27  ? 0.8896 1.0385 0.9118 -0.1492 -0.0066 0.1375  27   LYS A CA    
187  C C     . LYS A 27  ? 1.0195 1.1565 1.0197 -0.1595 -0.0101 0.1350  27   LYS A C     
188  O O     . LYS A 27  ? 1.1358 1.2831 1.1356 -0.1668 -0.0146 0.1411  27   LYS A O     
189  C CB    . LYS A 27  ? 0.7470 0.9027 0.7850 -0.1392 -0.0058 0.1406  27   LYS A CB    
190  N N     . PHE A 28  ? 0.9991 1.1140 0.9806 -0.1599 -0.0077 0.1262  28   PHE A N     
191  C CA    . PHE A 28  ? 1.0478 1.1484 1.0057 -0.1696 -0.0100 0.1234  28   PHE A CA    
192  C C     . PHE A 28  ? 1.0956 1.1963 1.0402 -0.1819 -0.0115 0.1239  28   PHE A C     
193  O O     . PHE A 28  ? 1.1025 1.2049 1.0350 -0.1939 -0.0155 0.1273  28   PHE A O     
194  C CB    . PHE A 28  ? 0.9897 1.0658 0.9328 -0.1635 -0.0062 0.1142  28   PHE A CB    
195  C CG    . PHE A 28  ? 0.9417 1.0016 0.8604 -0.1719 -0.0077 0.1117  28   PHE A CG    
196  C CD1   . PHE A 28  ? 0.8275 0.8896 0.7454 -0.1739 -0.0108 0.1153  28   PHE A CD1   
197  C CD2   . PHE A 28  ? 0.9508 0.9925 0.8467 -0.1776 -0.0057 0.1059  28   PHE A CD2   
198  C CE1   . PHE A 28  ? 0.7969 0.8429 0.6915 -0.1816 -0.0118 0.1133  28   PHE A CE1   
199  C CE2   . PHE A 28  ? 0.9476 0.9730 0.8197 -0.1851 -0.0064 0.1039  28   PHE A CE2   
200  C CZ    . PHE A 28  ? 0.8793 0.9067 0.7507 -0.1872 -0.0094 0.1077  28   PHE A CZ    
201  N N     . GLU A 29  ? 1.1316 1.2303 1.0786 -0.1791 -0.0083 0.1205  29   GLU A N     
202  C CA    . GLU A 29  ? 1.1890 1.2880 1.1248 -0.1898 -0.0091 0.1205  29   GLU A CA    
203  C C     . GLU A 29  ? 1.2452 1.3699 1.1941 -0.1978 -0.0136 0.1307  29   GLU A C     
204  O O     . GLU A 29  ? 1.2564 1.3838 1.1939 -0.2101 -0.0160 0.1326  29   GLU A O     
205  C CB    . GLU A 29  ? 1.1775 1.2693 1.1156 -0.1833 -0.0043 0.1147  29   GLU A CB    
206  C CG    . GLU A 29  ? 1.2271 1.3174 1.1532 -0.1934 -0.0045 0.1137  29   GLU A CG    
207  C CD    . GLU A 29  ? 1.3127 1.3914 1.2376 -0.1866 0.0007  0.1064  29   GLU A CD    
208  O OE1   . GLU A 29  ? 1.3385 1.4102 1.2716 -0.1742 0.0042  0.1023  29   GLU A OE1   
209  O OE2   . GLU A 29  ? 1.3511 1.4272 1.2663 -0.1939 0.0011  0.1047  29   GLU A OE2   
210  N N     . LYS A 30  ? 1.2692 1.4128 1.2414 -0.1909 -0.0145 0.1375  30   LYS A N     
211  C CA    . LYS A 30  ? 1.2429 1.4129 1.2299 -0.1968 -0.0185 0.1482  30   LYS A CA    
212  C C     . LYS A 30  ? 1.2479 1.4245 1.2286 -0.2063 -0.0240 0.1538  30   LYS A C     
213  O O     . LYS A 30  ? 1.2836 1.4818 1.2733 -0.2136 -0.0281 0.1630  30   LYS A O     
214  C CB    . LYS A 30  ? 1.2028 1.3901 1.2174 -0.1844 -0.0162 0.1535  30   LYS A CB    
215  N N     . ASP A 31  ? 1.2309 1.3889 1.1962 -0.2063 -0.0241 0.1486  31   ASP A N     
216  C CA    . ASP A 31  ? 1.2041 1.3659 1.1629 -0.2145 -0.0290 0.1534  31   ASP A CA    
217  C C     . ASP A 31  ? 1.2038 1.3452 1.1324 -0.2267 -0.0304 0.1487  31   ASP A C     
218  O O     . ASP A 31  ? 1.2373 1.3813 1.1567 -0.2370 -0.0349 0.1531  31   ASP A O     
219  C CB    . ASP A 31  ? 1.1858 1.3455 1.1543 -0.2037 -0.0282 0.1531  31   ASP A CB    
220  C CG    . ASP A 31  ? 1.1739 1.3558 1.1709 -0.1937 -0.0276 0.1598  31   ASP A CG    
221  O OD1   . ASP A 31  ? 1.1544 1.3470 1.1639 -0.1904 -0.0255 0.1617  31   ASP A OD1   
222  O OD2   . ASP A 31  ? 1.1470 1.3349 1.1533 -0.1890 -0.0289 0.1632  31   ASP A OD2   
223  N N     . THR A 32  ? 1.1593 1.2796 1.0719 -0.2255 -0.0262 0.1399  32   THR A N     
224  C CA    . THR A 32  ? 1.1199 1.2178 1.0020 -0.2358 -0.0262 0.1348  32   THR A CA    
225  C C     . THR A 32  ? 1.1387 1.2303 1.0074 -0.2433 -0.0246 0.1314  32   THR A C     
226  O O     . THR A 32  ? 1.2391 1.3232 1.0860 -0.2572 -0.0266 0.1316  32   THR A O     
227  C CB    . THR A 32  ? 1.0322 1.1050 0.9023 -0.2267 -0.0218 0.1262  32   THR A CB    
228  O OG1   . THR A 32  ? 0.9433 1.0076 0.8171 -0.2166 -0.0165 0.1195  32   THR A OG1   
229  C CG2   . THR A 32  ? 0.9634 1.0421 0.8482 -0.2178 -0.0228 0.1288  32   THR A CG2   
230  N N     . GLY A 33  ? 1.0803 1.1743 0.9614 -0.2342 -0.0209 0.1283  33   GLY A N     
231  C CA    . GLY A 33  ? 1.1815 1.2681 1.0508 -0.2394 -0.0186 0.1241  33   GLY A CA    
232  C C     . GLY A 33  ? 1.2843 1.3431 1.1365 -0.2327 -0.0129 0.1134  33   GLY A C     
233  O O     . GLY A 33  ? 1.3441 1.3919 1.1832 -0.2359 -0.0102 0.1083  33   GLY A O     
234  N N     . ILE A 34  ? 1.2433 1.2913 1.0958 -0.2232 -0.0110 0.1101  34   ILE A N     
235  C CA    . ILE A 34  ? 1.1491 1.1722 0.9872 -0.2155 -0.0056 0.1007  34   ILE A CA    
236  C C     . ILE A 34  ? 1.0253 1.0517 0.8821 -0.2018 -0.0017 0.0973  34   ILE A C     
237  O O     . ILE A 34  ? 0.8980 0.9356 0.7762 -0.1918 -0.0018 0.0998  34   ILE A O     
238  C CB    . ILE A 34  ? 1.1742 1.1846 1.0046 -0.2111 -0.0051 0.0991  34   ILE A CB    
239  C CG1   . ILE A 34  ? 1.1707 1.1800 0.9854 -0.2244 -0.0094 0.1038  34   ILE A CG1   
240  C CG2   . ILE A 34  ? 1.1796 1.1639 0.9921 -0.2045 0.0006  0.0901  34   ILE A CG2   
241  C CD1   . ILE A 34  ? 1.1580 1.1529 0.9445 -0.2380 -0.0090 0.1015  34   ILE A CD1   
242  N N     . LYS A 35  ? 1.1061 1.1222 0.9541 -0.2017 0.0018  0.0917  35   LYS A N     
243  C CA    . LYS A 35  ? 1.1225 1.1398 0.9861 -0.1895 0.0057  0.0880  35   LYS A CA    
244  C C     . LYS A 35  ? 1.1492 1.1518 1.0117 -0.1775 0.0093  0.0824  35   LYS A C     
245  O O     . LYS A 35  ? 1.2212 1.2028 1.0619 -0.1781 0.0118  0.0767  35   LYS A O     
246  C CB    . LYS A 35  ? 1.1117 1.1201 0.9642 -0.1928 0.0086  0.0830  35   LYS A CB    
247  N N     . VAL A 36  ? 1.0563 1.0698 0.9416 -0.1666 0.0097  0.0843  36   VAL A N     
248  C CA    . VAL A 36  ? 0.9474 0.9494 0.8337 -0.1553 0.0127  0.0797  36   VAL A CA    
249  C C     . VAL A 36  ? 1.0026 0.9995 0.8963 -0.1454 0.0172  0.0743  36   VAL A C     
250  O O     . VAL A 36  ? 1.1079 1.1183 1.0205 -0.1417 0.0174  0.0770  36   VAL A O     
251  C CB    . VAL A 36  ? 0.8279 0.8432 0.7322 -0.1500 0.0103  0.0850  36   VAL A CB    
252  C CG1   . VAL A 36  ? 0.8537 0.8587 0.7609 -0.1381 0.0136  0.0803  36   VAL A CG1   
253  C CG2   . VAL A 36  ? 0.6793 0.6969 0.5742 -0.1594 0.0061  0.0896  36   VAL A CG2   
254  N N     . THR A 37  ? 0.9288 0.9057 0.8071 -0.1411 0.0209  0.0671  37   THR A N     
255  C CA    . THR A 37  ? 0.9218 0.8918 0.8045 -0.1323 0.0252  0.0615  37   THR A CA    
256  C C     . THR A 37  ? 0.9124 0.8762 0.8003 -0.1211 0.0274  0.0588  37   THR A C     
257  O O     . THR A 37  ? 0.9805 0.9319 0.8543 -0.1203 0.0281  0.0564  37   THR A O     
258  C CB    . THR A 37  ? 0.9943 0.9460 0.8543 -0.1361 0.0284  0.0549  37   THR A CB    
259  O OG1   . THR A 37  ? 1.0160 0.9734 0.8706 -0.1471 0.0264  0.0574  37   THR A OG1   
260  C CG2   . THR A 37  ? 0.9993 0.9441 0.8642 -0.1269 0.0326  0.0493  37   THR A CG2   
261  N N     . VAL A 38  ? 0.8590 0.8314 0.7668 -0.1125 0.0285  0.0594  38   VAL A N     
262  C CA    . VAL A 38  ? 0.7377 0.7053 0.6513 -0.1023 0.0305  0.0570  38   VAL A CA    
263  C C     . VAL A 38  ? 0.7881 0.7444 0.6989 -0.0957 0.0348  0.0506  38   VAL A C     
264  O O     . VAL A 38  ? 0.8516 0.8126 0.7718 -0.0944 0.0360  0.0503  38   VAL A O     
265  C CB    . VAL A 38  ? 0.7748 0.7589 0.7118 -0.0971 0.0291  0.0624  38   VAL A CB    
266  C CG1   . VAL A 38  ? 0.8123 0.7908 0.7544 -0.0870 0.0313  0.0595  38   VAL A CG1   
267  C CG2   . VAL A 38  ? 0.7516 0.7473 0.6921 -0.1030 0.0248  0.0689  38   VAL A CG2   
268  N N     . GLU A 39  ? 0.8379 0.7795 0.7359 -0.0915 0.0372  0.0457  39   GLU A N     
269  C CA    . GLU A 39  ? 0.8142 0.7447 0.7084 -0.0851 0.0412  0.0397  39   GLU A CA    
270  C C     . GLU A 39  ? 0.7448 0.6726 0.6447 -0.0758 0.0426  0.0382  39   GLU A C     
271  O O     . GLU A 39  ? 0.7923 0.7207 0.6908 -0.0750 0.0412  0.0402  39   GLU A O     
272  C CB    . GLU A 39  ? 1.0057 0.9193 0.8758 -0.0891 0.0435  0.0346  39   GLU A CB    
273  C CG    . GLU A 39  ? 1.1684 1.0833 1.0302 -0.0993 0.0422  0.0357  39   GLU A CG    
274  C CD    . GLU A 39  ? 1.3674 1.2638 1.2029 -0.1034 0.0449  0.0307  39   GLU A CD    
275  O OE1   . GLU A 39  ? 1.3983 1.2818 1.2210 -0.0993 0.0473  0.0278  39   GLU A OE1   
276  O OE2   . GLU A 39  ? 1.4380 1.3325 1.2652 -0.1108 0.0450  0.0298  39   GLU A OE2   
277  N N     . HIS A 40  ? 0.7322 0.6571 0.6383 -0.0692 0.0453  0.0348  40   HIS A N     
278  C CA    . HIS A 40  ? 0.7585 0.6817 0.6706 -0.0608 0.0465  0.0336  40   HIS A CA    
279  C C     . HIS A 40  ? 0.7928 0.7023 0.6943 -0.0559 0.0502  0.0276  40   HIS A C     
280  O O     . HIS A 40  ? 0.8822 0.7921 0.7927 -0.0507 0.0519  0.0258  40   HIS A O     
281  C CB    . HIS A 40  ? 0.8047 0.7405 0.7385 -0.0568 0.0459  0.0370  40   HIS A CB    
282  C CG    . HIS A 40  ? 0.7992 0.7379 0.7410 -0.0570 0.0473  0.0365  40   HIS A CG    
283  N ND1   . HIS A 40  ? 0.7738 0.7071 0.7193 -0.0514 0.0502  0.0329  40   HIS A ND1   
284  C CD2   . HIS A 40  ? 0.7369 0.6834 0.6838 -0.0624 0.0462  0.0395  40   HIS A CD2   
285  C CE1   . HIS A 40  ? 0.7865 0.7231 0.7386 -0.0530 0.0511  0.0335  40   HIS A CE1   
286  N NE2   . HIS A 40  ? 0.7704 0.7156 0.7239 -0.0595 0.0487  0.0376  40   HIS A NE2   
287  N N     . PRO A 41  ? 0.8134 0.7105 0.6952 -0.0576 0.0517  0.0247  41   PRO A N     
288  C CA    . PRO A 41  ? 0.8832 0.7666 0.7523 -0.0532 0.0555  0.0192  41   PRO A CA    
289  C C     . PRO A 41  ? 0.8840 0.7676 0.7603 -0.0447 0.0567  0.0183  41   PRO A C     
290  O O     . PRO A 41  ? 0.8475 0.7375 0.7312 -0.0425 0.0549  0.0215  41   PRO A O     
291  C CB    . PRO A 41  ? 0.8155 0.6872 0.6627 -0.0565 0.0566  0.0183  41   PRO A CB    
292  C CG    . PRO A 41  ? 0.7967 0.6748 0.6435 -0.0651 0.0533  0.0223  41   PRO A CG    
293  C CD    . PRO A 41  ? 0.8142 0.7090 0.6836 -0.0639 0.0500  0.0270  41   PRO A CD    
294  N N     . ASP A 42  ? 0.8479 0.7245 0.7219 -0.0402 0.0595  0.0141  42   ASP A N     
295  C CA    . ASP A 42  ? 0.8768 0.7519 0.7539 -0.0326 0.0610  0.0129  42   ASP A CA    
296  C C     . ASP A 42  ? 0.8232 0.6905 0.6852 -0.0305 0.0623  0.0127  42   ASP A C     
297  O O     . ASP A 42  ? 0.7644 0.6229 0.6098 -0.0343 0.0635  0.0118  42   ASP A O     
298  C CB    . ASP A 42  ? 1.0048 0.8731 0.8804 -0.0291 0.0638  0.0083  42   ASP A CB    
299  C CG    . ASP A 42  ? 1.1750 1.0503 1.0661 -0.0301 0.0630  0.0088  42   ASP A CG    
300  O OD1   . ASP A 42  ? 1.2069 1.0931 1.1136 -0.0297 0.0609  0.0126  42   ASP A OD1   
301  O OD2   . ASP A 42  ? 1.2247 1.0940 1.1120 -0.0312 0.0648  0.0054  42   ASP A OD2   
302  N N     . LYS A 43  ? 0.7481 0.6184 0.6154 -0.0246 0.0624  0.0138  43   LYS A N     
303  C CA    . LYS A 43  ? 0.8839 0.7482 0.7389 -0.0216 0.0639  0.0144  43   LYS A CA    
304  C C     . LYS A 43  ? 0.9317 0.7931 0.7761 -0.0272 0.0629  0.0167  43   LYS A C     
305  O O     . LYS A 43  ? 0.9458 0.7958 0.7718 -0.0271 0.0655  0.0158  43   LYS A O     
306  C CB    . LYS A 43  ? 0.9924 0.8442 0.8320 -0.0175 0.0681  0.0105  43   LYS A CB    
307  C CG    . LYS A 43  ? 1.0791 0.9327 0.9271 -0.0120 0.0692  0.0082  43   LYS A CG    
308  C CD    . LYS A 43  ? 1.2514 1.0925 1.0831 -0.0084 0.0735  0.0044  43   LYS A CD    
309  C CE    . LYS A 43  ? 1.3560 1.1986 1.1955 -0.0035 0.0744  0.0022  43   LYS A CE    
310  N NZ    . LYS A 43  ? 1.3793 1.2098 1.2030 -0.0001 0.0786  -0.0016 43   LYS A NZ    
311  N N     . LEU A 44  ? 0.8922 0.7635 0.7477 -0.0321 0.0592  0.0200  44   LEU A N     
312  C CA    . LEU A 44  ? 0.8622 0.7320 0.7089 -0.0388 0.0577  0.0224  44   LEU A CA    
313  C C     . LEU A 44  ? 0.8155 0.6805 0.6526 -0.0368 0.0583  0.0245  44   LEU A C     
314  O O     . LEU A 44  ? 0.7456 0.6016 0.5661 -0.0411 0.0592  0.0249  44   LEU A O     
315  C CB    . LEU A 44  ? 0.8822 0.7659 0.7454 -0.0436 0.0535  0.0261  44   LEU A CB    
316  C CG    . LEU A 44  ? 0.8515 0.7422 0.7190 -0.0463 0.0504  0.0308  44   LEU A CG    
317  C CD1   . LEU A 44  ? 0.9515 0.8345 0.8016 -0.0536 0.0501  0.0317  44   LEU A CD1   
318  C CD2   . LEU A 44  ? 0.7536 0.6596 0.6415 -0.0480 0.0471  0.0342  44   LEU A CD2   
319  N N     . GLU A 45  ? 0.8113 0.6820 0.6583 -0.0305 0.0580  0.0258  45   GLU A N     
320  C CA    . GLU A 45  ? 0.8120 0.6792 0.6516 -0.0279 0.0587  0.0280  45   GLU A CA    
321  C C     . GLU A 45  ? 0.8384 0.6906 0.6574 -0.0246 0.0635  0.0257  45   GLU A C     
322  O O     . GLU A 45  ? 0.9218 0.7668 0.7284 -0.0237 0.0651  0.0275  45   GLU A O     
323  C CB    . GLU A 45  ? 0.8173 0.6946 0.6726 -0.0220 0.0574  0.0299  45   GLU A CB    
324  C CG    . GLU A 45  ? 0.8536 0.7290 0.7093 -0.0146 0.0602  0.0276  45   GLU A CG    
325  C CD    . GLU A 45  ? 0.8662 0.7469 0.7341 -0.0140 0.0597  0.0252  45   GLU A CD    
326  O OE1   . GLU A 45  ? 0.7474 0.6304 0.6196 -0.0191 0.0582  0.0247  45   GLU A OE1   
327  O OE2   . GLU A 45  ? 0.9054 0.7879 0.7782 -0.0085 0.0609  0.0241  45   GLU A OE2   
328  N N     . GLU A 46  ? 0.7866 0.6336 0.6016 -0.0224 0.0660  0.0220  46   GLU A N     
329  C CA    . GLU A 46  ? 0.8961 0.7287 0.6913 -0.0188 0.0711  0.0196  46   GLU A CA    
330  C C     . GLU A 46  ? 0.9083 0.7284 0.6847 -0.0254 0.0729  0.0177  46   GLU A C     
331  O O     . GLU A 46  ? 0.8889 0.6949 0.6446 -0.0246 0.0770  0.0172  46   GLU A O     
332  C CB    . GLU A 46  ? 0.8684 0.7014 0.6682 -0.0126 0.0732  0.0165  46   GLU A CB    
333  C CG    . GLU A 46  ? 0.9572 0.8002 0.7713 -0.0058 0.0722  0.0183  46   GLU A CG    
334  C CD    . GLU A 46  ? 1.0618 0.9040 0.8779 -0.0003 0.0744  0.0154  46   GLU A CD    
335  O OE1   . GLU A 46  ? 1.0917 0.9240 0.8961 -0.0009 0.0773  0.0119  46   GLU A OE1   
336  O OE2   . GLU A 46  ? 1.1091 0.9603 0.9380 0.0042  0.0733  0.0166  46   GLU A OE2   
337  N N     . LYS A 47  ? 0.8699 0.6949 0.6531 -0.0320 0.0702  0.0167  47   LYS A N     
338  C CA    . LYS A 47  ? 0.9428 0.7571 0.7091 -0.0391 0.0716  0.0146  47   LYS A CA    
339  C C     . LYS A 47  ? 0.9856 0.7955 0.7401 -0.0463 0.0705  0.0176  47   LYS A C     
340  O O     . LYS A 47  ? 1.0771 0.8727 0.8098 -0.0507 0.0734  0.0163  47   LYS A O     
341  C CB    . LYS A 47  ? 1.0456 0.8671 0.8233 -0.0435 0.0693  0.0128  47   LYS A CB    
342  C CG    . LYS A 47  ? 1.1103 0.9296 0.8912 -0.0378 0.0718  0.0086  47   LYS A CG    
343  C CD    . LYS A 47  ? 1.1669 0.9938 0.9605 -0.0418 0.0696  0.0072  47   LYS A CD    
344  C CE    . LYS A 47  ? 1.2369 1.0618 1.0352 -0.0359 0.0719  0.0033  47   LYS A CE    
345  N NZ    . LYS A 47  ? 1.2083 1.0410 1.0209 -0.0389 0.0699  0.0025  47   LYS A NZ    
346  N N     . PHE A 48  ? 0.9168 0.7383 0.6848 -0.0479 0.0663  0.0218  48   PHE A N     
347  C CA    . PHE A 48  ? 0.8720 0.6897 0.6293 -0.0551 0.0649  0.0249  48   PHE A CA    
348  C C     . PHE A 48  ? 0.9367 0.7373 0.6706 -0.0529 0.0696  0.0250  48   PHE A C     
349  O O     . PHE A 48  ? 0.9989 0.7866 0.7121 -0.0596 0.0713  0.0248  48   PHE A O     
350  C CB    . PHE A 48  ? 0.7854 0.6183 0.5614 -0.0564 0.0599  0.0294  48   PHE A CB    
351  C CG    . PHE A 48  ? 0.8273 0.6555 0.5916 -0.0632 0.0585  0.0327  48   PHE A CG    
352  C CD1   . PHE A 48  ? 0.8415 0.6705 0.6007 -0.0736 0.0559  0.0339  48   PHE A CD1   
353  C CD2   . PHE A 48  ? 0.7661 0.5888 0.5238 -0.0594 0.0599  0.0349  48   PHE A CD2   
354  C CE1   . PHE A 48  ? 0.8530 0.6771 0.6005 -0.0805 0.0545  0.0371  48   PHE A CE1   
355  C CE2   . PHE A 48  ? 0.7819 0.5988 0.5278 -0.0659 0.0588  0.0379  48   PHE A CE2   
356  C CZ    . PHE A 48  ? 0.8072 0.6248 0.5479 -0.0767 0.0560  0.0390  48   PHE A CZ    
357  N N     . PRO A 49  ? 0.9535 0.7536 0.6899 -0.0438 0.0718  0.0257  49   PRO A N     
358  C CA    . PRO A 49  ? 1.0059 0.7899 0.7203 -0.0411 0.0766  0.0267  49   PRO A CA    
359  C C     . PRO A 49  ? 1.1140 0.8799 0.8043 -0.0413 0.0824  0.0232  49   PRO A C     
360  O O     . PRO A 49  ? 1.1514 0.9010 0.8184 -0.0433 0.0864  0.0240  49   PRO A O     
361  C CB    . PRO A 49  ? 0.8669 0.6570 0.5921 -0.0305 0.0778  0.0281  49   PRO A CB    
362  C CG    . PRO A 49  ? 0.8151 0.6194 0.5621 -0.0273 0.0752  0.0260  49   PRO A CG    
363  C CD    . PRO A 49  ? 0.8251 0.6384 0.5829 -0.0358 0.0703  0.0259  49   PRO A CD    
364  N N     . GLN A 50  ? 1.0811 0.8490 0.7763 -0.0394 0.0831  0.0193  50   GLN A N     
365  C CA    . GLN A 50  ? 1.1646 0.9158 0.8380 -0.0397 0.0885  0.0155  50   GLN A CA    
366  C C     . GLN A 50  ? 1.2012 0.9437 0.8590 -0.0512 0.0880  0.0146  50   GLN A C     
367  O O     . GLN A 50  ? 1.2660 0.9908 0.8982 -0.0541 0.0923  0.0147  50   GLN A O     
368  C CB    . GLN A 50  ? 1.1364 0.8930 0.8208 -0.0350 0.0890  0.0116  50   GLN A CB    
369  C CG    . GLN A 50  ? 1.2682 1.0291 0.9612 -0.0236 0.0910  0.0119  50   GLN A CG    
370  C CD    . GLN A 50  ? 1.4345 1.2048 1.1441 -0.0202 0.0896  0.0088  50   GLN A CD    
371  O OE1   . GLN A 50  ? 1.4910 1.2637 1.2056 -0.0117 0.0915  0.0084  50   GLN A OE1   
372  N NE2   . GLN A 50  ? 1.4848 1.2608 1.2031 -0.0269 0.0862  0.0069  50   GLN A NE2   
373  N N     . VAL A 51  ? 1.2003 0.9552 0.8730 -0.0579 0.0829  0.0141  51   VAL A N     
374  C CA    . VAL A 51  ? 1.1882 0.9375 0.8483 -0.0695 0.0818  0.0136  51   VAL A CA    
375  C C     . VAL A 51  ? 1.1545 0.8987 0.8026 -0.0767 0.0805  0.0176  51   VAL A C     
376  O O     . VAL A 51  ? 1.2579 0.9872 0.8823 -0.0845 0.0829  0.0170  51   VAL A O     
377  C CB    . VAL A 51  ? 1.1502 0.9167 0.8317 -0.0748 0.0762  0.0134  51   VAL A CB    
378  C CG1   . VAL A 51  ? 1.0817 0.8507 0.7724 -0.0687 0.0778  0.0091  51   VAL A CG1   
379  C CG2   . VAL A 51  ? 1.1721 0.9578 0.8784 -0.0743 0.0704  0.0179  51   VAL A CG2   
380  N N     . ALA A 52  ? 1.0841 0.8398 0.7476 -0.0744 0.0770  0.0217  52   ALA A N     
381  C CA    . ALA A 52  ? 1.0185 0.7714 0.6737 -0.0814 0.0750  0.0258  52   ALA A CA    
382  C C     . ALA A 52  ? 1.0570 0.7886 0.6852 -0.0793 0.0810  0.0264  52   ALA A C     
383  O O     . ALA A 52  ? 1.0549 0.7786 0.6692 -0.0862 0.0806  0.0292  52   ALA A O     
384  C CB    . ALA A 52  ? 0.9973 0.7688 0.6776 -0.0791 0.0696  0.0297  52   ALA A CB    
385  N N     . ALA A 53  ? 1.0617 0.7840 0.6824 -0.0694 0.0868  0.0240  53   ALA A N     
386  C CA    . ALA A 53  ? 1.1964 0.8976 0.7905 -0.0660 0.0937  0.0247  53   ALA A CA    
387  C C     . ALA A 53  ? 1.2993 0.9803 0.8639 -0.0741 0.0979  0.0222  53   ALA A C     
388  O O     . ALA A 53  ? 1.2962 0.9586 0.8352 -0.0770 0.1023  0.0237  53   ALA A O     
389  C CB    . ALA A 53  ? 1.2148 0.9143 0.8114 -0.0526 0.0985  0.0236  53   ALA A CB    
390  N N     . THR A 54  ? 1.2984 0.9829 0.8662 -0.0777 0.0968  0.0183  54   THR A N     
391  C CA    . THR A 54  ? 1.3004 0.9672 0.8416 -0.0861 0.1004  0.0154  54   THR A CA    
392  C C     . THR A 54  ? 1.3382 1.0110 0.8801 -0.1005 0.0946  0.0170  54   THR A C     
393  O O     . THR A 54  ? 1.4571 1.1220 0.9845 -0.1091 0.0955  0.0144  54   THR A O     
394  C CB    . THR A 54  ? 1.2746 0.9404 0.8169 -0.0823 0.1029  0.0101  54   THR A CB    
395  O OG1   . THR A 54  ? 1.1831 0.8700 0.7523 -0.0853 0.0962  0.0093  54   THR A OG1   
396  C CG2   . THR A 54  ? 1.2906 0.9541 0.8361 -0.0679 0.1078  0.0090  54   THR A CG2   
397  N N     . GLY A 55  ? 1.2478 0.9354 0.8070 -0.1032 0.0887  0.0214  55   GLY A N     
398  C CA    . GLY A 55  ? 1.2924 0.9871 0.8529 -0.1166 0.0829  0.0239  55   GLY A CA    
399  C C     . GLY A 55  ? 1.3068 1.0225 0.8915 -0.1205 0.0770  0.0232  55   GLY A C     
400  O O     . GLY A 55  ? 1.3495 1.0742 0.9382 -0.1313 0.0718  0.0258  55   GLY A O     
401  N N     . ASP A 56  ? 1.3223 1.0456 0.9227 -0.1116 0.0778  0.0199  56   ASP A N     
402  C CA    . ASP A 56  ? 1.3830 1.1253 1.0067 -0.1139 0.0729  0.0192  56   ASP A CA    
403  C C     . ASP A 56  ? 1.3273 1.0916 0.9827 -0.1079 0.0679  0.0225  56   ASP A C     
404  O O     . ASP A 56  ? 1.2812 1.0466 0.9395 -0.1045 0.0672  0.0256  56   ASP A O     
405  C CB    . ASP A 56  ? 1.4657 1.2026 1.0873 -0.1086 0.0769  0.0137  56   ASP A CB    
406  C CG    . ASP A 56  ? 1.5347 1.2858 1.1721 -0.1139 0.0729  0.0126  56   ASP A CG    
407  O OD1   . ASP A 56  ? 1.5852 1.3414 1.2206 -0.1253 0.0692  0.0151  56   ASP A OD1   
408  O OD2   . ASP A 56  ? 1.5141 1.2714 1.1658 -0.1067 0.0735  0.0097  56   ASP A OD2   
409  N N     . GLY A 57  ? 1.2400 1.0207 0.9181 -0.1066 0.0646  0.0218  57   GLY A N     
410  C CA    . GLY A 57  ? 1.1543 0.9551 0.8616 -0.1012 0.0603  0.0248  57   GLY A CA    
411  C C     . GLY A 57  ? 1.1214 0.9385 0.8422 -0.1099 0.0541  0.0296  57   GLY A C     
412  O O     . GLY A 57  ? 1.1396 0.9535 0.8478 -0.1207 0.0527  0.0307  57   GLY A O     
413  N N     . PRO A 58  ? 1.0453 0.8801 0.7915 -0.1054 0.0503  0.0328  58   PRO A N     
414  C CA    . PRO A 58  ? 0.9099 0.7621 0.6716 -0.1120 0.0445  0.0381  58   PRO A CA    
415  C C     . PRO A 58  ? 0.8804 0.7295 0.6321 -0.1179 0.0425  0.0421  58   PRO A C     
416  O O     . PRO A 58  ? 0.9547 0.7895 0.6910 -0.1149 0.0456  0.0412  58   PRO A O     
417  C CB    . PRO A 58  ? 0.8151 0.6832 0.6042 -0.1029 0.0427  0.0395  58   PRO A CB    
418  C CG    . PRO A 58  ? 0.8931 0.7509 0.6775 -0.0929 0.0467  0.0364  58   PRO A CG    
419  C CD    . PRO A 58  ? 0.9719 0.8112 0.7333 -0.0934 0.0516  0.0315  58   PRO A CD    
420  N N     . ASP A 59  ? 0.7655 0.6282 0.5260 -0.1262 0.0374  0.0469  59   ASP A N     
421  C CA    . ASP A 59  ? 0.8160 0.6787 0.5708 -0.1319 0.0346  0.0514  59   ASP A CA    
422  C C     . ASP A 59  ? 0.8879 0.7599 0.6610 -0.1231 0.0332  0.0536  59   ASP A C     
423  O O     . ASP A 59  ? 0.9150 0.7815 0.6810 -0.1234 0.0328  0.0556  59   ASP A O     
424  C CB    . ASP A 59  ? 0.9371 0.8140 0.6979 -0.1433 0.0293  0.0563  59   ASP A CB    
425  C CG    . ASP A 59  ? 1.0346 0.9042 0.7782 -0.1531 0.0302  0.0545  59   ASP A CG    
426  O OD1   . ASP A 59  ? 1.0390 0.9156 0.7924 -0.1518 0.0305  0.0527  59   ASP A OD1   
427  O OD2   . ASP A 59  ? 1.0918 0.9480 0.8117 -0.1623 0.0306  0.0550  59   ASP A OD2   
428  N N     . ILE A 60  ? 0.9557 0.8414 0.7520 -0.1155 0.0326  0.0532  60   ILE A N     
429  C CA    . ILE A 60  ? 0.8659 0.7626 0.6816 -0.1078 0.0310  0.0555  60   ILE A CA    
430  C C     . ILE A 60  ? 0.8598 0.7578 0.6874 -0.0968 0.0338  0.0519  60   ILE A C     
431  O O     . ILE A 60  ? 0.9718 0.8752 0.8081 -0.0956 0.0343  0.0502  60   ILE A O     
432  C CB    . ILE A 60  ? 0.7281 0.6454 0.5644 -0.1115 0.0259  0.0609  60   ILE A CB    
433  C CG1   . ILE A 60  ? 0.7179 0.6356 0.5433 -0.1230 0.0224  0.0652  60   ILE A CG1   
434  C CG2   . ILE A 60  ? 0.7111 0.6389 0.5670 -0.1031 0.0248  0.0629  60   ILE A CG2   
435  C CD1   . ILE A 60  ? 0.7534 0.6923 0.5985 -0.1269 0.0174  0.0713  60   ILE A CD1   
436  N N     . ILE A 61  ? 0.7531 0.6461 0.5809 -0.0889 0.0357  0.0509  61   ILE A N     
437  C CA    . ILE A 61  ? 0.7154 0.6109 0.5552 -0.0788 0.0380  0.0481  61   ILE A CA    
438  C C     . ILE A 61  ? 0.7664 0.6749 0.6265 -0.0732 0.0357  0.0509  61   ILE A C     
439  O O     . ILE A 61  ? 0.8030 0.7110 0.6615 -0.0730 0.0345  0.0534  61   ILE A O     
440  C CB    . ILE A 61  ? 0.7377 0.6168 0.5613 -0.0729 0.0429  0.0439  61   ILE A CB    
441  C CG1   . ILE A 61  ? 0.7357 0.6195 0.5735 -0.0630 0.0445  0.0418  61   ILE A CG1   
442  C CG2   . ILE A 61  ? 0.7405 0.6100 0.5505 -0.0731 0.0436  0.0457  61   ILE A CG2   
443  C CD1   . ILE A 61  ? 0.7658 0.6363 0.5903 -0.0563 0.0491  0.0385  61   ILE A CD1   
444  N N     . PHE A 62  ? 0.7610 0.6803 0.6394 -0.0689 0.0354  0.0506  62   PHE A N     
445  C CA    . PHE A 62  ? 0.6333 0.5640 0.5306 -0.0631 0.0341  0.0527  62   PHE A CA    
446  C C     . PHE A 62  ? 0.6617 0.5875 0.5607 -0.0542 0.0372  0.0492  62   PHE A C     
447  O O     . PHE A 62  ? 0.6917 0.6149 0.5914 -0.0516 0.0394  0.0460  62   PHE A O     
448  C CB    . PHE A 62  ? 0.6850 0.6304 0.6011 -0.0640 0.0322  0.0551  62   PHE A CB    
449  C CG    . PHE A 62  ? 0.6478 0.6036 0.5690 -0.0710 0.0284  0.0603  62   PHE A CG    
450  C CD1   . PHE A 62  ? 0.6360 0.5909 0.5482 -0.0795 0.0272  0.0612  62   PHE A CD1   
451  C CD2   . PHE A 62  ? 0.6246 0.5916 0.5598 -0.0692 0.0261  0.0645  62   PHE A CD2   
452  C CE1   . PHE A 62  ? 0.7079 0.6738 0.6252 -0.0863 0.0234  0.0666  62   PHE A CE1   
453  C CE2   . PHE A 62  ? 0.5935 0.5711 0.5339 -0.0755 0.0225  0.0697  62   PHE A CE2   
454  C CZ    . PHE A 62  ? 0.6520 0.6296 0.5838 -0.0841 0.0210  0.0709  62   PHE A CZ    
455  N N     . TRP A 63  ? 0.6189 0.5438 0.5186 -0.0498 0.0373  0.0501  63   TRP A N     
456  C CA    . TRP A 63  ? 0.5404 0.4638 0.4444 -0.0417 0.0397  0.0477  63   TRP A CA    
457  C C     . TRP A 63  ? 0.6244 0.5530 0.5361 -0.0381 0.0384  0.0502  63   TRP A C     
458  O O     . TRP A 63  ? 0.6855 0.6158 0.5957 -0.0416 0.0362  0.0532  63   TRP A O     
459  C CB    . TRP A 63  ? 0.5839 0.4929 0.4699 -0.0392 0.0434  0.0442  63   TRP A CB    
460  C CG    . TRP A 63  ? 0.6858 0.5945 0.5768 -0.0315 0.0458  0.0417  63   TRP A CG    
461  C CD1   . TRP A 63  ? 0.6905 0.5980 0.5810 -0.0256 0.0470  0.0420  63   TRP A CD1   
462  C CD2   . TRP A 63  ? 0.6774 0.5877 0.5749 -0.0292 0.0471  0.0389  63   TRP A CD2   
463  N NE1   . TRP A 63  ? 0.6386 0.5473 0.5347 -0.0201 0.0488  0.0396  63   TRP A NE1   
464  C CE2   . TRP A 63  ? 0.6747 0.5846 0.5749 -0.0222 0.0489  0.0376  63   TRP A CE2   
465  C CE3   . TRP A 63  ? 0.6367 0.5487 0.5377 -0.0324 0.0469  0.0375  63   TRP A CE3   
466  C CZ2   . TRP A 63  ? 0.6639 0.5744 0.5696 -0.0188 0.0504  0.0349  63   TRP A CZ2   
467  C CZ3   . TRP A 63  ? 0.6663 0.5783 0.5729 -0.0286 0.0487  0.0346  63   TRP A CZ3   
468  C CH2   . TRP A 63  ? 0.7168 0.6278 0.6255 -0.0220 0.0504  0.0333  63   TRP A CH2   
469  N N     . ALA A 64  ? 0.5473 0.4783 0.4669 -0.0314 0.0398  0.0489  64   ALA A N     
470  C CA    . ALA A 64  ? 0.5418 0.4771 0.4677 -0.0278 0.0389  0.0509  64   ALA A CA    
471  C C     . ALA A 64  ? 0.5591 0.4846 0.4693 -0.0280 0.0398  0.0514  64   ALA A C     
472  O O     . ALA A 64  ? 0.6686 0.5831 0.5636 -0.0280 0.0424  0.0494  64   ALA A O     
473  C CB    . ALA A 64  ? 0.4398 0.3780 0.3740 -0.0213 0.0404  0.0493  64   ALA A CB    
474  N N     . HIS A 65  ? 0.5354 0.4642 0.4489 -0.0279 0.0381  0.0543  65   HIS A N     
475  C CA    . HIS A 65  ? 0.5550 0.4744 0.4539 -0.0288 0.0388  0.0555  65   HIS A CA    
476  C C     . HIS A 65  ? 0.6206 0.5298 0.5072 -0.0231 0.0428  0.0536  65   HIS A C     
477  O O     . HIS A 65  ? 0.6106 0.5085 0.4807 -0.0241 0.0447  0.0542  65   HIS A O     
478  C CB    . HIS A 65  ? 0.5330 0.4587 0.4399 -0.0285 0.0363  0.0586  65   HIS A CB    
479  C CG    . HIS A 65  ? 0.5160 0.4469 0.4327 -0.0216 0.0371  0.0585  65   HIS A CG    
480  N ND1   . HIS A 65  ? 0.5402 0.4818 0.4733 -0.0193 0.0361  0.0581  65   HIS A ND1   
481  C CD2   . HIS A 65  ? 0.5268 0.4535 0.4384 -0.0168 0.0389  0.0588  65   HIS A CD2   
482  C CE1   . HIS A 65  ? 0.5904 0.5342 0.5279 -0.0140 0.0370  0.0581  65   HIS A CE1   
483  N NE2   . HIS A 65  ? 0.6395 0.5751 0.5647 -0.0123 0.0386  0.0586  65   HIS A NE2   
484  N N     . ASP A 66  ? 0.5109 0.4239 0.4049 -0.0174 0.0443  0.0518  66   ASP A N     
485  C CA    . ASP A 66  ? 0.4949 0.4012 0.3799 -0.0112 0.0479  0.0510  66   ASP A CA    
486  C C     . ASP A 66  ? 0.5898 0.4821 0.4551 -0.0118 0.0514  0.0493  66   ASP A C     
487  O O     . ASP A 66  ? 0.6575 0.5410 0.5101 -0.0081 0.0547  0.0500  66   ASP A O     
488  C CB    . ASP A 66  ? 0.5716 0.4854 0.4683 -0.0059 0.0484  0.0495  66   ASP A CB    
489  C CG    . ASP A 66  ? 0.5350 0.4487 0.4336 -0.0069 0.0491  0.0465  66   ASP A CG    
490  O OD1   . ASP A 66  ? 0.5645 0.4833 0.4713 -0.0114 0.0468  0.0463  66   ASP A OD1   
491  O OD2   . ASP A 66  ? 0.6431 0.5518 0.5351 -0.0031 0.0520  0.0444  66   ASP A OD2   
492  N N     . ARG A 67  ? 0.5224 0.4123 0.3847 -0.0164 0.0512  0.0472  67   ARG A N     
493  C CA    . ARG A 67  ? 0.6206 0.4966 0.4634 -0.0176 0.0548  0.0452  67   ARG A CA    
494  C C     . ARG A 67  ? 0.6152 0.4801 0.4410 -0.0228 0.0553  0.0470  67   ARG A C     
495  O O     . ARG A 67  ? 0.6750 0.5258 0.4813 -0.0224 0.0593  0.0461  67   ARG A O     
496  C CB    . ARG A 67  ? 0.6535 0.5303 0.4983 -0.0214 0.0543  0.0423  67   ARG A CB    
497  C CG    . ARG A 67  ? 0.7189 0.6026 0.5760 -0.0167 0.0546  0.0400  67   ARG A CG    
498  C CD    . ARG A 67  ? 0.7894 0.6634 0.6341 -0.0119 0.0591  0.0374  67   ARG A CD    
499  N NE    . ARG A 67  ? 0.8141 0.6957 0.6712 -0.0062 0.0593  0.0362  67   ARG A NE    
500  C CZ    . ARG A 67  ? 0.7805 0.6571 0.6313 -0.0012 0.0626  0.0341  67   ARG A CZ    
501  N NH1   . ARG A 67  ? 0.7799 0.6433 0.6117 -0.0007 0.0665  0.0327  67   ARG A NH1   
502  N NH2   . ARG A 67  ? 0.6874 0.5719 0.5502 0.0031  0.0622  0.0335  67   ARG A NH2   
503  N N     . PHE A 68  ? 0.6588 0.5295 0.4909 -0.0278 0.0516  0.0496  68   PHE A N     
504  C CA    . PHE A 68  ? 0.7068 0.5676 0.5231 -0.0347 0.0514  0.0512  68   PHE A CA    
505  C C     . PHE A 68  ? 0.7168 0.5639 0.5155 -0.0319 0.0551  0.0528  68   PHE A C     
506  O O     . PHE A 68  ? 0.7709 0.6042 0.5497 -0.0367 0.0571  0.0531  68   PHE A O     
507  C CB    . PHE A 68  ? 0.7834 0.6548 0.6115 -0.0411 0.0462  0.0540  68   PHE A CB    
508  C CG    . PHE A 68  ? 0.8382 0.7182 0.6755 -0.0464 0.0435  0.0531  68   PHE A CG    
509  C CD1   . PHE A 68  ? 0.9077 0.7830 0.7343 -0.0552 0.0423  0.0536  68   PHE A CD1   
510  C CD2   . PHE A 68  ? 0.7507 0.6427 0.6065 -0.0427 0.0424  0.0519  68   PHE A CD2   
511  C CE1   . PHE A 68  ? 0.8839 0.7679 0.7193 -0.0599 0.0400  0.0532  68   PHE A CE1   
512  C CE2   . PHE A 68  ? 0.7493 0.6488 0.6134 -0.0470 0.0404  0.0514  68   PHE A CE2   
513  C CZ    . PHE A 68  ? 0.7696 0.6657 0.6241 -0.0555 0.0392  0.0522  68   PHE A CZ    
514  N N     . GLY A 69  ? 0.6702 0.5208 0.4753 -0.0243 0.0562  0.0540  69   GLY A N     
515  C CA    . GLY A 69  ? 0.5806 0.4186 0.3698 -0.0201 0.0605  0.0557  69   GLY A CA    
516  C C     . GLY A 69  ? 0.7534 0.5757 0.5214 -0.0185 0.0662  0.0538  69   GLY A C     
517  O O     . GLY A 69  ? 0.8173 0.6238 0.5644 -0.0201 0.0697  0.0550  69   GLY A O     
518  N N     . GLY A 70  ? 0.7085 0.5343 0.4812 -0.0153 0.0673  0.0508  70   GLY A N     
519  C CA    . GLY A 70  ? 0.7479 0.5596 0.5016 -0.0129 0.0729  0.0487  70   GLY A CA    
520  C C     . GLY A 70  ? 0.8221 0.6222 0.5595 -0.0216 0.0734  0.0471  70   GLY A C     
521  O O     . GLY A 70  ? 0.9113 0.6943 0.6257 -0.0217 0.0785  0.0467  70   GLY A O     
522  N N     . TYR A 71  ? 0.8649 0.6748 0.6141 -0.0289 0.0682  0.0463  71   TYR A N     
523  C CA    . TYR A 71  ? 0.8574 0.6591 0.5933 -0.0385 0.0677  0.0452  71   TYR A CA    
524  C C     . TYR A 71  ? 0.9444 0.7326 0.6611 -0.0436 0.0689  0.0480  71   TYR A C     
525  O O     . TYR A 71  ? 0.9766 0.7478 0.6697 -0.0475 0.0728  0.0471  71   TYR A O     
526  C CB    . TYR A 71  ? 0.7376 0.5551 0.4926 -0.0449 0.0615  0.0452  71   TYR A CB    
527  C CG    . TYR A 71  ? 0.7320 0.5609 0.5039 -0.0412 0.0605  0.0423  71   TYR A CG    
528  C CD1   . TYR A 71  ? 0.6720 0.4953 0.4390 -0.0343 0.0648  0.0394  71   TYR A CD1   
529  C CD2   . TYR A 71  ? 0.6645 0.5093 0.4569 -0.0445 0.0555  0.0428  71   TYR A CD2   
530  C CE1   . TYR A 71  ? 0.7119 0.5446 0.4936 -0.0314 0.0639  0.0368  71   TYR A CE1   
531  C CE2   . TYR A 71  ? 0.6695 0.5232 0.4762 -0.0413 0.0550  0.0404  71   TYR A CE2   
532  C CZ    . TYR A 71  ? 0.7494 0.5968 0.5506 -0.0350 0.0591  0.0373  71   TYR A CZ    
533  O OH    . TYR A 71  ? 0.7637 0.6190 0.5785 -0.0321 0.0586  0.0349  71   TYR A OH    
534  N N     . ALA A 72  ? 0.8750 0.6701 0.6012 -0.0438 0.0658  0.0514  72   ALA A N     
535  C CA    . ALA A 72  ? 0.8888 0.6716 0.5983 -0.0485 0.0666  0.0544  72   ALA A CA    
536  C C     . ALA A 72  ? 0.9990 0.7613 0.6836 -0.0437 0.0741  0.0546  72   ALA A C     
537  O O     . ALA A 72  ? 1.0700 0.8149 0.7307 -0.0498 0.0770  0.0548  72   ALA A O     
538  C CB    . ALA A 72  ? 0.7856 0.5795 0.5110 -0.0470 0.0628  0.0576  72   ALA A CB    
539  N N     . GLN A 73  ? 0.9840 0.7483 0.6738 -0.0329 0.0773  0.0548  73   GLN A N     
540  C CA    . GLN A 73  ? 1.0346 0.7810 0.7026 -0.0266 0.0849  0.0560  73   GLN A CA    
541  C C     . GLN A 73  ? 1.0825 0.8118 0.7270 -0.0291 0.0900  0.0533  73   GLN A C     
542  O O     . GLN A 73  ? 1.2118 0.9215 0.8316 -0.0276 0.0964  0.0546  73   GLN A O     
543  C CB    . GLN A 73  ? 1.0240 0.7790 0.7043 -0.0146 0.0870  0.0566  73   GLN A CB    
544  C CG    . GLN A 73  ? 1.0725 0.8121 0.7338 -0.0070 0.0945  0.0595  73   GLN A CG    
545  C CD    . GLN A 73  ? 1.1137 0.8500 0.7727 -0.0072 0.0941  0.0637  73   GLN A CD    
546  O OE1   . GLN A 73  ? 1.2223 0.9463 0.8667 -0.0010 0.1001  0.0667  73   GLN A OE1   
547  N NE2   . GLN A 73  ? 0.9934 0.7404 0.6669 -0.0138 0.0874  0.0642  73   GLN A NE2   
548  N N     . SER A 74  ? 1.0684 0.8045 0.7201 -0.0327 0.0876  0.0496  74   SER A N     
549  C CA    . SER A 74  ? 1.0790 0.7999 0.7095 -0.0356 0.0921  0.0466  74   SER A CA    
550  C C     . SER A 74  ? 1.0272 0.7405 0.6447 -0.0488 0.0897  0.0463  74   SER A C     
551  O O     . SER A 74  ? 1.0478 0.7517 0.6512 -0.0536 0.0918  0.0433  74   SER A O     
552  C CB    . SER A 74  ? 1.0638 0.7951 0.7078 -0.0321 0.0913  0.0426  74   SER A CB    
553  O OG    . SER A 74  ? 1.0282 0.7636 0.6792 -0.0204 0.0944  0.0428  74   SER A OG    
554  N N     . GLY A 75  ? 1.0373 0.7549 0.6597 -0.0547 0.0853  0.0495  75   GLY A N     
555  C CA    . GLY A 75  ? 1.0828 0.7957 0.6948 -0.0678 0.0822  0.0500  75   GLY A CA    
556  C C     . GLY A 75  ? 1.1344 0.8575 0.7558 -0.0742 0.0784  0.0469  75   GLY A C     
557  O O     . GLY A 75  ? 1.1775 0.8889 0.7800 -0.0826 0.0798  0.0454  75   GLY A O     
558  N N     . LEU A 76  ? 1.0191 0.7634 0.6688 -0.0702 0.0738  0.0461  76   LEU A N     
559  C CA    . LEU A 76  ? 0.9627 0.7184 0.6242 -0.0753 0.0701  0.0436  76   LEU A CA    
560  C C     . LEU A 76  ? 0.9993 0.7718 0.6785 -0.0830 0.0627  0.0465  76   LEU A C     
561  O O     . LEU A 76  ? 1.1291 0.9113 0.8169 -0.0892 0.0592  0.0456  76   LEU A O     
562  C CB    . LEU A 76  ? 0.9065 0.6735 0.5866 -0.0658 0.0706  0.0408  76   LEU A CB    
563  C CG    . LEU A 76  ? 0.9688 0.7219 0.6341 -0.0571 0.0777  0.0382  76   LEU A CG    
564  C CD1   . LEU A 76  ? 0.9679 0.7338 0.6533 -0.0485 0.0773  0.0358  76   LEU A CD1   
565  C CD2   . LEU A 76  ? 0.9665 0.7013 0.6057 -0.0629 0.0820  0.0355  76   LEU A CD2   
566  N N     . LEU A 77  ? 0.7901 0.5661 0.4747 -0.0824 0.0606  0.0501  77   LEU A N     
567  C CA    . LEU A 77  ? 0.8996 0.6926 0.6027 -0.0881 0.0537  0.0533  77   LEU A CA    
568  C C     . LEU A 77  ? 1.0648 0.8488 0.7527 -0.0967 0.0524  0.0569  77   LEU A C     
569  O O     . LEU A 77  ? 1.1373 0.9076 0.8110 -0.0937 0.0559  0.0581  77   LEU A O     
570  C CB    . LEU A 77  ? 0.8481 0.6568 0.5762 -0.0793 0.0514  0.0545  77   LEU A CB    
571  C CG    . LEU A 77  ? 0.8518 0.6724 0.5988 -0.0714 0.0516  0.0517  77   LEU A CG    
572  C CD1   . LEU A 77  ? 0.8878 0.7211 0.6554 -0.0636 0.0497  0.0533  77   LEU A CD1   
573  C CD2   . LEU A 77  ? 0.7423 0.5751 0.5013 -0.0773 0.0479  0.0510  77   LEU A CD2   
574  N N     . ALA A 78  ? 1.0536 0.8455 0.7444 -0.1074 0.0475  0.0588  78   ALA A N     
575  C CA    . ALA A 78  ? 1.0253 0.8123 0.7054 -0.1166 0.0449  0.0627  78   ALA A CA    
576  C C     . ALA A 78  ? 1.0987 0.8983 0.7982 -0.1119 0.0414  0.0659  78   ALA A C     
577  O O     . ALA A 78  ? 1.1620 0.9797 0.8868 -0.1058 0.0387  0.0657  78   ALA A O     
578  C CB    . ALA A 78  ? 0.9836 0.7787 0.6641 -0.1291 0.0401  0.0644  78   ALA A CB    
579  N N     . GLU A 79  ? 1.0689 0.8580 0.7557 -0.1148 0.0417  0.0687  79   GLU A N     
580  C CA    . GLU A 79  ? 1.0520 0.8533 0.7562 -0.1124 0.0377  0.0720  79   GLU A CA    
581  C C     . GLU A 79  ? 1.0254 0.8443 0.7439 -0.1215 0.0308  0.0749  79   GLU A C     
582  O O     . GLU A 79  ? 1.0202 0.8351 0.7257 -0.1325 0.0293  0.0759  79   GLU A O     
583  C CB    . GLU A 79  ? 1.0901 0.8747 0.7760 -0.1139 0.0397  0.0744  79   GLU A CB    
584  C CG    . GLU A 79  ? 1.0988 0.8953 0.8022 -0.1116 0.0356  0.0776  79   GLU A CG    
585  C CD    . GLU A 79  ? 1.1409 0.9206 0.8253 -0.1148 0.0371  0.0803  79   GLU A CD    
586  O OE1   . GLU A 79  ? 1.1661 0.9244 0.8228 -0.1195 0.0414  0.0800  79   GLU A OE1   
587  O OE2   . GLU A 79  ? 0.9369 0.7240 0.6335 -0.1125 0.0343  0.0828  79   GLU A OE2   
588  N N     . ILE A 80  ? 1.0394 0.8783 0.7846 -0.1168 0.0269  0.0764  80   ILE A N     
589  C CA    . ILE A 80  ? 1.0668 0.9240 0.8274 -0.1240 0.0207  0.0798  80   ILE A CA    
590  C C     . ILE A 80  ? 1.1476 1.0054 0.9072 -0.1286 0.0173  0.0842  80   ILE A C     
591  O O     . ILE A 80  ? 1.1439 0.9961 0.9035 -0.1223 0.0188  0.0843  80   ILE A O     
592  C CB    . ILE A 80  ? 1.0488 0.9272 0.8385 -0.1166 0.0187  0.0794  80   ILE A CB    
593  C CG1   . ILE A 80  ? 1.0359 0.9181 0.8389 -0.1062 0.0194  0.0793  80   ILE A CG1   
594  C CG2   . ILE A 80  ? 1.0449 0.9221 0.8350 -0.1127 0.0219  0.0751  80   ILE A CG2   
595  C CD1   . ILE A 80  ? 1.0574 0.9592 0.8874 -0.0997 0.0175  0.0793  80   ILE A CD1   
596  N N     . THR A 81  ? 1.2209 1.0857 0.9795 -0.1398 0.0126  0.0879  81   THR A N     
597  C CA    . THR A 81  ? 1.2328 1.0970 0.9877 -0.1458 0.0092  0.0922  81   THR A CA    
598  C C     . THR A 81  ? 1.1991 1.0873 0.9780 -0.1482 0.0029  0.0967  81   THR A C     
599  O O     . THR A 81  ? 1.1947 1.0882 0.9698 -0.1593 -0.0013 0.1007  81   THR A O     
600  C CB    . THR A 81  ? 1.2694 1.1168 0.9960 -0.1588 0.0093  0.0937  81   THR A CB    
601  O OG1   . THR A 81  ? 1.1945 1.0485 0.9194 -0.1671 0.0075  0.0939  81   THR A OG1   
602  C CG2   . THR A 81  ? 1.3211 1.1420 1.0217 -0.1558 0.0161  0.0903  81   THR A CG2   
603  N N     . PRO A 82  ? 1.1686 1.0714 0.9716 -0.1380 0.0025  0.0962  82   PRO A N     
604  C CA    . PRO A 82  ? 1.1526 1.0768 0.9776 -0.1389 -0.0027 0.1007  82   PRO A CA    
605  C C     . PRO A 82  ? 1.1548 1.0754 0.9764 -0.1409 -0.0049 0.1038  82   PRO A C     
606  O O     . PRO A 82  ? 1.1376 1.0436 0.9499 -0.1357 -0.0017 0.1016  82   PRO A O     
607  C CB    . PRO A 82  ? 1.0997 1.0354 0.9472 -0.1266 -0.0010 0.0985  82   PRO A CB    
608  C CG    . PRO A 82  ? 1.0708 0.9896 0.9075 -0.1186 0.0042  0.0936  82   PRO A CG    
609  C CD    . PRO A 82  ? 1.0805 0.9808 0.8911 -0.1253 0.0068  0.0918  82   PRO A CD    
610  N N     . ASP A 83  ? 1.1757 1.1095 1.0049 -0.1482 -0.0102 0.1091  83   ASP A N     
611  C CA    . ASP A 83  ? 1.2137 1.1446 1.0398 -0.1509 -0.0126 0.1123  83   ASP A CA    
612  C C     . ASP A 83  ? 1.2159 1.1602 1.0652 -0.1409 -0.0135 0.1130  83   ASP A C     
613  O O     . ASP A 83  ? 1.2066 1.1648 1.0751 -0.1336 -0.0129 0.1121  83   ASP A O     
614  C CB    . ASP A 83  ? 1.2739 1.2115 1.0948 -0.1644 -0.0180 0.1180  83   ASP A CB    
615  C CG    . ASP A 83  ? 1.3196 1.2823 1.1617 -0.1662 -0.0219 0.1218  83   ASP A CG    
616  O OD1   . ASP A 83  ? 1.3367 1.3129 1.2005 -0.1562 -0.0209 0.1209  83   ASP A OD1   
617  O OD2   . ASP A 83  ? 1.3218 1.2907 1.1584 -0.1779 -0.0256 0.1260  83   ASP A OD2   
618  N N     . LYS A 84  ? 1.1759 1.1150 1.0223 -0.1408 -0.0147 0.1147  84   LYS A N     
619  C CA    . LYS A 84  ? 1.1734 1.1227 1.0391 -0.1316 -0.0152 0.1151  84   LYS A CA    
620  C C     . LYS A 84  ? 1.1420 1.1157 1.0320 -0.1298 -0.0182 0.1183  84   LYS A C     
621  O O     . LYS A 84  ? 1.0864 1.0692 0.9940 -0.1201 -0.0168 0.1170  84   LYS A O     
622  C CB    . LYS A 84  ? 1.1895 1.1322 1.0484 -0.1349 -0.0174 0.1178  84   LYS A CB    
623  N N     . ALA A 85  ? 1.1407 1.1246 1.0309 -0.1395 -0.0220 0.1227  85   ALA A N     
624  C CA    . ALA A 85  ? 1.0861 1.0935 0.9983 -0.1385 -0.0247 0.1269  85   ALA A CA    
625  C C     . ALA A 85  ? 1.0079 1.0218 0.9326 -0.1302 -0.0213 0.1236  85   ALA A C     
626  O O     . ALA A 85  ? 0.9335 0.9610 0.8782 -0.1223 -0.0208 0.1245  85   ALA A O     
627  C CB    . ALA A 85  ? 1.0994 1.1157 1.0071 -0.1511 -0.0292 0.1323  85   ALA A CB    
628  N N     . PHE A 86  ? 1.0350 1.0382 0.9471 -0.1321 -0.0187 0.1198  86   PHE A N     
629  C CA    . PHE A 86  ? 0.9985 1.0065 0.9207 -0.1251 -0.0155 0.1166  86   PHE A CA    
630  C C     . PHE A 86  ? 0.9331 0.9341 0.8603 -0.1132 -0.0114 0.1116  86   PHE A C     
631  O O     . PHE A 86  ? 0.9277 0.9391 0.8720 -0.1054 -0.0099 0.1110  86   PHE A O     
632  C CB    . PHE A 86  ? 0.9728 0.9713 0.8794 -0.1309 -0.0140 0.1140  86   PHE A CB    
633  C CG    . PHE A 86  ? 1.0568 1.0607 0.9738 -0.1246 -0.0111 0.1110  86   PHE A CG    
634  C CD1   . PHE A 86  ? 1.0686 1.0910 1.0017 -0.1255 -0.0128 0.1146  86   PHE A CD1   
635  C CD2   . PHE A 86  ? 1.0783 1.0690 0.9891 -0.1174 -0.0064 0.1049  86   PHE A CD2   
636  C CE1   . PHE A 86  ? 1.0285 1.0548 0.9707 -0.1197 -0.0099 0.1119  86   PHE A CE1   
637  C CE2   . PHE A 86  ? 1.0456 1.0408 0.9656 -0.1119 -0.0038 0.1021  86   PHE A CE2   
638  C CZ    . PHE A 86  ? 1.0248 1.0372 0.9601 -0.1131 -0.0055 0.1055  86   PHE A CZ    
639  N N     . GLN A 87  ? 0.8917 0.8752 0.8035 -0.1120 -0.0094 0.1086  87   GLN A N     
640  C CA    . GLN A 87  ? 0.9176 0.8945 0.8329 -0.1014 -0.0057 0.1043  87   GLN A CA    
641  C C     . GLN A 87  ? 0.8565 0.8467 0.7922 -0.0944 -0.0066 0.1060  87   GLN A C     
642  O O     . GLN A 87  ? 0.8542 0.8458 0.7993 -0.0855 -0.0038 0.1030  87   GLN A O     
643  C CB    . GLN A 87  ? 0.9404 0.8976 0.8362 -0.1019 -0.0038 0.1023  87   GLN A CB    
644  C CG    . GLN A 87  ? 0.9729 0.9137 0.8463 -0.1074 -0.0015 0.1000  87   GLN A CG    
645  C CD    . GLN A 87  ? 1.0043 0.9247 0.8584 -0.1063 0.0014  0.0982  87   GLN A CD    
646  O OE1   . GLN A 87  ? 0.9733 0.8915 0.8324 -0.0986 0.0030  0.0971  87   GLN A OE1   
647  N NE2   . GLN A 87  ? 0.9740 0.8790 0.8054 -0.1139 0.0025  0.0981  87   GLN A NE2   
648  N N     . ASP A 88  ? 0.7935 0.7932 0.7353 -0.0987 -0.0105 0.1109  88   ASP A N     
649  C CA    . ASP A 88  ? 0.7879 0.8002 0.7481 -0.0924 -0.0113 0.1130  88   ASP A CA    
650  C C     . ASP A 88  ? 0.7729 0.8006 0.7516 -0.0875 -0.0102 0.1138  88   ASP A C     
651  O O     . ASP A 88  ? 0.7260 0.7612 0.7189 -0.0803 -0.0092 0.1141  88   ASP A O     
652  C CB    . ASP A 88  ? 0.9249 0.9443 0.8869 -0.0986 -0.0157 0.1185  88   ASP A CB    
653  C CG    . ASP A 88  ? 1.1162 1.1211 1.0644 -0.1004 -0.0162 0.1177  88   ASP A CG    
654  O OD1   . ASP A 88  ? 1.2182 1.2087 1.1572 -0.0957 -0.0128 0.1131  88   ASP A OD1   
655  O OD2   . ASP A 88  ? 1.1808 1.1888 1.1273 -0.1063 -0.0198 0.1220  88   ASP A OD2   
656  N N     . LYS A 89  ? 0.7597 0.7912 0.7373 -0.0915 -0.0103 0.1143  89   LYS A N     
657  C CA    . LYS A 89  ? 0.8209 0.8664 0.8151 -0.0874 -0.0091 0.1156  89   LYS A CA    
658  C C     . LYS A 89  ? 0.8129 0.8533 0.8113 -0.0784 -0.0046 0.1103  89   LYS A C     
659  O O     . LYS A 89  ? 0.8804 0.9309 0.8934 -0.0730 -0.0029 0.1111  89   LYS A O     
660  C CB    . LYS A 89  ? 0.8668 0.9186 0.8587 -0.0950 -0.0107 0.1181  89   LYS A CB    
661  C CG    . LYS A 89  ? 0.9061 0.9695 0.8998 -0.1035 -0.0154 0.1249  89   LYS A CG    
662  C CD    . LYS A 89  ? 0.9814 1.0494 0.9705 -0.1116 -0.0169 0.1269  89   LYS A CD    
663  C CE    . LYS A 89  ? 1.0748 1.1557 1.0656 -0.1209 -0.0219 0.1343  89   LYS A CE    
664  N NZ    . LYS A 89  ? 1.1105 1.1954 1.0952 -0.1299 -0.0234 0.1361  89   LYS A NZ    
665  N N     . LEU A 90  ? 0.7459 0.7706 0.7309 -0.0768 -0.0024 0.1052  90   LEU A N     
666  C CA    . LEU A 90  ? 0.6571 0.6767 0.6448 -0.0687 0.0016  0.1003  90   LEU A CA    
667  C C     . LEU A 90  ? 0.6384 0.6518 0.6260 -0.0626 0.0030  0.0981  90   LEU A C     
668  O O     . LEU A 90  ? 0.7709 0.7785 0.7509 -0.0650 0.0014  0.0990  90   LEU A O     
669  C CB    . LEU A 90  ? 0.6516 0.6588 0.6246 -0.0707 0.0037  0.0962  90   LEU A CB    
670  C CG    . LEU A 90  ? 0.7286 0.7386 0.6969 -0.0781 0.0023  0.0977  90   LEU A CG    
671  C CD1   . LEU A 90  ? 0.7890 0.7874 0.7459 -0.0773 0.0055  0.0927  90   LEU A CD1   
672  C CD2   . LEU A 90  ? 0.7512 0.7783 0.7372 -0.0775 0.0014  0.1014  90   LEU A CD2   
673  N N     . TYR A 91  ? 0.5625 0.5769 0.5584 -0.0550 0.0060  0.0953  91   TYR A N     
674  C CA    . TYR A 91  ? 0.6141 0.6235 0.6105 -0.0491 0.0074  0.0931  91   TYR A CA    
675  C C     . TYR A 91  ? 0.6474 0.6417 0.6271 -0.0496 0.0086  0.0901  91   TYR A C     
676  O O     . TYR A 91  ? 0.7144 0.7014 0.6845 -0.0509 0.0102  0.0877  91   TYR A O     
677  C CB    . TYR A 91  ? 0.6049 0.6181 0.6122 -0.0418 0.0105  0.0907  91   TYR A CB    
678  C CG    . TYR A 91  ? 0.6284 0.6550 0.6514 -0.0402 0.0103  0.0939  91   TYR A CG    
679  C CD1   . TYR A 91  ? 0.5749 0.6083 0.6067 -0.0385 0.0093  0.0968  91   TYR A CD1   
680  C CD2   . TYR A 91  ? 0.5641 0.5959 0.5929 -0.0402 0.0116  0.0941  91   TYR A CD2   
681  C CE1   . TYR A 91  ? 0.6118 0.6569 0.6572 -0.0366 0.0098  0.1002  91   TYR A CE1   
682  C CE2   . TYR A 91  ? 0.5377 0.5812 0.5804 -0.0383 0.0121  0.0975  91   TYR A CE2   
683  C CZ    . TYR A 91  ? 0.6178 0.6678 0.6685 -0.0363 0.0114  0.1007  91   TYR A CZ    
684  O OH    . TYR A 91  ? 0.6574 0.7185 0.7213 -0.0338 0.0125  0.1045  91   TYR A OH    
685  N N     . PRO A 92  ? 0.6991 0.6881 0.6746 -0.0483 0.0082  0.0903  92   PRO A N     
686  C CA    . PRO A 92  ? 0.7137 0.6877 0.6727 -0.0484 0.0098  0.0881  92   PRO A CA    
687  C C     . PRO A 92  ? 0.6722 0.6409 0.6289 -0.0422 0.0136  0.0840  92   PRO A C     
688  O O     . PRO A 92  ? 0.7494 0.7063 0.6916 -0.0428 0.0156  0.0823  92   PRO A O     
689  C CB    . PRO A 92  ? 0.6165 0.5881 0.5751 -0.0471 0.0088  0.0895  92   PRO A CB    
690  C CG    . PRO A 92  ? 0.6431 0.6284 0.6193 -0.0446 0.0073  0.0913  92   PRO A CG    
691  C CD    . PRO A 92  ? 0.7101 0.7060 0.6947 -0.0475 0.0061  0.0931  92   PRO A CD    
692  N N     . PHE A 93  ? 0.6198 0.5966 0.5900 -0.0367 0.0148  0.0828  93   PHE A N     
693  C CA    . PHE A 93  ? 0.6381 0.6112 0.6070 -0.0313 0.0180  0.0793  93   PHE A CA    
694  C C     . PHE A 93  ? 0.6073 0.5759 0.5684 -0.0337 0.0193  0.0775  93   PHE A C     
695  O O     . PHE A 93  ? 0.6018 0.5615 0.5528 -0.0314 0.0219  0.0751  93   PHE A O     
696  C CB    . PHE A 93  ? 0.5920 0.5747 0.5763 -0.0263 0.0189  0.0785  93   PHE A CB    
697  C CG    . PHE A 93  ? 0.5990 0.5796 0.5828 -0.0223 0.0218  0.0752  93   PHE A CG    
698  C CD1   . PHE A 93  ? 0.5632 0.5476 0.5516 -0.0230 0.0225  0.0743  93   PHE A CD1   
699  C CD2   . PHE A 93  ? 0.6312 0.6062 0.6098 -0.0179 0.0238  0.0733  93   PHE A CD2   
700  C CE1   . PHE A 93  ? 0.6359 0.6178 0.6234 -0.0195 0.0250  0.0712  93   PHE A CE1   
701  C CE2   . PHE A 93  ? 0.7002 0.6738 0.6783 -0.0144 0.0263  0.0706  93   PHE A CE2   
702  C CZ    . PHE A 93  ? 0.6878 0.6645 0.6702 -0.0153 0.0268  0.0695  93   PHE A CZ    
703  N N     . THR A 94  ? 0.6027 0.5780 0.5688 -0.0381 0.0176  0.0790  94   THR A N     
704  C CA    . THR A 94  ? 0.6461 0.6179 0.6056 -0.0409 0.0186  0.0775  94   THR A CA    
705  C C     . THR A 94  ? 0.6863 0.6456 0.6266 -0.0459 0.0188  0.0773  94   THR A C     
706  O O     . THR A 94  ? 0.6683 0.6197 0.5985 -0.0460 0.0211  0.0747  94   THR A O     
707  C CB    . THR A 94  ? 0.6089 0.5920 0.5795 -0.0442 0.0169  0.0796  94   THR A CB    
708  O OG1   . THR A 94  ? 0.6992 0.6860 0.6684 -0.0507 0.0136  0.0835  94   THR A OG1   
709  C CG2   . THR A 94  ? 0.5478 0.5416 0.5357 -0.0390 0.0174  0.0801  94   THR A CG2   
710  N N     . TRP A 95  ? 0.5353 0.4919 0.4697 -0.0502 0.0166  0.0800  95   TRP A N     
711  C CA    . TRP A 95  ? 0.5717 0.5141 0.4858 -0.0550 0.0173  0.0799  95   TRP A CA    
712  C C     . TRP A 95  ? 0.5777 0.5077 0.4809 -0.0492 0.0212  0.0774  95   TRP A C     
713  O O     . TRP A 95  ? 0.6382 0.5557 0.5248 -0.0506 0.0238  0.0760  95   TRP A O     
714  C CB    . TRP A 95  ? 0.6279 0.5691 0.5373 -0.0611 0.0142  0.0836  95   TRP A CB    
715  C CG    . TRP A 95  ? 0.6202 0.5709 0.5345 -0.0687 0.0105  0.0868  95   TRP A CG    
716  C CD1   . TRP A 95  ? 0.6649 0.6288 0.5932 -0.0702 0.0070  0.0904  95   TRP A CD1   
717  C CD2   . TRP A 95  ? 0.6064 0.5551 0.5118 -0.0759 0.0099  0.0870  95   TRP A CD2   
718  N NE1   . TRP A 95  ? 0.7140 0.6851 0.6432 -0.0778 0.0042  0.0932  95   TRP A NE1   
719  C CE2   . TRP A 95  ? 0.6393 0.6013 0.5547 -0.0816 0.0058  0.0911  95   TRP A CE2   
720  C CE3   . TRP A 95  ? 0.6315 0.5685 0.5214 -0.0779 0.0126  0.0842  95   TRP A CE3   
721  C CZ2   . TRP A 95  ? 0.6714 0.6360 0.5819 -0.0897 0.0041  0.0927  95   TRP A CZ2   
722  C CZ3   . TRP A 95  ? 0.7078 0.6463 0.5921 -0.0861 0.0110  0.0853  95   TRP A CZ3   
723  C CH2   . TRP A 95  ? 0.7092 0.6617 0.6040 -0.0920 0.0067  0.0896  95   TRP A CH2   
724  N N     . ASP A 96  ? 0.6134 0.5472 0.5258 -0.0426 0.0219  0.0771  96   ASP A N     
725  C CA    . ASP A 96  ? 0.7131 0.6376 0.6172 -0.0365 0.0255  0.0754  96   ASP A CA    
726  C C     . ASP A 96  ? 0.6672 0.5885 0.5673 -0.0335 0.0287  0.0723  96   ASP A C     
727  O O     . ASP A 96  ? 0.7037 0.6132 0.5894 -0.0312 0.0321  0.0712  96   ASP A O     
728  C CB    . ASP A 96  ? 0.8264 0.7585 0.7437 -0.0302 0.0254  0.0755  96   ASP A CB    
729  C CG    . ASP A 96  ? 0.9487 0.8826 0.8689 -0.0323 0.0228  0.0783  96   ASP A CG    
730  O OD1   . ASP A 96  ? 0.9300 0.8573 0.8398 -0.0382 0.0214  0.0802  96   ASP A OD1   
731  O OD2   . ASP A 96  ? 0.9852 0.9267 0.9176 -0.0281 0.0222  0.0785  96   ASP A OD2   
732  N N     . ALA A 97  ? 0.7035 0.6348 0.6161 -0.0332 0.0278  0.0710  97   ALA A N     
733  C CA    . ALA A 97  ? 0.6965 0.6261 0.6078 -0.0298 0.0305  0.0680  97   ALA A CA    
734  C C     . ALA A 97  ? 0.7447 0.6630 0.6390 -0.0340 0.0322  0.0668  97   ALA A C     
735  O O     . ALA A 97  ? 0.8123 0.7242 0.6991 -0.0308 0.0355  0.0643  97   ALA A O     
736  C CB    . ALA A 97  ? 0.6770 0.6191 0.6052 -0.0291 0.0292  0.0672  97   ALA A CB    
737  N N     . VAL A 98  ? 0.7655 0.6815 0.6533 -0.0416 0.0300  0.0688  98   VAL A N     
738  C CA    . VAL A 98  ? 0.7168 0.6216 0.5870 -0.0469 0.0315  0.0678  98   VAL A CA    
739  C C     . VAL A 98  ? 0.7697 0.6594 0.6201 -0.0494 0.0330  0.0692  98   VAL A C     
740  O O     . VAL A 98  ? 0.7285 0.6088 0.5634 -0.0563 0.0333  0.0696  98   VAL A O     
741  C CB    . VAL A 98  ? 0.7068 0.6189 0.5814 -0.0549 0.0281  0.0691  98   VAL A CB    
742  C CG1   . VAL A 98  ? 0.6574 0.5815 0.5485 -0.0523 0.0276  0.0676  98   VAL A CG1   
743  C CG2   . VAL A 98  ? 0.7299 0.6493 0.6111 -0.0595 0.0240  0.0731  98   VAL A CG2   
744  N N     . ARG A 99  ? 0.8260 0.7130 0.6764 -0.0439 0.0344  0.0701  99   ARG A N     
745  C CA    . ARG A 99  ? 0.8664 0.7380 0.6978 -0.0451 0.0366  0.0716  99   ARG A CA    
746  C C     . ARG A 99  ? 0.8284 0.6885 0.6474 -0.0382 0.0423  0.0699  99   ARG A C     
