data_3Q7I
# 
_entry.id   3Q7I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3Q7I         
RCSB  RCSB063291   
WWPDB D_1000063291 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      3LJK     'Glucose-6-phosphate isomerase from Francisella tularensis.'                                     unspecified 
PDB      3M5P     'Glucose-6-phosphate isomerase from Francisella tularensis complexed with fructose-6-phosphate.' unspecified 
TargetDB IDP02733 .                                                                                                unspecified 
# 
_pdbx_database_status.entry_id                        3Q7I 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-04 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Osipiuk, J.'                                                   1 
'Maltseva, N.'                                                  2 
'Hasseman, J.'                                                  3 
'Anderson, W.F.'                                                4 
'Joachimiak, A.'                                                5 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 
# 
_citation.id                        primary 
_citation.title                     'Glucose-6-phosphate isomerase from Francisella tularensis.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Osipiuk, J.'    1 
primary 'Maltseva, N.'   2 
primary 'Hasseman, J.'   3 
primary 'Anderson, W.F.' 4 
primary 'Joachimiak, A.' 5 
# 
_cell.length_a           114.439 
_cell.length_b           114.439 
_cell.length_c           84.319 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3Q7I 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         3Q7I 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase'        61466.449 1   5.3.1.9 F194L ? ? 
2 non-polymer man '6-PHOSPHOGLUCONIC ACID'               276.135   1   ?       ?     ? ? 
3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   2   ?       ?     ? ? 
4 non-polymer syn 'PHOSPHATE ION'                        94.971    1   ?       ?     ? ? 
5 non-polymer syn 'ISOPROPYL ALCOHOL'                    60.095    1   ?       ?     ? ? 
6 non-polymer syn 'CALCIUM ION'                          40.078    1   ?       ?     ? ? 
7 water       nat water                                  18.015    528 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNAMLFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQMFNGAK
INSTEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGGSDLGPKMVVR
ALQPYHCTDLKVHFVSNVDADSLLQALHVVDPETTLLIIASKSFSTEETLLNSISAREWLLDHYEDEKAVANHFVAISSK
LDKVKEFGIDLEHCYKMWDWVGGRYSLWSSIGMSIAFAIGYDNFEKLLAGAYSVDKHFKETEFSKNIPVIMALLASYYSC
TYNSQSQALLPYDERLCYFVDYLQQADMESNGKSVNIAGETVNYQTGVVLWGGVGTNGQHAFHQLLHQGNIFIPVDFIAI
ATSHHNYDNHQQALLANCFAQSQALMFGQSYDMVYNELLKSGLNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALI
ALYEHKIFVQGVLWDINSYDQWGVELGKKLGKNILKAMNDDSSDEYQNLDDSTRQLIAKVKNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAMLFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQMFNGAK
INSTEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGGSDLGPKMVVR
ALQPYHCTDLKVHFVSNVDADSLLQALHVVDPETTLLIIASKSFSTEETLLNSISAREWLLDHYEDEKAVANHFVAISSK
LDKVKEFGIDLEHCYKMWDWVGGRYSLWSSIGMSIAFAIGYDNFEKLLAGAYSVDKHFKETEFSKNIPVIMALLASYYSC
TYNSQSQALLPYDERLCYFVDYLQQADMESNGKSVNIAGETVNYQTGVVLWGGVGTNGQHAFHQLLHQGNIFIPVDFIAI
ATSHHNYDNHQQALLANCFAQSQALMFGQSYDMVYNELLKSGLNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALI
ALYEHKIFVQGVLWDINSYDQWGVELGKKLGKNILKAMNDDSSDEYQNLDDSTRQLIAKVKNK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         IDP02733 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   MET n 
1 5   LEU n 
1 6   PHE n 
1 7   CYS n 
1 8   ASP n 
1 9   ASP n 
1 10  SER n 
1 11  LYS n 
1 12  LYS n 
1 13  TYR n 
1 14  LEU n 
1 15  LYS n 
1 16  GLU n 
1 17  GLN n 
1 18  ASN n 
1 19  ILE n 
1 20  ASN n 
1 21  LEU n 
1 22  LYS n 
1 23  ASN n 
1 24  GLU n 
1 25  PHE n 
1 26  ASP n 
1 27  LYS n 
1 28  ASP n 
1 29  ASP n 
1 30  LYS n 
1 31  ARG n 
1 32  VAL n 
1 33  GLU n 
1 34  LYS n 
1 35  PHE n 
1 36  SER n 
1 37  LEU n 
1 38  LYS n 
1 39  HIS n 
1 40  GLN n 
1 41  ASN n 
1 42  ILE n 
1 43  TYR n 
1 44  PHE n 
1 45  ASP n 
1 46  TYR n 
1 47  SER n 
1 48  LYS n 
1 49  ASN n 
1 50  LEU n 
1 51  ILE n 
1 52  ASN n 
1 53  ASP n 
1 54  TYR n 
1 55  ILE n 
1 56  LEU n 
1 57  LYS n 
1 58  SER n 
1 59  LEU n 
1 60  LEU n 
1 61  GLU n 
1 62  SER n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  LYS n 
1 70  ASP n 
1 71  LYS n 
1 72  ILE n 
1 73  LYS n 
1 74  GLN n 
1 75  MET n 
1 76  PHE n 
1 77  ASN n 
1 78  GLY n 
1 79  ALA n 
1 80  LYS n 
1 81  ILE n 
1 82  ASN n 
1 83  SER n 
1 84  THR n 
1 85  GLU n 
1 86  HIS n 
1 87  ARG n 
1 88  ALA n 
1 89  VAL n 
1 90  LEU n 
1 91  HIS n 
1 92  THR n 
1 93  ALA n 
1 94  LEU n 
1 95  ARG n 
1 96  ASP n 
1 97  LEU n 
1 98  SER n 
1 99  SER n 
1 100 THR n 
1 101 PRO n 
1 102 LEU n 
1 103 ILE n 
1 104 VAL n 
1 105 ASP n 
1 106 GLY n 
1 107 GLN n 
1 108 ASP n 
1 109 ILE n 
1 110 ARG n 
1 111 GLN n 
1 112 GLU n 
1 113 VAL n 
1 114 THR n 
1 115 LYS n 
1 116 GLU n 
1 117 LYS n 
1 118 GLN n 
1 119 ARG n 
1 120 VAL n 
1 121 LYS n 
1 122 GLU n 
1 123 LEU n 
1 124 VAL n 
1 125 GLU n 
1 126 LYS n 
1 127 VAL n 
1 128 VAL n 
1 129 SER n 
1 130 GLY n 
1 131 ARG n 
1 132 TRP n 
1 133 ARG n 
1 134 GLY n 
1 135 PHE n 
1 136 SER n 
1 137 GLY n 
1 138 LYS n 
1 139 LYS n 
1 140 ILE n 
1 141 THR n 
1 142 ASP n 
1 143 ILE n 
1 144 VAL n 
1 145 ASN n 
1 146 ILE n 
1 147 GLY n 
1 148 ILE n 
1 149 GLY n 
1 150 GLY n 
1 151 SER n 
1 152 ASP n 
1 153 LEU n 
1 154 GLY n 
1 155 PRO n 
1 156 LYS n 
1 157 MET n 
1 158 VAL n 
1 159 VAL n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 GLN n 
1 164 PRO n 
1 165 TYR n 
1 166 HIS n 
1 167 CYS n 
1 168 THR n 
1 169 ASP n 
1 170 LEU n 
1 171 LYS n 
1 172 VAL n 
1 173 HIS n 
1 174 PHE n 
1 175 VAL n 
1 176 SER n 
1 177 ASN n 
1 178 VAL n 
1 179 ASP n 
1 180 ALA n 
1 181 ASP n 
1 182 SER n 
1 183 LEU n 
1 184 LEU n 
1 185 GLN n 
1 186 ALA n 
1 187 LEU n 
1 188 HIS n 
1 189 VAL n 
1 190 VAL n 
1 191 ASP n 
1 192 PRO n 
1 193 GLU n 
1 194 THR n 
1 195 THR n 
1 196 LEU n 
1 197 LEU n 
1 198 ILE n 
1 199 ILE n 
1 200 ALA n 
1 201 SER n 
1 202 LYS n 
1 203 SER n 
1 204 PHE n 
1 205 SER n 
1 206 THR n 
1 207 GLU n 
1 208 GLU n 
1 209 THR n 
1 210 LEU n 
1 211 LEU n 
1 212 ASN n 
1 213 SER n 
1 214 ILE n 
1 215 SER n 
1 216 ALA n 
1 217 ARG n 
1 218 GLU n 
1 219 TRP n 
1 220 LEU n 
1 221 LEU n 
1 222 ASP n 
1 223 HIS n 
1 224 TYR n 
1 225 GLU n 
1 226 ASP n 
1 227 GLU n 
1 228 LYS n 
1 229 ALA n 
1 230 VAL n 
1 231 ALA n 
1 232 ASN n 
1 233 HIS n 
1 234 PHE n 
1 235 VAL n 
1 236 ALA n 
1 237 ILE n 
1 238 SER n 
1 239 SER n 
1 240 LYS n 
1 241 LEU n 
1 242 ASP n 
1 243 LYS n 
1 244 VAL n 
1 245 LYS n 
1 246 GLU n 
1 247 PHE n 
1 248 GLY n 
1 249 ILE n 
1 250 ASP n 
1 251 LEU n 
1 252 GLU n 
1 253 HIS n 
1 254 CYS n 
1 255 TYR n 
1 256 LYS n 
1 257 MET n 
1 258 TRP n 
1 259 ASP n 
1 260 TRP n 
1 261 VAL n 
1 262 GLY n 
1 263 GLY n 
1 264 ARG n 
1 265 TYR n 
1 266 SER n 
1 267 LEU n 
1 268 TRP n 
1 269 SER n 
1 270 SER n 
1 271 ILE n 
1 272 GLY n 
1 273 MET n 
1 274 SER n 
1 275 ILE n 
1 276 ALA n 
1 277 PHE n 
1 278 ALA n 
1 279 ILE n 
1 280 GLY n 
1 281 TYR n 
1 282 ASP n 
1 283 ASN n 
1 284 PHE n 
1 285 GLU n 
1 286 LYS n 
1 287 LEU n 
1 288 LEU n 
1 289 ALA n 
1 290 GLY n 
1 291 ALA n 
1 292 TYR n 
1 293 SER n 
1 294 VAL n 
1 295 ASP n 
1 296 LYS n 
1 297 HIS n 
1 298 PHE n 
1 299 LYS n 
1 300 GLU n 
1 301 THR n 
1 302 GLU n 
1 303 PHE n 
1 304 SER n 
1 305 LYS n 
1 306 ASN n 
1 307 ILE n 
1 308 PRO n 
1 309 VAL n 
1 310 ILE n 
1 311 MET n 
1 312 ALA n 
1 313 LEU n 
1 314 LEU n 
1 315 ALA n 
1 316 SER n 
1 317 TYR n 
1 318 TYR n 
1 319 SER n 
1 320 CYS n 
1 321 THR n 
1 322 TYR n 
1 323 ASN n 
1 324 SER n 
1 325 GLN n 
1 326 SER n 
1 327 GLN n 
1 328 ALA n 
1 329 LEU n 
1 330 LEU n 
1 331 PRO n 
1 332 TYR n 
1 333 ASP n 
1 334 GLU n 
1 335 ARG n 
1 336 LEU n 
1 337 CYS n 
1 338 TYR n 
1 339 PHE n 
1 340 VAL n 
1 341 ASP n 
1 342 TYR n 
1 343 LEU n 
1 344 GLN n 
1 345 GLN n 
1 346 ALA n 
1 347 ASP n 
1 348 MET n 
1 349 GLU n 
1 350 SER n 
1 351 ASN n 
1 352 GLY n 
1 353 LYS n 
1 354 SER n 
1 355 VAL n 
1 356 ASN n 
1 357 ILE n 
1 358 ALA n 
1 359 GLY n 
1 360 GLU n 
1 361 THR n 
1 362 VAL n 
1 363 ASN n 
1 364 TYR n 
1 365 GLN n 
1 366 THR n 
1 367 GLY n 
1 368 VAL n 
1 369 VAL n 
1 370 LEU n 
1 371 TRP n 
1 372 GLY n 
1 373 GLY n 
1 374 VAL n 
1 375 GLY n 
1 376 THR n 
1 377 ASN n 
1 378 GLY n 
1 379 GLN n 
1 380 HIS n 
1 381 ALA n 
1 382 PHE n 
1 383 HIS n 
1 384 GLN n 
1 385 LEU n 
1 386 LEU n 
1 387 HIS n 
1 388 GLN n 
1 389 GLY n 
1 390 ASN n 
1 391 ILE n 
1 392 PHE n 
1 393 ILE n 
1 394 PRO n 
1 395 VAL n 
1 396 ASP n 
1 397 PHE n 
1 398 ILE n 
1 399 ALA n 
1 400 ILE n 
1 401 ALA n 
1 402 THR n 
1 403 SER n 
1 404 HIS n 
1 405 HIS n 
1 406 ASN n 
1 407 TYR n 
1 408 ASP n 
1 409 ASN n 
1 410 HIS n 
1 411 GLN n 
1 412 GLN n 
1 413 ALA n 
1 414 LEU n 
1 415 LEU n 
1 416 ALA n 
1 417 ASN n 
1 418 CYS n 
1 419 PHE n 
1 420 ALA n 
1 421 GLN n 
1 422 SER n 
1 423 GLN n 
1 424 ALA n 
1 425 LEU n 
1 426 MET n 
1 427 PHE n 
1 428 GLY n 
1 429 GLN n 
1 430 SER n 
1 431 TYR n 
1 432 ASP n 
1 433 MET n 
1 434 VAL n 
1 435 TYR n 
1 436 ASN n 
1 437 GLU n 
1 438 LEU n 
1 439 LEU n 
1 440 LYS n 
1 441 SER n 
1 442 GLY n 
1 443 LEU n 
1 444 ASN n 
1 445 GLU n 
1 446 THR n 
1 447 GLN n 
1 448 ALA n 
1 449 LYS n 
1 450 GLU n 
1 451 LEU n 
1 452 ALA n 
1 453 ALA n 
1 454 HIS n 
1 455 LYS n 
1 456 VAL n 
1 457 ILE n 
1 458 PRO n 
1 459 GLY n 
1 460 ASN n 
1 461 ARG n 
1 462 PRO n 
1 463 SER n 
1 464 THR n 
1 465 THR n 
1 466 ILE n 
1 467 LEU n 
1 468 LEU n 
1 469 ASP n 
1 470 GLU n 
1 471 LEU n 
1 472 SER n 
1 473 PRO n 
1 474 TYR n 
1 475 SER n 
1 476 LEU n 
1 477 GLY n 
1 478 ALA n 
1 479 LEU n 
1 480 ILE n 
1 481 ALA n 
1 482 LEU n 
1 483 TYR n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 ILE n 
1 488 PHE n 
1 489 VAL n 
1 490 GLN n 
1 491 GLY n 
1 492 VAL n 
1 493 LEU n 
1 494 TRP n 
1 495 ASP n 
1 496 ILE n 
1 497 ASN n 
1 498 SER n 
1 499 TYR n 
1 500 ASP n 
1 501 GLN n 
1 502 TRP n 
1 503 GLY n 
1 504 VAL n 
1 505 GLU n 
1 506 LEU n 
1 507 GLY n 
1 508 LYS n 
1 509 LYS n 
1 510 LEU n 
1 511 GLY n 
1 512 LYS n 
1 513 ASN n 
1 514 ILE n 
1 515 LEU n 
1 516 LYS n 
1 517 ALA n 
1 518 MET n 
1 519 ASN n 
1 520 ASP n 
1 521 ASP n 
1 522 SER n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 TYR n 
1 527 GLN n 
1 528 ASN n 
1 529 LEU n 
1 530 ASP n 
1 531 ASP n 
1 532 SER n 
1 533 THR n 
1 534 ARG n 
1 535 GLN n 
1 536 LEU n 
1 537 ILE n 
1 538 ALA n 
1 539 LYS n 
1 540 VAL n 
1 541 LYS n 
1 542 ASN n 
1 543 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FTT_1315c, pgi' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'SCHU S4' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Francisella tularensis subsp. tularensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     177416 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_FRATT 
_struct_ref.pdbx_db_accession          Q5NFC4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLFCDDSKKYLKEQNINLKNEFDKDDKRVEKFSLKHQNIYFDYSKNLINDYILKSLLESAEKSSLKDKIKQMFNGAKINS
TEHRAVLHTALRDLSSTPLIVDGQDIRQEVTKEKQRVKELVEKVVSGRWRGFSGKKITDIVNIGIGGSDLGPKMVVRALQ
PYHCTDLKVHFVSNVDADSLLQALHVVDPETTLFIIASKSFSTEETLLNSISAREWLLDHYEDEKAVANHFVAISSKLDK
VKEFGIDLEHCYKMWDWVGGRYSLWSSIGMSIAFAIGYDNFEKLLAGAYSVDKHFKETEFSKNIPVIMALLASYYSCTYN
SQSQALLPYDERLCYFVDYLQQADMESNGKSVNIAGETVNYQTGVVLWGGVGTNGQHAFHQLLHQGNIFIPVDFIAIATS
HHNYDNHQQALLANCFAQSQALMFGQSYDMVYNELLKSGLNETQAKELAAHKVIPGNRPSTTILLDELSPYSLGALIALY
EHKIFVQGVLWDINSYDQWGVELGKKLGKNILKAMNDDSSDEYQNLDDSTRQLIAKVKNK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3Q7I 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5NFC4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  540 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       540 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3Q7I SER A 1   ? UNP Q5NFC4 ?   ?   'EXPRESSION TAG'      -2  1 
1 3Q7I ASN A 2   ? UNP Q5NFC4 ?   ?   'EXPRESSION TAG'      -1  2 
1 3Q7I ALA A 3   ? UNP Q5NFC4 ?   ?   'EXPRESSION TAG'      0   3 
1 3Q7I LEU A 197 ? UNP Q5NFC4 PHE 194 'engineered mutation' 194 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6PG D-saccharide        . '6-PHOSPHOGLUCONIC ACID'               ?          'C6 H13 O10 P'   276.135 
ALA 'L-peptide linking' y ALANINE                                ?          'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?          'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?          'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?          'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                          ?          'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                               ?          'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?          'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?          'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?          'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?          'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ?          'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?          'C6 H13 N O2'    131.173 