747  O O     . ARG A 99  ? 0.8113 0.6776 0.6403 -0.0304 0.0437  0.0690  99   ARG A O     
748  C CB    . ARG A 99  ? 0.8668 0.7419 0.7049 -0.0442 0.0344  0.0744  99   ARG A CB    
749  C CG    . ARG A 99  ? 0.9590 0.8215 0.7800 -0.0508 0.0341  0.0769  99   ARG A CG    
750  C CD    . ARG A 99  ? 0.9331 0.7965 0.7587 -0.0484 0.0329  0.0793  99   ARG A CD    
751  N NE    . ARG A 99  ? 0.9517 0.8332 0.8005 -0.0471 0.0287  0.0798  99   ARG A NE    
752  C CZ    . ARG A 99  ? 0.9457 0.8363 0.8027 -0.0535 0.0241  0.0817  99   ARG A CZ    
753  N NH1   . ARG A 99  ? 1.0233 0.9075 0.8678 -0.0624 0.0227  0.0832  99   ARG A NH1   
754  N NH2   . ARG A 99  ? 0.8657 0.7718 0.7430 -0.0512 0.0212  0.0823  99   ARG A NH2   
755  N N     . TYR A 100 ? 0.8310 0.6744 0.6275 -0.0412 0.0457  0.0698  100  TYR A N     
756  C CA    . TYR A 100 ? 0.7779 0.6088 0.5600 -0.0347 0.0517  0.0688  100  TYR A CA    
757  C C     . TYR A 100 ? 0.8595 0.6711 0.6179 -0.0369 0.0552  0.0710  100  TYR A C     
758  O O     . TYR A 100 ? 0.8596 0.6617 0.6038 -0.0455 0.0546  0.0715  100  TYR A O     
759  C CB    . TYR A 100 ? 0.7636 0.5914 0.5397 -0.0351 0.0539  0.0656  100  TYR A CB    
760  C CG    . TYR A 100 ? 0.7710 0.5869 0.5331 -0.0277 0.0604  0.0648  100  TYR A CG    
761  C CD1   . TYR A 100 ? 0.7550 0.5781 0.5277 -0.0182 0.0620  0.0649  100  TYR A CD1   
762  C CD2   . TYR A 100 ? 0.7457 0.5433 0.4833 -0.0301 0.0650  0.0641  100  TYR A CD2   
763  C CE1   . TYR A 100 ? 0.7132 0.5269 0.4738 -0.0110 0.0679  0.0649  100  TYR A CE1   
764  C CE2   . TYR A 100 ? 0.8794 0.6662 0.6039 -0.0226 0.0714  0.0638  100  TYR A CE2   
765  C CZ    . TYR A 100 ? 0.7914 0.5870 0.5280 -0.0128 0.0727  0.0643  100  TYR A CZ    
766  O OH    . TYR A 100 ? 0.8866 0.6729 0.6110 -0.0050 0.0791  0.0647  100  TYR A OH    
767  N N     . ASN A 101 ? 0.9280 0.7334 0.6815 -0.0294 0.0591  0.0726  101  ASN A N     
768  C CA    . ASN A 101 ? 1.0133 0.7997 0.7446 -0.0303 0.0631  0.0752  101  ASN A CA    
769  C C     . ASN A 101 ? 1.0082 0.7915 0.7353 -0.0400 0.0590  0.0772  101  ASN A C     
770  O O     . ASN A 101 ? 0.9562 0.7224 0.6611 -0.0463 0.0612  0.0782  101  ASN A O     
771  C CB    . ASN A 101 ? 1.1103 0.8779 0.8166 -0.0303 0.0694  0.0743  101  ASN A CB    
772  C CG    . ASN A 101 ? 1.1796 0.9457 0.8845 -0.0193 0.0749  0.0738  101  ASN A CG    
773  O OD1   . ASN A 101 ? 1.2007 0.9781 0.9210 -0.0117 0.0745  0.0749  101  ASN A OD1   
774  N ND2   . ASN A 101 ? 1.1255 0.8777 0.8114 -0.0184 0.0804  0.0725  101  ASN A ND2   
775  N N     . GLY A 102 ? 0.9075 0.7070 0.6556 -0.0413 0.0533  0.0779  102  GLY A N     
776  C CA    . GLY A 102 ? 0.9996 0.7984 0.7462 -0.0499 0.0490  0.0802  102  GLY A CA    
777  C C     . GLY A 102 ? 1.0537 0.8588 0.8027 -0.0600 0.0445  0.0796  102  GLY A C     
778  O O     . GLY A 102 ? 1.2049 1.0208 0.9659 -0.0650 0.0391  0.0812  102  GLY A O     
779  N N     . LYS A 103 ? 1.0426 0.8410 0.7800 -0.0628 0.0467  0.0775  103  LYS A N     
780  C CA    . LYS A 103 ? 1.0454 0.8490 0.7832 -0.0727 0.0428  0.0771  103  LYS A CA    
781  C C     . LYS A 103 ? 1.0103 0.8355 0.7735 -0.0709 0.0389  0.0755  103  LYS A C     
782  O O     . LYS A 103 ? 0.9799 0.8111 0.7534 -0.0626 0.0408  0.0732  103  LYS A O     
783  C CB    . LYS A 103 ? 1.0731 0.8601 0.7872 -0.0768 0.0471  0.0754  103  LYS A CB    
784  C CG    . LYS A 103 ? 1.2389 1.0015 0.9240 -0.0792 0.0521  0.0769  103  LYS A CG    
785  C CD    . LYS A 103 ? 1.3500 1.0964 1.0119 -0.0827 0.0568  0.0748  103  LYS A CD    
786  C CE    . LYS A 103 ? 1.4158 1.1357 1.0468 -0.0839 0.0631  0.0763  103  LYS A CE    
787  N NZ    . LYS A 103 ? 1.4422 1.1543 1.0616 -0.0946 0.0602  0.0795  103  LYS A NZ    
788  N N     . LEU A 104 ? 0.9273 0.7639 0.6998 -0.0788 0.0335  0.0770  104  LEU A N     
789  C CA    . LEU A 104 ? 0.8219 0.6769 0.6153 -0.0783 0.0304  0.0759  104  LEU A CA    
790  C C     . LEU A 104 ? 0.8708 0.7205 0.6542 -0.0814 0.0325  0.0732  104  LEU A C     
791  O O     . LEU A 104 ? 0.9768 0.8169 0.7431 -0.0903 0.0324  0.0739  104  LEU A O     
792  C CB    . LEU A 104 ? 0.7786 0.6476 0.5846 -0.0856 0.0243  0.0792  104  LEU A CB    
793  C CG    . LEU A 104 ? 0.8296 0.7076 0.6498 -0.0827 0.0215  0.0818  104  LEU A CG    
794  C CD1   . LEU A 104 ? 0.7942 0.6852 0.6243 -0.0906 0.0158  0.0854  104  LEU A CD1   
795  C CD2   . LEU A 104 ? 0.8268 0.7161 0.6667 -0.0723 0.0223  0.0800  104  LEU A CD2   
796  N N     . ILE A 105 ? 0.8647 0.7201 0.6580 -0.0745 0.0344  0.0701  105  ILE A N     
797  C CA    . ILE A 105 ? 0.8244 0.6731 0.6071 -0.0763 0.0370  0.0671  105  ILE A CA    
798  C C     . ILE A 105 ? 0.7869 0.6510 0.5870 -0.0774 0.0344  0.0659  105  ILE A C     
799  O O     . ILE A 105 ? 0.8201 0.6802 0.6146 -0.0772 0.0368  0.0629  105  ILE A O     
800  C CB    . ILE A 105 ? 0.8506 0.6860 0.6212 -0.0681 0.0432  0.0643  105  ILE A CB    
801  C CG1   . ILE A 105 ? 0.8818 0.7262 0.6692 -0.0575 0.0438  0.0640  105  ILE A CG1   
802  C CG2   . ILE A 105 ? 0.9370 0.7519 0.6818 -0.0702 0.0471  0.0654  105  ILE A CG2   
803  C CD1   . ILE A 105 ? 0.7644 0.6245 0.5730 -0.0536 0.0421  0.0620  105  ILE A CD1   
804  N N     . ALA A 106 ? 0.7402 0.6215 0.5607 -0.0784 0.0297  0.0684  106  ALA A N     
805  C CA    . ALA A 106 ? 0.6998 0.5962 0.5373 -0.0796 0.0273  0.0682  106  ALA A CA    
806  C C     . ALA A 106 ? 0.5881 0.5018 0.4460 -0.0804 0.0227  0.0720  106  ALA A C     
807  O O     . ALA A 106 ? 0.7114 0.6263 0.5732 -0.0779 0.0217  0.0738  106  ALA A O     
808  C CB    . ALA A 106 ? 0.6532 0.5515 0.4989 -0.0711 0.0303  0.0644  106  ALA A CB    
809  N N     . TYR A 107 ? 0.6370 0.5641 0.5077 -0.0837 0.0201  0.0733  107  TYR A N     
810  C CA    . TYR A 107 ? 0.6381 0.5825 0.5294 -0.0834 0.0164  0.0772  107  TYR A CA    
811  C C     . TYR A 107 ? 0.6219 0.5751 0.5315 -0.0740 0.0179  0.0755  107  TYR A C     
812  O O     . TYR A 107 ? 0.6923 0.6463 0.6051 -0.0716 0.0198  0.0728  107  TYR A O     
813  C CB    . TYR A 107 ? 0.7080 0.6633 0.6041 -0.0916 0.0132  0.0804  107  TYR A CB    
814  C CG    . TYR A 107 ? 0.7848 0.7341 0.6647 -0.1022 0.0108  0.0831  107  TYR A CG    
815  C CD1   . TYR A 107 ? 0.8006 0.7574 0.6850 -0.1065 0.0069  0.0879  107  TYR A CD1   
816  C CD2   . TYR A 107 ? 0.8067 0.7426 0.6661 -0.1083 0.0125  0.0808  107  TYR A CD2   
817  C CE1   . TYR A 107 ? 0.8424 0.7934 0.7112 -0.1170 0.0045  0.0905  107  TYR A CE1   
818  C CE2   . TYR A 107 ? 0.8210 0.7504 0.6639 -0.1188 0.0105  0.0834  107  TYR A CE2   
819  C CZ    . TYR A 107 ? 0.8331 0.7703 0.6809 -0.1233 0.0064  0.0883  107  TYR A CZ    
820  O OH    . TYR A 107 ? 0.8907 0.8212 0.7216 -0.1344 0.0042  0.0910  107  TYR A OH    
821  N N     . PRO A 108 ? 0.6287 0.5878 0.5494 -0.0691 0.0170  0.0770  108  PRO A N     
822  C CA    . PRO A 108 ? 0.6584 0.6258 0.5959 -0.0611 0.0183  0.0758  108  PRO A CA    
823  C C     . PRO A 108 ? 0.6977 0.6802 0.6517 -0.0625 0.0166  0.0786  108  PRO A C     
824  O O     . PRO A 108 ? 0.6938 0.6840 0.6510 -0.0682 0.0134  0.0828  108  PRO A O     
825  C CB    . PRO A 108 ? 0.6290 0.5976 0.5713 -0.0570 0.0177  0.0771  108  PRO A CB    
826  C CG    . PRO A 108 ? 0.5864 0.5536 0.5212 -0.0639 0.0147  0.0805  108  PRO A CG    
827  C CD    . PRO A 108 ? 0.5612 0.5173 0.4775 -0.0704 0.0154  0.0794  108  PRO A CD    
828  N N     . ILE A 109 ? 0.7355 0.7219 0.6996 -0.0573 0.0187  0.0766  109  ILE A N     
829  C CA    . ILE A 109 ? 0.5747 0.5740 0.5536 -0.0578 0.0180  0.0793  109  ILE A CA    
830  C C     . ILE A 109 ? 0.5936 0.6008 0.5886 -0.0508 0.0191  0.0800  109  ILE A C     
831  O O     . ILE A 109 ? 0.6311 0.6499 0.6386 -0.0510 0.0178  0.0843  109  ILE A O     
832  C CB    . ILE A 109 ? 0.5638 0.5603 0.5398 -0.0588 0.0199  0.0766  109  ILE A CB    
833  C CG1   . ILE A 109 ? 0.5866 0.5731 0.5441 -0.0657 0.0194  0.0752  109  ILE A CG1   
834  C CG2   . ILE A 109 ? 0.4851 0.4950 0.4760 -0.0595 0.0194  0.0801  109  ILE A CG2   
835  C CD1   . ILE A 109 ? 0.6230 0.6157 0.5782 -0.0744 0.0158  0.0798  109  ILE A CD1   
836  N N     . ALA A 110 ? 0.6166 0.6174 0.6109 -0.0447 0.0219  0.0761  110  ALA A N     
837  C CA    . ALA A 110 ? 0.4982 0.5047 0.5059 -0.0386 0.0234  0.0763  110  ALA A CA    
838  C C     . ALA A 110 ? 0.4868 0.4854 0.4904 -0.0331 0.0256  0.0724  110  ALA A C     
839  O O     . ALA A 110 ? 0.5458 0.5349 0.5379 -0.0330 0.0269  0.0689  110  ALA A O     
840  C CB    . ALA A 110 ? 0.5342 0.5464 0.5513 -0.0375 0.0251  0.0768  110  ALA A CB    
841  N N     . VAL A 111 ? 0.5498 0.5528 0.5627 -0.0287 0.0262  0.0731  111  VAL A N     
842  C CA    . VAL A 111 ? 0.5007 0.4984 0.5117 -0.0238 0.0280  0.0701  111  VAL A CA    
843  C C     . VAL A 111 ? 0.5577 0.5559 0.5750 -0.0203 0.0308  0.0681  111  VAL A C     
844  O O     . VAL A 111 ? 0.5356 0.5404 0.5635 -0.0195 0.0315  0.0701  111  VAL A O     
845  C CB    . VAL A 111 ? 0.4943 0.4957 0.5107 -0.0215 0.0272  0.0719  111  VAL A CB    
846  C CG1   . VAL A 111 ? 0.4720 0.4694 0.4871 -0.0167 0.0290  0.0691  111  VAL A CG1   
847  C CG2   . VAL A 111 ? 0.5530 0.5527 0.5625 -0.0249 0.0246  0.0738  111  VAL A CG2   
848  N N     . GLU A 112 ? 0.5645 0.5555 0.5746 -0.0182 0.0325  0.0643  112  GLU A N     
849  C CA    . GLU A 112 ? 0.5313 0.5211 0.5452 -0.0155 0.0350  0.0620  112  GLU A CA    
850  C C     . GLU A 112 ? 0.5038 0.4917 0.5179 -0.0113 0.0363  0.0602  112  GLU A C     
851  O O     . GLU A 112 ? 0.5703 0.5549 0.5776 -0.0102 0.0358  0.0595  112  GLU A O     
852  C CB    . GLU A 112 ? 0.4791 0.4621 0.4841 -0.0168 0.0361  0.0591  112  GLU A CB    
853  C CG    . GLU A 112 ? 0.5362 0.5209 0.5405 -0.0214 0.0351  0.0605  112  GLU A CG    
854  C CD    . GLU A 112 ? 0.5177 0.4941 0.5108 -0.0228 0.0362  0.0571  112  GLU A CD    
855  O OE1   . GLU A 112 ? 0.4943 0.4637 0.4799 -0.0199 0.0377  0.0540  112  GLU A OE1   
856  O OE2   . GLU A 112 ? 0.4941 0.4713 0.4857 -0.0268 0.0357  0.0577  112  GLU A OE2   
857  N N     . ALA A 113 ? 0.4564 0.4459 0.4777 -0.0091 0.0382  0.0597  113  ALA A N     
858  C CA    . ALA A 113 ? 0.4037 0.3911 0.4243 -0.0060 0.0395  0.0578  113  ALA A CA    
859  C C     . ALA A 113 ? 0.4738 0.4607 0.4997 -0.0050 0.0420  0.0568  113  ALA A C     
860  O O     . ALA A 113 ? 0.4651 0.4549 0.4980 -0.0057 0.0428  0.0587  113  ALA A O     
861  C CB    . ALA A 113 ? 0.4003 0.3917 0.4248 -0.0047 0.0387  0.0595  113  ALA A CB    
862  N N     . LEU A 114 ? 0.4595 0.4424 0.4815 -0.0033 0.0432  0.0541  114  LEU A N     
863  C CA    . LEU A 114 ? 0.4392 0.4202 0.4647 -0.0027 0.0456  0.0530  114  LEU A CA    
864  C C     . LEU A 114 ? 0.3933 0.3774 0.4256 -0.0019 0.0466  0.0549  114  LEU A C     
865  O O     . LEU A 114 ? 0.3885 0.3753 0.4209 -0.0013 0.0455  0.0558  114  LEU A O     
866  C CB    . LEU A 114 ? 0.3244 0.3008 0.3434 -0.0014 0.0464  0.0499  114  LEU A CB    
867  C CG    . LEU A 114 ? 0.3983 0.3697 0.4095 -0.0016 0.0464  0.0476  114  LEU A CG    
868  C CD1   . LEU A 114 ? 0.4015 0.3696 0.4065 0.0003  0.0472  0.0452  114  LEU A CD1   
869  C CD2   . LEU A 114 ? 0.3449 0.3141 0.3588 -0.0031 0.0477  0.0471  114  LEU A CD2   
870  N N     . SER A 115 ? 0.4146 0.3976 0.4519 -0.0020 0.0490  0.0556  115  SER A N     
871  C CA    . SER A 115 ? 0.4505 0.4341 0.4923 -0.0013 0.0510  0.0571  115  SER A CA    
872  C C     . SER A 115 ? 0.5178 0.4952 0.5581 -0.0013 0.0539  0.0554  115  SER A C     
873  O O     . SER A 115 ? 0.4090 0.3824 0.4464 -0.0017 0.0544  0.0533  115  SER A O     
874  C CB    . SER A 115 ? 0.4684 0.4559 0.5175 -0.0011 0.0519  0.0608  115  SER A CB    
875  O OG    . SER A 115 ? 0.4738 0.4670 0.5242 -0.0016 0.0491  0.0626  115  SER A OG    
876  N N     . LEU A 116 ? 0.4951 0.4709 0.5366 -0.0012 0.0560  0.0561  116  LEU A N     
877  C CA    . LEU A 116 ? 0.3931 0.3621 0.4327 -0.0018 0.0592  0.0550  116  LEU A CA    
878  C C     . LEU A 116 ? 0.4353 0.4021 0.4798 -0.0011 0.0625  0.0574  116  LEU A C     
879  O O     . LEU A 116 ? 0.4664 0.4365 0.5157 -0.0002 0.0636  0.0606  116  LEU A O     
880  C CB    . LEU A 116 ? 0.3900 0.3573 0.4273 -0.0026 0.0604  0.0550  116  LEU A CB    
881  C CG    . LEU A 116 ? 0.4103 0.3692 0.4439 -0.0041 0.0637  0.0540  116  LEU A CG    
882  C CD1   . LEU A 116 ? 0.4307 0.3866 0.4593 -0.0049 0.0626  0.0508  116  LEU A CD1   
883  C CD2   . LEU A 116 ? 0.3926 0.3501 0.4233 -0.0057 0.0649  0.0544  116  LEU A CD2   
884  N N     . ILE A 117 ? 0.4440 0.4056 0.4872 -0.0014 0.0642  0.0561  117  ILE A N     
885  C CA    . ILE A 117 ? 0.3816 0.3410 0.4294 -0.0005 0.0677  0.0587  117  ILE A CA    
886  C C     . ILE A 117 ? 0.5448 0.4946 0.5892 -0.0009 0.0719  0.0581  117  ILE A C     
887  O O     . ILE A 117 ? 0.5628 0.5069 0.6016 -0.0022 0.0717  0.0548  117  ILE A O     
888  C CB    . ILE A 117 ? 0.4073 0.3680 0.4565 -0.0006 0.0666  0.0581  117  ILE A CB    
889  C CG1   . ILE A 117 ? 0.3525 0.3215 0.4030 -0.0011 0.0623  0.0586  117  ILE A CG1   
890  C CG2   . ILE A 117 ? 0.4351 0.3946 0.4897 0.0005  0.0704  0.0614  117  ILE A CG2   
891  C CD1   . ILE A 117 ? 0.3854 0.3558 0.4361 -0.0021 0.0612  0.0582  117  ILE A CD1   
892  N N     . TYR A 118 ? 0.5151 0.4623 0.5619 0.0002  0.0760  0.0613  118  TYR A N     
893  C CA    . TYR A 118 ? 0.4915 0.4278 0.5332 -0.0006 0.0804  0.0609  118  TYR A CA    
894  C C     . TYR A 118 ? 0.5179 0.4490 0.5625 0.0014  0.0859  0.0645  118  TYR A C     
895  O O     . TYR A 118 ? 0.5633 0.5005 0.6147 0.0038  0.0869  0.0684  118  TYR A O     
896  C CB    . TYR A 118 ? 0.5666 0.5010 0.6038 -0.0020 0.0810  0.0609  118  TYR A CB    
897  C CG    . TYR A 118 ? 0.5688 0.5061 0.6097 -0.0001 0.0832  0.0648  118  TYR A CG    
898  C CD1   . TYR A 118 ? 0.6132 0.5611 0.6593 0.0011  0.0796  0.0660  118  TYR A CD1   
899  C CD2   . TYR A 118 ? 0.5714 0.5002 0.6098 0.0006  0.0891  0.0674  118  TYR A CD2   
900  C CE1   . TYR A 118 ? 0.6065 0.5571 0.6560 0.0030  0.0816  0.0697  118  TYR A CE1   
901  C CE2   . TYR A 118 ? 0.6630 0.5942 0.7043 0.0028  0.0916  0.0712  118  TYR A CE2   
902  C CZ    . TYR A 118 ? 0.6595 0.6019 0.7066 0.0040  0.0877  0.0722  118  TYR A CZ    
903  O OH    . TYR A 118 ? 0.7000 0.6448 0.7499 0.0063  0.0902  0.0760  118  TYR A OH    
904  N N     . ASN A 119 ? 0.5526 0.4724 0.5918 0.0004  0.0896  0.0632  119  ASN A N     
905  C CA    . ASN A 119 ? 0.5930 0.5052 0.6332 0.0024  0.0957  0.0665  119  ASN A CA    
906  C C     . ASN A 119 ? 0.6267 0.5321 0.6629 0.0028  0.1007  0.0693  119  ASN A C     
907  O O     . ASN A 119 ? 0.5837 0.4805 0.6114 -0.0001 0.1019  0.0672  119  ASN A O     
908  C CB    . ASN A 119 ? 0.4915 0.3930 0.5263 0.0008  0.0975  0.0635  119  ASN A CB    
909  C CG    . ASN A 119 ? 0.6452 0.5379 0.6807 0.0030  0.1040  0.0669  119  ASN A CG    
910  O OD1   . ASN A 119 ? 0.5817 0.4716 0.6178 0.0051  0.1089  0.0712  119  ASN A OD1   
911  N ND2   . ASN A 119 ? 0.5538 0.4416 0.5887 0.0028  0.1047  0.0650  119  ASN A ND2   
912  N N     . LYS A 120 ? 0.6557 0.5652 0.6976 0.0062  0.1036  0.0742  120  LYS A N     
913  C CA    . LYS A 120 ? 0.6588 0.5626 0.6967 0.0070  0.1083  0.0771  120  LYS A CA    
914  C C     . LYS A 120 ? 0.6886 0.5758 0.7178 0.0066  0.1156  0.0780  120  LYS A C     
915  O O     . LYS A 120 ? 0.6917 0.5703 0.7129 0.0052  0.1190  0.0784  120  LYS A O     
916  C CB    . LYS A 120 ? 0.6876 0.6005 0.7340 0.0113  0.1099  0.0825  120  LYS A CB    
917  C CG    . LYS A 120 ? 0.7299 0.6573 0.7825 0.0111  0.1033  0.0819  120  LYS A CG    
918  C CD    . LYS A 120 ? 0.7895 0.7266 0.8511 0.0152  0.1045  0.0876  120  LYS A CD    
919  C CE    . LYS A 120 ? 0.8516 0.8006 0.9174 0.0146  0.0988  0.0872  120  LYS A CE    
920  N NZ    . LYS A 120 ? 0.8754 0.8355 0.9506 0.0180  0.0989  0.0928  120  LYS A NZ    
921  N N     . ASP A 121 ? 0.6323 0.5141 0.6624 0.0075  0.1180  0.0783  121  ASP A N     
922  C CA    . ASP A 121 ? 0.6531 0.5177 0.6744 0.0071  0.1251  0.0792  121  ASP A CA    
923  C C     . ASP A 121 ? 0.7354 0.5899 0.7457 0.0015  0.1236  0.0741  121  ASP A C     
924  O O     . ASP A 121 ? 0.8097 0.6498 0.8095 -0.0005 0.1289  0.0746  121  ASP A O     
925  C CB    . ASP A 121 ? 0.6992 0.5612 0.7251 0.0100  0.1282  0.0813  121  ASP A CB    
926  C CG    . ASP A 121 ? 0.7973 0.6681 0.8331 0.0155  0.1311  0.0876  121  ASP A CG    
927  O OD1   . ASP A 121 ? 0.7933 0.6673 0.8300 0.0175  0.1329  0.0910  121  ASP A OD1   
928  O OD2   . ASP A 121 ? 0.8199 0.6945 0.8626 0.0177  0.1316  0.0894  121  ASP A OD2   
929  N N     . LEU A 122 ? 0.6758 0.5376 0.6878 -0.0011 0.1167  0.0695  122  LEU A N     
930  C CA    . LEU A 122 ? 0.5951 0.4499 0.5977 -0.0063 0.1146  0.0650  122  LEU A CA    
931  C C     . LEU A 122 ? 0.6115 0.4708 0.6104 -0.0091 0.1116  0.0639  122  LEU A C     
932  O O     . LEU A 122 ? 0.6085 0.4599 0.5977 -0.0138 0.1120  0.0619  122  LEU A O     
933  C CB    . LEU A 122 ? 0.5782 0.4389 0.5838 -0.0073 0.1089  0.0608  122  LEU A CB    
934  C CG    . LEU A 122 ? 0.5862 0.4403 0.5929 -0.0059 0.1113  0.0604  122  LEU A CG    
935  C CD1   . LEU A 122 ? 0.4578 0.3194 0.4673 -0.0067 0.1052  0.0561  122  LEU A CD1   
936  C CD2   . LEU A 122 ? 0.6057 0.4419 0.6017 -0.0086 0.1167  0.0600  122  LEU A CD2   
937  N N     . LEU A 123 ? 0.5846 0.4570 0.5913 -0.0067 0.1085  0.0653  123  LEU A N     
938  C CA    . LEU A 123 ? 0.5829 0.4619 0.5878 -0.0091 0.1046  0.0639  123  LEU A CA    
939  C C     . LEU A 123 ? 0.6301 0.5163 0.6405 -0.0058 0.1054  0.0674  123  LEU A C     
940  O O     . LEU A 123 ? 0.6073 0.5065 0.6260 -0.0038 0.1009  0.0675  123  LEU A O     
941  C CB    . LEU A 123 ? 0.6591 0.5491 0.6677 -0.0101 0.0972  0.0602  123  LEU A CB    
942  C CG    . LEU A 123 ? 0.7256 0.6225 0.7318 -0.0129 0.0926  0.0584  123  LEU A CG    
943  C CD1   . LEU A 123 ? 0.6891 0.5762 0.6843 -0.0180 0.0945  0.0571  123  LEU A CD1   
944  C CD2   . LEU A 123 ? 0.5686 0.4756 0.5788 -0.0127 0.0863  0.0555  123  LEU A CD2   
945  N N     . PRO A 124 ? 0.7041 0.5810 0.7088 -0.0055 0.1116  0.0703  124  PRO A N     
946  C CA    . PRO A 124 ? 0.6780 0.5598 0.6869 -0.0019 0.1136  0.0741  124  PRO A CA    
947  C C     . PRO A 124 ? 0.6741 0.5680 0.6863 -0.0030 0.1076  0.0724  124  PRO A C     
948  O O     . PRO A 124 ? 0.6863 0.5908 0.7070 0.0004  0.1057  0.0745  124  PRO A O     
949  C CB    . PRO A 124 ? 0.6947 0.5613 0.6923 -0.0032 0.1211  0.0760  124  PRO A CB    
950  C CG    . PRO A 124 ? 0.7588 0.6119 0.7492 -0.0055 0.1245  0.0748  124  PRO A CG    
951  C CD    . PRO A 124 ? 0.7493 0.6092 0.7420 -0.0086 0.1173  0.0702  124  PRO A CD    
952  N N     . ASN A 125 ? 0.6650 0.5573 0.6702 -0.0078 0.1048  0.0689  125  ASN A N     
953  C CA    . ASN A 125 ? 0.7062 0.6096 0.7140 -0.0089 0.0990  0.0673  125  ASN A CA    
954  C C     . ASN A 125 ? 0.7365 0.6463 0.7452 -0.0113 0.0928  0.0635  125  ASN A C     
955  O O     . ASN A 125 ? 0.7708 0.6750 0.7719 -0.0156 0.0924  0.0612  125  ASN A O     
956  C CB    . ASN A 125 ? 0.7746 0.6726 0.7737 -0.0120 0.1012  0.0673  125  ASN A CB    
957  C CG    . ASN A 125 ? 0.8491 0.7398 0.8460 -0.0092 0.1081  0.0712  125  ASN A CG    
958  O OD1   . ASN A 125 ? 0.8891 0.7873 0.8936 -0.0049 0.1080  0.0737  125  ASN A OD1   
959  N ND2   . ASN A 125 ? 0.7890 0.6646 0.7749 -0.0116 0.1143  0.0718  125  ASN A ND2   
960  N N     . PRO A 126 ? 0.7465 0.6678 0.7638 -0.0088 0.0880  0.0631  126  PRO A N     
961  C CA    . PRO A 126 ? 0.7477 0.6752 0.7658 -0.0101 0.0825  0.0599  126  PRO A CA    
962  C C     . PRO A 126 ? 0.7071 0.6385 0.7209 -0.0133 0.0793  0.0582  126  PRO A C     
963  O O     . PRO A 126 ? 0.6847 0.6184 0.6983 -0.0133 0.0796  0.0595  126  PRO A O     
964  C CB    . PRO A 126 ? 0.7240 0.6619 0.7512 -0.0066 0.0791  0.0607  126  PRO A CB    
965  C CG    . PRO A 126 ? 0.8144 0.7548 0.8453 -0.0043 0.0811  0.0641  126  PRO A CG    
966  C CD    . PRO A 126 ? 0.8371 0.7662 0.8631 -0.0046 0.0877  0.0660  126  PRO A CD    
967  N N     . PRO A 127 ? 0.6792 0.6115 0.6895 -0.0158 0.0763  0.0556  127  PRO A N     
968  C CA    . PRO A 127 ? 0.5942 0.5308 0.6002 -0.0190 0.0734  0.0545  127  PRO A CA    
969  C C     . PRO A 127 ? 0.5670 0.5151 0.5785 -0.0166 0.0693  0.0548  127  PRO A C     
970  O O     . PRO A 127 ? 0.5933 0.5466 0.6109 -0.0132 0.0673  0.0549  127  PRO A O     
971  C CB    . PRO A 127 ? 0.5757 0.5120 0.5786 -0.0208 0.0712  0.0522  127  PRO A CB    
972  C CG    . PRO A 127 ? 0.7051 0.6417 0.7132 -0.0172 0.0710  0.0516  127  PRO A CG    
973  C CD    . PRO A 127 ? 0.7068 0.6377 0.7177 -0.0152 0.0753  0.0538  127  PRO A CD    
974  N N     . LYS A 128 ? 0.5467 0.4982 0.5557 -0.0188 0.0682  0.0551  128  LYS A N     
975  C CA    . LYS A 128 ? 0.5274 0.4888 0.5408 -0.0167 0.0647  0.0556  128  LYS A CA    
976  C C     . LYS A 128 ? 0.5046 0.4736 0.5177 -0.0170 0.0603  0.0543  128  LYS A C     
977  O O     . LYS A 128 ? 0.5210 0.4974 0.5381 -0.0142 0.0573  0.0546  128  LYS A O     
978  C CB    . LYS A 128 ? 0.7184 0.6797 0.7291 -0.0187 0.0659  0.0566  128  LYS A CB    
979  C CG    . LYS A 128 ? 0.9102 0.8691 0.9242 -0.0161 0.0688  0.0585  128  LYS A CG    
980  C CD    . LYS A 128 ? 1.0659 1.0153 1.0791 -0.0153 0.0736  0.0595  128  LYS A CD    
981  C CE    . LYS A 128 ? 1.1314 1.0806 1.1495 -0.0115 0.0763  0.0621  128  LYS A CE    
982  N NZ    . LYS A 128 ? 1.1340 1.0752 1.1524 -0.0099 0.0810  0.0637  128  LYS A NZ    
983  N N     . THR A 129 ? 0.5521 0.5189 0.5599 -0.0202 0.0602  0.0532  129  THR A N     
984  C CA    . THR A 129 ? 0.5601 0.5345 0.5672 -0.0201 0.0565  0.0526  129  THR A CA    
985  C C     . THR A 129 ? 0.5753 0.5464 0.5805 -0.0199 0.0564  0.0511  129  THR A C     
986  O O     . THR A 129 ? 0.5301 0.4923 0.5326 -0.0217 0.0592  0.0504  129  THR A O     
987  C CB    . THR A 129 ? 0.5636 0.5414 0.5657 -0.0245 0.0555  0.0532  129  THR A CB    
988  O OG1   . THR A 129 ? 0.6581 0.6282 0.6538 -0.0292 0.0577  0.0526  129  THR A OG1   
989  C CG2   . THR A 129 ? 0.6027 0.5818 0.6052 -0.0254 0.0562  0.0544  129  THR A CG2   
990  N N     . TRP A 130 ? 0.5692 0.5468 0.5755 -0.0174 0.0535  0.0506  130  TRP A N     
991  C CA    . TRP A 130 ? 0.5578 0.5332 0.5615 -0.0172 0.0532  0.0491  130  TRP A CA    
992  C C     . TRP A 130 ? 0.4605 0.4336 0.4583 -0.0221 0.0537  0.0490  130  TRP A C     
993  O O     . TRP A 130 ? 0.4527 0.4192 0.4474 -0.0234 0.0550  0.0477  130  TRP A O     
994  C CB    . TRP A 130 ? 0.4981 0.4812 0.5025 -0.0136 0.0503  0.0492  130  TRP A CB    
995  C CG    . TRP A 130 ? 0.4461 0.4283 0.4538 -0.0094 0.0501  0.0486  130  TRP A CG    
996  C CD1   . TRP A 130 ? 0.3884 0.3744 0.3996 -0.0070 0.0491  0.0496  130  TRP A CD1   
997  C CD2   . TRP A 130 ? 0.4683 0.4453 0.4751 -0.0078 0.0509  0.0467  130  TRP A CD2   
998  N NE1   . TRP A 130 ? 0.4848 0.4684 0.4971 -0.0044 0.0491  0.0488  130  TRP A NE1   
999  C CE2   . TRP A 130 ? 0.4882 0.4664 0.4979 -0.0048 0.0503  0.0469  130  TRP A CE2   
1000 C CE3   . TRP A 130 ? 0.3984 0.3695 0.4020 -0.0089 0.0521  0.0449  130  TRP A CE3   
1001 C CZ2   . TRP A 130 ? 0.4390 0.4130 0.4481 -0.0031 0.0507  0.0454  130  TRP A CZ2   
1002 C CZ3   . TRP A 130 ? 0.4575 0.4242 0.4610 -0.0067 0.0527  0.0433  130  TRP A CZ3   
1003 C CH2   . TRP A 130 ? 0.4750 0.4435 0.4812 -0.0040 0.0520  0.0435  130  TRP A CH2   
1004 N N     . GLU A 131 ? 0.4151 0.3935 0.4111 -0.0251 0.0526  0.0505  131  GLU A N     
1005 C CA    . GLU A 131 ? 0.5038 0.4820 0.4937 -0.0306 0.0524  0.0509  131  GLU A CA    
1006 C C     . GLU A 131 ? 0.5553 0.5208 0.5397 -0.0351 0.0559  0.0500  131  GLU A C     
1007 O O     . GLU A 131 ? 0.6258 0.5886 0.6048 -0.0390 0.0559  0.0497  131  GLU A O     
1008 C CB    . GLU A 131 ? 0.4675 0.4539 0.4565 -0.0334 0.0508  0.0529  131  GLU A CB    
1009 C CG    . GLU A 131 ? 0.5489 0.5483 0.5412 -0.0299 0.0473  0.0545  131  GLU A CG    
1010 C CD    . GLU A 131 ? 0.5832 0.5858 0.5814 -0.0245 0.0467  0.0547  131  GLU A CD    
1011 O OE1   . GLU A 131 ? 0.6505 0.6465 0.6510 -0.0234 0.0487  0.0538  131  GLU A OE1   
1012 O OE2   . GLU A 131 ? 0.5197 0.5314 0.5199 -0.0213 0.0445  0.0561  131  GLU A OE2   
1013 N N     . GLU A 132 ? 0.5602 0.5179 0.5457 -0.0345 0.0591  0.0500  132  GLU A N     
1014 C CA    . GLU A 132 ? 0.5445 0.4889 0.5240 -0.0383 0.0633  0.0496  132  GLU A CA    
1015 C C     . GLU A 132 ? 0.5948 0.5311 0.5751 -0.0360 0.0652  0.0481  132  GLU A C     
1016 O O     . GLU A 132 ? 0.6499 0.5742 0.6253 -0.0385 0.0691  0.0479  132  GLU A O     
1017 C CB    . GLU A 132 ? 0.6702 0.6092 0.6494 -0.0385 0.0667  0.0508  132  GLU A CB    
1018 C CG    . GLU A 132 ? 0.7456 0.6857 0.7330 -0.0324 0.0676  0.0511  132  GLU A CG    
1019 C CD    . GLU A 132 ? 0.7095 0.6502 0.6981 -0.0319 0.0691  0.0527  132  GLU A CD    
1020 O OE1   . GLU A 132 ? 0.6792 0.6101 0.6649 -0.0324 0.0738  0.0536  132  GLU A OE1   
1021 O OE2   . GLU A 132 ? 0.6693 0.6199 0.6615 -0.0306 0.0659  0.0531  132  GLU A OE2   
1022 N N     . ILE A 133 ? 0.5276 0.4697 0.5133 -0.0313 0.0628  0.0471  133  ILE A N     
1023 C CA    . ILE A 133 ? 0.4877 0.4227 0.4743 -0.0291 0.0645  0.0455  133  ILE A CA    
1024 C C     . ILE A 133 ? 0.4911 0.4194 0.4709 -0.0328 0.0651  0.0442  133  ILE A C     
1025 O O     . ILE A 133 ? 0.5291 0.4462 0.5065 -0.0336 0.0684  0.0434  133  ILE A O     
1026 C CB    . ILE A 133 ? 0.5172 0.4592 0.5100 -0.0236 0.0620  0.0447  133  ILE A CB    
1027 C CG1   . ILE A 133 ? 0.5430 0.4890 0.5419 -0.0205 0.0621  0.0462  133  ILE A CG1   
1028 C CG2   . ILE A 133 ? 0.3806 0.3154 0.3734 -0.0219 0.0635  0.0429  133  ILE A CG2   
1029 C CD1   . ILE A 133 ? 0.5051 0.4551 0.5092 -0.0159 0.0606  0.0456  133  ILE A CD1   
1030 N N     . PRO A 134 ? 0.4871 0.4224 0.4638 -0.0353 0.0620  0.0443  134  PRO A N     
1031 C CA    . PRO A 134 ? 0.5551 0.4839 0.5249 -0.0394 0.0625  0.0434  134  PRO A CA    
1032 C C     . PRO A 134 ? 0.5232 0.4386 0.4858 -0.0449 0.0665  0.0438  134  PRO A C     
1033 O O     . PRO A 134 ? 0.5759 0.4799 0.5351 -0.0457 0.0692  0.0425  134  PRO A O     
1034 C CB    . PRO A 134 ? 0.5544 0.4948 0.5223 -0.0417 0.0586  0.0446  134  PRO A CB    
1035 C CG    . PRO A 134 ? 0.5458 0.4984 0.5210 -0.0361 0.0559  0.0453  134  PRO A CG    
1036 C CD    . PRO A 134 ? 0.4883 0.4374 0.4677 -0.0340 0.0580  0.0456  134  PRO A CD    
1037 N N     . ALA A 135 ? 0.5662 0.4819 0.5258 -0.0486 0.0673  0.0455  135  ALA A N     
1038 C CA    . ALA A 135 ? 0.5831 0.4847 0.5341 -0.0540 0.0718  0.0460  135  ALA A CA    
1039 C C     . ALA A 135 ? 0.5519 0.4418 0.5048 -0.0502 0.0767  0.0457  135  ALA A C     
1040 O O     . ALA A 135 ? 0.6074 0.4833 0.5536 -0.0529 0.0806  0.0454  135  ALA A O     
1041 C CB    . ALA A 135 ? 0.5846 0.4884 0.5318 -0.0580 0.0722  0.0479  135  ALA A CB    
1042 N N     . LEU A 136 ? 0.5275 0.4234 0.4895 -0.0441 0.0764  0.0461  136  LEU A N     
1043 C CA    . LEU A 136 ? 0.4951 0.3825 0.4603 -0.0401 0.0807  0.0465  136  LEU A CA    
1044 C C     . LEU A 136 ? 0.5447 0.4254 0.5097 -0.0389 0.0815  0.0446  136  LEU A C     
1045 O O     . LEU A 136 ? 0.5609 0.4286 0.5224 -0.0392 0.0863  0.0449  136  LEU A O     
1046 C CB    . LEU A 136 ? 0.6170 0.5142 0.5925 -0.0342 0.0793  0.0473  136  LEU A CB    
1047 C CG    . LEU A 136 ? 0.6498 0.5406 0.6297 -0.0300 0.0834  0.0484  136  LEU A CG    
1048 C CD1   . LEU A 136 ? 0.6826 0.5616 0.6566 -0.0320 0.0893  0.0506  136  LEU A CD1   
1049 C CD2   . LEU A 136 ? 0.5967 0.4989 0.5866 -0.0248 0.0809  0.0493  136  LEU A CD2   
1050 N N     . ASP A 137 ? 0.5191 0.4083 0.4873 -0.0373 0.0772  0.0428  137  ASP A N     
1051 C CA    . ASP A 137 ? 0.5622 0.4457 0.5300 -0.0359 0.0777  0.0407  137  ASP A CA    
1052 C C     . ASP A 137 ? 0.5630 0.4337 0.5208 -0.0415 0.0802  0.0401  137  ASP A C     
1053 O O     . ASP A 137 ? 0.5568 0.4161 0.5125 -0.0410 0.0835  0.0392  137  ASP A O     
1054 C CB    . ASP A 137 ? 0.5837 0.4782 0.5552 -0.0332 0.0729  0.0389  137  ASP A CB    
1055 C CG    . ASP A 137 ? 0.5647 0.4529 0.5352 -0.0317 0.0735  0.0365  137  ASP A CG    
1056 O OD1   . ASP A 137 ? 0.5684 0.4518 0.5428 -0.0285 0.0759  0.0361  137  ASP A OD1   
1057 O OD2   . ASP A 137 ? 0.5360 0.4244 0.5019 -0.0338 0.0716  0.0351  137  ASP A OD2   
1058 N N     . LYS A 138 ? 0.5741 0.4468 0.5255 -0.0470 0.0785  0.0407  138  LYS A N     
1059 C CA    . LYS A 138 ? 0.6216 0.4821 0.5620 -0.0536 0.0807  0.0405  138  LYS A CA    
1060 C C     . LYS A 138 ? 0.6320 0.4754 0.5669 -0.0549 0.0873  0.0417  138  LYS A C     
1061 O O     . LYS A 138 ? 0.6415 0.4714 0.5703 -0.0569 0.0904  0.0408  138  LYS A O     
1062 C CB    . LYS A 138 ? 0.6797 0.5466 0.6143 -0.0599 0.0778  0.0418  138  LYS A CB    
1063 C CG    . LYS A 138 ? 0.7931 0.6496 0.7160 -0.0675 0.0787  0.0415  138  LYS A CG    
1064 C CD    . LYS A 138 ? 0.8398 0.7049 0.7574 -0.0741 0.0753  0.0431  138  LYS A CD    
1065 C CE    . LYS A 138 ? 0.9262 0.7817 0.8318 -0.0823 0.0757  0.0431  138  LYS A CE    
1066 N NZ    . LYS A 138 ? 0.9367 0.8006 0.8365 -0.0898 0.0725  0.0452  138  LYS A NZ    
1067 N N     . GLU A 139 ? 0.5201 0.3639 0.4569 -0.0534 0.0897  0.0437  139  GLU A N     
1068 C CA    . GLU A 139 ? 0.6028 0.4310 0.5347 -0.0535 0.0966  0.0455  139  GLU A CA    
1069 C C     . GLU A 139 ? 0.6323 0.4550 0.5700 -0.0478 0.0994  0.0450  139  GLU A C     
1070 O O     . GLU A 139 ? 0.7319 0.5389 0.6632 -0.0489 0.1046  0.0454  139  GLU A O     
1071 C CB    . GLU A 139 ? 0.6370 0.4686 0.5715 -0.0516 0.0985  0.0479  139  GLU A CB    
1072 C CG    . GLU A 139 ? 0.8440 0.6795 0.7723 -0.0572 0.0968  0.0487  139  GLU A CG    
1073 C CD    . GLU A 139 ? 1.0262 0.8632 0.9568 -0.0546 0.0995  0.0510  139  GLU A CD    
1074 O OE1   . GLU A 139 ? 1.0530 0.8793 0.9826 -0.0516 0.1054  0.0527  139  GLU A OE1   
1075 O OE2   . GLU A 139 ? 1.0106 0.8597 0.9442 -0.0551 0.0957  0.0512  139  GLU A OE2   
1076 N N     . LEU A 140 ? 0.5798 0.4151 0.5292 -0.0418 0.0962  0.0445  140  LEU A N     
1077 C CA    . LEU A 140 ? 0.5736 0.4060 0.5295 -0.0365 0.0985  0.0444  140  LEU A CA    
1078 C C     . LEU A 140 ? 0.5970 0.4216 0.5495 -0.0375 0.0985  0.0418  140  LEU A C     
1079 O O     . LEU A 140 ? 0.5891 0.4042 0.5423 -0.0351 0.1027  0.0420  140  LEU A O     
1080 C CB    . LEU A 140 ? 0.5856 0.4337 0.5535 -0.0309 0.0945  0.0443  140  LEU A CB    
1081 C CG    . LEU A 140 ? 0.5775 0.4302 0.5500 -0.0285 0.0962  0.0474  140  LEU A CG    
1082 C CD1   . LEU A 140 ? 0.5836 0.4526 0.5658 -0.0248 0.0912  0.0473  140  LEU A CD1   
1083 C CD2   . LEU A 140 ? 0.5268 0.3697 0.5005 -0.0255 0.1025  0.0501  140  LEU A CD2   
1084 N N     . LYS A 141 ? 0.5566 0.3857 0.5057 -0.0408 0.0941  0.0394  141  LYS A N     
1085 C CA    . LYS A 141 ? 0.6102 0.4324 0.5555 -0.0420 0.0938  0.0368  141  LYS A CA    
1086 C C     . LYS A 141 ? 0.6858 0.4887 0.6206 -0.0463 0.0994  0.0373  141  LYS A C     
1087 O O     . LYS A 141 ? 0.6689 0.4619 0.6018 -0.0455 0.1015  0.0358  141  LYS A O     
1088 C CB    . LYS A 141 ? 0.5681 0.4002 0.5116 -0.0446 0.0880  0.0349  141  LYS A CB    
1089 C CG    . LYS A 141 ? 0.6053 0.4535 0.5581 -0.0394 0.0832  0.0338  141  LYS A CG    
1090 C CD    . LYS A 141 ? 0.5487 0.3945 0.5044 -0.0356 0.0831  0.0311  141  LYS A CD    
1091 C CE    . LYS A 141 ? 0.4816 0.3409 0.4454 -0.0304 0.0794  0.0303  141  LYS A CE    
1092 N NZ    . LYS A 141 ? 0.4840 0.3556 0.4471 -0.0311 0.0746  0.0302  141  LYS A NZ    
1093 N N     . ALA A 142 ? 0.6619 0.4583 0.5889 -0.0508 0.1020  0.0396  142  ALA A N     
1094 C CA    . ALA A 142 ? 0.6812 0.4575 0.5961 -0.0554 0.1080  0.0405  142  ALA A CA    
1095 C C     . ALA A 142 ? 0.7399 0.5051 0.6572 -0.0505 0.1145  0.0422  142  ALA A C     
1096 O O     . ALA A 142 ? 0.7643 0.5116 0.6729 -0.0526 0.1199  0.0426  142  ALA A O     
1097 C CB    . ALA A 142 ? 0.6308 0.4027 0.5358 -0.0616 0.1095  0.0425  142  ALA A CB    
1098 N N     . LYS A 143 ? 0.7116 0.4875 0.6407 -0.0439 0.1141  0.0434  143  LYS A N     
1099 C CA    . LYS A 143 ? 0.6568 0.4258 0.5903 -0.0385 0.1198  0.0458  143  LYS A CA    
1100 C C     . LYS A 143 ? 0.5887 0.3628 0.5312 -0.0340 0.1177  0.0436  143  LYS A C     
1101 O O     . LYS A 143 ? 0.6901 0.4617 0.6382 -0.0291 0.1215  0.0456  143  LYS A O     
1102 C CB    . LYS A 143 ? 0.7370 0.5148 0.6777 -0.0344 0.1210  0.0491  143  LYS A CB    
1103 C CG    . LYS A 143 ? 0.9275 0.7024 0.8603 -0.0384 0.1226  0.0510  143  LYS A CG    
1104 C CD    . LYS A 143 ? 0.9912 0.7763 0.9321 -0.0338 0.1231  0.0540  143  LYS A CD    
1105 C CE    . LYS A 143 ? 1.0688 0.8552 1.0029 -0.0381 0.1225  0.0548  143  LYS A CE    
1106 N NZ    . LYS A 143 ? 1.0695 0.8669 1.0118 -0.0337 0.1223  0.0572  143  LYS A NZ    
1107 N N     . GLY A 144 ? 0.5149 0.2964 0.4582 -0.0354 0.1119  0.0399  144  GLY A N     
1108 C CA    . GLY A 144 ? 0.5327 0.3193 0.4833 -0.0315 0.1096  0.0374  144  GLY A CA    
1109 C C     . GLY A 144 ? 0.6426 0.4463 0.6052 -0.0264 0.1059  0.0379  144  GLY A C     
1110 O O     . GLY A 144 ? 0.5707 0.3775 0.5399 -0.0226 0.1057  0.0371  144  GLY A O     
1111 N N     . LYS A 145 ? 0.5645 0.3791 0.5295 -0.0269 0.1031  0.0393  145  LYS A N     
1112 C CA    . LYS A 145 ? 0.5103 0.3404 0.4854 -0.0228 0.0996  0.0400  145  LYS A CA    
1113 C C     . LYS A 145 ? 0.5521 0.3943 0.5270 -0.0245 0.0935  0.0381  145  LYS A C     
1114 O O     . LYS A 145 ? 0.5866 0.4256 0.5541 -0.0288 0.0922  0.0368  145  LYS A O     
1115 C CB    . LYS A 145 ? 0.4598 0.2915 0.4384 -0.0210 0.1029  0.0442  145  LYS A CB    
1116 C CG    . LYS A 145 ? 0.5219 0.3424 0.5009 -0.0186 0.1096  0.0471  145  LYS A CG    
1117 C CD    . LYS A 145 ? 0.5844 0.4091 0.5716 -0.0145 0.1091  0.0467  145  LYS A CD    
1118 C CE    . LYS A 145 ? 0.6315 0.4461 0.6198 -0.0117 0.1161  0.0502  145  LYS A CE    
1119 N NZ    . LYS A 145 ? 0.6687 0.4871 0.6644 -0.0084 0.1156  0.0497  145  LYS A NZ    
1120 N N     . SER A 146 ? 0.5625 0.4183 0.5453 -0.0212 0.0899  0.0384  146  SER A N     
1121 C CA    . SER A 146 ? 0.4722 0.3399 0.4553 -0.0220 0.0846  0.0373  146  SER A CA    
1122 C C     . SER A 146 ? 0.4928 0.3706 0.4818 -0.0201 0.0833  0.0399  146  SER A C     
1123 O O     . SER A 146 ? 0.5477 0.4256 0.5421 -0.0174 0.0857  0.0421  146  SER A O     
1124 C CB    . SER A 146 ? 0.4980 0.3714 0.4826 -0.0199 0.0808  0.0343  146  SER A CB    
1125 O OG    . SER A 146 ? 0.5043 0.3837 0.4963 -0.0160 0.0803  0.0347  146  SER A OG    
1126 N N     . ALA A 147 ? 0.5215 0.4083 0.5098 -0.0214 0.0795  0.0398  147  ALA A N     
1127 C CA    . ALA A 147 ? 0.4751 0.3713 0.4685 -0.0198 0.0781  0.0420  147  ALA A CA    
1128 C C     . ALA A 147 ? 0.5214 0.4276 0.5221 -0.0157 0.0751  0.0418  147  ALA A C     
1129 O O     . ALA A 147 ? 0.4734 0.3830 0.4798 -0.0134 0.0759  0.0439  147  ALA A O     
1130 C CB    . ALA A 147 ? 0.4442 0.3462 0.4339 -0.0228 0.0754  0.0422  147  ALA A CB    
1131 N N     . LEU A 148 ? 0.5501 0.4604 0.5498 -0.0148 0.0719  0.0393  148  LEU A N     
1132 C CA    . LEU A 148 ? 0.4883 0.4077 0.4925 -0.0117 0.0688  0.0391  148  LEU A CA    
1133 C C     . LEU A 148 ? 0.5029 0.4213 0.5052 -0.0102 0.0676  0.0363  148  LEU A C     
1134 O O     . LEU A 148 ? 0.4667 0.3834 0.4638 -0.0111 0.0666  0.0343  148  LEU A O     
1135 C CB    . LEU A 148 ? 0.3957 0.3246 0.3998 -0.0118 0.0655  0.0399  148  LEU A CB    
1136 C CG    . LEU A 148 ? 0.4206 0.3582 0.4274 -0.0089 0.0623  0.0399  148  LEU A CG    
1137 C CD1   . LEU A 148 ? 0.3948 0.3347 0.4078 -0.0072 0.0629  0.0417  148  LEU A CD1   
1138 C CD2   . LEU A 148 ? 0.4084 0.3539 0.4140 -0.0092 0.0596  0.0408  148  LEU A CD2   
1139 N N     . MET A 149 ? 0.5125 0.4320 0.5187 -0.0080 0.0677  0.0363  149  MET A N     
1140 C CA    . MET A 149 ? 0.5559 0.4753 0.5597 -0.0066 0.0663  0.0337  149  MET A CA    
1141 C C     . MET A 149 ? 0.5207 0.4473 0.5277 -0.0048 0.0642  0.0346  149  MET A C     
1142 O O     . MET A 149 ? 0.4718 0.4003 0.4844 -0.0045 0.0650  0.0368  149  MET A O     
1143 C CB    . MET A 149 ? 0.5482 0.4585 0.5511 -0.0068 0.0690  0.0320  149  MET A CB    
1144 C CG    . MET A 149 ? 0.6264 0.5280 0.6245 -0.0089 0.0710  0.0307  149  MET A CG    
1145 S SD    . MET A 149 ? 0.6171 0.5074 0.6144 -0.0088 0.0746  0.0289  149  MET A SD    
1146 C CE    . MET A 149 ? 0.3101 0.2021 0.3038 -0.0070 0.0721  0.0252  149  MET A CE    
1147 N N     . PHE A 150 ? 0.4621 0.3924 0.4650 -0.0036 0.0617  0.0332  150  PHE A N     
1148 C CA    . PHE A 150 ? 0.4944 0.4295 0.4978 -0.0023 0.0598  0.0336  150  PHE A CA    
1149 C C     . PHE A 150 ? 0.4921 0.4254 0.4881 -0.0010 0.0589  0.0309  150  PHE A C     
1150 O O     . PHE A 150 ? 0.4458 0.3762 0.4370 -0.0006 0.0592  0.0290  150  PHE A O     
1151 C CB    . PHE A 150 ? 0.4491 0.3921 0.4556 -0.0020 0.0579  0.0363  150  PHE A CB    
1152 C CG    . PHE A 150 ? 0.3972 0.3437 0.3999 -0.0013 0.0563  0.0362  150  PHE A CG    
1153 C CD1   . PHE A 150 ? 0.3666 0.3127 0.3695 -0.0027 0.0570  0.0366  150  PHE A CD1   
1154 C CD2   . PHE A 150 ? 0.4066 0.3567 0.4052 0.0005  0.0544  0.0361  150  PHE A CD2   
1155 C CE1   . PHE A 150 ? 0.3921 0.3428 0.3920 -0.0023 0.0554  0.0371  150  PHE A CE1   
1156 C CE2   . PHE A 150 ? 0.4611 0.4153 0.4568 0.0015  0.0533  0.0367  150  PHE A CE2   
1157 C CZ    . PHE A 150 ? 0.4327 0.3880 0.4296 0.0001  0.0535  0.0373  150  PHE A CZ    
1158 N N     . ASN A 151 ? 0.5283 0.4631 0.5227 -0.0005 0.0579  0.0308  151  ASN A N     
1159 C CA    . ASN A 151 ? 0.4947 0.4261 0.4807 0.0008  0.0577  0.0282  151  ASN A CA    
1160 C C     . ASN A 151 ? 0.4932 0.4272 0.4736 0.0029  0.0567  0.0282  151  ASN A C     
1161 O O     . ASN A 151 ? 0.4834 0.4229 0.4643 0.0037  0.0552  0.0304  151  ASN A O     
1162 C CB    . ASN A 151 ? 0.4980 0.4301 0.4826 0.0000  0.0569  0.0287  151  ASN A CB    
1163 C CG    . ASN A 151 ? 0.4797 0.4067 0.4537 0.0010  0.0573  0.0259  151  ASN A CG    
1164 O OD1   . ASN A 151 ? 0.4804 0.4027 0.4489 0.0026  0.0584  0.0234  151  ASN A OD1   
1165 N ND2   . ASN A 151 ? 0.3958 0.3232 0.3662 0.0000  0.0564  0.0265  151  ASN A ND2   
1166 N N     . LEU A 152 ? 0.5099 0.4399 0.4847 0.0041  0.0576  0.0260  152  LEU A N     
1167 C CA    . LEU A 152 ? 0.5144 0.4478 0.4842 0.0066  0.0569  0.0266  152  LEU A CA    
1168 C C     . LEU A 152 ? 0.4365 0.3663 0.3965 0.0093  0.0576  0.0250  152  LEU A C     
1169 O O     . LEU A 152 ? 0.4887 0.4205 0.4434 0.0121  0.0577  0.0257  152  LEU A O     
1170 C CB    . LEU A 152 ? 0.4441 0.3771 0.4141 0.0062  0.0573  0.0261  152  LEU A CB    
1171 C CG    . LEU A 152 ? 0.5044 0.4403 0.4820 0.0034  0.0569  0.0279  152  LEU A CG    
1172 C CD1   . LEU A 152 ? 0.4613 0.3956 0.4374 0.0020  0.0573  0.0274  152  LEU A CD1   
1173 C CD2   . LEU A 152 ? 0.5489 0.4930 0.5300 0.0037  0.0552  0.0310  152  LEU A CD2   
1174 N N     . GLN A 153 ? 0.4730 0.3973 0.4300 0.0084  0.0584  0.0232  153  GLN A N     
1175 C CA    . GLN A 153 ? 0.4746 0.3934 0.4205 0.0104  0.0597  0.0215  153  GLN A CA    
1176 C C     . GLN A 153 ? 0.5453 0.4659 0.4871 0.0109  0.0590  0.0235  153  GLN A C     
1177 O O     . GLN A 153 ? 0.5666 0.4828 0.4976 0.0132  0.0603  0.0228  153  GLN A O     
1178 C CB    . GLN A 153 ? 0.4287 0.3395 0.3716 0.0086  0.0611  0.0182  153  GLN A CB    
1179 C CG    . GLN A 153 ? 0.4618 0.3693 0.4082 0.0079  0.0621  0.0161  153  GLN A CG    
1180 C CD    . GLN A 153 ? 0.5387 0.4467 0.4817 0.0106  0.0625  0.0158  153  GLN A CD    
1181 O OE1   . GLN A 153 ? 0.5759 0.4804 0.5094 0.0135  0.0637  0.0144  153  GLN A OE1   
1182 N NE2   . GLN A 153 ? 0.5452 0.4576 0.4952 0.0096  0.0616  0.0173  153  GLN A NE2   
1183 N N     . GLU A 154 ? 0.5619 0.4883 0.5115 0.0089  0.0571  0.0260  154  GLU A N     
1184 C CA    . GLU A 154 ? 0.5253 0.4533 0.4715 0.0089  0.0562  0.0282  154  GLU A CA    
1185 C C     . GLU A 154 ? 0.5046 0.4405 0.4563 0.0103  0.0548  0.0313  154  GLU A C     
1186 O O     . GLU A 154 ? 0.4852 0.4264 0.4469 0.0086  0.0535  0.0326  154  GLU A O     
1187 C CB    . GLU A 154 ? 0.4457 0.3739 0.3958 0.0049  0.0551  0.0287  154  GLU A CB    
1188 C CG    . GLU A 154 ? 0.4113 0.3320 0.3541 0.0030  0.0564  0.0261  154  GLU A CG    
1189 C CD    . GLU A 154 ? 0.5149 0.4288 0.4430 0.0043  0.0577  0.0253  154  GLU A CD    
1190 O OE1   . GLU A 154 ? 0.5115 0.4272 0.4360 0.0062  0.0575  0.0275  154  GLU A OE1   
1191 O OE2   . GLU A 154 ? 0.5777 0.4839 0.4972 0.0034  0.0594  0.0225  154  GLU A OE2   
1192 N N     . PRO A 155 ? 0.4428 0.3791 0.3874 0.0134  0.0553  0.0327  155  PRO A N     
1193 C CA    . PRO A 155 ? 0.4814 0.4253 0.4303 0.0151  0.0541  0.0358  155  PRO A CA    
1194 C C     . PRO A 155 ? 0.5109 0.4597 0.4682 0.0124  0.0519  0.0379  155  PRO A C     
1195 O O     . PRO A 155 ? 0.5456 0.5012 0.5094 0.0127  0.0508  0.0399  155  PRO A O     
1196 C CB    . PRO A 155 ? 0.4045 0.3456 0.3423 0.0189  0.0556  0.0371  155  PRO A CB    
1197 C CG    . PRO A 155 ? 0.4928 0.4244 0.4206 0.0179  0.0572  0.0349  155  PRO A CG    
1198 C CD    . PRO A 155 ? 0.4269 0.3557 0.3580 0.0156  0.0574  0.0317  155  PRO A CD    
1199 N N     . TYR A 156 ? 0.5193 0.4650 0.4762 0.0096  0.0515  0.0374  156  TYR A N     
1200 C CA    . TYR A 156 ? 0.4925 0.4429 0.4572 0.0070  0.0495  0.0396  156  TYR A CA    
1201 C C     . TYR A 156 ? 0.4979 0.4541 0.4741 0.0060  0.0488  0.0402  156  TYR A C     
1202 O O     . TYR A 156 ? 0.4221 0.3837 0.4045 0.0056  0.0475  0.0424  156  TYR A O     
1203 C CB    . TYR A 156 ? 0.4879 0.4346 0.4508 0.0036  0.0492  0.0389  156  TYR A CB    
1204 C CG    . TYR A 156 ? 0.4984 0.4503 0.4692 0.0007  0.0472  0.0414  156  TYR A CG    
1205 C CD1   . TYR A 156 ? 0.5413 0.4945 0.5096 0.0003  0.0459  0.0437  156  TYR A CD1   
1206 C CD2   . TYR A 156 ? 0.4721 0.4271 0.4525 -0.0015 0.0469  0.0417  156  TYR A CD2   
1207 C CE1   . TYR A 156 ? 0.4221 0.3803 0.3975 -0.0023 0.0440  0.0461  156  TYR A CE1   
1208 C CE2   . TYR A 156 ? 0.4324 0.3927 0.4200 -0.0038 0.0453  0.0445  156  TYR A CE2   
1209 C CZ    . TYR A 156 ? 0.4240 0.3861 0.4091 -0.0042 0.0437  0.0466  156  TYR A CZ    
1210 O OH    . TYR A 156 ? 0.4874 0.4552 0.4796 -0.0064 0.0420  0.0494  156  TYR A OH    
1211 N N     . PHE A 157 ? 0.4119 0.3659 0.3902 0.0056  0.0500  0.0382  157  PHE A N     
1212 C CA    . PHE A 157 ? 0.3767 0.3339 0.3643 0.0042  0.0500  0.0388  157  PHE A CA    
1213 C C     . PHE A 157 ? 0.3880 0.3492 0.3772 0.0055  0.0498  0.0396  157  PHE A C     
1214 O O     . PHE A 157 ? 0.4154 0.3797 0.4112 0.0041  0.0496  0.0408  157  PHE A O     
1215 C CB    . PHE A 157 ? 0.4384 0.3906 0.4272 0.0029  0.0516  0.0366  157  PHE A CB    
1216 C CG    . PHE A 157 ? 0.3999 0.3502 0.3901 0.0009  0.0516  0.0365  157  PHE A CG    
1217 C CD1   . PHE A 157 ? 0.4173 0.3633 0.3994 0.0007  0.0517  0.0350  157  PHE A CD1   
1218 C CD2   . PHE A 157 ? 0.3683 0.3213 0.3672 -0.0008 0.0518  0.0384  157  PHE A CD2   
1219 C CE1   . PHE A 157 ? 0.4083 0.3533 0.3914 -0.0019 0.0515  0.0353  157  PHE A CE1   
1220 C CE2   . PHE A 157 ? 0.3922 0.3451 0.3930 -0.0028 0.0517  0.0390  157  PHE A CE2   
1221 C CZ    . PHE A 157 ? 0.3897 0.3390 0.3828 -0.0036 0.0513  0.0374  157  PHE A CZ    
1222 N N     . THR A 158 ? 0.4433 0.4045 0.4258 0.0080  0.0500  0.0393  158  THR A N     
1223 C CA    A THR A 158 ? 0.4203 0.3864 0.4035 0.0090  0.0497  0.0404  158  THR A CA    
1224 C CA    B THR A 158 ? 0.4142 0.3803 0.3977 0.0089  0.0496  0.0405  158  THR A CA    
1225 C C     . THR A 158 ? 0.4423 0.4141 0.4255 0.0106  0.0484  0.0432  158  THR A C     
1226 O O     . THR A 158 ? 0.4757 0.4534 0.4617 0.0107  0.0477  0.0448  158  THR A O     
1227 C CB    A THR A 158 ? 0.4186 0.3823 0.3946 0.0113  0.0508  0.0390  158  THR A CB    
1228 C CB    B THR A 158 ? 0.4262 0.3902 0.4034 0.0109  0.0507  0.0390  158  THR A CB    
1229 O OG1   A THR A 158 ? 0.3981 0.3560 0.3741 0.0098  0.0520  0.0363  158  THR A OG1   
1230 O OG1   B THR A 158 ? 0.3720 0.3319 0.3408 0.0136  0.0516  0.0383  158  THR A OG1   
1231 C CG2   A THR A 158 ? 0.3716 0.3420 0.3483 0.0123  0.0502  0.0409  158  THR A CG2   
1232 C CG2   B THR A 158 ? 0.4301 0.3889 0.4087 0.0088  0.0518  0.0365  158  THR A CG2   
1233 N N     . TRP A 159 ? 0.4472 0.4171 0.4268 0.0116  0.0482  0.0437  159  TRP A N     
1234 C CA    . TRP A 159 ? 0.4909 0.4649 0.4697 0.0133  0.0473  0.0463  159  TRP A CA    
1235 C C     . TRP A 159 ? 0.4280 0.4082 0.4154 0.0115  0.0458  0.0481  159  TRP A C     
1236 O O     . TRP A 159 ? 0.4488 0.4341 0.4366 0.0129  0.0452  0.0501  159  TRP A O     
1237 C CB    . TRP A 159 ? 0.4583 0.4276 0.4313 0.0135  0.0474  0.0466  159  TRP A CB    
1238 C CG    . TRP A 159 ? 0.4800 0.4516 0.4499 0.0158  0.0471  0.0492  159  TRP A CG    
1239 C CD1   . TRP A 159 ? 0.3989 0.3733 0.3727 0.0147  0.0456  0.0510  159  TRP A CD1   
1240 C CD2   . TRP A 159 ? 0.4957 0.4672 0.4581 0.0199  0.0485  0.0505  159  TRP A CD2   
1241 N NE1   . TRP A 159 ? 0.4506 0.4260 0.4195 0.0178  0.0460  0.0533  159  TRP A NE1   
1242 C CE2   . TRP A 159 ? 0.4261 0.3999 0.3880 0.0211  0.0479  0.0532  159  TRP A CE2   
1243 C CE3   . TRP A 159 ? 0.4803 0.4500 0.4362 0.0230  0.0505  0.0499  159  TRP A CE3   
1244 C CZ2   . TRP A 159 ? 0.4874 0.4617 0.4426 0.0255  0.0494  0.0556  159  TRP A CZ2   
1245 C CZ3   . TRP A 159 ? 0.4997 0.4704 0.4490 0.0274  0.0520  0.0524  159  TRP A CZ3   
1246 C CH2   . TRP A 159 ? 0.5569 0.5298 0.5059 0.0287  0.0516  0.0553  159  TRP A CH2   
1247 N N     . PRO A 160 ? 0.3551 0.3346 0.3489 0.0086  0.0455  0.0476  160  PRO A N     
1248 C CA    . PRO A 160 ? 0.4436 0.4281 0.4443 0.0073  0.0446  0.0493  160  PRO A CA    
1249 C C     . PRO A 160 ? 0.4621 0.4511 0.4637 0.0074  0.0446  0.0499  160  PRO A C     
1250 O O     . PRO A 160 ? 0.4594 0.4534 0.4632 0.0075  0.0437  0.0517  160  PRO A O     
1251 C CB    . PRO A 160 ? 0.4630 0.4454 0.4696 0.0047  0.0453  0.0487  160  PRO A CB    
1252 C CG    . PRO A 160 ? 0.4446 0.4219 0.4479 0.0046  0.0458  0.0471  160  PRO A CG    
1253 C CD    . PRO A 160 ? 0.3542 0.3289 0.3495 0.0067  0.0463  0.0457  160  PRO A CD    
1254 N N     . LEU A 161 ? 0.4581 0.4454 0.4576 0.0070  0.0455  0.0485  161  LEU A N     
1255 C CA    . LEU A 161 ? 0.4901 0.4818 0.4899 0.0062  0.0454  0.0492  161  LEU A CA    
1256 C C     . LEU A 161 ? 0.5161 0.5130 0.5117 0.0092  0.0448  0.0510  161  LEU A C     
1257 O O     . LEU A 161 ? 0.4848 0.4883 0.4819 0.0088  0.0440  0.0529  161  LEU A O     
1258 C CB    . LEU A 161 ? 0.4059 0.3935 0.4045 0.0044  0.0466  0.0472  161  LEU A CB    
1259 C CG    . LEU A 161 ? 0.4302 0.4219 0.4276 0.0028  0.0463  0.0479  161  LEU A CG    
1260 C CD1   . LEU A 161 ? 0.5054 0.5015 0.5067 0.0000  0.0456  0.0497  161  LEU A CD1   
1261 C CD2   . LEU A 161 ? 0.4235 0.4094 0.4192 0.0005  0.0475  0.0458  161  LEU A CD2   
1262 N N     . ILE A 162 ? 0.5329 0.5266 0.5227 0.0124  0.0455  0.0505  162  ILE A N     
1263 C CA    . ILE A 162 ? 0.5260 0.5235 0.5106 0.0163  0.0458  0.0526  162  ILE A CA    
1264 C C     . ILE A 162 ? 0.5091 0.5106 0.4950 0.0176  0.0449  0.0552  162  ILE A C     
1265 O O     . ILE A 162 ? 0.5230 0.5310 0.5081 0.0197  0.0448  0.0579  162  ILE A O     
1266 C CB    . ILE A 162 ? 0.5158 0.5065 0.4923 0.0193  0.0475  0.0513  162  ILE A CB    
1267 C CG1   . ILE A 162 ? 0.5043 0.4919 0.4787 0.0188  0.0484  0.0490  162  ILE A CG1   
1268 C CG2   . ILE A 162 ? 0.4615 0.4545 0.4317 0.0241  0.0485  0.0541  162  ILE A CG2   
1269 C CD1   . ILE A 162 ? 0.4352 0.4148 0.4011 0.0213  0.0503  0.0472  162  ILE A CD1   
1270 N N     . ALA A 163 ? 0.4710 0.4692 0.4592 0.0163  0.0444  0.0547  163  ALA A N     
1271 C CA    . ALA A 163 ? 0.5673 0.5679 0.5563 0.0173  0.0436  0.0569  163  ALA A CA    
1272 C C     . ALA A 163 ? 0.6160 0.6234 0.6119 0.0152  0.0423  0.0581  163  ALA A C     
1273 O O     . ALA A 163 ? 0.5795 0.5912 0.5757 0.0167  0.0418  0.0604  163  ALA A O     
1274 C CB    . ALA A 163 ? 0.4635 0.4582 0.4519 0.0163  0.0433  0.0561  163  ALA A CB    
1275 N N     . ALA A 164 ? 0.5581 0.5655 0.5587 0.0117  0.0421  0.0567  164  ALA A N     
1276 C CA    . ALA A 164 ? 0.5587 0.5705 0.5647 0.0090  0.0413  0.0575  164  ALA A CA    
1277 C C     . ALA A 164 ? 0.5725 0.5922 0.5784 0.0101  0.0406  0.0601  164  ALA A C     
1278 O O     . ALA A 164 ? 0.5652 0.5874 0.5737 0.0099  0.0398  0.0613  164  ALA A O     
1279 C CB    . ALA A 164 ? 0.3803 0.3906 0.3886 0.0054  0.0420  0.0559  164  ALA A CB    
1280 N N     . ASP A 165 ? 0.5527 0.5765 0.5556 0.0113  0.0408  0.0611  165  ASP A N     
1281 C CA    . ASP A 165 ? 0.4944 0.5273 0.4978 0.0119  0.0401  0.0640  165  ASP A CA    
1282 C C     . ASP A 165 ? 0.4544 0.4897 0.4540 0.0171  0.0405  0.0667  165  ASP A C     
1283 O O     . ASP A 165 ? 0.4769 0.5204 0.4767 0.0185  0.0402  0.0698  165  ASP A O     
1284 C CB    . ASP A 165 ? 0.5716 0.6094 0.5743 0.0096  0.0399  0.0645  165  ASP A CB    
1285 C CG    . ASP A 165 ? 0.5835 0.6318 0.5878 0.0084  0.0388  0.0676  165  ASP A CG    
1286 O OD1   . ASP A 165 ? 0.6476 0.6975 0.6551 0.0061  0.0381  0.0679  165  ASP A OD1   
1287 O OD2   . ASP A 165 ? 0.5315 0.5867 0.5339 0.0097  0.0386  0.0700  165  ASP A OD2   
1288 N N     . GLY A 166 ? 0.4439 0.4720 0.4397 0.0199  0.0415  0.0659  166  GLY A N     
1289 C CA    . GLY A 166 ? 0.4278 0.4560 0.4187 0.0248  0.0426  0.0685  166  GLY A CA    
1290 C C     . GLY A 166 ? 0.5719 0.5927 0.5547 0.0285  0.0446  0.0681  166  GLY A C     
1291 O O     . GLY A 166 ? 0.5866 0.6057 0.5637 0.0326  0.0461  0.0705  166  GLY A O     
1292 N N     . GLY A 167 ? 0.4557 0.4713 0.4370 0.0269  0.0450  0.0652  167  GLY A N     
1293 C CA    . GLY A 167 ? 0.5701 0.5776 0.5429 0.0298  0.0470  0.0643  167  GLY A CA    
1294 C C     . GLY A 167 ? 0.5745 0.5739 0.5437 0.0297  0.0472  0.0637  167  GLY A C     
1295 O O     . GLY A 167 ? 0.6009 0.6002 0.5758 0.0263  0.0455  0.0628  167  GLY A O     
1296 N N     . TYR A 168 ? 0.4660 0.4585 0.4252 0.0331  0.0495  0.0645  168  TYR A N     
1297 C CA    . TYR A 168 ? 0.5004 0.4840 0.4545 0.0320  0.0497  0.0638  168  TYR A CA    
1298 C C     . TYR A 168 ? 0.4969 0.4708 0.4380 0.0348  0.0528  0.0635  168  TYR A C     
1299 O O     . TYR A 168 ? 0.5225 0.4969 0.4578 0.0393  0.0552  0.0652  168  TYR A O     
1300 C CB    . TYR A 168 ? 0.5046 0.4896 0.4597 0.0326  0.0490  0.0664  168  TYR A CB    
1301 C CG    . TYR A 168 ? 0.4883 0.4755 0.4382 0.0380  0.0512  0.0703  168  TYR A CG    
1302 C CD1   . TYR A 168 ? 0.4481 0.4264 0.3856 0.0416  0.0544  0.0719  168  TYR A CD1   
1303 C CD2   . TYR A 168 ? 0.4485 0.4468 0.4054 0.0393  0.0504  0.0726  168  TYR A CD2   
1304 C CE1   . TYR A 168 ? 0.4003 0.3804 0.3327 0.0472  0.0570  0.0760  168  TYR A CE1   
1305 C CE2   . TYR A 168 ? 0.3721 0.3736 0.3248 0.0445  0.0526  0.0767  168  TYR A CE2   
1306 C CZ    . TYR A 168 ? 0.4929 0.4852 0.4335 0.0488  0.0560  0.0785  168  TYR A CZ    
1307 O OH    . TYR A 168 ? 0.5812 0.5764 0.5174 0.0546  0.0588  0.0832  168  TYR A OH    