IPA non-polymer         . 'ISOPROPYL ALCOHOL'                    2-PROPANOL 'C3 H8 O'        60.095  
LEU 'L-peptide linking' y LEUCINE                                ?          'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?          'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?          'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ?          'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?          'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                        ?          'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE                                ?          'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?          'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?          'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?          'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?          'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ?          'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3Q7I 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    
;0.2 M Ca(OAc)2, 0.1 M MES buffer, 10% 2-propanol, 0.01 M 6-phosphogluconic acid., pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-03-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3Q7I 
_reflns.d_resolution_high            1.540 
_reflns.d_resolution_low             37.5 
_reflns.number_obs                   93541 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_netI_over_sigmaI        11.300 
_reflns.pdbx_chi_squared             1.070 
_reflns.pdbx_redundancy              10.000 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   93541 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        28.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.540 1.570  ? ? ? 0.794 2.15 ? 0.988 5.600  ? 4616 100.000 ? 1  
1.570 1.600  ? ? ? 0.660 ?    ? 1.048 6.500  ? 4629 100.000 ? 2  
1.600 1.630  ? ? ? 0.569 ?    ? 1.022 7.600  ? 4621 100.000 ? 3  
1.630 1.660  ? ? ? 0.480 ?    ? 1.059 9.300  ? 4639 100.000 ? 4  
1.660 1.690  ? ? ? 0.385 ?    ? 1.084 10.500 ? 4654 100.000 ? 5  
1.690 1.730  ? ? ? 0.324 ?    ? 1.110 10.500 ? 4662 100.000 ? 6  
1.730 1.780  ? ? ? 0.281 ?    ? 1.150 10.600 ? 4624 100.000 ? 7  
1.780 1.830  ? ? ? 0.233 ?    ? 1.147 10.600 ? 4657 100.000 ? 8  
1.830 1.880  ? ? ? 0.190 ?    ? 1.197 10.700 ? 4657 100.000 ? 9  
1.880 1.940  ? ? ? 0.162 ?    ? 1.202 10.700 ? 4655 100.000 ? 10 
1.940 2.010  ? ? ? 0.134 ?    ? 1.207 10.800 ? 4678 100.000 ? 11 
2.010 2.090  ? ? ? 0.115 ?    ? 1.212 10.900 ? 4649 100.000 ? 12 
2.090 2.190  ? ? ? 0.099 ?    ? 1.221 10.900 ? 4674 100.000 ? 13 
2.190 2.300  ? ? ? 0.087 ?    ? 1.204 10.900 ? 4661 100.000 ? 14 
2.300 2.440  ? ? ? 0.080 ?    ? 1.034 11.000 ? 4693 100.000 ? 15 
2.440 2.630  ? ? ? 0.073 ?    ? 0.988 10.900 ? 4697 100.000 ? 16 
2.630 2.900  ? ? ? 0.069 ?    ? 0.924 10.900 ? 4721 100.000 ? 17 
2.900 3.320  ? ? ? 0.069 ?    ? 1.051 10.800 ? 4702 100.000 ? 18 
3.320 4.180  ? ? ? 0.048 ?    ? 0.852 10.600 ? 4780 100.000 ? 19 
4.180 50.000 ? ? ? 0.026 ?    ? 0.641 10.400 ? 4872 98.900  ? 20 
# 
_refine.entry_id                                 3Q7I 
_refine.ls_d_res_high                            1.5400 
_refine.ls_d_res_low                             37.4600 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.5400 
_refine.ls_number_reflns_obs                     93350 
_refine.ls_number_reflns_all                     93350 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          0.1458 
_refine.ls_R_factor_obs                          0.1458 
_refine.ls_R_factor_R_work                       0.1445 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1707 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  4684 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               24.138 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.7200 
_refine.aniso_B[2][2]                            -0.7200 
_refine.aniso_B[3][3]                            1.0900 
_refine.aniso_B[1][2]                            -0.3600 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9760 
_refine.correlation_coeff_Fo_to_Fc_free          0.9690 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.0650 
_refine.overall_SU_ML                            0.0360 
_refine.overall_SU_B                             2.2280 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 3LJK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                54.080 
_refine.B_iso_min                                2.160 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.250 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4312 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             528 
_refine_hist.number_atoms_total               4891 
_refine_hist.d_res_high                       1.5400 
_refine_hist.d_res_low                        37.4600 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       4869 0.019  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         3325 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    6650 1.853  1.966  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      8249 1.018  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 648  5.885  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 237  37.194 25.781 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 936  13.926 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14   17.804 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         733  0.115  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   5467 0.010  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     931  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2898 0.993  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         1182 0.321  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4724 1.698  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            1971 2.720  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           1875 4.422  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.5420 