1308 N N     . ALA A 169 ? 0.5109 0.4758 0.4469 0.0321  0.0528  0.0617  169  ALA A N     
1309 C CA    . ALA A 169 ? 0.5079 0.4618 0.4297 0.0339  0.0559  0.0613  169  ALA A CA    
1310 C C     . ALA A 169 ? 0.6720 0.6214 0.5838 0.0383  0.0586  0.0650  169  ALA A C     
1311 O O     . ALA A 169 ? 0.7620 0.7138 0.6702 0.0437  0.0612  0.0674  169  ALA A O     
1312 C CB    . ALA A 169 ? 0.4844 0.4306 0.4033 0.0289  0.0548  0.0588  169  ALA A CB    
1313 N N     . PHE A 170 ? 0.6733 0.6160 0.5803 0.0362  0.0583  0.0657  170  PHE A N     
1314 C CA    . PHE A 170 ? 0.6594 0.5962 0.5563 0.0400  0.0611  0.0692  170  PHE A CA    
1315 C C     . PHE A 170 ? 0.7047 0.6467 0.6093 0.0389  0.0587  0.0713  170  PHE A C     
1316 O O     . PHE A 170 ? 0.6563 0.5995 0.5676 0.0337  0.0554  0.0697  170  PHE A O     
1317 C CB    . PHE A 170 ? 0.6106 0.5319 0.4911 0.0385  0.0637  0.0687  170  PHE A CB    
1318 C CG    . PHE A 170 ? 0.6012 0.5153 0.4711 0.0404  0.0670  0.0670  170  PHE A CG    
1319 C CD1   . PHE A 170 ? 0.5556 0.4652 0.4144 0.0471  0.0719  0.0696  170  PHE A CD1   
1320 C CD2   . PHE A 170 ? 0.6012 0.5130 0.4719 0.0358  0.0655  0.0631  170  PHE A CD2   
1321 C CE1   . PHE A 170 ? 0.6022 0.5046 0.4504 0.0491  0.0753  0.0680  170  PHE A CE1   
1322 C CE2   . PHE A 170 ? 0.5436 0.4482 0.4040 0.0374  0.0687  0.0613  170  PHE A CE2   
1323 C CZ    . PHE A 170 ? 0.5409 0.4405 0.3898 0.0441  0.0736  0.0636  170  PHE A CZ    
1324 N N     . LYS A 171 ? 0.7518 0.6970 0.6554 0.0438  0.0605  0.0750  171  LYS A N     
1325 C CA    . LYS A 171 ? 0.7723 0.7226 0.6832 0.0431  0.0584  0.0769  171  LYS A CA    
1326 C C     . LYS A 171 ? 0.7418 0.6813 0.6451 0.0402  0.0582  0.0772  171  LYS A C     
1327 O O     . LYS A 171 ? 0.6991 0.6264 0.5875 0.0419  0.0617  0.0786  171  LYS A O     
1328 C CB    . LYS A 171 ? 0.7784 0.7348 0.6898 0.0492  0.0605  0.0811  171  LYS A CB    
1329 C CG    . LYS A 171 ? 0.8342 0.8000 0.7572 0.0481  0.0576  0.0824  171  LYS A CG    
1330 C CD    . LYS A 171 ? 0.9642 0.9376 0.9004 0.0424  0.0532  0.0788  171  LYS A CD    
1331 C CE    . LYS A 171 ? 1.1167 1.0986 1.0634 0.0411  0.0506  0.0798  171  LYS A CE    
1332 N NZ    . LYS A 171 ? 1.1521 1.1451 1.1041 0.0445  0.0511  0.0824  171  LYS A NZ    
1333 N N     . TYR A 172 ? 0.7845 0.7282 0.6975 0.0355  0.0543  0.0760  172  TYR A N     
1334 C CA    . TYR A 172 ? 0.8210 0.7566 0.7289 0.0321  0.0533  0.0766  172  TYR A CA    
1335 C C     . TYR A 172 ? 0.8440 0.7833 0.7560 0.0345  0.0530  0.0794  172  TYR A C     
1336 O O     . TYR A 172 ? 0.7764 0.7266 0.7016 0.0338  0.0503  0.0789  172  TYR A O     
1337 C CB    . TYR A 172 ? 0.8038 0.7425 0.7204 0.0257  0.0492  0.0738  172  TYR A CB    
1338 C CG    . TYR A 172 ? 0.8120 0.7420 0.7221 0.0211  0.0480  0.0742  172  TYR A CG    
1339 C CD1   . TYR A 172 ? 0.7796 0.6972 0.6750 0.0189  0.0499  0.0739  172  TYR A CD1   
1340 C CD2   . TYR A 172 ? 0.9229 0.8571 0.8412 0.0185  0.0449  0.0748  172  TYR A CD2   
1341 C CE1   . TYR A 172 ? 0.8646 0.7744 0.7533 0.0138  0.0486  0.0746  172  TYR A CE1   
1342 C CE2   . TYR A 172 ? 0.8864 0.8131 0.7987 0.0139  0.0436  0.0755  172  TYR A CE2   
1343 C CZ    . TYR A 172 ? 0.8857 0.8005 0.7833 0.0113  0.0453  0.0754  172  TYR A CZ    
1344 O OH    . TYR A 172 ? 0.8494 0.7568 0.7403 0.0060  0.0437  0.0763  172  TYR A OH    
1345 N N     . GLU A 173 ? 0.9516 0.8812 0.8513 0.0376  0.0563  0.0823  173  GLU A N     
1346 C CA    . GLU A 173 ? 1.0722 1.0033 0.9741 0.0397  0.0563  0.0852  173  GLU A CA    
1347 C C     . GLU A 173 ? 1.0779 0.9943 0.9666 0.0379  0.0576  0.0866  173  GLU A C     
1348 O O     . GLU A 173 ? 0.9828 0.8868 0.8572 0.0370  0.0601  0.0865  173  GLU A O     
1349 C CB    . GLU A 173 ? 1.2119 1.1481 1.1133 0.0469  0.0596  0.0886  173  GLU A CB    
1350 C CG    . GLU A 173 ? 1.2913 1.2441 1.2081 0.0476  0.0572  0.0879  173  GLU A CG    
1351 C CD    . GLU A 173 ? 1.3312 1.2905 1.2475 0.0543  0.0603  0.0918  173  GLU A CD    
1352 O OE1   . GLU A 173 ? 1.3703 1.3212 1.2739 0.0592  0.0649  0.0948  173  GLU A OE1   
1353 O OE2   . GLU A 173 ? 1.2790 1.2520 1.2073 0.0547  0.0583  0.0922  173  GLU A OE2   
1354 N N     . ASN A 174 ? 1.1126 1.0298 1.0054 0.0371  0.0559  0.0879  174  ASN A N     
1355 C CA    . ASN A 174 ? 1.0315 0.9359 0.9141 0.0336  0.0558  0.0887  174  ASN A CA    
1356 C C     . ASN A 174 ? 1.0051 0.9063 0.8866 0.0264  0.0530  0.0858  174  ASN A C     
1357 O O     . ASN A 174 ? 1.0191 0.9302 0.9140 0.0226  0.0487  0.0836  174  ASN A O     
1358 C CB    . ASN A 174 ? 1.0774 0.9666 0.9411 0.0376  0.0615  0.0920  174  ASN A CB    
1359 C CG    . ASN A 174 ? 1.1597 1.0465 1.0220 0.0414  0.0631  0.0956  174  ASN A CG    
1360 O OD1   . ASN A 174 ? 1.2201 1.1060 1.0775 0.0482  0.0675  0.0989  174  ASN A OD1   
1361 N ND2   . ASN A 174 ? 1.1073 0.9933 0.9738 0.0371  0.0598  0.0951  174  ASN A ND2   
1362 N N     . GLY A 175 ? 0.9453 0.8325 0.8103 0.0246  0.0555  0.0860  175  GLY A N     
1363 C CA    . GLY A 175 ? 0.9468 0.8309 0.8097 0.0173  0.0529  0.0837  175  GLY A CA    
1364 C C     . GLY A 175 ? 1.0097 0.8893 0.8641 0.0174  0.0553  0.0820  175  GLY A C     
1365 O O     . GLY A 175 ? 1.0431 0.9173 0.8916 0.0114  0.0540  0.0804  175  GLY A O     
1366 N N     . LYS A 176 ? 0.9526 0.8348 0.8065 0.0239  0.0586  0.0824  176  LYS A N     
1367 C CA    . LYS A 176 ? 0.9960 0.8723 0.8400 0.0246  0.0616  0.0810  176  LYS A CA    
1368 C C     . LYS A 176 ? 0.9596 0.8477 0.8140 0.0293  0.0621  0.0798  176  LYS A C     
1369 O O     . LYS A 176 ? 0.8513 0.7507 0.7174 0.0334  0.0613  0.0809  176  LYS A O     
1370 C CB    . LYS A 176 ? 1.0351 0.8939 0.8571 0.0277  0.0676  0.0836  176  LYS A CB    
1371 C CG    . LYS A 176 ? 1.1650 1.0135 0.9728 0.0263  0.0706  0.0818  176  LYS A CG    
1372 C CD    . LYS A 176 ? 1.1718 1.0234 0.9849 0.0179  0.0659  0.0783  176  LYS A CD    
1373 C CE    . LYS A 176 ? 1.0299 0.8790 0.8375 0.0176  0.0677  0.0755  176  LYS A CE    
1374 N NZ    . LYS A 176 ? 0.8441 0.6997 0.6609 0.0103  0.0629  0.0723  176  LYS A NZ    
1375 N N     . TYR A 177 ? 0.9471 0.8323 0.7966 0.0281  0.0631  0.0773  177  TYR A N     
1376 C CA    . TYR A 177 ? 0.8097 0.7034 0.6658 0.0322  0.0640  0.0761  177  TYR A CA    
1377 C C     . TYR A 177 ? 0.7633 0.6504 0.6067 0.0396  0.0699  0.0788  177  TYR A C     
1378 O O     . TYR A 177 ? 0.8003 0.6725 0.6256 0.0400  0.0740  0.0795  177  TYR A O     
1379 C CB    . TYR A 177 ? 0.6753 0.5678 0.5308 0.0279  0.0629  0.0723  177  TYR A CB    
1380 C CG    . TYR A 177 ? 0.6607 0.5636 0.5322 0.0222  0.0575  0.0699  177  TYR A CG    
1381 C CD1   . TYR A 177 ? 0.6053 0.5226 0.4940 0.0238  0.0550  0.0693  177  TYR A CD1   
1382 C CD2   . TYR A 177 ? 0.6351 0.5335 0.5041 0.0152  0.0551  0.0686  177  TYR A CD2   
1383 C CE1   . TYR A 177 ? 0.6017 0.5275 0.5041 0.0192  0.0508  0.0675  177  TYR A CE1   
1384 C CE2   . TYR A 177 ? 0.6378 0.5463 0.5218 0.0107  0.0506  0.0671  177  TYR A CE2   
1385 C CZ    . TYR A 177 ? 0.5827 0.5043 0.4830 0.0130  0.0487  0.0665  177  TYR A CZ    
1386 O OH    . TYR A 177 ? 0.6720 0.6027 0.5861 0.0091  0.0450  0.0653  177  TYR A OH    
1387 N N     . ASP A 178 ? 0.6870 0.5850 0.5393 0.0454  0.0705  0.0808  178  ASP A N     
1388 C CA    . ASP A 178 ? 0.6701 0.5644 0.5122 0.0532  0.0761  0.0843  178  ASP A CA    
1389 C C     . ASP A 178 ? 0.7094 0.6053 0.5494 0.0556  0.0780  0.0825  178  ASP A C     
1390 O O     . ASP A 178 ? 0.6770 0.5866 0.5306 0.0564  0.0756  0.0815  178  ASP A O     
1391 C CB    . ASP A 178 ? 0.6117 0.5182 0.4644 0.0582  0.0758  0.0880  178  ASP A CB    
1392 C CG    . ASP A 178 ? 0.6408 0.5458 0.4846 0.0668  0.0816  0.0925  178  ASP A CG    
1393 O OD1   . ASP A 178 ? 0.7077 0.6006 0.5359 0.0692  0.0863  0.0927  178  ASP A OD1   
1394 O OD2   . ASP A 178 ? 0.7730 0.6891 0.6253 0.0711  0.0816  0.0959  178  ASP A OD2   
1395 N N     . ILE A 179 ? 0.7340 0.6151 0.5561 0.0565  0.0825  0.0822  179  ILE A N     
1396 C CA    . ILE A 179 ? 0.6993 0.5798 0.5178 0.0581  0.0844  0.0799  179  ILE A CA    
1397 C C     . ILE A 179 ? 0.7120 0.6021 0.5343 0.0661  0.0870  0.0828  179  ILE A C     
1398 O O     . ILE A 179 ? 0.7489 0.6413 0.5712 0.0676  0.0879  0.0810  179  ILE A O     
1399 C CB    . ILE A 179 ? 0.6646 0.5257 0.4607 0.0578  0.0894  0.0792  179  ILE A CB    
1400 C CG1   . ILE A 179 ? 0.6368 0.4972 0.4316 0.0565  0.0896  0.0751  179  ILE A CG1   
1401 C CG2   . ILE A 179 ? 0.6794 0.5317 0.4603 0.0661  0.0965  0.0841  179  ILE A CG2   
1402 C CD1   . ILE A 179 ? 0.6981 0.5391 0.4702 0.0556  0.0945  0.0739  179  ILE A CD1   
1403 N N     . LYS A 180 ? 0.7993 0.6951 0.6247 0.0711  0.0883  0.0875  180  LYS A N     
1404 C CA    . LYS A 180 ? 0.7822 0.6885 0.6112 0.0788  0.0909  0.0913  180  LYS A CA    
1405 C C     . LYS A 180 ? 0.7483 0.6743 0.5984 0.0773  0.0855  0.0914  180  LYS A C     
1406 O O     . LYS A 180 ? 0.7079 0.6455 0.5636 0.0826  0.0866  0.0950  180  LYS A O     
1407 C CB    . LYS A 180 ? 0.8658 0.7657 0.6832 0.0862  0.0968  0.0975  180  LYS A CB    
1408 C CG    . LYS A 180 ? 0.9193 0.7981 0.7131 0.0886  0.1034  0.0983  180  LYS A CG    
1409 C CD    . LYS A 180 ? 0.8994 0.7729 0.6824 0.0971  0.1098  0.1052  180  LYS A CD    
1410 C CE    . LYS A 180 ? 0.9459 0.7965 0.7035 0.0995  0.1172  0.1063  180  LYS A CE    
1411 N NZ    . LYS A 180 ? 0.9964 0.8421 0.7427 0.1094  0.1247  0.1136  180  LYS A NZ    
1412 N N     . ASP A 181 ? 0.6584 0.5881 0.5195 0.0700  0.0799  0.0877  181  ASP A N     
1413 C CA    . ASP A 181 ? 0.6798 0.6264 0.5595 0.0677  0.0750  0.0872  181  ASP A CA    
1414 C C     . ASP A 181 ? 0.6085 0.5584 0.4966 0.0616  0.0710  0.0819  181  ASP A C     
1415 O O     . ASP A 181 ? 0.5319 0.4809 0.4260 0.0555  0.0673  0.0789  181  ASP A O     
1416 C CB    . ASP A 181 ? 0.8178 0.7667 0.7039 0.0653  0.0724  0.0884  181  ASP A CB    
1417 C CG    . ASP A 181 ? 0.8901 0.8561 0.7929 0.0644  0.0686  0.0892  181  ASP A CG    
1418 O OD1   . ASP A 181 ? 0.8920 0.8676 0.8022 0.0641  0.0672  0.0881  181  ASP A OD1   
1419 O OD2   . ASP A 181 ? 0.9469 0.9161 0.8549 0.0636  0.0670  0.0908  181  ASP A OD2   
1420 N N     . VAL A 182 ? 0.6609 0.6147 0.5494 0.0636  0.0720  0.0810  182  VAL A N     
1421 C CA    . VAL A 182 ? 0.5511 0.5074 0.4465 0.0587  0.0690  0.0763  182  VAL A CA    
1422 C C     . VAL A 182 ? 0.5721 0.5443 0.4827 0.0577  0.0656  0.0767  182  VAL A C     
1423 O O     . VAL A 182 ? 0.5252 0.5063 0.4378 0.0621  0.0668  0.0807  182  VAL A O     
1424 C CB    . VAL A 182 ? 0.5889 0.5378 0.4735 0.0614  0.0725  0.0748  182  VAL A CB    
1425 C CG1   . VAL A 182 ? 0.5886 0.5392 0.4798 0.0565  0.0697  0.0699  182  VAL A CG1   
1426 C CG2   . VAL A 182 ? 0.5559 0.4879 0.4231 0.0624  0.0764  0.0748  182  VAL A CG2   
1427 N N     . GLY A 183 ? 0.5658 0.5416 0.4865 0.0517  0.0616  0.0730  183  GLY A N     
1428 C CA    . GLY A 183 ? 0.6520 0.6412 0.5858 0.0497  0.0586  0.0733  183  GLY A CA    
1429 C C     . GLY A 183 ? 0.6220 0.6139 0.5608 0.0467  0.0571  0.0699  183  GLY A C     
1430 O O     . GLY A 183 ? 0.5315 0.5303 0.4807 0.0424  0.0540  0.0686  183  GLY A O     
1431 N N     . VAL A 184 ? 0.5864 0.5724 0.5173 0.0489  0.0595  0.0686  184  VAL A N     
1432 C CA    . VAL A 184 ? 0.6082 0.5956 0.5430 0.0461  0.0584  0.0653  184  VAL A CA    
1433 C C     . VAL A 184 ? 0.5384 0.5364 0.4764 0.0485  0.0585  0.0678  184  VAL A C     
1434 O O     . VAL A 184 ? 0.6159 0.6158 0.5570 0.0463  0.0575  0.0656  184  VAL A O     
1435 C CB    . VAL A 184 ? 0.5729 0.5483 0.4976 0.0466  0.0608  0.0621  184  VAL A CB    
1436 C CG1   . VAL A 184 ? 0.5113 0.4761 0.4295 0.0450  0.0614  0.0609  184  VAL A CG1   
1437 C CG2   . VAL A 184 ? 0.5782 0.5523 0.4932 0.0528  0.0645  0.0643  184  VAL A CG2   
1438 N N     . ASP A 185 ? 0.5879 0.5930 0.5252 0.0528  0.0596  0.0726  185  ASP A N     
1439 C CA    . ASP A 185 ? 0.5677 0.5834 0.5062 0.0561  0.0602  0.0761  185  ASP A CA    
1440 C C     . ASP A 185 ? 0.6414 0.6710 0.5900 0.0541  0.0575  0.0793  185  ASP A C     
1441 O O     . ASP A 185 ? 0.6601 0.7008 0.6110 0.0559  0.0574  0.0829  185  ASP A O     
1442 C CB    . ASP A 185 ? 0.7660 0.7787 0.6936 0.0639  0.0649  0.0802  185  ASP A CB    
1443 C CG    . ASP A 185 ? 0.9025 0.9245 0.8293 0.0682  0.0663  0.0837  185  ASP A CG    
1444 O OD1   . ASP A 185 ? 0.9637 0.9913 0.8962 0.0646  0.0639  0.0819  185  ASP A OD1   
1445 O OD2   . ASP A 185 ? 0.9087 0.9321 0.8287 0.0751  0.0700  0.0886  185  ASP A OD2   
1446 N N     . ASN A 186 ? 0.5817 0.6110 0.5360 0.0503  0.0552  0.0783  186  ASN A N     
1447 C CA    . ASN A 186 ? 0.5722 0.6135 0.5350 0.0483  0.0528  0.0812  186  ASN A CA    
1448 C C     . ASN A 186 ? 0.5621 0.6106 0.5331 0.0421  0.0497  0.0794  186  ASN A C     
1449 O O     . ASN A 186 ? 0.6078 0.6512 0.5785 0.0392  0.0492  0.0756  186  ASN A O     
1450 C CB    . ASN A 186 ? 0.4662 0.5043 0.4310 0.0472  0.0520  0.0811  186  ASN A CB    
1451 C CG    . ASN A 186 ? 0.5523 0.5817 0.5196 0.0419  0.0503  0.0760  186  ASN A CG    
1452 O OD1   . ASN A 186 ? 0.5204 0.5500 0.4919 0.0376  0.0487  0.0729  186  ASN A OD1   
1453 N ND2   . ASN A 186 ? 0.5449 0.5666 0.5094 0.0423  0.0507  0.0755  186  ASN A ND2   
1454 N N     . ALA A 187 ? 0.4983 0.5579 0.4757 0.0400  0.0477  0.0821  187  ALA A N     
1455 C CA    . ALA A 187 ? 0.5342 0.6005 0.5177 0.0337  0.0451  0.0811  187  ALA A CA    
1456 C C     . ALA A 187 ? 0.5478 0.6052 0.5340 0.0280  0.0437  0.0758  187  ALA A C     
1457 O O     . ALA A 187 ? 0.5657 0.6225 0.5533 0.0238  0.0428  0.0736  187  ALA A O     
1458 C CB    . ALA A 187 ? 0.5792 0.6577 0.5679 0.0320  0.0434  0.0849  187  ALA A CB    
1459 N N     . GLY A 188 ? 0.5437 0.5940 0.5305 0.0280  0.0438  0.0741  188  GLY A N     
1460 C CA    . GLY A 188 ? 0.5408 0.5833 0.5305 0.0234  0.0428  0.0698  188  GLY A CA    
1461 C C     . GLY A 188 ? 0.5177 0.5510 0.5038 0.0234  0.0440  0.0664  188  GLY A C     
1462 O O     . GLY A 188 ? 0.5731 0.6030 0.5618 0.0191  0.0433  0.0635  188  GLY A O     
1463 N N     . ALA A 189 ? 0.5132 0.5420 0.4926 0.0282  0.0459  0.0668  189  ALA A N     
1464 C CA    . ALA A 189 ? 0.4935 0.5136 0.4682 0.0286  0.0472  0.0636  189  ALA A CA    
1465 C C     . ALA A 189 ? 0.4483 0.4721 0.4237 0.0269  0.0470  0.0631  189  ALA A C     
1466 O O     . ALA A 189 ? 0.4215 0.4399 0.3979 0.0236  0.0467  0.0598  189  ALA A O     
1467 C CB    . ALA A 189 ? 0.3841 0.3988 0.3499 0.0342  0.0499  0.0647  189  ALA A CB    
1468 N N     . LYS A 190 ? 0.4267 0.4603 0.4017 0.0291  0.0470  0.0669  190  LYS A N     
1469 C CA    . LYS A 190 ? 0.5441 0.5821 0.5191 0.0275  0.0465  0.0670  190  LYS A CA    
1470 C C     . LYS A 190 ? 0.5478 0.5869 0.5285 0.0203  0.0444  0.0652  190  LYS A C     
1471 O O     . LYS A 190 ? 0.5679 0.6033 0.5480 0.0175  0.0443  0.0628  190  LYS A O     
1472 C CB    . LYS A 190 ? 0.4948 0.5450 0.4689 0.0310  0.0467  0.0723  190  LYS A CB    
1473 C CG    . LYS A 190 ? 0.4947 0.5431 0.4614 0.0387  0.0498  0.0746  190  LYS A CG    
1474 C CD    . LYS A 190 ? 0.6336 0.6957 0.6008 0.0424  0.0501  0.0808  190  LYS A CD    
1475 C CE    . LYS A 190 ? 0.7631 0.8231 0.7220 0.0508  0.0540  0.0838  190  LYS A CE    
1476 N NZ    . LYS A 190 ? 0.7700 0.8446 0.7302 0.0549  0.0546  0.0907  190  LYS A NZ    
1477 N N     . ALA A 191 ? 0.5578 0.6011 0.5435 0.0175  0.0429  0.0663  191  ALA A N     
1478 C CA    . ALA A 191 ? 0.5586 0.6020 0.5484 0.0108  0.0414  0.0648  191  ALA A CA    
1479 C C     . ALA A 191 ? 0.5190 0.5505 0.5090 0.0082  0.0422  0.0603  191  ALA A C     
1480 O O     . ALA A 191 ? 0.5512 0.5798 0.5414 0.0038  0.0421  0.0587  191  ALA A O     
1481 C CB    . ALA A 191 ? 0.5966 0.6453 0.5907 0.0088  0.0402  0.0666  191  ALA A CB    
1482 N N     . GLY A 192 ? 0.5378 0.5624 0.5274 0.0109  0.0431  0.0587  192  GLY A N     
1483 C CA    . GLY A 192 ? 0.4735 0.4881 0.4640 0.0088  0.0439  0.0551  192  GLY A CA    
1484 C C     . GLY A 192 ? 0.4880 0.4964 0.4745 0.0095  0.0451  0.0527  192  GLY A C     
1485 O O     . GLY A 192 ? 0.4442 0.4468 0.4316 0.0060  0.0456  0.0503  192  GLY A O     
1486 N N     . LEU A 193 ? 0.4907 0.4996 0.4719 0.0141  0.0460  0.0534  193  LEU A N     
1487 C CA    . LEU A 193 ? 0.4236 0.4266 0.4001 0.0152  0.0473  0.0511  193  LEU A CA    
1488 C C     . LEU A 193 ? 0.4898 0.4960 0.4667 0.0119  0.0467  0.0512  193  LEU A C     
1489 O O     . LEU A 193 ? 0.4298 0.4290 0.4053 0.0099  0.0474  0.0484  193  LEU A O     
1490 C CB    . LEU A 193 ? 0.4314 0.4341 0.4010 0.0211  0.0489  0.0522  193  LEU A CB    
1491 C CG    . LEU A 193 ? 0.4491 0.4442 0.4127 0.0228  0.0506  0.0494  193  LEU A CG    
1492 C CD1   . LEU A 193 ? 0.3906 0.3760 0.3557 0.0195  0.0509  0.0454  193  LEU A CD1   
1493 C CD2   . LEU A 193 ? 0.4541 0.4467 0.4095 0.0288  0.0529  0.0504  193  LEU A CD2   
1494 N N     . THR A 194 ? 0.4960 0.5126 0.4746 0.0110  0.0453  0.0547  194  THR A N     
1495 C CA    . THR A 194 ? 0.4742 0.4948 0.4528 0.0068  0.0443  0.0554  194  THR A CA    
1496 C C     . THR A 194 ? 0.5261 0.5398 0.5071 0.0006  0.0442  0.0529  194  THR A C     
1497 O O     . THR A 194 ? 0.4921 0.5018 0.4711 -0.0028 0.0444  0.0514  194  THR A O     
1498 C CB    . THR A 194 ? 0.5221 0.5562 0.5025 0.0062  0.0426  0.0600  194  THR A CB    
1499 O OG1   . THR A 194 ? 0.5718 0.6124 0.5494 0.0125  0.0433  0.0631  194  THR A OG1   
1500 C CG2   . THR A 194 ? 0.5616 0.5996 0.5415 0.0004  0.0413  0.0608  194  THR A CG2   
1501 N N     . PHE A 195 ? 0.4342 0.4459 0.4191 -0.0008 0.0441  0.0525  195  PHE A N     
1502 C CA    . PHE A 195 ? 0.4346 0.4391 0.4213 -0.0060 0.0447  0.0505  195  PHE A CA    
1503 C C     . PHE A 195 ? 0.5060 0.4991 0.4911 -0.0056 0.0465  0.0469  195  PHE A C     
1504 O O     . PHE A 195 ? 0.5508 0.5376 0.5345 -0.0095 0.0474  0.0454  195  PHE A O     
1505 C CB    . PHE A 195 ? 0.4574 0.4622 0.4484 -0.0069 0.0446  0.0511  195  PHE A CB    
1506 C CG    . PHE A 195 ? 0.4917 0.4900 0.4836 -0.0122 0.0457  0.0499  195  PHE A CG    
1507 C CD1   . PHE A 195 ? 0.5332 0.5345 0.5235 -0.0174 0.0451  0.0514  195  PHE A CD1   
1508 C CD2   . PHE A 195 ? 0.4141 0.4029 0.4075 -0.0121 0.0476  0.0477  195  PHE A CD2   
1509 C CE1   . PHE A 195 ? 0.4933 0.4867 0.4825 -0.0223 0.0468  0.0504  195  PHE A CE1   
1510 C CE2   . PHE A 195 ? 0.3997 0.3817 0.3932 -0.0163 0.0493  0.0472  195  PHE A CE2   
1511 C CZ    . PHE A 195 ? 0.4661 0.4496 0.4569 -0.0214 0.0492  0.0484  195  PHE A CZ    
1512 N N     . LEU A 196 ? 0.4364 0.4266 0.4212 -0.0011 0.0472  0.0458  196  LEU A N     
1513 C CA    . LEU A 196 ? 0.4740 0.4542 0.4572 -0.0004 0.0489  0.0425  196  LEU A CA    
1514 C C     . LEU A 196 ? 0.5279 0.5053 0.5065 -0.0008 0.0494  0.0412  196  LEU A C     
1515 O O     . LEU A 196 ? 0.5256 0.4945 0.5034 -0.0031 0.0507  0.0388  196  LEU A O     
1516 C CB    . LEU A 196 ? 0.4838 0.4628 0.4657 0.0043  0.0492  0.0420  196  LEU A CB    
1517 C CG    . LEU A 196 ? 0.5653 0.5347 0.5456 0.0048  0.0508  0.0388  196  LEU A CG    
1518 C CD1   . LEU A 196 ? 0.4951 0.4614 0.4807 0.0030  0.0511  0.0385  196  LEU A CD1   
1519 C CD2   . LEU A 196 ? 0.6734 0.6414 0.6481 0.0093  0.0514  0.0381  196  LEU A CD2   
1520 N N     . VAL A 197 ? 0.5105 0.4949 0.4859 0.0018  0.0486  0.0430  197  VAL A N     
1521 C CA    . VAL A 197 ? 0.4855 0.4686 0.4562 0.0019  0.0489  0.0422  197  VAL A CA    
1522 C C     . VAL A 197 ? 0.5271 0.5095 0.4980 -0.0042 0.0483  0.0424  197  VAL A C     
1523 O O     . VAL A 197 ? 0.5056 0.4811 0.4734 -0.0058 0.0492  0.0403  197  VAL A O     
1524 C CB    . VAL A 197 ? 0.4278 0.4199 0.3953 0.0066  0.0484  0.0450  197  VAL A CB    
1525 C CG1   . VAL A 197 ? 0.4026 0.3948 0.3657 0.0064  0.0486  0.0447  197  VAL A CG1   
1526 C CG2   . VAL A 197 ? 0.4178 0.4070 0.3824 0.0124  0.0499  0.0443  197  VAL A CG2   
1527 N N     . ASP A 198 ? 0.5565 0.5451 0.5302 -0.0078 0.0470  0.0449  198  ASP A N     
1528 C CA    . ASP A 198 ? 0.4723 0.4591 0.4447 -0.0145 0.0466  0.0452  198  ASP A CA    
1529 C C     . ASP A 198 ? 0.4422 0.4158 0.4147 -0.0177 0.0488  0.0422  198  ASP A C     
1530 O O     . ASP A 198 ? 0.5335 0.5004 0.5024 -0.0220 0.0496  0.0412  198  ASP A O     
1531 C CB    . ASP A 198 ? 0.4433 0.4396 0.4178 -0.0179 0.0449  0.0486  198  ASP A CB    
1532 C CG    . ASP A 198 ? 0.5296 0.5398 0.5036 -0.0158 0.0428  0.0523  198  ASP A CG    
1533 O OD1   . ASP A 198 ? 0.6190 0.6308 0.5903 -0.0123 0.0429  0.0523  198  ASP A OD1   
1534 O OD2   . ASP A 198 ? 0.5650 0.5845 0.5412 -0.0176 0.0413  0.0553  198  ASP A OD2   
1535 N N     . LEU A 199 ? 0.4827 0.4523 0.4590 -0.0155 0.0500  0.0412  199  LEU A N     
1536 C CA    . LEU A 199 ? 0.4877 0.4453 0.4645 -0.0173 0.0524  0.0388  199  LEU A CA    
1537 C C     . LEU A 199 ? 0.5312 0.4808 0.5045 -0.0164 0.0537  0.0360  199  LEU A C     
1538 O O     . LEU A 199 ? 0.4925 0.4322 0.4636 -0.0196 0.0556  0.0346  199  LEU A O     
1539 C CB    . LEU A 199 ? 0.4771 0.4338 0.4590 -0.0142 0.0532  0.0386  199  LEU A CB    
1540 C CG    . LEU A 199 ? 0.4875 0.4485 0.4732 -0.0157 0.0528  0.0408  199  LEU A CG    
1541 C CD1   . LEU A 199 ? 0.5066 0.4680 0.4971 -0.0121 0.0531  0.0407  199  LEU A CD1   
1542 C CD2   . LEU A 199 ? 0.4329 0.3865 0.4173 -0.0208 0.0549  0.0409  199  LEU A CD2   
1543 N N     . ILE A 200 ? 0.5117 0.4648 0.4837 -0.0117 0.0529  0.0354  200  ILE A N     
1544 C CA    . ILE A 200 ? 0.4898 0.4354 0.4579 -0.0102 0.0541  0.0325  200  ILE A CA    
1545 C C     . ILE A 200 ? 0.4764 0.4218 0.4396 -0.0132 0.0536  0.0327  200  ILE A C     
1546 O O     . ILE A 200 ? 0.5143 0.4499 0.4746 -0.0154 0.0551  0.0304  200  ILE A O     
1547 C CB    . ILE A 200 ? 0.4617 0.4100 0.4284 -0.0043 0.0540  0.0317  200  ILE A CB    
1548 C CG1   . ILE A 200 ? 0.4329 0.3792 0.4034 -0.0023 0.0547  0.0311  200  ILE A CG1   
1549 C CG2   . ILE A 200 ? 0.3665 0.3075 0.3279 -0.0027 0.0553  0.0287  200  ILE A CG2   
1550 C CD1   . ILE A 200 ? 0.4587 0.4081 0.4269 0.0028  0.0544  0.0311  200  ILE A CD1   
1551 N N     . LYS A 201 ? 0.4848 0.4413 0.4474 -0.0136 0.0514  0.0357  201  LYS A N     
1552 C CA    . LYS A 201 ? 0.5145 0.4731 0.4728 -0.0170 0.0504  0.0367  201  LYS A CA    
1553 C C     . LYS A 201 ? 0.6088 0.5587 0.5650 -0.0242 0.0512  0.0361  201  LYS A C     
1554 O O     . LYS A 201 ? 0.6413 0.5847 0.5928 -0.0270 0.0517  0.0348  201  LYS A O     
1555 C CB    . LYS A 201 ? 0.5823 0.5560 0.5412 -0.0167 0.0478  0.0410  201  LYS A CB    
1556 C CG    . LYS A 201 ? 0.7221 0.7038 0.6810 -0.0094 0.0475  0.0422  201  LYS A CG    
1557 C CD    . LYS A 201 ? 0.8031 0.8000 0.7623 -0.0092 0.0453  0.0470  201  LYS A CD    
1558 C CE    . LYS A 201 ? 0.7627 0.7659 0.7198 -0.0016 0.0458  0.0485  201  LYS A CE    
1559 N NZ    . LYS A 201 ? 0.7484 0.7675 0.7065 -0.0006 0.0439  0.0539  201  LYS A NZ    
1560 N N     . ASN A 202 ? 0.5757 0.5248 0.5347 -0.0272 0.0517  0.0372  202  ASN A N     
1561 C CA    . ASN A 202 ? 0.5306 0.4702 0.4863 -0.0339 0.0532  0.0370  202  ASN A CA    
1562 C C     . ASN A 202 ? 0.5468 0.4717 0.5026 -0.0333 0.0567  0.0340  202  ASN A C     
1563 O O     . ASN A 202 ? 0.5440 0.4594 0.4976 -0.0377 0.0589  0.0340  202  ASN A O     
1564 C CB    . ASN A 202 ? 0.5384 0.4829 0.4957 -0.0375 0.0527  0.0396  202  ASN A CB    
1565 C CG    . ASN A 202 ? 0.5261 0.4858 0.4837 -0.0384 0.0494  0.0430  202  ASN A CG    
1566 O OD1   . ASN A 202 ? 0.5245 0.4927 0.4861 -0.0370 0.0483  0.0449  202  ASN A OD1   
1567 N ND2   . ASN A 202 ? 0.4906 0.4541 0.4440 -0.0407 0.0477  0.0439  202  ASN A ND2   
1568 N N     . LYS A 203 ? 0.5346 0.4576 0.4927 -0.0277 0.0573  0.0317  203  LYS A N     
1569 C CA    . LYS A 203 ? 0.5566 0.4668 0.5150 -0.0267 0.0604  0.0289  203  LYS A CA    
1570 C C     . LYS A 203 ? 0.5270 0.4333 0.4900 -0.0268 0.0626  0.0297  203  LYS A C     
1571 O O     . LYS A 203 ? 0.6205 0.5157 0.5834 -0.0271 0.0656  0.0284  203  LYS A O     
1572 C CB    . LYS A 203 ? 0.5732 0.4716 0.5253 -0.0311 0.0621  0.0275  203  LYS A CB    
1573 C CG    . LYS A 203 ? 0.6723 0.5693 0.6209 -0.0290 0.0614  0.0252  203  LYS A CG    
1574 C CD    . LYS A 203 ? 0.6913 0.6014 0.6385 -0.0281 0.0580  0.0270  203  LYS A CD    
1575 C CE    . LYS A 203 ? 0.7255 0.6334 0.6683 -0.0257 0.0578  0.0248  203  LYS A CE    
1576 N NZ    . LYS A 203 ? 0.7411 0.6376 0.6780 -0.0309 0.0590  0.0235  203  LYS A NZ    
1577 N N     . HIS A 204 ? 0.4962 0.4116 0.4632 -0.0261 0.0612  0.0320  204  HIS A N     
1578 C CA    . HIS A 204 ? 0.4937 0.4067 0.4655 -0.0251 0.0631  0.0328  204  HIS A CA    
1579 C C     . HIS A 204 ? 0.5772 0.4909 0.5537 -0.0199 0.0633  0.0314  204  HIS A C     
1580 O O     . HIS A 204 ? 0.5981 0.5075 0.5785 -0.0189 0.0655  0.0317  204  HIS A O     
1581 C CB    . HIS A 204 ? 0.4323 0.3539 0.4063 -0.0264 0.0617  0.0356  204  HIS A CB    
1582 C CG    . HIS A 204 ? 0.4526 0.3742 0.4212 -0.0323 0.0612  0.0370  204  HIS A CG    
1583 N ND1   . HIS A 204 ? 0.5002 0.4100 0.4633 -0.0372 0.0642  0.0369  204  HIS A ND1   
1584 C CD2   . HIS A 204 ? 0.5013 0.4333 0.4686 -0.0343 0.0583  0.0389  204  HIS A CD2   
1585 C CE1   . HIS A 204 ? 0.5006 0.4131 0.4586 -0.0426 0.0629  0.0384  204  HIS A CE1   
1586 N NE2   . HIS A 204 ? 0.5586 0.4852 0.5195 -0.0409 0.0592  0.0398  204  HIS A NE2   
1587 N N     . MET A 205 ? 0.5050 0.4240 0.4806 -0.0166 0.0612  0.0302  205  MET A N     
1588 C CA    . MET A 205 ? 0.4729 0.3910 0.4505 -0.0124 0.0615  0.0285  205  MET A CA    
1589 C C     . MET A 205 ? 0.5175 0.4337 0.4901 -0.0106 0.0610  0.0260  205  MET A C     
1590 O O     . MET A 205 ? 0.5010 0.4190 0.4694 -0.0119 0.0600  0.0261  205  MET A O     
1591 C CB    . MET A 205 ? 0.4558 0.3834 0.4373 -0.0094 0.0596  0.0300  205  MET A CB    
1592 C CG    . MET A 205 ? 0.5054 0.4351 0.4924 -0.0104 0.0601  0.0324  205  MET A CG    
1593 S SD    . MET A 205 ? 0.5319 0.4706 0.5231 -0.0068 0.0581  0.0338  205  MET A SD    
1594 C CE    . MET A 205 ? 0.3691 0.3169 0.3565 -0.0053 0.0553  0.0346  205  MET A CE    
1595 N N     . ASN A 206 ? 0.5485 0.4614 0.5211 -0.0076 0.0618  0.0239  206  ASN A N     
1596 C CA    . ASN A 206 ? 0.5577 0.4675 0.5246 -0.0054 0.0619  0.0212  206  ASN A CA    
1597 C C     . ASN A 206 ? 0.5008 0.4156 0.4664 -0.0012 0.0609  0.0209  206  ASN A C     
1598 O O     . ASN A 206 ? 0.5049 0.4199 0.4736 -0.0003 0.0611  0.0211  206  ASN A O     
1599 C CB    . ASN A 206 ? 0.4424 0.3405 0.4081 -0.0062 0.0644  0.0183  206  ASN A CB    
1600 C CG    . ASN A 206 ? 0.5619 0.4555 0.5210 -0.0043 0.0648  0.0152  206  ASN A CG    
1601 O OD1   . ASN A 206 ? 0.4966 0.3909 0.4533 -0.0010 0.0647  0.0137  206  ASN A OD1   
1602 N ND2   . ASN A 206 ? 0.4708 0.3591 0.4262 -0.0065 0.0653  0.0142  206  ASN A ND2   
1603 N N     . ALA A 207 ? 0.4539 0.3724 0.4142 0.0013  0.0600  0.0208  207  ALA A N     
1604 C CA    . ALA A 207 ? 0.4692 0.3912 0.4260 0.0056  0.0596  0.0209  207  ALA A CA    
1605 C C     . ALA A 207 ? 0.5692 0.4843 0.5241 0.0068  0.0611  0.0182  207  ALA A C     
1606 O O     . ALA A 207 ? 0.5053 0.4228 0.4589 0.0088  0.0608  0.0188  207  ALA A O     
1607 C CB    . ALA A 207 ? 0.3779 0.3025 0.3281 0.0085  0.0595  0.0209  207  ALA A CB    
1608 N N     . ASP A 208 ? 0.5158 0.4220 0.4702 0.0052  0.0627  0.0153  208  ASP A N     
1609 C CA    . ASP A 208 ? 0.4423 0.3418 0.3937 0.0062  0.0641  0.0126  208  ASP A CA    
1610 C C     . ASP A 208 ? 0.4700 0.3689 0.4283 0.0040  0.0644  0.0134  208  ASP A C     
1611 O O     . ASP A 208 ? 0.5418 0.4363 0.4985 0.0040  0.0654  0.0116  208  ASP A O     
1612 C CB    . ASP A 208 ? 0.4664 0.3565 0.4128 0.0062  0.0660  0.0089  208  ASP A CB    
1613 C CG    . ASP A 208 ? 0.5748 0.4654 0.5134 0.0091  0.0660  0.0081  208  ASP A CG    
1614 O OD1   . ASP A 208 ? 0.6181 0.5102 0.5507 0.0124  0.0662  0.0081  208  ASP A OD1   
1615 O OD2   . ASP A 208 ? 0.7074 0.5964 0.6453 0.0080  0.0660  0.0078  208  ASP A OD2   
1616 N N     . THR A 209 ? 0.4615 0.3651 0.4270 0.0020  0.0637  0.0162  209  THR A N     
1617 C CA    . THR A 209 ? 0.5287 0.4329 0.5012 0.0005  0.0641  0.0177  209  THR A CA    
1618 C C     . THR A 209 ? 0.4711 0.3796 0.4430 0.0016  0.0629  0.0185  209  THR A C     
1619 O O     . THR A 209 ? 0.4413 0.3556 0.4112 0.0030  0.0613  0.0199  209  THR A O     
1620 C CB    . THR A 209 ? 0.4913 0.4000 0.4703 -0.0013 0.0636  0.0209  209  THR A CB    
1621 O OG1   . THR A 209 ? 0.5137 0.4164 0.4925 -0.0033 0.0652  0.0203  209  THR A OG1   
1622 C CG2   . THR A 209 ? 0.4764 0.3876 0.4625 -0.0021 0.0640  0.0232  209  THR A CG2   
1623 N N     . ASP A 210 ? 0.3968 0.3022 0.3700 0.0006  0.0637  0.0177  210  ASP A N     
1624 C CA    . ASP A 210 ? 0.3918 0.3005 0.3636 0.0006  0.0626  0.0185  210  ASP A CA    
1625 C C     . ASP A 210 ? 0.5158 0.4288 0.4966 -0.0013 0.0623  0.0215  210  ASP A C     
1626 O O     . ASP A 210 ? 0.5610 0.4749 0.5488 -0.0020 0.0632  0.0233  210  ASP A O     
1627 C CB    . ASP A 210 ? 0.4387 0.3407 0.4023 0.0009  0.0636  0.0152  210  ASP A CB    
1628 C CG    . ASP A 210 ? 0.5218 0.4175 0.4876 -0.0007 0.0656  0.0134  210  ASP A CG    
1629 O OD1   . ASP A 210 ? 0.5406 0.4377 0.5150 -0.0019 0.0662  0.0154  210  ASP A OD1   
1630 O OD2   . ASP A 210 ? 0.5943 0.4832 0.5529 -0.0005 0.0668  0.0100  210  ASP A OD2   
1631 N N     . TYR A 211 ? 0.5071 0.4225 0.4870 -0.0023 0.0614  0.0222  211  TYR A N     
1632 C CA    . TYR A 211 ? 0.4212 0.3423 0.4095 -0.0041 0.0608  0.0257  211  TYR A CA    
1633 C C     . TYR A 211 ? 0.5125 0.4309 0.5071 -0.0051 0.0630  0.0261  211  TYR A C     
1634 O O     . TYR A 211 ? 0.5594 0.4811 0.5623 -0.0052 0.0637  0.0291  211  TYR A O     
1635 C CB    . TYR A 211 ? 0.4106 0.3344 0.3953 -0.0057 0.0591  0.0264  211  TYR A CB    
1636 C CG    . TYR A 211 ? 0.4575 0.3893 0.4510 -0.0074 0.0579  0.0306  211  TYR A CG    
1637 C CD1   . TYR A 211 ? 0.4559 0.3891 0.4558 -0.0091 0.0589  0.0322  211  TYR A CD1   
1638 C CD2   . TYR A 211 ? 0.4581 0.3962 0.4537 -0.0071 0.0559  0.0333  211  TYR A CD2   
1639 C CE1   . TYR A 211 ? 0.5012 0.4425 0.5094 -0.0104 0.0579  0.0366  211  TYR A CE1   
1640 C CE2   . TYR A 211 ? 0.4012 0.3466 0.4048 -0.0085 0.0548  0.0372  211  TYR A CE2   
1641 C CZ    . TYR A 211 ? 0.4864 0.4337 0.4963 -0.0101 0.0558  0.0390  211  TYR A CZ    
1642 O OH    . TYR A 211 ? 0.4623 0.4178 0.4804 -0.0112 0.0549  0.0435  211  TYR A OH    
1643 N N     . SER A 212 ? 0.4591 0.3709 0.4492 -0.0057 0.0643  0.0231  212  SER A N     
1644 C CA    . SER A 212 ? 0.4937 0.4022 0.4890 -0.0065 0.0667  0.0234  212  SER A CA    
1645 C C     . SER A 212 ? 0.4391 0.3435 0.4381 -0.0054 0.0689  0.0237  212  SER A C     
1646 O O     . SER A 212 ? 0.5088 0.4137 0.5152 -0.0055 0.0709  0.0265  212  SER A O     
1647 C CB    . SER A 212 ? 0.5421 0.4429 0.5303 -0.0071 0.0679  0.0194  212  SER A CB    
1648 O OG    . SER A 212 ? 0.7442 0.6481 0.7297 -0.0093 0.0665  0.0197  212  SER A OG    
1649 N N     . ILE A 213 ? 0.4339 0.3339 0.4270 -0.0043 0.0689  0.0211  213  ILE A N     
1650 C CA    . ILE A 213 ? 0.4395 0.3344 0.4339 -0.0041 0.0708  0.0211  213  ILE A CA    
1651 C C     . ILE A 213 ? 0.4965 0.3968 0.4976 -0.0043 0.0708  0.0251  213  ILE A C     
1652 O O     . ILE A 213 ? 0.5207 0.4176 0.5261 -0.0046 0.0735  0.0270  213  ILE A O     
1653 C CB    . ILE A 213 ? 0.4799 0.3706 0.4664 -0.0034 0.0702  0.0178  213  ILE A CB    
1654 C CG1   . ILE A 213 ? 0.5201 0.4029 0.5000 -0.0031 0.0713  0.0137  213  ILE A CG1   
1655 C CG2   . ILE A 213 ? 0.4770 0.3640 0.4645 -0.0042 0.0716  0.0185  213  ILE A CG2   
1656 C CD1   . ILE A 213 ? 0.4602 0.3402 0.4315 -0.0018 0.0705  0.0107  213  ILE A CD1   
1657 N N     . ALA A 214 ? 0.4398 0.3480 0.4412 -0.0039 0.0681  0.0266  214  ALA A N     
1658 C CA    . ALA A 214 ? 0.4143 0.3277 0.4215 -0.0041 0.0681  0.0302  214  ALA A CA    
1659 C C     . ALA A 214 ? 0.4177 0.3340 0.4329 -0.0042 0.0696  0.0338  214  ALA A C     
1660 O O     . ALA A 214 ? 0.4579 0.3731 0.4774 -0.0041 0.0719  0.0364  214  ALA A O     
1661 C CB    . ALA A 214 ? 0.3826 0.3037 0.3885 -0.0035 0.0649  0.0310  214  ALA A CB    
1662 N N     . GLU A 215 ? 0.4555 0.3753 0.4719 -0.0045 0.0685  0.0341  215  GLU A N     
1663 C CA    . GLU A 215 ? 0.4897 0.4142 0.5142 -0.0046 0.0697  0.0381  215  GLU A CA    
1664 C C     . GLU A 215 ? 0.4981 0.4161 0.5260 -0.0041 0.0739  0.0391  215  GLU A C     
1665 O O     . GLU A 215 ? 0.4535 0.3735 0.4878 -0.0033 0.0762  0.0432  215  GLU A O     
1666 C CB    . GLU A 215 ? 0.4518 0.3814 0.4761 -0.0059 0.0675  0.0383  215  GLU A CB    
1667 C CG    . GLU A 215 ? 0.4505 0.3872 0.4838 -0.0063 0.0683  0.0432  215  GLU A CG    
1668 C CD    . GLU A 215 ? 0.5448 0.4873 0.5772 -0.0087 0.0657  0.0436  215  GLU A CD    
1669 O OE1   . GLU A 215 ? 0.5567 0.4943 0.5818 -0.0099 0.0651  0.0398  215  GLU A OE1   
1670 O OE2   . GLU A 215 ? 0.5484 0.4999 0.5865 -0.0095 0.0643  0.0478  215  GLU A OE2   
1671 N N     . ALA A 216 ? 0.3720 0.2818 0.3951 -0.0045 0.0752  0.0356  216  ALA A N     
1672 C CA    . ALA A 216 ? 0.4820 0.3842 0.5073 -0.0040 0.0794  0.0363  216  ALA A CA    
1673 C C     . ALA A 216 ? 0.5014 0.3974 0.5263 -0.0034 0.0822  0.0374  216  ALA A C     
1674 O O     . ALA A 216 ? 0.5318 0.4248 0.5609 -0.0025 0.0861  0.0408  216  ALA A O     
1675 C CB    . ALA A 216 ? 0.4356 0.3295 0.4548 -0.0045 0.0800  0.0317  216  ALA A CB    
1676 N N     . ALA A 217 ? 0.5125 0.4065 0.5315 -0.0041 0.0805  0.0349  217  ALA A N     
1677 C CA    . ALA A 217 ? 0.4226 0.3111 0.4398 -0.0046 0.0827  0.0358  217  ALA A CA    
1678 C C     . ALA A 217 ? 0.4803 0.3741 0.5035 -0.0038 0.0840  0.0407  217  ALA A C     
1679 O O     . ALA A 217 ? 0.5098 0.3973 0.5339 -0.0035 0.0882  0.0432  217  ALA A O     
1680 C CB    . ALA A 217 ? 0.3675 0.2561 0.3781 -0.0058 0.0798  0.0328  217  ALA A CB    
1681 N N     . PHE A 218 ? 0.4661 0.3709 0.4928 -0.0034 0.0806  0.0421  218  PHE A N     
1682 C CA    . PHE A 218 ? 0.5232 0.4332 0.5555 -0.0024 0.0818  0.0467  218  PHE A CA    
1683 C C     . PHE A 218 ? 0.5486 0.4596 0.5879 -0.0007 0.0851  0.0508  218  PHE A C     
1684 O O     . PHE A 218 ? 0.4953 0.4037 0.5370 0.0005  0.0891  0.0545  218  PHE A O     
1685 C CB    . PHE A 218 ? 0.5273 0.4483 0.5617 -0.0024 0.0775  0.0475  218  PHE A CB    
1686 C CG    . PHE A 218 ? 0.4997 0.4252 0.5390 -0.0014 0.0788  0.0518  218  PHE A CG    
1687 C CD1   . PHE A 218 ? 0.4547 0.3776 0.4906 -0.0021 0.0794  0.0518  218  PHE A CD1   
1688 C CD2   . PHE A 218 ? 0.4761 0.4082 0.5229 0.0001  0.0797  0.0561  218  PHE A CD2   
1689 C CE1   . PHE A 218 ? 0.4336 0.3597 0.4731 -0.0012 0.0810  0.0556  218  PHE A CE1   
1690 C CE2   . PHE A 218 ? 0.4924 0.4283 0.5434 0.0014  0.0812  0.0602  218  PHE A CE2   
1691 C CZ    . PHE A 218 ? 0.3921 0.3244 0.4391 0.0009  0.0820  0.0597  218  PHE A CZ    
1692 N N     . ASN A 219 ? 0.4868 0.4015 0.5287 -0.0007 0.0839  0.0504  219  ASN A N     
1693 C CA    . ASN A 219 ? 0.5394 0.4577 0.5888 0.0008  0.0866  0.0550  219  ASN A CA    
1694 C C     . ASN A 219 ? 0.6341 0.5414 0.6830 0.0020  0.0923  0.0559  219  ASN A C     
1695 O O     . ASN A 219 ? 0.6504 0.5596 0.7055 0.0040  0.0958  0.0606  219  ASN A O     
1696 C CB    . ASN A 219 ? 0.4784 0.4051 0.5306 -0.0003 0.0832  0.0547  219  ASN A CB    
1697 C CG    . ASN A 219 ? 0.4773 0.4145 0.5301 -0.0014 0.0783  0.0550  219  ASN A CG    
1698 O OD1   . ASN A 219 ? 0.5195 0.4634 0.5734 -0.0029 0.0754  0.0552  219  ASN A OD1   
1699 N ND2   . ASN A 219 ? 0.4353 0.3734 0.4868 -0.0010 0.0774  0.0551  219  ASN A ND2   
1700 N N     . LYS A 220 ? 0.6416 0.5373 0.6827 0.0009  0.0934  0.0518  220  LYS A N     
1701 C CA    . LYS A 220 ? 0.6298 0.5130 0.6688 0.0017  0.0990  0.0524  220  LYS A CA    
1702 C C     . LYS A 220 ? 0.6213 0.4956 0.6556 0.0015  0.1026  0.0536  220  LYS A C     
1703 O O     . LYS A 220 ? 0.6721 0.5338 0.7025 0.0017  0.1076  0.0540  220  LYS A O     
1704 C CB    . LYS A 220 ? 0.5395 0.4143 0.5725 0.0002  0.0984  0.0471  220  LYS A CB    
1705 C CG    . LYS A 220 ? 0.5541 0.4342 0.5909 0.0004  0.0969  0.0464  220  LYS A CG    
1706 C CD    . LYS A 220 ? 0.6227 0.4986 0.6524 -0.0015 0.0939  0.0402  220  LYS A CD    
1707 C CE    . LYS A 220 ? 0.6826 0.5457 0.7086 -0.0014 0.0976  0.0379  220  LYS A CE    
1708 N NZ    . LYS A 220 ? 0.6985 0.5585 0.7178 -0.0029 0.0946  0.0319  220  LYS A NZ    
1709 N N     . GLY A 221 ? 0.5439 0.4240 0.5777 0.0008  0.1001  0.0540  221  GLY A N     
1710 C CA    . GLY A 221 ? 0.5152 0.3878 0.5441 0.0002  0.1033  0.0554  221  GLY A CA    
1711 C C     . GLY A 221 ? 0.5132 0.3756 0.5323 -0.0031 0.1028  0.0510  221  GLY A C     
1712 O O     . GLY A 221 ? 0.5818 0.4331 0.5947 -0.0044 0.1069  0.0519  221  GLY A O     
1713 N N     . GLU A 222 ? 0.4823 0.3481 0.4991 -0.0047 0.0979  0.0465  222  GLU A N     
1714 C CA    . GLU A 222 ? 0.5413 0.3989 0.5492 -0.0077 0.0971  0.0426  222  GLU A CA    
1715 C C     . GLU A 222 ? 0.5561 0.4199 0.5612 -0.0097 0.0933  0.0417  222  GLU A C     
1716 O O     . GLU A 222 ? 0.5353 0.3926 0.5329 -0.0128 0.0935  0.0402  222  GLU A O     
1717 C CB    . GLU A 222 ? 0.4745 0.3313 0.4807 -0.0079 0.0946  0.0382  222  GLU A CB    
1718 C CG    . GLU A 222 ? 0.5626 0.4143 0.5719 -0.0061 0.0978  0.0388  222  GLU A CG    
1719 C CD    . GLU A 222 ? 0.5453 0.3960 0.5522 -0.0063 0.0953  0.0342  222  GLU A CD    
1720 O OE1   . GLU A 222 ? 0.5777 0.4250 0.5870 -0.0051 0.0975  0.0342  222  GLU A OE1   
1721 O OE2   . GLU A 222 ? 0.5464 0.3997 0.5487 -0.0076 0.0914  0.0308  222  GLU A OE2   
1722 N N     . THR A 223 ? 0.4960 0.3724 0.5067 -0.0083 0.0899  0.0429  223  THR A N     
1723 C CA    . THR A 223 ? 0.5153 0.3984 0.5240 -0.0098 0.0864  0.0425  223  THR A CA    
1724 C C     . THR A 223 ? 0.4991 0.3888 0.5131 -0.0084 0.0871  0.0464  223  THR A C     
1725 O O     . THR A 223 ? 0.5326 0.4264 0.5533 -0.0058 0.0882  0.0490  223  THR A O     
1726 C CB    . THR A 223 ? 0.4617 0.3535 0.4703 -0.0095 0.0810  0.0394  223  THR A CB    
1727 O OG1   . THR A 223 ? 0.4424 0.3397 0.4483 -0.0110 0.0781  0.0393  223  THR A OG1   
1728 C CG2   . THR A 223 ? 0.3684 0.2694 0.3838 -0.0069 0.0790  0.0405  223  THR A CG2   
1729 N N     . ALA A 224 ? 0.5260 0.4167 0.5368 -0.0102 0.0865  0.0470  224  ALA A N     
1730 C CA    . ALA A 224 ? 0.5364 0.4313 0.5508 -0.0091 0.0878  0.0506  224  ALA A CA    
1731 C C     . ALA A 224 ? 0.5796 0.4882 0.6004 -0.0073 0.0833  0.0511  224  ALA A C     
1732 O O     . ALA A 224 ? 0.5892 0.5026 0.6151 -0.0054 0.0841  0.0544  224  ALA A O     
1733 C CB    . ALA A 224 ? 0.4809 0.3705 0.4883 -0.0122 0.0894  0.0509  224  ALA A CB    
1734 N N     . MET A 225 ? 0.5052 0.4194 0.5250 -0.0077 0.0787  0.0482  225  MET A N     
1735 C CA    . MET A 225 ? 0.5268 0.4524 0.5508 -0.0064 0.0745  0.0486  225  MET A CA    
1736 C C     . MET A 225 ? 0.5206 0.4496 0.5443 -0.0056 0.0712  0.0460  225  MET A C     
1737 O O     . MET A 225 ? 0.5270 0.4509 0.5460 -0.0065 0.0711  0.0431  225  MET A O     
1738 C CB    . MET A 225 ? 0.4713 0.4011 0.4924 -0.0078 0.0721  0.0483  225  MET A CB    
1739 C CG    . MET A 225 ? 0.4746 0.4015 0.4950 -0.0088 0.0750  0.0507  225  MET A CG    
1740 S SD    . MET A 225 ? 0.5118 0.4447 0.5287 -0.0109 0.0718  0.0502  225  MET A SD    
1741 C CE    . MET A 225 ? 0.5196 0.4461 0.5281 -0.0146 0.0718  0.0474  225  MET A CE    
1742 N N     . THR A 226 ? 0.5153 0.4524 0.5433 -0.0042 0.0687  0.0471  226  THR A N     
1743 C CA    . THR A 226 ? 0.4476 0.3880 0.4736 -0.0038 0.0655  0.0448  226  THR A CA    
1744 C C     . THR A 226 ? 0.5753 0.5245 0.6032 -0.0032 0.0623  0.0462  226  THR A C     
1745 O O     . THR A 226 ? 0.5897 0.5426 0.6217 -0.0029 0.0626  0.0489  226  THR A O     
1746 C CB    . THR A 226 ? 0.3849 0.3237 0.4133 -0.0034 0.0665  0.0447  226  THR A CB    
1747 O OG1   . THR A 226 ? 0.4809 0.4208 0.5050 -0.0034 0.0639  0.0420  226  THR A OG1   
1748 C CG2   . THR A 226 ? 0.3759 0.3207 0.4117 -0.0026 0.0669  0.0487  226  THR A CG2   
1749 N N     . ILE A 227 ? 0.4904 0.4419 0.5144 -0.0029 0.0595  0.0443  227  ILE A N     
1750 C CA    . ILE A 227 ? 0.4663 0.4248 0.4909 -0.0023 0.0566  0.0455  227  ILE A CA    
1751 C C     . ILE A 227 ? 0.4555 0.4149 0.4794 -0.0025 0.0554  0.0452  227  ILE A C     
1752 O O     . ILE A 227 ? 0.4657 0.4209 0.4846 -0.0026 0.0556  0.0426  227  ILE A O     
1753 C CB    . ILE A 227 ? 0.4522 0.4122 0.4712 -0.0017 0.0547  0.0440  227  ILE A CB    
1754 C CG1   . ILE A 227 ? 0.4393 0.3993 0.4587 -0.0024 0.0555  0.0446  227  ILE A CG1   
1755 C CG2   . ILE A 227 ? 0.3708 0.3363 0.3892 -0.0010 0.0520  0.0452  227  ILE A CG2   
1756 C CD1   . ILE A 227 ? 0.3398 0.3026 0.3543 -0.0019 0.0536  0.0437  227  ILE A CD1   
1757 N N     . ASN A 228 ? 0.4419 0.4067 0.4704 -0.0029 0.0543  0.0480  228  ASN A N     
1758 C CA    . ASN A 228 ? 0.4065 0.3727 0.4344 -0.0040 0.0532  0.0483  228  ASN A CA    
1759 C C     . ASN A 228 ? 0.4631 0.4365 0.4952 -0.0048 0.0512  0.0517  228  ASN A C     
1760 O O     . ASN A 228 ? 0.4546 0.4316 0.4908 -0.0039 0.0511  0.0538  228  ASN A O     
1761 C CB    . ASN A 228 ? 0.3521 0.3151 0.3829 -0.0046 0.0556  0.0483  228  ASN A CB    
1762 C CG    . ASN A 228 ? 0.5002 0.4600 0.5252 -0.0059 0.0549  0.0458  228  ASN A CG    
1763 O OD1   . ASN A 228 ? 0.4533 0.4151 0.4739 -0.0071 0.0526  0.0457  228  ASN A OD1   
1764 N ND2   . ASN A 228 ? 0.4591 0.4130 0.4831 -0.0059 0.0571  0.0438  228  ASN A ND2   
1765 N N     . GLY A 229 ? 0.5051 0.4801 0.5353 -0.0066 0.0496  0.0522  229  GLY A N     
1766 C CA    . GLY A 229 ? 0.4968 0.4785 0.5302 -0.0081 0.0474  0.0556  229  GLY A CA    
1767 C C     . GLY A 229 ? 0.5186 0.5054 0.5600 -0.0093 0.0481  0.0591  229  GLY A C     
1768 O O     . GLY A 229 ? 0.4895 0.4742 0.5340 -0.0088 0.0506  0.0590  229  GLY A O     
1769 N N     . PRO A 230 ? 0.5245 0.5184 0.5693 -0.0109 0.0460  0.0627  230  PRO A N     
1770 C CA    . PRO A 230 ? 0.5104 0.5117 0.5639 -0.0118 0.0464  0.0673  230  PRO A CA    
1771 C C     . PRO A 230 ? 0.4845 0.4852 0.5377 -0.0138 0.0472  0.0671  230  PRO A C     
1772 O O     . PRO A 230 ? 0.4767 0.4813 0.5378 -0.0131 0.0492  0.0703  230  PRO A O     
1773 C CB    . PRO A 230 ? 0.4423 0.4501 0.4958 -0.0142 0.0430  0.0701  230  PRO A CB    
1774 C CG    . PRO A 230 ? 0.4138 0.4178 0.4613 -0.0130 0.0417  0.0676  230  PRO A CG    
1775 C CD    . PRO A 230 ? 0.4930 0.4882 0.5328 -0.0120 0.0430  0.0628  230  PRO A CD    
1776 N N     . TRP A 231 ? 0.4022 0.3977 0.4460 -0.0162 0.0458  0.0636  231  TRP A N     
1777 C CA    . TRP A 231 ? 0.3321 0.3264 0.3741 -0.0187 0.0463  0.0630  231  TRP A CA    
1778 C C     . TRP A 231 ? 0.5073 0.4977 0.5536 -0.0161 0.0500  0.0619  231  TRP A C     
1779 O O     . TRP A 231 ? 0.5467 0.5381 0.5953 -0.0175 0.0511  0.0629  231  TRP A O     
1780 C CB    . TRP A 231 ? 0.3838 0.3707 0.4128 -0.0210 0.0449  0.0586  231  TRP A CB    
1781 C CG    . TRP A 231 ? 0.5361 0.5144 0.5588 -0.0178 0.0463  0.0541  231  TRP A CG    
1782 C CD1   . TRP A 231 ? 0.5120 0.4837 0.5332 -0.0158 0.0488  0.0508  231  TRP A CD1   
1783 C CD2   . TRP A 231 ? 0.5758 0.5520 0.5934 -0.0162 0.0451  0.0528  231  TRP A CD2   
1784 N NE1   . TRP A 231 ? 0.5019 0.4682 0.5174 -0.0133 0.0492  0.0477  231  TRP A NE1   
1785 C CE2   . TRP A 231 ? 0.4451 0.4142 0.4584 -0.0133 0.0470  0.0490  231  TRP A CE2   
1786 C CE3   . TRP A 231 ? 0.5666 0.5460 0.5825 -0.0169 0.0428  0.0547  231  TRP A CE3   
1787 C CZ2   . TRP A 231 ? 0.4414 0.4080 0.4496 -0.0111 0.0466  0.0474  231  TRP A CZ2   
1788 C CZ3   . TRP A 231 ? 0.5328 0.5086 0.5433 -0.0145 0.0426  0.0528  231  TRP A CZ3   
1789 C CH2   . TRP A 231 ? 0.5363 0.5063 0.5432 -0.0116 0.0445  0.0494  231  TRP A CH2   
1790 N N     . ALA A 232 ? 0.3965 0.3820 0.4433 -0.0126 0.0521  0.0602  232  ALA A N     
1791 C CA    . ALA A 232 ? 0.5149 0.4945 0.5637 -0.0104 0.0558  0.0587  232  ALA A CA    
1792 C C     . ALA A 232 ? 0.5627 0.5463 0.6218 -0.0084 0.0588  0.0634  232  ALA A C     
1793 O O     . ALA A 232 ? 0.5474 0.5262 0.6083 -0.0071 0.0622  0.0632  232  ALA A O     
1794 C CB    . ALA A 232 ? 0.5469 0.5189 0.5901 -0.0084 0.0566  0.0548  232  ALA A CB    
1795 N N     . TRP A 233 ? 0.5188 0.5105 0.5839 -0.0079 0.0579  0.0678  233  TRP A N     
1796 C CA    . TRP A 233 ? 0.5087 0.5039 0.5828 -0.0052 0.0613  0.0727  233  TRP A CA    
1797 C C     . TRP A 233 ? 0.5422 0.5408 0.6221 -0.0054 0.0634  0.0760  233  TRP A C     
1798 O O     . TRP A 233 ? 0.6218 0.6178 0.7061 -0.0026 0.0679  0.0783  233  TRP A O     
1799 C CB    . TRP A 233 ? 0.5367 0.5409 0.6158 -0.0049 0.0596  0.0769  233  TRP A CB    
1800 C CG    . TRP A 233 ? 0.5381 0.5398 0.6123 -0.0045 0.0576  0.0742  233  TRP A CG    
1801 C CD1   . TRP A 233 ? 0.4930 0.4862 0.5612 -0.0035 0.0585  0.0698  233  TRP A CD1   
1802 C CD2   . TRP A 233 ? 0.5284 0.5366 0.6036 -0.0053 0.0544  0.0761  233  TRP A CD2   
1803 N NE1   . TRP A 233 ? 0.3892 0.3838 0.4548 -0.0035 0.0561  0.0689  233  TRP A NE1   
1804 C CE2   . TRP A 233 ? 0.4609 0.4641 0.5306 -0.0045 0.0537  0.0726  233  TRP A CE2   
1805 C CE3   . TRP A 233 ? 0.4792 0.4973 0.5593 -0.0068 0.0521  0.0805  233  TRP A CE3   
1806 C CZ2   . TRP A 233 ? 0.4379 0.4448 0.5068 -0.0048 0.0510  0.0732  233  TRP A CZ2   
1807 C CZ3   . TRP A 233 ? 0.4601 0.4814 0.5390 -0.0073 0.0493  0.0810  233  TRP A CZ3   
1808 C CH2   . TRP A 233 ? 0.4962 0.5116 0.5695 -0.0062 0.0488  0.0773  233  TRP A CH2   
1809 N N     . SER A 234 ? 0.4601 0.4641 0.5391 -0.0090 0.0604  0.0764  234  SER A N     
1810 C CA    . SER A 234 ? 0.5305 0.5395 0.6150 -0.0099 0.0618  0.0799  234  SER A CA    
1811 C C     . SER A 234 ? 0.5680 0.5677 0.6518 -0.0079 0.0661  0.0778  234  SER A C     
1812 O O     . SER A 234 ? 0.5419 0.5440 0.6330 -0.0056 0.0699  0.0822  234  SER A O     
1813 C CB    . SER A 234 ? 0.6141 0.6275 0.6941 -0.0152 0.0575  0.0790  234  SER A CB    
1814 O OG    . SER A 234 ? 0.7400 0.7580 0.8245 -0.0167 0.0587  0.0818  234  SER A OG    
1815 N N     . ASN A 235 ? 0.5217 0.5108 0.5966 -0.0085 0.0659  0.0714  235  ASN A N     
1816 C CA    . ASN A 235 ? 0.4950 0.4742 0.5683 -0.0068 0.0699  0.0689  235  ASN A CA    
1817 C C     . ASN A 235 ? 0.5488 0.5222 0.6249 -0.0029 0.0744  0.0704  235  ASN A C     
1818 O O     . ASN A 235 ? 0.5341 0.5024 0.6127 -0.0009 0.0788  0.0718  235  ASN A O     
1819 C CB    . ASN A 235 ? 0.4647 0.4343 0.5273 -0.0085 0.0684  0.0618  235  ASN A CB    
1820 C CG    . ASN A 235 ? 0.5303 0.5026 0.5888 -0.0124 0.0655  0.0603  235  ASN A CG    
1821 O OD1   . ASN A 235 ? 0.5679 0.5490 0.6321 -0.0143 0.0649  0.0646  235  ASN A OD1   
1822 N ND2   . ASN A 235 ? 0.5326 0.4974 0.5808 -0.0139 0.0639  0.0545  235  ASN A ND2   
1823 N N     . ILE A 236 ? 0.4445 0.4180 0.5194 -0.0018 0.0735  0.0702  236  ILE A N     
1824 C CA    . ILE A 236 ? 0.5230 0.4908 0.5993 0.0013  0.0779  0.0718  236  ILE A CA    
1825 C C     . ILE A 236 ? 0.5928 0.5669 0.6784 0.0040  0.0815  0.0790  236  ILE A C     
1826 O O     . ILE A 236 ? 0.6327 0.6000 0.7194 0.0067  0.0869  0.0809  236  ILE A O     
1827 C CB    . ILE A 236 ? 0.4734 0.4410 0.5466 0.0016  0.0761  0.0705  236  ILE A CB    
1828 C CG1   . ILE A 236 ? 0.4923 0.4568 0.5572 -0.0008 0.0720  0.0645  236  ILE A CG1   
1829 C CG2   . ILE A 236 ? 0.5094 0.4680 0.5810 0.0038  0.0809  0.0709  236  ILE A CG2   
1830 C CD1   . ILE A 236 ? 0.4557 0.4203 0.5174 -0.0006 0.0702  0.0632  236  ILE A CD1   
1831 N N     . ASP A 237 ? 0.5293 0.5162 0.6211 0.0032  0.0788  0.0831  237  ASP A N     
1832 C CA    . ASP A 237 ? 0.5809 0.5759 0.6822 0.0057  0.0819  0.0906  237  ASP A CA    
1833 C C     . ASP A 237 ? 0.6277 0.6187 0.7311 0.0068  0.0860  0.0920  237  ASP A C     
1834 O O     . ASP A 237 ? 0.6341 0.6213 0.7408 0.0106  0.0918  0.0959  237  ASP A O     
1835 C CB    . ASP A 237 ? 0.6205 0.6307 0.7275 0.0035  0.0775  0.0946  237  ASP A CB    
1836 C CG    . ASP A 237 ? 0.6103 0.6252 0.7170 0.0034  0.0746  0.0951  237  ASP A CG    
1837 O OD1   . ASP A 237 ? 0.5526 0.5605 0.6566 0.0058  0.0768  0.0937  237  ASP A OD1   
1838 O OD2   . ASP A 237 ? 0.6217 0.6469 0.7305 0.0007  0.0700  0.0969  237  ASP A OD2   
1839 N N     . THR A 238 ? 0.6148 0.6060 0.7156 0.0035  0.0832  0.0886  238  THR A N     
1840 C CA    . THR A 238 ? 0.5923 0.5798 0.6946 0.0039  0.0865  0.0893  238  THR A CA    
1841 C C     . THR A 238 ? 0.6515 0.6234 0.7492 0.0067  0.0919  0.0867  238  THR A C     
1842 O O     . THR A 238 ? 0.6853 0.6534 0.7861 0.0090  0.0968  0.0895  238  THR A O     
1843 C CB    . THR A 238 ? 0.5980 0.5855 0.6953 -0.0006 0.0824  0.0844  238  THR A CB    
1844 O OG1   . THR A 238 ? 0.5973 0.5985 0.6978 -0.0040 0.0777  0.0872  238  THR A OG1   
1845 C CG2   . THR A 238 ? 0.6661 0.6488 0.7645 -0.0002 0.0859  0.0846  238  THR A CG2   
1846 N N     . SER A 239 ? 0.5934 0.5563 0.6835 0.0064  0.0911  0.0817  239  SER A N     
1847 C CA    . SER A 239 ? 0.6048 0.5524 0.6889 0.0079  0.0955  0.0787  239  SER A CA    
1848 C C     . SER A 239 ? 0.6904 0.6341 0.7772 0.0119  0.1016  0.0839  239  SER A C     
1849 O O     . SER A 239 ? 0.6869 0.6172 0.7687 0.0132  0.1064  0.0828  239  SER A O     
1850 C CB    . SER A 239 ? 0.5622 0.5028 0.6370 0.0057  0.0923  0.0720  239  SER A CB    
1851 O OG    . SER A 239 ? 0.5974 0.5395 0.6718 0.0066  0.0920  0.0732  239  SER A OG    
1852 N N     . LYS A 240 ? 0.6985 0.6531 0.7921 0.0137  0.1015  0.0896  240  LYS A N     
1853 C CA    . LYS A 240 ? 0.8276 0.7788 0.9230 0.0178  0.1076  0.0948  240  LYS A CA    
1854 C C     . LYS A 240 ? 0.8252 0.7638 0.9114 0.0175  0.1091  0.0910  240  LYS A C     
1855 O O     . LYS A 240 ? 0.8707 0.8017 0.9551 0.0204  0.1151  0.0943  240  LYS A O     
1856 C CB    . LYS A 240 ? 1.0046 0.9503 1.1030 0.0212  0.1145  0.0994  240  LYS A CB    
1857 C CG    . LYS A 240 ? 1.1436 1.1020 1.2514 0.0214  0.1135  0.1038  240  LYS A CG    
1858 C CD    . LYS A 240 ? 1.2330 1.2078 1.3502 0.0234  0.1126  0.1111  240  LYS A CD    
1859 C CE    . LYS A 240 ? 1.3099 1.2977 1.4364 0.0233  0.1120  0.1163  240  LYS A CE    
1860 N NZ    . LYS A 240 ? 1.3448 1.3496 1.4811 0.0252  0.1113  0.1242  240  LYS A NZ    
1861 N N     . VAL A 241 ? 0.7262 0.6624 0.8061 0.0139  0.1041  0.0845  241  VAL A N     
1862 C CA    . VAL A 241 ? 0.6441 0.5716 0.7161 0.0129  0.1045  0.0813  241  VAL A CA    
1863 C C     . VAL A 241 ? 0.6465 0.5821 0.7218 0.0142  0.1038  0.0848  241  VAL A C     
1864 O O     . VAL A 241 ? 0.6902 0.6389 0.7714 0.0138  0.0993  0.0861  241  VAL A O     
1865 C CB    . VAL A 241 ? 0.6040 0.5295 0.6694 0.0091  0.0989  0.0742  241  VAL A CB    
1866 C CG1   . VAL A 241 ? 0.5131 0.4352 0.5726 0.0079  0.0981  0.0722  241  VAL A CG1   
1867 C CG2   . VAL A 241 ? 0.5671 0.4816 0.6270 0.0078  0.1004  0.0701  241  VAL A CG2   
1868 N N     . ASN A 242 ? 0.5528 0.4800 0.6236 0.0156  0.1083  0.0862  242  ASN A N     