_refine_ls_shell.d_res_low                        1.5820 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.3300 
_refine_ls_shell.number_reflns_R_work             6267 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3090 
_refine_ls_shell.R_factor_R_free                  0.3130 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             343 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6610 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3Q7I 
_struct.title                     
'Glucose-6-phosphate isomerase from Francisella tularensis complexed with 6-phosphogluconic acid.' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3Q7I 
_struct_keywords.text            
;STRUCTURAL GENOMICS, GLUCOSE-6-PHOSPHATE, ISOMERASE, FRUCTOSE-6-PHOSPHATE, GLUCONEOGENESIS, GLYCOLYSIS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID
;
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? TYR A 13  ? ASP A 5   TYR A 10  1 ? 6  
HELX_P HELX_P2  2  LEU A 14  ? ASN A 18  ? LEU A 11  ASN A 15  5 ? 5  
HELX_P HELX_P3  3  ASN A 20  ? ASP A 28  ? ASN A 17  ASP A 25  1 ? 9  
HELX_P HELX_P4  4  LYS A 30  ? PHE A 35  ? LYS A 27  PHE A 32  1 ? 6  
HELX_P HELX_P5  5  ASN A 52  ? SER A 66  ? ASN A 49  SER A 63  1 ? 15 
HELX_P HELX_P6  6  SER A 67  ? GLY A 78  ? SER A 64  GLY A 75  1 ? 12 
HELX_P HELX_P7  7  LEU A 90  ? ARG A 95  ? LEU A 87  ARG A 92  1 ? 6  
HELX_P HELX_P8  8  ILE A 109 ? SER A 129 ? ILE A 106 SER A 126 1 ? 21 
HELX_P HELX_P9  9  ILE A 148 ? SER A 151 ? ILE A 145 SER A 148 5 ? 4  
HELX_P HELX_P10 10 ASP A 152 ? LEU A 162 ? ASP A 149 LEU A 159 1 ? 11 
HELX_P HELX_P11 11 GLN A 163 ? HIS A 166 ? GLN A 160 HIS A 163 5 ? 4  
HELX_P HELX_P12 12 ASP A 179 ? HIS A 188 ? ASP A 176 HIS A 185 1 ? 10 
HELX_P HELX_P13 13 VAL A 189 ? VAL A 190 ? VAL A 186 VAL A 187 5 ? 2  
HELX_P HELX_P14 14 ASP A 191 ? GLU A 193 ? ASP A 188 GLU A 190 5 ? 3  
HELX_P HELX_P15 15 THR A 206 ? GLU A 225 ? THR A 203 GLU A 222 1 ? 20 
HELX_P HELX_P16 16 ASP A 226 ? LYS A 228 ? ASP A 223 LYS A 225 5 ? 3  
HELX_P HELX_P17 17 ALA A 229 ? HIS A 233 ? ALA A 226 HIS A 230 1 ? 5  
HELX_P HELX_P18 18 LYS A 240 ? GLY A 248 ? LYS A 237 GLY A 245 1 ? 9  
HELX_P HELX_P19 19 ASP A 250 ? GLU A 252 ? ASP A 247 GLU A 249 5 ? 3  
HELX_P HELX_P20 20 GLY A 262 ? SER A 266 ? GLY A 259 SER A 263 5 ? 5  
HELX_P HELX_P21 21 SER A 269 ? ILE A 271 ? SER A 266 ILE A 268 5 ? 3  
HELX_P HELX_P22 22 GLY A 272 ? GLY A 280 ? GLY A 269 GLY A 277 1 ? 9  
HELX_P HELX_P23 23 GLY A 280 ? THR A 301 ? GLY A 277 THR A 298 1 ? 22 
HELX_P HELX_P24 24 GLU A 302 ? LYS A 305 ? GLU A 299 LYS A 302 5 ? 4  
HELX_P HELX_P25 25 ASN A 306 ? TYR A 322 ? ASN A 303 TYR A 319 1 ? 17 
HELX_P HELX_P26 26 ASP A 333 ? CYS A 337 ? ASP A 330 CYS A 334 5 ? 5  
HELX_P HELX_P27 27 TYR A 338 ? GLY A 352 ? TYR A 335 GLY A 349 1 ? 15 
HELX_P HELX_P28 28 THR A 376 ? ALA A 381 ? THR A 373 ALA A 378 5 ? 6  
HELX_P HELX_P29 29 PHE A 382 ? GLY A 389 ? PHE A 379 GLY A 386 1 ? 8  
HELX_P HELX_P30 30 TYR A 407 ? GLY A 428 ? TYR A 404 GLY A 425 1 ? 22 
HELX_P HELX_P31 31 SER A 430 ? SER A 441 ? SER A 427 SER A 438 1 ? 12 
HELX_P HELX_P32 32 ASN A 444 ? VAL A 456 ? ASN A 441 VAL A 453 1 ? 13 
HELX_P HELX_P33 33 SER A 472 ? ASP A 495 ? SER A 469 ASP A 492 1 ? 24 
HELX_P HELX_P34 34 GLN A 501 ? LYS A 508 ? GLN A 498 LYS A 505 1 ? 8  
HELX_P HELX_P35 35 GLY A 511 ? ASP A 520 ? GLY A 508 ASP A 517 1 ? 10 
HELX_P HELX_P36 36 SER A 523 ? ASN A 528 ? SER A 520 ASN A 525 1 ? 6  
HELX_P HELX_P37 37 ASP A 530 ? VAL A 540 ? ASP A 527 VAL A 537 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG A ? ? 1_555 A CYS 320 SG ? ? A CYS 4   A CYS 317 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc1 metalc ? ? A GLU 64 O  ? ? ? 1_555 G CA  .   CA ? ? A GLU 61  A CA  606 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc2 metalc ? ? G CA  .  CA ? ? ? 1_555 H HOH .   O  ? ? A CA  606 A HOH 574 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc3 metalc ? ? G CA  .  CA ? ? ? 1_555 H HOH .   O  ? ? A CA  606 A HOH 573 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc4 metalc ? ? G CA  .  CA ? ? ? 1_555 H HOH .   O  ? ? A CA  606 A HOH 592 1_555 ? ? ? ? ? ? ? 2.465 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           375 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            372 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   THR 
_struct_mon_prot_cis.pdbx_label_seq_id_2    376 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    THR 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     373 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       12.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 36  ? HIS A 39  ? SER A 33  HIS A 36  
A 2 ILE A 42  ? LYS A 48  ? ILE A 39  LYS A 45  
A 3 SER A 463 ? LEU A 468 ? SER A 460 LEU A 465 
A 4 VAL A 395 ? ILE A 400 ? VAL A 392 ILE A 397 
A 5 SER A 326 ? PRO A 331 ? SER A 323 PRO A 328 
A 6 VAL A 369 ? GLY A 372 ? VAL A 366 GLY A 369 
B 1 ILE A 103 ? VAL A 104 ? ILE A 100 VAL A 101 
B 2 GLN A 107 ? ASP A 108 ? GLN A 104 ASP A 105 
C 1 LYS A 171 ? VAL A 175 ? LYS A 168 VAL A 172 
C 2 ASP A 142 ? ILE A 146 ? ASP A 139 ILE A 143 
C 3 THR A 195 ? ALA A 200 ? THR A 192 ALA A 197 
C 4 PHE A 234 ? SER A 238 ? PHE A 231 SER A 235 
C 5 CYS A 254 ? LYS A 256 ? CYS A 251 LYS A 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 37  ? N LEU A 34  O PHE A 44  ? O PHE A 41  
A 2 3 N TYR A 43  ? N TYR A 40  O LEU A 467 ? O LEU A 464 
A 3 4 O ILE A 466 ? O ILE A 463 N PHE A 397 ? N PHE A 394 
A 4 5 O ASP A 396 ? O ASP A 393 N LEU A 330 ? N LEU A 327 
A 5 6 N GLN A 327 ? N GLN A 324 O VAL A 369 ? O VAL A 366 
B 1 2 N VAL A 104 ? N VAL A 101 O GLN A 107 ? O GLN A 104 
C 1 2 O HIS A 173 ? O HIS A 170 N ASN A 145 ? N ASN A 142 
C 2 3 N VAL A 144 ? N VAL A 141 O ILE A 198 ? O ILE A 195 
C 3 4 N ILE A 199 ? N ILE A 196 O VAL A 235 ? O VAL A 232 
C 4 5 N ALA A 236 ? N ALA A 233 O TYR A 255 ? O TYR A 252 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 6PG A 601' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MES A 602' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MES A 603' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PO4 A 604' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE IPA A 605' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 606'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ILE A 148 ? ILE A 145  . ? 1_555 ? 
2  AC1 22 GLY A 149 ? GLY A 146  . ? 1_555 ? 
3  AC1 22 GLY A 150 ? GLY A 147  . ? 1_555 ? 
4  AC1 22 SER A 151 ? SER A 148  . ? 1_555 ? 
5  AC1 22 SER A 201 ? SER A 198  . ? 1_555 ? 
6  AC1 22 LYS A 202 ? LYS A 199  . ? 1_555 ? 
7  AC1 22 SER A 203 ? SER A 200  . ? 1_555 ? 
8  AC1 22 THR A 206 ? THR A 203  . ? 1_555 ? 
9  AC1 22 GLY A 263 ? GLY A 260  . ? 1_555 ? 
10 AC1 22 ARG A 264 ? ARG A 261  . ? 1_555 ? 
11 AC1 22 GLN A 345 ? GLN A 342  . ? 1_555 ? 
12 AC1 22 GLU A 349 ? GLU A 346  . ? 1_555 ? 
13 AC1 22 HIS A 380 ? HIS A 377  . ? 4_555 ? 
14 AC1 22 GLN A 501 ? GLN A 498  . ? 1_555 ? 
15 AC1 22 LYS A 508 ? LYS A 505  . ? 1_555 ? 
16 AC1 22 HOH H .   ? HOH A 567  . ? 1_555 ? 
17 AC1 22 HOH H .   ? HOH A 626  . ? 1_555 ? 
18 AC1 22 HOH H .   ? HOH A 661  . ? 1_555 ? 
19 AC1 22 HOH H .   ? HOH A 816  . ? 1_555 ? 
20 AC1 22 HOH H .   ? HOH A 922  . ? 1_555 ? 
21 AC1 22 HOH H .   ? HOH A 923  . ? 1_555 ? 
22 AC1 22 HOH H .   ? HOH A 978  . ? 1_555 ? 
23 AC2 8  ASN A 77  ? ASN A 74   . ? 1_555 ? 
24 AC2 8  PRO A 101 ? PRO A 98   . ? 1_555 ? 
25 AC2 8  LEU A 102 ? LEU A 99   . ? 1_555 ? 
26 AC2 8  ILE A 103 ? ILE A 100  . ? 1_555 ? 
27 AC2 8  HIS A 404 ? HIS A 401  . ? 3_665 ? 
28 AC2 8  HIS A 405 ? HIS A 402  . ? 3_665 ? 
29 AC2 8  ASN A 406 ? ASN A 403  . ? 3_665 ? 
30 AC2 8  HOH H .   ? HOH A 998  . ? 1_555 ? 
31 AC3 8  GLN A 163 ? GLN A 160  . ? 1_555 ? 
32 AC3 8  PRO A 164 ? PRO A 161  . ? 1_555 ? 
33 AC3 8  HIS A 166 ? HIS A 163  . ? 1_555 ? 
34 AC3 8  GLN A 185 ? GLN A 182  . ? 4_555 ? 
35 AC3 8  HIS A 188 ? HIS A 185  . ? 4_555 ? 
36 AC3 8  HIS A 404 ? HIS A 401  . ? 1_555 ? 
37 AC3 8  HOH H .   ? HOH A 621  . ? 4_555 ? 
38 AC3 8  HOH H .   ? HOH A 874  . ? 1_555 ? 
39 AC4 6  ASN A 41  ? ASN A 38   . ? 1_555 ? 
40 AC4 6  TYR A 43  ? TYR A 40   . ? 1_555 ? 
41 AC4 6  LEU A 467 ? LEU A 464  . ? 1_555 ? 
42 AC4 6  ASP A 469 ? ASP A 466  . ? 1_555 ? 
43 AC4 6  LYS A 539 ? LYS A 536  . ? 4_555 ? 
44 AC4 6  HOH H .   ? HOH A 1032 . ? 1_555 ? 
45 AC5 7  HIS A 39  ? HIS A 36   . ? 1_555 ? 
46 AC5 7  GLN A 40  ? GLN A 37   . ? 1_555 ? 
47 AC5 7  ASN A 41  ? ASN A 38   . ? 1_555 ? 
48 AC5 7  TYR A 474 ? TYR A 471  . ? 1_555 ? 
49 AC5 7  SER A 475 ? SER A 472  . ? 1_555 ? 
50 AC5 7  ALA A 478 ? ALA A 475  . ? 1_555 ? 
51 AC5 7  HOH H .   ? HOH A 800  . ? 1_555 ? 
52 AC6 6  GLU A 64  ? GLU A 61   . ? 1_555 ? 
53 AC6 6  GLU A 225 ? GLU A 222  . ? 5_665 ? 
54 AC6 6  HOH H .   ? HOH A 573  . ? 1_555 ? 
55 AC6 6  HOH H .   ? HOH A 574  . ? 1_555 ? 
56 AC6 6  HOH H .   ? HOH A 592  . ? 1_555 ? 
57 AC6 6  HOH H .   ? HOH A 982  . ? 5_665 ? 
# 
_atom_sites.entry_id                    3Q7I 
_atom_sites.fract_transf_matrix[1][1]   0.008738 
_atom_sites.fract_transf_matrix[1][2]   0.005045 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010090 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011860 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 2   ? 69.182 74.758 13.419  1.00 48.00 ? -1   ASN A N   1 
ATOM   2    C  CA  A ASN A 1 2   ? 70.175 75.075 12.346  0.60 48.35 ? -1   ASN A CA  1 
ATOM   3    C  CA  B ASN A 1 2   ? 70.149 75.114 12.330  0.40 47.95 ? -1   ASN A CA  1 
ATOM   4    C  C   . ASN A 1 2   ? 69.965 74.217 11.099  1.00 46.98 ? -1   ASN A C   1 
ATOM   5    O  O   . ASN A 1 2   ? 70.869 74.071 10.263  1.00 47.12 ? -1   ASN A O   1 
ATOM   6    C  CB  A ASN A 1 2   ? 71.632 74.957 12.866  0.60 49.94 ? -1   ASN A CB  1 
ATOM   7    C  CB  B ASN A 1 2   ? 71.594 75.028 12.850  0.40 49.20 ? -1   ASN A CB  1 
ATOM   8    C  CG  A ASN A 1 2   ? 72.013 73.539 13.338  0.60 50.43 ? -1   ASN A CG  1 
ATOM   9    C  CG  B ASN A 1 2   ? 72.532 76.009 12.157  0.40 50.27 ? -1   ASN A CG  1 
ATOM   10   O  OD1 A ASN A 1 2   ? 73.067 73.352 13.954  0.60 54.62 ? -1   ASN A OD1 1 
ATOM   11   O  OD1 B ASN A 1 2   ? 73.195 76.813 12.810  0.40 51.67 ? -1   ASN A OD1 1 
ATOM   12   N  ND2 A ASN A 1 2   ? 71.184 72.559 13.048  0.60 52.58 ? -1   ASN A ND2 1 
ATOM   13   N  ND2 B ASN A 1 2   ? 72.584 75.948 10.829  0.40 49.73 ? -1   ASN A ND2 1 
ATOM   14   N  N   . ALA A 1 3   ? 68.776 73.627 10.970  1.00 43.82 ? 0    ALA A N   1 
ATOM   15   C  CA  . ALA A 1 3   ? 68.499 72.834 9.801   1.00 41.83 ? 0    ALA A CA  1 
ATOM   16   C  C   . ALA A 1 3   ? 68.439 73.764 8.586   1.00 40.30 ? 0    ALA A C   1 
ATOM   17   O  O   . ALA A 1 3   ? 68.144 74.963 8.716   1.00 41.80 ? 0    ALA A O   1 
ATOM   18   C  CB  . ALA A 1 3   ? 67.161 72.064 9.949   1.00 40.45 ? 0    ALA A CB  1 
ATOM   19   N  N   . MET A 1 4   ? 68.751 73.205 7.420   1.00 36.60 ? 1    MET A N   1 
ATOM   20   C  CA  . MET A 1 4   ? 68.554 73.886 6.158   1.00 35.21 ? 1    MET A CA  1 
ATOM   21   C  C   . MET A 1 4   ? 67.099 74.352 5.999   1.00 32.69 ? 1    MET A C   1 
ATOM   22   O  O   . MET A 1 4   ? 66.144 73.600 6.272   1.00 32.30 ? 1    MET A O   1 
ATOM   23   C  CB  . MET A 1 4   ? 68.930 72.959 5.011   1.00 33.92 ? 1    MET A CB  1 
ATOM   24   C  CG  . MET A 1 4   ? 68.823 73.620 3.634   1.00 37.22 ? 1    MET A CG  1 
ATOM   25   S  SD  . MET A 1 4   ? 68.636 72.406 2.323   1.00 36.90 ? 1    MET A SD  1 
ATOM   26   C  CE  . MET A 1 4   ? 66.832 72.143 2.269   1.00 34.26 ? 1    MET A CE  1 
ATOM   27   N  N   . LEU A 1 5   ? 66.922 75.585 5.537   1.00 31.92 ? 2    LEU A N   1 
ATOM   28   C  CA  . LEU A 1 5   ? 65.589 76.129 5.270   1.00 30.09 ? 2    LEU A CA  1 
ATOM   29   C  C   . LEU A 1 5   ? 65.181 75.789 3.839   1.00 29.60 ? 2    LEU A C   1 
ATOM   30   O  O   . LEU A 1 5   ? 65.823 76.217 2.898   1.00 30.89 ? 2    LEU A O   1 
ATOM   31   C  CB  . LEU A 1 5   ? 65.613 77.670 5.436   1.00 30.98 ? 2    LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 5   ? 64.318 78.398 5.073   1.00 30.44 ? 2    LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 5   ? 63.149 78.023 5.991   1.00 29.83 ? 2    LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 5   ? 64.481 79.942 5.097   1.00 33.11 ? 2    LEU A CD2 1 