1869 C CA    . ASN A 242 ? 0.5996 0.5327 0.6723 0.0169  0.1082  0.0891  242  ASN A CA    
1870 C C     . ASN A 242 ? 0.5566 0.4914 0.6245 0.0135  0.1025  0.0839  242  ASN A C     
1871 O O     . ASN A 242 ? 0.6035 0.5282 0.6629 0.0117  0.1037  0.0808  242  ASN A O     
1872 C CB    . ASN A 242 ? 0.6210 0.5433 0.6895 0.0198  0.1160  0.0928  242  ASN A CB    
1873 C CG    . ASN A 242 ? 0.8022 0.7294 0.8717 0.0213  0.1164  0.0957  242  ASN A CG    
1874 O OD1   . ASN A 242 ? 0.8209 0.7615 0.8967 0.0212  0.1114  0.0964  242  ASN A OD1   
1875 N ND2   . ASN A 242 ? 0.8692 0.7849 0.9316 0.0226  0.1227  0.0973  242  ASN A ND2   
1876 N N     . TYR A 243 ? 0.5369 0.4841 0.6096 0.0125  0.0965  0.0833  243  TYR A N     
1877 C CA    . TYR A 243 ? 0.5658 0.5151 0.6342 0.0096  0.0910  0.0785  243  TYR A CA    
1878 C C     . TYR A 243 ? 0.6026 0.5614 0.6743 0.0100  0.0881  0.0804  243  TYR A C     
1879 O O     . TYR A 243 ? 0.5264 0.4937 0.6053 0.0121  0.0884  0.0851  243  TYR A O     
1880 C CB    . TYR A 243 ? 0.5095 0.4624 0.5776 0.0072  0.0859  0.0747  243  TYR A CB    
1881 C CG    . TYR A 243 ? 0.4965 0.4621 0.5717 0.0072  0.0823  0.0772  243  TYR A CG    
1882 C CD1   . TYR A 243 ? 0.5255 0.4952 0.6070 0.0085  0.0841  0.0811  243  TYR A CD1   
1883 C CD2   . TYR A 243 ? 0.5148 0.4880 0.5899 0.0057  0.0770  0.0760  243  TYR A CD2   
1884 C CE1   . TYR A 243 ? 0.4732 0.4549 0.5606 0.0076  0.0805  0.0836  243  TYR A CE1   
1885 C CE2   . TYR A 243 ? 0.5273 0.5112 0.6076 0.0049  0.0736  0.0783  243  TYR A CE2   
1886 C CZ    . TYR A 243 ? 0.5456 0.5339 0.6319 0.0056  0.0752  0.0821  243  TYR A CZ    
1887 O OH    . TYR A 243 ? 0.4869 0.4863 0.5779 0.0040  0.0716  0.0848  243  TYR A OH    
1888 N N     . GLY A 244 ? 0.6015 0.5590 0.6679 0.0080  0.0852  0.0767  244  GLY A N     
1889 C CA    . GLY A 244 ? 0.5646 0.5303 0.6332 0.0081  0.0819  0.0776  244  GLY A CA    
1890 C C     . GLY A 244 ? 0.5761 0.5458 0.6421 0.0055  0.0758  0.0734  244  GLY A C     
1891 O O     . GLY A 244 ? 0.5457 0.5105 0.6068 0.0038  0.0747  0.0694  244  GLY A O     
1892 N N     . VAL A 245 ? 0.4956 0.4740 0.5646 0.0054  0.0720  0.0744  245  VAL A N     
1893 C CA    . VAL A 245 ? 0.4838 0.4654 0.5496 0.0034  0.0668  0.0709  245  VAL A CA    
1894 C C     . VAL A 245 ? 0.5519 0.5352 0.6159 0.0034  0.0654  0.0706  245  VAL A C     
1895 O O     . VAL A 245 ? 0.6281 0.6155 0.6962 0.0048  0.0662  0.0739  245  VAL A O     
1896 C CB    . VAL A 245 ? 0.4590 0.4487 0.5287 0.0028  0.0633  0.0725  245  VAL A CB    
1897 C CG1   . VAL A 245 ? 0.4217 0.4122 0.4861 0.0008  0.0587  0.0687  245  VAL A CG1   
1898 C CG2   . VAL A 245 ? 0.4125 0.4017 0.4853 0.0029  0.0653  0.0739  245  VAL A CG2   
1899 N N     . THR A 246 ? 0.4624 0.4429 0.5205 0.0020  0.0635  0.0669  246  THR A N     
1900 C CA    . THR A 246 ? 0.5035 0.4847 0.5595 0.0018  0.0629  0.0666  246  THR A CA    
1901 C C     . THR A 246 ? 0.5514 0.5347 0.6030 0.0006  0.0588  0.0635  246  THR A C     
1902 O O     . THR A 246 ? 0.5582 0.5413 0.6074 0.0000  0.0568  0.0615  246  THR A O     
1903 C CB    . THR A 246 ? 0.4800 0.4535 0.5322 0.0014  0.0672  0.0664  246  THR A CB    
1904 O OG1   . THR A 246 ? 0.5517 0.5264 0.6027 0.0013  0.0672  0.0669  246  THR A OG1   
1905 C CG2   . THR A 246 ? 0.3990 0.3665 0.4449 -0.0007 0.0672  0.0628  246  THR A CG2   
1906 N N     . VAL A 247 ? 0.4958 0.4809 0.5461 0.0004  0.0579  0.0635  247  VAL A N     
1907 C CA    . VAL A 247 ? 0.4282 0.4156 0.4745 -0.0002 0.0546  0.0614  247  VAL A CA    
1908 C C     . VAL A 247 ? 0.4105 0.3937 0.4514 -0.0015 0.0549  0.0585  247  VAL A C     
1909 O O     . VAL A 247 ? 0.4473 0.4253 0.4860 -0.0027 0.0577  0.0581  247  VAL A O     
1910 C CB    . VAL A 247 ? 0.5153 0.5053 0.5616 -0.0002 0.0541  0.0621  247  VAL A CB    
1911 C CG1   . VAL A 247 ? 0.5516 0.5364 0.5954 -0.0014 0.0577  0.0620  247  VAL A CG1   
1912 C CG2   . VAL A 247 ? 0.4827 0.4760 0.5256 -0.0004 0.0508  0.0606  247  VAL A CG2   
1913 N N     . LEU A 248 ? 0.5292 0.5141 0.5670 -0.0014 0.0522  0.0568  248  LEU A N     
1914 C CA    . LEU A 248 ? 0.4938 0.4758 0.5264 -0.0022 0.0522  0.0544  248  LEU A CA    
1915 C C     . LEU A 248 ? 0.5163 0.4983 0.5464 -0.0038 0.0528  0.0543  248  LEU A C     
1916 O O     . LEU A 248 ? 0.4864 0.4717 0.5179 -0.0037 0.0523  0.0556  248  LEU A O     
1917 C CB    . LEU A 248 ? 0.4076 0.3920 0.4368 -0.0011 0.0494  0.0532  248  LEU A CB    
1918 C CG    . LEU A 248 ? 0.4831 0.4660 0.5123 -0.0005 0.0490  0.0527  248  LEU A CG    
1919 C CD1   . LEU A 248 ? 0.4276 0.4123 0.4524 0.0007  0.0466  0.0521  248  LEU A CD1   
1920 C CD2   . LEU A 248 ? 0.4361 0.4133 0.4636 -0.0012 0.0510  0.0509  248  LEU A CD2   
1921 N N     . PRO A 249 ? 0.5240 0.5023 0.5499 -0.0055 0.0539  0.0528  249  PRO A N     
1922 C CA    . PRO A 249 ? 0.4266 0.4052 0.4492 -0.0079 0.0542  0.0528  249  PRO A CA    
1923 C C     . PRO A 249 ? 0.4478 0.4339 0.4694 -0.0071 0.0510  0.0530  249  PRO A C     
1924 O O     . PRO A 249 ? 0.5258 0.5146 0.5472 -0.0048 0.0491  0.0527  249  PRO A O     
1925 C CB    . PRO A 249 ? 0.5483 0.5216 0.5664 -0.0100 0.0555  0.0512  249  PRO A CB    
1926 C CG    . PRO A 249 ? 0.5011 0.4697 0.5208 -0.0085 0.0567  0.0504  249  PRO A CG    
1927 C CD    . PRO A 249 ? 0.4215 0.3951 0.4451 -0.0057 0.0546  0.0510  249  PRO A CD    
1928 N N     . THR A 250 ? 0.4448 0.4336 0.4649 -0.0090 0.0508  0.0538  250  THR A N     
1929 C CA    . THR A 250 ? 0.4105 0.4068 0.4296 -0.0083 0.0481  0.0544  250  THR A CA    
1930 C C     . THR A 250 ? 0.4616 0.4596 0.4763 -0.0096 0.0474  0.0538  250  THR A C     
1931 O O     . THR A 250 ? 0.3592 0.3523 0.3713 -0.0123 0.0489  0.0529  250  THR A O     
1932 C CB    . THR A 250 ? 0.5111 0.5104 0.5304 -0.0100 0.0481  0.0557  250  THR A CB    
1933 O OG1   . THR A 250 ? 0.5330 0.5292 0.5484 -0.0143 0.0498  0.0554  250  THR A OG1   
1934 C CG2   . THR A 250 ? 0.4590 0.4564 0.4824 -0.0088 0.0492  0.0564  250  THR A CG2   
1935 N N     . PHE A 251 ? 0.4308 0.4357 0.4446 -0.0077 0.0452  0.0547  251  PHE A N     
1936 C CA    . PHE A 251 ? 0.4691 0.4779 0.4793 -0.0086 0.0443  0.0550  251  PHE A CA    
1937 C C     . PHE A 251 ? 0.4420 0.4597 0.4521 -0.0088 0.0426  0.0572  251  PHE A C     
1938 O O     . PHE A 251 ? 0.4873 0.5086 0.4992 -0.0056 0.0416  0.0583  251  PHE A O     
1939 C CB    . PHE A 251 ? 0.4246 0.4329 0.4331 -0.0050 0.0439  0.0543  251  PHE A CB    
1940 C CG    . PHE A 251 ? 0.4733 0.4868 0.4782 -0.0049 0.0430  0.0551  251  PHE A CG    
1941 C CD1   . PHE A 251 ? 0.4654 0.4777 0.4678 -0.0088 0.0434  0.0546  251  PHE A CD1   
1942 C CD2   . PHE A 251 ? 0.4332 0.4527 0.4368 -0.0008 0.0419  0.0568  251  PHE A CD2   
1943 C CE1   . PHE A 251 ? 0.4389 0.4571 0.4383 -0.0088 0.0424  0.0559  251  PHE A CE1   
1944 C CE2   . PHE A 251 ? 0.4368 0.4621 0.4375 -0.0002 0.0414  0.0582  251  PHE A CE2   
1945 C CZ    . PHE A 251 ? 0.4162 0.4414 0.4151 -0.0043 0.0414  0.0578  251  PHE A CZ    
1946 N N     . LYS A 252 ? 0.5450 0.5661 0.5526 -0.0127 0.0423  0.0580  252  LYS A N     
1947 C CA    . LYS A 252 ? 0.5355 0.5658 0.5433 -0.0136 0.0408  0.0604  252  LYS A CA    
1948 C C     . LYS A 252 ? 0.5351 0.5650 0.5458 -0.0134 0.0410  0.0606  252  LYS A C     
1949 O O     . LYS A 252 ? 0.5767 0.6133 0.5890 -0.0114 0.0396  0.0624  252  LYS A O     
1950 C CB    . LYS A 252 ? 0.5495 0.5878 0.5573 -0.0090 0.0392  0.0624  252  LYS A CB    
1951 C CG    . LYS A 252 ? 0.6279 0.6705 0.6326 -0.0094 0.0387  0.0634  252  LYS A CG    
1952 C CD    . LYS A 252 ? 0.6753 0.7281 0.6801 -0.0051 0.0376  0.0667  252  LYS A CD    
1953 C CE    . LYS A 252 ? 0.7615 0.8189 0.7634 -0.0038 0.0373  0.0680  252  LYS A CE    
1954 N NZ    . LYS A 252 ? 0.9592 1.0215 0.9596 -0.0098 0.0364  0.0691  252  LYS A NZ    
1955 N N     . GLY A 253 ? 0.5508 0.5725 0.5622 -0.0150 0.0429  0.0590  253  GLY A N     
1956 C CA    . GLY A 253 ? 0.5864 0.6069 0.6002 -0.0149 0.0434  0.0592  253  GLY A CA    
1957 C C     . GLY A 253 ? 0.6262 0.6468 0.6440 -0.0100 0.0427  0.0594  253  GLY A C     
1958 O O     . GLY A 253 ? 0.5646 0.5841 0.5848 -0.0096 0.0431  0.0596  253  GLY A O     
1959 N N     . GLN A 254 ? 0.5997 0.6211 0.6175 -0.0066 0.0418  0.0593  254  GLN A N     
1960 C CA    . GLN A 254 ? 0.4419 0.4623 0.4619 -0.0026 0.0411  0.0595  254  GLN A CA    
1961 C C     . GLN A 254 ? 0.5082 0.5219 0.5291 -0.0019 0.0422  0.0580  254  GLN A C     
1962 O O     . GLN A 254 ? 0.6275 0.6380 0.6465 -0.0031 0.0431  0.0568  254  GLN A O     
1963 C CB    . GLN A 254 ? 0.4274 0.4527 0.4454 0.0009  0.0397  0.0609  254  GLN A CB    
1964 C CG    . GLN A 254 ? 0.4970 0.5301 0.5147 0.0007  0.0387  0.0630  254  GLN A CG    
1965 C CD    . GLN A 254 ? 0.5478 0.5864 0.5625 0.0030  0.0381  0.0647  254  GLN A CD    
1966 O OE1   . GLN A 254 ? 0.5528 0.5932 0.5661 0.0071  0.0378  0.0662  254  GLN A OE1   
1967 N NE2   . GLN A 254 ? 0.5280 0.5691 0.5411 0.0004  0.0382  0.0646  254  GLN A NE2   
1968 N N     . PRO A 255 ? 0.5324 0.5440 0.5559 -0.0002 0.0420  0.0582  255  PRO A N     
1969 C CA    . PRO A 255 ? 0.5646 0.5709 0.5894 0.0001  0.0430  0.0572  255  PRO A CA    
1970 C C     . PRO A 255 ? 0.5185 0.5233 0.5398 0.0017  0.0425  0.0562  255  PRO A C     
1971 O O     . PRO A 255 ? 0.4587 0.4662 0.4769 0.0038  0.0414  0.0569  255  PRO A O     
1972 C CB    . PRO A 255 ? 0.5251 0.5316 0.5532 0.0013  0.0422  0.0583  255  PRO A CB    
1973 C CG    . PRO A 255 ? 0.6017 0.6125 0.6285 0.0028  0.0405  0.0594  255  PRO A CG    
1974 C CD    . PRO A 255 ? 0.5829 0.5972 0.6081 0.0014  0.0408  0.0595  255  PRO A CD    
1975 N N     . SER A 256 ? 0.4177 0.4177 0.4391 0.0010  0.0438  0.0549  256  SER A N     
1976 C CA    . SER A 256 ? 0.4529 0.4503 0.4708 0.0026  0.0436  0.0538  256  SER A CA    
1977 C C     . SER A 256 ? 0.4539 0.4513 0.4715 0.0042  0.0424  0.0546  256  SER A C     
1978 O O     . SER A 256 ? 0.4803 0.4782 0.5019 0.0036  0.0421  0.0557  256  SER A O     
1979 C CB    . SER A 256 ? 0.4333 0.4253 0.4518 0.0013  0.0453  0.0522  256  SER A CB    
1980 O OG    . SER A 256 ? 0.4442 0.4349 0.4611 -0.0004 0.0464  0.0513  256  SER A OG    
1981 N N     . LYS A 257 ? 0.4765 0.4728 0.4886 0.0062  0.0419  0.0544  257  LYS A N     
1982 C CA    . LYS A 257 ? 0.4364 0.4315 0.4460 0.0073  0.0409  0.0553  257  LYS A CA    
1983 C C     . LYS A 257 ? 0.4722 0.4620 0.4773 0.0073  0.0414  0.0540  257  LYS A C     
1984 O O     . LYS A 257 ? 0.5211 0.5081 0.5189 0.0091  0.0419  0.0535  257  LYS A O     
1985 C CB    . LYS A 257 ? 0.5029 0.5004 0.5081 0.0099  0.0404  0.0568  257  LYS A CB    
1986 C CG    . LYS A 257 ? 0.6006 0.6040 0.6098 0.0097  0.0399  0.0580  257  LYS A CG    
1987 C CD    . LYS A 257 ? 0.6281 0.6334 0.6357 0.0115  0.0391  0.0601  257  LYS A CD    
1988 C CE    . LYS A 257 ? 0.6674 0.6703 0.6670 0.0147  0.0397  0.0608  257  LYS A CE    
1989 N NZ    . LYS A 257 ? 0.6302 0.6331 0.6273 0.0165  0.0392  0.0630  257  LYS A NZ    
1990 N N     . PRO A 258 ? 0.4443 0.4324 0.4533 0.0052  0.0415  0.0536  258  PRO A N     
1991 C CA    . PRO A 258 ? 0.4345 0.4177 0.4390 0.0046  0.0420  0.0523  258  PRO A CA    
1992 C C     . PRO A 258 ? 0.5426 0.5235 0.5409 0.0047  0.0409  0.0532  258  PRO A C     
1993 O O     . PRO A 258 ? 0.5768 0.5603 0.5768 0.0047  0.0397  0.0551  258  PRO A O     
1994 C CB    . PRO A 258 ? 0.4192 0.4029 0.4307 0.0023  0.0422  0.0526  258  PRO A CB    
1995 C CG    . PRO A 258 ? 0.4183 0.4068 0.4365 0.0020  0.0415  0.0548  258  PRO A CG    
1996 C CD    . PRO A 258 ? 0.3997 0.3904 0.4167 0.0035  0.0415  0.0547  258  PRO A CD    
1997 N N     . PHE A 259 ? 0.5070 0.4824 0.4973 0.0048  0.0417  0.0519  259  PHE A N     
1998 C CA    . PHE A 259 ? 0.5755 0.5470 0.5583 0.0040  0.0410  0.0528  259  PHE A CA    
1999 C C     . PHE A 259 ? 0.6316 0.6051 0.6196 0.0005  0.0394  0.0542  259  PHE A C     
2000 O O     . PHE A 259 ? 0.6270 0.6031 0.6222 -0.0011 0.0395  0.0539  259  PHE A O     
2001 C CB    . PHE A 259 ? 0.5519 0.5160 0.5238 0.0045  0.0426  0.0510  259  PHE A CB    
2002 C CG    . PHE A 259 ? 0.6494 0.6105 0.6124 0.0083  0.0442  0.0512  259  PHE A CG    
2003 C CD1   . PHE A 259 ? 0.7240 0.6853 0.6839 0.0098  0.0439  0.0535  259  PHE A CD1   
2004 C CD2   . PHE A 259 ? 0.6591 0.6171 0.6168 0.0107  0.0462  0.0494  259  PHE A CD2   
2005 C CE1   . PHE A 259 ? 0.7956 0.7544 0.7474 0.0139  0.0458  0.0543  259  PHE A CE1   
2006 C CE2   . PHE A 259 ? 0.6958 0.6518 0.6455 0.0148  0.0480  0.0502  259  PHE A CE2   
2007 C CZ    . PHE A 259 ? 0.7030 0.6595 0.6498 0.0166  0.0479  0.0528  259  PHE A CZ    
2008 N N     . VAL A 260 ? 0.4734 0.4458 0.4576 -0.0008 0.0381  0.0560  260  VAL A N     
2009 C CA    . VAL A 260 ? 0.5301 0.5047 0.5181 -0.0046 0.0364  0.0576  260  VAL A CA    
2010 C C     . VAL A 260 ? 0.5135 0.4814 0.4907 -0.0074 0.0364  0.0572  260  VAL A C     
2011 O O     . VAL A 260 ? 0.5132 0.4746 0.4793 -0.0067 0.0370  0.0571  260  VAL A O     
2012 C CB    . VAL A 260 ? 0.5387 0.5171 0.5305 -0.0049 0.0346  0.0602  260  VAL A CB    
2013 C CG1   . VAL A 260 ? 0.5524 0.5342 0.5486 -0.0089 0.0327  0.0624  260  VAL A CG1   
2014 C CG2   . VAL A 260 ? 0.5799 0.5640 0.5809 -0.0023 0.0349  0.0605  260  VAL A CG2   
2015 N N     . GLY A 261 ? 0.4752 0.4442 0.4550 -0.0106 0.0359  0.0570  261  GLY A N     
2016 C CA    . GLY A 261 ? 0.4783 0.4413 0.4477 -0.0143 0.0358  0.0566  261  GLY A CA    
2017 C C     . GLY A 261 ? 0.5193 0.4866 0.4919 -0.0193 0.0333  0.0595  261  GLY A C     
2018 O O     . GLY A 261 ? 0.5276 0.5033 0.5124 -0.0198 0.0321  0.0615  261  GLY A O     
2019 N N     . VAL A 262 ? 0.4689 0.4300 0.4297 -0.0231 0.0326  0.0601  262  VAL A N     
2020 C CA    . VAL A 262 ? 0.5127 0.4780 0.4753 -0.0289 0.0300  0.0629  262  VAL A CA    
2021 C C     . VAL A 262 ? 0.5570 0.5177 0.5112 -0.0334 0.0304  0.0617  262  VAL A C     
2022 O O     . VAL A 262 ? 0.5717 0.5222 0.5104 -0.0353 0.0315  0.0603  262  VAL A O     
2023 C CB    . VAL A 262 ? 0.5005 0.4632 0.4565 -0.0312 0.0282  0.0653  262  VAL A CB    
2024 C CG1   . VAL A 262 ? 0.4773 0.4453 0.4353 -0.0378 0.0253  0.0686  262  VAL A CG1   
2025 C CG2   . VAL A 262 ? 0.4193 0.3865 0.3837 -0.0268 0.0279  0.0663  262  VAL A CG2   
2026 N N     . LEU A 263 ? 0.5566 0.5245 0.5204 -0.0349 0.0300  0.0623  263  LEU A N     
2027 C CA    . LEU A 263 ? 0.5177 0.4827 0.4749 -0.0397 0.0301  0.0614  263  LEU A CA    
2028 C C     . LEU A 263 ? 0.5930 0.5555 0.5400 -0.0464 0.0279  0.0638  263  LEU A C     
2029 O O     . LEU A 263 ? 0.6522 0.6227 0.6061 -0.0491 0.0251  0.0677  263  LEU A O     
2030 C CB    . LEU A 263 ? 0.4127 0.3877 0.3836 -0.0405 0.0297  0.0629  263  LEU A CB    
2031 C CG    . LEU A 263 ? 0.5303 0.5032 0.4952 -0.0456 0.0298  0.0622  263  LEU A CG    
2032 C CD1   . LEU A 263 ? 0.6431 0.6051 0.5979 -0.0431 0.0329  0.0571  263  LEU A CD1   
2033 C CD2   . LEU A 263 ? 0.5950 0.5794 0.5746 -0.0466 0.0293  0.0649  263  LEU A CD2   
2034 N N     . SER A 264 ? 0.5686 0.5195 0.4985 -0.0493 0.0292  0.0616  264  SER A N     
2035 C CA    . SER A 264 ? 0.5683 0.5137 0.4849 -0.0561 0.0276  0.0635  264  SER A CA    
2036 C C     . SER A 264 ? 0.6703 0.6103 0.5754 -0.0626 0.0279  0.0623  264  SER A C     
2037 O O     . SER A 264 ? 0.6372 0.5740 0.5409 -0.0606 0.0303  0.0590  264  SER A O     
2038 C CB    . SER A 264 ? 0.5908 0.5240 0.4933 -0.0535 0.0294  0.0623  264  SER A CB    
2039 O OG    . SER A 264 ? 0.6646 0.6030 0.5777 -0.0477 0.0291  0.0633  264  SER A OG    
2040 N N     . ALA A 265 ? 0.7281 0.6673 0.6249 -0.0707 0.0256  0.0651  265  ALA A N     
2041 C CA    . ALA A 265 ? 0.7634 0.6969 0.6473 -0.0781 0.0257  0.0642  265  ALA A CA    
2042 C C     . ALA A 265 ? 0.7098 0.6279 0.5706 -0.0830 0.0267  0.0639  265  ALA A C     
2043 O O     . ALA A 265 ? 0.7556 0.6742 0.6134 -0.0871 0.0242  0.0673  265  ALA A O     
2044 C CB    . ALA A 265 ? 0.8082 0.7560 0.7029 -0.0849 0.0219  0.0684  265  ALA A CB    
2045 N N     . GLY A 266 ? 0.7249 0.6283 0.5688 -0.0822 0.0305  0.0599  266  GLY A N     
2046 C CA    . GLY A 266 ? 0.7873 0.6735 0.6068 -0.0862 0.0326  0.0595  266  GLY A CA    
2047 C C     . GLY A 266 ? 0.8122 0.6912 0.6157 -0.0956 0.0328  0.0588  266  GLY A C     
2048 O O     . GLY A 266 ? 0.8581 0.7413 0.6662 -0.0965 0.0331  0.0568  266  GLY A O     
2049 N N     . ILE A 267 ? 0.8316 0.6990 0.6155 -0.1030 0.0327  0.0604  267  ILE A N     
2050 C CA    . ILE A 267 ? 0.8518 0.7108 0.6174 -0.1133 0.0330  0.0599  267  ILE A CA    
2051 C C     . ILE A 267 ? 0.8498 0.6861 0.5893 -0.1119 0.0390  0.0559  267  ILE A C     
2052 O O     . ILE A 267 ? 0.9654 0.7883 0.6910 -0.1092 0.0418  0.0561  267  ILE A O     
2053 C CB    . ILE A 267 ? 0.9107 0.7712 0.6695 -0.1242 0.0289  0.0646  267  ILE A CB    
2054 C CG1   . ILE A 267 ? 0.8279 0.7118 0.6125 -0.1256 0.0231  0.0690  267  ILE A CG1   
2055 C CG2   . ILE A 267 ? 0.9652 0.8155 0.7025 -0.1357 0.0294  0.0641  267  ILE A CG2   
2056 C CD1   . ILE A 267 ? 0.8031 0.6907 0.5842 -0.1350 0.0187  0.0743  267  ILE A CD1   
2057 N N     . ASN A 268 ? 0.8392 0.6711 0.5720 -0.1134 0.0412  0.0524  268  ASN A N     
2058 C CA    . ASN A 268 ? 0.9264 0.7366 0.6336 -0.1124 0.0473  0.0486  268  ASN A CA    
2059 C C     . ASN A 268 ? 1.0501 0.8429 0.7307 -0.1204 0.0487  0.0504  268  ASN A C     
2060 O O     . ASN A 268 ? 1.0933 0.8898 0.7705 -0.1313 0.0448  0.0536  268  ASN A O     
2061 C CB    . ASN A 268 ? 0.9503 0.7593 0.6534 -0.1159 0.0485  0.0451  268  ASN A CB    
2062 C CG    . ASN A 268 ? 0.9770 0.7673 0.6613 -0.1102 0.0553  0.0402  268  ASN A CG    
2063 O OD1   . ASN A 268 ? 0.9957 0.7679 0.6581 -0.1091 0.0597  0.0399  268  ASN A OD1   
2064 N ND2   . ASN A 268 ? 1.0283 0.8229 0.7210 -0.1062 0.0565  0.0365  268  ASN A ND2   
2065 N N     . ALA A 269 ? 1.1072 0.8812 0.7689 -0.1150 0.0545  0.0489  269  ALA A N     
2066 C CA    . ALA A 269 ? 1.1513 0.9061 0.7857 -0.1218 0.0569  0.0507  269  ALA A CA    
2067 C C     . ALA A 269 ? 1.1976 0.9383 0.8076 -0.1319 0.0592  0.0487  269  ALA A C     
2068 O O     . ALA A 269 ? 1.2581 0.9840 0.8447 -0.1411 0.0601  0.0504  269  ALA A O     
2069 C CB    . ALA A 269 ? 1.1322 0.8711 0.7537 -0.1121 0.0631  0.0502  269  ALA A CB    
2070 N N     . ALA A 270 ? 1.1717 0.9164 0.7866 -0.1305 0.0601  0.0449  270  ALA A N     
2071 C CA    . ALA A 270 ? 1.1591 0.8908 0.7517 -0.1395 0.0624  0.0424  270  ALA A CA    
2072 C C     . ALA A 270 ? 1.1798 0.9283 0.7845 -0.1503 0.0561  0.0439  270  ALA A C     
2073 O O     . ALA A 270 ? 1.2696 1.0118 0.8611 -0.1575 0.0573  0.0415  270  ALA A O     
2074 C CB    . ALA A 270 ? 1.1532 0.8752 0.7390 -0.1312 0.0685  0.0371  270  ALA A CB    
2075 N N     . SER A 271 ? 1.1378 0.9075 0.7673 -0.1512 0.0497  0.0480  271  SER A N     
2076 C CA    . SER A 271 ? 1.1472 0.9353 0.7906 -0.1606 0.0436  0.0505  271  SER A CA    
2077 C C     . SER A 271 ? 1.1202 0.9045 0.7475 -0.1752 0.0405  0.0546  271  SER A C     
2078 O O     . SER A 271 ? 1.0767 0.8577 0.7000 -0.1767 0.0392  0.0580  271  SER A O     
2079 C CB    . SER A 271 ? 1.1243 0.9378 0.8023 -0.1544 0.0385  0.0534  271  SER A CB    
2080 O OG    . SER A 271 ? 1.0721 0.9029 0.7614 -0.1644 0.0324  0.0578  271  SER A OG    
2081 N N     . PRO A 272 ? 1.1682 0.9533 0.7866 -0.1865 0.0390  0.0545  272  PRO A N     
2082 C CA    . PRO A 272 ? 1.2247 1.0087 0.8288 -0.2020 0.0353  0.0588  272  PRO A CA    
2083 C C     . PRO A 272 ? 1.3348 1.1459 0.9659 -0.2058 0.0274  0.0648  272  PRO A C     
2084 O O     . PRO A 272 ? 1.4263 1.2407 1.0501 -0.2184 0.0232  0.0694  272  PRO A O     
2085 C CB    . PRO A 272 ? 1.2324 1.0096 0.8203 -0.2111 0.0368  0.0560  272  PRO A CB    
2086 C CG    . PRO A 272 ? 1.2383 1.0277 0.8478 -0.2014 0.0376  0.0525  272  PRO A CG    
2087 C CD    . PRO A 272 ? 1.2163 1.0032 0.8369 -0.1855 0.0409  0.0503  272  PRO A CD    
2088 N N     . ASN A 273 ? 1.3232 1.1533 0.9847 -0.1950 0.0256  0.0650  273  ASN A N     
2089 C CA    . ASN A 273 ? 1.2858 1.1427 0.9746 -0.1971 0.0190  0.0707  273  ASN A CA    
2090 C C     . ASN A 273 ? 1.2913 1.1565 0.9971 -0.1891 0.0170  0.0736  273  ASN A C     
2091 O O     . ASN A 273 ? 1.3292 1.2162 1.0623 -0.1849 0.0132  0.0767  273  ASN A O     
2092 C CB    . ASN A 273 ? 1.2691 1.1428 0.9802 -0.1921 0.0183  0.0694  273  ASN A CB    
2093 C CG    . ASN A 273 ? 1.2943 1.1618 0.9906 -0.2003 0.0198  0.0667  273  ASN A CG    
2094 O OD1   . ASN A 273 ? 1.3567 1.2230 1.0386 -0.2140 0.0174  0.0695  273  ASN A OD1   
2095 N ND2   . ASN A 273 ? 1.2516 1.1147 0.9508 -0.1924 0.0239  0.0613  273  ASN A ND2   
2096 N N     . LYS A 274 ? 1.2354 1.0827 0.9243 -0.1870 0.0198  0.0726  274  LYS A N     
2097 C CA    . LYS A 274 ? 1.0721 0.9246 0.7752 -0.1785 0.0188  0.0746  274  LYS A CA    
2098 C C     . LYS A 274 ? 1.0447 0.9181 0.7662 -0.1836 0.0120  0.0811  274  LYS A C     
2099 O O     . LYS A 274 ? 1.1338 1.0194 0.8764 -0.1752 0.0103  0.0828  274  LYS A O     
2100 C CB    . LYS A 274 ? 1.0247 0.8536 0.7038 -0.1772 0.0230  0.0733  274  LYS A CB    
2101 C CG    . LYS A 274 ? 1.0192 0.8286 0.6829 -0.1692 0.0303  0.0674  274  LYS A CG    
2102 C CD    . LYS A 274 ? 1.0729 0.8611 0.7164 -0.1659 0.0346  0.0670  274  LYS A CD    
2103 C CE    . LYS A 274 ? 1.0678 0.8384 0.6978 -0.1565 0.0422  0.0618  274  LYS A CE    
2104 N NZ    . LYS A 274 ? 1.0467 0.8036 0.6544 -0.1636 0.0455  0.0587  274  LYS A NZ    
2105 N N     . GLU A 275 ? 1.0483 0.9260 0.7616 -0.1974 0.0081  0.0850  275  GLU A N     
2106 C CA    . GLU A 275 ? 1.0582 0.9547 0.7864 -0.2030 0.0017  0.0918  275  GLU A CA    
2107 C C     . GLU A 275 ? 1.0671 0.9906 0.8249 -0.2001 -0.0018 0.0947  275  GLU A C     
2108 O O     . GLU A 275 ? 1.0384 0.9797 0.8175 -0.1970 -0.0055 0.0992  275  GLU A O     
2109 C CB    . GLU A 275 ? 1.1288 1.0192 0.8353 -0.2196 -0.0013 0.0955  275  GLU A CB    
2110 C CG    . GLU A 275 ? 1.2683 1.1707 0.9834 -0.2246 -0.0069 0.1022  275  GLU A CG    
2111 C CD    . GLU A 275 ? 1.3373 1.2293 1.0515 -0.2161 -0.0051 0.1013  275  GLU A CD    
2112 O OE1   . GLU A 275 ? 1.2916 1.1954 1.0181 -0.2168 -0.0094 0.1061  275  GLU A OE1   
2113 O OE2   . GLU A 275 ? 1.4041 1.2762 1.1050 -0.2087 0.0008  0.0960  275  GLU A OE2   
2114 N N     . LEU A 276 ? 1.1304 1.0560 0.8888 -0.2009 -0.0002 0.0920  276  LEU A N     
2115 C CA    . LEU A 276 ? 1.1479 1.0968 0.9333 -0.1969 -0.0023 0.0942  276  LEU A CA    
2116 C C     . LEU A 276 ? 1.1193 1.0723 0.9246 -0.1812 0.0003  0.0915  276  LEU A C     
2117 O O     . LEU A 276 ? 1.1189 1.0911 0.9487 -0.1761 -0.0023 0.0954  276  LEU A O     
2118 C CB    . LEU A 276 ? 1.1953 1.1425 0.9739 -0.2014 -0.0006 0.0915  276  LEU A CB    
2119 C CG    . LEU A 276 ? 1.2083 1.1499 0.9648 -0.2177 -0.0026 0.0934  276  LEU A CG    
2120 C CD1   . LEU A 276 ? 1.1678 1.1071 0.9191 -0.2202 -0.0002 0.0897  276  LEU A CD1   
2121 C CD2   . LEU A 276 ? 1.2210 1.1839 0.9888 -0.2273 -0.0093 0.1019  276  LEU A CD2   
2122 N N     . ALA A 277 ? 1.0557 0.9900 0.8495 -0.1737 0.0056  0.0851  277  ALA A N     
2123 C CA    . ALA A 277 ? 0.9261 0.8620 0.7357 -0.1594 0.0083  0.0822  277  ALA A CA    
2124 C C     . ALA A 277 ? 0.9180 0.8622 0.7405 -0.1553 0.0057  0.0860  277  ALA A C     
2125 O O     . ALA A 277 ? 0.8927 0.8508 0.7380 -0.1468 0.0051  0.0872  277  ALA A O     
2126 C CB    . ALA A 277 ? 0.7869 0.7005 0.5785 -0.1533 0.0141  0.0755  277  ALA A CB    
2127 N N     . LYS A 278 ? 0.9731 0.9082 0.7802 -0.1617 0.0043  0.0880  278  LYS A N     
2128 C CA    . LYS A 278 ? 0.9512 0.8928 0.7687 -0.1586 0.0018  0.0916  278  LYS A CA    
2129 C C     . LYS A 278 ? 1.0451 1.0114 0.8852 -0.1612 -0.0034 0.0979  278  LYS A C     
2130 O O     . LYS A 278 ? 1.1158 1.0936 0.9751 -0.1537 -0.0045 0.1000  278  LYS A O     
2131 C CB    . LYS A 278 ? 0.9392 0.8652 0.7343 -0.1659 0.0013  0.0928  278  LYS A CB    
2132 C CG    . LYS A 278 ? 0.9606 0.8963 0.7670 -0.1655 -0.0026 0.0976  278  LYS A CG    
2133 C CD    . LYS A 278 ? 1.0461 0.9648 0.8298 -0.1723 -0.0028 0.0987  278  LYS A CD    
2134 C CE    . LYS A 278 ? 1.0482 0.9779 0.8443 -0.1725 -0.0070 0.1038  278  LYS A CE    
2135 N NZ    . LYS A 278 ? 1.0677 0.9799 0.8421 -0.1785 -0.0070 0.1048  278  LYS A NZ    
2136 N N     . GLU A 279 ? 1.1188 1.0936 0.9564 -0.1718 -0.0064 0.1014  279  GLU A N     
2137 C CA    . GLU A 279 ? 1.1758 1.1750 1.0342 -0.1747 -0.0112 0.1083  279  GLU A CA    
2138 C C     . GLU A 279 ? 1.0645 1.0785 0.9471 -0.1647 -0.0097 0.1080  279  GLU A C     
2139 O O     . GLU A 279 ? 1.0520 1.0826 0.9557 -0.1595 -0.0115 0.1122  279  GLU A O     
2140 C CB    . GLU A 279 ? 1.2703 1.2755 1.1194 -0.1892 -0.0148 0.1125  279  GLU A CB    
2141 C CG    . GLU A 279 ? 1.3450 1.3720 1.2089 -0.1947 -0.0205 0.1210  279  GLU A CG    
2142 C CD    . GLU A 279 ? 1.4544 1.5001 1.3273 -0.2019 -0.0233 0.1259  279  GLU A CD    
2143 O OE1   . GLU A 279 ? 1.5390 1.5775 1.4002 -0.2067 -0.0215 0.1227  279  GLU A OE1   
2144 O OE2   . GLU A 279 ? 1.4405 1.5083 1.3324 -0.2027 -0.0271 0.1331  279  GLU A OE2   
2145 N N     . PHE A 280 ? 0.9886 0.9955 0.8673 -0.1619 -0.0060 0.1030  280  PHE A N     
2146 C CA    . PHE A 280 ? 0.9662 0.9838 0.8653 -0.1524 -0.0039 0.1020  280  PHE A CA    
2147 C C     . PHE A 280 ? 0.9927 1.0116 0.9059 -0.1402 -0.0022 0.1008  280  PHE A C     
2148 O O     . PHE A 280 ? 0.9866 1.0205 0.9212 -0.1338 -0.0023 0.1035  280  PHE A O     
2149 C CB    . PHE A 280 ? 0.9574 0.9627 0.8464 -0.1508 0.0002  0.0956  280  PHE A CB    
2150 C CG    . PHE A 280 ? 0.9423 0.9539 0.8495 -0.1399 0.0032  0.0934  280  PHE A CG    
2151 C CD1   . PHE A 280 ? 0.9983 1.0263 0.9214 -0.1404 0.0023  0.0968  280  PHE A CD1   
2152 C CD2   . PHE A 280 ? 0.9420 0.9432 0.8502 -0.1293 0.0068  0.0883  280  PHE A CD2   
2153 C CE1   . PHE A 280 ? 1.0037 1.0359 0.9424 -0.1306 0.0054  0.0949  280  PHE A CE1   
2154 C CE2   . PHE A 280 ? 0.9312 0.9374 0.8550 -0.1201 0.0095  0.0864  280  PHE A CE2   
2155 C CZ    . PHE A 280 ? 0.9746 0.9956 0.9133 -0.1207 0.0089  0.0896  280  PHE A CZ    
2156 N N     . LEU A 281 ? 0.9833 0.9858 0.8837 -0.1370 -0.0004 0.0969  281  LEU A N     
2157 C CA    . LEU A 281 ? 0.9109 0.9124 0.8220 -0.1257 0.0016  0.0950  281  LEU A CA    
2158 C C     . LEU A 281 ? 0.8587 0.8720 0.7823 -0.1248 -0.0017 0.1003  281  LEU A C     
2159 O O     . LEU A 281 ? 0.9230 0.9456 0.8646 -0.1163 -0.0010 0.1012  281  LEU A O     
2160 C CB    . LEU A 281 ? 0.8701 0.8503 0.7632 -0.1221 0.0052  0.0892  281  LEU A CB    
2161 C CG    . LEU A 281 ? 0.8387 0.8078 0.7232 -0.1192 0.0094  0.0833  281  LEU A CG    
2162 C CD1   . LEU A 281 ? 0.7901 0.7384 0.6552 -0.1162 0.0130  0.0785  281  LEU A CD1   
2163 C CD2   . LEU A 281 ? 0.8875 0.8663 0.7920 -0.1098 0.0112  0.0819  281  LEU A CD2   
2164 N N     . GLU A 282 ? 0.8509 0.8630 0.7642 -0.1337 -0.0051 0.1038  282  GLU A N     
2165 C CA    . GLU A 282 ? 0.8518 0.8737 0.7753 -0.1331 -0.0082 0.1087  282  GLU A CA    
2166 C C     . GLU A 282 ? 0.8878 0.9327 0.8304 -0.1355 -0.0116 0.1156  282  GLU A C     
2167 O O     . GLU A 282 ? 0.9268 0.9834 0.8854 -0.1304 -0.0127 0.1191  282  GLU A O     
2168 C CB    . GLU A 282 ? 0.8436 0.8543 0.7480 -0.1417 -0.0105 0.1099  282  GLU A CB    
2169 C CG    . GLU A 282 ? 0.9319 0.9195 0.8167 -0.1389 -0.0068 0.1041  282  GLU A CG    
2170 C CD    . GLU A 282 ? 1.0138 0.9904 0.8818 -0.1458 -0.0086 0.1059  282  GLU A CD    
2171 O OE1   . GLU A 282 ? 1.0891 1.0770 0.9649 -0.1497 -0.0128 0.1112  282  GLU A OE1   
2172 O OE2   . GLU A 282 ? 0.9724 0.9286 0.8190 -0.1471 -0.0056 0.1021  282  GLU A OE2   
2173 N N     . ASN A 283 ? 0.9265 0.9781 0.8670 -0.1432 -0.0130 0.1178  283  ASN A N     
2174 C CA    . ASN A 283 ? 1.0121 1.0860 0.9682 -0.1472 -0.0165 0.1255  283  ASN A CA    
2175 C C     . ASN A 283 ? 0.8861 0.9733 0.8604 -0.1413 -0.0144 0.1266  283  ASN A C     
2176 O O     . ASN A 283 ? 0.8930 0.9998 0.8849 -0.1404 -0.0162 0.1333  283  ASN A O     
2177 C CB    . ASN A 283 ? 1.1485 1.2240 1.0907 -0.1617 -0.0206 0.1293  283  ASN A CB    
2178 C CG    . ASN A 283 ? 1.2409 1.3050 1.1665 -0.1682 -0.0230 0.1297  283  ASN A CG    
2179 O OD1   . ASN A 283 ? 1.2381 1.3026 1.1697 -0.1630 -0.0235 0.1306  283  ASN A OD1   
2180 N ND2   . ASN A 283 ? 1.2697 1.3226 1.1732 -0.1798 -0.0242 0.1290  283  ASN A ND2   
2181 N N     . TYR A 284 ? 0.7539 0.8303 0.7237 -0.1369 -0.0104 0.1204  284  TYR A N     
2182 C CA    . TYR A 284 ? 0.8046 0.8913 0.7900 -0.1313 -0.0080 0.1210  284  TYR A CA    
2183 C C     . TYR A 284 ? 0.8064 0.8880 0.8016 -0.1185 -0.0036 0.1166  284  TYR A C     
2184 O O     . TYR A 284 ? 0.8686 0.9628 0.8822 -0.1117 -0.0028 0.1202  284  TYR A O     
2185 C CB    . TYR A 284 ? 0.8539 0.9353 0.8284 -0.1375 -0.0071 0.1183  284  TYR A CB    
2186 C CG    . TYR A 284 ? 0.9423 1.0344 0.9122 -0.1502 -0.0114 0.1242  284  TYR A CG    
2187 C CD1   . TYR A 284 ? 0.9991 1.0834 0.9510 -0.1602 -0.0146 0.1248  284  TYR A CD1   
2188 C CD2   . TYR A 284 ? 0.9936 1.1037 0.9770 -0.1523 -0.0123 0.1296  284  TYR A CD2   
2189 C CE1   . TYR A 284 ? 1.0762 1.1703 1.0230 -0.1727 -0.0189 0.1304  284  TYR A CE1   
2190 C CE2   . TYR A 284 ? 1.0537 1.1750 1.0332 -0.1644 -0.0166 0.1354  284  TYR A CE2   
2191 C CZ    . TYR A 284 ? 1.0858 1.1991 1.0468 -0.1749 -0.0200 0.1358  284  TYR A CZ    
2192 O OH    . TYR A 284 ? 1.0874 1.2119 1.0436 -0.1878 -0.0244 0.1419  284  TYR A OH    
2193 N N     . LEU A 285 ? 0.7516 0.8148 0.7338 -0.1152 -0.0007 0.1092  285  LEU A N     
2194 C CA    . LEU A 285 ? 0.6607 0.7182 0.6504 -0.1039 0.0033  0.1048  285  LEU A CA    
2195 C C     . LEU A 285 ? 0.7004 0.7620 0.6996 -0.0981 0.0028  0.1068  285  LEU A C     
2196 O O     . LEU A 285 ? 0.6835 0.7543 0.6993 -0.0909 0.0043  0.1088  285  LEU A O     
2197 C CB    . LEU A 285 ? 0.6510 0.6884 0.6236 -0.1022 0.0062  0.0970  285  LEU A CB    
2198 C CG    . LEU A 285 ? 0.7000 0.7315 0.6793 -0.0912 0.0100  0.0926  285  LEU A CG    
2199 C CD1   . LEU A 285 ? 0.6381 0.6794 0.6339 -0.0859 0.0122  0.0936  285  LEU A CD1   
2200 C CD2   . LEU A 285 ? 0.7320 0.7448 0.6942 -0.0896 0.0128  0.0856  285  LEU A CD2   
2201 N N     . LEU A 286 ? 0.7173 0.7709 0.7049 -0.1013 0.0008  0.1063  286  LEU A N     
2202 C CA    . LEU A 286 ? 0.6650 0.7194 0.6589 -0.0958 0.0005  0.1072  286  LEU A CA    
2203 C C     . LEU A 286 ? 0.7337 0.8056 0.7415 -0.0973 -0.0026 0.1147  286  LEU A C     
2204 O O     . LEU A 286 ? 0.8042 0.8760 0.8090 -0.0997 -0.0052 0.1169  286  LEU A O     
2205 C CB    . LEU A 286 ? 0.6247 0.6631 0.6008 -0.0979 0.0001  0.1038  286  LEU A CB    
2206 C CG    . LEU A 286 ? 0.6232 0.6465 0.5921 -0.0909 0.0043  0.0969  286  LEU A CG    
2207 C CD1   . LEU A 286 ? 0.5920 0.5993 0.5424 -0.0930 0.0044  0.0942  286  LEU A CD1   
2208 C CD2   . LEU A 286 ? 0.6565 0.6850 0.6413 -0.0808 0.0064  0.0962  286  LEU A CD2   
2209 N N     . THR A 287 ? 0.7462 0.8328 0.7692 -0.0956 -0.0021 0.1188  287  THR A N     
2210 C CA    . THR A 287 ? 0.7581 0.8626 0.7969 -0.0949 -0.0041 0.1263  287  THR A CA    
2211 C C     . THR A 287 ? 0.7766 0.8878 0.8322 -0.0849 0.0000  0.1269  287  THR A C     
2212 O O     . THR A 287 ? 0.8025 0.9050 0.8569 -0.0799 0.0036  0.1217  287  THR A O     
2213 C CB    . THR A 287 ? 0.8182 0.9366 0.8589 -0.1039 -0.0075 0.1327  287  THR A CB    
2214 O OG1   . THR A 287 ? 0.7193 0.8361 0.7575 -0.1056 -0.0056 0.1306  287  THR A OG1   
2215 C CG2   . THR A 287 ? 0.9025 1.0165 0.9278 -0.1145 -0.0119 0.1338  287  THR A CG2   
2216 N N     . ASP A 288 ? 0.7446 0.8708 0.8150 -0.0820 -0.0005 0.1334  288  ASP A N     
2217 C CA    . ASP A 288 ? 0.7956 0.9278 0.8810 -0.0728 0.0038  0.1348  288  ASP A CA    
2218 C C     . ASP A 288 ? 0.8617 0.9980 0.9510 -0.0732 0.0060  0.1354  288  ASP A C     
2219 O O     . ASP A 288 ? 0.9406 1.0703 1.0325 -0.0669 0.0102  0.1316  288  ASP A O     
2220 C CB    . ASP A 288 ? 0.8656 1.0138 0.9653 -0.0701 0.0031  0.1427  288  ASP A CB    
2221 C CG    . ASP A 288 ? 0.9251 1.0693 1.0216 -0.0692 0.0012  0.1421  288  ASP A CG    
2222 O OD1   . ASP A 288 ? 0.9523 1.1074 1.0520 -0.0732 -0.0023 0.1481  288  ASP A OD1   
2223 O OD2   . ASP A 288 ? 0.9438 1.0745 1.0348 -0.0646 0.0032  0.1358  288  ASP A OD2   
2224 N N     . GLU A 289 ? 0.7658 0.9129 0.8552 -0.0811 0.0029  0.1404  289  GLU A N     
2225 C CA    . GLU A 289 ? 0.7333 0.8865 0.8275 -0.0820 0.0047  0.1421  289  GLU A CA    
2226 C C     . GLU A 289 ? 0.7988 0.9358 0.8802 -0.0833 0.0064  0.1339  289  GLU A C     
2227 O O     . GLU A 289 ? 0.7531 0.8905 0.8389 -0.0808 0.0095  0.1331  289  GLU A O     
2228 C CB    . GLU A 289 ? 0.7364 0.9058 0.8328 -0.0911 0.0004  0.1497  289  GLU A CB    
2229 N N     . GLY A 290 ? 0.8229 0.9455 0.8882 -0.0871 0.0047  0.1282  290  GLY A N     
2230 C CA    . GLY A 290 ? 0.7696 0.8762 0.8214 -0.0881 0.0064  0.1205  290  GLY A CA    
2231 C C     . GLY A 290 ? 0.7049 0.7998 0.7579 -0.0786 0.0108  0.1145  290  GLY A C     
2232 O O     . GLY A 290 ? 0.7164 0.8049 0.7684 -0.0758 0.0139  0.1105  290  GLY A O     
2233 N N     . LEU A 291 ? 0.6466 0.7388 0.7016 -0.0739 0.0108  0.1139  291  LEU A N     
2234 C CA    . LEU A 291 ? 0.6777 0.7597 0.7337 -0.0655 0.0146  0.1086  291  LEU A CA    
2235 C C     . LEU A 291 ? 0.7392 0.8279 0.8100 -0.0586 0.0185  0.1107  291  LEU A C     
2236 O O     . LEU A 291 ? 0.7645 0.8442 0.8350 -0.0528 0.0220  0.1060  291  LEU A O     
2237 C CB    . LEU A 291 ? 0.6523 0.7312 0.7074 -0.0626 0.0136  0.1081  291  LEU A CB    
2238 C CG    . LEU A 291 ? 0.6581 0.7260 0.6966 -0.0678 0.0110  0.1049  291  LEU A CG    
2239 C CD1   . LEU A 291 ? 0.6212 0.6862 0.6603 -0.0639 0.0105  0.1044  291  LEU A CD1   
2240 C CD2   . LEU A 291 ? 0.5968 0.6498 0.6220 -0.0679 0.0130  0.0980  291  LEU A CD2   
2241 N N     . GLU A 292 ? 0.7639 0.8679 0.8468 -0.0591 0.0180  0.1180  292  GLU A N     
2242 C CA    . GLU A 292 ? 0.8120 0.9221 0.9082 -0.0526 0.0223  0.1208  292  GLU A CA    
2243 C C     . GLU A 292 ? 0.7814 0.8876 0.8754 -0.0537 0.0244  0.1182  292  GLU A C     
2244 O O     . GLU A 292 ? 0.8406 0.9406 0.9378 -0.0477 0.0287  0.1155  292  GLU A O     
2245 C CB    . GLU A 292 ? 0.9300 1.0583 1.0398 -0.0525 0.0215  0.1301  292  GLU A CB    
2246 C CG    . GLU A 292 ? 1.0688 1.2022 1.1920 -0.0444 0.0268  0.1336  292  GLU A CG    
2247 C CD    . GLU A 292 ? 1.2250 1.3774 1.3613 -0.0442 0.0264  0.1436  292  GLU A CD    
2248 O OE1   . GLU A 292 ? 1.2757 1.4382 1.4110 -0.0512 0.0216  0.1477  292  GLU A OE1   
2249 O OE2   . GLU A 292 ? 1.2990 1.4560 1.4462 -0.0372 0.0311  0.1476  292  GLU A OE2   
2250 N N     . ALA A 293 ? 0.7083 0.8176 0.7960 -0.0617 0.0213  0.1191  293  ALA A N     
2251 C CA    . ALA A 293 ? 0.6833 0.7889 0.7678 -0.0635 0.0231  0.1165  293  ALA A CA    
2252 C C     . ALA A 293 ? 0.6873 0.7748 0.7621 -0.0599 0.0258  0.1078  293  ALA A C     
2253 O O     . ALA A 293 ? 0.7080 0.7915 0.7858 -0.0561 0.0295  0.1056  293  ALA A O     
2254 C CB    . ALA A 293 ? 0.6554 0.7646 0.7309 -0.0738 0.0190  0.1178  293  ALA A CB    
2255 N N     . VAL A 294 ? 0.6465 0.7234 0.7097 -0.0609 0.0242  0.1030  294  VAL A N     
2256 C CA    . VAL A 294 ? 0.6417 0.7025 0.6955 -0.0573 0.0267  0.0951  294  VAL A CA    
2257 C C     . VAL A 294 ? 0.6035 0.6624 0.6665 -0.0487 0.0303  0.0944  294  VAL A C     
2258 O O     . VAL A 294 ? 0.6531 0.7041 0.7156 -0.0447 0.0336  0.0904  294  VAL A O     
2259 C CB    . VAL A 294 ? 0.6215 0.6718 0.6606 -0.0600 0.0244  0.0910  294  VAL A CB    
2260 C CG1   . VAL A 294 ? 0.5473 0.5825 0.5778 -0.0556 0.0273  0.0836  294  VAL A CG1   
2261 C CG2   . VAL A 294 ? 0.6197 0.6696 0.6471 -0.0693 0.0212  0.0915  294  VAL A CG2   
2262 N N     . ASN A 295 ? 0.6158 0.6816 0.6865 -0.0461 0.0296  0.0983  295  ASN A N     
2263 C CA    . ASN A 295 ? 0.5584 0.6220 0.6363 -0.0385 0.0329  0.0978  295  ASN A CA    
2264 C C     . ASN A 295 ? 0.6268 0.6934 0.7148 -0.0342 0.0372  0.1000  295  ASN A C     
2265 O O     . ASN A 295 ? 0.6012 0.6596 0.6897 -0.0291 0.0408  0.0967  295  ASN A O     
2266 C CB    . ASN A 295 ? 0.6061 0.6779 0.6905 -0.0371 0.0314  0.1024  295  ASN A CB    
2267 C CG    . ASN A 295 ? 0.6869 0.7528 0.7737 -0.0305 0.0341  0.1001  295  ASN A CG    
2268 O OD1   . ASN A 295 ? 0.6886 0.7449 0.7669 -0.0300 0.0334  0.0951  295  ASN A OD1   
2269 N ND2   . ASN A 295 ? 0.7082 0.7796 0.8060 -0.0256 0.0374  0.1041  295  ASN A ND2   
2270 N N     . LYS A 296 ? 0.6404 0.7188 0.7359 -0.0366 0.0368  0.1059  296  LYS A N     
2271 C CA    . LYS A 296 ? 0.7175 0.7997 0.8231 -0.0324 0.0412  0.1092  296  LYS A CA    
2272 C C     . LYS A 296 ? 0.7232 0.7943 0.8228 -0.0322 0.0436  0.1036  296  LYS A C     
2273 O O     . LYS A 296 ? 0.7102 0.7784 0.8153 -0.0275 0.0482  0.1039  296  LYS A O     
2274 C CB    . LYS A 296 ? 0.8239 0.9227 0.9391 -0.0352 0.0401  0.1174  296  LYS A CB    
2275 C CG    . LYS A 296 ? 0.9365 1.0470 1.0628 -0.0316 0.0407  0.1247  296  LYS A CG    
2276 C CD    . LYS A 296 ? 1.0574 1.1853 1.1944 -0.0335 0.0403  0.1336  296  LYS A CD    
2277 C CE    . LYS A 296 ? 1.1707 1.2983 1.3115 -0.0320 0.0442  0.1344  296  LYS A CE    
2278 N NZ    . LYS A 296 ? 1.1803 1.2984 1.3246 -0.0237 0.0506  0.1329  296  LYS A NZ    
2279 N N     . ASP A 297 ? 0.6919 0.7562 0.7796 -0.0374 0.0408  0.0985  297  ASP A N     
2280 C CA    . ASP A 297 ? 0.7104 0.7631 0.7906 -0.0374 0.0428  0.0925  297  ASP A CA    
2281 C C     . ASP A 297 ? 0.6859 0.7255 0.7609 -0.0325 0.0450  0.0864  297  ASP A C     
2282 O O     . ASP A 297 ? 0.6448 0.6781 0.7222 -0.0282 0.0489  0.0845  297  ASP A O     
2283 C CB    . ASP A 297 ? 0.6834 0.7332 0.7515 -0.0448 0.0394  0.0895  297  ASP A CB    
2284 C CG    . ASP A 297 ? 0.7287 0.7666 0.7886 -0.0449 0.0416  0.0833  297  ASP A CG    
2285 O OD1   . ASP A 297 ? 0.7534 0.7875 0.8188 -0.0399 0.0455  0.0824  297  ASP A OD1   
2286 O OD2   . ASP A 297 ? 0.7157 0.7473 0.7628 -0.0499 0.0396  0.0794  297  ASP A OD2   
2287 N N     . LYS A 298 ? 0.6569 0.6923 0.7242 -0.0335 0.0424  0.0837  298  LYS A N     
2288 C CA    . LYS A 298 ? 0.5955 0.6209 0.6588 -0.0290 0.0439  0.0789  298  LYS A CA    
2289 C C     . LYS A 298 ? 0.6080 0.6368 0.6713 -0.0288 0.0414  0.0806  298  LYS A C     
2290 O O     . LYS A 298 ? 0.5721 0.6021 0.6286 -0.0332 0.0379  0.0806  298  LYS A O     
2291 C CB    . LYS A 298 ? 0.4882 0.5013 0.5381 -0.0305 0.0437  0.0721  298  LYS A CB    
2292 C CG    . LYS A 298 ? 0.5424 0.5515 0.5901 -0.0318 0.0456  0.0700  298  LYS A CG    
2293 C CD    . LYS A 298 ? 0.6907 0.6910 0.7395 -0.0268 0.0495  0.0664  298  LYS A CD    
2294 C CE    . LYS A 298 ? 0.7917 0.7871 0.8378 -0.0281 0.0514  0.0640  298  LYS A CE    
2295 N NZ    . LYS A 298 ? 0.8293 0.8141 0.8736 -0.0239 0.0548  0.0597  298  LYS A NZ    
2296 N N     . PRO A 299 ? 0.5527 0.5824 0.6227 -0.0239 0.0434  0.0819  299  PRO A N     
2297 C CA    . PRO A 299 ? 0.4940 0.5271 0.5647 -0.0234 0.0412  0.0835  299  PRO A CA    
2298 C C     . PRO A 299 ? 0.5176 0.5431 0.5760 -0.0257 0.0385  0.0790  299  PRO A C     
2299 O O     . PRO A 299 ? 0.4759 0.4917 0.5263 -0.0249 0.0396  0.0738  299  PRO A O     
2300 C CB    . PRO A 299 ? 0.4836 0.5139 0.5597 -0.0177 0.0447  0.0834  299  PRO A CB    
2301 C CG    . PRO A 299 ? 0.5391 0.5696 0.6216 -0.0155 0.0486  0.0850  299  PRO A CG    
2302 C CD    . PRO A 299 ? 0.5394 0.5660 0.6157 -0.0189 0.0479  0.0820  299  PRO A CD    
2303 N N     . LEU A 300 ? 0.5545 0.5844 0.6112 -0.0282 0.0353  0.0811  300  LEU A N     
2304 C CA    . LEU A 300 ? 0.4875 0.5103 0.5319 -0.0306 0.0329  0.0778  300  LEU A CA    
2305 C C     . LEU A 300 ? 0.4756 0.4944 0.5188 -0.0267 0.0333  0.0759  300  LEU A C     
2306 O O     . LEU A 300 ? 0.4915 0.5027 0.5245 -0.0270 0.0325  0.0725  300  LEU A O     
2307 C CB    . LEU A 300 ? 0.5695 0.5982 0.6112 -0.0364 0.0292  0.0814  300  LEU A CB    
2308 C CG    . LEU A 300 ? 0.5322 0.5609 0.5675 -0.0426 0.0278  0.0815  300  LEU A CG    
2309 C CD1   . LEU A 300 ? 0.5172 0.5559 0.5546 -0.0482 0.0243  0.0871  300  LEU A CD1   
2310 C CD2   . LEU A 300 ? 0.4748 0.4907 0.4940 -0.0444 0.0278  0.0762  300  LEU A CD2   
2311 N N     . GLY A 301 ? 0.4589 0.4829 0.5122 -0.0230 0.0346  0.0784  301  GLY A N     
2312 C CA    . GLY A 301 ? 0.5022 0.5242 0.5552 -0.0200 0.0345  0.0776  301  GLY A CA    
2313 C C     . GLY A 301 ? 0.5389 0.5682 0.5951 -0.0217 0.0318  0.0817  301  GLY A C     
2314 O O     . GLY A 301 ? 0.5495 0.5874 0.6124 -0.0237 0.0310  0.0863  301  GLY A O     
2315 N N     . ALA A 302 ? 0.4997 0.5259 0.5514 -0.0210 0.0305  0.0805  302  ALA A N     
2316 C CA    . ALA A 302 ? 0.4961 0.5280 0.5502 -0.0226 0.0279  0.0841  302  ALA A CA    
2317 C C     . ALA A 302 ? 0.4761 0.5072 0.5216 -0.0284 0.0245  0.0849  302  ALA A C     
2318 O O     . ALA A 302 ? 0.5165 0.5395 0.5511 -0.0296 0.0235  0.0821  302  ALA A O     
2319 C CB    . ALA A 302 ? 0.4230 0.4518 0.4761 -0.0194 0.0280  0.0826  302  ALA A CB    
2320 N N     . VAL A 303 ? 0.4427 0.4819 0.4925 -0.0322 0.0230  0.0890  303  VAL A N     
2321 C CA    . VAL A 303 ? 0.5432 0.5816 0.5842 -0.0389 0.0199  0.0900  303  VAL A CA    
2322 C C     . VAL A 303 ? 0.6064 0.6427 0.6410 -0.0415 0.0170  0.0910  303  VAL A C     
2323 O O     . VAL A 303 ? 0.5983 0.6383 0.6390 -0.0388 0.0167  0.0928  303  VAL A O     
2324 C CB    . VAL A 303 ? 0.5356 0.5852 0.5839 -0.0428 0.0188  0.0950  303  VAL A CB    
2325 C CG1   . VAL A 303 ? 0.4818 0.5327 0.5363 -0.0400 0.0220  0.0942  303  VAL A CG1   
2326 C CG2   . VAL A 303 ? 0.4828 0.5440 0.5423 -0.0418 0.0175  0.1007  303  VAL A CG2   
2327 N N     . ALA A 304 ? 0.6315 0.6610 0.6530 -0.0470 0.0153  0.0899  304  ALA A N     
2328 C CA    . ALA A 304 ? 0.6159 0.6401 0.6281 -0.0497 0.0130  0.0902  304  ALA A CA    
2329 C C     . ALA A 304 ? 0.6343 0.6685 0.6517 -0.0543 0.0096  0.0959  304  ALA A C     
2330 O O     . ALA A 304 ? 0.6597 0.6920 0.6737 -0.0553 0.0078  0.0971  304  ALA A O     
2331 C CB    . ALA A 304 ? 0.4986 0.5105 0.4932 -0.0539 0.0130  0.0872  304  ALA A CB    
2332 N N     . LEU A 305 ? 0.6464 0.6915 0.6719 -0.0570 0.0087  0.0997  305  LEU A N     
2333 C CA    . LEU A 305 ? 0.6824 0.7387 0.7129 -0.0620 0.0052  0.1058  305  LEU A CA    
2334 C C     . LEU A 305 ? 0.7262 0.7915 0.7702 -0.0568 0.0055  0.1090  305  LEU A C     
2335 O O     . LEU A 305 ? 0.7836 0.8551 0.8395 -0.0512 0.0082  0.1098  305  LEU A O     
2336 C CB    . LEU A 305 ? 0.6729 0.7392 0.7083 -0.0664 0.0045  0.1093  305  LEU A CB    
2337 C CG    . LEU A 305 ? 0.6694 0.7469 0.7065 -0.0739 0.0003  0.1158  305  LEU A CG    
2338 C CD1   . LEU A 305 ? 0.6143 0.6819 0.6342 -0.0816 -0.0027 0.1147  305  LEU A CD1   
2339 C CD2   . LEU A 305 ? 0.6872 0.7752 0.7301 -0.0773 0.0001  0.1191  305  LEU A CD2   
2340 N N     . LYS A 306 ? 0.7211 0.7860 0.7623 -0.0587 0.0029  0.1108  306  LYS A N     
2341 C CA    . LYS A 306 ? 0.7363 0.8082 0.7885 -0.0539 0.0032  0.1135  306  LYS A CA    
2342 C C     . LYS A 306 ? 0.7988 0.8865 0.8663 -0.0522 0.0036  0.1193  306  LYS A C     
2343 O O     . LYS A 306 ? 0.8538 0.9456 0.9315 -0.0456 0.0063  0.1202  306  LYS A O     
2344 C CB    . LYS A 306 ? 0.7606 0.8301 0.8066 -0.0576 -0.0002 0.1151  306  LYS A CB    
2345 C CG    . LYS A 306 ? 0.7710 0.8248 0.8037 -0.0569 0.0003  0.1099  306  LYS A CG    
2346 C CD    . LYS A 306 ? 0.7295 0.7808 0.7567 -0.0603 -0.0027 0.1119  306  LYS A CD    
2347 C CE    . LYS A 306 ? 0.7452 0.7807 0.7589 -0.0592 -0.0018 0.1072  306  LYS A CE    
2348 N NZ    . LYS A 306 ? 0.7725 0.8037 0.7790 -0.0631 -0.0046 0.1092  306  LYS A NZ    
2349 N N     . SER A 307 ? 0.8215 0.9180 0.8901 -0.0582 0.0014  0.1236  307  SER A N     
2350 C CA    . SER A 307 ? 0.8543 0.9674 0.9374 -0.0571 0.0016  0.1304  307  SER A CA    
2351 C C     . SER A 307 ? 0.9455 1.0615 1.0381 -0.0507 0.0063  0.1300  307  SER A C     
2352 O O     . SER A 307 ? 0.9755 1.1031 1.0808 -0.0467 0.0081  0.1353  307  SER A O     
2353 C CB    . SER A 307 ? 0.8315 0.9540 0.9127 -0.0661 -0.0025 0.1356  307  SER A CB    
2354 O OG    . SER A 307 ? 0.8301 0.9464 0.9023 -0.0706 -0.0024 0.1324  307  SER A OG    
2355 N N     . TYR A 308 ? 0.9473 1.0523 1.0333 -0.0494 0.0085  0.1240  308  TYR A N     
2356 C CA    . TYR A 308 ? 0.9720 1.0777 1.0654 -0.0439 0.0130  0.1232  308  TYR A CA    
2357 C C     . TYR A 308 ? 1.1010 1.2036 1.2004 -0.0357 0.0168  0.1216  308  TYR A C     
2358 O O     . TYR A 308 ? 1.1497 1.2543 1.2568 -0.0305 0.0209  0.1224  308  TYR A O     
2359 C CB    . TYR A 308 ? 0.8812 0.9757 0.9648 -0.0456 0.0140  0.1171  308  TYR A CB    
2360 C CG    . TYR A 308 ? 0.9600 1.0579 1.0500 -0.0434 0.0172  0.1178  308  TYR A CG    
2361 C CD1   . TYR A 308 ? 0.9366 1.0409 1.0263 -0.0490 0.0156  0.1205  308  TYR A CD1   
2362 C CD2   . TYR A 308 ? 0.9995 1.0937 1.0953 -0.0361 0.0219  0.1157  308  TYR A CD2   
2363 C CE1   . TYR A 308 ? 0.9274 1.0345 1.0231 -0.0469 0.0187  0.1212  308  TYR A CE1   
2364 C CE2   . TYR A 308 ? 0.9443 1.0403 1.0453 -0.0341 0.0251  0.1164  308  TYR A CE2   
2365 C CZ    . TYR A 308 ? 0.9188 1.0214 1.0200 -0.0393 0.0235  0.1191  308  TYR A CZ    
2366 O OH    . TYR A 308 ? 0.9446 1.0489 1.0511 -0.0373 0.0269  0.1199  308  TYR A OH    
2367 N N     . GLU A 309 ? 1.2011 1.2982 1.2962 -0.0347 0.0156  0.1196  309  GLU A N     
2368 C CA    . GLU A 309 ? 1.3077 1.4009 1.4067 -0.0277 0.0189  0.1177  309  GLU A CA    
2369 C C     . GLU A 309 ? 1.3972 1.4992 1.5087 -0.0224 0.0227  0.1224  309  GLU A C     
2370 O O     . GLU A 309 ? 1.4199 1.5167 1.5337 -0.0167 0.0269  0.1201  309  GLU A O     
2371 C CB    . GLU A 309 ? 1.3072 1.3989 1.4034 -0.0282 0.0164  0.1178  309  GLU A CB    
2372 N N     . GLU A 310 ? 1.4453 1.5604 1.5643 -0.0244 0.0215  0.1292  310  GLU A N     
2373 C CA    . GLU A 310 ? 1.4458 1.5702 1.5767 -0.0192 0.0255  0.1348  310  GLU A CA    
2374 C C     . GLU A 310 ? 1.4320 1.5498 1.5641 -0.0147 0.0308  0.1320  310  GLU A C     
2375 O O     . GLU A 310 ? 1.4602 1.5727 1.5941 -0.0087 0.0351  0.1307  310  GLU A O     
2376 C CB    . GLU A 310 ? 1.4325 1.5722 1.5702 -0.0232 0.0232  0.1424  310  GLU A CB    
2377 N N     . GLU A 311 ? 1.3720 1.4894 1.5021 -0.0178 0.0304  0.1310  311  GLU A N     
2378 C CA    . GLU A 311 ? 1.3000 1.4114 1.4313 -0.0140 0.0352  0.1287  311  GLU A CA    
2379 C C     . GLU A 311 ? 1.3406 1.4372 1.4647 -0.0110 0.0375  0.1213  311  GLU A C     
2380 O O     . GLU A 311 ? 1.3584 1.4503 1.4851 -0.0058 0.0424  0.1207  311  GLU A O     
2381 C CB    . GLU A 311 ? 1.2296 1.3421 1.3585 -0.0187 0.0338  0.1281  311  GLU A CB    
2382 N N     . LEU A 312 ? 1.3501 1.4394 1.4648 -0.0143 0.0339  0.1161  312  LEU A N     
2383 C CA    . LEU A 312 ? 1.3317 1.4081 1.4391 -0.0121 0.0355  0.1094  312  LEU A CA    
2384 C C     . LEU A 312 ? 1.3806 1.4541 1.4905 -0.0068 0.0386  0.1091  312  LEU A C     
2385 O O     . LEU A 312 ? 1.3799 1.4445 1.4867 -0.0040 0.0416  0.1050  312  LEU A O     
2386 C CB    . LEU A 312 ? 1.2630 1.3331 1.3597 -0.0164 0.0313  0.1049  312  LEU A CB    
2387 C CG    . LEU A 312 ? 1.2067 1.2755 1.2970 -0.0218 0.0288  0.1034  312  LEU A CG    
2388 C CD1   . LEU A 312 ? 1.1641 1.2226 1.2420 -0.0241 0.0266  0.0979  312  LEU A CD1   
2389 C CD2   . LEU A 312 ? 1.1567 1.2234 1.2489 -0.0204 0.0321  0.1022  312  LEU A CD2   
2390 N N     . ALA A 313 ? 1.4043 1.4851 1.5193 -0.0058 0.0378  0.1135  313  ALA A N     
2391 C CA    . ALA A 313 ? 1.3932 1.4712 1.5099 -0.0011 0.0407  0.1134  313  ALA A CA    
2392 C C     . ALA A 313 ? 1.3165 1.3922 1.4376 0.0039  0.0469  0.1148  313  ALA A C     
2393 O O     . ALA A 313 ? 1.3192 1.3867 1.4373 0.0069  0.0502  0.1118  313  ALA A O     
2394 C CB    . ALA A 313 ? 1.4046 1.4916 1.5263 -0.0010 0.0388  0.1184  313  ALA A CB    
2395 N N     . LYS A 314 ? 1.2107 1.2934 1.3382 0.0044  0.0487  0.1196  314  LYS A N     
2396 C CA    . LYS A 314 ? 1.1542 1.2346 1.2857 0.0094  0.0552  0.1220  314  LYS A CA    
2397 C C     . LYS A 314 ? 1.0946 1.1629 1.2200 0.0097  0.0578  0.1162  314  LYS A C     
2398 O O     . LYS A 314 ? 1.0990 1.1602 1.2236 0.0136  0.0631  0.1159  314  LYS A O     
2399 C CB    . LYS A 314 ? 1.1439 1.2357 1.2842 0.0099  0.0563  0.1291  314  LYS A CB    
2400 N N     . ASP A 315 ? 0.9872 1.0525 1.1074 0.0055  0.0541  0.1118  315  ASP A N     
2401 C CA    . ASP A 315 ? 0.7672 0.8223 0.8821 0.0054  0.0562  0.1069  315  ASP A CA    
2402 C C     . ASP A 315 ? 0.6025 0.6471 0.7096 0.0058  0.0564  0.1009  315  ASP A C     
2403 O O     . ASP A 315 ? 0.6670 0.7100 0.7686 0.0030  0.0522  0.0972  315  ASP A O     
2404 C CB    . ASP A 315 ? 0.7563 0.8127 0.8684 0.0009  0.0526  0.1049  315  ASP A CB    
2405 C CG    . ASP A 315 ? 0.6870 0.7344 0.7952 0.0012  0.0552  0.1010  315  ASP A CG    
2406 O OD1   . ASP A 315 ? 0.6419 0.6809 0.7479 0.0041  0.0591  0.0988  315  ASP A OD1   
2407 O OD2   . ASP A 315 ? 0.6574 0.7059 0.7642 -0.0019 0.0534  0.1001  315  ASP A OD2   
2408 N N     . PRO A 316 ? 0.5619 0.5992 0.6680 0.0091  0.0614  0.1002  316  PRO A N     
2409 C CA    . PRO A 316 ? 0.5908 0.6189 0.6897 0.0092  0.0618  0.0950  316  PRO A CA    
2410 C C     . PRO A 316 ? 0.6371 0.6588 0.7291 0.0065  0.0597  0.0893  316  PRO A C     
2411 O O     . PRO A 316 ? 0.7020 0.7187 0.7882 0.0057  0.0584  0.0853  316  PRO A O     
2412 C CB    . PRO A 316 ? 0.6114 0.6329 0.7103 0.0127  0.0683  0.0965  316  PRO A CB    
2413 C CG    . PRO A 316 ? 0.6449 0.6696 0.7496 0.0144  0.0715  0.1010  316  PRO A CG    
2414 C CD    . PRO A 316 ? 0.6138 0.6508 0.7248 0.0128  0.0673  0.1046  316  PRO A CD    
2415 N N     . ARG A 317 ? 0.5379 0.5602 0.6307 0.0051  0.0593  0.0893  317  ARG A N     
2416 C CA    . ARG A 317 ? 0.5432 0.5598 0.6292 0.0027  0.0573  0.0841  317  ARG A CA    
2417 C C     . ARG A 317 ? 0.5184 0.5379 0.6005 0.0000  0.0521  0.0822  317  ARG A C     
2418 O O     . ARG A 317 ? 0.5162 0.5304 0.5915 -0.0008 0.0506  0.0778  317  ARG A O     
2419 C CB    . ARG A 317 ? 0.4299 0.4466 0.5174 0.0017  0.0581  0.0845  317  ARG A CB    
2420 C CG    . ARG A 317 ? 0.3993 0.4124 0.4903 0.0045  0.0637  0.0868  317  ARG A CG    
2421 C CD    . ARG A 317 ? 0.4172 0.4321 0.5108 0.0035  0.0642  0.0880  317  ARG A CD    
2422 N NE    . ARG A 317 ? 0.4032 0.4295 0.5026 0.0020  0.0615  0.0925  317  ARG A NE    
2423 C CZ    . ARG A 317 ? 0.5288 0.5594 0.6309 0.0003  0.0610  0.0942  317  ARG A CZ    
2424 N NH1   . ARG A 317 ? 0.5200 0.5436 0.6194 0.0001  0.0631  0.0915  317  ARG A NH1   
2425 N NH2   . ARG A 317 ? 0.5139 0.5558 0.6210 -0.0018 0.0582  0.0987  317  ARG A NH2   
2426 N N     . ILE A 318 ? 0.5642 0.5920 0.6502 -0.0013 0.0495  0.0858  318  ILE A N     
2427 C CA    . ILE A 318 ? 0.5834 0.6133 0.6652 -0.0040 0.0449  0.0848  318  ILE A CA    
2428 C C     . ILE A 318 ? 0.5441 0.5715 0.6235 -0.0024 0.0445  0.0832  318  ILE A C     