ATOM   35   N  N   . PHE A 1 6   ? 64.092 75.017 3.668   1.00 28.28 ? 3    PHE A N   1 
ATOM   36   C  CA  . PHE A 1 6   ? 63.660 74.648 2.350   1.00 27.44 ? 3    PHE A CA  1 
ATOM   37   C  C   . PHE A 1 6   ? 62.964 75.824 1.647   1.00 29.50 ? 3    PHE A C   1 
ATOM   38   O  O   . PHE A 1 6   ? 63.330 76.158 0.527   1.00 28.65 ? 3    PHE A O   1 
ATOM   39   C  CB  . PHE A 1 6   ? 62.697 73.447 2.363   1.00 26.89 ? 3    PHE A CB  1 
ATOM   40   C  CG  . PHE A 1 6   ? 62.144 73.132 0.985   1.00 25.00 ? 3    PHE A CG  1 
ATOM   41   C  CD1 . PHE A 1 6   ? 60.894 73.611 0.580   1.00 26.27 ? 3    PHE A CD1 1 
ATOM   42   C  CD2 . PHE A 1 6   ? 62.900 72.413 0.091   1.00 26.54 ? 3    PHE A CD2 1 
ATOM   43   C  CE1 . PHE A 1 6   ? 60.435 73.380 -0.690  1.00 26.16 ? 3    PHE A CE1 1 
ATOM   44   C  CE2 . PHE A 1 6   ? 62.456 72.175 -1.199  1.00 26.65 ? 3    PHE A CE2 1 
ATOM   45   C  CZ  . PHE A 1 6   ? 61.194 72.641 -1.596  1.00 25.25 ? 3    PHE A CZ  1 
ATOM   46   N  N   . CYS A 1 7   ? 61.994 76.436 2.322   1.00 30.62 ? 4    CYS A N   1 
ATOM   47   C  CA  A CYS A 1 7   ? 61.225 77.525 1.719   0.75 31.29 ? 4    CYS A CA  1 
ATOM   48   C  CA  B CYS A 1 7   ? 61.208 77.549 1.801   0.25 32.08 ? 4    CYS A CA  1 
ATOM   49   C  C   . CYS A 1 7   ? 61.946 78.848 1.983   1.00 33.81 ? 4    CYS A C   1 
ATOM   50   O  O   . CYS A 1 7   ? 61.623 79.612 2.904   1.00 34.00 ? 4    CYS A O   1 
ATOM   51   C  CB  A CYS A 1 7   ? 59.787 77.531 2.217   0.75 30.43 ? 4    CYS A CB  1 
ATOM   52   C  CB  B CYS A 1 7   ? 59.908 77.666 2.583   0.25 31.53 ? 4    CYS A CB  1 
ATOM   53   S  SG  A CYS A 1 7   ? 58.711 78.713 1.279   0.75 29.65 ? 4    CYS A SG  1 
ATOM   54   S  SG  B CYS A 1 7   ? 58.988 76.181 2.623   0.25 33.18 ? 4    CYS A SG  1 
ATOM   55   N  N   . ASP A 1 8   ? 62.936 79.096 1.130   1.00 35.27 ? 5    ASP A N   1 
ATOM   56   C  CA  . ASP A 1 8   ? 63.779 80.267 1.283   1.00 37.17 ? 5    ASP A CA  1 
ATOM   57   C  C   . ASP A 1 8   ? 63.588 81.226 0.116   1.00 38.57 ? 5    ASP A C   1 
ATOM   58   O  O   . ASP A 1 8   ? 62.749 81.008 -0.750  1.00 38.19 ? 5    ASP A O   1 
ATOM   59   C  CB  . ASP A 1 8   ? 65.238 79.840 1.500   1.00 38.51 ? 5    ASP A CB  1 
ATOM   60   C  CG  . ASP A 1 8   ? 65.881 79.143 0.283   1.00 40.33 ? 5    ASP A CG  1 
ATOM   61   O  OD1 . ASP A 1 8   ? 65.262 78.973 -0.781  1.00 41.03 ? 5    ASP A OD1 1 
ATOM   62   O  OD2 . ASP A 1 8   ? 67.074 78.778 0.410   1.00 43.64 ? 5    ASP A OD2 1 
ATOM   63   N  N   . ASP A 1 9   ? 64.351 82.326 0.115   1.00 41.16 ? 6    ASP A N   1 
ATOM   64   C  CA  . ASP A 1 9   ? 64.200 83.329 -0.971  1.00 43.53 ? 6    ASP A CA  1 
ATOM   65   C  C   . ASP A 1 9   ? 64.467 82.767 -2.354  1.00 42.90 ? 6    ASP A C   1 
ATOM   66   O  O   . ASP A 1 9   ? 63.778 83.122 -3.314  1.00 43.78 ? 6    ASP A O   1 
ATOM   67   C  CB  . ASP A 1 9   ? 65.177 84.490 -0.782  1.00 45.48 ? 6    ASP A CB  1 
ATOM   68   C  CG  . ASP A 1 9   ? 64.727 85.500 0.270   1.00 50.25 ? 6    ASP A CG  1 
ATOM   69   O  OD1 . ASP A 1 9   ? 63.621 85.354 0.843   1.00 52.49 ? 6    ASP A OD1 1 
ATOM   70   O  OD2 . ASP A 1 9   ? 65.518 86.456 0.521   1.00 55.12 ? 6    ASP A OD2 1 
ATOM   71   N  N   . SER A 1 10  ? 65.475 81.915 -2.444  1.00 44.34 ? 7    SER A N   1 
ATOM   72   C  CA  . SER A 1 10  ? 65.854 81.224 -3.676  1.00 45.87 ? 7    SER A CA  1 
ATOM   73   C  C   . SER A 1 10  ? 64.668 80.489 -4.342  1.00 45.59 ? 7    SER A C   1 
ATOM   74   O  O   . SER A 1 10  ? 64.488 80.581 -5.563  1.00 44.88 ? 7    SER A O   1 
ATOM   75   C  CB  . SER A 1 10  ? 67.030 80.280 -3.376  1.00 46.80 ? 7    SER A CB  1 
ATOM   76   O  OG  . SER A 1 10  ? 66.989 79.064 -4.107  1.00 49.66 ? 7    SER A OG  1 
ATOM   77   N  N   . LYS A 1 11  ? 63.844 79.805 -3.544  1.00 45.27 ? 8    LYS A N   1 
ATOM   78   C  CA  . LYS A 1 11  ? 62.677 79.076 -4.095  1.00 45.88 ? 8    LYS A CA  1 
ATOM   79   C  C   . LYS A 1 11  ? 61.642 80.026 -4.639  1.00 47.80 ? 8    LYS A C   1 
ATOM   80   O  O   . LYS A 1 11  ? 61.154 79.850 -5.784  1.00 48.05 ? 8    LYS A O   1 
ATOM   81   C  CB  . LYS A 1 11  ? 61.956 78.229 -3.034  1.00 44.80 ? 8    LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 11  ? 62.752 77.161 -2.412  1.00 46.38 ? 8    LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 11  ? 63.330 76.142 -3.376  1.00 47.25 ? 8    LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 11  ? 64.539 75.425 -2.731  1.00 49.25 ? 8    LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 11  ? 65.754 75.581 -3.585  1.00 51.48 ? 8    LYS A NZ  1 
ATOM   86   N  N   . LYS A 1 12  ? 61.313 81.027 -3.808  1.00 49.05 ? 9    LYS A N   1 
ATOM   87   C  CA  . LYS A 1 12  ? 60.304 82.019 -4.156  1.00 49.65 ? 9    LYS A CA  1 
ATOM   88   C  C   . LYS A 1 12  ? 60.571 82.583 -5.561  1.00 49.42 ? 9    LYS A C   1 
ATOM   89   O  O   . LYS A 1 12  ? 59.617 82.825 -6.295  1.00 50.22 ? 9    LYS A O   1 
ATOM   90   C  CB  . LYS A 1 12  ? 60.189 83.118 -3.072  1.00 50.57 ? 9    LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 12  ? 59.787 82.606 -1.650  1.00 51.79 ? 9    LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 12  ? 58.335 82.095 -1.589  1.00 51.44 ? 9    LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 12  ? 57.782 82.032 -0.153  1.00 50.25 ? 9    LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 12  ? 56.291 81.870 -0.089  1.00 48.53 ? 9    LYS A NZ  1 
ATOM   95   N  N   A TYR A 1 13  ? 61.862 82.741 -5.908  0.60 49.86 ? 10   TYR A N   1 
ATOM   96   N  N   B TYR A 1 13  ? 61.836 82.729 -5.938  0.40 49.77 ? 10   TYR A N   1 
ATOM   97   C  CA  A TYR A 1 13  ? 62.372 83.251 -7.216  0.60 49.51 ? 10   TYR A CA  1 
ATOM   98   C  CA  B TYR A 1 13  ? 62.200 83.306 -7.227  0.40 49.56 ? 10   TYR A CA  1 
ATOM   99   C  C   A TYR A 1 13  ? 62.545 82.259 -8.409  0.60 48.04 ? 10   TYR A C   1 
ATOM   100  C  C   B TYR A 1 13  ? 62.295 82.331 -8.427  0.40 47.93 ? 10   TYR A C   1 
ATOM   101  O  O   A TYR A 1 13  ? 62.847 82.669 -9.536  0.60 47.82 ? 10   TYR A O   1 
ATOM   102  O  O   B TYR A 1 13  ? 62.144 82.779 -9.563  0.40 47.83 ? 10   TYR A O   1 
ATOM   103  C  CB  A TYR A 1 13  ? 63.763 83.900 -7.030  0.60 50.87 ? 10   TYR A CB  1 
ATOM   104  C  CB  B TYR A 1 13  ? 63.489 84.122 -7.058  0.40 51.08 ? 10   TYR A CB  1 
ATOM   105  C  CG  A TYR A 1 13  ? 64.655 83.552 -8.200  0.60 52.46 ? 10   TYR A CG  1 
ATOM   106  C  CG  B TYR A 1 13  ? 63.246 85.426 -6.315  0.40 53.31 ? 10   TYR A CG  1 
ATOM   107  C  CD1 A TYR A 1 13  ? 64.684 84.347 -9.349  0.60 55.37 ? 10   TYR A CD1 1 
ATOM   108  C  CD1 B TYR A 1 13  ? 63.512 86.649 -6.910  0.40 55.62 ? 10   TYR A CD1 1 
ATOM   109  C  CD2 A TYR A 1 13  ? 65.386 82.373 -8.202  0.60 53.12 ? 10   TYR A CD2 1 
ATOM   110  C  CD2 B TYR A 1 13  ? 62.707 85.426 -5.032  0.40 54.51 ? 10   TYR A CD2 1 
ATOM   111  C  CE1 A TYR A 1 13  ? 65.455 83.979 -10.450 0.60 56.61 ? 10   TYR A CE1 1 
ATOM   112  C  CE1 B TYR A 1 13  ? 63.272 87.836 -6.241  0.40 57.18 ? 10   TYR A CE1 1 
ATOM   113  C  CE2 A TYR A 1 13  ? 66.137 82.002 -9.279  0.60 53.33 ? 10   TYR A CE2 1 
ATOM   114  C  CE2 B TYR A 1 13  ? 62.467 86.605 -4.351  0.40 55.90 ? 10   TYR A CE2 1 
ATOM   115  C  CZ  A TYR A 1 13  ? 66.184 82.801 -10.400 0.60 55.80 ? 10   TYR A CZ  1 
ATOM   116  C  CZ  B TYR A 1 13  ? 62.750 87.805 -4.962  0.40 57.34 ? 10   TYR A CZ  1 
ATOM   117  O  OH  A TYR A 1 13  ? 66.970 82.419 -11.469 0.60 55.17 ? 10   TYR A OH  1 
ATOM   118  O  OH  B TYR A 1 13  ? 62.511 88.984 -4.296  0.40 58.49 ? 10   TYR A OH  1 
ATOM   119  N  N   A LEU A 1 14  ? 62.427 80.959 -8.176  0.60 44.69 ? 11   LEU A N   1 
ATOM   120  N  N   B LEU A 1 14  ? 62.508 81.023 -8.192  0.40 44.86 ? 11   LEU A N   1 
ATOM   121  C  CA  . LEU A 1 14  ? 62.496 79.987 -9.271  1.00 42.90 ? 11   LEU A CA  1 
ATOM   122  C  C   . LEU A 1 14  ? 61.254 80.120 -10.184 1.00 40.92 ? 11   LEU A C   1 
ATOM   123  O  O   . LEU A 1 14  ? 61.275 79.814 -11.384 1.00 39.67 ? 11   LEU A O   1 
ATOM   124  C  CB  . LEU A 1 14  ? 62.531 78.532 -8.692  1.00 41.48 ? 11   LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 14  ? 63.839 78.064 -8.007  1.00 39.61 ? 11   LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 14  ? 63.707 76.642 -7.401  1.00 36.82 ? 11   LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 14  ? 64.986 78.084 -8.986  1.00 41.23 ? 11   LEU A CD2 1 
ATOM   128  N  N   . LYS A 1 15  ? 60.185 80.598 -9.572  1.00 39.33 ? 12   LYS A N   1 
ATOM   129  C  CA  . LYS A 1 15  ? 58.910 80.831 -10.205 1.00 39.28 ? 12   LYS A CA  1 
ATOM   130  C  C   . LYS A 1 15  ? 59.071 81.860 -11.320 1.00 38.40 ? 12   LYS A C   1 
ATOM   131  O  O   . LYS A 1 15  ? 58.387 81.816 -12.352 1.00 37.16 ? 12   LYS A O   1 
ATOM   132  C  CB  . LYS A 1 15  ? 57.946 81.329 -9.129  1.00 40.05 ? 12   LYS A CB  1 
ATOM   133  C  CG  . LYS A 1 15  ? 56.520 81.517 -9.551  1.00 42.44 ? 12   LYS A CG  1 
ATOM   134  C  CD  . LYS A 1 15  ? 55.602 81.692 -8.339  1.00 45.74 ? 12   LYS A CD  1 
ATOM   135  C  CE  . LYS A 1 15  ? 54.449 82.642 -8.625  1.00 48.03 ? 12   LYS A CE  1 
ATOM   136  N  NZ  . LYS A 1 15  ? 54.887 84.079 -8.453  1.00 53.08 ? 12   LYS A NZ  1 
ATOM   137  N  N   . GLU A 1 16  ? 60.033 82.767 -11.147 1.00 37.39 ? 13   GLU A N   1 
ATOM   138  C  CA  . GLU A 1 16  ? 60.284 83.807 -12.153 1.00 37.75 ? 13   GLU A CA  1 
ATOM   139  C  C   . GLU A 1 16  ? 60.806 83.275 -13.494 1.00 35.56 ? 13   GLU A C   1 
ATOM   140  O  O   . GLU A 1 16  ? 60.901 84.033 -14.481 1.00 34.92 ? 13   GLU A O   1 
ATOM   141  C  CB  . GLU A 1 16  ? 61.259 84.840 -11.588 1.00 40.09 ? 13   GLU A CB  1 
ATOM   142  C  CG  . GLU A 1 16  ? 60.656 85.707 -10.488 1.00 44.85 ? 13   GLU A CG  1 
ATOM   143  C  CD  . GLU A 1 16  ? 61.657 86.744 -9.909  1.00 52.99 ? 13   GLU A CD  1 
ATOM   144  O  OE1 . GLU A 1 16  ? 62.768 86.991 -10.485 1.00 55.66 ? 13   GLU A OE1 1 
ATOM   145  O  OE2 . GLU A 1 16  ? 61.311 87.307 -8.842  1.00 59.78 ? 13   GLU A OE2 1 
ATOM   146  N  N   . GLN A 1 17  ? 61.168 82.003 -13.556 1.00 33.15 ? 14   GLN A N   1 
ATOM   147  C  CA  . GLN A 1 17  ? 61.415 81.339 -14.846 1.00 32.60 ? 14   GLN A CA  1 
ATOM   148  C  C   . GLN A 1 17  ? 60.180 81.381 -15.761 1.00 31.62 ? 14   GLN A C   1 
ATOM   149  O  O   . GLN A 1 17  ? 60.334 81.269 -16.982 1.00 31.63 ? 14   GLN A O   1 
ATOM   150  C  CB  . GLN A 1 17  ? 61.871 79.895 -14.680 1.00 32.06 ? 14   GLN A CB  1 
ATOM   151  C  CG  . GLN A 1 17  ? 63.266 79.701 -14.057 1.00 32.35 ? 14   GLN A CG  1 
ATOM   152  C  CD  . GLN A 1 17  ? 64.355 79.911 -15.059 1.00 34.68 ? 14   GLN A CD  1 
ATOM   153  O  OE1 . GLN A 1 17  ? 64.550 79.095 -15.960 1.00 35.48 ? 14   GLN A OE1 1 
ATOM   154  N  NE2 . GLN A 1 17  ? 65.130 81.004 -14.897 1.00 39.16 ? 14   GLN A NE2 1 
ATOM   155  N  N   . ASN A 1 18  ? 59.016 81.582 -15.172 1.00 31.60 ? 15   ASN A N   1 
ATOM   156  C  CA  A ASN A 1 18  ? 57.753 81.713 -15.941 0.70 31.76 ? 15   ASN A CA  1 
ATOM   157  C  CA  B ASN A 1 18  ? 57.727 81.671 -15.894 0.30 30.45 ? 15   ASN A CA  1 
ATOM   158  C  C   . ASN A 1 18  ? 57.538 80.574 -16.937 1.00 30.16 ? 15   ASN A C   1 
ATOM   159  O  O   . ASN A 1 18  ? 57.262 80.819 -18.137 1.00 30.43 ? 15   ASN A O   1 
ATOM   160  C  CB  A ASN A 1 18  ? 57.715 83.074 -16.659 0.70 34.67 ? 15   ASN A CB  1 
ATOM   161  C  CB  B ASN A 1 18  ? 57.522 83.048 -16.511 0.30 31.79 ? 15   ASN A CB  1 
ATOM   162  C  CG  A ASN A 1 18  ? 57.590 84.238 -15.691 0.70 38.12 ? 15   ASN A CG  1 
ATOM   163  C  CG  B ASN A 1 18  ? 56.079 83.297 -16.894 0.30 29.90 ? 15   ASN A CG  1 