2429 O O     . ILE A 318 ? 0.6077 0.6324 0.6808 -0.0038 0.0418  0.0804  318  ILE A O     
2430 C CB    . ILE A 318 ? 0.6327 0.6723 0.7194 -0.0061 0.0423  0.0897  318  ILE A CB    
2431 C CG1   . ILE A 318 ? 0.5622 0.6049 0.6507 -0.0084 0.0423  0.0913  318  ILE A CG1   
2432 C CG2   . ILE A 318 ? 0.5299 0.5698 0.6109 -0.0091 0.0379  0.0886  318  ILE A CG2   
2433 C CD1   . ILE A 318 ? 0.6577 0.6954 0.7373 -0.0120 0.0397  0.0872  318  ILE A CD1   
2434 N N     . ALA A 319 ? 0.5244 0.5525 0.6085 0.0005  0.0476  0.0853  319  ALA A N     
2435 C CA    . ALA A 319 ? 0.5689 0.5947 0.6509 0.0019  0.0476  0.0839  319  ALA A CA    
2436 C C     . ALA A 319 ? 0.5647 0.5827 0.6398 0.0018  0.0482  0.0789  319  ALA A C     
2437 O O     . ALA A 319 ? 0.5292 0.5458 0.5998 0.0013  0.0459  0.0766  319  ALA A O     
2438 C CB    . ALA A 319 ? 0.5617 0.5887 0.6488 0.0050  0.0515  0.0871  319  ALA A CB    
2439 N N     . ALA A 320 ? 0.5586 0.5717 0.6328 0.0024  0.0512  0.0776  320  ALA A N     
2440 C CA    . ALA A 320 ? 0.4877 0.4942 0.5555 0.0019  0.0515  0.0732  320  ALA A CA    
2441 C C     . ALA A 320 ? 0.4145 0.4208 0.4769 0.0001  0.0477  0.0705  320  ALA A C     
2442 O O     . ALA A 320 ? 0.4589 0.4628 0.5161 0.0000  0.0465  0.0679  320  ALA A O     
2443 C CB    . ALA A 320 ? 0.5577 0.5588 0.6253 0.0023  0.0551  0.0725  320  ALA A CB    
2444 N N     . THR A 321 ? 0.4291 0.4377 0.4921 -0.0014 0.0462  0.0715  321  THR A N     
2445 C CA    . THR A 321 ? 0.5035 0.5107 0.5600 -0.0033 0.0432  0.0693  321  THR A CA    
2446 C C     . THR A 321 ? 0.5936 0.6023 0.6471 -0.0035 0.0405  0.0694  321  THR A C     
2447 O O     . THR A 321 ? 0.5601 0.5651 0.6069 -0.0033 0.0395  0.0668  321  THR A O     
2448 C CB    . THR A 321 ? 0.4557 0.4660 0.5134 -0.0057 0.0419  0.0712  321  THR A CB    
2449 O OG1   . THR A 321 ? 0.4795 0.4886 0.5405 -0.0052 0.0447  0.0714  321  THR A OG1   
2450 C CG2   . THR A 321 ? 0.3578 0.3648 0.4067 -0.0080 0.0394  0.0688  321  THR A CG2   
2451 N N     . MET A 322 ? 0.5431 0.5572 0.6015 -0.0037 0.0395  0.0727  322  MET A N     
2452 C CA    . MET A 322 ? 0.5848 0.6001 0.6410 -0.0038 0.0371  0.0731  322  MET A CA    
2453 C C     . MET A 322 ? 0.4710 0.4833 0.5248 -0.0018 0.0381  0.0709  322  MET A C     
2454 O O     . MET A 322 ? 0.4493 0.4597 0.4977 -0.0017 0.0364  0.0695  322  MET A O     
2455 C CB    . MET A 322 ? 0.6807 0.7024 0.7436 -0.0040 0.0364  0.0773  322  MET A CB    
2456 C CG    . MET A 322 ? 0.7585 0.7839 0.8209 -0.0072 0.0335  0.0798  322  MET A CG    
2457 S SD    . MET A 322 ? 1.4667 1.4872 1.5183 -0.0095 0.0301  0.0777  322  MET A SD    
2458 C CE    . MET A 322 ? 0.5554 0.5718 0.6005 -0.0120 0.0301  0.0757  322  MET A CE    
2459 N N     . GLU A 323 ? 0.4341 0.4459 0.4918 -0.0002 0.0410  0.0709  323  GLU A N     
2460 C CA    . GLU A 323 ? 0.4555 0.4648 0.5109 0.0010  0.0421  0.0690  323  GLU A CA    
2461 C C     . GLU A 323 ? 0.5258 0.5314 0.5745 0.0008  0.0414  0.0658  323  GLU A C     
2462 O O     . GLU A 323 ? 0.5886 0.5941 0.6336 0.0013  0.0403  0.0648  323  GLU A O     
2463 C CB    . GLU A 323 ? 0.4931 0.5008 0.5519 0.0020  0.0459  0.0695  323  GLU A CB    
2464 C CG    . GLU A 323 ? 0.7422 0.7480 0.7992 0.0025  0.0473  0.0684  323  GLU A CG    
2465 C CD    . GLU A 323 ? 0.9373 0.9403 0.9965 0.0031  0.0515  0.0695  323  GLU A CD    
2466 O OE1   . GLU A 323 ? 0.8741 0.8780 0.9378 0.0040  0.0533  0.0721  323  GLU A OE1   
2467 O OE2   . GLU A 323 ? 1.0596 1.0593 1.1155 0.0027  0.0532  0.0682  323  GLU A OE2   
2468 N N     . ASN A 324 ? 0.4477 0.4507 0.4948 0.0002  0.0423  0.0645  324  ASN A N     
2469 C CA    . ASN A 324 ? 0.4199 0.4193 0.4603 0.0004  0.0419  0.0617  324  ASN A CA    
2470 C C     . ASN A 324 ? 0.4619 0.4611 0.4968 0.0002  0.0394  0.0615  324  ASN A C     
2471 O O     . ASN A 324 ? 0.4799 0.4777 0.5095 0.0013  0.0390  0.0602  324  ASN A O     
2472 C CB    . ASN A 324 ? 0.3612 0.3572 0.4009 -0.0002 0.0435  0.0603  324  ASN A CB    
2473 C CG    . ASN A 324 ? 0.4395 0.4332 0.4814 0.0000  0.0464  0.0597  324  ASN A CG    
2474 O OD1   . ASN A 324 ? 0.4812 0.4740 0.5209 0.0002  0.0469  0.0586  324  ASN A OD1   
2475 N ND2   . ASN A 324 ? 0.4608 0.4534 0.5067 -0.0002 0.0485  0.0608  324  ASN A ND2   
2476 N N     . ALA A 325 ? 0.4445 0.4451 0.4802 -0.0011 0.0379  0.0632  325  ALA A N     
2477 C CA    . ALA A 325 ? 0.4372 0.4360 0.4660 -0.0018 0.0359  0.0633  325  ALA A CA    
2478 C C     . ALA A 325 ? 0.4963 0.4960 0.5236 -0.0005 0.0349  0.0639  325  ALA A C     
2479 O O     . ALA A 325 ? 0.5608 0.5574 0.5809 0.0003  0.0344  0.0632  325  ALA A O     
2480 C CB    . ALA A 325 ? 0.4633 0.4637 0.4930 -0.0045 0.0343  0.0654  325  ALA A CB    
2481 N N     . GLN A 326 ? 0.4568 0.4604 0.4906 0.0000  0.0349  0.0654  326  GLN A N     
2482 C CA    . GLN A 326 ? 0.5736 0.5781 0.6065 0.0012  0.0341  0.0659  326  GLN A CA    
2483 C C     . GLN A 326 ? 0.5259 0.5294 0.5552 0.0030  0.0350  0.0641  326  GLN A C     
2484 O O     . GLN A 326 ? 0.6471 0.6498 0.6719 0.0042  0.0342  0.0643  326  GLN A O     
2485 C CB    . GLN A 326 ? 0.6082 0.6167 0.6485 0.0014  0.0344  0.0676  326  GLN A CB    
2486 C CG    . GLN A 326 ? 0.8175 0.8289 0.8628 -0.0001 0.0337  0.0701  326  GLN A CG    
2487 C CD    . GLN A 326 ? 1.0738 1.0866 1.1187 -0.0008 0.0314  0.0721  326  GLN A CD    
2488 O OE1   . GLN A 326 ? 1.1316 1.1481 1.1817 -0.0016 0.0308  0.0746  326  GLN A OE1   
2489 N NE2   . GLN A 326 ? 1.1217 1.1313 1.1601 -0.0004 0.0302  0.0712  326  GLN A NE2   
2490 N N     . LYS A 327 ? 0.4643 0.4678 0.4953 0.0032  0.0367  0.0628  327  LYS A N     
2491 C CA    . LYS A 327 ? 0.6147 0.6183 0.6427 0.0044  0.0375  0.0615  327  LYS A CA    
2492 C C     . LYS A 327 ? 0.6251 0.6258 0.6458 0.0055  0.0374  0.0604  327  LYS A C     
2493 O O     . LYS A 327 ? 0.6315 0.6331 0.6488 0.0071  0.0376  0.0602  327  LYS A O     
2494 C CB    . LYS A 327 ? 0.7291 0.7331 0.7605 0.0036  0.0394  0.0605  327  LYS A CB    
2495 C CG    . LYS A 327 ? 0.7690 0.7748 0.8060 0.0029  0.0402  0.0617  327  LYS A CG    
2496 C CD    . LYS A 327 ? 0.8618 0.8670 0.8994 0.0019  0.0423  0.0609  327  LYS A CD    
2497 C CE    . LYS A 327 ? 0.8629 0.8692 0.9037 0.0015  0.0433  0.0621  327  LYS A CE    
2498 N NZ    . LYS A 327 ? 0.8307 0.8401 0.8706 0.0023  0.0415  0.0627  327  LYS A NZ    
2499 N N     . GLY A 328 ? 0.6012 0.5986 0.6194 0.0046  0.0372  0.0601  328  GLY A N     
2500 C CA    . GLY A 328 ? 0.6883 0.6816 0.6986 0.0056  0.0377  0.0589  328  GLY A CA    
2501 C C     . GLY A 328 ? 0.6443 0.6347 0.6472 0.0066  0.0369  0.0600  328  GLY A C     
2502 O O     . GLY A 328 ? 0.6839 0.6760 0.6880 0.0069  0.0359  0.0616  328  GLY A O     
2503 N N     . GLU A 329 ? 0.5948 0.5799 0.5894 0.0071  0.0377  0.0592  329  GLU A N     
2504 C CA    . GLU A 329 ? 0.6961 0.6763 0.6812 0.0084  0.0379  0.0602  329  GLU A CA    
2505 C C     . GLU A 329 ? 0.6556 0.6293 0.6336 0.0060  0.0380  0.0596  329  GLU A C     
2506 O O     . GLU A 329 ? 0.5740 0.5459 0.5511 0.0051  0.0388  0.0578  329  GLU A O     
2507 C CB    . GLU A 329 ? 0.8521 0.8314 0.8312 0.0122  0.0397  0.0602  329  GLU A CB    
2508 C CG    . GLU A 329 ? 1.0465 1.0222 1.0174 0.0147  0.0404  0.0623  329  GLU A CG    
2509 C CD    . GLU A 329 ? 1.1594 1.1414 1.1354 0.0169  0.0400  0.0640  329  GLU A CD    
2510 O OE1   . GLU A 329 ? 1.2598 1.2423 1.2311 0.0206  0.0417  0.0653  329  GLU A OE1   
2511 O OE2   . GLU A 329 ? 1.0587 1.0454 1.0431 0.0150  0.0383  0.0643  329  GLU A OE2   
2512 N N     . ILE A 330 ? 0.5947 0.5644 0.5670 0.0044  0.0371  0.0612  330  ILE A N     
2513 C CA    . ILE A 330 ? 0.6121 0.5754 0.5765 0.0012  0.0371  0.0608  330  ILE A CA    
2514 C C     . ILE A 330 ? 0.6027 0.5578 0.5543 0.0033  0.0397  0.0596  330  ILE A C     
2515 O O     . ILE A 330 ? 0.7065 0.6586 0.6516 0.0070  0.0414  0.0605  330  ILE A O     
2516 C CB    . ILE A 330 ? 0.6301 0.5907 0.5907 -0.0018 0.0354  0.0630  330  ILE A CB    
2517 C CG1   . ILE A 330 ? 0.6440 0.6011 0.6000 -0.0069 0.0344  0.0629  330  ILE A CG1   
2518 C CG2   . ILE A 330 ? 0.7511 0.7045 0.7003 0.0006  0.0368  0.0642  330  ILE A CG2   
2519 C CD1   . ILE A 330 ? 0.8417 0.7948 0.7913 -0.0107 0.0328  0.0652  330  ILE A CD1   
2520 N N     . MET A 331 ? 0.4258 0.3775 0.3738 0.0014  0.0404  0.0577  331  MET A N     
2521 C CA    . MET A 331 ? 0.5839 0.5269 0.5187 0.0033  0.0433  0.0563  331  MET A CA    
2522 C C     . MET A 331 ? 0.6006 0.5342 0.5212 0.0031  0.0445  0.0580  331  MET A C     
2523 O O     . MET A 331 ? 0.5392 0.4703 0.4572 -0.0014 0.0428  0.0591  331  MET A O     
2524 C CB    . MET A 331 ? 0.5629 0.5028 0.4954 0.0004  0.0437  0.0539  331  MET A CB    
2525 C CG    . MET A 331 ? 0.5733 0.5188 0.5152 0.0020  0.0440  0.0519  331  MET A CG    
2526 S SD    . MET A 331 ? 0.5990 0.5396 0.5369 -0.0010 0.0449  0.0490  331  MET A SD    
2527 C CE    . MET A 331 ? 0.5236 0.4692 0.4696 -0.0070 0.0419  0.0506  331  MET A CE    
2528 N N     . PRO A 332 ? 0.6173 0.5455 0.5284 0.0079  0.0476  0.0585  332  PRO A N     
2529 C CA    . PRO A 332 ? 0.5815 0.4980 0.4761 0.0079  0.0498  0.0599  332  PRO A CA    
2530 C C     . PRO A 332 ? 0.6260 0.5335 0.5096 0.0034  0.0507  0.0581  332  PRO A C     
2531 O O     . PRO A 332 ? 0.6384 0.5485 0.5263 0.0023  0.0504  0.0556  332  PRO A O     
2532 C CB    . PRO A 332 ? 0.5674 0.4811 0.4552 0.0147  0.0537  0.0607  332  PRO A CB    
2533 C CG    . PRO A 332 ? 0.5132 0.4398 0.4165 0.0177  0.0522  0.0606  332  PRO A CG    
2534 C CD    . PRO A 332 ? 0.5209 0.4537 0.4355 0.0134  0.0493  0.0582  332  PRO A CD    
2535 N N     . ASN A 333 ? 0.6099 0.5063 0.4788 0.0006  0.0518  0.0593  333  ASN A N     
2536 C CA    . ASN A 333 ? 0.5045 0.3912 0.3605 -0.0041 0.0529  0.0577  333  ASN A CA    
2537 C C     . ASN A 333 ? 0.5722 0.4434 0.4068 -0.0014 0.0581  0.0579  333  ASN A C     
2538 O O     . ASN A 333 ? 0.5976 0.4578 0.4175 -0.0058 0.0595  0.0569  333  ASN A O     
2539 C CB    . ASN A 333 ? 0.5867 0.4732 0.4426 -0.0121 0.0495  0.0587  333  ASN A CB    
2540 C CG    . ASN A 333 ? 0.7009 0.5791 0.5459 -0.0137 0.0499  0.0616  333  ASN A CG    
2541 O OD1   . ASN A 333 ? 0.6944 0.5661 0.5312 -0.0085 0.0531  0.0630  333  ASN A OD1   
2542 N ND2   . ASN A 333 ? 0.6146 0.4930 0.4593 -0.0209 0.0467  0.0629  333  ASN A ND2   
2543 N N     . ILE A 334 ? 0.5809 0.4513 0.4133 0.0058  0.0611  0.0595  334  ILE A N     
2544 C CA    . ILE A 334 ? 0.6259 0.4815 0.4377 0.0095  0.0667  0.0605  334  ILE A CA    
2545 C C     . ILE A 334 ? 0.6739 0.5231 0.4765 0.0102  0.0697  0.0575  334  ILE A C     
2546 O O     . ILE A 334 ? 0.7616 0.6199 0.5761 0.0107  0.0680  0.0550  334  ILE A O     
2547 C CB    . ILE A 334 ? 0.6742 0.5318 0.4866 0.0177  0.0695  0.0635  334  ILE A CB    
2548 C CG1   . ILE A 334 ? 0.6854 0.5555 0.5114 0.0232  0.0693  0.0626  334  ILE A CG1   
2549 C CG2   . ILE A 334 ? 0.6231 0.4853 0.4429 0.0167  0.0667  0.0663  334  ILE A CG2   
2550 C CD1   . ILE A 334 ? 0.6440 0.5177 0.4711 0.0310  0.0718  0.0660  334  ILE A CD1   
2551 N N     . PRO A 335 ? 0.6677 0.5002 0.4481 0.0100  0.0744  0.0576  335  PRO A N     
2552 C CA    . PRO A 335 ? 0.6311 0.4556 0.4005 0.0104  0.0777  0.0546  335  PRO A CA    
2553 C C     . PRO A 335 ? 0.7181 0.5510 0.4966 0.0178  0.0791  0.0536  335  PRO A C     
2554 O O     . PRO A 335 ? 0.6550 0.4874 0.4331 0.0171  0.0796  0.0503  335  PRO A O     
2555 C CB    . PRO A 335 ? 0.5289 0.3337 0.2721 0.0118  0.0839  0.0563  335  PRO A CB    
2556 C CG    . PRO A 335 ? 0.6523 0.4532 0.3921 0.0068  0.0819  0.0591  335  PRO A CG    
2557 C CD    . PRO A 335 ? 0.6040 0.4228 0.3674 0.0085  0.0770  0.0606  335  PRO A CD    
2558 N N     . GLN A 336 ? 0.6713 0.5121 0.4579 0.0244  0.0796  0.0565  336  GLN A N     
2559 C CA    . GLN A 336 ? 0.6602 0.5087 0.4536 0.0315  0.0812  0.0563  336  GLN A CA    
2560 C C     . GLN A 336 ? 0.7136 0.5769 0.5274 0.0293  0.0764  0.0535  336  GLN A C     
2561 O O     . GLN A 336 ? 0.6949 0.5636 0.5135 0.0335  0.0774  0.0525  336  GLN A O     
2562 C CB    . GLN A 336 ? 0.6112 0.4649 0.4075 0.0385  0.0829  0.0608  336  GLN A CB    
2563 C CG    . GLN A 336 ? 0.6286 0.4895 0.4288 0.0463  0.0854  0.0618  336  GLN A CG    
2564 C CD    . GLN A 336 ? 0.7561 0.6037 0.5369 0.0508  0.0918  0.0616  336  GLN A CD    
2565 O OE1   . GLN A 336 ? 0.7865 0.6180 0.5489 0.0487  0.0951  0.0612  336  GLN A OE1   
2566 N NE2   . GLN A 336 ? 0.7484 0.6023 0.5326 0.0568  0.0936  0.0618  336  GLN A NE2   
2567 N N     . MET A 337 ? 0.6141 0.4833 0.4389 0.0227  0.0715  0.0525  337  MET A N     
2568 C CA    . MET A 337 ? 0.5958 0.4780 0.4395 0.0207  0.0673  0.0504  337  MET A CA    
2569 C C     . MET A 337 ? 0.6747 0.5547 0.5165 0.0206  0.0686  0.0467  337  MET A C     
2570 O O     . MET A 337 ? 0.6700 0.5593 0.5242 0.0223  0.0671  0.0455  337  MET A O     
2571 C CB    . MET A 337 ? 0.5290 0.4160 0.3822 0.0136  0.0627  0.0502  337  MET A CB    
2572 C CG    . MET A 337 ? 0.5537 0.4492 0.4178 0.0139  0.0600  0.0531  337  MET A CG    
2573 S SD    . MET A 337 ? 0.5955 0.5053 0.4761 0.0194  0.0589  0.0539  337  MET A SD    
2574 C CE    . MET A 337 ? 0.5820 0.5009 0.4787 0.0150  0.0552  0.0509  337  MET A CE    
2575 N N     . SER A 338 ? 0.6876 0.5548 0.5134 0.0182  0.0712  0.0449  338  SER A N     
2576 C CA    . SER A 338 ? 0.7385 0.6024 0.5616 0.0178  0.0725  0.0411  338  SER A CA    
2577 C C     . SER A 338 ? 0.7507 0.6167 0.5737 0.0253  0.0754  0.0410  338  SER A C     
2578 O O     . SER A 338 ? 0.7842 0.6562 0.6165 0.0257  0.0742  0.0386  338  SER A O     
2579 C CB    . SER A 338 ? 0.8653 0.7137 0.6686 0.0141  0.0754  0.0394  338  SER A CB    
2580 O OG    . SER A 338 ? 1.0816 0.9270 0.8829 0.0131  0.0764  0.0355  338  SER A OG    
2581 N N     . ALA A 339 ? 0.6846 0.5458 0.4969 0.0311  0.0793  0.0440  339  ALA A N     
2582 C CA    . ALA A 339 ? 0.6007 0.4649 0.4125 0.0387  0.0823  0.0450  339  ALA A CA    
2583 C C     . ALA A 339 ? 0.5950 0.4760 0.4268 0.0402  0.0785  0.0463  339  ALA A C     
2584 O O     . ALA A 339 ? 0.6015 0.4884 0.4392 0.0432  0.0786  0.0454  339  ALA A O     
2585 C CB    . ALA A 339 ? 0.5030 0.3590 0.2993 0.0448  0.0874  0.0488  339  ALA A CB    
2586 N N     . PHE A 340 ? 0.5640 0.4519 0.4054 0.0380  0.0752  0.0485  340  PHE A N     
2587 C CA    . PHE A 340 ? 0.5227 0.4256 0.3826 0.0381  0.0714  0.0495  340  PHE A CA    
2588 C C     . PHE A 340 ? 0.6073 0.5154 0.4783 0.0345  0.0686  0.0458  340  PHE A C     
2589 O O     . PHE A 340 ? 0.6020 0.5186 0.4820 0.0365  0.0678  0.0458  340  PHE A O     
2590 C CB    . PHE A 340 ? 0.4502 0.3574 0.3173 0.0350  0.0683  0.0517  340  PHE A CB    
2591 C CG    . PHE A 340 ? 0.4681 0.3891 0.3538 0.0332  0.0641  0.0518  340  PHE A CG    
2592 C CD1   . PHE A 340 ? 0.4982 0.4287 0.3909 0.0372  0.0638  0.0547  340  PHE A CD1   
2593 C CD2   . PHE A 340 ? 0.5022 0.4263 0.3978 0.0275  0.0607  0.0493  340  PHE A CD2   
2594 C CE1   . PHE A 340 ? 0.5244 0.4664 0.4326 0.0350  0.0602  0.0548  340  PHE A CE1   
2595 C CE2   . PHE A 340 ? 0.4923 0.4276 0.4036 0.0260  0.0575  0.0496  340  PHE A CE2   
2596 C CZ    . PHE A 340 ? 0.5107 0.4545 0.4278 0.0296  0.0573  0.0521  340  PHE A CZ    
2597 N N     . TRP A 341 ? 0.6289 0.5318 0.4989 0.0289  0.0673  0.0430  341  TRP A N     
2598 C CA    . TRP A 341 ? 0.6711 0.5780 0.5514 0.0253  0.0650  0.0398  341  TRP A CA    
2599 C C     . TRP A 341 ? 0.6472 0.5509 0.5231 0.0282  0.0674  0.0373  341  TRP A C     
2600 O O     . TRP A 341 ? 0.5736 0.4841 0.4600 0.0280  0.0659  0.0361  341  TRP A O     
2601 C CB    . TRP A 341 ? 0.6107 0.5129 0.4900 0.0188  0.0634  0.0379  341  TRP A CB    
2602 C CG    . TRP A 341 ? 0.5524 0.4614 0.4422 0.0150  0.0598  0.0400  341  TRP A CG    
2603 C CD1   . TRP A 341 ? 0.6086 0.5136 0.4933 0.0111  0.0589  0.0412  341  TRP A CD1   
2604 C CD2   . TRP A 341 ? 0.5108 0.4315 0.4170 0.0147  0.0568  0.0412  341  TRP A CD2   
2605 N NE1   . TRP A 341 ? 0.5926 0.5067 0.4903 0.0088  0.0555  0.0431  341  TRP A NE1   
2606 C CE2   . TRP A 341 ? 0.5708 0.4941 0.4815 0.0111  0.0543  0.0431  341  TRP A CE2   
2607 C CE3   . TRP A 341 ? 0.5136 0.4421 0.4302 0.0169  0.0562  0.0409  341  TRP A CE3   
2608 C CZ2   . TRP A 341 ? 0.5739 0.5072 0.4990 0.0100  0.0515  0.0446  341  TRP A CZ2   
2609 C CZ3   . TRP A 341 ? 0.5834 0.5211 0.5136 0.0153  0.0534  0.0424  341  TRP A CZ3   
2610 C CH2   . TRP A 341 ? 0.6610 0.6010 0.5954 0.0122  0.0513  0.0441  341  TRP A CH2   
2611 N N     . TYR A 342 ? 0.5703 0.4631 0.4299 0.0308  0.0714  0.0365  342  TYR A N     
2612 C CA    . TYR A 342 ? 0.6135 0.5027 0.4676 0.0342  0.0741  0.0343  342  TYR A CA    
2613 C C     . TYR A 342 ? 0.5670 0.4660 0.4280 0.0395  0.0742  0.0366  342  TYR A C     
2614 O O     . TYR A 342 ? 0.5112 0.4141 0.3785 0.0398  0.0735  0.0348  342  TYR A O     
2615 C CB    . TYR A 342 ? 0.5324 0.4074 0.3660 0.0368  0.0791  0.0336  342  TYR A CB    
2616 C CG    . TYR A 342 ? 0.6248 0.4895 0.4502 0.0309  0.0793  0.0302  342  TYR A CG    
2617 C CD1   . TYR A 342 ? 0.7172 0.5700 0.5261 0.0296  0.0820  0.0309  342  TYR A CD1   
2618 C CD2   . TYR A 342 ? 0.7107 0.5772 0.5444 0.0264  0.0769  0.0266  342  TYR A CD2   
2619 C CE1   . TYR A 342 ? 0.7788 0.6227 0.5797 0.0235  0.0819  0.0280  342  TYR A CE1   
2620 C CE2   . TYR A 342 ? 0.7814 0.6397 0.6081 0.0209  0.0769  0.0239  342  TYR A CE2   
2621 C CZ    . TYR A 342 ? 0.8589 0.7063 0.6693 0.0191  0.0793  0.0246  342  TYR A CZ    
2622 O OH    . TYR A 342 ? 0.9238 0.7635 0.7268 0.0128  0.0791  0.0220  342  TYR A OH    
2623 N N     . ALA A 343 ? 0.5563 0.4592 0.4161 0.0432  0.0750  0.0409  343  ALA A N     
2624 C CA    . ALA A 343 ? 0.5475 0.4605 0.4130 0.0482  0.0751  0.0440  343  ALA A CA    
2625 C C     . ALA A 343 ? 0.5721 0.4977 0.4553 0.0450  0.0707  0.0438  343  ALA A C     
2626 O O     . ALA A 343 ? 0.5390 0.4711 0.4268 0.0469  0.0704  0.0441  343  ALA A O     
2627 C CB    . ALA A 343 ? 0.5291 0.4439 0.3902 0.0524  0.0768  0.0490  343  ALA A CB    
2628 N N     . VAL A 344 ? 0.5310 0.4596 0.4232 0.0400  0.0674  0.0435  344  VAL A N     
2629 C CA    . VAL A 344 ? 0.4711 0.4103 0.3787 0.0369  0.0637  0.0435  344  VAL A CA    
2630 C C     . VAL A 344 ? 0.4420 0.3790 0.3542 0.0333  0.0627  0.0395  344  VAL A C     
2631 O O     . VAL A 344 ? 0.4555 0.3990 0.3766 0.0321  0.0611  0.0392  344  VAL A O     
2632 C CB    . VAL A 344 ? 0.4038 0.3472 0.3195 0.0334  0.0609  0.0450  344  VAL A CB    
2633 C CG1   . VAL A 344 ? 0.3777 0.3302 0.3078 0.0301  0.0577  0.0447  344  VAL A CG1   
2634 C CG2   . VAL A 344 ? 0.4515 0.3975 0.3636 0.0371  0.0618  0.0491  344  VAL A CG2   
2635 N N     . ARG A 345 ? 0.5396 0.4669 0.4451 0.0312  0.0638  0.0364  345  ARG A N     
2636 C CA    . ARG A 345 ? 0.5204 0.4442 0.4284 0.0283  0.0635  0.0326  345  ARG A CA    
2637 C C     . ARG A 345 ? 0.5472 0.4717 0.4526 0.0319  0.0652  0.0320  345  ARG A C     
2638 O O     . ARG A 345 ? 0.5105 0.4389 0.4237 0.0303  0.0638  0.0309  345  ARG A O     
2639 C CB    . ARG A 345 ? 0.5479 0.4607 0.4461 0.0263  0.0651  0.0298  345  ARG A CB    
2640 C CG    . ARG A 345 ? 0.6336 0.5425 0.5346 0.0231  0.0649  0.0260  345  ARG A CG    
2641 C CD    . ARG A 345 ? 0.7809 0.6783 0.6676 0.0242  0.0681  0.0230  345  ARG A CD    
2642 N NE    . ARG A 345 ? 0.9582 0.8491 0.8396 0.0199  0.0681  0.0218  345  ARG A NE    
2643 C CZ    . ARG A 345 ? 0.9317 0.8116 0.7980 0.0201  0.0710  0.0198  345  ARG A CZ    
2644 N NH1   . ARG A 345 ? 0.6916 0.5657 0.5468 0.0250  0.0744  0.0190  345  ARG A NH1   
2645 N NH2   . ARG A 345 ? 1.0044 0.8793 0.8662 0.0152  0.0705  0.0190  345  ARG A NH2   
2646 N N     . THR A 346 ? 0.5016 0.4221 0.3952 0.0369  0.0683  0.0330  346  THR A N     
2647 C CA    . THR A 346 ? 0.5240 0.4455 0.4139 0.0411  0.0701  0.0331  346  THR A CA    
2648 C C     . THR A 346 ? 0.5281 0.4624 0.4287 0.0417  0.0679  0.0360  346  THR A C     
2649 O O     . THR A 346 ? 0.5239 0.4606 0.4279 0.0412  0.0673  0.0348  346  THR A O     
2650 C CB    . THR A 346 ? 0.5187 0.4340 0.3936 0.0471  0.0744  0.0347  346  THR A CB    
2651 O OG1   . THR A 346 ? 0.5629 0.4650 0.4265 0.0456  0.0767  0.0314  346  THR A OG1   
2652 C CG2   . THR A 346 ? 0.5051 0.4226 0.3765 0.0519  0.0765  0.0353  346  THR A CG2   
2653 N N     . ALA A 347 ? 0.4882 0.4303 0.3934 0.0423  0.0666  0.0399  347  ALA A N     
2654 C CA    . ALA A 347 ? 0.5182 0.4729 0.4328 0.0424  0.0644  0.0430  347  ALA A CA    
2655 C C     . ALA A 347 ? 0.5367 0.4948 0.4625 0.0365  0.0613  0.0410  347  ALA A C     
2656 O O     . ALA A 347 ? 0.5278 0.4918 0.4578 0.0358  0.0603  0.0416  347  ALA A O     
2657 C CB    . ALA A 347 ? 0.4977 0.4590 0.4146 0.0439  0.0637  0.0473  347  ALA A CB    
2658 N N     . VAL A 348 ? 0.4644 0.4188 0.3948 0.0323  0.0599  0.0389  348  VAL A N     
2659 C CA    . VAL A 348 ? 0.4265 0.3827 0.3666 0.0271  0.0577  0.0373  348  VAL A CA    
2660 C C     . VAL A 348 ? 0.4305 0.3807 0.3687 0.0260  0.0586  0.0338  348  VAL A C     
2661 O O     . VAL A 348 ? 0.4542 0.4076 0.3972 0.0238  0.0576  0.0337  348  VAL A O     
2662 C CB    . VAL A 348 ? 0.4055 0.3590 0.3504 0.0236  0.0565  0.0364  348  VAL A CB    
2663 C CG1   . VAL A 348 ? 0.3997 0.3537 0.3536 0.0189  0.0551  0.0349  348  VAL A CG1   
2664 C CG2   . VAL A 348 ? 0.4321 0.3916 0.3795 0.0244  0.0554  0.0398  348  VAL A CG2   
2665 N N     . ILE A 349 ? 0.4428 0.3837 0.3732 0.0272  0.0607  0.0310  349  ILE A N     
2666 C CA    . ILE A 349 ? 0.4797 0.4140 0.4073 0.0266  0.0618  0.0275  349  ILE A CA    
2667 C C     . ILE A 349 ? 0.5164 0.4547 0.4412 0.0295  0.0624  0.0287  349  ILE A C     
2668 O O     . ILE A 349 ? 0.5851 0.5226 0.5126 0.0273  0.0619  0.0271  349  ILE A O     
2669 C CB    . ILE A 349 ? 0.5868 0.5104 0.5049 0.0276  0.0642  0.0244  349  ILE A CB    
2670 C CG1   . ILE A 349 ? 0.5618 0.4820 0.4847 0.0232  0.0631  0.0229  349  ILE A CG1   
2671 C CG2   . ILE A 349 ? 0.4517 0.3684 0.3641 0.0287  0.0660  0.0210  349  ILE A CG2   
2672 C CD1   . ILE A 349 ? 0.5836 0.4942 0.4969 0.0232  0.0650  0.0204  349  ILE A CD1   
2673 N N     . ASN A 350 ? 0.4850 0.4279 0.4045 0.0343  0.0635  0.0319  350  ASN A N     
2674 C CA    . ASN A 350 ? 0.4241 0.3723 0.3410 0.0375  0.0642  0.0338  350  ASN A CA    
2675 C C     . ASN A 350 ? 0.4847 0.4441 0.4111 0.0345  0.0612  0.0366  350  ASN A C     
2676 O O     . ASN A 350 ? 0.5089 0.4704 0.4360 0.0333  0.0607  0.0363  350  ASN A O     
2677 C CB    . ASN A 350 ? 0.4062 0.3563 0.3143 0.0442  0.0668  0.0371  350  ASN A CB    
2678 C CG    . ASN A 350 ? 0.5151 0.4531 0.4104 0.0478  0.0706  0.0343  350  ASN A CG    
2679 O OD1   . ASN A 350 ? 0.4722 0.4008 0.3656 0.0451  0.0710  0.0296  350  ASN A OD1   
2680 N ND2   . ASN A 350 ? 0.5314 0.4694 0.4174 0.0541  0.0737  0.0372  350  ASN A ND2   
2681 N N     . ALA A 351 ? 0.4217 0.3878 0.3545 0.0328  0.0594  0.0392  351  ALA A N     
2682 C CA    . ALA A 351 ? 0.4297 0.4057 0.3708 0.0291  0.0567  0.0416  351  ALA A CA    
2683 C C     . ALA A 351 ? 0.5106 0.4814 0.4564 0.0231  0.0555  0.0384  351  ALA A C     
2684 O O     . ALA A 351 ? 0.4596 0.4345 0.4079 0.0201  0.0542  0.0392  351  ALA A O     
2685 C CB    . ALA A 351 ? 0.4195 0.4020 0.3659 0.0285  0.0552  0.0445  351  ALA A CB    
2686 N N     . ALA A 352 ? 0.4738 0.4356 0.4204 0.0214  0.0561  0.0350  352  ALA A N     
2687 C CA    . ALA A 352 ? 0.4693 0.4253 0.4202 0.0163  0.0557  0.0323  352  ALA A CA    
2688 C C     . ALA A 352 ? 0.5299 0.4808 0.4767 0.0158  0.0566  0.0300  352  ALA A C     
2689 O O     . ALA A 352 ? 0.4855 0.4362 0.4353 0.0116  0.0558  0.0298  352  ALA A O     
2690 C CB    . ALA A 352 ? 0.4823 0.4306 0.4347 0.0152  0.0565  0.0298  352  ALA A CB    
2691 N N     . SER A 353 ? 0.5257 0.4718 0.4650 0.0200  0.0585  0.0283  353  SER A N     
2692 C CA    . SER A 353 ? 0.5473 0.4874 0.4818 0.0201  0.0597  0.0257  353  SER A CA    
2693 C C     . SER A 353 ? 0.5627 0.5112 0.4956 0.0213  0.0589  0.0287  353  SER A C     
2694 O O     . SER A 353 ? 0.5376 0.4829 0.4682 0.0200  0.0591  0.0272  353  SER A O     
2695 C CB    . SER A 353 ? 0.5556 0.4869 0.4816 0.0242  0.0623  0.0228  353  SER A CB    
2696 O OG    . SER A 353 ? 0.5415 0.4775 0.4614 0.0298  0.0635  0.0254  353  SER A OG    
2697 N N     . GLY A 354 ? 0.6110 0.5706 0.5450 0.0237  0.0580  0.0331  354  GLY A N     
2698 C CA    . GLY A 354 ? 0.5923 0.5618 0.5250 0.0252  0.0572  0.0368  354  GLY A CA    
2699 C C     . GLY A 354 ? 0.6160 0.5858 0.5404 0.0324  0.0597  0.0378  354  GLY A C     
2700 O O     . GLY A 354 ? 0.5508 0.5295 0.4736 0.0348  0.0595  0.0414  354  GLY A O     
2701 N N     . ARG A 355 ? 0.5778 0.5378 0.4963 0.0359  0.0624  0.0349  355  ARG A N     
2702 C CA    . ARG A 355 ? 0.4887 0.4473 0.3975 0.0431  0.0655  0.0361  355  ARG A CA    
2703 C C     . ARG A 355 ? 0.4364 0.4073 0.3457 0.0474  0.0656  0.0423  355  ARG A C     
2704 O O     . ARG A 355 ? 0.4850 0.4602 0.3885 0.0532  0.0677  0.0453  355  ARG A O     
2705 C CB    . ARG A 355 ? 0.6290 0.5747 0.5307 0.0450  0.0683  0.0323  355  ARG A CB    
2706 C CG    . ARG A 355 ? 0.8808 0.8211 0.7699 0.0521  0.0724  0.0324  355  ARG A CG    
2707 C CD    . ARG A 355 ? 0.9742 0.9027 0.8554 0.0532  0.0750  0.0295  355  ARG A CD    
2708 N NE    . ARG A 355 ? 1.0433 0.9586 0.9155 0.0539  0.0776  0.0245  355  ARG A NE    
2709 C CZ    . ARG A 355 ? 1.1401 1.0513 1.0146 0.0507  0.0768  0.0208  355  ARG A CZ    
2710 N NH1   . ARG A 355 ? 1.2231 1.1414 1.1080 0.0464  0.0734  0.0215  355  ARG A NH1   
2711 N NH2   . ARG A 355 ? 1.1489 1.0478 1.0143 0.0517  0.0795  0.0163  355  ARG A NH2   
2712 N N     . GLN A 356 ? 0.4172 0.3941 0.3336 0.0449  0.0635  0.0443  356  GLN A N     
2713 C CA    . GLN A 356 ? 0.4780 0.4672 0.3962 0.0482  0.0632  0.0503  356  GLN A CA    
2714 C C     . GLN A 356 ? 0.5130 0.5123 0.4419 0.0423  0.0594  0.0524  356  GLN A C     
2715 O O     . GLN A 356 ? 0.5480 0.5425 0.4821 0.0365  0.0575  0.0491  356  GLN A O     
2716 C CB    . GLN A 356 ? 0.4801 0.4647 0.3934 0.0524  0.0656  0.0511  356  GLN A CB    
2717 C CG    . GLN A 356 ? 0.5162 0.4917 0.4166 0.0591  0.0702  0.0505  356  GLN A CG    
2718 C CD    . GLN A 356 ? 0.5764 0.5478 0.4710 0.0629  0.0727  0.0523  356  GLN A CD    
2719 O OE1   . GLN A 356 ? 0.5073 0.4694 0.4005 0.0601  0.0726  0.0490  356  GLN A OE1   
2720 N NE2   . GLN A 356 ? 0.4352 0.4135 0.3259 0.0692  0.0749  0.0579  356  GLN A NE2   
2721 N N     . THR A 357 ? 0.4790 0.4921 0.4108 0.0440  0.0584  0.0581  357  THR A N     
2722 C CA    . THR A 357 ? 0.4896 0.5120 0.4303 0.0388  0.0551  0.0603  357  THR A CA    
2723 C C     . THR A 357 ? 0.5082 0.5274 0.4506 0.0394  0.0553  0.0600  357  THR A C     
2724 O O     . THR A 357 ? 0.4726 0.4850 0.4088 0.0444  0.0581  0.0595  357  THR A O     
2725 C CB    . THR A 357 ? 0.4943 0.5334 0.4376 0.0403  0.0539  0.0669  357  THR A CB    
2726 O OG1   . THR A 357 ? 0.4974 0.5409 0.4376 0.0475  0.0562  0.0710  357  THR A OG1   
2727 C CG2   . THR A 357 ? 0.5056 0.5485 0.4458 0.0409  0.0540  0.0680  357  THR A CG2   
2728 N N     . VAL A 358 ? 0.5132 0.5367 0.4633 0.0341  0.0526  0.0603  358  VAL A N     
2729 C CA    . VAL A 358 ? 0.4249 0.4463 0.3775 0.0341  0.0525  0.0603  358  VAL A CA    
2730 C C     . VAL A 358 ? 0.4693 0.4968 0.4189 0.0405  0.0541  0.0650  358  VAL A C     
2731 O O     . VAL A 358 ? 0.5655 0.5859 0.5108 0.0438  0.0560  0.0643  358  VAL A O     
2732 C CB    . VAL A 358 ? 0.4869 0.5131 0.4478 0.0276  0.0495  0.0604  358  VAL A CB    
2733 C CG1   . VAL A 358 ? 0.4764 0.5034 0.4400 0.0285  0.0493  0.0616  358  VAL A CG1   
2734 C CG2   . VAL A 358 ? 0.4333 0.4500 0.3961 0.0219  0.0488  0.0556  358  VAL A CG2   
2735 N N     . ASP A 359 ? 0.5062 0.5469 0.4576 0.0421  0.0535  0.0701  359  ASP A N     
2736 C CA    . ASP A 359 ? 0.5108 0.5582 0.4595 0.0488  0.0555  0.0754  359  ASP A CA    
2737 C C     . ASP A 359 ? 0.5518 0.5899 0.4898 0.0560  0.0598  0.0750  359  ASP A C     
2738 O O     . ASP A 359 ? 0.5732 0.6061 0.5067 0.0601  0.0621  0.0760  359  ASP A O     
2739 C CB    . ASP A 359 ? 0.5481 0.6122 0.5004 0.0493  0.0542  0.0813  359  ASP A CB    
2740 C CG    . ASP A 359 ? 0.7431 0.8169 0.7042 0.0434  0.0506  0.0830  359  ASP A CG    
2741 O OD1   . ASP A 359 ? 0.6932 0.7600 0.6577 0.0387  0.0492  0.0791  359  ASP A OD1   
2742 O OD2   . ASP A 359 ? 0.8345 0.9229 0.7989 0.0434  0.0494  0.0883  359  ASP A OD2   
2743 N N     . GLU A 360 ? 0.5990 0.6343 0.5325 0.0574  0.0610  0.0736  360  GLU A N     
2744 C CA    . GLU A 360 ? 0.5967 0.6225 0.5189 0.0641  0.0655  0.0730  360  GLU A CA    
2745 C C     . GLU A 360 ? 0.5302 0.5401 0.4471 0.0632  0.0669  0.0679  360  GLU A C     
2746 O O     . GLU A 360 ? 0.5750 0.5776 0.4828 0.0685  0.0706  0.0689  360  GLU A O     
2747 C CB    . GLU A 360 ? 0.7207 0.7455 0.6398 0.0643  0.0660  0.0713  360  GLU A CB    
2748 C CG    . GLU A 360 ? 0.8975 0.9383 0.8209 0.0648  0.0645  0.0766  360  GLU A CG    
2749 C CD    . GLU A 360 ? 0.9242 0.9632 0.8459 0.0629  0.0640  0.0740  360  GLU A CD    
2750 O OE1   . GLU A 360 ? 0.7699 0.7951 0.6879 0.0607  0.0646  0.0678  360  GLU A OE1   
2751 O OE2   . GLU A 360 ? 0.8709 0.9226 0.7950 0.0633  0.0629  0.0783  360  GLU A OE2   
2752 N N     . ALA A 361 ? 0.4719 0.4762 0.3939 0.0564  0.0643  0.0628  361  ALA A N     
2753 C CA    . ALA A 361 ? 0.4722 0.4625 0.3902 0.0546  0.0651  0.0580  361  ALA A CA    
2754 C C     . ALA A 361 ? 0.5407 0.5295 0.4583 0.0554  0.0654  0.0597  361  ALA A C     
2755 O O     . ALA A 361 ? 0.5422 0.5200 0.4512 0.0573  0.0679  0.0581  361  ALA A O     
2756 C CB    . ALA A 361 ? 0.3598 0.3468 0.2850 0.0474  0.0622  0.0533  361  ALA A CB    
2757 N N     . LEU A 362 ? 0.4431 0.4421 0.3694 0.0534  0.0628  0.0627  362  LEU A N     
2758 C CA    . LEU A 362 ? 0.5466 0.5443 0.4731 0.0539  0.0628  0.0642  362  LEU A CA    
2759 C C     . LEU A 362 ? 0.5400 0.5384 0.4581 0.0613  0.0665  0.0690  362  LEU A C     
2760 O O     . LEU A 362 ? 0.5490 0.5391 0.4606 0.0630  0.0684  0.0692  362  LEU A O     
2761 C CB    . LEU A 362 ? 0.4771 0.4843 0.4153 0.0491  0.0590  0.0653  362  LEU A CB    
2762 C CG    . LEU A 362 ? 0.4847 0.4883 0.4297 0.0421  0.0563  0.0607  362  LEU A CG    
2763 C CD1   . LEU A 362 ? 0.4713 0.4841 0.4266 0.0376  0.0531  0.0621  362  LEU A CD1   
2764 C CD2   . LEU A 362 ? 0.4439 0.4356 0.3854 0.0408  0.0570  0.0573  362  LEU A CD2   
2765 N N     . LYS A 363 ? 0.4804 0.4885 0.3982 0.0656  0.0676  0.0733  363  LYS A N     
2766 C CA    . LYS A 363 ? 0.5812 0.5892 0.4898 0.0736  0.0720  0.0783  363  LYS A CA    
2767 C C     . LYS A 363 ? 0.6328 0.6240 0.5273 0.0768  0.0764  0.0756  363  LYS A C     
2768 O O     . LYS A 363 ? 0.5907 0.5744 0.4770 0.0800  0.0793  0.0773  363  LYS A O     
2769 C CB    . LYS A 363 ? 0.5696 0.5892 0.4787 0.0780  0.0731  0.0827  363  LYS A CB    
2770 C CG    . LYS A 363 ? 0.6118 0.6329 0.5121 0.0872  0.0781  0.0890  363  LYS A CG    
2771 C CD    . LYS A 363 ? 0.7837 0.8128 0.6816 0.0921  0.0801  0.0924  363  LYS A CD    
2772 C CE    . LYS A 363 ? 0.9380 0.9722 0.8294 0.1015  0.0850  0.1001  363  LYS A CE    
2773 N NZ    . LYS A 363 ? 0.9977 1.0414 0.8877 0.1064  0.0867  0.1041  363  LYS A NZ    
2774 N N     . ASP A 364 ? 0.5402 0.5247 0.4309 0.0755  0.0768  0.0713  364  ASP A N     
2775 C CA    . ASP A 364 ? 0.5474 0.5157 0.4239 0.0779  0.0810  0.0684  364  ASP A CA    
2776 C C     . ASP A 364 ? 0.5866 0.5439 0.4611 0.0731  0.0800  0.0647  364  ASP A C     
2777 O O     . ASP A 364 ? 0.5444 0.4897 0.4061 0.0757  0.0838  0.0647  364  ASP A O     
2778 C CB    . ASP A 364 ? 0.5571 0.5211 0.4309 0.0772  0.0814  0.0643  364  ASP A CB    
2779 C CG    . ASP A 364 ? 0.6081 0.5801 0.4795 0.0833  0.0837  0.0683  364  ASP A CG    
2780 O OD1   . ASP A 364 ? 0.6332 0.6123 0.5025 0.0893  0.0861  0.0744  364  ASP A OD1   
2781 O OD2   . ASP A 364 ? 0.5414 0.5125 0.4127 0.0823  0.0833  0.0654  364  ASP A OD2   
2782 N N     . ALA A 365 ? 0.4898 0.4510 0.3763 0.0661  0.0752  0.0618  365  ALA A N     
2783 C CA    . ALA A 365 ? 0.5518 0.5048 0.4382 0.0612  0.0738  0.0589  365  ALA A CA    
2784 C C     . ALA A 365 ? 0.5706 0.5230 0.4537 0.0635  0.0749  0.0628  365  ALA A C     
2785 O O     . ALA A 365 ? 0.5182 0.4596 0.3930 0.0623  0.0763  0.0616  365  ALA A O     
2786 C CB    . ALA A 365 ? 0.5053 0.4643 0.4059 0.0542  0.0688  0.0561  365  ALA A CB    
2787 N N     . GLN A 366 ? 0.5647 0.5289 0.4541 0.0663  0.0743  0.0675  366  GLN A N     
2788 C CA    . GLN A 366 ? 0.5594 0.5238 0.4459 0.0692  0.0756  0.0717  366  GLN A CA    
2789 C C     . GLN A 366 ? 0.6189 0.5712 0.4880 0.0753  0.0816  0.0736  366  GLN A C     
2790 O O     . GLN A 366 ? 0.6201 0.5619 0.4807 0.0750  0.0833  0.0738  366  GLN A O     
2791 C CB    . GLN A 366 ? 0.5743 0.5544 0.4699 0.0719  0.0745  0.0768  366  GLN A CB    
2792 C CG    . GLN A 366 ? 0.5140 0.4952 0.4070 0.0756  0.0762  0.0817  366  GLN A CG    
2793 C CD    . GLN A 366 ? 0.6704 0.6508 0.5703 0.0701  0.0727  0.0801  366  GLN A CD    
2794 O OE1   . GLN A 366 ? 0.7110 0.6939 0.6203 0.0637  0.0685  0.0762  366  GLN A OE1   
2795 N NE2   . GLN A 366 ? 0.7615 0.7380 0.6562 0.0727  0.0746  0.0833  366  GLN A NE2   
2796 N N     . THR A 367 ? 0.6123 0.5656 0.4754 0.0809  0.0850  0.0753  367  THR A N     
2797 C CA    . THR A 367 ? 0.5624 0.5040 0.4079 0.0876  0.0915  0.0776  367  THR A CA    
2798 C C     . THR A 367 ? 0.6398 0.5632 0.4726 0.0843  0.0932  0.0727  367  THR A C     
2799 O O     . THR A 367 ? 0.7009 0.6120 0.5200 0.0864  0.0972  0.0742  367  THR A O     
2800 C CB    . THR A 367 ? 0.5798 0.5265 0.4220 0.0939  0.0945  0.0799  367  THR A CB    
2801 O OG1   . THR A 367 ? 0.6372 0.6004 0.4886 0.0977  0.0937  0.0859  367  THR A OG1   
2802 C CG2   . THR A 367 ? 0.5262 0.4581 0.3483 0.1007  0.1019  0.0813  367  THR A CG2   
2803 N N     . ASN A 368 ? 0.6133 0.5348 0.4503 0.0787  0.0903  0.0671  368  ASN A N     
2804 C CA    . ASN A 368 ? 0.5864 0.4918 0.4115 0.0753  0.0920  0.0624  368  ASN A CA    
2805 C C     . ASN A 368 ? 0.6069 0.5072 0.4340 0.0683  0.0889  0.0602  368  ASN A C     
2806 O O     . ASN A 368 ? 0.6250 0.5112 0.4394 0.0658  0.0910  0.0579  368  ASN A O     
2807 C CB    . ASN A 368 ? 0.4933 0.3982 0.3208 0.0730  0.0909  0.0575  368  ASN A CB    
2808 C CG    . ASN A 368 ? 0.6534 0.5547 0.4698 0.0801  0.0960  0.0587  368  ASN A CG    
2809 O OD1   . ASN A 368 ? 0.6618 0.5573 0.4653 0.0865  0.1013  0.0626  368  ASN A OD1   
2810 N ND2   . ASN A 368 ? 0.6069 0.5110 0.4277 0.0791  0.0947  0.0555  368  ASN A ND2   
2811 N N     . SER A 369 ? 0.5661 0.4780 0.4088 0.0649  0.0841  0.0611  369  SER A N     
2812 C CA    . SER A 369 ? 0.5838 0.4925 0.4289 0.0593  0.0814  0.0603  369  SER A CA    
2813 C C     . SER A 369 ? 0.7125 0.6126 0.5448 0.0627  0.0851  0.0642  369  SER A C     
2814 O O     . SER A 369 ? 0.6964 0.5873 0.5224 0.0585  0.0848  0.0633  369  SER A O     
2815 C CB    . SER A 369 ? 0.5055 0.4285 0.3694 0.0559  0.0760  0.0609  369  SER A CB    
2816 O OG    . SER A 369 ? 0.6215 0.5493 0.4960 0.0512  0.0725  0.0569  369  SER A OG    
2817 N N     . SER A 370 ? 0.7057 0.6089 0.5339 0.0702  0.0888  0.0688  370  SER A N     
2818 C CA    . SER A 370 ? 0.6574 0.5530 0.4739 0.0743  0.0928  0.0733  370  SER A CA    
2819 C C     . SER A 370 ? 0.6852 0.5612 0.4794 0.0756  0.0985  0.0724  370  SER A C     
2820 O O     . SER A 370 ? 0.6728 0.5427 0.4607 0.0749  0.0999  0.0689  370  SER A O     
2821 C CB    . SER A 370 ? 0.5570 0.4629 0.3765 0.0823  0.0952  0.0791  370  SER A CB    
2822 O OG    . SER A 370 ? 0.6684 0.5915 0.5074 0.0800  0.0898  0.0799  370  SER A OG    
2823 N N     . SER A 371 ? 0.6928 0.5584 0.4746 0.0774  0.1021  0.0757  371  SER A N     
2824 C CA    . SER A 371 ? 0.6696 0.5144 0.4285 0.0771  0.1074  0.0748  371  SER A CA    
2825 C C     . SER A 371 ? 0.5843 0.4211 0.3271 0.0858  0.1151  0.0775  371  SER A C     
2826 O O     . SER A 371 ? 0.7122 0.5542 0.4547 0.0938  0.1185  0.0830  371  SER A O     
2827 C CB    . SER A 371 ? 0.7853 0.6204 0.5357 0.0750  0.1084  0.0774  371  SER A CB    
2828 O OG    . SER A 371 ? 0.8889 0.7028 0.6148 0.0752  0.1145  0.0774  371  SER A OG    
2829 N N     . MET A 372 ? 0.6161 0.4402 0.3452 0.0844  0.1179  0.0737  372  MET A N     
2830 C CA    . MET A 372 ? 0.6477 0.4610 0.3585 0.0923  0.1259  0.0758  372  MET A CA    
2831 C C     . MET A 372 ? 0.8195 0.6176 0.5106 0.0969  0.1328  0.0809  372  MET A C     
2832 O O     . MET A 372 ? 0.8618 0.6576 0.5435 0.1064  0.1393  0.0859  372  MET A O     
2833 C CB    . MET A 372 ? 0.6667 0.4674 0.3654 0.0884  0.1274  0.0701  372  MET A CB    
2834 C CG    . MET A 372 ? 0.7912 0.5815 0.4719 0.0966  0.1354  0.0715  372  MET A CG    
2835 S SD    . MET A 372 ? 0.7916 0.6020 0.4882 0.1049  0.1348  0.0738  372  MET A SD    
2836 C CE    . MET A 372 ? 0.6829 0.5023 0.3964 0.0961  0.1269  0.0660  372  MET A CE    
2837 N N     . ASP A 373 ? 0.7382 0.5257 0.4226 0.0902  0.1315  0.0800  373  ASP A N     
2838 C CA    . ASP A 373 ? 0.8602 0.6316 0.5252 0.0934  0.1378  0.0846  373  ASP A CA    
2839 C C     . ASP A 373 ? 0.8259 0.6087 0.4992 0.1021  0.1396  0.0915  373  ASP A C     
2840 O O     . ASP A 373 ? 0.8575 0.6312 0.5154 0.1108  0.1476  0.0968  373  ASP A O     
2841 C CB    . ASP A 373 ? 0.8573 0.6192 0.5181 0.0837  0.1345  0.0827  373  ASP A CB    
2842 C CG    . ASP A 373 ? 1.0382 0.7845 0.6840 0.0757  0.1349  0.0772  373  ASP A CG    
2843 O OD1   . ASP A 373 ? 1.0947 0.8196 0.7145 0.0768  0.1421  0.0782  373  ASP A OD1   
2844 O OD2   . ASP A 373 ? 1.2024 0.9574 0.8617 0.0682  0.1282  0.0722  373  ASP A OD2   
2845 N N     . VAL A 374 ? 0.7731 0.5758 0.4706 0.0998  0.1324  0.0917  374  VAL A N     
2846 C CA    . VAL A 374 ? 0.6599 0.4766 0.3683 0.1072  0.1330  0.0979  374  VAL A CA    
2847 C C     . VAL A 374 ? 0.7371 0.5623 0.4461 0.1168  0.1372  0.1013  374  VAL A C     
2848 O O     . VAL A 374 ? 0.8128 0.6384 0.5159 0.1258  0.1428  0.1080  374  VAL A O     
2849 C CB    . VAL A 374 ? 0.7431 0.5796 0.4771 0.1019  0.1241  0.0966  374  VAL A CB    
2850 C CG1   . VAL A 374 ? 0.7567 0.6089 0.5023 0.1092  0.1246  0.1029  374  VAL A CG1   
2851 C CG2   . VAL A 374 ? 0.7218 0.5502 0.4547 0.0937  0.1206  0.0944  374  VAL A CG2   
2852 N N     . PHE A 375 ? 0.6669 0.4988 0.3825 0.1152  0.1346  0.0970  375  PHE A N     
2853 C CA    . PHE A 375 ? 0.5654 0.4050 0.2809 0.1239  0.1385  0.1001  375  PHE A CA    
2854 C C     . PHE A 375 ? 0.6634 0.4847 0.3533 0.1323  0.1489  0.1042  375  PHE A C     
2855 O O     . PHE A 375 ? 0.6748 0.5015 0.3625 0.1422  0.1540  0.1110  375  PHE A O     
2856 C CB    . PHE A 375 ? 0.4856 0.3309 0.2086 0.1201  0.1347  0.0941  375  PHE A CB    
2857 C CG    . PHE A 375 ? 0.5272 0.3739 0.2432 0.1287  0.1401  0.0965  375  PHE A CG    
2858 C CD1   . PHE A 375 ? 0.6009 0.4303 0.2979 0.1298  0.1454  0.0933  375  PHE A CD1   
2859 C CD2   . PHE A 375 ? 0.5886 0.4540 0.3167 0.1357  0.1401  0.1021  375  PHE A CD2   
2860 C CE1   . PHE A 375 ? 0.6287 0.4592 0.3190 0.1381  0.1506  0.0956  375  PHE A CE1   
2861 C CE2   . PHE A 375 ? 0.5282 0.3957 0.2501 0.1437  0.1450  0.1047  375  PHE A CE2   
2862 C CZ    . PHE A 375 ? 0.6054 0.4552 0.3084 0.1451  0.1503  0.1014  375  PHE A CZ    
2863 N N     . MET A 376 ? 0.7577 0.5574 0.4281 0.1283  0.1521  0.1001  376  MET A N     
2864 C CA    . MET A 376 ? 0.8021 0.5809 0.4451 0.1352  0.1624  0.1030  376  MET A CA    
2865 C C     . MET A 376 ? 0.8305 0.6015 0.4627 0.1414  0.1684  0.1104  376  MET A C     
2866 O O     . MET A 376 ? 0.9045 0.6687 0.5221 0.1517  0.1772  0.1163  376  MET A O     
2867 C CB    . MET A 376 ? 0.7629 0.5200 0.3875 0.1275  0.1637  0.0965  376  MET A CB    
2868 C CG    . MET A 376 ? 0.6779 0.4396 0.3088 0.1233  0.1600  0.0897  376  MET A CG    
2869 S SD    . MET A 376 ? 0.8009 0.5552 0.4152 0.1340  0.1690  0.0916  376  MET A SD    
2870 C CE    . MET A 376 ? 0.6928 0.4527 0.3172 0.1268  0.1630  0.0827  376  MET A CE    
2871 N N     . LYS A 377 ? 0.8128 0.5848 0.4520 0.1354  0.1640  0.1103  377  LYS A N     
2872 C CA    . LYS A 377 ? 0.8316 0.5966 0.4620 0.1407  0.1691  0.1172  377  LYS A CA    
2873 C C     . LYS A 377 ? 0.8857 0.6708 0.5302 0.1508  0.1702  0.1245  377  LYS A C     
2874 O O     . LYS A 377 ? 0.9298 0.7084 0.5621 0.1601  0.1782  0.1318  377  LYS A O     
2875 C CB    . LYS A 377 ? 0.7675 0.5309 0.4044 0.1316  0.1632  0.1152  377  LYS A CB    
2876 N N     . GLY A 378 ? 0.8519 0.6612 0.5217 0.1486  0.1624  0.1227  378  GLY A N     
2877 C CA    . GLY A 378 ? 0.7476 0.5785 0.4328 0.1565  0.1622  0.1293  378  GLY A CA    
2878 C C     . GLY A 378 ? 0.7902 0.6200 0.4638 0.1680  0.1706  0.1348  378  GLY A C     
2879 O O     . GLY A 378 ? 0.8325 0.6709 0.5076 0.1773  0.1750  0.1430  378  GLY A O     
2880 N N     . LEU A 379 ? 0.7586 0.5780 0.4205 0.1676  0.1731  0.1304  379  LEU A N     
2881 C CA    . LEU A 379 ? 0.7900 0.6056 0.4382 0.1786  0.1818  0.1352  379  LEU A CA    
2882 C C     . LEU A 379 ? 0.9399 0.7354 0.5638 0.1868  0.1927  0.1419  379  LEU A C     
2883 O O     . LEU A 379 ? 0.9500 0.7462 0.5653 0.1984  0.2008  0.1492  379  LEU A O     
2884 C CB    . LEU A 379 ? 0.6848 0.4903 0.3234 0.1758  0.1826  0.1284  379  LEU A CB    
2885 C CG    . LEU A 379 ? 0.7462 0.5695 0.4064 0.1685  0.1730  0.1219  379  LEU A CG    
2886 C CD1   . LEU A 379 ? 0.6307 0.4408 0.2777 0.1669  0.1754  0.1159  379  LEU A CD1   
2887 C CD2   . LEU A 379 ? 0.7441 0.5941 0.4243 0.1742  0.1703  0.1272  379  LEU A CD2   
2888 N N     . SER A 380 ? 1.0426 0.8200 0.6551 0.1807  0.1931  0.1398  380  SER A N     
2889 C CA    . SER A 380 ? 1.1178 0.8772 0.7096 0.1877  0.2027  0.1466  380  SER A CA    
2890 C C     . SER A 380 ? 1.2155 0.9931 0.8239 0.1926  0.2011  0.1540  380  SER A C     
2891 O O     . SER A 380 ? 1.2027 0.9809 0.8185 0.1866  0.1964  0.1532  380  SER A O     
2892 C CB    . SER A 380 ? 1.0024 0.7357 0.5754 0.1789  0.2036  0.1420  380  SER A CB    
2893 O OG    . SER A 380 ? 1.0178 0.7318 0.5708 0.1761  0.2073  0.1367  380  SER A OG    
2894 N N     . LYS A 381 ? 1.3689 1.1623 0.9837 0.2035  0.2048  0.1613  381  LYS A N     
2895 C CA    . LYS A 381 ? 1.4340 1.2473 1.0649 0.2093  0.2038  0.1692  381  LYS A CA    
2896 C C     . LYS A 381 ? 1.4796 1.3038 1.1087 0.2226  0.2108  0.1776  381  LYS A C     
2897 O O     . LYS A 381 ? 1.4941 1.3436 1.1425 0.2270  0.2080  0.1833  381  LYS A O     
2898 C CB    . LYS A 381 ? 1.3536 1.1926 1.0150 0.2005  0.1912  0.1651  381  LYS A CB    
2899 N N     . ALA A 382 ? 1.4026 1.2073 1.0079 0.2285  0.2200  0.1781  382  ALA A N     
2900 C CA    . ALA A 382 ? 1.2179 1.0282 0.8163 0.2423  0.2287  0.1866  382  ALA A CA    
2901 C C     . ALA A 382 ? 1.0920 0.8995 0.6824 0.2531  0.2373  0.1978  382  ALA A C     
2902 O O     . ALA A 382 ? 1.0423 0.8475 0.6367 0.2492  0.2349  0.1985  382  ALA A O     
2903 C CB    . ALA A 382 ? 1.2345 1.0214 0.8070 0.2452  0.2367  0.1836  382  ALA A CB    
2904 N N     . LYS B 2   ? 1.2259 1.1479 1.1156 0.0759  0.0741  0.1193  2    LYS C N     
2905 C CA    . LYS B 2   ? 1.2674 1.1851 1.1537 0.0803  0.0771  0.1237  2    LYS C CA    
2906 C C     . LYS B 2   ? 1.2681 1.2028 1.1707 0.0803  0.0739  0.1238  2    LYS C C     
2907 O O     . LYS B 2   ? 1.2861 1.2178 1.1893 0.0810  0.0740  0.1252  2    LYS C O     
2908 C CB    . LYS B 2   ? 1.2467 1.1457 1.1221 0.0768  0.0772  0.1229  2    LYS C CB    
2909 N N     . ILE B 3   ? 1.1744 1.1264 1.0894 0.0793  0.0710  0.1222  3    ILE C N     
2910 C CA    . ILE B 3   ? 1.0963 1.0651 1.0259 0.0788  0.0682  0.1223  3    ILE C CA    
2911 C C     . ILE B 3   ? 1.0845 1.0622 1.0143 0.0862  0.0723  0.1288  3    ILE C C     
2912 O O     . ILE B 3   ? 1.1015 1.0875 1.0318 0.0892  0.0739  0.1309  3    ILE C O     
2913 C CB    . ILE B 3   ? 1.0107 0.9937 0.9528 0.0736  0.0633  0.1178  3    ILE C CB    
2914 C CG1   . ILE B 3   ? 0.9856 0.9614 0.9288 0.0666  0.0594  0.1119  3    ILE C CG1   
2915 C CG2   . ILE B 3   ? 0.9208 0.9202 0.8760 0.0727  0.0609  0.1183  3    ILE C CG2   
2916 C CD1   . ILE B 3   ? 0.9423 0.9307 0.8977 0.0615  0.0550  0.1077  3    ILE C CD1   
2917 N N     . GLU B 4   ? 1.0625 1.0389 0.9920 0.0893  0.0741  0.1322  4    GLU C N     
2918 C CA    . GLU B 4   ? 1.0506 1.0362 0.9808 0.0965  0.0781  0.1391  4    GLU C CA    
2919 C C     . GLU B 4   ? 1.0870 1.0950 1.0304 0.0957  0.0755  0.1396  4    GLU C C     
2920 O O     . GLU B 4   ? 1.1082 1.1262 1.0629 0.0897  0.0704  0.1354  4    GLU C O     
2921 C CB    . GLU B 4   ? 1.0650 1.0478 0.9958 0.0986  0.0793  0.1417  4    GLU C CB    
2922 C CG    . GLU B 4   ? 1.1450 1.1413 1.0799 0.1052  0.0826  0.1488  4    GLU C CG    
2923 C CD    . GLU B 4   ? 1.2184 1.2105 1.1529 0.1077  0.0842  0.1517  4    GLU C CD    
2924 O OE1   . GLU B 4   ? 1.2529 1.2282 1.1807 0.1053  0.0840  0.1489  4    GLU C OE1   
2925 O OE2   . GLU B 4   ? 1.2280 1.2339 1.1688 0.1118  0.0857  0.1569  4    GLU C OE2   
2926 N N     . GLU B 5   ? 1.0847 1.0999 1.0257 0.1017  0.0792  0.1448  5    GLU C N     
2927 C CA    . GLU B 5   ? 1.0519 1.0888 1.0043 0.1014  0.0772  0.1466  5    GLU C CA    
2928 C C     . GLU B 5   ? 0.9817 1.0312 0.9402 0.1051  0.0785  0.1525  5    GLU C C     
2929 O O     . GLU B 5   ? 0.9411 0.9827 0.8925 0.1113  0.0832  0.1575  5    GLU C O     
2930 C CB    . GLU B 5   ? 1.1370 1.1770 1.0845 0.1058  0.0803  0.1496  5    GLU C CB    
2931 C CG    . GLU B 5   ? 1.1831 1.2460 1.1409 0.1067  0.0790  0.1533  5    GLU C CG    
2932 C CD    . GLU B 5   ? 1.2452 1.3112 1.1993 0.1094  0.0809  0.1546  5    GLU C CD    
2933 O OE1   . GLU B 5   ? 1.1806 1.2650 1.1431 0.1089  0.0792  0.1569  5    GLU C OE1   
2934 O OE2   . GLU B 5   ? 1.3189 1.3687 1.2612 0.1118  0.0840  0.1534  5    GLU C OE2   
2935 N N     . GLY B 6   ? 0.9788 1.0476 0.9500 0.1012  0.0745  0.1521  6    GLY C N     
2936 C CA    . GLY B 6   ? 1.0018 1.0849 0.9796 0.1038  0.0752  0.1578  6    GLY C CA    
2937 C C     . GLY B 6   ? 1.0218 1.1042 1.0053 0.0990  0.0720  0.1544  6    GLY C C     
2938 O O     . GLY B 6   ? 1.0388 1.1336 1.0287 0.0999  0.0720  0.1583  6    GLY C O     
2939 N N     . LYS B 7   ? 1.0306 1.0989 1.0119 0.0938  0.0694  0.1474  7    LYS C N     
2940 C CA    . LYS B 7   ? 1.0088 1.0755 0.9953 0.0889  0.0662  0.1435  7    LYS C CA    
2941 C C     . LYS B 7   ? 1.0076 1.0687 0.9968 0.0809  0.0614  0.1352  7    LYS C C     
2942 O O     . LYS B 7   ? 1.0180 1.0688 1.0015 0.0801  0.0614  0.1323  7    LYS C O     
2943 C CB    . LYS B 7   ? 1.0573 1.1087 1.0361 0.0933  0.0696  0.1456  7    LYS C CB    
2944 C CG    . LYS B 7   ? 1.1195 1.1498 1.0897 0.0910  0.0693  0.1406  7    LYS C CG    
2945 C CD    . LYS B 7   ? 1.1627 1.1812 1.1296 0.0917  0.0702  0.1406  7    LYS C CD    
2946 C CE    . LYS B 7   ? 1.1301 1.1302 1.0906 0.0874  0.0684  0.1350  7    LYS C CE    
2947 N NZ    . LYS B 7   ? 1.0970 1.0885 1.0571 0.0862  0.0678  0.1336  7    LYS C NZ    
2948 N N     . LEU B 8   ? 0.9711 1.0390 0.9684 0.0751  0.0576  0.1315  8    LEU C N     
2949 C CA    . LEU B 8   ? 0.8564 0.9203 0.8568 0.0678  0.0534  0.1242  8    LEU C CA    
2950 C C     . LEU B 8   ? 0.7582 0.8068 0.7555 0.0662  0.0527  0.1204  8    LEU C C     
2951 O O     . LEU B 8   ? 0.7749 0.8212 0.7721 0.0678  0.0535  0.1219  8    LEU C O     
2952 C CB    . LEU B 8   ? 0.8041 0.8834 0.8140 0.0619  0.0499  0.1221  8    LEU C CB    
2953 C CG    . LEU B 8   ? 0.8178 0.9113 0.8312 0.0607  0.0493  0.1238  8    LEU C CG    
2954 C CD1   . LEU B 8   ? 0.8278 0.9350 0.8489 0.0541  0.0460  0.1220  8    LEU C CD1   
2955 C CD2   . LEU B 8   ? 0.8166 0.9028 0.8267 0.0594  0.0487  0.1204  8    LEU C CD2   
2956 N N     . VAL B 9   ? 0.7534 0.7920 0.7482 0.0628  0.0510  0.1157  9    VAL C N     
2957 C CA    . VAL B 9   ? 0.7563 0.7814 0.7485 0.0604  0.0497  0.1119  9    VAL C CA    
2958 C C     . VAL B 9   ? 0.8029 0.8301 0.8011 0.0537  0.0457  0.1059  9    VAL C C     
2959 O O     . VAL B 9   ? 0.7715 0.7998 0.7701 0.0516  0.0447  0.1040  9    VAL C O     
2960 C CB    . VAL B 9   ? 0.7480 0.7567 0.7293 0.0631  0.0519  0.1128  9    VAL C CB    
2961 C CG1   . VAL B 9   ? 0.6021 0.5987 0.5817 0.0589  0.0496  0.1083  9    VAL C CG1   
2962 C CG2   . VAL B 9   ? 0.8794 0.8823 0.8532 0.0698  0.0565  0.1186  9    VAL C CG2   
2963 N N     . ILE B 10  ? 0.7351 0.7622 0.7376 0.0506  0.0438  0.1032  10   ILE C N     
2964 C CA    . ILE B 10  ? 0.6859 0.7161 0.6943 0.0446  0.0406  0.0980  10   ILE C CA    
2965 C C     . ILE B 10  ? 0.7222 0.7408 0.7293 0.0424  0.0392  0.0946  10   ILE C C     
2966 O O     . ILE B 10  ? 0.6801 0.6931 0.6856 0.0436  0.0396  0.0951  10   ILE C O     
2967 C CB    . ILE B 10  ? 0.7234 0.7660 0.7384 0.0420  0.0397  0.0976  10   ILE C CB    
2968 C CG1   . ILE B 10  ? 0.7375 0.7934 0.7543 0.0437  0.0407  0.1016  10   ILE C CG1   
2969 C CG2   . ILE B 10  ? 0.7035 0.7476 0.7229 0.0361  0.0372  0.0925  10   ILE C CG2   
2970 C CD1   . ILE B 10  ? 0.7257 0.7942 0.7480 0.0406  0.0398  0.1018  10   ILE C CD1   
2971 N N     . TRP B 11  ? 0.7276 0.7429 0.7354 0.0392  0.0375  0.0913  11   TRP C N     
2972 C CA    . TRP B 11  ? 0.6944 0.7011 0.7022 0.0365  0.0358  0.0882  11   TRP C CA    
2973 C C     . TRP B 11  ? 0.7042 0.7171 0.7189 0.0323  0.0340  0.0845  11   TRP C C     
2974 O O     . TRP B 11  ? 0.7395 0.7590 0.7575 0.0300  0.0336  0.0831  11   TRP C O     
2975 C CB    . TRP B 11  ? 0.6792 0.6776 0.6828 0.0358  0.0353  0.0875  11   TRP C CB    
2976 C CG    . TRP B 11  ? 0.6638 0.6520 0.6582 0.0392  0.0372  0.0907  11   TRP C CG    
2977 C CD1   . TRP B 11  ? 0.6824 0.6685 0.6724 0.0435  0.0397  0.0943  11   TRP C CD1   
2978 C CD2   . TRP B 11  ? 0.6385 0.6166 0.6261 0.0384  0.0372  0.0907  11   TRP C CD2   
2979 N NE1   . TRP B 11  ? 0.6425 0.6166 0.6225 0.0457  0.0416  0.0966  11   TRP C NE1   
2980 C CE2   . TRP B 11  ? 0.6555 0.6245 0.6336 0.0423  0.0399  0.0943  11   TRP C CE2   
2981 C CE3   . TRP B 11  ? 0.6665 0.6424 0.6547 0.0348  0.0352  0.0883  11   TRP C CE3   
2982 C CZ2   . TRP B 11  ? 0.7016 0.6584 0.6698 0.0420  0.0408  0.0953  11   TRP C CZ2   
2983 C CZ3   . TRP B 11  ? 0.7454 0.7106 0.7248 0.0344  0.0357  0.0894  11   TRP C CZ3   
2984 C CH2   . TRP B 11  ? 0.7643 0.7197 0.7334 0.0378  0.0385  0.0927  11   TRP C CH2   
2985 N N     . ILE B 12  ? 0.5999 0.6097 0.6160 0.0313  0.0334  0.0829  12   ILE C N     
2986 C CA    . ILE B 12  ? 0.5900 0.6034 0.6111 0.0276  0.0324  0.0794  12   ILE C CA    
2987 C C     . ILE B 12  ? 0.6550 0.6593 0.6754 0.0270  0.0314  0.0777  12   ILE C C     
2988 O O     . ILE B 12  ? 0.6358 0.6332 0.6525 0.0293  0.0317  0.0793  12   ILE C O     
2989 C CB    . ILE B 12  ? 0.5351 0.5574 0.5589 0.0267  0.0330  0.0795  12   ILE C CB    
2990 C CG1   . ILE B 12  ? 0.5410 0.5664 0.5682 0.0224  0.0325  0.0759  12   ILE C CG1   
2991 C CG2   . ILE B 12  ? 0.5144 0.5336 0.5365 0.0292  0.0337  0.0810  12   ILE C CG2   
2992 C CD1   . ILE B 12  ? 0.4314 0.4663 0.4600 0.0202  0.0331  0.0760  12   ILE C CD1   
2993 N N     . ASN B 13  ? 0.5967 0.6009 0.6203 0.0241  0.0305  0.0748  13   ASN C N     
2994 C CA    . ASN B 13  ? 0.5582 0.5546 0.5815 0.0237  0.0295  0.0735  13   ASN C CA    
2995 C C     . ASN B 13  ? 0.5203 0.5137 0.5429 0.0246  0.0299  0.0731  13   ASN C C     
2996 O O     . ASN B 13  ? 0.5376 0.5365 0.5613 0.0246  0.0309  0.0728  13   ASN C O     
2997 C CB    . ASN B 13  ? 0.6979 0.6956 0.7249 0.0210  0.0290  0.0711  13   ASN C CB    
2998 C CG    . ASN B 13  ? 0.7844 0.7751 0.8110 0.0207  0.0276  0.0711  13   ASN C CG    
2999 O OD1   . ASN B 13  ? 0.9058 0.8906 0.9285 0.0216  0.0267  0.0730  13   ASN C OD1   
3000 N ND2   . ASN B 13  ? 0.6528 0.6438 0.6826 0.0192  0.0276  0.0693  13   ASN C ND2   
3001 N N     . GLY B 14  ? 0.5200 0.5047 0.5404 0.0251  0.0290  0.0731  14   GLY C N     
3002 C CA    . GLY B 14  ? 0.5035 0.4836 0.5225 0.0263  0.0293  0.0727  14   GLY C CA    
3003 C C     . GLY B 14  ? 0.6161 0.5992 0.6386 0.0246  0.0297  0.0696  14   GLY C C     
3004 O O     . GLY B 14  ? 0.5390 0.5204 0.5607 0.0253  0.0303  0.0690  14   GLY C O     
3005 N N     . ASP B 15  ? 0.6041 0.5909 0.6297 0.0223  0.0296  0.0678  15   ASP C N     
3006 C CA    . ASP B 15  ? 0.6338 0.6221 0.6612 0.0207  0.0307  0.0649  15   ASP C CA    
3007 C C     . ASP B 15  ? 0.5999 0.5960 0.6277 0.0192  0.0322  0.0641  15   ASP C C     
3008 O O     . ASP B 15  ? 0.5604 0.5571 0.5878 0.0177  0.0334  0.0618  15   ASP C O     
3009 C CB    . ASP B 15  ? 0.6107 0.5983 0.6404 0.0193  0.0306  0.0636  15   ASP C CB    
3010 C CG    . ASP B 15  ? 0.6700 0.6627 0.7015 0.0182  0.0307  0.0643  15   ASP C CG    
3011 O OD1   . ASP B 15  ? 0.7159 0.7132 0.7468 0.0181  0.0308  0.0654  15   ASP C OD1   
3012 O OD2   . ASP B 15  ? 0.5107 0.5029 0.5442 0.0175  0.0308  0.0639  15   ASP C OD2   
3013 N N     . LYS B 16  ? 0.5443 0.5461 0.5720 0.0195  0.0321  0.0662  16   LYS C N     
3014 C CA    . LYS B 16  ? 0.5091 0.5195 0.5372 0.0175  0.0332  0.0661  16   LYS C CA    
3015 C C     . LYS B 16  ? 0.5047 0.5178 0.5317 0.0190  0.0335  0.0678  16   LYS C C     
3016 O O     . LYS B 16  ? 0.5200 0.5274 0.5456 0.0220  0.0332  0.0693  16   LYS C O     
3017 C CB    . LYS B 16  ? 0.5624 0.5786 0.5914 0.0169  0.0330  0.0676  16   LYS C CB    
3018 C CG    . LYS B 16  ? 0.5228 0.5364 0.5531 0.0158  0.0327  0.0664  16   LYS C CG    
3019 C CD    . LYS B 16  ? 0.4834 0.4954 0.5140 0.0133  0.0339  0.0634  16   LYS C CD    
3020 C CE    . LYS B 16  ? 0.4694 0.4822 0.5013 0.0117  0.0345  0.0629  16   LYS C CE    
3021 N NZ    . LYS B 16  ? 0.4721 0.4813 0.5056 0.0135  0.0332  0.0640  16   LYS C NZ    
3022 N N     . GLY B 17  ? 0.4390 0.4607 0.4663 0.0168  0.0343  0.0680  17   GLY C N     
3023 C CA    . GLY B 17  ? 0.5213 0.5475 0.5482 0.0177  0.0348  0.0699  17   GLY C CA    
3024 C C     . GLY B 17  ? 0.5802 0.6107 0.6072 0.0213  0.0348  0.0745  17   GLY C C     
3025 O O     . GLY B 17  ? 0.5884 0.6292 0.6165 0.0204  0.0351  0.0768  17   GLY C O     
3026 N N     . TYR B 18  ? 0.5667 0.5892 0.5922 0.0252  0.0346  0.0761  18   TYR C N     
3027 C CA    . TYR B 18  ? 0.5818 0.6064 0.6059 0.0291  0.0353  0.0807  18   TYR C CA    
3028 C C     . TYR B 18  ? 0.5959 0.6257 0.6200 0.0314  0.0366  0.0839  18   TYR C C     
3029 O O     . TYR B 18  ? 0.6102 0.6477 0.6346 0.0336  0.0375  0.0879  18   TYR C O     
3030 C CB    . TYR B 18  ? 0.5966 0.6096 0.6171 0.0322  0.0351  0.0816  18   TYR C CB    
3031 C CG    . TYR B 18  ? 0.6827 0.6845 0.7010 0.0331  0.0349  0.0802  18   TYR C CG    
3032 C CD1   . TYR B 18  ? 0.7524 0.7511 0.7686 0.0360  0.0362  0.0823  18   TYR C CD1   
3033 C CD2   . TYR B 18  ? 0.7109 0.7055 0.7292 0.0311  0.0335  0.0772  18   TYR C CD2   
3034 C CE1   . TYR B 18  ? 0.7821 0.7698 0.7957 0.0366  0.0359  0.0810  18   TYR C CE1   
3035 C CE2   . TYR B 18  ? 0.7701 0.7548 0.7863 0.0317  0.0331  0.0761  18   TYR C CE2   
3036 C CZ    . TYR B 18  ? 0.7841 0.7649 0.7977 0.0344  0.0342  0.0778  18   TYR C CZ    
3037 O OH    . TYR B 18  ? 0.7276 0.6979 0.7387 0.0348  0.0338  0.0767  18   TYR C OH    
3038 N N     . ASN B 19  ? 0.5501 0.5763 0.5740 0.0310  0.0368  0.0823  19   ASN C N     
3039 C CA    . ASN B 19  ? 0.6135 0.6450 0.6377 0.0329  0.0381  0.0853  19   ASN C CA    
3040 C C     . ASN B 19  ? 0.5902 0.6371 0.6175 0.0297  0.0380  0.0864  19   ASN C C     
3041 O O     . ASN B 19  ? 0.6747 0.7302 0.7029 0.0320  0.0391  0.0911  19   ASN C O     
3042 C CB    . ASN B 19  ? 0.7650 0.7891 0.7882 0.0327  0.0382  0.0827  19   ASN C CB    
3043 C CG    . ASN B 19  ? 0.7676 0.7774 0.7870 0.0366  0.0386  0.0833  19   ASN C CG    
3044 O OD1   . ASN B 19  ? 0.6877 0.6944 0.7044 0.0407  0.0398  0.0874  19   ASN C OD1   
3045 N ND2   . ASN B 19  ? 0.7968 0.7972 0.8151 0.0353  0.0379  0.0795  19   ASN C ND2   
3046 N N     . GLY B 20  ? 0.6458 0.6960 0.6742 0.0242  0.0370  0.0826  20   GLY C N     
3047 C CA    . GLY B 20  ? 0.5898 0.6536 0.6199 0.0199  0.0367  0.0834  20   GLY C CA    
3048 C C     . GLY B 20  ? 0.5617 0.6336 0.5931 0.0212  0.0366  0.0871  20   GLY C C     
3049 O O     . GLY B 20  ? 0.6097 0.6943 0.6427 0.0205  0.0368  0.0909  20   GLY C O     
3050 N N     . LEU B 21  ? 0.4721 0.5370 0.5026 0.0229  0.0363  0.0863  21   LEU C N     
3051 C CA    . LEU B 21  ? 0.5350 0.6057 0.5660 0.0244  0.0363  0.0894  21   LEU C CA    
3052 C C     . LEU B 21  ? 0.6503 0.7245 0.6809 0.0304  0.0378  0.0952  21   LEU C C     
3053 O O     . LEU B 21  ? 0.6505 0.7358 0.6825 0.0312  0.0382  0.0992  21   LEU C O     
3054 C CB    . LEU B 21  ? 0.4997 0.5608 0.5294 0.0252  0.0357  0.0871  21   LEU C CB    
3055 C CG    . LEU B 21  ? 0.5414 0.6071 0.5709 0.0266  0.0358  0.0896  21   LEU C CG    
3056 C CD1   . LEU B 21  ? 0.5441 0.6225 0.5759 0.0220  0.0352  0.0898  21   LEU C CD1   
3057 C CD2   . LEU B 21  ? 0.5477 0.6034 0.5757 0.0268  0.0353  0.0870  21   LEU C CD2   
3058 N N     . ALA B 22  ? 0.6062 0.6705 0.6345 0.0346  0.0389  0.0960  22   ALA C N     
3059 C CA    . ALA B 22  ? 0.6333 0.6988 0.6602 0.0406  0.0411  0.1018  22   ALA C CA    
3060 C C     . ALA B 22  ? 0.6410 0.7215 0.6713 0.0400  0.0416  0.1054  22   ALA C C     
3061 O O     . ALA B 22  ? 0.7249 0.8137 0.7557 0.0440  0.0433  0.1113  22   ALA C O     
3062 C CB    . ALA B 22  ? 0.6136 0.6647 0.6367 0.0442  0.0422  0.1013  22   ALA C CB    
3063 N N     . GLU B 23  ? 0.6231 0.7073 0.6555 0.0348  0.0404  0.1021  23   GLU C N     
3064 C CA    . GLU B 23  ? 0.6807 0.7799 0.7161 0.0327  0.0405  0.1052  23   GLU C CA    
3065 C C     . GLU B 23  ? 0.7932 0.9071 0.8310 0.0300  0.0396  0.1078  23   GLU C C     
3066 O O     . GLU B 23  ? 0.8697 0.9977 0.9100 0.0308  0.0401  0.1132  23   GLU C O     
3067 C CB    . GLU B 23  ? 0.6928 0.7914 0.7284 0.0269  0.0394  0.1005  23   GLU C CB    
3068 C CG    . GLU B 23  ? 0.8648 0.9503 0.8984 0.0296  0.0403  0.0984  23   GLU C CG    
3069 C CD    . GLU B 23  ? 0.9828 1.0683 1.0162 0.0242  0.0396  0.0940  23   GLU C CD    
3070 O OE1   . GLU B 23  ? 0.9987 1.0932 1.0325 0.0178  0.0385  0.0924  23   GLU C OE1   
3071 O OE2   . GLU B 23  ? 1.0022 1.0780 1.0340 0.0261  0.0403  0.0923  23   GLU C OE2   
3072 N N     . VAL B 24  ? 0.7040 0.8148 0.7410 0.0268  0.0382  0.1042  24   VAL C N     
3073 C CA    . VAL B 24  ? 0.6799 0.8028 0.7184 0.0245  0.0375  0.1066  24   VAL C CA    
3074 C C     . VAL B 24  ? 0.6885 0.8137 0.7269 0.0318  0.0392  0.1125  24   VAL C C     
3075 O O     . VAL B 24  ? 0.6397 0.7789 0.6803 0.0323  0.0394  0.1174  24   VAL C O     
3076 C CB    . VAL B 24  ? 0.5998 0.7175 0.6371 0.0198  0.0360  0.1014  24   VAL C CB    
3077 C CG1   . VAL B 24  ? 0.6742 0.8049 0.7129 0.0168  0.0351  0.1039  24   VAL C CG1   
3078 C CG2   . VAL B 24  ? 0.5554 0.6682 0.5915 0.0135  0.0351  0.0957  24   VAL C CG2   
3079 N N     . GLY B 25  ? 0.7539 0.8651 0.7891 0.0373  0.0407  0.1121  25   GLY C N     
3080 C CA    . GLY B 25  ? 0.8282 0.9384 0.8612 0.0447  0.0432  0.1175  25   GLY C CA    
3081 C C     . GLY B 25  ? 0.8984 1.0182 0.9329 0.0493  0.0454  0.1244  25   GLY C C     
3082 O O     . GLY B 25  ? 0.9588 1.0855 0.9929 0.0543  0.0475  0.1304  25   GLY C O     
3083 N N     . LYS B 26  ? 0.8373 0.9576 0.8733 0.0478  0.0453  0.1237  26   LYS C N     
3084 C CA    . LYS B 26  ? 0.8973 1.0269 0.9351 0.0521  0.0475  0.1303  26   LYS C CA    
3085 C C     . LYS B 26  ? 0.8945 1.0458 0.9371 0.0498  0.0467  0.1352  26   LYS C C     
3086 O O     . LYS B 26  ? 0.9862 1.1463 1.0296 0.0557  0.0492  0.1427  26   LYS C O     
3087 C CB    . LYS B 26  ? 0.9786 1.1036 1.0168 0.0504  0.0473  0.1278  26   LYS C CB    
3088 C CG    . LYS B 26  ? 1.1097 1.2142 1.1429 0.0542  0.0487  0.1251  26   LYS C CG    
3089 C CD    . LYS B 26  ? 1.2159 1.3139 1.2446 0.0629  0.0524  0.1309  26   LYS C CD    
3090 C CE    . LYS B 26  ? 1.2824 1.3588 1.3046 0.0657  0.0536  0.1281  26   LYS C CE    
3091 N NZ    . LYS B 26  ? 1.3086 1.3768 1.3244 0.0736  0.0577  0.1338  26   LYS C NZ    
3092 N N     . LYS B 27  ? 0.7503 0.9100 0.7955 0.0413  0.0436  0.1315  27   LYS C N     
3093 C CA    . LYS B 27  ? 0.8166 0.9969 0.8658 0.0379  0.0424  0.1360  27   LYS C CA    
3094 C C     . LYS B 27  ? 0.8162 1.0013 0.8652 0.0416  0.0432  0.1398  27   LYS C C     
3095 O O     . LYS B 27  ? 0.8564 1.0576 0.9083 0.0438  0.0440  0.1469  27   LYS C O     
3096 C CB    . LYS B 27  ? 0.8758 1.0612 0.9257 0.0273  0.0391  0.1307  27   LYS C CB    
3097 C CG    . LYS B 27  ? 0.9204 1.1258 0.9732 0.0225  0.0375  0.1349  27   LYS C CG    
3098 C CD    . LYS B 27  ? 0.9683 1.1852 1.0224 0.0141  0.0356  0.1344  27   LYS C CD    
3099 C CE    . LYS B 27  ? 0.9676 1.2068 1.0249 0.0104  0.0342  0.1408  27   LYS C CE    
3100 N NZ    . LYS B 27  ? 0.9548 1.2056 1.0122 0.0010  0.0322  0.1406  27   LYS C NZ    
3101 N N     . PHE B 28  ? 0.7888 0.9604 0.8343 0.0422  0.0430  0.1353  28   PHE C N     
3102 C CA    . PHE B 28  ? 0.8484 1.0223 0.8927 0.0458  0.0439  0.1382  28   PHE C CA    
3103 C C     . PHE B 28  ? 0.9693 1.1455 1.0125 0.0555  0.0479  0.1461  28   PHE C C     
3104 O O     . PHE B 28  ? 1.0678 1.2558 1.1121 0.0585  0.0490  0.1519  28   PHE C O     
3105 C CB    . PHE B 28  ? 0.8147 0.9715 0.8548 0.0455  0.0434  0.1320  28   PHE C CB    
3106 C CG    . PHE B 28  ? 0.8337 0.9927 0.8724 0.0476  0.0439  0.1338  28   PHE C CG    
3107 C CD1   . PHE B 28  ? 0.7868 0.9568 0.8280 0.0417  0.0415  0.1329  28   PHE C CD1   
3108 C CD2   . PHE B 28  ? 0.8356 0.9847 0.8696 0.0553  0.0470  0.1362  28   PHE C CD2   
3109 C CE1   . PHE B 28  ? 0.7405 0.9121 0.7803 0.0437  0.0420  0.1344  28   PHE C CE1   
3110 C CE2   . PHE B 28  ? 0.7456 0.8961 0.7776 0.0573  0.0476  0.1375  28   PHE C CE2   
3111 C CZ    . PHE B 28  ? 0.7436 0.9057 0.7790 0.0517  0.0451  0.1366  28   PHE C CZ    
3112 N N     . GLU B 29  ? 0.9681 1.1323 1.0084 0.0606  0.0503  0.1466  29   GLU C N     
3113 C CA    . GLU B 29  ? 1.0288 1.1923 1.0665 0.0702  0.0549  0.1542  29   GLU C CA    
3114 C C     . GLU B 29  ? 1.0693 1.2532 1.1127 0.0715  0.0557  0.1617  29   GLU C C     
3115 O O     . GLU B 29  ? 1.1525 1.3463 1.1961 0.0777  0.0586  0.1695  29   GLU C O     
3116 C CB    . GLU B 29  ? 1.1021 1.2459 1.1342 0.0744  0.0572  0.1523  29   GLU C CB    
3117 C CG    . GLU B 29  ? 1.1870 1.3229 1.2129 0.0846  0.0626  0.1589  29   GLU C CG    
3118 C CD    . GLU B 29  ? 1.2325 1.3462 1.2513 0.0874  0.0646  0.1561  29   GLU C CD    
3119 O OE1   . GLU B 29  ? 1.2690 1.3757 1.2891 0.0820  0.0617  0.1497  29   GLU C OE1   
3120 O OE2   . GLU B 29  ? 1.2210 1.3237 1.2322 0.0950  0.0692  0.1605  29   GLU C OE2   
3121 N N     . LYS B 30  ? 1.0544 1.2449 1.1019 0.0655  0.0533  0.1596  30   LYS C N     
3122 C CA    . LYS B 30  ? 1.0435 1.2545 1.0968 0.0652  0.0535  0.1664  30   LYS C CA    
3123 C C     . LYS B 30  ? 1.0165 1.2478 1.0738 0.0628  0.0520  0.1710  30   LYS C C     
3124 O O     . LYS B 30  ? 1.0572 1.3071 1.1189 0.0649  0.0530  0.1791  30   LYS C O     
3125 C CB    . LYS B 30  ? 1.0710 1.2844 1.1270 0.0572  0.0505  0.1618  30   LYS C CB    
3126 C CG    . LYS B 30  ? 1.1198 1.3566 1.1819 0.0538  0.0495  0.1677  30   LYS C CG    
3127 C CD    . LYS B 30  ? 1.1789 1.4174 1.2421 0.0436  0.0460  0.1615  30   LYS C CD    
3128 C CE    . LYS B 30  ? 1.1899 1.4528 1.2583 0.0379  0.0442  0.1669  30   LYS C CE    
3129 N NZ    . LYS B 30  ? 1.1664 1.4299 1.2341 0.0269  0.0409  0.1604  30   LYS C NZ    
3130 N N     . ASP B 31  ? 0.9437 1.1716 0.9995 0.0584  0.0496  0.1661  31   ASP C N     
3131 C CA    . ASP B 31  ? 0.9181 1.1638 0.9770 0.0550  0.0478  0.1695  31   ASP C CA    
3132 C C     . ASP B 31  ? 0.9049 1.1488 0.9610 0.0627  0.0506  0.1736  31   ASP C C     
3133 O O     . ASP B 31  ? 0.8962 1.1574 0.9553 0.0647  0.0511  0.1807  31   ASP C O     
3134 C CB    . ASP B 31  ? 0.8845 1.1289 0.9432 0.0440  0.0432  0.1616  31   ASP C CB    
3135 C CG    . ASP B 31  ? 0.8506 1.1025 0.9119 0.0352  0.0405  0.1592  31   ASP C CG    
3136 O OD1   . ASP B 31  ? 0.8530 1.1090 0.9163 0.0375  0.0418  0.1626  31   ASP C OD1   
3137 O OD2   . ASP B 31  ? 0.8387 1.0915 0.8992 0.0258  0.0372  0.1539  31   ASP C OD2   
3138 N N     . THR B 32  ? 0.8889 1.1121 0.9390 0.0668  0.0524  0.1693  32   THR C N     
3139 C CA    . THR B 32  ? 0.9253 1.1440 0.9712 0.0730  0.0549  0.1716  32   THR C CA    
3140 C C     . THR B 32  ? 0.9211 1.1280 0.9612 0.0840  0.0605  0.1764  32   THR C C     
3141 O O     . THR B 32  ? 0.8918 1.0974 0.9278 0.0907  0.0638  0.1806  32   THR C O     
3142 C CB    . THR B 32  ? 0.9725 1.1761 1.0146 0.0686  0.0527  0.1630  32   THR C CB    
3143 O OG1   . THR B 32  ? 0.8718 1.0549 0.9094 0.0694  0.0534  0.1574  32   THR C OG1   
3144 C CG2   . THR B 32  ? 1.0079 1.2203 1.0543 0.0577  0.0477  0.1580  32   THR C CG2   
3145 N N     . GLY B 33  ? 0.9109 1.1082 0.9496 0.0858  0.0619  0.1757  33   GLY C N     
3146 C CA    . GLY B 33  ? 0.9366 1.1190 0.9680 0.0954  0.0674  0.1793  33   GLY C CA    
3147 C C     . GLY B 33  ? 0.9942 1.1540 1.0172 0.0960  0.0680  0.1731  33   GLY C C     
3148 O O     . GLY B 33  ? 1.0036 1.1484 1.0183 0.1033  0.0726  0.1755  33   GLY C O     
3149 N N     . ILE B 34  ? 1.0161 1.1733 1.0408 0.0880  0.0634  0.1652  34   ILE C N     
3150 C CA    . ILE B 34  ? 1.0083 1.1453 1.0261 0.0872  0.0632  0.1589  34   ILE C CA    
3151 C C     . ILE B 34  ? 0.9991 1.1213 1.0153 0.0842  0.0619  0.1532  34   ILE C C     
3152 O O     . ILE B 34  ? 0.9433 1.0705 0.9653 0.0774  0.0582  0.1489  34   ILE C O     
3153 C CB    . ILE B 34  ? 0.9796 1.1198 0.9997 0.0805  0.0593  0.1533  34   ILE C CB    
3154 C CG1   . ILE B 34  ? 1.0078 1.1644 1.0302 0.0827  0.0601  0.1589  34   ILE C CG1   
3155 C CG2   . ILE B 34  ? 0.9281 1.0484 0.9409 0.0806  0.0596  0.1479  34   ILE C CG2   
3156 C CD1   . ILE B 34  ? 1.0339 1.1844 1.0488 0.0923  0.0655  0.1647  34   ILE C CD1   
3157 N N     . LYS B 35  ? 1.0670 1.1706 1.0747 0.0893  0.0652  0.1534  35   LYS C N     
3158 C CA    . LYS B 35  ? 1.1504 1.2388 1.1556 0.0871  0.0643  0.1486  35   LYS C CA    
3159 C C     . LYS B 35  ? 1.0951 1.1755 1.1009 0.0797  0.0600  0.1400  35   LYS C C     
3160 O O     . LYS B 35  ? 1.0475 1.1201 1.0486 0.0797  0.0601  0.1380  35   LYS C O     
3161 C CB    . LYS B 35  ? 1.2739 1.3440 1.2683 0.0943  0.0693  0.1519  35   LYS C CB    
3162 C CG    . LYS B 35  ? 1.3564 1.4086 1.3466 0.0923  0.0686  0.1472  35   LYS C CG    
3163 C CD    . LYS B 35  ? 1.4318 1.4657 1.4097 0.0993  0.0740  0.1513  35   LYS C CD    
3164 C CE    . LYS B 35  ? 1.4584 1.4727 1.4305 0.0966  0.0731  0.1465  35   LYS C CE    
3165 N NZ    . LYS B 35  ? 1.4752 1.4702 1.4335 0.1028  0.0786  0.1505  35   LYS C NZ    
3166 N N     . VAL B 36  ? 1.0449 1.1274 1.0562 0.0735  0.0565  0.1351  36   VAL C N     
3167 C CA    . VAL B 36  ? 0.9502 1.0262 0.9626 0.0668  0.0527  0.1274  36   VAL C CA    
3168 C C     . VAL B 36  ? 0.8631 0.9221 0.8716 0.0661  0.0524  0.1235  36   VAL C C     
3169 O O     . VAL B 36  ? 0.8182 0.8768 0.8286 0.0656  0.0522  0.1232  36   VAL C O     
3170 C CB    . VAL B 36  ? 0.9662 1.0563 0.9867 0.0597  0.0491  0.1243  36   VAL C CB    
3171 C CG1   . VAL B 36  ? 0.9556 1.0381 0.9767 0.0534  0.0459  0.1168  36   VAL C CG1   
3172 C CG2   . VAL B 36  ? 0.9098 1.0169 0.9339 0.0595  0.0490  0.1282  36   VAL C CG2   
3173 N N     . THR B 37  ? 0.7987 0.8440 0.8016 0.0657  0.0522  0.1205  37   THR C N     
3174 C CA    . THR B 37  ? 0.8182 0.8468 0.8164 0.0649  0.0519  0.1173  37   THR C CA    
3175 C C     . THR B 37  ? 0.7615 0.7864 0.7625 0.0585  0.0480  0.1106  37   THR C C     
3176 O O     . THR B 37  ? 0.7643 0.7868 0.7637 0.0569  0.0472  0.1088  37   THR C O     
3177 C CB    . THR B 37  ? 0.8535 0.8669 0.8409 0.0700  0.0553  0.1203  37   THR C CB    
3178 O OG1   . THR B 37  ? 0.9311 0.9444 0.9149 0.0764  0.0595  0.1266  37   THR C OG1   
3179 C CG2   . THR B 37  ? 0.8371 0.8335 0.8194 0.0675  0.0541  0.1164  37   THR C CG2   
3180 N N     . VAL B 38  ? 0.7517 0.7758 0.7565 0.0550  0.0460  0.1071  38   VAL C N     
3181 C CA    . VAL B 38  ? 0.7319 0.7525 0.7394 0.0494  0.0429  0.1011  38   VAL C CA    
3182 C C     . VAL B 38  ? 0.7367 0.7411 0.7389 0.0494  0.0425  0.0992  38   VAL C C     
3183 O O     . VAL B 38  ? 0.7709 0.7683 0.7704 0.0514  0.0436  0.1003  38   VAL C O     
3184 C CB    . VAL B 38  ? 0.6808 0.7100 0.6949 0.0453  0.0410  0.0982  38   VAL C CB    
3185 C CG1   . VAL B 38  ? 0.5812 0.6067 0.5975 0.0401  0.0385  0.0926  38   VAL C CG1   
3186 C CG2   . VAL B 38  ? 0.6549 0.7004 0.6736 0.0443  0.0412  0.1004  38   VAL C CG2   
3187 N N     . GLU B 39  ? 0.7345 0.7331 0.7351 0.0469  0.0410  0.0965  39   GLU C N     
3188 C CA    . GLU B 39  ? 0.7784 0.7627 0.7741 0.0459  0.0402  0.0949  39   GLU C CA    
3189 C C     . GLU B 39  ? 0.7355 0.7201 0.7358 0.0408  0.0371  0.0901  39   GLU C C     
3190 O O     . GLU B 39  ? 0.8051 0.7981 0.8101 0.0385  0.0361  0.0884  39   GLU C O     
3191 C CB    . GLU B 39  ? 0.8727 0.8469 0.8593 0.0483  0.0420  0.0975  39   GLU C CB    
3192 C CG    . GLU B 39  ? 1.0095 0.9799 0.9895 0.0540  0.0458  0.1027  39   GLU C CG    
3193 C CD    . GLU B 39  ? 1.1303 1.0921 1.1006 0.0565  0.0483  0.1055  39   GLU C CD    
3194 O OE1   . GLU B 39  ? 1.1032 1.0661 1.0737 0.0540  0.0469  0.1035  39   GLU C OE1   
3195 O OE2   . GLU B 39  ? 1.2137 1.1671 1.1756 0.0612  0.0520  0.1097  39   GLU C OE2   
3196 N N     . HIS B 40  ? 0.6482 0.6233 0.6467 0.0394  0.0359  0.0883  40   HIS C N     
3197 C CA    . HIS B 40  ? 0.6570 0.6318 0.6595 0.0352  0.0333  0.0845  40   HIS C CA    
3198 C C     . HIS B 40  ? 0.7026 0.6654 0.6995 0.0340  0.0322  0.0846  40   HIS C C     
3199 O O     . HIS B 40  ? 0.7310 0.6871 0.7270 0.0330  0.0312  0.0836  40   HIS C O     
3200 C CB    . HIS B 40  ? 0.5212 0.4992 0.5289 0.0336  0.0325  0.0818  40   HIS C CB    
3201 C CG    . HIS B 40  ? 0.5726 0.5436 0.5773 0.0357  0.0333  0.0828  40   HIS C CG    
3202 N ND1   . HIS B 40  ? 0.6927 0.6530 0.6944 0.0348  0.0322  0.0818  40   HIS C ND1   
3203 C CD2   . HIS B 40  ? 0.6314 0.6045 0.6354 0.0385  0.0352  0.0848  40   HIS C CD2   
3204 C CE1   . HIS B 40  ? 0.6791 0.6345 0.6783 0.0370  0.0334  0.0828  40   HIS C CE1   
3205 N NE2   . HIS B 40  ? 0.7183 0.6814 0.7189 0.0394  0.0353  0.0847  40   HIS C NE2   
3206 N N     . PRO B 41  ? 0.6749 0.6350 0.6675 0.0338  0.0324  0.0859  41   PRO C N     
3207 C CA    . PRO B 41  ? 0.7317 0.6808 0.7180 0.0318  0.0313  0.0862  41   PRO C CA    
3208 C C     . PRO B 41  ? 0.7770 0.7282 0.7690 0.0278  0.0283  0.0834  41   PRO C C     
3209 O O     . PRO B 41  ? 0.8651 0.8258 0.8652 0.0267  0.0277  0.0811  41   PRO C O     
3210 C CB    . PRO B 41  ? 0.7155 0.6643 0.6972 0.0323  0.0324  0.0878  41   PRO C CB    
3211 C CG    . PRO B 41  ? 0.7232 0.6803 0.7068 0.0360  0.0347  0.0893  41   PRO C CG    
3212 C CD    . PRO B 41  ? 0.6520 0.6190 0.6447 0.0354  0.0338  0.0872  41   PRO C CD    
3213 N N     . ASP B 42  ? 0.7021 0.6441 0.6893 0.0254  0.0268  0.0839  42   ASP C N     
3214 C CA    . ASP B 42  ? 0.7206 0.6651 0.7128 0.0217  0.0241  0.0821  42   ASP C CA    
3215 C C     . ASP B 42  ? 0.7015 0.6506 0.6949 0.0199  0.0236  0.0821  42   ASP C C     
3216 O O     . ASP B 42  ? 0.7122 0.6584 0.6996 0.0208  0.0249  0.0836  42   ASP C O     
3217 C CB    . ASP B 42  ? 0.8197 0.7536 0.8062 0.0194  0.0224  0.0832  42   ASP C CB    
3218 C CG    . ASP B 42  ? 0.9604 0.8889 0.9457 0.0210  0.0229  0.0830  42   ASP C CG    
3219 O OD1   . ASP B 42  ? 0.9095 0.8444 0.9007 0.0232  0.0239  0.0814  42   ASP C OD1   
3220 O OD2   . ASP B 42  ? 1.0400 0.9575 1.0180 0.0197  0.0222  0.0844  42   ASP C OD2   
3221 N N     . LYS B 43  ? 0.7079 0.6637 0.7087 0.0176  0.0219  0.0805  43   LYS C N     
3222 C CA    . LYS B 43  ? 0.8309 0.7914 0.8337 0.0158  0.0214  0.0804  43   LYS C CA    
3223 C C     . LYS B 43  ? 0.8184 0.7821 0.8196 0.0179  0.0234  0.0806  43   LYS C C     
3224 O O     . LYS B 43  ? 0.7883 0.7504 0.7855 0.0170  0.0235  0.0814  43   LYS C O     
3225 C CB    . LYS B 43  ? 0.9205 0.8739 0.9170 0.0126  0.0197  0.0821  43   LYS C CB    
3226 C CG    . LYS B 43  ? 1.0279 0.9778 1.0250 0.0102  0.0174  0.0827  43   LYS C CG    
3227 C CD    . LYS B 43  ? 1.1348 1.0782 1.1248 0.0061  0.0155  0.0848  43   LYS C CD    
3228 C CE    . LYS B 43  ? 1.2193 1.1592 1.2092 0.0033  0.0130  0.0858  43   LYS C CE    
3229 N NZ    . LYS B 43  ? 1.2472 1.1816 1.2299 -0.0017 0.0108  0.0881  43   LYS C NZ    
3230 N N     . LEU B 44  ? 0.7683 0.7370 0.7724 0.0206  0.0250  0.0799  44   LEU C N     
3231 C CA    . LEU B 44  ? 0.7515 0.7237 0.7538 0.0229  0.0270  0.0806  44   LEU C CA    
3232 C C     . LEU B 44  ? 0.8446 0.8233 0.8507 0.0214  0.0268  0.0796  44   LEU C C     
3233 O O     . LEU B 44  ? 0.9066 0.8862 0.9095 0.0227  0.0280  0.0805  44   LEU C O     
3234 C CB    . LEU B 44  ? 0.7313 0.7090 0.7366 0.0254  0.0284  0.0806  44   LEU C CB    
3235 C CG    . LEU B 44  ? 0.6959 0.6840 0.7089 0.0245  0.0286  0.0785  44   LEU C CG    
3236 C CD1   . LEU B 44  ? 0.7153 0.7099 0.7294 0.0246  0.0294  0.0786  44   LEU C CD1   
3237 C CD2   . LEU B 44  ? 0.6414 0.6325 0.6556 0.0263  0.0296  0.0787  44   LEU C CD2   
3238 N N     . GLU B 45  ? 0.8478 0.8307 0.8604 0.0190  0.0255  0.0778  45   GLU C N     
3239 C CA    . GLU B 45  ? 0.7814 0.7698 0.7976 0.0176  0.0255  0.0768  45   GLU C CA    
3240 C C     . GLU B 45  ? 0.7839 0.7678 0.7959 0.0159  0.0246  0.0778  45   GLU C C     
3241 O O     . GLU B 45  ? 0.7475 0.7346 0.7609 0.0151  0.0248  0.0773  45   GLU C O     
3242 C CB    . GLU B 45  ? 0.7462 0.7400 0.7701 0.0160  0.0252  0.0750  45   GLU C CB    
3243 C CG    . GLU B 45  ? 0.7227 0.7142 0.7484 0.0139  0.0235  0.0754  45   GLU C CG    
3244 C CD    . GLU B 45  ? 0.7126 0.6995 0.7372 0.0140  0.0225  0.0759  45   GLU C CD    
3245 O OE1   . GLU B 45  ? 0.7683 0.7528 0.7901 0.0158  0.0232  0.0759  45   GLU C OE1   
3246 O OE2   . GLU B 45  ? 0.6678 0.6538 0.6943 0.0123  0.0210  0.0765  45   GLU C OE2   
3247 N N     . GLU B 46  ? 0.7823 0.7584 0.7888 0.0150  0.0235  0.0793  46   GLU C N     
3248 C CA    . GLU B 46  ? 0.8762 0.8466 0.8765 0.0127  0.0227  0.0805  46   GLU C CA    
3249 C C     . GLU B 46  ? 0.8852 0.8477 0.8749 0.0146  0.0244  0.0821  46   GLU C C     
3250 O O     . GLU B 46  ? 0.8711 0.8304 0.8551 0.0138  0.0250  0.0826  46   GLU C O     
3251 C CB    . GLU B 46  ? 0.9593 0.9258 0.9591 0.0096  0.0203  0.0814  46   GLU C CB    
3252 C CG    . GLU B 46  ? 1.0720 1.0464 1.0818 0.0080  0.0189  0.0805  46   GLU C CG    
3253 C CD    . GLU B 46  ? 1.1852 1.1570 1.1948 0.0050  0.0165  0.0820  46   GLU C CD    
3254 O OE1   . GLU B 46  ? 1.1787 1.1443 1.1842 0.0051  0.0159  0.0827  46   GLU C OE1   
3255 O OE2   . GLU B 46  ? 1.2440 1.2203 1.2577 0.0025  0.0151  0.0828  46   GLU C OE2   
3256 N N     . LYS B 47  ? 0.8842 0.8432 0.8709 0.0174  0.0257  0.0830  47   LYS C N     
3257 C CA    . LYS B 47  ? 0.8824 0.8343 0.8593 0.0204  0.0283  0.0850  47   LYS C CA    
3258 C C     . LYS B 47  ? 0.9418 0.8993 0.9192 0.0228  0.0302  0.0850  47   LYS C C     
3259 O O     . LYS B 47  ? 0.9600 0.9125 0.9298 0.0229  0.0315  0.0859  47   LYS C O     
3260 C CB    . LYS B 47  ? 0.8939 0.8440 0.8703 0.0235  0.0295  0.0860  47   LYS C CB    
3261 C CG    . LYS B 47  ? 1.0140 0.9508 0.9784 0.0246  0.0311  0.0886  47   LYS C CG    
3262 C CD    . LYS B 47  ? 1.1641 1.0931 1.1256 0.0205  0.0286  0.0885  47   LYS C CD    
3263 C CE    . LYS B 47  ? 1.3223 1.2359 1.2695 0.0208  0.0305  0.0912  47   LYS C CE    
3264 N NZ    . LYS B 47  ? 1.3489 1.2557 1.2855 0.0205  0.0325  0.0926  47   LYS C NZ    
3265 N N     . PHE B 48  ? 0.8406 0.8084 0.8265 0.0244  0.0305  0.0838  48   PHE C N     
3266 C CA    . PHE B 48  ? 0.7913 0.7654 0.7779 0.0268  0.0323  0.0841  48   PHE C CA    
3267 C C     . PHE B 48  ? 0.8054 0.7777 0.7882 0.0256  0.0326  0.0838  48   PHE C C     
3268 O O     . PHE B 48  ? 0.8512 0.8213 0.8276 0.0284  0.0349  0.0854  48   PHE C O     
3269 C CB    . PHE B 48  ? 0.7184 0.7042 0.7152 0.0265  0.0317  0.0824  48   PHE C CB    
3270 C CG    . PHE B 48  ? 0.6792 0.6720 0.6770 0.0280  0.0330  0.0826  48   PHE C CG    
3271 C CD1   . PHE B 48  ? 0.6818 0.6769 0.6766 0.0319  0.0352  0.0852  48   PHE C CD1   
3272 C CD2   . PHE B 48  ? 0.7024 0.6995 0.7042 0.0257  0.0323  0.0807  48   PHE C CD2   
3273 C CE1   . PHE B 48  ? 0.7209 0.7230 0.7167 0.0332  0.0363  0.0858  48   PHE C CE1   
3274 C CE2   . PHE B 48  ? 0.7711 0.7742 0.7735 0.0269  0.0334  0.0809  48   PHE C CE2   
3275 C CZ    . PHE B 48  ? 0.7635 0.7694 0.7630 0.0305  0.0353  0.0835  48   PHE C CZ    
3276 N N     . PRO B 49  ? 0.7705 0.7441 0.7574 0.0218  0.0305  0.0819  49   PRO C N     
3277 C CA    . PRO B 49  ? 0.7687 0.7407 0.7520 0.0206  0.0308  0.0814  49   PRO C CA    
3278 C C     . PRO B 49  ? 0.9211 0.8811 0.8918 0.0201  0.0317  0.0832  49   PRO C C     
3279 O O     . PRO B 49  ? 0.8746 0.8316 0.8391 0.0207  0.0333  0.0834  49   PRO C O     
3280 C CB    . PRO B 49  ? 0.7267 0.7032 0.7179 0.0166  0.0284  0.0795  49   PRO C CB    
3281 C CG    . PRO B 49  ? 0.7285 0.7052 0.7238 0.0156  0.0268  0.0796  49   PRO C CG    
3282 C CD    . PRO B 49  ? 0.7505 0.7282 0.7458 0.0189  0.0282  0.0802  49   PRO C CD    
3283 N N     . GLN B 50  ? 1.0423 0.9949 1.0086 0.0189  0.0310  0.0843  50   GLN C N     
3284 C CA    . GLN B 50  ? 1.1054 1.0449 1.0579 0.0181  0.0323  0.0862  50   GLN C CA    
3285 C C     . GLN B 50  ? 1.0361 0.9712 0.9801 0.0232  0.0362  0.0882  50   GLN C C     
3286 O O     . GLN B 50  ? 1.1441 1.0730 1.0787 0.0236  0.0383  0.0889  50   GLN C O     
3287 C CB    . GLN B 50  ? 1.2542 1.1862 1.2032 0.0163  0.0311  0.0874  50   GLN C CB    
3288 C CG    . GLN B 50  ? 1.3655 1.2991 1.3191 0.0108  0.0274  0.0865  50   GLN C CG    
3289 C CD    . GLN B 50  ? 1.4618 1.3876 1.4113 0.0092  0.0262  0.0878  50   GLN C CD    
3290 O OE1   . GLN B 50  ? 1.5116 1.4406 1.4670 0.0057  0.0232  0.0874  50   GLN C OE1   
3291 N NE2   . GLN B 50  ? 1.4411 1.3567 1.3803 0.0118  0.0288  0.0897  50   GLN C NE2   
3292 N N     . VAL B 51  ? 0.8991 0.8377 0.8465 0.0272  0.0375  0.0894  51   VAL C N     
3293 C CA    . VAL B 51  ? 0.8817 0.8169 0.8215 0.0326  0.0415  0.0922  51   VAL C CA    
3294 C C     . VAL B 51  ? 0.9540 0.8982 0.8973 0.0355  0.0430  0.0920  51   VAL C C     
3295 O O     . VAL B 51  ? 1.0788 1.0183 1.0130 0.0391  0.0465  0.0942  51   VAL C O     
3296 C CB    . VAL B 51  ? 0.8312 0.7675 0.7733 0.0360  0.0424  0.0940  51   VAL C CB    
3297 C CG1   . VAL B 51  ? 0.8334 0.7609 0.7726 0.0329  0.0407  0.0939  51   VAL C CG1   
3298 C CG2   . VAL B 51  ? 0.7751 0.7265 0.7311 0.0366  0.0408  0.0925  51   VAL C CG2   
3299 N N     . ALA B 52  ? 0.8643 0.8209 0.8199 0.0338  0.0406  0.0895  52   ALA C N     
3300 C CA    . ALA B 52  ? 0.8243 0.7898 0.7836 0.0360  0.0416  0.0893  52   ALA C CA    
3301 C C     . ALA B 52  ? 0.8808 0.8416 0.8339 0.0347  0.0424  0.0883  52   ALA C C     
3302 O O     . ALA B 52  ? 0.7982 0.7616 0.7490 0.0376  0.0445  0.0891  52   ALA C O     
3303 C CB    . ALA B 52  ? 0.7254 0.7037 0.6981 0.0339  0.0391  0.0869  52   ALA C CB    
3304 N N     . ALA B 53  ? 0.9585 0.9126 0.9089 0.0302  0.0405  0.0867  53   ALA C N     
3305 C CA    . ALA B 53  ? 1.0392 0.9883 0.9832 0.0283  0.0410  0.0856  53   ALA C CA    
3306 C C     . ALA B 53  ? 1.0741 1.0107 1.0023 0.0311  0.0449  0.0881  53   ALA C C     
3307 O O     . ALA B 53  ? 1.0311 0.9627 0.9518 0.0305  0.0463  0.0876  53   ALA C O     
3308 C CB    . ALA B 53  ? 1.0473 0.9941 0.9933 0.0223  0.0379  0.0838  53   ALA C CB    
3309 N N     . THR B 54  ? 1.0884 1.0194 1.0108 0.0343  0.0470  0.0910  54   THR C N     
3310 C CA    . THR B 54  ? 1.0699 0.9880 0.9763 0.0378  0.0516  0.0940  54   THR C CA    
3311 C C     . THR B 54  ? 1.0619 0.9853 0.9686 0.0450  0.0552  0.0971  54   THR C C     
3312 O O     . THR B 54  ? 1.0656 0.9791 0.9598 0.0494  0.0597  0.1005  54   THR C O     
3313 C CB    . THR B 54  ? 1.0099 0.9145 0.9063 0.0362  0.0522  0.0958  54   THR C CB    
3314 O OG1   . THR B 54  ? 0.9918 0.9002 0.8935 0.0396  0.0525  0.0977  54   THR C OG1   
3315 C CG2   . THR B 54  ? 0.9830 0.8856 0.8819 0.0288  0.0478  0.0933  54   THR C CG2   
3316 N N     . GLY B 55  ? 0.9823 0.9212 0.9028 0.0461  0.0534  0.0962  55   GLY C N     
3317 C CA    . GLY B 55  ? 0.9117 0.8584 0.8341 0.0523  0.0561  0.0993  55   GLY C CA    
3318 C C     . GLY B 55  ? 0.9889 0.9378 0.9141 0.0550  0.0567  0.1021  55   GLY C C     
3319 O O     . GLY B 55  ? 0.9975 0.9539 0.9249 0.0601  0.0590  0.1054  55   GLY C O     
3320 N N     . ASP B 56  ? 1.0794 1.0219 1.0046 0.0517  0.0547  0.1010  56   ASP C N     
3321 C CA    . ASP B 56  ? 1.2046 1.1480 1.1323 0.0538  0.0551  0.1032  56   ASP C CA    
3322 C C     . ASP B 56  ? 1.1751 1.1306 1.1177 0.0505  0.0507  0.1005  56   ASP C C     
3323 O O     . ASP B 56  ? 1.1083 1.0722 1.0595 0.0470  0.0478  0.0972  56   ASP C O     
3324 C CB    . ASP B 56  ? 1.2986 1.2251 1.2145 0.0528  0.0563  0.1044  56   ASP C CB    
3325 C CG    . ASP B 56  ? 1.4010 1.3174 1.3037 0.0591  0.0621  0.1094  56   ASP C CG    
3326 O OD1   . ASP B 56  ? 1.4582 1.3657 1.3490 0.0608  0.0655  0.1107  56   ASP C OD1   
3327 O OD2   . ASP B 56  ? 1.4019 1.3190 1.3059 0.0625  0.0635  0.1121  56   ASP C OD2   
3328 N N     . GLY B 57  ? 1.1339 1.0894 1.0787 0.0517  0.0507  0.1019  57   GLY C N     
3329 C CA    . GLY B 57  ? 1.0390 1.0041 0.9961 0.0487  0.0472  0.0994  57   GLY C CA    
3330 C C     . GLY B 57  ? 0.9624 0.9393 0.9263 0.0520  0.0481  0.1015  57   GLY C C     
3331 O O     . GLY B 57  ? 0.9541 0.9317 0.9134 0.0573  0.0515  0.1057  57   GLY C O     
3332 N N     . PRO B 58  ? 0.8339 0.8204 0.8086 0.0489  0.0451  0.0990  58   PRO C N     
3333 C CA    . PRO B 58  ? 0.7312 0.7300 0.7129 0.0506  0.0453  0.1006  58   PRO C CA    
3334 C C     . PRO B 58  ? 0.7318 0.7428 0.7179 0.0509  0.0454  0.1011  58   PRO C C     
3335 O O     . PRO B 58  ? 0.7501 0.7600 0.7351 0.0492  0.0448  0.0992  58   PRO C O     
3336 C CB    . PRO B 58  ? 0.7031 0.7053 0.6930 0.0460  0.0420  0.0968  58   PRO C CB    
3337 C CG    . PRO B 58  ? 0.6571 0.6554 0.6477 0.0417  0.0398  0.0931  58   PRO C CG    
3338 C CD    . PRO B 58  ? 0.6776 0.6636 0.6579 0.0433  0.0415  0.0945  58   PRO C CD    
3339 N N     . ASP B 59  ? 0.6999 0.7227 0.6906 0.0528  0.0460  0.1037  59   ASP C N     
3340 C CA    . ASP B 59  ? 0.6743 0.7100 0.6697 0.0523  0.0457  0.1044  59   ASP C CA    
3341 C C     . ASP B 59  ? 0.7787 0.8206 0.7820 0.0459  0.0423  0.0997  59   ASP C C     
3342 O O     . ASP B 59  ? 0.8835 0.9295 0.8886 0.0437  0.0414  0.0981  59   ASP C O     
3343 C CB    . ASP B 59  ? 0.7011 0.7481 0.6986 0.0559  0.0474  0.1094  59   ASP C CB    
3344 C CG    . ASP B 59  ? 0.8190 0.8603 0.8082 0.0631  0.0517  0.1148  59   ASP C CG    
3345 O OD1   . ASP B 59  ? 0.7881 0.8253 0.7752 0.0659  0.0533  0.1172  59   ASP C OD1   
3346 O OD2   . ASP B 59  ? 0.8226 0.8627 0.8069 0.0660  0.0538  0.1166  59   ASP C OD2   
3347 N N     . ILE B 60  ? 0.7290 0.7706 0.7361 0.0433  0.0407  0.0978  60   ILE C N     
3348 C CA    . ILE B 60  ? 0.6510 0.6976 0.6645 0.0377  0.0382  0.0938  60   ILE C CA    
3349 C C     . ILE B 60  ? 0.6527 0.6895 0.6663 0.0354  0.0369  0.0904  60   ILE C C     
3350 O O     . ILE B 60  ? 0.6858 0.7175 0.6978 0.0371  0.0373  0.0912  60   ILE C O     
3351 C CB    . ILE B 60  ? 0.6275 0.6854 0.6458 0.0364  0.0379  0.0950  60   ILE C CB    
3352 C CG1   . ILE B 60  ? 0.5260 0.5951 0.5444 0.0390  0.0392  0.0995  60   ILE C CG1   
3353 C CG2   . ILE B 60  ? 0.6313 0.6929 0.6543 0.0303  0.0358  0.0909  60   ILE C CG2   
3354 C CD1   . ILE B 60  ? 0.4895 0.5709 0.5121 0.0376  0.0388  0.1016  60   ILE C CD1   
3355 N N     . ILE B 61  ? 0.5905 0.6248 0.6061 0.0318  0.0354  0.0868  61   ILE C N     
3356 C CA    . ILE B 61  ? 0.5482 0.5751 0.5648 0.0295  0.0341  0.0839  61   ILE C CA    
3357 C C     . ILE B 61  ? 0.5969 0.6288 0.6191 0.0252  0.0330  0.0809  61   ILE C C     
3358 O O     . ILE B 61  ? 0.5460 0.5830 0.5705 0.0228  0.0328  0.0796  61   ILE C O     
3359 C CB    . ILE B 61  ? 0.5582 0.5771 0.5720 0.0289  0.0336  0.0827  61   ILE C CB    
3360 C CG1   . ILE B 61  ? 0.6104 0.6236 0.6262 0.0263  0.0320  0.0802  61   ILE C CG1   
3361 C CG2   . ILE B 61  ? 0.5315 0.5551 0.5471 0.0272  0.0335  0.0816  61   ILE C CG2   
3362 C CD1   . ILE B 61  ? 0.6852 0.6934 0.7003 0.0245  0.0311  0.0789  61   ILE C CD1   
3363 N N     . PHE B 62  ? 0.5325 0.5621 0.5562 0.0244  0.0326  0.0797  62   PHE C N     
3364 C CA    . PHE B 62  ? 0.4859 0.5180 0.5133 0.0206  0.0321  0.0767  62   PHE C CA    
3365 C C     . PHE B 62  ? 0.5048 0.5297 0.5332 0.0192  0.0313  0.0744  62   PHE C C     
3366 O O     . PHE B 62  ? 0.5262 0.5441 0.5529 0.0207  0.0308  0.0748  62   PHE C O     
3367 C CB    . PHE B 62  ? 0.4954 0.5294 0.5234 0.0206  0.0323  0.0768  62   PHE C CB    
3368 C CG    . PHE B 62  ? 0.5203 0.5643 0.5490 0.0201  0.0329  0.0787  62   PHE C CG    
3369 C CD1   . PHE B 62  ? 0.5358 0.5836 0.5629 0.0237  0.0336  0.0825  62   PHE C CD1   
3370 C CD2   . PHE B 62  ? 0.4452 0.4950 0.4756 0.0158  0.0330  0.0769  62   PHE C CD2   
3371 C CE1   . PHE B 62  ? 0.4472 0.5058 0.4755 0.0232  0.0341  0.0849  62   PHE C CE1   
3372 C CE2   . PHE B 62  ? 0.5184 0.5783 0.5493 0.0146  0.0332  0.0789  62   PHE C CE2   
3373 C CZ    . PHE B 62  ? 0.4490 0.5142 0.4794 0.0183  0.0336  0.0831  62   PHE C CZ    
3374 N N     . TRP B 63  ? 0.5127 0.5392 0.5435 0.0163  0.0314  0.0723  63   TRP C N     
3375 C CA    . TRP B 63  ? 0.5065 0.5278 0.5390 0.0151  0.0311  0.0705  63   TRP C CA    
3376 C C     . TRP B 63  ? 0.5414 0.5654 0.5760 0.0121  0.0322  0.0685  63   TRP C C     
3377 O O     . TRP B 63  ? 0.4856 0.5147 0.5198 0.0105  0.0329  0.0685  63   TRP C O     
3378 C CB    . TRP B 63  ? 0.4629 0.4797 0.4943 0.0162  0.0302  0.0714  63   TRP C CB    
3379 C CG    . TRP B 63  ? 0.4539 0.4660 0.4872 0.0154  0.0295  0.0706  63   TRP C CG    
3380 C CD1   . TRP B 63  ? 0.4429 0.4553 0.4790 0.0138  0.0298  0.0697  63   TRP C CD1   
3381 C CD2   . TRP B 63  ? 0.4405 0.4473 0.4729 0.0163  0.0285  0.0710  63   TRP C CD2   
3382 N NE1   . TRP B 63  ? 0.4121 0.4207 0.4496 0.0138  0.0290  0.0698  63   TRP C NE1   
3383 C CE2   . TRP B 63  ? 0.4663 0.4714 0.5015 0.0150  0.0281  0.0705  63   TRP C CE2   
3384 C CE3   . TRP B 63  ? 0.5031 0.5065 0.5326 0.0180  0.0282  0.0720  63   TRP C CE3   
3385 C CZ2   . TRP B 63  ? 0.5624 0.5630 0.5976 0.0153  0.0269  0.0710  63   TRP C CZ2   
3386 C CZ3   . TRP B 63  ? 0.5506 0.5483 0.5796 0.0180  0.0271  0.0721  63   TRP C CZ3   
3387 C CH2   . TRP B 63  ? 0.5453 0.5420 0.5772 0.0166  0.0264  0.0716  63   TRP C CH2   
3388 N N     . ALA B 64  ? 0.4614 0.4817 0.4977 0.0112  0.0326  0.0672  64   ALA C N     
3389 C CA    . ALA B 64  ? 0.4544 0.4755 0.4916 0.0088  0.0344  0.0657  64   ALA C CA    
3390 C C     . ALA B 64  ? 0.5054 0.5279 0.5431 0.0084  0.0343  0.0662  64   ALA C C     
3391 O O     . ALA B 64  ? 0.5126 0.5337 0.5504 0.0101  0.0329  0.0674  64   ALA C O     
3392 C CB    . ALA B 64  ? 0.3343 0.3509 0.3732 0.0089  0.0352  0.0649  64   ALA C CB    
3393 N N     . HIS B 65  ? 0.5270 0.5515 0.5641 0.0059  0.0358  0.0653  65   HIS C N     
3394 C CA    . HIS B 65  ? 0.4842 0.5102 0.5212 0.0053  0.0359  0.0656  65   HIS C CA    
3395 C C     . HIS B 65  ? 0.5416 0.5643 0.5808 0.0065  0.0356  0.0660  65   HIS C C     
3396 O O     . HIS B 65  ? 0.5712 0.5948 0.6102 0.0067  0.0351  0.0664  65   HIS C O     
3397 C CB    . HIS B 65  ? 0.5191 0.5461 0.5544 0.0018  0.0380  0.0644  65   HIS C CB    
3398 C CG    . HIS B 65  ? 0.5270 0.5490 0.5628 0.0009  0.0404  0.0634  65   HIS C CG    
3399 N ND1   . HIS B 65  ? 0.5245 0.5435 0.5596 0.0007  0.0419  0.0626  65   HIS C ND1   
3400 C CD2   . HIS B 65  ? 0.5275 0.5470 0.5642 0.0006  0.0418  0.0634  65   HIS C CD2   
3401 C CE1   . HIS B 65  ? 0.5223 0.5371 0.5576 0.0005  0.0444  0.0624  65   HIS C CE1   
3402 N NE2   . HIS B 65  ? 0.5947 0.6099 0.6312 0.0005  0.0444  0.0630  65   HIS C NE2   
3403 N N     . ASP B 66  ? 0.5002 0.5197 0.5415 0.0071  0.0359  0.0660  66   ASP C N     
3404 C CA    . ASP B 66  ? 0.4504 0.4680 0.4943 0.0078  0.0357  0.0668  66   ASP C CA    
3405 C C     . ASP B 66  ? 0.5431 0.5606 0.5865 0.0089  0.0335  0.0680  66   ASP C C     
3406 O O     . ASP B 66  ? 0.5700 0.5870 0.6146 0.0086  0.0334  0.0685  66   ASP C O     
3407 C CB    . ASP B 66  ? 0.4358 0.4511 0.4823 0.0086  0.0362  0.0674  66   ASP C CB    
3408 C CG    . ASP B 66  ? 0.4584 0.4725 0.5044 0.0099  0.0341  0.0680  66   ASP C CG    
3409 O OD1   . ASP B 66  ? 0.5172 0.5317 0.5609 0.0100  0.0338  0.0673  66   ASP C OD1   
3410 O OD2   . ASP B 66  ? 0.4931 0.5060 0.5410 0.0106  0.0327  0.0694  66   ASP C OD2   
3411 N N     . ARG B 67  ? 0.5194 0.5365 0.5602 0.0101  0.0319  0.0686  67   ARG C N     
3412 C CA    . ARG B 67  ? 0.5739 0.5890 0.6123 0.0111  0.0303  0.0699  67   ARG C CA    
3413 C C     . ARG B 67  ? 0.5702 0.5868 0.6053 0.0117  0.0305  0.0700  67   ARG C C     
3414 O O     . ARG B 67  ? 0.6297 0.6438 0.6616 0.0125  0.0297  0.0710  67   ARG C O     
3415 C CB    . ARG B 67  ? 0.4741 0.4859 0.5103 0.0123  0.0289  0.0710  67   ARG C CB    
3416 C CG    . ARG B 67  ? 0.5921 0.6014 0.6305 0.0117  0.0279  0.0716  67   ARG C CG    
3417 C CD    . ARG B 67  ? 0.6434 0.6483 0.6787 0.0124  0.0263  0.0728  67   ARG C CD    
3418 N NE    . ARG B 67  ? 0.7765 0.7803 0.8147 0.0115  0.0253  0.0735  67   ARG C NE    
3419 C CZ    . ARG B 67  ? 0.8094 0.8122 0.8480 0.0101  0.0239  0.0749  67   ARG C CZ    
3420 N NH1   . ARG B 67  ? 0.8916 0.8934 0.9271 0.0092  0.0234  0.0755  67   ARG C NH1   
3421 N NH2   . ARG B 67  ? 0.6364 0.6396 0.6782 0.0094  0.0230  0.0760  67   ARG C NH2   
3422 N N     . PHE B 68  ? 0.4342 0.4548 0.4696 0.0111  0.0316  0.0693  68   PHE C N     
3423 C CA    . PHE B 68  ? 0.5945 0.6178 0.6271 0.0119  0.0319  0.0698  68   PHE C CA    
3424 C C     . PHE B 68  ? 0.6250 0.6476 0.6573 0.0112  0.0322  0.0693  68   PHE C C     
3425 O O     . PHE B 68  ? 0.6504 0.6735 0.6796 0.0124  0.0322  0.0699  68   PHE C O     
3426 C CB    . PHE B 68  ? 0.6179 0.6466 0.6507 0.0108  0.0327  0.0695  68   PHE C CB    
3427 C CG    . PHE B 68  ? 0.6770 0.7074 0.7087 0.0124  0.0323  0.0708  68   PHE C CG    
3428 C CD1   . PHE B 68  ? 0.7546 0.7900 0.7843 0.0137  0.0324  0.0724  68   PHE C CD1   
3429 C CD2   . PHE B 68  ? 0.7236 0.7507 0.7561 0.0128  0.0318  0.0705  68   PHE C CD2   
3430 C CE1   . PHE B 68  ? 0.7383 0.7753 0.7670 0.0154  0.0323  0.0740  68   PHE C CE1   
3431 C CE2   . PHE B 68  ? 0.7024 0.7305 0.7337 0.0143  0.0316  0.0716  68   PHE C CE2   
3432 C CZ    . PHE B 68  ? 0.6607 0.6937 0.6902 0.0156  0.0319  0.0734  68   PHE C CZ    
3433 N N     . GLY B 69  ? 0.6208 0.6421 0.6563 0.0095  0.0327  0.0683  69   GLY C N     
3434 C CA    . GLY B 69  ? 0.6518 0.6720 0.6876 0.0088  0.0331  0.0678  69   GLY C CA    
3435 C C     . GLY B 69  ? 0.6456 0.6624 0.6788 0.0099  0.0319  0.0687  69   GLY C C     
3436 O O     . GLY B 69  ? 0.6564 0.6724 0.6866 0.0102  0.0321  0.0686  69   GLY C O     
3437 N N     . GLY B 70  ? 0.6719 0.6862 0.7053 0.0100  0.0307  0.0697  70   GLY C N     
3438 C CA    . GLY B 70  ? 0.5987 0.6089 0.6281 0.0102  0.0295  0.0707  70   GLY C CA    
3439 C C     . GLY B 70  ? 0.6538 0.6620 0.6766 0.0123  0.0298  0.0714  70   GLY C C     
3440 O O     . GLY B 70  ? 0.7392 0.7442 0.7572 0.0125  0.0299  0.0716  70   GLY C O     
3441 N N     . TYR B 71  ? 0.6147 0.6249 0.6371 0.0138  0.0301  0.0718  71   TYR C N     
3442 C CA    . TYR B 71  ? 0.6128 0.6220 0.6293 0.0165  0.0309  0.0731  71   TYR C CA    
3443 C C     . TYR B 71  ? 0.6848 0.6965 0.6998 0.0172  0.0320  0.0728  71   TYR C C     
3444 O O     . TYR B 71  ? 0.7368 0.7450 0.7456 0.0189  0.0328  0.0736  71   TYR C O     
3445 C CB    . TYR B 71  ? 0.5840 0.5968 0.6019 0.0179  0.0312  0.0739  71   TYR C CB    
3446 C CG    . TYR B 71  ? 0.6497 0.6594 0.6683 0.0177  0.0302  0.0743  71   TYR C CG    
3447 C CD1   . TYR B 71  ? 0.6272 0.6309 0.6441 0.0166  0.0291  0.0746  71   TYR C CD1   
3448 C CD2   . TYR B 71  ? 0.5849 0.5976 0.6054 0.0184  0.0304  0.0746  71   TYR C CD2   
3449 C CE1   . TYR B 71  ? 0.6469 0.6477 0.6641 0.0163  0.0281  0.0751  71   TYR C CE1   
3450 C CE2   . TYR B 71  ? 0.5822 0.5915 0.6030 0.0184  0.0296  0.0748  71   TYR C CE2   
3451 C CZ    . TYR B 71  ? 0.6255 0.6288 0.6447 0.0174  0.0285  0.0751  71   TYR C CZ    
3452 O OH    . TYR B 71  ? 0.5843 0.5841 0.6037 0.0173  0.0276  0.0754  71   TYR C OH    
3453 N N     . ALA B 72  ? 0.6526 0.6698 0.6724 0.0157  0.0324  0.0715  72   ALA C N     
3454 C CA    . ALA B 72  ? 0.6885 0.7086 0.7072 0.0160  0.0333  0.0711  72   ALA C CA    
3455 C C     . ALA B 72  ? 0.7938 0.8093 0.8102 0.0154  0.0334  0.0702  72   ALA C C     
3456 O O     . ALA B 72  ? 0.7962 0.8107 0.8080 0.0170  0.0343  0.0705  72   ALA C O     
3457 C CB    . ALA B 72  ? 0.6753 0.7006 0.6989 0.0135  0.0336  0.0698  72   ALA C CB    
3458 N N     . GLN B 73  ? 0.8258 0.8387 0.8452 0.0133  0.0327  0.0693  73   GLN C N     
3459 C CA    . GLN B 73  ? 0.8360 0.8451 0.8537 0.0122  0.0326  0.0686  73   GLN C CA    
3460 C C     . GLN B 73  ? 0.8834 0.8869 0.8930 0.0137  0.0327  0.0696  73   GLN C C     
3461 O O     . GLN B 73  ? 0.8779 0.8783 0.8835 0.0135  0.0333  0.0690  73   GLN C O     
3462 C CB    . GLN B 73  ? 0.8797 0.8881 0.9023 0.0099  0.0317  0.0685  73   GLN C CB    
3463 C CG    . GLN B 73  ? 0.9746 0.9806 0.9969 0.0083  0.0316  0.0680  73   GLN C CG    
3464 C CD    . GLN B 73  ? 1.0741 1.0820 1.0991 0.0078  0.0330  0.0664  73   GLN C CD    
3465 O OE1   . GLN B 73  ? 1.0337 1.0431 1.0570 0.0088  0.0339  0.0657  73   GLN C OE1   
3466 N NE2   . GLN B 73  ? 1.1506 1.1586 1.1798 0.0061  0.0332  0.0663  73   GLN C NE2   
3467 N N     . SER B 74  ? 0.8688 0.8700 0.8750 0.0151  0.0324  0.0712  74   SER C N     
3468 C CA    . SER B 74  ? 0.8635 0.8576 0.8601 0.0166  0.0331  0.0725  74   SER C CA    
3469 C C     . SER B 74  ? 0.8276 0.8225 0.8194 0.0205  0.0350  0.0738  74   SER C C     
3470 O O     . SER B 74  ? 0.8926 0.8815 0.8760 0.0227  0.0363  0.0756  74   SER C O     
3471 C CB    . SER B 74  ? 0.8357 0.8253 0.8302 0.0158  0.0319  0.0739  74   SER C CB    
3472 O OG    . SER B 74  ? 0.7875 0.7774 0.7866 0.0123  0.0301  0.0733  74   SER C OG    
3473 N N     . GLY B 75  ? 0.7782 0.7805 0.7748 0.0212  0.0354  0.0733  75   GLY C N     
3474 C CA    . GLY B 75  ? 0.7833 0.7888 0.7768 0.0248  0.0371  0.0750  75   GLY C CA    
3475 C C     . GLY B 75  ? 0.8024 0.8074 0.7930 0.0277  0.0378  0.0777  75   GLY C C     
3476 O O     . GLY B 75  ? 0.7786 0.7829 0.7632 0.0315  0.0399  0.0801  75   GLY C O     
3477 N N     . LEU B 76  ? 0.7729 0.7783 0.7677 0.0262  0.0364  0.0776  76   LEU C N     
3478 C CA    . LEU B 76  ? 0.7450 0.7489 0.7370 0.0287  0.0370  0.0801  76   LEU C CA    
3479 C C     . LEU B 76  ? 0.7409 0.7545 0.7381 0.0300  0.0372  0.0812  76   LEU C C     
3480 O O     . LEU B 76  ? 0.6965 0.7104 0.6918 0.0327  0.0381  0.0837  76   LEU C O     
3481 C CB    . LEU B 76  ? 0.7552 0.7542 0.7483 0.0265  0.0354  0.0794  76   LEU C CB    
3482 C CG    . LEU B 76  ? 0.9196 0.9107 0.9088 0.0239  0.0346  0.0784  76   LEU C CG    
3483 C CD1   . LEU B 76  ? 0.9922 0.9804 0.9838 0.0214  0.0326  0.0781  76   LEU C CD1   
3484 C CD2   . LEU B 76  ? 1.0098 0.9919 0.9873 0.0261  0.0366  0.0801  76   LEU C CD2   
3485 N N     . LEU B 77  ? 0.7471 0.7682 0.7503 0.0278  0.0364  0.0797  77   LEU C N     
3486 C CA    . LEU B 77  ? 0.7226 0.7532 0.7306 0.0276  0.0362  0.0806  77   LEU C CA    
3487 C C     . LEU B 77  ? 0.7306 0.7685 0.7385 0.0285  0.0371  0.0818  77   LEU C C     
3488 O O     . LEU B 77  ? 0.6974 0.7348 0.7052 0.0271  0.0370  0.0801  77   LEU C O     
3489 C CB    . LEU B 77  ? 0.6246 0.6579 0.6394 0.0232  0.0347  0.0780  77   LEU C CB    
3490 C CG    . LEU B 77  ? 0.6057 0.6342 0.6220 0.0222  0.0337  0.0771  77   LEU C CG    
3491 C CD1   . LEU B 77  ? 0.6300 0.6603 0.6520 0.0183  0.0329  0.0746  77   LEU C CD1   
3492 C CD2   . LEU B 77  ? 0.4750 0.5051 0.4903 0.0246  0.0341  0.0794  77   LEU C CD2   
3493 N N     . ALA B 78  ? 0.7028 0.7479 0.7107 0.0309  0.0378  0.0849  78   ALA C N     
3494 C CA    . ALA B 78  ? 0.6633 0.7176 0.6720 0.0315  0.0383  0.0867  78   ALA C CA    
3495 C C     . ALA B 78  ? 0.7130 0.7739 0.7274 0.0261  0.0367  0.0845  78   ALA C C     
3496 O O     . ALA B 78  ? 0.6671 0.7284 0.6850 0.0231  0.0356  0.0831  78   ALA C O     
3497 C CB    . ALA B 78  ? 0.6427 0.7038 0.6502 0.0356  0.0397  0.0914  78   ALA C CB    
3498 N N     . GLU B 79  ? 0.6845 0.7496 0.6990 0.0248  0.0367  0.0843  79   GLU C N     
3499 C CA    . GLU B 79  ? 0.7063 0.7772 0.7245 0.0195  0.0355  0.0827  79   GLU C CA    
3500 C C     . GLU B 79  ? 0.6953 0.7775 0.7155 0.0188  0.0350  0.0859  79   GLU C C     
3501 O O     . GLU B 79  ? 0.6723 0.7609 0.6911 0.0227  0.0359  0.0899  79   GLU C O     
3502 C CB    . GLU B 79  ? 0.7596 0.8310 0.7765 0.0184  0.0357  0.0818  79   GLU C CB    
3503 C CG    . GLU B 79  ? 0.8424 0.9170 0.8618 0.0123  0.0348  0.0798  79   GLU C CG    
3504 C CD    . GLU B 79  ? 0.9075 0.9804 0.9251 0.0113  0.0351  0.0785  79   GLU C CD    
3505 O OE1   . GLU B 79  ? 0.9156 0.9881 0.9303 0.0155  0.0360  0.0799  79   GLU C OE1   
3506 O OE2   . GLU B 79  ? 0.9082 0.9792 0.9267 0.0064  0.0348  0.0761  79   GLU C OE2   
3507 N N     . ILE B 80  ? 0.7477 0.8324 0.7707 0.0140  0.0340  0.0845  80   ILE C N     
3508 C CA    . ILE B 80  ? 0.7131 0.8086 0.7377 0.0124  0.0334  0.0874  80   ILE C CA    
3509 C C     . ILE B 80  ? 0.7221 0.8261 0.7468 0.0077  0.0326  0.0880  80   ILE C C     
3510 O O     . ILE B 80  ? 0.6492 0.7486 0.6731 0.0040  0.0325  0.0851  80   ILE C O     
3511 C CB    . ILE B 80  ? 0.6464 0.7400 0.6728 0.0095  0.0329  0.0857  80   ILE C CB    
3512 C CG1   . ILE B 80  ? 0.6790 0.7652 0.7055 0.0045  0.0328  0.0812  80   ILE C CG1   
3513 C CG2   . ILE B 80  ? 0.5317 0.6190 0.5578 0.0143  0.0335  0.0861  80   ILE C CG2   
3514 C CD1   . ILE B 80  ? 0.7222 0.8099 0.7491 -0.0005 0.0325  0.0800  80   ILE C CD1   
3515 N N     . THR B 81  ? 0.8084 0.9247 0.8339 0.0077  0.0322  0.0922  81   THR C N     
3516 C CA    . THR B 81  ? 0.8862 1.0119 0.9114 0.0038  0.0313  0.0939  81   THR C CA    
3517 C C     . THR B 81  ? 0.8909 1.0271 0.9170 -0.0023 0.0299  0.0957  81   THR C C     
3518 O O     . THR B 81  ? 0.8766 1.0259 0.9035 -0.0025 0.0293  0.1002  81   THR C O     
3519 C CB    . THR B 81  ? 0.8723 1.0054 0.8969 0.0096  0.0321  0.0986  81   THR C CB    
3520 O OG1   . THR B 81  ? 0.7955 0.9371 0.8217 0.0137  0.0326  0.1033  81   THR C OG1   
3521 C CG2   . THR B 81  ? 0.8587 0.9807 0.8808 0.0152  0.0337  0.0968  81   THR C CG2   
3522 N N     . PRO B 82  ? 0.8400 0.9707 0.8656 -0.0075 0.0297  0.0922  82   PRO C N     
3523 C CA    . PRO B 82  ? 0.7926 0.9321 0.8177 -0.0141 0.0286  0.0935  82   PRO C CA    
3524 C C     . PRO B 82  ? 0.7973 0.9422 0.8197 -0.0209 0.0276  0.0940  82   PRO C C     
3525 O O     . PRO B 82  ? 0.8001 0.9358 0.8198 -0.0237 0.0281  0.0905  82   PRO C O     
3526 C CB    . PRO B 82  ? 0.6834 0.8119 0.7071 -0.0174 0.0292  0.0889  82   PRO C CB    
3527 C CG    . PRO B 82  ? 0.6266 0.7419 0.6495 -0.0153 0.0303  0.0851  82   PRO C CG    
3528 C CD    . PRO B 82  ? 0.7017 0.8181 0.7266 -0.0079 0.0306  0.0872  82   PRO C CD    
3529 N N     . ASP B 83  ? 0.7981 0.9578 0.8210 -0.0238 0.0262  0.0986  83   ASP C N     
3530 C CA    . ASP B 83  ? 0.8692 1.0344 0.8888 -0.0313 0.0249  0.0993  83   ASP C CA    
3531 C C     . ASP B 83  ? 0.8537 1.0107 0.8681 -0.0403 0.0252  0.0952  83   ASP C C     
3532 O O     . ASP B 83  ? 0.8525 1.0029 0.8664 -0.0406 0.0261  0.0927  83   ASP C O     
3533 C CB    . ASP B 83  ? 0.8913 1.0758 0.9127 -0.0327 0.0232  0.1058  83   ASP C CB    
3534 C CG    . ASP B 83  ? 0.9448 1.1373 0.9670 -0.0360 0.0225  0.1078  83   ASP C CG    
3535 O OD1   . ASP B 83  ? 0.9635 1.1463 0.9836 -0.0389 0.0232  0.1036  83   ASP C OD1   
3536 O OD2   . ASP B 83  ? 0.9095 1.1186 0.9344 -0.0356 0.0213  0.1137  83   ASP C OD2   
3537 N N     . LYS B 84  ? 0.7879 0.9443 0.7974 -0.0474 0.0247  0.0946  84   LYS C N     
3538 C CA    . LYS B 84  ? 0.7865 0.9329 0.7892 -0.0560 0.0256  0.0908  84   LYS C CA    
3539 C C     . LYS B 84  ? 0.8170 0.9681 0.8177 -0.0611 0.0253  0.0915  84   LYS C C     
3540 O O     . LYS B 84  ? 0.7907 0.9305 0.7866 -0.0649 0.0270  0.0877  84   LYS C O     
3541 C CB    . LYS B 84  ? 0.8115 0.9585 0.8084 -0.0637 0.0249  0.0911  84   LYS C CB    
3542 C CG    . LYS B 84  ? 0.9351 1.0701 0.9229 -0.0730 0.0266  0.0875  84   LYS C CG    
3543 C CD    . LYS B 84  ? 1.0494 1.1660 1.0361 -0.0695 0.0296  0.0824  84   LYS C CD    
3544 C CE    . LYS B 84  ? 1.1073 1.2109 1.0840 -0.0781 0.0321  0.0793  84   LYS C CE    
3545 N NZ    . LYS B 84  ? 1.1038 1.1902 1.0796 -0.0744 0.0353  0.0750  84   LYS C NZ    
3546 N N     . ALA B 85  ? 0.7765 0.9443 0.7805 -0.0610 0.0233  0.0965  85   ALA C N     
3547 C CA    . ALA B 85  ? 0.7683 0.9423 0.7706 -0.0660 0.0227  0.0977  85   ALA C CA    
3548 C C     . ALA B 85  ? 0.8761 1.0403 0.8804 -0.0610 0.0245  0.0944  85   ALA C C     
3549 O O     . ALA B 85  ? 0.9037 1.0604 0.9029 -0.0662 0.0257  0.0914  85   ALA C O     
3550 C CB    . ALA B 85  ? 0.7493 0.9440 0.7566 -0.0650 0.0204  0.1044  85   ALA C CB    
3551 N N     . PHE B 86  ? 0.7962 0.9600 0.8073 -0.0509 0.0248  0.0952  86   PHE C N     
3552 C CA    . PHE B 86  ? 0.7351 0.8904 0.7484 -0.0457 0.0262  0.0926  86   PHE C CA    
3553 C C     . PHE B 86  ? 0.7057 0.8430 0.7154 -0.0465 0.0283  0.0868  86   PHE C C     
3554 O O     . PHE B 86  ? 0.6765 0.8065 0.6848 -0.0470 0.0295  0.0841  86   PHE C O     
3555 C CB    . PHE B 86  ? 0.7276 0.8858 0.7477 -0.0352 0.0263  0.0951  86   PHE C CB    
3556 C CG    . PHE B 86  ? 0.7413 0.8915 0.7634 -0.0302 0.0274  0.0930  86   PHE C CG    
3557 C CD1   . PHE B 86  ? 0.7329 0.8904 0.7567 -0.0300 0.0271  0.0952  86   PHE C CD1   
3558 C CD2   . PHE B 86  ? 0.7576 0.8934 0.7799 -0.0261 0.0288  0.0890  86   PHE C CD2   
3559 C CE1   . PHE B 86  ? 0.6725 0.8220 0.6977 -0.0257 0.0281  0.0933  86   PHE C CE1   
3560 C CE2   . PHE B 86  ? 0.7439 0.8727 0.7678 -0.0220 0.0296  0.0873  86   PHE C CE2   
3561 C CZ    . PHE B 86  ? 0.6492 0.7844 0.6744 -0.0218 0.0293  0.0893  86   PHE C CZ    
3562 N N     . GLN B 87  ? 0.6187 0.7489 0.6269 -0.0464 0.0289  0.0850  87   GLN C N     
3563 C CA    . GLN B 87  ? 0.6460 0.7600 0.6511 -0.0470 0.0312  0.0801  87   GLN C CA    
3564 C C     . GLN B 87  ? 0.7102 0.8186 0.7074 -0.0556 0.0326  0.0779  87   GLN C C     
3565 O O     . GLN B 87  ? 0.7327 0.8291 0.7275 -0.0554 0.0349  0.0745  87   GLN C O     
3566 C CB    . GLN B 87  ? 0.7033 0.8116 0.7075 -0.0464 0.0317  0.0790  87   GLN C CB    
3567 C CG    . GLN B 87  ? 0.8149 0.9262 0.8252 -0.0380 0.0309  0.0807  87   GLN C CG    
3568 C CD    . GLN B 87  ? 0.8442 0.9477 0.8535 -0.0372 0.0317  0.0788  87   GLN C CD    
3569 O OE1   . GLN B 87  ? 0.8709 0.9628 0.8768 -0.0400 0.0335  0.0754  87   GLN C OE1   
3570 N NE2   . GLN B 87  ? 0.7932 0.9028 0.8052 -0.0332 0.0306  0.0811  87   GLN C NE2   
3571 N N     . ASP B 88  ? 0.6292 0.7461 0.6219 -0.0633 0.0314  0.0801  88   ASP C N     
3572 C CA    . ASP B 88  ? 0.7276 0.8391 0.7109 -0.0727 0.0329  0.0783  88   ASP C CA    
3573 C C     . ASP B 88  ? 0.7149 0.8273 0.6979 -0.0729 0.0333  0.0778  88   ASP C C     
3574 O O     . ASP B 88  ? 0.6689 0.7756 0.6434 -0.0802 0.0350  0.0759  88   ASP C O     
3575 C CB    . ASP B 88  ? 0.8168 0.9378 0.7946 -0.0817 0.0312  0.0812  88   ASP C CB    
3576 C CG    . ASP B 88  ? 0.9147 1.0303 0.8893 -0.0838 0.0315  0.0806  88   ASP C CG    
3577 O OD1   . ASP B 88  ? 0.8776 0.9794 0.8519 -0.0801 0.0339  0.0773  88   ASP C OD1   
3578 O OD2   . ASP B 88  ? 0.9992 1.1247 0.9717 -0.0893 0.0295  0.0837  88   ASP C OD2   
3579 N N     . LYS B 89  ? 0.6457 0.7645 0.6372 -0.0650 0.0321  0.0793  89   LYS C N     
3580 C CA    . LYS B 89  ? 0.5954 0.7147 0.5874 -0.0642 0.0325  0.0788  89   LYS C CA    
3581 C C     . LYS B 89  ? 0.5633 0.6676 0.5557 -0.0594 0.0350  0.0745  89   LYS C C     
3582 O O     . LYS B 89  ? 0.6380 0.7391 0.6287 -0.0599 0.0360  0.0730  89   LYS C O     
3583 C CB    . LYS B 89  ? 0.5858 0.7193 0.5861 -0.0584 0.0302  0.0830  89   LYS C CB    
3584 C CG    . LYS B 89  ? 0.6987 0.8495 0.6991 -0.0633 0.0278  0.0880  89   LYS C CG    
3585 C CD    . LYS B 89  ? 0.8050 0.9688 0.8137 -0.0561 0.0263  0.0926  89   LYS C CD    
3586 C CE    . LYS B 89  ? 0.9160 1.0988 0.9256 -0.0607 0.0240  0.0983  89   LYS C CE    
3587 N NZ    . LYS B 89  ? 0.9312 1.1263 0.9485 -0.0533 0.0232  0.1034  89   LYS C NZ    
3588 N N     . LEU B 90  ? 0.4805 0.5762 0.4750 -0.0548 0.0360  0.0729  90   LEU C N     
3589 C CA    . LEU B 90  ? 0.5177 0.6003 0.5130 -0.0502 0.0382  0.0695  90   LEU C CA    
3590 C C     . LEU B 90  ? 0.5985 0.6680 0.5870 -0.0540 0.0412  0.0665  90   LEU C C     
3591 O O     . LEU B 90  ? 0.6250 0.6946 0.6102 -0.0578 0.0413  0.0670  90   LEU C O     
3592 C CB    . LEU B 90  ? 0.5262 0.6093 0.5300 -0.0411 0.0370  0.0703  90   LEU C CB    
3593 C CG    . LEU B 90  ? 0.5708 0.6654 0.5810 -0.0360 0.0346  0.0738  90   LEU C CG    
3594 C CD1   . LEU B 90  ? 0.5737 0.6639 0.5896 -0.0276 0.0344  0.0737  90   LEU C CD1   
3595 C CD2   . LEU B 90  ? 0.4646 0.5635 0.4743 -0.0373 0.0344  0.0744  90   LEU C CD2   
3596 N N     . TYR B 91  ? 0.6257 0.6837 0.6117 -0.0527 0.0440  0.0637  91   TYR C N     
3597 C CA    . TYR B 91  ? 0.5950 0.6398 0.5744 -0.0552 0.0477  0.0613  91   TYR C CA    
3598 C C     . TYR B 91  ? 0.6420 0.6840 0.6265 -0.0504 0.0475  0.0615  91   TYR C C     
3599 O O     . TYR B 91  ? 0.5900 0.6342 0.5827 -0.0433 0.0460  0.0620  91   TYR C O     
3600 C CB    . TYR B 91  ? 0.5429 0.5767 0.5190 -0.0538 0.0510  0.0588  91   TYR C CB    
3601 C CG    . TYR B 91  ? 0.6371 0.6719 0.6069 -0.0588 0.0517  0.0581  91   TYR C CG    
3602 C CD1   . TYR B 91  ? 0.5944 0.6248 0.5525 -0.0677 0.0540  0.0574  91   TYR C CD1   
3603 C CD2   . TYR B 91  ? 0.4479 0.4874 0.4228 -0.0550 0.0501  0.0582  91   TYR C CD2   
3604 C CE1   . TYR B 91  ? 0.5166 0.5477 0.4681 -0.0727 0.0547  0.0567  91   TYR C CE1   
3605 C CE2   . TYR B 91  ? 0.5001 0.5406 0.4692 -0.0596 0.0508  0.0575  91   TYR C CE2   
3606 C CZ    . TYR B 91  ? 0.5898 0.6263 0.5472 -0.0686 0.0530  0.0567  91   TYR C CZ    
3607 O OH    . TYR B 91  ? 0.5777 0.6149 0.5286 -0.0737 0.0537  0.0559  91   TYR C OH    
3608 N N     . PRO B 92  ? 0.6021 0.6384 0.5810 -0.0545 0.0493  0.0611  92   PRO C N     
3609 C CA    . PRO B 92  ? 0.5639 0.5976 0.5471 -0.0505 0.0492  0.0612  92   PRO C CA    
3610 C C     . PRO B 92  ? 0.5631 0.5898 0.5518 -0.0434 0.0506  0.0601  92   PRO C C     
3611 O O     . PRO B 92  ? 0.5295 0.5586 0.5251 -0.0381 0.0489  0.0607  92   PRO C O     
3612 C CB    . PRO B 92  ? 0.5679 0.5932 0.5418 -0.0570 0.0520  0.0605  92   PRO C CB    
3613 C CG    . PRO B 92  ? 0.7235 0.7436 0.6874 -0.0636 0.0546  0.0595  92   PRO C CG    
3614 C CD    . PRO B 92  ? 0.5965 0.6275 0.5638 -0.0634 0.0517  0.0604  92   PRO C CD    
3615 N N     . PHE B 93  ? 0.5736 0.5921 0.5589 -0.0433 0.0536  0.0586  93   PHE C N     
3616 C CA    . PHE B 93  ? 0.5521 0.5654 0.5429 -0.0367 0.0547  0.0580  93   PHE C CA    
3617 C C     . PHE B 93  ? 0.4816 0.5033 0.4817 -0.0309 0.0508  0.0591  93   PHE C C     
3618 O O     . PHE B 93  ? 0.5010 0.5212 0.5070 -0.0256 0.0503  0.0593  93   PHE C O     
3619 C CB    . PHE B 93  ? 0.5666 0.5716 0.5527 -0.0370 0.0583  0.0567  93   PHE C CB    
3620 C CG    . PHE B 93  ? 0.5967 0.5995 0.5897 -0.0301 0.0584  0.0567  93   PHE C CG    
3621 C CD1   . PHE B 93  ? 0.5709 0.5673 0.5660 -0.0267 0.0607  0.0570  93   PHE C CD1   
3622 C CD2   . PHE B 93  ? 0.5523 0.5599 0.5499 -0.0270 0.0561  0.0567  93   PHE C CD2   
3623 C CE1   . PHE B 93  ? 0.6146 0.6103 0.6162 -0.0209 0.0605  0.0575  93   PHE C CE1   
3624 C CE2   . PHE B 93  ? 0.4715 0.4772 0.4750 -0.0212 0.0559  0.0569  93   PHE C CE2   
3625 C CZ    . PHE B 93  ? 0.5166 0.5169 0.5223 -0.0184 0.0579  0.0574  93   PHE C CZ    
3626 N N     . THR B 94  ? 0.4240 0.4543 0.4249 -0.0320 0.0483  0.0599  94   THR C N     
3627 C CA    . THR B 94  ? 0.5353 0.5718 0.5435 -0.0265 0.0454  0.0611  94   THR C CA    
3628 C C     . THR B 94  ? 0.5364 0.5787 0.5493 -0.0235 0.0428  0.0628  94   THR C C     
3629 O O     . THR B 94  ? 0.5567 0.5991 0.5748 -0.0181 0.0416  0.0633  94   THR C O     
3630 C CB    . THR B 94  ? 0.4350 0.4776 0.4423 -0.0279 0.0441  0.0616  94   THR C CB    
3631 O OG1   . THR B 94  ? 0.4679 0.5191 0.4727 -0.0325 0.0427  0.0632  94   THR C OG1   
3632 C CG2   . THR B 94  ? 0.4552 0.4904 0.4572 -0.0305 0.0469  0.0595  94   THR C CG2   
3633 N N     . TRP B 95  ? 0.5396 0.5865 0.5499 -0.0273 0.0423  0.0637  95   TRP C N     
3634 C CA    . TRP B 95  ? 0.5167 0.5676 0.5302 -0.0247 0.0406  0.0650  95   TRP C CA    
3635 C C     . TRP B 95  ? 0.4950 0.5377 0.5105 -0.0218 0.0419  0.0637  95   TRP C C     
3636 O O     . TRP B 95  ? 0.4902 0.5340 0.5100 -0.0171 0.0405  0.0644  95   TRP C O     
3637 C CB    . TRP B 95  ? 0.5206 0.5768 0.5303 -0.0299 0.0401  0.0660  95   TRP C CB    
3638 C CG    . TRP B 95  ? 0.4533 0.5206 0.4625 -0.0324 0.0382  0.0684  95   TRP C CG    
3639 C CD1   . TRP B 95  ? 0.4650 0.5354 0.4684 -0.0395 0.0385  0.0687  95   TRP C CD1   
3640 C CD2   . TRP B 95  ? 0.3907 0.4678 0.4048 -0.0279 0.0359  0.0711  95   TRP C CD2   
3641 N NE1   . TRP B 95  ? 0.4893 0.5722 0.4948 -0.0397 0.0362  0.0716  95   TRP C NE1   
3642 C CE2   . TRP B 95  ? 0.4548 0.5417 0.4668 -0.0322 0.0348  0.0733  95   TRP C CE2   
3643 C CE3   . TRP B 95  ? 0.3513 0.4291 0.3703 -0.0207 0.0349  0.0722  95   TRP C CE3   
3644 C CZ2   . TRP B 95  ? 0.4775 0.5756 0.4933 -0.0290 0.0329  0.0767  95   TRP C CZ2   
3645 C CZ3   . TRP B 95  ? 0.3519 0.4394 0.3736 -0.0176 0.0333  0.0754  95   TRP C CZ3   
3646 C CH2   . TRP B 95  ? 0.3922 0.4900 0.4127 -0.0214 0.0324  0.0778  95   TRP C CH2   
3647 N N     . ASP B 96  ? 0.4927 0.5269 0.5044 -0.0246 0.0449  0.0621  96   ASP C N     
3648 C CA    . ASP B 96  ? 0.5045 0.5313 0.5181 -0.0219 0.0465  0.0613  96   ASP C CA    
3649 C C     . ASP B 96  ? 0.5910 0.6173 0.6106 -0.0162 0.0454  0.0616  96   ASP C C     
3650 O O     . ASP B 96  ? 0.5963 0.6211 0.6193 -0.0130 0.0449  0.0618  96   ASP C O     
3651 C CB    . ASP B 96  ? 0.6027 0.6198 0.6108 -0.0251 0.0506  0.0600  96   ASP C CB    
3652 C CG    . ASP B 96  ? 0.7531 0.7684 0.7539 -0.0314 0.0520  0.0598  96   ASP C CG    
3653 O OD1   . ASP B 96  ? 0.7065 0.7279 0.7077 -0.0327 0.0497  0.0606  96   ASP C OD1   
3654 O OD2   . ASP B 96  ? 0.8347 0.8420 0.8286 -0.0351 0.0556  0.0589  96   ASP C OD2   
3655 N N     . ALA B 97  ? 0.5894 0.6166 0.6096 -0.0152 0.0451  0.0616  97   ALA C N     
3656 C CA    . ALA B 97  ? 0.5478 0.5739 0.5729 -0.0104 0.0441  0.0619  97   ALA C CA    
3657 C C     . ALA B 97  ? 0.4900 0.5212 0.5186 -0.0069 0.0410  0.0633  97   ALA C C     
3658 O O     . ALA B 97  ? 0.5002 0.5293 0.5320 -0.0035 0.0402  0.0637  97   ALA C O     
3659 C CB    . ALA B 97  ? 0.5374 0.5630 0.5616 -0.0104 0.0444  0.0615  97   ALA C CB    
3660 N N     . VAL B 98  ? 0.4771 0.5148 0.5044 -0.0079 0.0396  0.0643  98   VAL C N     
3661 C CA    . VAL B 98  ? 0.5002 0.5421 0.5295 -0.0043 0.0375  0.0659  98   VAL C CA    
3662 C C     . VAL B 98  ? 0.6281 0.6712 0.6568 -0.0045 0.0373  0.0662  98   VAL C C     
3663 O O     . VAL B 98  ? 0.5740 0.6221 0.6025 -0.0026 0.0360  0.0678  98   VAL C O     
3664 C CB    . VAL B 98  ? 0.5233 0.5725 0.5520 -0.0041 0.0362  0.0676  98   VAL C CB    
3665 C CG1   . VAL B 98  ? 0.4973 0.5448 0.5270 -0.0027 0.0361  0.0674  98   VAL C CG1   
3666 C CG2   . VAL B 98  ? 0.4901 0.5445 0.5158 -0.0091 0.0366  0.0678  98   VAL C CG2   
3667 N N     . ARG B 99  ? 0.6734 0.7115 0.7015 -0.0064 0.0389  0.0648  99   ARG C N     
3668 C CA    . ARG B 99  ? 0.6255 0.6635 0.6528 -0.0068 0.0389  0.0647  99   ARG C CA    
3669 C C     . ARG B 99  ? 0.6283 0.6608 0.6580 -0.0039 0.0391  0.0642  99   ARG C C     
3670 O O     . ARG B 99  ? 0.6384 0.6658 0.6693 -0.0043 0.0406  0.0633  99   ARG C O     
3671 C CB    . ARG B 99  ? 0.5656 0.6014 0.5894 -0.0117 0.0408  0.0637  99   ARG C CB    
3672 C CG    . ARG B 99  ? 0.7831 0.8206 0.8052 -0.0129 0.0405  0.0639  99   ARG C CG    
3673 C CD    . ARG B 99  ? 0.8525 0.8854 0.8704 -0.0180 0.0427  0.0627  99   ARG C CD    
3674 N NE    . ARG B 99  ? 0.8406 0.8750 0.8546 -0.0226 0.0433  0.0628  99   ARG C NE    
3675 C CZ    . ARG B 99  ? 0.7539 0.7956 0.7653 -0.0259 0.0419  0.0641  99   ARG C CZ    
3676 N NH1   . ARG B 99  ? 0.7431 0.7914 0.7557 -0.0247 0.0400  0.0655  99   ARG C NH1   
3677 N NH2   . ARG B 99  ? 0.6181 0.6608 0.6254 -0.0307 0.0426  0.0641  99   ARG C NH2   
3678 N N     . TYR B 100 ? 0.5843 0.6183 0.6143 -0.0011 0.0378  0.0649  100  TYR C N     
3679 C CA    . TYR B 100 ? 0.5704 0.5996 0.6019 0.0009  0.0378  0.0645  100  TYR C CA    
3680 C C     . TYR B 100 ? 0.6091 0.6380 0.6390 0.0013  0.0379  0.0642  100  TYR C C     
3681 O O     . TYR B 100 ? 0.5966 0.6294 0.6243 0.0025  0.0370  0.0651  100  TYR C O     
3682 C CB    . TYR B 100 ? 0.4511 0.4798 0.4834 0.0041  0.0364  0.0655  100  TYR C CB    
3683 C CG    . TYR B 100 ? 0.5406 0.5649 0.5742 0.0053  0.0362  0.0653  100  TYR C CG    
3684 C CD1   . TYR B 100 ? 0.5792 0.6004 0.6159 0.0044  0.0371  0.0649  100  TYR C CD1   
3685 C CD2   . TYR B 100 ? 0.5563 0.5793 0.5874 0.0072  0.0354  0.0658  100  TYR C CD2   
3686 C CE1   . TYR B 100 ? 0.7240 0.7425 0.7623 0.0051  0.0368  0.0652  100  TYR C CE1   
3687 C CE2   . TYR B 100 ? 0.5121 0.5312 0.5438 0.0075  0.0351  0.0656  100  TYR C CE2   
3688 C CZ    . TYR B 100 ? 0.6920 0.7096 0.7277 0.0063  0.0356  0.0655  100  TYR C CZ    
3689 O OH    . TYR B 100 ? 0.7637 0.7787 0.8004 0.0063  0.0351  0.0658  100  TYR C OH    
3690 N N     . ASN B 101 ? 0.6780 0.7022 0.7088 0.0005  0.0390  0.0631  101  ASN C N     
3691 C CA    . ASN B 101 ? 0.6261 0.6490 0.6553 0.0006  0.0393  0.0624  101  ASN C CA    
3692 C C     . ASN B 101 ? 0.6348 0.6616 0.6611 -0.0011 0.0393  0.0625  101  ASN C C     
3693 O O     . ASN B 101 ? 0.7079 0.7365 0.7320 0.0004  0.0387  0.0628  101  ASN C O     
3694 C CB    . ASN B 101 ? 0.5043 0.5264 0.5324 0.0037  0.0381  0.0628  101  ASN C CB    
3695 C CG    . ASN B 101 ? 0.5147 0.5326 0.5451 0.0044  0.0381  0.0627  101  ASN C CG    
3696 O OD1   . ASN B 101 ? 0.5375 0.5541 0.5663 0.0062  0.0370  0.0633  101  ASN C OD1   
3697 N ND2   . ASN B 101 ? 0.5322 0.5479 0.5658 0.0027  0.0394  0.0623  101  ASN C ND2   
3698 N N     . GLY B 102 ? 0.5583 0.5864 0.5838 -0.0045 0.0401  0.0624  102  GLY C N     
3699 C CA    . GLY B 102 ? 0.5966 0.6288 0.6191 -0.0072 0.0399  0.0627  102  GLY C CA    
3700 C C     . GLY B 102 ? 0.6269 0.6676 0.6487 -0.0063 0.0382  0.0648  102  GLY C C     
3701 O O     . GLY B 102 ? 0.6141 0.6600 0.6337 -0.0088 0.0378  0.0657  102  GLY C O     
3702 N N     . LYS B 103 ? 0.5421 0.5845 0.5656 -0.0028 0.0373  0.0658  103  LYS C N     
3703 C CA    . LYS B 103 ? 0.6467 0.6970 0.6698 -0.0011 0.0361  0.0683  103  LYS C CA    
3704 C C     . LYS B 103 ? 0.7032 0.7551 0.7278 -0.0014 0.0358  0.0688  103  LYS C C     
3705 O O     . LYS B 103 ? 0.6592 0.7057 0.6855 -0.0007 0.0361  0.0677  103  LYS C O     
3706 C CB    . LYS B 103 ? 0.7404 0.7909 0.7625 0.0042  0.0357  0.0696  103  LYS C CB    
3707 C CG    . LYS B 103 ? 0.8286 0.8781 0.8484 0.0050  0.0361  0.0692  103  LYS C CG    
3708 C CD    . LYS B 103 ? 0.9181 0.9683 0.9351 0.0102  0.0362  0.0711  103  LYS C CD    
3709 C CE    . LYS B 103 ? 0.9565 0.9981 0.9722 0.0126  0.0366  0.0698  103  LYS C CE    
3710 N NZ    . LYS B 103 ? 0.9346 0.9707 0.9496 0.0113  0.0372  0.0674  103  LYS C NZ    
3711 N N     . LEU B 104 ? 0.6629 0.7227 0.6869 -0.0026 0.0351  0.0708  104  LEU C N     
3712 C CA    . LEU B 104 ? 0.6189 0.6810 0.6441 -0.0024 0.0347  0.0715  104  LEU C CA    
3713 C C     . LEU B 104 ? 0.5979 0.6595 0.6239 0.0032  0.0342  0.0731  104  LEU C C     
3714 O O     . LEU B 104 ? 0.6807 0.7466 0.7055 0.0064  0.0340  0.0754  104  LEU C O     
3715 C CB    . LEU B 104 ? 0.5346 0.6061 0.5588 -0.0054 0.0340  0.0736  104  LEU C CB    
3716 C CG    . LEU B 104 ? 0.5968 0.6687 0.6185 -0.0121 0.0346  0.0723  104  LEU C CG    
3717 C CD1   . LEU B 104 ? 0.5797 0.6621 0.6004 -0.0153 0.0336  0.0748  104  LEU C CD1   
3718 C CD2   . LEU B 104 ? 0.5404 0.6033 0.5614 -0.0144 0.0361  0.0695  104  LEU C CD2   
3719 N N     . ILE B 105 ? 0.5396 0.5955 0.5669 0.0044  0.0343  0.0720  105  ILE C N     
3720 C CA    . ILE B 105 ? 0.5212 0.5744 0.5480 0.0091  0.0339  0.0733  105  ILE C CA    
3721 C C     . ILE B 105 ? 0.6288 0.6839 0.6562 0.0103  0.0336  0.0746  105  ILE C C     
3722 O O     . ILE B 105 ? 0.5854 0.6371 0.6117 0.0139  0.0335  0.0757  105  ILE C O     
3723 C CB    . ILE B 105 ? 0.4773 0.5218 0.5044 0.0101  0.0340  0.0716  105  ILE C CB    
3724 C CG1   . ILE B 105 ? 0.4742 0.5150 0.5039 0.0071  0.0344  0.0694  105  ILE C CG1   
3725 C CG2   . ILE B 105 ? 0.4914 0.5341 0.5170 0.0103  0.0344  0.0709  105  ILE C CG2   
3726 C CD1   . ILE B 105 ? 0.5914 0.6327 0.6223 0.0067  0.0342  0.0695  105  ILE C CD1   
3727 N N     . ALA B 106 ? 0.6744 0.7345 0.7028 0.0070  0.0335  0.0745  106  ALA C N     
3728 C CA    . ALA B 106 ? 0.5718 0.6342 0.6009 0.0078  0.0332  0.0756  106  ALA C CA    
3729 C C     . ALA B 106 ? 0.5666 0.6354 0.5957 0.0032  0.0332  0.0755  106  ALA C C     
3730 O O     . ALA B 106 ? 0.5375 0.6068 0.5657 -0.0012 0.0336  0.0741  106  ALA C O     
3731 C CB    . ALA B 106 ? 0.5219 0.5760 0.5518 0.0087  0.0332  0.0738  106  ALA C CB    
3732 N N     . TYR B 107 ? 0.5355 0.6087 0.5651 0.0041  0.0330  0.0772  107  TYR C N     
3733 C CA    . TYR B 107 ? 0.5643 0.6427 0.5934 -0.0007 0.0329  0.0769  107  TYR C CA    
3734 C C     . TYR B 107 ? 0.5762 0.6470 0.6051 -0.0023 0.0336  0.0739  107  TYR C C     
3735 O O     . TYR B 107 ? 0.5304 0.5966 0.5604 0.0012  0.0335  0.0738  107  TYR C O     
3736 C CB    . TYR B 107 ? 0.5597 0.6476 0.5894 0.0009  0.0324  0.0806  107  TYR C CB    
3737 C CG    . TYR B 107 ? 0.5979 0.6955 0.6278 0.0021  0.0320  0.0842  107  TYR C CG    
3738 C CD1   . TYR B 107 ? 0.6241 0.7306 0.6532 -0.0031 0.0314  0.0853  107  TYR C CD1   
3739 C CD2   . TYR B 107 ? 0.5933 0.6908 0.6233 0.0083  0.0324  0.0869  107  TYR C CD2   
3740 C CE1   . TYR B 107 ? 0.7097 0.8261 0.7392 -0.0019 0.0310  0.0890  107  TYR C CE1   
3741 C CE2   . TYR B 107 ? 0.6186 0.7249 0.6484 0.0100  0.0324  0.0905  107  TYR C CE2   
3742 C CZ    . TYR B 107 ? 0.7129 0.8293 0.7430 0.0050  0.0316  0.0917  107  TYR C CZ    
3743 O OH    . TYR B 107 ? 0.7618 0.8878 0.7920 0.0069  0.0316  0.0957  107  TYR C OH    
3744 N N     . PRO B 108 ? 0.5773 0.6461 0.6040 -0.0075 0.0345  0.0716  108  PRO C N     
3745 C CA    . PRO B 108 ? 0.5698 0.6312 0.5956 -0.0089 0.0357  0.0689  108  PRO C CA    
3746 C C     . PRO B 108 ? 0.5481 0.6135 0.5727 -0.0106 0.0357  0.0693  108  PRO C C     
3747 O O     . PRO B 108 ? 0.4942 0.5680 0.5174 -0.0139 0.0351  0.0710  108  PRO C O     
3748 C CB    . PRO B 108 ? 0.5850 0.6422 0.6074 -0.0138 0.0374  0.0668  108  PRO C CB    
3749 C CG    . PRO B 108 ? 0.6013 0.6663 0.6221 -0.0169 0.0367  0.0685  108  PRO C CG    
3750 C CD    . PRO B 108 ? 0.5851 0.6587 0.6092 -0.0129 0.0347  0.0718  108  PRO C CD    
3751 N N     . ILE B 109 ? 0.5284 0.5882 0.5536 -0.0086 0.0361  0.0680  109  ILE C N     
3752 C CA    . ILE B 109 ? 0.5101 0.5728 0.5343 -0.0097 0.0360  0.0682  109  ILE C CA    
3753 C C     . ILE B 109 ? 0.4546 0.5112 0.4748 -0.0138 0.0380  0.0651  109  ILE C C     
3754 O O     . ILE B 109 ? 0.4778 0.5383 0.4945 -0.0184 0.0385  0.0649  109  ILE C O     
3755 C CB    . ILE B 109 ? 0.4751 0.5358 0.5023 -0.0041 0.0352  0.0693  109  ILE C CB    
3756 C CG1   . ILE B 109 ? 0.4518 0.5159 0.4813 0.0005  0.0340  0.0724  109  ILE C CG1   
3757 C CG2   . ILE B 109 ? 0.4169 0.4815 0.4432 -0.0050 0.0351  0.0699  109  ILE C CG2   
3758 C CD1   . ILE B 109 ? 0.5034 0.5788 0.5331 -0.0002 0.0334  0.0757  109  ILE C CD1   
3759 N N     . ALA B 110 ? 0.4157 0.4629 0.4360 -0.0120 0.0393  0.0630  110  ALA C N     
3760 C CA    . ALA B 110 ? 0.4748 0.5151 0.4908 -0.0148 0.0417  0.0603  110  ALA C CA    
3761 C C     . ALA B 110 ? 0.4536 0.4848 0.4699 -0.0130 0.0435  0.0587  110  ALA C C     
3762 O O     . ALA B 110 ? 0.3978 0.4276 0.4188 -0.0087 0.0423  0.0596  110  ALA C O     
3763 C CB    . ALA B 110 ? 0.4751 0.5149 0.4914 -0.0133 0.0414  0.0598  110  ALA C CB    
3764 N N     . VAL B 111 ? 0.4503 0.4754 0.4612 -0.0163 0.0466  0.0568  111  VAL C N     
3765 C CA    . VAL B 111 ? 0.3943 0.4108 0.4050 -0.0144 0.0491  0.0558  111  VAL C CA    
3766 C C     . VAL B 111 ? 0.4104 0.4217 0.4219 -0.0113 0.0499  0.0548  111  VAL C C     
3767 O O     . VAL B 111 ? 0.4019 0.4112 0.4090 -0.0132 0.0513  0.0533  111  VAL C O     
3768 C CB    . VAL B 111 ? 0.4784 0.4893 0.4816 -0.0191 0.0529  0.0546  111  VAL C CB    
3769 C CG1   . VAL B 111 ? 0.4200 0.4218 0.4225 -0.0165 0.0564  0.0540  111  VAL C CG1   
3770 C CG2   . VAL B 111 ? 0.4631 0.4780 0.4661 -0.0217 0.0521  0.0557  111  VAL C CG2   
3771 N N     . GLU B 112 ? 0.3943 0.4035 0.4111 -0.0067 0.0491  0.0556  112  GLU C N     
3772 C CA    . GLU B 112 ? 0.4107 0.4157 0.4292 -0.0034 0.0493  0.0552  112  GLU C CA    
3773 C C     . GLU B 112 ? 0.4484 0.4470 0.4665 -0.0018 0.0524  0.0551  112  GLU C C     
3774 O O     . GLU B 112 ? 0.4402 0.4388 0.4601 -0.0013 0.0530  0.0563  112  GLU C O     
3775 C CB    . GLU B 112 ? 0.4060 0.4140 0.4307 0.0006  0.0455  0.0568  112  GLU C CB    
3776 C CG    . GLU B 112 ? 0.4651 0.4787 0.4904 0.0004  0.0429  0.0575  112  GLU C CG    
3777 C CD    . GLU B 112 ? 0.4267 0.4413 0.4564 0.0042  0.0399  0.0594  112  GLU C CD    
3778 O OE1   . GLU B 112 ? 0.4298 0.4414 0.4622 0.0063  0.0395  0.0601  112  GLU C OE1   
3779 O OE2   . GLU B 112 ? 0.5235 0.5419 0.5536 0.0050  0.0381  0.0606  112  GLU C OE2   
3780 N N     . ALA B 113 ? 0.4146 0.4080 0.4303 -0.0006 0.0546  0.0540  113  ALA C N     
3781 C CA    . ALA B 113 ? 0.3871 0.3750 0.4032 0.0021  0.0576  0.0547  113  ALA C CA    
3782 C C     . ALA B 113 ? 0.4105 0.3951 0.4266 0.0046  0.0579  0.0540  113  ALA C C     
3783 O O     . ALA B 113 ? 0.4383 0.4219 0.4506 0.0030  0.0579  0.0521  113  ALA C O     
3784 C CB    . ALA B 113 ? 0.4125 0.3946 0.4212 -0.0005 0.0628  0.0540  113  ALA C CB    
3785 N N     . LEU B 114 ? 0.3924 0.3756 0.4127 0.0085  0.0582  0.0557  114  LEU C N     
3786 C CA    . LEU B 114 ? 0.4501 0.4299 0.4706 0.0112  0.0586  0.0554  114  LEU C CA    
3787 C C     . LEU B 114 ? 0.5254 0.4979 0.5378 0.0105  0.0642  0.0536  114  LEU C C     
3788 O O     . LEU B 114 ? 0.4372 0.4063 0.4449 0.0092  0.0683  0.0538  114  LEU C O     
3789 C CB    . LEU B 114 ? 0.3487 0.3300 0.3758 0.0151  0.0575  0.0583  114  LEU C CB    
3790 C CG    . LEU B 114 ? 0.3672 0.3540 0.4009 0.0158  0.0520  0.0600  114  LEU C CG    
3791 C CD1   . LEU B 114 ? 0.3231 0.3116 0.3625 0.0186  0.0511  0.0632  114  LEU C CD1   
3792 C CD2   . LEU B 114 ? 0.3457 0.3320 0.3790 0.0157  0.0489  0.0586  114  LEU C CD2   
3793 N N     . SER B 115 ? 0.4767 0.4458 0.4866 0.0114  0.0646  0.0520  115  SER C N     
3794 C CA    . SER B 115 ? 0.3506 0.3115 0.3521 0.0114  0.0702  0.0503  115  SER C CA    
3795 C C     . SER B 115 ? 0.3775 0.3357 0.3810 0.0157  0.0704  0.0507  115  SER C C     
3796 O O     . SER B 115 ? 0.3667 0.3289 0.3771 0.0176  0.0658  0.0517  115  SER C O     
3797 C CB    . SER B 115 ? 0.4272 0.3856 0.4204 0.0067  0.0713  0.0470  115  SER C CB    
3798 O OG    . SER B 115 ? 0.4240 0.3842 0.4138 0.0022  0.0718  0.0468  115  SER C OG    
3799 N N     . LEU B 116 ? 0.4378 0.3883 0.4343 0.0170  0.0760  0.0500  116  LEU C N     
3800 C CA    . LEU B 116 ? 0.4270 0.3741 0.4237 0.0208  0.0769  0.0498  116  LEU C CA    
3801 C C     . LEU B 116 ? 0.4633 0.4073 0.4549 0.0183  0.0760  0.0460  116  LEU C C     
3802 O O     . LEU B 116 ? 0.4170 0.3563 0.3994 0.0146  0.0793  0.0433  116  LEU C O     
3803 C CB    . LEU B 116 ? 0.4552 0.3948 0.4457 0.0238  0.0839  0.0508  116  LEU C CB    
3804 C CG    . LEU B 116 ? 0.4797 0.4158 0.4703 0.0284  0.0854  0.0512  116  LEU C CG    
3805 C CD1   . LEU B 116 ? 0.4316 0.3755 0.4339 0.0321  0.0807  0.0550  116  LEU C CD1   
3806 C CD2   . LEU B 116 ? 0.3884 0.3158 0.3702 0.0312  0.0937  0.0520  116  LEU C CD2   
3807 N N     . ILE B 117 ? 0.4787 0.4254 0.4760 0.0200  0.0715  0.0459  117  ILE C N     
3808 C CA    . ILE B 117 ? 0.3860 0.3297 0.3791 0.0183  0.0707  0.0426  117  ILE C CA    
3809 C C     . ILE B 117 ? 0.4618 0.3995 0.4533 0.0222  0.0727  0.0421  117  ILE C C     
3810 O O     . ILE B 117 ? 0.4779 0.4176 0.4760 0.0261  0.0710  0.0449  117  ILE C O     
3811 C CB    . ILE B 117 ? 0.3680 0.3181 0.3675 0.0172  0.0644  0.0429  117  ILE C CB    
3812 C CG1   . ILE B 117 ? 0.3836 0.3402 0.3852 0.0140  0.0627  0.0440  117  ILE C CG1   
3813 C CG2   . ILE B 117 ? 0.3880 0.3354 0.3833 0.0154  0.0638  0.0397  117  ILE C CG2   
3814 C CD1   . ILE B 117 ? 0.3338 0.2965 0.3408 0.0132  0.0573  0.0447  117  ILE C CD1   
3815 N N     . TYR B 118 ? 0.4082 0.3386 0.3907 0.0211  0.0764  0.0387  118  TYR C N     
3816 C CA    . TYR B 118 ? 0.3313 0.2552 0.3112 0.0251  0.0792  0.0381  118  TYR C CA    
3817 C C     . TYR B 118 ? 0.4255 0.3437 0.3994 0.0237  0.0795  0.0340  118  TYR C C     
3818 O O     . TYR B 118 ? 0.4438 0.3615 0.4123 0.0190  0.0797  0.0312  118  TYR C O     
3819 C CB    . TYR B 118 ? 0.5143 0.4320 0.4875 0.0273  0.0862  0.0391  118  TYR C CB    
3820 C CG    . TYR B 118 ? 0.5073 0.4172 0.4673 0.0232  0.0919  0.0359  118  TYR C CG    
3821 C CD1   . TYR B 118 ? 0.5162 0.4284 0.4735 0.0184  0.0922  0.0358  118  TYR C CD1   
3822 C CD2   . TYR B 118 ? 0.5539 0.4537 0.5034 0.0239  0.0971  0.0330  118  TYR C CD2   
3823 C CE1   . TYR B 118 ? 0.5113 0.4159 0.4554 0.0138  0.0973  0.0330  118  TYR C CE1   
3824 C CE2   . TYR B 118 ? 0.5931 0.4848 0.5288 0.0194  0.1026  0.0301  118  TYR C CE2   
3825 C CZ    . TYR B 118 ? 0.6114 0.5056 0.5444 0.0141  0.1026  0.0302  118  TYR C CZ    
3826 O OH    . TYR B 118 ? 0.6971 0.5829 0.6155 0.0088  0.1078  0.0274  118  TYR C OH    
3827 N N     . ASN B 119 ? 0.4113 0.3258 0.3863 0.0277  0.0795  0.0339  119  ASN C N     
3828 C CA    . ASN B 119 ? 0.3978 0.3065 0.3680 0.0271  0.0795  0.0301  119  ASN C CA    
3829 C C     . ASN B 119 ? 0.5106 0.4092 0.4686 0.0274  0.0868  0.0275  119  ASN C C     
3830 O O     . ASN B 119 ? 0.6521 0.5467 0.6088 0.0319  0.0905  0.0290  119  ASN C O     
3831 C CB    . ASN B 119 ? 0.4416 0.3505 0.4187 0.0312  0.0757  0.0314  119  ASN C CB    
3832 C CG    . ASN B 119 ? 0.4797 0.3832 0.4530 0.0305  0.0749  0.0276  119  ASN C CG    
3833 O OD1   . ASN B 119 ? 0.5177 0.4147 0.4814 0.0284  0.0789  0.0238  119  ASN C OD1   
3834 N ND2   . ASN B 119 ? 0.5809 0.4861 0.5609 0.0319  0.0697  0.0286  119  ASN C ND2   
3835 N N     . LYS B 120 ? 0.4411 0.3359 0.3898 0.0225  0.0892  0.0238  120  LYS C N     
3836 C CA    . LYS B 120 ? 0.5398 0.4239 0.4746 0.0216  0.0966  0.0211  120  LYS C CA    
3837 C C     . LYS B 120 ? 0.5656 0.4413 0.4960 0.0254  0.0991  0.0189  120  LYS C C     
3838 O O     . LYS B 120 ? 0.6374 0.5041 0.5587 0.0279  0.1057  0.0184  120  LYS C O     
3839 C CB    . LYS B 120 ? 0.6495 0.5322 0.5751 0.0143  0.0980  0.0179  120  LYS C CB    
3840 C CG    . LYS B 120 ? 0.6570 0.5456 0.5837 0.0104  0.0974  0.0200  120  LYS C CG    
3841 C CD    . LYS B 120 ? 0.6877 0.5751 0.6044 0.0027  0.0987  0.0170  120  LYS C CD    
3842 C CE    . LYS B 120 ? 0.7702 0.6632 0.6876 -0.0013 0.0981  0.0192  120  LYS C CE    
3843 N NZ    . LYS B 120 ? 0.7268 0.6175 0.6325 -0.0095 0.1003  0.0167  120  LYS C NZ    
3844 N N     . ASP B 121 ? 0.5926 0.4705 0.5290 0.0261  0.0941  0.0177  121  ASP C N     
3845 C CA    . ASP B 121 ? 0.5425 0.4126 0.4757 0.0299  0.0959  0.0156  121  ASP C CA    
3846 C C     . ASP B 121 ? 0.5378 0.4082 0.4766 0.0366  0.0966  0.0195  121  ASP C C     
3847 O O     . ASP B 121 ? 0.6407 0.5032 0.5734 0.0403  0.1012  0.0186  121  ASP C O     
3848 C CB    . ASP B 121 ? 0.4929 0.3648 0.4308 0.0289  0.0903  0.0136  121  ASP C CB    
3849 C CG    . ASP B 121 ? 0.5943 0.4661 0.5261 0.0226  0.0902  0.0101  121  ASP C CG    
3850 O OD1   . ASP B 121 ? 0.7315 0.5980 0.6519 0.0191  0.0956  0.0078  121  ASP C OD1   
3851 O OD2   . ASP B 121 ? 0.6667 0.5437 0.6046 0.0209  0.0850  0.0099  121  ASP C OD2   
3852 N N     . LEU B 122 ? 0.5448 0.4247 0.4951 0.0380  0.0922  0.0240  122  LEU C N     
3853 C CA    . LEU B 122 ? 0.4682 0.3500 0.4241 0.0439  0.0927  0.0283  122  LEU C CA    
3854 C C     . LEU B 122 ? 0.5223 0.4027 0.4737 0.0457  0.0991  0.0309  122  LEU C C     
3855 O O     . LEU B 122 ? 0.5301 0.4093 0.4821 0.0511  0.1023  0.0340  122  LEU C O     
3856 C CB    . LEU B 122 ? 0.4019 0.2942 0.3715 0.0444  0.0854  0.0323  122  LEU C CB    
3857 C CG    . LEU B 122 ? 0.4716 0.3651 0.4468 0.0438  0.0790  0.0313  122  LEU C CG    
3858 C CD1   . LEU B 122 ? 0.4435 0.3465 0.4302 0.0438  0.0727  0.0358  122  LEU C CD1   
3859 C CD2   . LEU B 122 ? 0.4382 0.3247 0.4108 0.0477  0.0804  0.0302  122  LEU C CD2   
3860 N N     . LEU B 123 ? 0.4727 0.3533 0.4194 0.0412  0.1009  0.0299  123  LEU C N     
3861 C CA    . LEU B 123 ? 0.4546 0.3347 0.3984 0.0426  0.1061  0.0330  123  LEU C CA    
3862 C C     . LEU B 123 ? 0.5840 0.4579 0.5155 0.0371  0.1107  0.0299  123  LEU C C     
3863 O O     . LEU B 123 ? 0.6254 0.5049 0.5596 0.0328  0.1081  0.0305  123  LEU C O     
3864 C CB    . LEU B 123 ? 0.5204 0.4123 0.4772 0.0432  0.1010  0.0378  123  LEU C CB    
3865 C CG    . LEU B 123 ? 0.6095 0.5033 0.5669 0.0455  0.1051  0.0422  123  LEU C CG    
3866 C CD1   . LEU B 123 ? 0.5857 0.4747 0.5400 0.0522  0.1112  0.0451  123  LEU C CD1   
3867 C CD2   . LEU B 123 ? 0.4697 0.3757 0.4408 0.0453  0.0985  0.0461  123  LEU C CD2   
3868 N N     . PRO B 124 ? 0.6549 0.5166 0.5720 0.0368  0.1175  0.0266  124  PRO C N     
3869 C CA    . PRO B 124 ? 0.6049 0.4590 0.5079 0.0306  0.1222  0.0233  124  PRO C CA    
3870 C C     . PRO B 124 ? 0.5529 0.4078 0.4540 0.0294  0.1253  0.0264  124  PRO C C     
3871 O O     . PRO B 124 ? 0.6205 0.4760 0.5170 0.0228  0.1248  0.0248  124  PRO C O     
3872 C CB    . PRO B 124 ? 0.6417 0.4815 0.5297 0.0328  0.1303  0.0207  124  PRO C CB    
3873 C CG    . PRO B 124 ? 0.6901 0.5315 0.5857 0.0384  0.1274  0.0209  124  PRO C CG    
3874 C CD    . PRO B 124 ? 0.6703 0.5244 0.5830 0.0423  0.1215  0.0261  124  PRO C CD    
3875 N N     . ASN B 125 ? 0.5300 0.3853 0.4348 0.0357  0.1284  0.0310  125  ASN C N     
3876 C CA    . ASN B 125 ? 0.5588 0.4147 0.4627 0.0355  0.1316  0.0345  125  ASN C CA    
3877 C C     . ASN B 125 ? 0.6185 0.4873 0.5392 0.0394  0.1263  0.0397  125  ASN C C     
3878 O O     . ASN B 125 ? 0.5803 0.4516 0.5073 0.0461  0.1270  0.0434  125  ASN C O     
3879 C CB    . ASN B 125 ? 0.6931 0.5357 0.5828 0.0392  0.1423  0.0359  125  ASN C CB    
3880 C CG    . ASN B 125 ? 0.8170 0.6453 0.6883 0.0355  0.1482  0.0307  125  ASN C CG    
3881 O OD1   . ASN B 125 ? 0.9132 0.7373 0.7748 0.0279  0.1490  0.0275  125  ASN C OD1   
3882 N ND2   . ASN B 125 ? 0.7863 0.6073 0.6524 0.0406  0.1524  0.0299  125  ASN C ND2   
3883 N N     . PRO B 126 ? 0.6362 0.5135 0.5638 0.0349  0.1210  0.0402  126  PRO C N     
3884 C CA    . PRO B 126 ? 0.6515 0.5410 0.5946 0.0376  0.1155  0.0447  126  PRO C CA    
3885 C C     . PRO B 126 ? 0.6386 0.5264 0.5809 0.0422  0.1214  0.0496  126  PRO C C     
3886 O O     . PRO B 126 ? 0.5724 0.4501 0.5021 0.0412  0.1288  0.0491  126  PRO C O     
3887 C CB    . PRO B 126 ? 0.7003 0.5961 0.6466 0.0311  0.1103  0.0432  126  PRO C CB    
3888 C CG    . PRO B 126 ? 0.6812 0.5669 0.6120 0.0259  0.1161  0.0400  126  PRO C CG    
3889 C CD    . PRO B 126 ? 0.6372 0.5121 0.5569 0.0272  0.1211  0.0370  126  PRO C CD    
3890 N N     . PRO B 127 ? 0.6916 0.5889 0.6468 0.0470  0.1183  0.0545  127  PRO C N     
3891 C CA    . PRO B 127 ? 0.6573 0.5549 0.6137 0.0522  0.1236  0.0600  127  PRO C CA    
3892 C C     . PRO B 127 ? 0.6833 0.5817 0.6388 0.0488  0.1245  0.0610  127  PRO C C     
3893 O O     . PRO B 127 ? 0.5860 0.4918 0.5482 0.0442  0.1179  0.0597  127  PRO C O     
3894 C CB    . PRO B 127 ? 0.6728 0.5830 0.6449 0.0564  0.1176  0.0644  127  PRO C CB    
3895 C CG    . PRO B 127 ? 0.6305 0.5482 0.6104 0.0513  0.1083  0.0615  127  PRO C CG    
3896 C CD    . PRO B 127 ? 0.6295 0.5385 0.5990 0.0470  0.1091  0.0553  127  PRO C CD    
3897 N N     . LYS B 128 ? 0.6831 0.5735 0.6301 0.0514  0.1330  0.0636  128  LYS C N     
3898 C CA    . LYS B 128 ? 0.7125 0.6016 0.6569 0.0484  0.1350  0.0648  128  LYS C CA    
3899 C C     . LYS B 128 ? 0.5697 0.4711 0.5288 0.0516  0.1313  0.0702  128  LYS C C     
3900 O O     . LYS B 128 ? 0.6200 0.5243 0.5816 0.0483  0.1296  0.0707  128  LYS C O     
3901 C CB    . LYS B 128 ? 0.8664 0.7403 0.7944 0.0500  0.1462  0.0656  128  LYS C CB    
3902 C CG    . LYS B 128 ? 1.0592 0.9208 0.9707 0.0427  0.1494  0.0601  128  LYS C CG    
3903 C CD    . LYS B 128 ? 1.1800 1.0397 1.0878 0.0400  0.1466  0.0549  128  LYS C CD    
3904 C CE    . LYS B 128 ? 1.2508 1.1028 1.1455 0.0311  0.1472  0.0496  128  LYS C CE    
3905 N NZ    . LYS B 128 ? 1.2936 1.1556 1.1966 0.0252  0.1397  0.0488  128  LYS C NZ    
3906 N N     . THR B 129 ? 0.4709 0.3794 0.4394 0.0578  0.1302  0.0744  129  THR C N     
3907 C CA    . THR B 129 ? 0.4256 0.3457 0.4073 0.0612  0.1276  0.0804  129  THR C CA    
3908 C C     . THR B 129 ? 0.5198 0.4529 0.5156 0.0620  0.1188  0.0816  129  THR C C     
3909 O O     . THR B 129 ? 0.5904 0.5225 0.5856 0.0628  0.1170  0.0796  129  THR C O     
3910 C CB    . THR B 129 ? 0.5564 0.4734 0.5356 0.0688  0.1362  0.0864  129  THR C CB    
3911 O OG1   . THR B 129 ? 0.6213 0.5397 0.6023 0.0738  0.1367  0.0879  129  THR C OG1   
3912 C CG2   . THR B 129 ? 0.5508 0.4516 0.5128 0.0686  0.1464  0.0852  129  THR C CG2   
3913 N N     . TRP B 130 ? 0.5284 0.4729 0.5360 0.0615  0.1134  0.0849  130  TRP C N     
3914 C CA    . TRP B 130 ? 0.5005 0.4570 0.5208 0.0623  0.1058  0.0873  130  TRP C CA    
3915 C C     . TRP B 130 ? 0.5114 0.4707 0.5346 0.0691  0.1092  0.0926  130  TRP C C     
3916 O O     . TRP B 130 ? 0.5422 0.5064 0.5708 0.0700  0.1046  0.0931  130  TRP C O     
3917 C CB    . TRP B 130 ? 0.4742 0.4415 0.5051 0.0603  0.1005  0.0902  130  TRP C CB    
3918 C CG    . TRP B 130 ? 0.5624 0.5304 0.5937 0.0538  0.0945  0.0855  130  TRP C CG    
3919 C CD1   . TRP B 130 ? 0.5323 0.4957 0.5582 0.0502  0.0962  0.0829  130  TRP C CD1   
3920 C CD2   . TRP B 130 ? 0.6177 0.5915 0.6550 0.0504  0.0861  0.0834  130  TRP C CD2   
3921 N NE1   . TRP B 130 ? 0.4905 0.4573 0.5191 0.0450  0.0894  0.0793  130  TRP C NE1   
3922 C CE2   . TRP B 130 ? 0.5521 0.5247 0.5874 0.0453  0.0834  0.0796  130  TRP C CE2   
3923 C CE3   . TRP B 130 ? 0.5279 0.5069 0.5712 0.0512  0.0809  0.0845  130  TRP C CE3   
3924 C CZ2   . TRP B 130 ? 0.4493 0.4259 0.4884 0.0415  0.0761  0.0772  130  TRP C CZ2   
3925 C CZ3   . TRP B 130 ? 0.4797 0.4614 0.5260 0.0469  0.0736  0.0818  130  TRP C CZ3   
3926 C CH2   . TRP B 130 ? 0.3956 0.3762 0.4398 0.0424  0.0715  0.0783  130  TRP C CH2   
3927 N N     . GLU B 131 ? 0.5568 0.5127 0.5762 0.0740  0.1173  0.0968  131  GLU C N     
3928 C CA    . GLU B 131 ? 0.6405 0.6006 0.6635 0.0813  0.1212  0.1032  131  GLU C CA    
3929 C C     . GLU B 131 ? 0.6374 0.5921 0.6552 0.0839  0.1227  0.1012  131  GLU C C     
3930 O O     . GLU B 131 ? 0.6422 0.6045 0.6669 0.0883  0.1215  0.1058  131  GLU C O     
3931 C CB    . GLU B 131 ? 0.6992 0.6541 0.7165 0.0865  0.1312  0.1079  131  GLU C CB    
3932 C CG    . GLU B 131 ? 0.6736 0.6378 0.6999 0.0865  0.1299  0.1129  131  GLU C CG    
3933 C CD    . GLU B 131 ? 0.6647 0.6223 0.6854 0.0810  0.1302  0.1086  131  GLU C CD    
3934 O OE1   . GLU B 131 ? 0.6875 0.6366 0.7001 0.0757  0.1288  0.1017  131  GLU C OE1   
3935 O OE2   . GLU B 131 ? 0.6653 0.6264 0.6898 0.0818  0.1320  0.1125  131  GLU C OE2   
3936 N N     . GLU B 132 ? 0.5048 0.4467 0.5105 0.0810  0.1251  0.0945  132  GLU C N     
3937 C CA    . GLU B 132 ? 0.5734 0.5086 0.5728 0.0834  0.1273  0.0922  132  GLU C CA    
3938 C C     . GLU B 132 ? 0.6036 0.5442 0.6096 0.0799  0.1181  0.0888  132  GLU C C     
3939 O O     . GLU B 132 ? 0.5667 0.5036 0.5697 0.0821  0.1186  0.0873  132  GLU C O     
3940 C CB    . GLU B 132 ? 0.5956 0.5140 0.5777 0.0820  0.1349  0.0868  132  GLU C CB    
3941 C CG    . GLU B 132 ? 0.6393 0.5533 0.6169 0.0739  0.1306  0.0797  132  GLU C CG    
3942 C CD    . GLU B 132 ? 0.7262 0.6249 0.6868 0.0715  0.1387  0.0760  132  GLU C CD    
3943 O OE1   . GLU B 132 ? 0.7899 0.6784 0.7395 0.0705  0.1416  0.0714  132  GLU C OE1   
3944 O OE2   . GLU B 132 ? 0.6584 0.5549 0.6159 0.0704  0.1422  0.0776  132  GLU C OE2   
3945 N N     . ILE B 133 ? 0.5448 0.4935 0.5593 0.0747  0.1099  0.0878  133  ILE C N     
3946 C CA    . ILE B 133 ? 0.4487 0.4008 0.4681 0.0709  0.1015  0.0845  133  ILE C CA    
3947 C C     . ILE B 133 ? 0.4960 0.4557 0.5235 0.0743  0.0978  0.0885  133  ILE C C     
3948 O O     . ILE B 133 ? 0.4828 0.4390 0.5085 0.0735  0.0951  0.0852  133  ILE C O     
3949 C CB    . ILE B 133 ? 0.4774 0.4355 0.5027 0.0647  0.0942  0.0827  133  ILE C CB    
3950 C CG1   . ILE B 133 ? 0.5130 0.4623 0.5288 0.0605  0.0970  0.0773  133  ILE C CG1   
3951 C CG2   . ILE B 133 ? 0.3904 0.3523 0.4211 0.0617  0.0859  0.0806  133  ILE C CG2   
3952 C CD1   . ILE B 133 ? 0.4361 0.3904 0.4565 0.0549  0.0908  0.0754  133  ILE C CD1   
3953 N N     . PRO B 134 ? 0.5128 0.4828 0.5489 0.0779  0.0979  0.0957  134  PRO C N     
3954 C CA    . PRO B 134 ? 0.5248 0.5026 0.5681 0.0808  0.0945  0.1000  134  PRO C CA    
3955 C C     . PRO B 134 ? 0.5593 0.5285 0.5950 0.0852  0.0995  0.0985  134  PRO C C     
3956 O O     . PRO B 134 ? 0.5696 0.5385 0.6065 0.0843  0.0950  0.0967  134  PRO C O     
3957 C CB    . PRO B 134 ? 0.5711 0.5600 0.6224 0.0850  0.0967  0.1085  134  PRO C CB    
3958 C CG    . PRO B 134 ? 0.4775 0.4672 0.5293 0.0819  0.0970  0.1079  134  PRO C CG    
3959 C CD    . PRO B 134 ? 0.4795 0.4550 0.5192 0.0794  0.1009  0.1006  134  PRO C CD    
3960 N N     . ALA B 135 ? 0.4908 0.4523 0.5178 0.0901  0.1090  0.0993  135  ALA C N     
3961 C CA    . ALA B 135 ? 0.5393 0.4913 0.5574 0.0946  0.1149  0.0977  135  ALA C CA    
3962 C C     . ALA B 135 ? 0.5204 0.4615 0.5303 0.0899  0.1127  0.0891  135  ALA C C     
3963 O O     . ALA B 135 ? 0.5272 0.4639 0.5340 0.0916  0.1127  0.0871  135  ALA C O     
3964 C CB    . ALA B 135 ? 0.5564 0.4999 0.5644 0.1002  0.1264  0.0998  135  ALA C CB    
3965 N N     . LEU B 136 ? 0.4810 0.4183 0.4876 0.0839  0.1108  0.0841  136  LEU C N     
3966 C CA    . LEU B 136 ? 0.4813 0.4095 0.4807 0.0791  0.1086  0.0764  136  LEU C CA    
3967 C C     . LEU B 136 ? 0.5441 0.4779 0.5516 0.0766  0.0996  0.0753  136  LEU C C     
3968 O O     . LEU B 136 ? 0.5627 0.4894 0.5650 0.0759  0.0989  0.0708  136  LEU C O     
3969 C CB    . LEU B 136 ? 0.4746 0.3999 0.4701 0.0732  0.1081  0.0724  136  LEU C CB    
3970 C CG    . LEU B 136 ? 0.5204 0.4387 0.5097 0.0675  0.1052  0.0650  136  LEU C CG    
3971 C CD1   . LEU B 136 ? 0.5968 0.5025 0.5736 0.0695  0.1115  0.0611  136  LEU C CD1   
3972 C CD2   . LEU B 136 ? 0.4959 0.4130 0.4819 0.0620  0.1051  0.0624  136  LEU C CD2   
3973 N N     . ASP B 137 ? 0.5765 0.5222 0.5956 0.0751  0.0930  0.0794  137  ASP C N     
3974 C CA    . ASP B 137 ? 0.5391 0.4896 0.5652 0.0723  0.0845  0.0791  137  ASP C CA    
3975 C C     . ASP B 137 ? 0.4176 0.3681 0.4445 0.0768  0.0849  0.0815  137  ASP C C     
3976 O O     . ASP B 137 ? 0.4562 0.4022 0.4815 0.0752  0.0814  0.0780  137  ASP C O     
3977 C CB    . ASP B 137 ? 0.4349 0.3976 0.4719 0.0696  0.0780  0.0836  137  ASP C CB    
3978 C CG    . ASP B 137 ? 0.5176 0.4835 0.5599 0.0660  0.0695  0.0832  137  ASP C CG    
3979 O OD1   . ASP B 137 ? 0.4974 0.4573 0.5362 0.0620  0.0664  0.0779  137  ASP C OD1   
3980 O OD2   . ASP B 137 ? 0.5317 0.5061 0.5812 0.0671  0.0661  0.0886  137  ASP C OD2   
3981 N N     . LYS B 138 ? 0.5005 0.4559 0.5298 0.0825  0.0896  0.0875  138  LYS C N     
3982 C CA    . LYS B 138 ? 0.5192 0.4755 0.5492 0.0874  0.0908  0.0906  138  LYS C CA    
3983 C C     . LYS B 138 ? 0.5750 0.5174 0.5939 0.0886  0.0946  0.0843  138  LYS C C     
3984 O O     . LYS B 138 ? 0.5526 0.4935 0.5723 0.0890  0.0914  0.0833  138  LYS C O     
3985 C CB    . LYS B 138 ? 0.5284 0.4909 0.5607 0.0943  0.0972  0.0980  138  LYS C CB    
3986 C CG    . LYS B 138 ? 0.6532 0.6199 0.6885 0.0996  0.0978  0.1028  138  LYS C CG    
3987 C CD    . LYS B 138 ? 0.7293 0.7059 0.7697 0.1061  0.1029  0.1118  138  LYS C CD    
3988 C CE    . LYS B 138 ? 0.7550 0.7372 0.7987 0.1117  0.1036  0.1173  138  LYS C CE    
3989 N NZ    . LYS B 138 ? 0.8318 0.8274 0.8833 0.1174  0.1068  0.1274  138  LYS C NZ    
3990 N N     . GLU B 139 ? 0.5104 0.4423 0.5187 0.0887  0.1013  0.0798  139  GLU C N     
3991 C CA    . GLU B 139 ? 0.5367 0.4549 0.5332 0.0892  0.1053  0.0735  139  GLU C CA    
3992 C C     . GLU B 139 ? 0.5101 0.4251 0.5070 0.0832  0.0982  0.0675  139  GLU C C     
3993 O O     . GLU B 139 ? 0.5150 0.4234 0.5080 0.0839  0.0976  0.0643  139  GLU C O     
3994 C CB    . GLU B 139 ? 0.6049 0.5122 0.5887 0.0892  0.1139  0.0700  139  GLU C CB    
3995 C CG    . GLU B 139 ? 0.8902 0.7964 0.8699 0.0957  0.1229  0.0753  139  GLU C CG    
3996 C CD    . GLU B 139 ? 1.1472 1.0407 1.1125 0.0946  0.1312  0.0714  139  GLU C CD    
3997 O OE1   . GLU B 139 ? 1.1858 1.0704 1.1429 0.0894  0.1305  0.0643  139  GLU C OE1   
3998 O OE2   . GLU B 139 ? 1.2517 1.1440 1.2133 0.0986  0.1384  0.0757  139  GLU C OE2   
3999 N N     . LEU B 140 ? 0.4173 0.3364 0.4183 0.0775  0.0931  0.0661  140  LEU C N     
4000 C CA    . LEU B 140 ? 0.4441 0.3602 0.4452 0.0722  0.0869  0.0609  140  LEU C CA    
4001 C C     . LEU B 140 ? 0.4785 0.4001 0.4880 0.0719  0.0795  0.0634  140  LEU C C     
4002 O O     . LEU B 140 ? 0.4131 0.3293 0.4207 0.0697  0.0760  0.0595  140  LEU C O     
4003 C CB    . LEU B 140 ? 0.4707 0.3896 0.4734 0.0667  0.0839  0.0591  140  LEU C CB    
4004 C CG    . LEU B 140 ? 0.5087 0.4200 0.5010 0.0652  0.0903  0.0551  140  LEU C CG    
4005 C CD1   . LEU B 140 ? 0.3943 0.3111 0.3898 0.0608  0.0881  0.0554  140  LEU C CD1   
4006 C CD2   . LEU B 140 ? 0.4507 0.3516 0.4338 0.0629  0.0914  0.0484  140  LEU C CD2   
4007 N N     . LYS B 141 ? 0.4476 0.3797 0.4659 0.0740  0.0773  0.0702  141  LYS C N     
4008 C CA    . LYS B 141 ? 0.5027 0.4400 0.5280 0.0730  0.0703  0.0731  141  LYS C CA    
4009 C C     . LYS B 141 ? 0.5703 0.5000 0.5908 0.0762  0.0719  0.0712  141  LYS C C     
4010 O O     . LYS B 141 ? 0.4293 0.3563 0.4508 0.0737  0.0665  0.0695  141  LYS C O     
4011 C CB    . LYS B 141 ? 0.5148 0.4655 0.5499 0.0745  0.0682  0.0812  141  LYS C CB    
4012 C CG    . LYS B 141 ? 0.4754 0.4341 0.5165 0.0701  0.0642  0.0831  141  LYS C CG    
4013 C CD    . LYS B 141 ? 0.5335 0.4879 0.5735 0.0641  0.0582  0.0785  141  LYS C CD    
4014 C CE    . LYS B 141 ? 0.4610 0.4245 0.5088 0.0598  0.0510  0.0825  141  LYS C CE    
4015 N NZ    . LYS B 141 ? 0.4045 0.3762 0.4566 0.0591  0.0519  0.0855  141  LYS C NZ    
4016 N N     . ALA B 142 ? 0.4767 0.4017 0.4910 0.0816  0.0797  0.0712  142  ALA C N     
4017 C CA    . ALA B 142 ? 0.4672 0.3844 0.4760 0.0854  0.0823  0.0692  142  ALA C CA    
4018 C C     . ALA B 142 ? 0.5317 0.4367 0.5327 0.0820  0.0814  0.0612  142  ALA C C     
4019 O O     . ALA B 142 ? 0.5695 0.4675 0.5668 0.0837  0.0815  0.0589  142  ALA C O     
4020 C CB    . ALA B 142 ? 0.3577 0.2714 0.3599 0.0922  0.0920  0.0710  142  ALA C CB    
4021 N N     . LYS B 143 ? 0.5285 0.4312 0.5273 0.0773  0.0806  0.0571  143  LYS C N     
4022 C CA    . LYS B 143 ? 0.5067 0.3993 0.4987 0.0737  0.0796  0.0500  143  LYS C CA    
4023 C C     . LYS B 143 ? 0.4853 0.3814 0.4838 0.0686  0.0712  0.0497  143  LYS C C     
4024 O O     . LYS B 143 ? 0.5385 0.4286 0.5333 0.0651  0.0695  0.0447  143  LYS C O     
4025 C CB    . LYS B 143 ? 0.5949 0.4822 0.5787 0.0718  0.0850  0.0457  143  LYS C CB    
4026 C CG    . LYS B 143 ? 0.7673 0.6487 0.7421 0.0764  0.0943  0.0456  143  LYS C CG    
4027 C CD    . LYS B 143 ? 0.8455 0.7230 0.8126 0.0734  0.0990  0.0426  143  LYS C CD    
4028 C CE    . LYS B 143 ? 0.9753 0.8459 0.9322 0.0779  0.1089  0.0433  143  LYS C CE    
4029 N NZ    . LYS B 143 ? 1.0742 0.9422 1.0243 0.0747  0.1132  0.0418  143  LYS C NZ    
4030 N N     . GLY B 144 ? 0.4998 0.4058 0.5076 0.0681  0.0661  0.0554  144  GLY C N     
4031 C CA    . GLY B 144 ? 0.5230 0.4317 0.5358 0.0632  0.0585  0.0558  144  GLY C CA    
4032 C C     . GLY B 144 ? 0.4678 0.3791 0.4812 0.0592  0.0577  0.0542  144  GLY C C     
4033 O O     . GLY B 144 ? 0.4915 0.4013 0.5056 0.0553  0.0531  0.0525  144  GLY C O     
4034 N N     . LYS B 145 ? 0.5186 0.4332 0.5310 0.0604  0.0625  0.0550  145  LYS C N     
4035 C CA    . LYS B 145 ? 0.5388 0.4565 0.5518 0.0568  0.0619  0.0539  145  LYS C CA    
4036 C C     . LYS B 145 ? 0.5093 0.4374 0.5290 0.0575  0.0617  0.0595  145  LYS C C     
4037 O O     . LYS B 145 ? 0.5805 0.5137 0.6045 0.0607  0.0620  0.0643  145  LYS C O     
4038 C CB    . LYS B 145 ? 0.4077 0.3185 0.4117 0.0566  0.0681  0.0490  145  LYS C CB    
4039 C CG    . LYS B 145 ? 0.4660 0.3669 0.4630 0.0555  0.0685  0.0432  145  LYS C CG    
4040 C CD    . LYS B 145 ? 0.4737 0.3751 0.4740 0.0515  0.0621  0.0418  145  LYS C CD    
4041 C CE    . LYS B 145 ? 0.4655 0.3573 0.4594 0.0508  0.0624  0.0366  145  LYS C CE    
4042 N NZ    . LYS B 145 ? 0.4478 0.3395 0.4442 0.0474  0.0570  0.0357  145  LYS C NZ    
4043 N N     . SER B 146 ? 0.4903 0.4219 0.5111 0.0546  0.0614  0.0591  146  SER C N     
4044 C CA    . SER B 146 ? 0.4672 0.4076 0.4933 0.0553  0.0622  0.0639  146  SER C CA    
4045 C C     . SER B 146 ? 0.4564 0.3950 0.4778 0.0543  0.0669  0.0616  146  SER C C     
4046 O O     . SER B 146 ? 0.4432 0.3758 0.4585 0.0517  0.0679  0.0566  146  SER C O     
4047 C CB    . SER B 146 ? 0.4141 0.3623 0.4479 0.0520  0.0552  0.0671  146  SER C CB    
4048 O OG    . SER B 146 ? 0.4551 0.4019 0.4875 0.0479  0.0529  0.0639  146  SER C OG    
4049 N N     . ALA B 147 ? 0.4035 0.3475 0.4274 0.0562  0.0700  0.0655  147  ALA C N     
4050 C CA    . ALA B 147 ? 0.4058 0.3477 0.4247 0.0551  0.0747  0.0638  147  ALA C CA    
4051 C C     . ALA B 147 ? 0.4318 0.3771 0.4532 0.0500  0.0704  0.0623  147  ALA C C     
4052 O O     . ALA B 147 ? 0.4981 0.4387 0.5133 0.0471  0.0721  0.0581  147  ALA C O     
4053 C CB    . ALA B 147 ? 0.3365 0.2825 0.3574 0.0589  0.0795  0.0689  147  ALA C CB    
4054 N N     . LEU B 148 ? 0.4486 0.4022 0.4785 0.0487  0.0649  0.0658  148  LEU C N     
4055 C CA    . LEU B 148 ? 0.4047 0.3624 0.4369 0.0449  0.0621  0.0654  148  LEU C CA    
4056 C C     . LEU B 148 ? 0.4475 0.4108 0.4863 0.0423  0.0548  0.0674  148  LEU C C     
4057 O O     . LEU B 148 ? 0.5470 0.5161 0.5918 0.0434  0.0522  0.0718  148  LEU C O     
4058 C CB    . LEU B 148 ? 0.3505 0.3120 0.3839 0.0461  0.0660  0.0685  148  LEU C CB    
4059 C CG    . LEU B 148 ? 0.3716 0.3388 0.4089 0.0428  0.0630  0.0693  148  LEU C CG    
4060 C CD1   . LEU B 148 ? 0.3419 0.3046 0.3732 0.0392  0.0637  0.0645  148  LEU C CD1   
4061 C CD2   . LEU B 148 ? 0.3063 0.2779 0.3464 0.0450  0.0666  0.0734  148  LEU C CD2   
4062 N N     . MET B 149 ? 0.4354 0.3969 0.4726 0.0388  0.0518  0.0643  149  MET C N     
4063 C CA    . MET B 149 ? 0.4768 0.4423 0.5184 0.0362  0.0457  0.0660  149  MET C CA    
4064 C C     . MET B 149 ? 0.4512 0.4186 0.4922 0.0333  0.0449  0.0646  149  MET C C     
4065 O O     . MET B 149 ? 0.4707 0.4345 0.5071 0.0320  0.0466  0.0609  149  MET C O     
4066 C CB    . MET B 149 ? 0.4468 0.4074 0.4869 0.0354  0.0420  0.0646  149  MET C CB    
4067 C CG    . MET B 149 ? 0.4579 0.4174 0.4994 0.0378  0.0414  0.0666  149  MET C CG    
4068 S SD    . MET B 149 ? 0.6599 0.6125 0.6990 0.0363  0.0368  0.0650  149  MET C SD    
4069 C CE    . MET B 149 ? 0.3986 0.3557 0.4414 0.0326  0.0308  0.0686  149  MET C CE    
4070 N N     . PHE B 150 ? 0.4622 0.4357 0.5080 0.0320  0.0422  0.0677  150  PHE C N     
4071 C CA    . PHE B 150 ? 0.4668 0.4422 0.5122 0.0294  0.0411  0.0666  150  PHE C CA    
4072 C C     . PHE B 150 ? 0.4189 0.3990 0.4686 0.0277  0.0365  0.0699  150  PHE C C     
4073 O O     . PHE B 150 ? 0.4775 0.4606 0.5308 0.0283  0.0348  0.0734  150  PHE C O     
4074 C CB    . PHE B 150 ? 0.4066 0.3834 0.4506 0.0296  0.0457  0.0659  150  PHE C CB    
4075 C CG    . PHE B 150 ? 0.4102 0.3921 0.4587 0.0312  0.0472  0.0699  150  PHE C CG    
4076 C CD1   . PHE B 150 ? 0.4151 0.3964 0.4638 0.0346  0.0510  0.0716  150  PHE C CD1   
4077 C CD2   . PHE B 150 ? 0.4431 0.4305 0.4953 0.0296  0.0453  0.0720  150  PHE C CD2   
4078 C CE1   . PHE B 150 ? 0.4050 0.3916 0.4580 0.0365  0.0528  0.0758  150  PHE C CE1   
4079 C CE2   . PHE B 150 ? 0.4380 0.4304 0.4946 0.0312  0.0468  0.0758  150  PHE C CE2   
4080 C CZ    . PHE B 150 ? 0.4053 0.3976 0.4625 0.0347  0.0506  0.0779  150  PHE C CZ    
4081 N N     . ASN B 151 ? 0.3866 0.3673 0.4352 0.0254  0.0347  0.0689  151  ASN C N     
4082 C CA    . ASN B 151 ? 0.3693 0.3527 0.4200 0.0234  0.0306  0.0715  151  ASN C CA    
4083 C C     . ASN B 151 ? 0.4661 0.4559 0.5216 0.0234  0.0304  0.0751  151  ASN C C     
4084 O O     . ASN B 151 ? 0.4946 0.4878 0.5514 0.0235  0.0328  0.0751  151  ASN C O     
4085 C CB    . ASN B 151 ? 0.3585 0.3413 0.4066 0.0217  0.0298  0.0696  151  ASN C CB    
4086 C CG    . ASN B 151 ? 0.4582 0.4417 0.5063 0.0197  0.0260  0.0719  151  ASN C CG    
4087 O OD1   . ASN B 151 ? 0.4471 0.4304 0.4962 0.0189  0.0234  0.0746  151  ASN C OD1   
4088 N ND2   . ASN B 151 ? 0.3101 0.2941 0.3563 0.0187  0.0259  0.0710  151  ASN C ND2   
4089 N N     . LEU B 152 ? 0.4078 0.3997 0.4661 0.0230  0.0276  0.0785  152  LEU C N     
4090 C CA    . LEU B 152 ? 0.4581 0.4574 0.5215 0.0227  0.0272  0.0826  152  LEU C CA    
4091 C C     . LEU B 152 ? 0.5182 0.5195 0.5817 0.0193  0.0233  0.0844  152  LEU C C     
4092 O O     . LEU B 152 ? 0.4435 0.4511 0.5110 0.0183  0.0222  0.0880  152  LEU C O     
4093 C CB    . LEU B 152 ? 0.4554 0.4576 0.5222 0.0242  0.0268  0.0861  152  LEU C CB    
4094 C CG    . LEU B 152 ? 0.5107 0.5108 0.5770 0.0281  0.0312  0.0849  152  LEU C CG    
4095 C CD1   . LEU B 152 ? 0.4475 0.4519 0.5178 0.0298  0.0307  0.0892  152  LEU C CD1   
4096 C CD2   . LEU B 152 ? 0.4310 0.4325 0.4976 0.0302  0.0365  0.0840  152  LEU C CD2   
4097 N N     . GLN B 153 ? 0.5146 0.5105 0.5732 0.0174  0.0214  0.0821  153  GLN C N     
4098 C CA    . GLN B 153 ? 0.5095 0.5055 0.5662 0.0142  0.0181  0.0836  153  GLN C CA    
4099 C C     . GLN B 153 ? 0.5916 0.5901 0.6485 0.0140  0.0196  0.0825  153  GLN C C     
4100 O O     . GLN B 153 ? 0.6045 0.6045 0.6607 0.0117  0.0177  0.0841  153  GLN C O     
4101 C CB    . GLN B 153 ? 0.4610 0.4489 0.5112 0.0126  0.0156  0.0825  153  GLN C CB    
4102 C CG    . GLN B 153 ? 0.4398 0.4238 0.4889 0.0125  0.0139  0.0835  153  GLN C CG    
4103 C CD    . GLN B 153 ? 0.5538 0.5440 0.6075 0.0114  0.0122  0.0876  153  GLN C CD    
4104 O OE1   . GLN B 153 ? 0.6953 0.6892 0.7496 0.0085  0.0099  0.0905  153  GLN C OE1   
4105 N NE2   . GLN B 153 ? 0.5555 0.5473 0.6123 0.0139  0.0135  0.0880  153  GLN C NE2   
4106 N N     . GLU B 154 ? 0.5824 0.5811 0.6397 0.0161  0.0232  0.0797  154  GLU C N     
4107 C CA    . GLU B 154 ? 0.4843 0.4851 0.5415 0.0158  0.0248  0.0785  154  GLU C CA    
4108 C C     . GLU B 154 ? 0.5259 0.5310 0.5872 0.0175  0.0285  0.0790  154  GLU C C     
4109 O O     . GLU B 154 ? 0.6331 0.6370 0.6945 0.0195  0.0314  0.0779  154  GLU C O     
4110 C CB    . GLU B 154 ? 0.3940 0.3910 0.4470 0.0161  0.0258  0.0751  154  GLU C CB    
4111 C CG    . GLU B 154 ? 0.4218 0.4142 0.4701 0.0150  0.0230  0.0750  154  GLU C CG    
4112 C CD    . GLU B 154 ? 0.5785 0.5719 0.6253 0.0132  0.0214  0.0764  154  GLU C CD    
4113 O OE1   . GLU B 154 ? 0.5729 0.5708 0.6224 0.0130  0.0226  0.0766  154  GLU C OE1   
4114 O OE2   . GLU B 154 ? 0.6023 0.5910 0.6444 0.0120  0.0192  0.0772  154  GLU C OE2   
4115 N N     . PRO B 155 ? 0.5467 0.5562 0.6106 0.0167  0.0287  0.0807  155  PRO C N     
4116 C CA    . PRO B 155 ? 0.3840 0.3969 0.4514 0.0185  0.0325  0.0817  155  PRO C CA    
4117 C C     . PRO B 155 ? 0.4128 0.4225 0.4770 0.0194  0.0365  0.0783  155  PRO C C     
4118 O O     . PRO B 155 ? 0.4515 0.4612 0.5164 0.0212  0.0405  0.0787  155  PRO C O     
4119 C CB    . PRO B 155 ? 0.4583 0.4756 0.5282 0.0169  0.0313  0.0836  155  PRO C CB    
4120 C CG    . PRO B 155 ? 0.4734 0.4880 0.5392 0.0145  0.0280  0.0821  155  PRO C CG    
4121 C CD    . PRO B 155 ? 0.4794 0.4899 0.5423 0.0142  0.0257  0.0816  155  PRO C CD    
4122 N N     . TYR B 156 ? 0.4230 0.4297 0.4831 0.0181  0.0355  0.0753  156  TYR C N     
4123 C CA    . TYR B 156 ? 0.4503 0.4542 0.5066 0.0180  0.0386  0.0722  156  TYR C CA    
4124 C C     . TYR B 156 ? 0.4588 0.4597 0.5136 0.0198  0.0420  0.0715  156  TYR C C     
4125 O O     . TYR B 156 ? 0.4112 0.4103 0.4636 0.0200  0.0461  0.0703  156  TYR C O     
4126 C CB    . TYR B 156 ? 0.4676 0.4696 0.5202 0.0167  0.0365  0.0699  156  TYR C CB    
4127 C CG    . TYR B 156 ? 0.4747 0.4754 0.5233 0.0158  0.0391  0.0671  156  TYR C CG    
4128 C CD1   . TYR B 156 ? 0.3913 0.3937 0.4391 0.0144  0.0409  0.0665  156  TYR C CD1   
4129 C CD2   . TYR B 156 ? 0.4978 0.4956 0.5432 0.0158  0.0397  0.0650  156  TYR C CD2   
4130 C CE1   . TYR B 156 ? 0.4512 0.4527 0.4949 0.0127  0.0430  0.0642  156  TYR C CE1   
4131 C CE2   . TYR B 156 ? 0.4918 0.4891 0.5333 0.0142  0.0419  0.0627  156  TYR C CE2   
4132 C CZ    . TYR B 156 ? 0.4955 0.4948 0.5360 0.0124  0.0434  0.0624  156  TYR C CZ    
4133 O OH    . TYR B 156 ? 0.4758 0.4748 0.5117 0.0100  0.0454  0.0603  156  TYR C OH    
4134 N N     . PHE B 157 ? 0.4539 0.4535 0.5095 0.0210  0.0404  0.0722  157  PHE C N     
4135 C CA    . PHE B 157 ? 0.4393 0.4352 0.4927 0.0228  0.0434  0.0711  157  PHE C CA    
4136 C C     . PHE B 157 ? 0.4890 0.4864 0.5451 0.0254  0.0468  0.0739  157  PHE C C     
4137 O O     . PHE B 157 ? 0.5722 0.5659 0.6251 0.0272  0.0511  0.0730  157  PHE C O     
4138 C CB    . PHE B 157 ? 0.3514 0.3447 0.4040 0.0231  0.0405  0.0704  157  PHE C CB    
4139 C CG    . PHE B 157 ? 0.2892 0.2802 0.3383 0.0213  0.0385  0.0677  157  PHE C CG    
4140 C CD1   . PHE B 157 ? 0.4099 0.4025 0.4596 0.0198  0.0349  0.0686  157  PHE C CD1   
4141 C CD2   . PHE B 157 ? 0.3561 0.3433 0.4007 0.0211  0.0406  0.0646  157  PHE C CD2   
4142 C CE1   . PHE B 157 ? 0.4556 0.4463 0.5019 0.0188  0.0336  0.0667  157  PHE C CE1   
4143 C CE2   . PHE B 157 ? 0.3992 0.3854 0.4411 0.0197  0.0389  0.0627  157  PHE C CE2   
4144 C CZ    . PHE B 157 ? 0.4181 0.4062 0.4611 0.0188  0.0355  0.0640  157  PHE C CZ    
4145 N N     . THR B 158 ? 0.4900 0.4928 0.5515 0.0258  0.0449  0.0776  158  THR C N     
4146 C CA    . THR B 158 ? 0.4136 0.4196 0.4789 0.0286  0.0478  0.0815  158  THR C CA    
4147 C C     . THR B 158 ? 0.5108 0.5172 0.5758 0.0291  0.0521  0.0821  158  THR C C     
4148 O O     . THR B 158 ? 0.5417 0.5480 0.6072 0.0321  0.0567  0.0845  158  THR C O     
4149 C CB    . THR B 158 ? 0.5354 0.5482 0.6069 0.0281  0.0436  0.0857  158  THR C CB    
4150 O OG1   . THR B 158 ? 0.6291 0.6406 0.7002 0.0276  0.0400  0.0856  158  THR C OG1   
4151 C CG2   . THR B 158 ? 0.5701 0.5880 0.6464 0.0312  0.0466  0.0905  158  THR C CG2   
4152 N N     . TRP B 159 ? 0.4921 0.4985 0.5559 0.0264  0.0508  0.0802  159  TRP C N     
4153 C CA    . TRP B 159 ? 0.4759 0.4824 0.5393 0.0263  0.0542  0.0807  159  TRP C CA    
4154 C C     . TRP B 159 ? 0.5248 0.5251 0.5826 0.0280  0.0608  0.0798  159  TRP C C     
4155 O O     . TRP B 159 ? 0.5483 0.5486 0.6068 0.0297  0.0649  0.0822  159  TRP C O     
4156 C CB    . TRP B 159 ? 0.4307 0.4372 0.4923 0.0230  0.0517  0.0781  159  TRP C CB    
4157 C CG    . TRP B 159 ? 0.5845 0.5912 0.6461 0.0227  0.0547  0.0789  159  TRP C CG    
4158 C CD1   . TRP B 159 ? 0.6505 0.6523 0.7066 0.0216  0.0586  0.0767  159  TRP C CD1   
4159 C CD2   . TRP B 159 ? 0.5780 0.5897 0.6451 0.0233  0.0541  0.0823  159  TRP C CD2   
4160 N NE1   . TRP B 159 ? 0.6473 0.6501 0.7050 0.0217  0.0605  0.0784  159  TRP C NE1   
4161 C CE2   . TRP B 159 ? 0.6167 0.6258 0.6814 0.0229  0.0578  0.0818  159  TRP C CE2   
4162 C CE3   . TRP B 159 ? 0.5600 0.5781 0.6333 0.0236  0.0506  0.0858  159  TRP C CE3   
4163 C CZ2   . TRP B 159 ? 0.5710 0.5835 0.6398 0.0233  0.0584  0.0846  159  TRP C CZ2   
4164 C CZ3   . TRP B 159 ? 0.5122 0.5344 0.5895 0.0238  0.0511  0.0887  159  TRP C CZ3   
4165 C CH2   . TRP B 159 ? 0.5519 0.5713 0.6273 0.0239  0.0550  0.0880  159  TRP C CH2   
4166 N N     . PRO B 160 ? 0.5701 0.5648 0.6218 0.0273  0.0622  0.0763  160  PRO C N     
4167 C CA    . PRO B 160 ? 0.5739 0.5614 0.6184 0.0281  0.0688  0.0752  160  PRO C CA    
4168 C C     . PRO B 160 ? 0.5325 0.5197 0.5787 0.0327  0.0736  0.0793  160  PRO C C     
4169 O O     . PRO B 160 ? 0.4769 0.4596 0.5189 0.0339  0.0794  0.0804  160  PRO C O     
4170 C CB    . PRO B 160 ? 0.5856 0.5682 0.6245 0.0271  0.0687  0.0715  160  PRO C CB    
4171 C CG    . PRO B 160 ? 0.5445 0.5314 0.5866 0.0245  0.0621  0.0699  160  PRO C CG    
4172 C CD    . PRO B 160 ? 0.4348 0.4286 0.4851 0.0257  0.0583  0.0734  160  PRO C CD    
4173 N N     . LEU B 161 ? 0.4969 0.4889 0.5489 0.0352  0.0711  0.0820  161  LEU C N     
4174 C CA    . LEU B 161 ? 0.5116 0.5051 0.5661 0.0400  0.0751  0.0866  161  LEU C CA    
4175 C C     . LEU B 161 ? 0.6399 0.6404 0.7014 0.0414  0.0752  0.0915  161  LEU C C     
4176 O O     . LEU B 161 ? 0.6716 0.6715 0.7331 0.0452  0.0808  0.0952  161  LEU C O     
4177 C CB    . LEU B 161 ? 0.4912 0.4879 0.5493 0.0418  0.0720  0.0879  161  LEU C CB    
4178 C CG    . LEU B 161 ? 0.4607 0.4623 0.5238 0.0467  0.0744  0.0937  161  LEU C CG    
4179 C CD1   . LEU B 161 ? 0.4870 0.4814 0.5435 0.0508  0.0831  0.0946  161  LEU C CD1   
4180 C CD2   . LEU B 161 ? 0.4350 0.4396 0.5012 0.0474  0.0704  0.0943  161  LEU C CD2   
4181 N N     . ILE B 162 ? 0.6383 0.6453 0.7054 0.0384  0.0692  0.0916  162  ILE C N     
4182 C CA    . ILE B 162 ? 0.5608 0.5749 0.6345 0.0389  0.0685  0.0958  162  ILE C CA    
4183 C C     . ILE B 162 ? 0.6267 0.6361 0.6966 0.0388  0.0735  0.0954  162  ILE C C     
4184 O O     . ILE B 162 ? 0.5746 0.5865 0.6476 0.0416  0.0771  0.0997  162  ILE C O     
4185 C CB    . ILE B 162 ? 0.6252 0.6456 0.7037 0.0350  0.0610  0.0954  162  ILE C CB    
4186 C CG1   . ILE B 162 ? 0.6239 0.6491 0.7064 0.0351  0.0564  0.0974  162  ILE C CG1   
4187 C CG2   . ILE B 162 ? 0.6409 0.6672 0.7246 0.0347  0.0606  0.0988  162  ILE C CG2   
4188 C CD1   . ILE B 162 ? 0.6802 0.7097 0.7654 0.0310  0.0495  0.0970  162  ILE C CD1   
4189 N N     . ALA B 163 ? 0.6084 0.6110 0.6714 0.0356  0.0738  0.0904  163  ALA C N     
4190 C CA    . ALA B 163 ? 0.5910 0.5884 0.6495 0.0347  0.0782  0.0896  163  ALA C CA    
4191 C C     . ALA B 163 ? 0.6871 0.6757 0.7380 0.0376  0.0865  0.0904  163  ALA C C     
4192 O O     . ALA B 163 ? 0.7126 0.6965 0.7600 0.0380  0.0913  0.0914  163  ALA C O     
4193 C CB    . ALA B 163 ? 0.5945 0.5887 0.6483 0.0298  0.0753  0.0844  163  ALA C CB    
4194 N N     . ALA B 164 ? 0.6692 0.6545 0.7167 0.0396  0.0885  0.0899  164  ALA C N     
4195 C CA    . ALA B 164 ? 0.5568 0.5318 0.5949 0.0421  0.0967  0.0901  164  ALA C CA    
4196 C C     . ALA B 164 ? 0.6215 0.5949 0.6598 0.0462  0.1033  0.0952  164  ALA C C     
4197 O O     . ALA B 164 ? 0.6041 0.5674 0.6331 0.0458  0.1097  0.0944  164  ALA C O     
4198 C CB    . ALA B 164 ? 0.4899 0.4634 0.5263 0.0449  0.0978  0.0901  164  ALA C CB    
4199 N N     . ASP B 165 ? 0.6640 0.6471 0.7123 0.0500  0.1021  0.1007  165  ASP C N     
4200 C CA    . ASP B 165 ? 0.7527 0.7351 0.8018 0.0549  0.1089  0.1064  165  ASP C CA    
4201 C C     . ASP B 165 ? 0.8316 0.8185 0.8861 0.0535  0.1074  0.1082  165  ASP C C     
4202 O O     . ASP B 165 ? 0.8515 0.8419 0.9104 0.0576  0.1112  0.1140  165  ASP C O     
4203 C CB    . ASP B 165 ? 0.7664 0.7569 0.8228 0.0607  0.1099  0.1125  165  ASP C CB    
4204 C CG    . ASP B 165 ? 0.7770 0.7638 0.8309 0.0670  0.1192  0.1185  165  ASP C CG    
4205 O OD1   . ASP B 165 ? 0.8183 0.7915 0.8603 0.0674  0.1266  0.1168  165  ASP C OD1   
4206 O OD2   . ASP B 165 ? 0.6652 0.6625 0.7285 0.0713  0.1194  0.1252  165  ASP C OD2   
4207 N N     . GLY B 166 ? 0.8276 0.8147 0.8817 0.0478  0.1021  0.1035  166  GLY C N     
4208 C CA    . GLY B 166 ? 0.7259 0.7159 0.7839 0.0461  0.1008  0.1044  166  GLY C CA    
4209 C C     . GLY B 166 ? 0.7016 0.7026 0.7688 0.0430  0.0920  0.1037  166  GLY C C     
4210 O O     . GLY B 166 ? 0.7528 0.7587 0.8253 0.0425  0.0906  0.1058  166  GLY C O     
4211 N N     . GLY B 167 ? 0.7021 0.7061 0.7704 0.0408  0.0863  0.1009  167  GLY C N     
4212 C CA    . GLY B 167 ? 0.5815 0.5931 0.6557 0.0372  0.0783  0.0994  167  GLY C CA    
4213 C C     . GLY B 167 ? 0.5689 0.5755 0.6379 0.0328  0.0769  0.0944  167  GLY C C     
4214 O O     . GLY B 167 ? 0.6638 0.6618 0.7244 0.0315  0.0801  0.0911  167  GLY C O     
4215 N N     . TYR B 168 ? 0.5680 0.5798 0.6413 0.0302  0.0721  0.0941  168  TYR C N     
4216 C CA    . TYR B 168 ? 0.6180 0.6263 0.6870 0.0262  0.0700  0.0896  168  TYR C CA    
4217 C C     . TYR B 168 ? 0.5514 0.5664 0.6252 0.0238  0.0634  0.0892  168  TYR C C     
4218 O O     . TYR B 168 ? 0.5967 0.6187 0.6771 0.0247  0.0612  0.0927  168  TYR C O     
4219 C CB    . TYR B 168 ? 0.7324 0.7346 0.7973 0.0260  0.0751  0.0894  168  TYR C CB    
4220 C CG    . TYR B 168 ? 0.8027 0.8090 0.8734 0.0278  0.0764  0.0936  168  TYR C CG    
4221 C CD1   . TYR B 168 ? 0.8409 0.8503 0.9143 0.0254  0.0730  0.0927  168  TYR C CD1   
4222 C CD2   . TYR B 168 ? 0.8209 0.8278 0.8941 0.0322  0.0815  0.0985  168  TYR C CD2   
4223 C CE1   . TYR B 168 ? 0.8341 0.8472 0.9127 0.0269  0.0742  0.0964  168  TYR C CE1   
4224 C CE2   . TYR B 168 ? 0.8705 0.8818 0.9495 0.0340  0.0829  0.1027  168  TYR C CE2   
4225 C CZ    . TYR B 168 ? 0.8873 0.9017 0.9690 0.0311  0.0791  0.1015  168  TYR C CZ    
4226 O OH    . TYR B 168 ? 0.8753 0.8942 0.9626 0.0327  0.0805  0.1055  168  TYR C OH    
4227 N N     . ALA B 169 ? 0.4848 0.4979 0.5550 0.0205  0.0603  0.0851  169  ALA C N     
4228 C CA    . ALA B 169 ? 0.6908 0.7085 0.7636 0.0183  0.0548  0.0845  169  ALA C CA    
4229 C C     . ALA B 169 ? 0.7596 0.7780 0.8340 0.0176  0.0556  0.0852  169  ALA C C     
4230 O O     . ALA B 169 ? 0.7192 0.7421 0.7988 0.0189  0.0558  0.0889  169  ALA C O     
4231 C CB    . ALA B 169 ? 0.6640 0.6795 0.7322 0.0159  0.0517  0.0804  169  ALA C CB    
4232 N N     . PHE B 170 ? 0.7250 0.7393 0.7947 0.0156  0.0562  0.0820  170  PHE C N     
4233 C CA    . PHE B 170 ? 0.7068 0.7206 0.7771 0.0148  0.0572  0.0823  170  PHE C CA    
4234 C C     . PHE B 170 ? 0.7654 0.7724 0.8312 0.0150  0.0628  0.0816  170  PHE C C     
4235 O O     . PHE B 170 ? 0.6990 0.7009 0.7585 0.0134  0.0642  0.0788  170  PHE C O     
4236 C CB    . PHE B 170 ? 0.6112 0.6259 0.6796 0.0121  0.0530  0.0794  170  PHE C CB    
4237 C CG    . PHE B 170 ? 0.6303 0.6500 0.7016 0.0116  0.0480  0.0803  170  PHE C CG    
4238 C CD1   . PHE B 170 ? 0.6894 0.7135 0.7654 0.0117  0.0467  0.0831  170  PHE C CD1   
4239 C CD2   . PHE B 170 ? 0.6664 0.6862 0.7351 0.0108  0.0448  0.0785  170  PHE C CD2   
4240 C CE1   . PHE B 170 ? 0.7261 0.7539 0.8031 0.0104  0.0422  0.0840  170  PHE C CE1   
4241 C CE2   . PHE B 170 ? 0.6208 0.6436 0.6907 0.0100  0.0406  0.0795  170  PHE C CE2   
4242 C CZ    . PHE B 170 ? 0.6883 0.7147 0.7618 0.0095  0.0393  0.0821  170  PHE C CZ    
4243 N N     . LYS B 171 ? 0.7783 0.7847 0.8465 0.0167  0.0663  0.0844  171  LYS C N     
4244 C CA    . LYS B 171 ? 0.7766 0.7749 0.8395 0.0169  0.0722  0.0843  171  LYS C CA    
4245 C C     . LYS B 171 ? 0.7650 0.7588 0.8220 0.0132  0.0714  0.0803  171  LYS C C     
4246 O O     . LYS B 171 ? 0.7267 0.7243 0.7856 0.0115  0.0671  0.0787  171  LYS C O     
4247 C CB    . LYS B 171 ? 0.8016 0.8005 0.8686 0.0195  0.0758  0.0883  171  LYS C CB    
4248 C CG    . LYS B 171 ? 0.8386 0.8279 0.8997 0.0209  0.0834  0.0894  171  LYS C CG    
4249 C CD    . LYS B 171 ? 1.0027 0.9876 1.0592 0.0225  0.0870  0.0898  171  LYS C CD    
4250 C CE    . LYS B 171 ? 1.1283 1.1074 1.1829 0.0265  0.0949  0.0941  171  LYS C CE    
4251 N NZ    . LYS B 171 ? 1.1754 1.1635 1.2398 0.0308  0.0948  0.0996  171  LYS C NZ    
4252 N N     . TYR B 172 ? 0.7242 0.7099 0.7734 0.0118  0.0756  0.0788  172  TYR C N     
4253 C CA    . TYR B 172 ? 0.8384 0.8202 0.8817 0.0079  0.0750  0.0754  172  TYR C CA    
4254 C C     . TYR B 172 ? 0.9965 0.9698 1.0350 0.0074  0.0805  0.0762  172  TYR C C     
4255 O O     . TYR B 172 ? 1.0320 0.9973 1.0643 0.0077  0.0861  0.0770  172  TYR C O     
4256 C CB    . TYR B 172 ? 0.8188 0.7982 0.8556 0.0051  0.0746  0.0727  172  TYR C CB    
4257 C CG    . TYR B 172 ? 0.8678 0.8464 0.8997 0.0008  0.0724  0.0696  172  TYR C CG    
4258 C CD1   . TYR B 172 ? 0.8123 0.7980 0.8477 0.0000  0.0668  0.0682  172  TYR C CD1   
4259 C CD2   . TYR B 172 ? 0.9831 0.9535 1.0063 -0.0025 0.0763  0.0684  172  TYR C CD2   
4260 C CE1   . TYR B 172 ? 0.8831 0.8691 0.9144 -0.0034 0.0650  0.0659  172  TYR C CE1   
4261 C CE2   . TYR B 172 ? 1.0199 0.9906 1.0388 -0.0067 0.0742  0.0661  172  TYR C CE2   
4262 C CZ    . TYR B 172 ? 1.0047 0.9838 1.0282 -0.0069 0.0685  0.0650  172  TYR C CZ    
4263 O OH    . TYR B 172 ? 1.0477 1.0280 1.0673 -0.0106 0.0665  0.0631  172  TYR C OH    
4264 N N     . GLU B 173 ? 1.1201 1.0944 1.1610 0.0068  0.0793  0.0760  173  GLU C N     
4265 C CA    . GLU B 173 ? 1.2718 1.2378 1.3085 0.0064  0.0843  0.0768  173  GLU C CA    
4266 C C     . GLU B 173 ? 1.3445 1.3092 1.3784 0.0028  0.0818  0.0738  173  GLU C C     
4267 O O     . GLU B 173 ? 1.3714 1.3434 1.4097 0.0023  0.0764  0.0724  173  GLU C O     
4268 C CB    . GLU B 173 ? 1.3600 1.3282 1.4037 0.0106  0.0864  0.0808  173  GLU C CB    
4269 C CG    . GLU B 173 ? 1.4659 1.4345 1.5119 0.0147  0.0902  0.0847  173  GLU C CG    
4270 C CD    . GLU B 173 ? 1.5541 1.5108 1.5905 0.0148  0.0976  0.0853  173  GLU C CD    
4271 O OE1   . GLU B 173 ? 1.5918 1.5396 1.6198 0.0113  0.0998  0.0830  173  GLU C OE1   
4272 O OE2   . GLU B 173 ? 1.5688 1.5246 1.6055 0.0183  0.1014  0.0884  173  GLU C OE2   
4273 N N     . ASN B 174 ? 1.4203 1.3752 1.4461 0.0003  0.0861  0.0730  174  ASN C N     
4274 C CA    . ASN B 174 ? 1.4718 1.4247 1.4944 -0.0032 0.0844  0.0706  174  ASN C CA    
4275 C C     . ASN B 174 ? 1.3575 1.3179 1.3805 -0.0058 0.0782  0.0677  174  ASN C C     
4276 O O     . ASN B 174 ? 1.3232 1.2878 1.3489 -0.0063 0.0746  0.0664  174  ASN C O     
4277 C CB    . ASN B 174 ? 1.5788 1.5333 1.6074 -0.0009 0.0840  0.0717  174  ASN C CB    
4278 C CG    . ASN B 174 ? 1.6549 1.6061 1.6864 0.0031  0.0893  0.0757  174  ASN C CG    
4279 O OD1   . ASN B 174 ? 1.6770 1.6350 1.7169 0.0063  0.0877  0.0779  174  ASN C OD1   
4280 N ND2   . ASN B 174 ? 1.6636 1.6042 1.6875 0.0029  0.0957  0.0770  174  ASN C ND2   
4281 N N     . GLY B 175 ? 1.2563 1.2182 1.2765 -0.0071 0.0774  0.0669  175  GLY C N     
4282 C CA    . GLY B 175 ? 1.1233 1.0920 1.1433 -0.0094 0.0723  0.0647  175  GLY C CA    
4283 C C     . GLY B 175 ? 1.0116 0.9901 1.0397 -0.0066 0.0671  0.0648  175  GLY C C     
4284 O O     . GLY B 175 ? 1.0246 1.0086 1.0527 -0.0078 0.0630  0.0634  175  GLY C O     
4285 N N     . LYS B 176 ? 0.9046 0.8853 0.9391 -0.0028 0.0673  0.0669  176  LYS C N     
4286 C CA    . LYS B 176 ? 0.8835 0.8722 0.9243 -0.0007 0.0626  0.0672  176  LYS C CA    
4287 C C     . LYS B 176 ? 0.7196 0.7110 0.7656 0.0024  0.0629  0.0697  176  LYS C C     
4288 O O     . LYS B 176 ? 0.6538 0.6414 0.7001 0.0039  0.0672  0.0717  176  LYS C O     
4289 C CB    . LYS B 176 ? 0.9374 0.9278 0.9812 -0.0002 0.0609  0.0671  176  LYS C CB    
4290 C CG    . LYS B 176 ? 1.0282 1.0165 1.0758 0.0019  0.0638  0.0695  176  LYS C CG    
4291 C CD    . LYS B 176 ? 1.1731 1.1647 1.2243 0.0025  0.0611  0.0693  176  LYS C CD    
4292 C CE    . LYS B 176 ? 1.2961 1.2857 1.3509 0.0041  0.0643  0.0718  176  LYS C CE    
4293 N NZ    . LYS B 176 ? 1.3442 1.3254 1.3944 0.0031  0.0689  0.0713  176  LYS C NZ    
4294 N N     . TYR B 177 ? 0.6831 0.6809 0.7329 0.0034  0.0587  0.0698  177  TYR C N     
4295 C CA    . TYR B 177 ? 0.7395 0.7406 0.7945 0.0060  0.0583  0.0724  177  TYR C CA    
4296 C C     . TYR B 177 ? 0.7813 0.7855 0.8417 0.0074  0.0575  0.0745  177  TYR C C     
4297 O O     . TYR B 177 ? 0.8176 0.8249 0.8790 0.0066  0.0539  0.0737  177  TYR C O     
4298 C CB    . TYR B 177 ? 0.8117 0.8172 0.8674 0.0061  0.0543  0.0717  177  TYR C CB    
4299 C CG    . TYR B 177 ? 0.8223 0.8257 0.8736 0.0051  0.0553  0.0702  177  TYR C CG    
4300 C CD1   . TYR B 177 ? 0.8529 0.8541 0.9040 0.0064  0.0582  0.0714  177  TYR C CD1   
4301 C CD2   . TYR B 177 ? 0.7854 0.7892 0.8325 0.0029  0.0534  0.0678  177  TYR C CD2   
4302 C CE1   . TYR B 177 ? 0.8165 0.8153 0.8629 0.0051  0.0592  0.0698  177  TYR C CE1   
4303 C CE2   . TYR B 177 ? 0.7695 0.7721 0.8126 0.0015  0.0542  0.0666  177  TYR C CE2   
4304 C CZ    . TYR B 177 ? 0.8119 0.8116 0.8544 0.0024  0.0570  0.0674  177  TYR C CZ    
4305 O OH    . TYR B 177 ? 0.7908 0.7888 0.8285 0.0007  0.0579  0.0660  177  TYR C OH    
4306 N N     . ASP B 178 ? 0.8047 0.8079 0.8681 0.0094  0.0611  0.0775  178  ASP C N     
4307 C CA    . ASP B 178 ? 0.7852 0.7928 0.8546 0.0107  0.0604  0.0803  178  ASP C CA    
4308 C C     . ASP B 178 ? 0.6986 0.7132 0.7721 0.0109  0.0560  0.0817  178  ASP C C     
4309 O O     . ASP B 178 ? 0.7164 0.7337 0.7930 0.0127  0.0566  0.0843  178  ASP C O     
4310 C CB    . ASP B 178 ? 0.8652 0.8711 0.9372 0.0133  0.0657  0.0840  178  ASP C CB    
4311 C CG    . ASP B 178 ? 0.8717 0.8837 0.9507 0.0146  0.0650  0.0877  178  ASP C CG    
4312 O OD1   . ASP B 178 ? 0.7761 0.7936 0.8575 0.0131  0.0601  0.0873  178  ASP C OD1   
4313 O OD2   . ASP B 178 ? 0.8847 0.8960 0.9664 0.0171  0.0695  0.0913  178  ASP C OD2   
4314 N N     . ILE B 179 ? 0.6907 0.7078 0.7637 0.0091  0.0517  0.0802  179  ILE C N     
4315 C CA    . ILE B 179 ? 0.6758 0.6976 0.7504 0.0086  0.0473  0.0810  179  ILE C CA    
4316 C C     . ILE B 179 ? 0.7289 0.7567 0.8097 0.0092  0.0466  0.0853  179  ILE C C     
4317 O O     . ILE B 179 ? 0.7563 0.7880 0.8379 0.0079  0.0427  0.0864  179  ILE C O     
4318 C CB    . ILE B 179 ? 0.7524 0.7737 0.8231 0.0065  0.0436  0.0785  179  ILE C CB    
4319 C CG1   . ILE B 179 ? 0.8113 0.8338 0.8834 0.0055  0.0432  0.0793  179  ILE C CG1   
4320 C CG2   . ILE B 179 ? 0.7934 0.8102 0.8586 0.0060  0.0444  0.0749  179  ILE C CG2   
4321 C CD1   . ILE B 179 ? 0.8212 0.8453 0.8911 0.0035  0.0391  0.0791  179  ILE C CD1   
4322 N N     . LYS B 180 ? 0.7234 0.7520 0.8081 0.0110  0.0504  0.0881  180  LYS C N     
4323 C CA    . LYS B 180 ? 0.8085 0.8442 0.8998 0.0118  0.0501  0.0930  180  LYS C CA    
4324 C C     . LYS B 180 ? 0.7907 0.8275 0.8856 0.0154  0.0545  0.0966  180  LYS C C     
4325 O O     . LYS B 180 ? 0.7956 0.8394 0.8966 0.0167  0.0545  0.1014  180  LYS C O     
4326 C CB    . LYS B 180 ? 0.9281 0.9656 1.0218 0.0110  0.0505  0.0942  180  LYS C CB    
4327 C CG    . LYS B 180 ? 1.0789 1.1180 1.1703 0.0075  0.0456  0.0926  180  LYS C CG    
4328 C CD    . LYS B 180 ? 1.1756 1.2209 1.2719 0.0064  0.0450  0.0961  180  LYS C CD    
4329 C CE    . LYS B 180 ? 1.1783 1.2208 1.2761 0.0079  0.0493  0.0963  180  LYS C CE    
4330 N NZ    . LYS B 180 ? 1.1688 1.2178 1.2716 0.0069  0.0488  0.1000  180  LYS C NZ    
4331 N N     . ASP B 181 ? 0.8195 0.8494 0.9102 0.0168  0.0583  0.0946  181  ASP C N     
4332 C CA    . ASP B 181 ? 0.8572 0.8862 0.9491 0.0203  0.0629  0.0976  181  ASP C CA    
4333 C C     . ASP B 181 ? 0.8708 0.8997 0.9607 0.0203  0.0609  0.0962  181  ASP C C     
4334 O O     . ASP B 181 ? 0.8670 0.8894 0.9510 0.0198  0.0624  0.0928  181  ASP C O     
4335 C CB    . ASP B 181 ? 0.8652 0.8852 0.9522 0.0216  0.0690  0.0965  181  ASP C CB    
4336 C CG    . ASP B 181 ? 0.8740 0.8921 0.9614 0.0256  0.0749  0.1003  181  ASP C CG    
4337 O OD1   . ASP B 181 ? 0.9432 0.9686 1.0364 0.0279  0.0742  0.1044  181  ASP C OD1   
4338 O OD2   . ASP B 181 ? 0.7969 0.8058 0.8782 0.0265  0.0804  0.0994  181  ASP C OD2   
4339 N N     . VAL B 182 ? 0.8783 0.9146 0.9730 0.0204  0.0575  0.0990  182  VAL C N     
4340 C CA    . VAL B 182 ? 0.8425 0.8790 0.9358 0.0204  0.0553  0.0981  182  VAL C CA    
4341 C C     . VAL B 182 ? 0.7791 0.8172 0.8751 0.0242  0.0591  0.1019  182  VAL C C     
4342 O O     . VAL B 182 ? 0.7926 0.8376 0.8948 0.0262  0.0599  0.1071  182  VAL C O     
4343 C CB    . VAL B 182 ? 0.8010 0.8434 0.8964 0.0176  0.0489  0.0986  182  VAL C CB    
4344 C CG1   . VAL B 182 ? 0.7756 0.8186 0.8705 0.0181  0.0471  0.0986  182  VAL C CG1   
4345 C CG2   . VAL B 182 ? 0.8148 0.8540 0.9056 0.0143  0.0456  0.0943  182  VAL C CG2   
4346 N N     . GLY B 183 ? 0.7501 0.7822 0.8413 0.0254  0.0615  0.0997  183  GLY C N     
4347 C CA    . GLY B 183 ? 0.7986 0.8306 0.8908 0.0294  0.0660  0.1030  183  GLY C CA    
4348 C C     . GLY B 183 ? 0.7367 0.7720 0.8303 0.0299  0.0631  0.1037  183  GLY C C     
4349 O O     . GLY B 183 ? 0.7678 0.7983 0.8576 0.0319  0.0661  0.1027  183  GLY C O     
4350 N N     . VAL B 184 ? 0.6158 0.6588 0.7142 0.0279  0.0573  0.1053  184  VAL C N     
4351 C CA    . VAL B 184 ? 0.6062 0.6521 0.7058 0.0279  0.0541  0.1061  184  VAL C CA    
4352 C C     . VAL B 184 ? 0.6884 0.7436 0.7953 0.0303  0.0543  0.1127  184  VAL C C     
4353 O O     . VAL B 184 ? 0.7070 0.7659 0.8157 0.0301  0.0514  0.1143  184  VAL C O     
4354 C CB    . VAL B 184 ? 0.6526 0.6990 0.7504 0.0235  0.0474  0.1032  184  VAL C CB    
4355 C CG1   . VAL B 184 ? 0.6502 0.6893 0.7417 0.0214  0.0472  0.0975  184  VAL C CG1   
4356 C CG2   . VAL B 184 ? 0.6324 0.6865 0.7350 0.0210  0.0435  0.1065  184  VAL C CG2   
4357 N N     . ASP B 185 ? 0.7347 0.7938 0.8458 0.0325  0.0579  0.1168  185  ASP C N     
4358 C CA    . ASP B 185 ? 0.7923 0.8621 0.9113 0.0348  0.0580  0.1239  185  ASP C CA    
4359 C C     . ASP B 185 ? 0.7418 0.8112 0.8625 0.0405  0.0658  0.1283  185  ASP C C     
4360 O O     . ASP B 185 ? 0.6653 0.7444 0.7931 0.0432  0.0670  0.1351  185  ASP C O     
4361 C CB    . ASP B 185 ? 0.9412 1.0196 1.0652 0.0309  0.0532  0.1264  185  ASP C CB    
4362 C CG    . ASP B 185 ? 1.0568 1.1475 1.1879 0.0306  0.0500  0.1328  185  ASP C CG    
4363 O OD1   . ASP B 185 ? 1.0810 1.1748 1.2148 0.0348  0.0529  0.1367  185  ASP C OD1   
4364 O OD2   . ASP B 185 ? 1.1128 1.2099 1.2462 0.0260  0.0446  0.1341  185  ASP C OD2   
4365 N N     . ASN B 186 ? 0.7514 0.8098 0.8652 0.0423  0.0713  0.1248  186  ASN C N     
4366 C CA    . ASN B 186 ? 0.8093 0.8648 0.9225 0.0480  0.0796  0.1288  186  ASN C CA    
4367 C C     . ASN B 186 ? 0.8104 0.8665 0.9234 0.0523  0.0825  0.1317  186  ASN C C     
4368 O O     . ASN B 186 ? 0.8246 0.8845 0.9391 0.0508  0.0777  0.1309  186  ASN C O     
4369 C CB    . ASN B 186 ? 0.8146 0.8568 0.9190 0.0478  0.0847  0.1242  186  ASN C CB    
4370 C CG    . ASN B 186 ? 0.8757 0.9086 0.9717 0.0451  0.0834  0.1174  186  ASN C CG    
4371 O OD1   . ASN B 186 ? 0.9600 0.9941 1.0556 0.0453  0.0812  0.1166  186  ASN C OD1   
4372 N ND2   . ASN B 186 ? 0.8095 0.8336 0.8987 0.0424  0.0846  0.1125  186  ASN C ND2   
4373 N N     . ALA B 187 ? 0.8010 0.8527 0.9117 0.0579  0.0908  0.1352  187  ALA C N     
4374 C CA    . ALA B 187 ? 0.8197 0.8723 0.9303 0.0630  0.0946  0.1389  187  ALA C CA    
4375 C C     . ALA B 187 ? 0.7555 0.7986 0.8578 0.0618  0.0942  0.1329  187  ALA C C     
4376 O O     . ALA B 187 ? 0.7093 0.7558 0.8131 0.0635  0.0929  0.1343  187  ALA C O     
4377 C CB    . ALA B 187 ? 0.8490 0.8974 0.9574 0.0697  0.1046  0.1442  187  ALA C CB    
4378 N N     . GLY B 188 ? 0.7540 0.7854 0.8475 0.0586  0.0953  0.1263  188  GLY C N     
4379 C CA    . GLY B 188 ? 0.7702 0.7923 0.8552 0.0570  0.0952  0.1204  188  GLY C CA    
4380 C C     . GLY B 188 ? 0.7830 0.8111 0.8717 0.0533  0.0866  0.1178  188  GLY C C     
4381 O O     . GLY B 188 ? 0.8211 0.8483 0.9083 0.0546  0.0862  0.1171  188  GLY C O     
4382 N N     . ALA B 189 ? 0.7545 0.7880 0.8475 0.0488  0.0801  0.1163  189  ALA C N     
4383 C CA    . ALA B 189 ? 0.7087 0.7471 0.8045 0.0450  0.0722  0.1141  189  ALA C CA    
4384 C C     . ALA B 189 ? 0.7143 0.7615 0.8164 0.0474  0.0704  0.1193  189  ALA C C     
4385 O O     . ALA B 189 ? 0.7295 0.7754 0.8300 0.0468  0.0677  0.1174  189  ALA C O     
4386 C CB    . ALA B 189 ? 0.6804 0.7234 0.7796 0.0404  0.0666  0.1131  189  ALA C CB    
4387 N N     . LYS B 190 ? 0.6667 0.7232 0.7761 0.0501  0.0718  0.1260  190  LYS C N     
4388 C CA    . LYS B 190 ? 0.7150 0.7817 0.8311 0.0521  0.0698  0.1319  190  LYS C CA    
4389 C C     . LYS B 190 ? 0.7209 0.7825 0.8330 0.0566  0.0742  0.1320  190  LYS C C     
4390 O O     . LYS B 190 ? 0.6260 0.6919 0.7404 0.0566  0.0708  0.1333  190  LYS C O     
4391 C CB    . LYS B 190 ? 0.7983 0.8759 0.9226 0.0550  0.0721  0.1398  190  LYS C CB    
4392 C CG    . LYS B 190 ? 0.9132 0.9972 1.0420 0.0505  0.0675  0.1404  190  LYS C CG    
4393 C CD    . LYS B 190 ? 0.9900 1.0863 1.1277 0.0534  0.0695  0.1489  190  LYS C CD    
4394 C CE    . LYS B 190 ? 1.0672 1.1712 1.2097 0.0481  0.0639  0.1497  190  LYS C CE    
4395 N NZ    . LYS B 190 ? 1.1153 1.2334 1.2672 0.0503  0.0650  0.1586  190  LYS C NZ    
4396 N N     . ALA B 191 ? 0.6723 0.7240 0.7776 0.0602  0.0819  0.1305  191  ALA C N     
4397 C CA    . ALA B 191 ? 0.6740 0.7191 0.7738 0.0647  0.0872  0.1304  191  ALA C CA    
4398 C C     . ALA B 191 ? 0.6967 0.7342 0.7902 0.0613  0.0836  0.1234  191  ALA C C     
4399 O O     . ALA B 191 ? 0.6935 0.7314 0.7867 0.0630  0.0830  0.1239  191  ALA C O     
4400 C CB    . ALA B 191 ? 0.7203 0.7551 0.8125 0.0688  0.0969  0.1307  191  ALA C CB    
4401 N N     . GLY B 192 ? 0.6463 0.6771 0.7348 0.0565  0.0814  0.1172  192  GLY C N     
4402 C CA    . GLY B 192 ? 0.6740 0.6981 0.7568 0.0531  0.0780  0.1107  192  GLY C CA    
4403 C C     . GLY B 192 ? 0.6622 0.6933 0.7504 0.0506  0.0703  0.1110  192  GLY C C     
4404 O O     . GLY B 192 ? 0.6528 0.6803 0.7380 0.0507  0.0692  0.1087  192  GLY C O     
4405 N N     . LEU B 193 ? 0.6326 0.6729 0.7279 0.0480  0.0651  0.1139  193  LEU C N     
4406 C CA    . LEU B 193 ? 0.6025 0.6485 0.7016 0.0447  0.0577  0.1144  193  LEU C CA    
4407 C C     . LEU B 193 ? 0.6669 0.7199 0.7709 0.0479  0.0577  0.1200  193  LEU C C     
4408 O O     . LEU B 193 ? 0.7117 0.7656 0.8159 0.0461  0.0531  0.1195  193  LEU C O     
4409 C CB    . LEU B 193 ? 0.6325 0.6852 0.7361 0.0404  0.0525  0.1158  193  LEU C CB    
4410 C CG    . LEU B 193 ? 0.6187 0.6759 0.7244 0.0358  0.0448  0.1163  193  LEU C CG    
4411 C CD1   . LEU B 193 ? 0.4584 0.5071 0.5579 0.0341  0.0425  0.1109  193  LEU C CD1   
4412 C CD2   . LEU B 193 ? 0.6077 0.6680 0.7148 0.0313  0.0409  0.1160  193  LEU C CD2   
4413 N N     . THR B 194 ? 0.6531 0.7110 0.7607 0.0528  0.0630  0.1256  194  THR C N     
4414 C CA    . THR B 194 ? 0.6226 0.6879 0.7349 0.0567  0.0639  0.1316  194  THR C CA    
4415 C C     . THR B 194 ? 0.6292 0.6858 0.7352 0.0597  0.0670  0.1286  194  THR C C     
4416 O O     . THR B 194 ? 0.6550 0.7152 0.7631 0.0602  0.0642  0.1305  194  THR C O     
4417 C CB    . THR B 194 ? 0.7149 0.7875 0.8324 0.0621  0.0698  0.1389  194  THR C CB    
4418 O OG1   . THR B 194 ? 0.7307 0.8130 0.8550 0.0590  0.0662  0.1423  194  THR C OG1   
4419 C CG2   . THR B 194 ? 0.6778 0.7580 0.7997 0.0670  0.0715  0.1454  194  THR C CG2   
4420 N N     . PHE B 195 ? 0.6373 0.6820 0.7349 0.0613  0.0727  0.1237  195  PHE C N     
4421 C CA    . PHE B 195 ? 0.6062 0.6415 0.6965 0.0637  0.0759  0.1202  195  PHE C CA    
4422 C C     . PHE B 195 ? 0.6343 0.6668 0.7229 0.0589  0.0690  0.1151  195  PHE C C     
4423 O O     . PHE B 195 ? 0.6630 0.6932 0.7498 0.0604  0.0685  0.1145  195  PHE C O     
4424 C CB    . PHE B 195 ? 0.5965 0.6191 0.6769 0.0651  0.0831  0.1158  195  PHE C CB    
4425 C CG    . PHE B 195 ? 0.6124 0.6251 0.6843 0.0678  0.0875  0.1127  195  PHE C CG    
4426 C CD1   . PHE B 195 ? 0.6492 0.6609 0.7194 0.0744  0.0945  0.1171  195  PHE C CD1   
4427 C CD2   . PHE B 195 ? 0.5395 0.5441 0.6052 0.0640  0.0847  0.1057  195  PHE C CD2   
4428 C CE1   . PHE B 195 ? 0.6560 0.6578 0.7176 0.0769  0.0987  0.1140  195  PHE C CE1   
4429 C CE2   . PHE B 195 ? 0.5828 0.5783 0.6406 0.0662  0.0887  0.1027  195  PHE C CE2   
4430 C CZ    . PHE B 195 ? 0.6535 0.6471 0.7088 0.0725  0.0957  0.1067  195  PHE C CZ    
4431 N N     . LEU B 196 ? 0.6223 0.6544 0.7110 0.0535  0.0639  0.1117  196  LEU C N     
4432 C CA    . LEU B 196 ? 0.6102 0.6394 0.6970 0.0490  0.0575  0.1074  196  LEU C CA    
4433 C C     . LEU B 196 ? 0.5682 0.6053 0.6608 0.0480  0.0520  0.1116  196  LEU C C     
4434 O O     . LEU B 196 ? 0.6401 0.6735 0.7303 0.0472  0.0494  0.1095  196  LEU C O     
4435 C CB    . LEU B 196 ? 0.5148 0.5428 0.6007 0.0439  0.0537  0.1039  196  LEU C CB    
4436 C CG    . LEU B 196 ? 0.5793 0.6039 0.6628 0.0397  0.0476  0.1000  196  LEU C CG    
4437 C CD1   . LEU B 196 ? 0.6077 0.6219 0.6833 0.0394  0.0498  0.0937  196  LEU C CD1   
4438 C CD2   . LEU B 196 ? 0.6715 0.6996 0.7570 0.0351  0.0426  0.1000  196  LEU C CD2   
4439 N N     . VAL B 197 ? 0.5458 0.5939 0.6458 0.0478  0.0503  0.1176  197  VAL C N     
4440 C CA    . VAL B 197 ? 0.5568 0.6136 0.6622 0.0459  0.0447  0.1223  197  VAL C CA    
4441 C C     . VAL B 197 ? 0.5504 0.6093 0.6572 0.0507  0.0474  0.1258  197  VAL C C     
4442 O O     . VAL B 197 ? 0.5699 0.6299 0.6771 0.0490  0.0430  0.1265  197  VAL C O     
4443 C CB    . VAL B 197 ? 0.6218 0.6908 0.7347 0.0437  0.0421  0.1282  197  VAL C CB    
4444 C CG1   . VAL B 197 ? 0.5509 0.6298 0.6692 0.0417  0.0368  0.1340  197  VAL C CG1   
4445 C CG2   . VAL B 197 ? 0.5448 0.6111 0.6557 0.0383  0.0384  0.1245  197  VAL C CG2   
4446 N N     . ASP B 198 ? 0.5704 0.6291 0.6771 0.0569  0.0549  0.1280  198  ASP C N     
4447 C CA    . ASP B 198 ? 0.6105 0.6697 0.7171 0.0623  0.0586  0.1311  198  ASP C CA    
4448 C C     . ASP B 198 ? 0.6091 0.6566 0.7080 0.0620  0.0584  0.1247  198  ASP C C     
4449 O O     . ASP B 198 ? 0.6293 0.6781 0.7290 0.0632  0.0566  0.1263  198  ASP C O     
4450 C CB    . ASP B 198 ? 0.6032 0.6621 0.7091 0.0693  0.0677  0.1344  198  ASP C CB    
4451 C CG    . ASP B 198 ? 0.6941 0.7666 0.8090 0.0710  0.0683  0.1426  198  ASP C CG    
4452 O OD1   . ASP B 198 ? 0.6775 0.7614 0.7997 0.0672  0.0616  0.1466  198  ASP C OD1   
4453 O OD2   . ASP B 198 ? 0.7353 0.8067 0.8494 0.0758  0.0757  0.1450  198  ASP C OD2   
4454 N N     . LEU B 199 ? 0.5456 0.5818 0.6371 0.0603  0.0600  0.1176  199  LEU C N     
4455 C CA    . LEU B 199 ? 0.5155 0.5409 0.5999 0.0592  0.0593  0.1112  199  LEU C CA    
4456 C C     . LEU B 199 ? 0.5504 0.5784 0.6374 0.0550  0.0514  0.1113  199  LEU C C     
4457 O O     . LEU B 199 ? 0.5081 0.5315 0.5922 0.0560  0.0507  0.1098  199  LEU C O     
4458 C CB    . LEU B 199 ? 0.4647 0.4807 0.5424 0.0563  0.0603  0.1043  199  LEU C CB    
4459 C CG    . LEU B 199 ? 0.4908 0.4991 0.5617 0.0593  0.0683  0.1019  199  LEU C CG    
4460 C CD1   . LEU B 199 ? 0.4353 0.4362 0.5004 0.0549  0.0675  0.0954  199  LEU C CD1   
4461 C CD2   . LEU B 199 ? 0.5551 0.5562 0.6200 0.0639  0.0740  0.1010  199  LEU C CD2   
4462 N N     . ILE B 200 ? 0.5890 0.6235 0.6804 0.0502  0.0456  0.1132  200  ILE C N     
4463 C CA    . ILE B 200 ? 0.5225 0.5583 0.6148 0.0454  0.0381  0.1135  200  ILE C CA    
4464 C C     . ILE B 200 ? 0.5596 0.6052 0.6579 0.0465  0.0360  0.1205  200  ILE C C     
4465 O O     . ILE B 200 ? 0.5766 0.6203 0.6736 0.0445  0.0319  0.1204  200  ILE C O     
4466 C CB    . ILE B 200 ? 0.5535 0.5914 0.6467 0.0395  0.0330  0.1130  200  ILE C CB    
4467 C CG1   . ILE B 200 ? 0.5100 0.5391 0.5976 0.0384  0.0349  0.1065  200  ILE C CG1   
4468 C CG2   . ILE B 200 ? 0.4828 0.5200 0.5750 0.0342  0.0259  0.1134  200  ILE C CG2   
4469 C CD1   . ILE B 200 ? 0.4994 0.5308 0.5879 0.0338  0.0313  0.1062  200  ILE C CD1   
4470 N N     . LYS B 201 ? 0.5924 0.6488 0.6971 0.0495  0.0387  0.1268  201  LYS C N     
4471 C CA    . LYS B 201 ? 0.6256 0.6933 0.7367 0.0511  0.0372  0.1343  201  LYS C CA    
4472 C C     . LYS B 201 ? 0.6368 0.6996 0.7450 0.0560  0.0404  0.1337  201  LYS C C     
4473 O O     . LYS B 201 ? 0.6948 0.7617 0.8050 0.0551  0.0367  0.1370  201  LYS C O     
4474 C CB    . LYS B 201 ? 0.6553 0.7351 0.7736 0.0548  0.0410  0.1413  201  LYS C CB    
4475 C CG    . LYS B 201 ? 0.8150 0.9032 0.9381 0.0497  0.0368  0.1440  201  LYS C CG    
4476 C CD    . LYS B 201 ? 0.8700 0.9705 1.0006 0.0540  0.0411  0.1514  201  LYS C CD    
4477 C CE    . LYS B 201 ? 0.8335 0.9426 0.9688 0.0486  0.0368  0.1541  201  LYS C CE    
4478 N NZ    . LYS B 201 ? 0.8364 0.9566 0.9788 0.0531  0.0415  0.1611  201  LYS C NZ    
4479 N N     . ASN B 202 ? 0.6114 0.6648 0.7140 0.0609  0.0475  0.1296  202  ASN C N     
4480 C CA    . ASN B 202 ? 0.5667 0.6146 0.6655 0.0663  0.0519  0.1288  202  ASN C CA    
4481 C C     . ASN B 202 ? 0.6437 0.6787 0.7350 0.0637  0.0495  0.1214  202  ASN C C     
4482 O O     . ASN B 202 ? 0.6549 0.6822 0.7410 0.0677  0.0536  0.1189  202  ASN C O     
4483 C CB    . ASN B 202 ? 0.5364 0.5800 0.6316 0.0729  0.0614  0.1287  202  ASN C CB    
4484 C CG    . ASN B 202 ? 0.6128 0.6688 0.7154 0.0765  0.0646  0.1367  202  ASN C CG    
4485 O OD1   . ASN B 202 ? 0.6647 0.7188 0.7659 0.0781  0.0695  0.1363  202  ASN C OD1   
4486 N ND2   . ASN B 202 ? 0.5623 0.6314 0.6728 0.0775  0.0617  0.1444  202  ASN C ND2   
4487 N N     . LYS B 203 ? 0.5537 0.5863 0.6442 0.0571  0.0431  0.1181  203  LYS C N     
4488 C CA    . LYS B 203 ? 0.5268 0.5482 0.6109 0.0541  0.0399  0.1119  203  LYS C CA    
4489 C C     . LYS B 203 ? 0.4997 0.5085 0.5757 0.0561  0.0451  0.1046  203  LYS C C     
4490 O O     . LYS B 203 ? 0.5027 0.5022 0.5734 0.0557  0.0445  0.1000  203  LYS C O     
4491 C CB    . LYS B 203 ? 0.6164 0.6383 0.7010 0.0550  0.0375  0.1143  203  LYS C CB    
4492 C CG    . LYS B 203 ? 0.6412 0.6759 0.7331 0.0522  0.0320  0.1219  203  LYS C CG    
4493 C CD    . LYS B 203 ? 0.7169 0.7513 0.8084 0.0443  0.0246  0.1211  203  LYS C CD    
4494 C CE    . LYS B 203 ? 0.7011 0.7424 0.7957 0.0403  0.0182  0.1267  203  LYS C CE    
4495 N NZ    . LYS B 203 ? 0.7275 0.7845 0.8305 0.0430  0.0192  0.1352  203  LYS C NZ    
4496 N N     . HIS B 204 ? 0.4443 0.4526 0.5192 0.0580  0.0502  0.1036  204  HIS C N     
4497 C CA    . HIS B 204 ? 0.4299 0.4268 0.4966 0.0584  0.0545  0.0967  204  HIS C CA    
4498 C C     . HIS B 204 ? 0.5188 0.5122 0.5838 0.0526  0.0499  0.0922  204  HIS C C     
4499 O O     . HIS B 204 ? 0.5512 0.5355 0.6097 0.0515  0.0512  0.0863  204  HIS C O     
4500 C CB    . HIS B 204 ? 0.3731 0.3693 0.4376 0.0624  0.0622  0.0974  204  HIS C CB    
4501 C CG    . HIS B 204 ? 0.4742 0.4737 0.5399 0.0688  0.0676  0.1025  204  HIS C CG    
4502 N ND1   . HIS B 204 ? 0.5571 0.5506 0.6183 0.0724  0.0704  0.1013  204  HIS C ND1   
4503 C CD2   . HIS B 204 ? 0.4977 0.5056 0.5684 0.0726  0.0712  0.1090  204  HIS C CD2   
4504 C CE1   . HIS B 204 ? 0.4622 0.4605 0.5254 0.0783  0.0756  0.1071  204  HIS C CE1   
4505 N NE2   . HIS B 204 ? 0.5419 0.5491 0.6110 0.0787  0.0762  0.1120  204  HIS C NE2   
4506 N N     . MET B 205 ? 0.5510 0.5519 0.6214 0.0490  0.0448  0.0953  205  MET C N     
4507 C CA    . MET B 205 ? 0.4767 0.4746 0.5454 0.0437  0.0400  0.0920  205  MET C CA    
4508 C C     . MET B 205 ? 0.5687 0.5722 0.6415 0.0398  0.0332  0.0958  205  MET C C     
4509 O O     . MET B 205 ? 0.5215 0.5332 0.5996 0.0406  0.0320  0.1014  205  MET C O     
4510 C CB    . MET B 205 ? 0.4328 0.4318 0.5013 0.0427  0.0421  0.0906  205  MET C CB    
4511 C CG    . MET B 205 ? 0.4729 0.4652 0.5356 0.0452  0.0486  0.0865  205  MET C CG    
4512 S SD    . MET B 205 ? 0.5316 0.5226 0.5920 0.0423  0.0497  0.0832  205  MET C SD    
4513 C CE    . MET B 205 ? 0.4678 0.4695 0.5357 0.0427  0.0495  0.0893  205  MET C CE    
4514 N N     . ASN B 206 ? 0.6100 0.6090 0.6798 0.0353  0.0289  0.0931  206  ASN C N     
4515 C CA    . ASN B 206 ? 0.5456 0.5478 0.6171 0.0307  0.0227  0.0963  206  ASN C CA    
4516 C C     . ASN B 206 ? 0.4588 0.4630 0.5304 0.0271  0.0207  0.0960  206  ASN C C     
4517 O O     . ASN B 206 ? 0.3950 0.3940 0.4631 0.0270  0.0223  0.0917  206  ASN C O     
4518 C CB    . ASN B 206 ? 0.5041 0.4974 0.5704 0.0286  0.0193  0.0939  206  ASN C CB    
4519 C CG    . ASN B 206 ? 0.4680 0.4631 0.5344 0.0235  0.0132  0.0976  206  ASN C CG    
4520 O OD1   . ASN B 206 ? 0.4204 0.4147 0.4848 0.0195  0.0105  0.0975  206  ASN C OD1   
4521 N ND2   . ASN B 206 ? 0.4758 0.4731 0.5436 0.0233  0.0110  0.1010  206  ASN C ND2   
4522 N N     . ALA B 207 ? 0.4467 0.4587 0.5222 0.0241  0.0173  0.1009  207  ALA C N     
4523 C CA    . ALA B 207 ? 0.5376 0.5521 0.6132 0.0208  0.0156  0.1012  207  ALA C CA    
4524 C C     . ALA B 207 ? 0.5522 0.5576 0.6210 0.0175  0.0132  0.0972  207  ALA C C     
4525 O O     . ALA B 207 ? 0.5603 0.5654 0.6279 0.0162  0.0135  0.0957  207  ALA C O     
4526 C CB    . ALA B 207 ? 0.5015 0.5258 0.5817 0.0176  0.0120  0.1073  207  ALA C CB    
4527 N N     . ASP B 208 ? 0.4666 0.4641 0.5305 0.0163  0.0110  0.0957  208  ASP C N     
4528 C CA    . ASP B 208 ? 0.5296 0.5180 0.5866 0.0132  0.0087  0.0930  208  ASP C CA    
4529 C C     . ASP B 208 ? 0.5086 0.4896 0.5619 0.0159  0.0118  0.0875  208  ASP C C     
4530 O O     . ASP B 208 ? 0.4669 0.4404 0.5145 0.0143  0.0107  0.0854  208  ASP C O     
4531 C CB    . ASP B 208 ? 0.5190 0.5020 0.5715 0.0096  0.0043  0.0949  208  ASP C CB    
4532 C CG    . ASP B 208 ? 0.6797 0.6697 0.7342 0.0052  0.0005  0.1004  208  ASP C CG    
4533 O OD1   . ASP B 208 ? 0.7448 0.7384 0.7995 0.0028  -0.0002 0.1014  208  ASP C OD1   
4534 O OD2   . ASP B 208 ? 0.7877 0.7803 0.8437 0.0039  -0.0018 0.1037  208  ASP C OD2   
4535 N N     . THR B 209 ? 0.5156 0.4984 0.5715 0.0200  0.0161  0.0856  209  THR C N     
4536 C CA    . THR B 209 ? 0.5073 0.4840 0.5597 0.0220  0.0190  0.0807  209  THR C CA    
4537 C C     . THR B 209 ? 0.4508 0.4277 0.5015 0.0206  0.0194  0.0791  209  THR C C     
4538 O O     . THR B 209 ? 0.4830 0.4663 0.5371 0.0202  0.0201  0.0806  209  THR C O     
4539 C CB    . THR B 209 ? 0.4686 0.4469 0.5228 0.0260  0.0240  0.0790  209  THR C CB    
4540 O OG1   . THR B 209 ? 0.4742 0.4511 0.5289 0.0277  0.0240  0.0802  209  THR C OG1   
4541 C CG2   . THR B 209 ? 0.3374 0.3099 0.3872 0.0270  0.0269  0.0740  209  THR C CG2   
4542 N N     . ASP B 210 ? 0.4667 0.4368 0.5125 0.0200  0.0189  0.0762  210  ASP C N     
4543 C CA    . ASP B 210 ? 0.4687 0.4390 0.5126 0.0191  0.0194  0.0748  210  ASP C CA    
4544 C C     . ASP B 210 ? 0.4568 0.4242 0.4983 0.0209  0.0224  0.0708  210  ASP C C     
4545 O O     . ASP B 210 ? 0.5141 0.4791 0.5552 0.0227  0.0243  0.0689  210  ASP C O     
4546 C CB    . ASP B 210 ? 0.4892 0.4548 0.5286 0.0164  0.0160  0.0763  210  ASP C CB    
4547 C CG    . ASP B 210 ? 0.5130 0.4693 0.5470 0.0165  0.0150  0.0751  210  ASP C CG    
4548 O OD1   . ASP B 210 ? 0.4981 0.4521 0.5322 0.0187  0.0170  0.0725  210  ASP C OD1   
4549 O OD2   . ASP B 210 ? 0.5781 0.5287 0.6073 0.0142  0.0124  0.0768  210  ASP C OD2   
4550 N N     . TYR B 211 ? 0.3676 0.3356 0.4074 0.0203  0.0228  0.0697  211  TYR C N     
4551 C CA    . TYR B 211 ? 0.4305 0.3974 0.4682 0.0213  0.0254  0.0665  211  TYR C CA    
4552 C C     . TYR B 211 ? 0.4676 0.4278 0.5018 0.0222  0.0254  0.0646  211  TYR C C     
4553 O O     . TYR B 211 ? 0.4380 0.3974 0.4717 0.0233  0.0280  0.0620  211  TYR C O     
4554 C CB    . TYR B 211 ? 0.3333 0.3022 0.3695 0.0203  0.0251  0.0665  211  TYR C CB    
4555 C CG    . TYR B 211 ? 0.4367 0.4075 0.4719 0.0208  0.0279  0.0638  211  TYR C CG    
4556 C CD1   . TYR B 211 ? 0.4228 0.3901 0.4548 0.0213  0.0282  0.0623  211  TYR C CD1   
4557 C CD2   . TYR B 211 ? 0.4402 0.4164 0.4773 0.0202  0.0302  0.0630  211  TYR C CD2   
4558 C CE1   . TYR B 211 ? 0.4529 0.4230 0.4839 0.0211  0.0304  0.0601  211  TYR C CE1   
4559 C CE2   . TYR B 211 ? 0.3947 0.3727 0.4300 0.0197  0.0325  0.0607  211  TYR C CE2   
4560 C CZ    . TYR B 211 ? 0.4950 0.4705 0.5274 0.0200  0.0325  0.0594  211  TYR C CZ    
4561 O OH    . TYR B 211 ? 0.4911 0.4694 0.5216 0.0188  0.0345  0.0575  211  TYR C OH    
4562 N N     . SER B 212 ? 0.4262 0.3806 0.4573 0.0216  0.0228  0.0659  212  SER C N     
4563 C CA    . SER B 212 ? 0.4488 0.3958 0.4761 0.0226  0.0228  0.0644  212  SER C CA    
4564 C C     . SER B 212 ? 0.3665 0.3111 0.3948 0.0236  0.0233  0.0634  212  SER C C     
4565 O O     . SER B 212 ? 0.4228 0.3639 0.4493 0.0248  0.0251  0.0607  212  SER C O     
4566 C CB    . SER B 212 ? 0.5464 0.4864 0.5692 0.0216  0.0202  0.0666  212  SER C CB    
4567 O OG    . SER B 212 ? 0.7062 0.6477 0.7272 0.0211  0.0201  0.0677  212  SER C OG    
4568 N N     . ILE B 213 ? 0.4463 0.3928 0.4772 0.0230  0.0218  0.0658  213  ILE C N     
4569 C CA    . ILE B 213 ? 0.4265 0.3712 0.4585 0.0242  0.0221  0.0656  213  ILE C CA    
4570 C C     . ILE B 213 ? 0.4779 0.4256 0.5114 0.0264  0.0263  0.0630  213  ILE C C     
4571 O O     . ILE B 213 ? 0.4656 0.4088 0.4970 0.0279  0.0280  0.0606  213  ILE C O     
4572 C CB    . ILE B 213 ? 0.3937 0.3418 0.4287 0.0230  0.0195  0.0696  213  ILE C CB    
4573 C CG1   . ILE B 213 ? 0.4782 0.4202 0.5092 0.0202  0.0155  0.0718  213  ILE C CG1   
4574 C CG2   . ILE B 213 ? 0.3850 0.3336 0.4222 0.0250  0.0206  0.0698  213  ILE C CG2   
4575 C CD1   . ILE B 213 ? 0.4519 0.3978 0.4850 0.0177  0.0124  0.0761  213  ILE C CD1   
4576 N N     . ALA B 214 ? 0.3880 0.3426 0.4245 0.0263  0.0281  0.0636  214  ALA C N     
4577 C CA    . ALA B 214 ? 0.3918 0.3482 0.4282 0.0279  0.0325  0.0614  214  ALA C CA    
4578 C C     . ALA B 214 ? 0.4280 0.3806 0.4600 0.0277  0.0346  0.0574  214  ALA C C     
4579 O O     . ALA B 214 ? 0.4338 0.3833 0.4632 0.0290  0.0378  0.0549  214  ALA C O     
4580 C CB    . ALA B 214 ? 0.3273 0.2906 0.3666 0.0275  0.0340  0.0629  214  ALA C CB    
4581 N N     . GLU B 215 ? 0.4209 0.3737 0.4517 0.0262  0.0330  0.0571  215  GLU C N     
4582 C CA    . GLU B 215 ? 0.3869 0.3380 0.4141 0.0257  0.0348  0.0540  215  GLU C CA    
4583 C C     . GLU B 215 ? 0.5116 0.4554 0.5356 0.0268  0.0348  0.0520  215  GLU C C     
4584 O O     . GLU B 215 ? 0.5402 0.4818 0.5612 0.0270  0.0376  0.0489  215  GLU C O     
4585 C CB    . GLU B 215 ? 0.3411 0.2949 0.3681 0.0244  0.0331  0.0549  215  GLU C CB    
4586 C CG    . GLU B 215 ? 0.3470 0.3002 0.3709 0.0239  0.0345  0.0525  215  GLU C CG    
4587 C CD    . GLU B 215 ? 0.5018 0.4577 0.5257 0.0233  0.0328  0.0543  215  GLU C CD    
4588 O OE1   . GLU B 215 ? 0.5691 0.5227 0.5932 0.0239  0.0303  0.0568  215  GLU C OE1   
4589 O OE2   . GLU B 215 ? 0.4918 0.4522 0.5148 0.0223  0.0342  0.0534  215  GLU C OE2   
4590 N N     . ALA B 216 ? 0.4898 0.4292 0.5139 0.0272  0.0317  0.0538  216  ALA C N     
4591 C CA    . ALA B 216 ? 0.4914 0.4229 0.5125 0.0282  0.0314  0.0521  216  ALA C CA    
4592 C C     . ALA B 216 ? 0.4043 0.3339 0.4250 0.0298  0.0339  0.0504  216  ALA C C     
4593 O O     . ALA B 216 ? 0.4796 0.4045 0.4969 0.0305  0.0360  0.0472  216  ALA C O     
4594 C CB    . ALA B 216 ? 0.4747 0.4011 0.4952 0.0279  0.0277  0.0548  216  ALA C CB    
4595 N N     . ALA B 217 ? 0.3995 0.3328 0.4234 0.0304  0.0339  0.0526  217  ALA C N     
4596 C CA    . ALA B 217 ? 0.3976 0.3294 0.4211 0.0326  0.0367  0.0517  217  ALA C CA    
4597 C C     . ALA B 217 ? 0.5229 0.4544 0.5428 0.0329  0.0416  0.0483  217  ALA C C     
4598 O O     . ALA B 217 ? 0.4945 0.4206 0.5105 0.0344  0.0443  0.0456  217  ALA C O     
4599 C CB    . ALA B 217 ? 0.3633 0.3007 0.3914 0.0334  0.0361  0.0557  217  ALA C CB    
4600 N N     . PHE B 218 ? 0.4597 0.3965 0.4801 0.0313  0.0429  0.0482  218  PHE C N     
4601 C CA    . PHE B 218 ? 0.4229 0.3587 0.4385 0.0307  0.0475  0.0451  218  PHE C CA    
4602 C C     . PHE B 218 ? 0.3929 0.3247 0.4040 0.0292  0.0478  0.0416  218  PHE C C     
4603 O O     . PHE B 218 ? 0.3886 0.3159 0.3943 0.0293  0.0514  0.0384  218  PHE C O     
4604 C CB    . PHE B 218 ? 0.3622 0.3043 0.3788 0.0288  0.0488  0.0460  218  PHE C CB    
4605 C CG    . PHE B 218 ? 0.3500 0.2901 0.3603 0.0275  0.0538  0.0430  218  PHE C CG    
4606 C CD1   . PHE B 218 ? 0.3819 0.3190 0.3890 0.0293  0.0585  0.0428  218  PHE C CD1   
4607 C CD2   . PHE B 218 ? 0.2939 0.2346 0.3006 0.0244  0.0540  0.0405  218  PHE C CD2   
4608 C CE1   . PHE B 218 ? 0.3824 0.3157 0.3816 0.0276  0.0635  0.0400  218  PHE C CE1   
4609 C CE2   . PHE B 218 ? 0.3512 0.2894 0.3508 0.0222  0.0585  0.0378  218  PHE C CE2   
4610 C CZ    . PHE B 218 ? 0.3374 0.2712 0.3327 0.0237  0.0634  0.0373  218  PHE C CZ    
4611 N N     . ASN B 219 ? 0.3506 0.2838 0.3633 0.0280  0.0444  0.0423  219  ASN C N     
4612 C CA    . ASN B 219 ? 0.4140 0.3450 0.4231 0.0267  0.0448  0.0397  219  ASN C CA    
4613 C C     . ASN B 219 ? 0.4571 0.3800 0.4636 0.0283  0.0446  0.0377  219  ASN C C     
4614 O O     . ASN B 219 ? 0.4577 0.3780 0.4607 0.0275  0.0456  0.0352  219  ASN C O     
4615 C CB    . ASN B 219 ? 0.4165 0.3521 0.4281 0.0254  0.0418  0.0417  219  ASN C CB    
4616 C CG    . ASN B 219 ? 0.4226 0.3661 0.4357 0.0234  0.0424  0.0429  219  ASN C CG    
4617 O OD1   . ASN B 219 ? 0.4315 0.3795 0.4463 0.0225  0.0406  0.0446  219  ASN C OD1   
4618 N ND2   . ASN B 219 ? 0.3242 0.2690 0.3364 0.0230  0.0452  0.0422  219  ASN C ND2   
4619 N N     . LYS B 220 ? 0.4565 0.3757 0.4648 0.0305  0.0433  0.0391  220  LYS C N     
4620 C CA    . LYS B 220 ? 0.5573 0.4682 0.5628 0.0322  0.0432  0.0373  220  LYS C CA    
4621 C C     . LYS B 220 ? 0.5278 0.4354 0.5307 0.0340  0.0468  0.0356  220  LYS C C     
4622 O O     . LYS B 220 ? 0.5420 0.4429 0.5430 0.0359  0.0469  0.0344  220  LYS C O     
4623 C CB    . LYS B 220 ? 0.5035 0.4112 0.5116 0.0330  0.0390  0.0401  220  LYS C CB    
4624 C CG    . LYS B 220 ? 0.5458 0.4530 0.5539 0.0318  0.0364  0.0413  220  LYS C CG    
4625 C CD    . LYS B 220 ? 0.6279 0.5354 0.6387 0.0314  0.0326  0.0454  220  LYS C CD    
4626 C CE    . LYS B 220 ? 0.6343 0.5337 0.6437 0.0323  0.0304  0.0462  220  LYS C CE    
4627 N NZ    . LYS B 220 ? 0.6892 0.5876 0.6992 0.0309  0.0267  0.0502  220  LYS C NZ    
4628 N N     . GLY B 221 ? 0.4578 0.3697 0.4603 0.0337  0.0499  0.0358  221  GLY C N     
4629 C CA    . GLY B 221 ? 0.4730 0.3813 0.4714 0.0357  0.0546  0.0342  221  GLY C CA    
4630 C C     . GLY B 221 ? 0.4602 0.3683 0.4618 0.0390  0.0543  0.0372  221  GLY C C     
4631 O O     . GLY B 221 ? 0.4262 0.3292 0.4240 0.0415  0.0577  0.0358  221  GLY C O     
4632 N N     . GLU B 222 ? 0.4571 0.3710 0.4654 0.0390  0.0503  0.0414  222  GLU C N     
4633 C CA    . GLU B 222 ? 0.3986 0.3140 0.4107 0.0417  0.0494  0.0450  222  GLU C CA    
4634 C C     . GLU B 222 ? 0.3812 0.3025 0.3953 0.0433  0.0527  0.0477  222  GLU C C     
4635 O O     . GLU B 222 ? 0.3901 0.3126 0.4060 0.0463  0.0539  0.0504  222  GLU C O     
4636 C CB    . GLU B 222 ? 0.3986 0.3168 0.4161 0.0402  0.0433  0.0485  222  GLU C CB    
4637 C CG    . GLU B 222 ? 0.4086 0.3203 0.4238 0.0388  0.0401  0.0467  222  GLU C CG    
4638 C CD    . GLU B 222 ? 0.5375 0.4510 0.5562 0.0367  0.0347  0.0503  222  GLU C CD    
4639 O OE1   . GLU B 222 ? 0.5767 0.4851 0.5931 0.0353  0.0325  0.0493  222  GLU C OE1   
4640 O OE2   . GLU B 222 ? 0.5555 0.4753 0.5786 0.0365  0.0330  0.0543  222  GLU C OE2   
4641 N N     . THR B 223 ? 0.3912 0.3163 0.4050 0.0413  0.0541  0.0473  223  THR C N     
4642 C CA    . THR B 223 ? 0.4127 0.3429 0.4282 0.0426  0.0573  0.0501  223  THR C CA    
4643 C C     . THR B 223 ? 0.4008 0.3281 0.4095 0.0413  0.0625  0.0469  223  THR C C     
4644 O O     . THR B 223 ? 0.4314 0.3570 0.4369 0.0381  0.0618  0.0436  223  THR C O     
4645 C CB    . THR B 223 ? 0.3915 0.3303 0.4144 0.0410  0.0531  0.0542  223  THR C CB    
4646 O OG1   . THR B 223 ? 0.4402 0.3840 0.4658 0.0432  0.0560  0.0577  223  THR C OG1   
4647 C CG2   . THR B 223 ? 0.3564 0.2968 0.3786 0.0374  0.0515  0.0523  223  THR C CG2   
4648 N N     . ALA B 224 ? 0.3630 0.2896 0.3689 0.0437  0.0680  0.0480  224  ALA C N     
4649 C CA    . ALA B 224 ? 0.4359 0.3573 0.4329 0.0424  0.0738  0.0449  224  ALA C CA    
4650 C C     . ALA B 224 ? 0.4849 0.4112 0.4828 0.0388  0.0734  0.0453  224  ALA C C     
4651 O O     . ALA B 224 ? 0.4712 0.3938 0.4618 0.0356  0.0763  0.0421  224  ALA C O     
4652 C CB    . ALA B 224 ? 0.3493 0.2662 0.3412 0.0466  0.0807  0.0462  224  ALA C CB    
4653 N N     . MET B 225 ? 0.4006 0.3349 0.4069 0.0389  0.0698  0.0492  225  MET C N     
4654 C CA    . MET B 225 ? 0.4259 0.3649 0.4334 0.0360  0.0694  0.0499  225  MET C CA    
4655 C C     . MET B 225 ? 0.4470 0.3937 0.4631 0.0345  0.0630  0.0523  225  MET C C     
4656 O O     . MET B 225 ? 0.5161 0.4657 0.5381 0.0362  0.0593  0.0550  225  MET C O     
4657 C CB    . MET B 225 ? 0.4375 0.3771 0.4442 0.0381  0.0744  0.0528  225  MET C CB    
4658 C CG    . MET B 225 ? 0.4567 0.3874 0.4529 0.0394  0.0821  0.0509  225  MET C CG    
4659 S SD    . MET B 225 ? 0.4080 0.3390 0.4038 0.0433  0.0883  0.0555  225  MET C SD    
4660 C CE    . MET B 225 ? 0.5100 0.4484 0.5168 0.0485  0.0850  0.0609  225  MET C CE    
4661 N N     . THR B 226 ? 0.3781 0.3277 0.3939 0.0310  0.0617  0.0513  226  THR C N     
4662 C CA    . THR B 226 ? 0.3492 0.3057 0.3718 0.0298  0.0568  0.0538  226  THR C CA    
4663 C C     . THR B 226 ? 0.4698 0.4295 0.4917 0.0276  0.0587  0.0542  226  THR C C     
4664 O O     . THR B 226 ? 0.3485 0.3044 0.3639 0.0265  0.0634  0.0522  226  THR C O     
4665 C CB    . THR B 226 ? 0.3549 0.3117 0.3785 0.0278  0.0521  0.0524  226  THR C CB    
4666 O OG1   . THR B 226 ? 0.3952 0.3573 0.4246 0.0272  0.0476  0.0553  226  THR C OG1   
4667 C CG2   . THR B 226 ? 0.3827 0.3389 0.4014 0.0246  0.0532  0.0492  226  THR C CG2   
4668 N N     . ILE B 227 ? 0.3932 0.3590 0.4209 0.0268  0.0551  0.0566  227  ILE C N     
4669 C CA    . ILE B 227 ? 0.4000 0.3690 0.4275 0.0247  0.0562  0.0570  227  ILE C CA    
4670 C C     . ILE B 227 ? 0.4064 0.3793 0.4360 0.0221  0.0517  0.0565  227  ILE C C     
4671 O O     . ILE B 227 ? 0.3635 0.3393 0.3978 0.0226  0.0475  0.0585  227  ILE C O     
4672 C CB    . ILE B 227 ? 0.4008 0.3736 0.4333 0.0266