ATOM   164  O  OD1 A ASN A 1 18  ? 57.078 84.073 -14.569 0.70 45.35 ? 15   ASN A OD1 1 
ATOM   165  O  OD1 B ASN A 1 18  ? 55.153 82.640 -16.385 0.30 25.84 ? 15   ASN A OD1 1 
ATOM   166  N  ND2 A ASN A 1 18  ? 58.047 85.419 -16.113 0.70 47.16 ? 15   ASN A ND2 1 
ATOM   167  N  ND2 B ASN A 1 18  ? 55.868 84.264 -17.787 0.30 31.66 ? 15   ASN A ND2 1 
ATOM   168  N  N   . ILE A 1 19  ? 57.604 79.350 -16.443 1.00 27.66 ? 16   ILE A N   1 
ATOM   169  C  CA  . ILE A 1 19  ? 57.491 78.178 -17.291 1.00 26.96 ? 16   ILE A CA  1 
ATOM   170  C  C   . ILE A 1 19  ? 56.161 78.191 -18.044 1.00 27.22 ? 16   ILE A C   1 
ATOM   171  O  O   . ILE A 1 19  ? 55.096 78.395 -17.450 1.00 27.51 ? 16   ILE A O   1 
ATOM   172  C  CB  . ILE A 1 19  ? 57.546 76.874 -16.454 1.00 27.06 ? 16   ILE A CB  1 
ATOM   173  C  CG1 . ILE A 1 19  ? 58.891 76.736 -15.736 1.00 28.56 ? 16   ILE A CG1 1 
ATOM   174  C  CG2 . ILE A 1 19  ? 57.293 75.637 -17.365 1.00 26.41 ? 16   ILE A CG2 1 
ATOM   175  C  CD1 . ILE A 1 19  ? 60.063 76.545 -16.705 1.00 31.20 ? 16   ILE A CD1 1 
ATOM   176  N  N   . ASN A 1 20  ? 56.256 78.001 -19.350 1.00 27.58 ? 17   ASN A N   1 
ATOM   177  C  CA  . ASN A 1 20  ? 55.100 77.803 -20.221 1.00 27.88 ? 17   ASN A CA  1 
ATOM   178  C  C   . ASN A 1 20  ? 55.201 76.386 -20.723 1.00 26.71 ? 17   ASN A C   1 
ATOM   179  O  O   . ASN A 1 20  ? 56.106 76.036 -21.455 1.00 27.06 ? 17   ASN A O   1 
ATOM   180  C  CB  . ASN A 1 20  ? 55.097 78.792 -21.386 1.00 29.42 ? 17   ASN A CB  1 
ATOM   181  C  CG  . ASN A 1 20  ? 53.890 78.649 -22.271 1.00 33.10 ? 17   ASN A CG  1 
ATOM   182  O  OD1 . ASN A 1 20  ? 53.695 77.638 -22.937 1.00 29.78 ? 17   ASN A OD1 1 
ATOM   183  N  ND2 . ASN A 1 20  ? 53.078 79.707 -22.318 1.00 41.04 ? 17   ASN A ND2 1 
ATOM   184  N  N   . LEU A 1 21  ? 54.261 75.546 -20.298 1.00 25.69 ? 18   LEU A N   1 
ATOM   185  C  CA  . LEU A 1 21  ? 54.334 74.118 -20.602 1.00 25.65 ? 18   LEU A CA  1 
ATOM   186  C  C   . LEU A 1 21  ? 54.233 73.831 -22.089 1.00 26.60 ? 18   LEU A C   1 
ATOM   187  O  O   . LEU A 1 21  ? 54.998 73.005 -22.632 1.00 27.28 ? 18   LEU A O   1 
ATOM   188  C  CB  . LEU A 1 21  ? 53.218 73.363 -19.879 1.00 25.12 ? 18   LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 21  ? 53.287 73.323 -18.363 1.00 22.59 ? 18   LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 21  ? 51.980 72.708 -17.846 1.00 22.43 ? 18   LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 21  ? 54.452 72.475 -17.856 1.00 24.35 ? 18   LEU A CD2 1 
ATOM   192  N  N   . LYS A 1 22  ? 53.321 74.509 -22.769 1.00 27.09 ? 19   LYS A N   1 
ATOM   193  C  CA  . LYS A 1 22  ? 53.226 74.342 -24.236 1.00 27.90 ? 19   LYS A CA  1 
ATOM   194  C  C   . LYS A 1 22  ? 54.568 74.618 -24.916 1.00 29.09 ? 19   LYS A C   1 
ATOM   195  O  O   . LYS A 1 22  ? 55.020 73.863 -25.769 1.00 29.92 ? 19   LYS A O   1 
ATOM   196  C  CB  . LYS A 1 22  ? 52.149 75.244 -24.824 1.00 29.71 ? 19   LYS A CB  1 
ATOM   197  C  CG  . LYS A 1 22  ? 52.119 75.248 -26.357 1.00 34.56 ? 19   LYS A CG  1 
ATOM   198  C  CD  . LYS A 1 22  ? 50.808 75.808 -26.927 1.00 40.06 ? 19   LYS A CD  1 
ATOM   199  C  CE  . LYS A 1 22  ? 50.869 75.906 -28.479 1.00 43.83 ? 19   LYS A CE  1 
ATOM   200  N  NZ  . LYS A 1 22  ? 51.879 76.891 -28.925 1.00 48.40 ? 19   LYS A NZ  1 
ATOM   201  N  N   . ASN A 1 23  ? 55.182 75.712 -24.528 1.00 29.23 ? 20   ASN A N   1 
ATOM   202  C  CA  . ASN A 1 23  ? 56.460 76.134 -25.136 1.00 30.83 ? 20   ASN A CA  1 
ATOM   203  C  C   . ASN A 1 23  ? 57.540 75.099 -24.816 1.00 30.26 ? 20   ASN A C   1 
ATOM   204  O  O   . ASN A 1 23  ? 58.353 74.772 -25.678 1.00 31.77 ? 20   ASN A O   1 
ATOM   205  C  CB  . ASN A 1 23  ? 56.848 77.505 -24.584 1.00 31.52 ? 20   ASN A CB  1 
ATOM   206  C  CG  . ASN A 1 23  ? 56.019 78.642 -25.174 1.00 34.97 ? 20   ASN A CG  1 
ATOM   207  O  OD1 . ASN A 1 23  ? 55.177 78.430 -26.062 1.00 41.64 ? 20   ASN A OD1 1 
ATOM   208  N  ND2 . ASN A 1 23  ? 56.254 79.869 -24.684 1.00 40.72 ? 20   ASN A ND2 1 
ATOM   209  N  N   . GLU A 1 24  ? 57.570 74.579 -23.577 1.00 27.58 ? 21   GLU A N   1 
ATOM   210  C  CA  . GLU A 1 24  ? 58.555 73.580 -23.225 1.00 27.85 ? 21   GLU A CA  1 
ATOM   211  C  C   . GLU A 1 24  ? 58.445 72.316 -24.040 1.00 28.10 ? 21   GLU A C   1 
ATOM   212  O  O   . GLU A 1 24  ? 59.452 71.822 -24.529 1.00 30.79 ? 21   GLU A O   1 
ATOM   213  C  CB  . GLU A 1 24  ? 58.547 73.223 -21.745 1.00 27.41 ? 21   GLU A CB  1 
ATOM   214  C  CG  . GLU A 1 24  ? 58.962 74.349 -20.810 1.00 29.28 ? 21   GLU A CG  1 
ATOM   215  C  CD  . GLU A 1 24  ? 60.397 74.824 -21.026 1.00 33.79 ? 21   GLU A CD  1 
ATOM   216  O  OE1 . GLU A 1 24  ? 61.299 74.007 -21.347 1.00 33.45 ? 21   GLU A OE1 1 
ATOM   217  O  OE2 . GLU A 1 24  ? 60.597 76.048 -20.912 1.00 36.37 ? 21   GLU A OE2 1 
ATOM   218  N  N   . PHE A 1 25  ? 57.231 71.803 -24.236 1.00 28.00 ? 22   PHE A N   1 
ATOM   219  C  CA  . PHE A 1 25  ? 57.061 70.588 -25.026 1.00 27.56 ? 22   PHE A CA  1 
ATOM   220  C  C   . PHE A 1 25  ? 57.347 70.834 -26.519 1.00 31.50 ? 22   PHE A C   1 
ATOM   221  O  O   . PHE A 1 25  ? 57.852 69.941 -27.173 1.00 33.74 ? 22   PHE A O   1 
ATOM   222  C  CB  . PHE A 1 25  ? 55.653 70.026 -24.834 1.00 26.86 ? 22   PHE A CB  1 
ATOM   223  C  CG  . PHE A 1 25  ? 55.513 69.182 -23.599 1.00 24.26 ? 22   PHE A CG  1 
ATOM   224  C  CD1 . PHE A 1 25  ? 55.791 67.842 -23.635 1.00 25.96 ? 22   PHE A CD1 1 
ATOM   225  C  CD2 . PHE A 1 25  ? 55.125 69.740 -22.403 1.00 24.35 ? 22   PHE A CD2 1 
ATOM   226  C  CE1 . PHE A 1 25  ? 55.639 67.047 -22.500 1.00 24.30 ? 22   PHE A CE1 1 
ATOM   227  C  CE2 . PHE A 1 25  ? 55.016 68.963 -21.273 1.00 23.17 ? 22   PHE A CE2 1 
ATOM   228  C  CZ  . PHE A 1 25  ? 55.252 67.623 -21.336 1.00 22.86 ? 22   PHE A CZ  1 
ATOM   229  N  N   . ASP A 1 26  ? 57.070 72.048 -26.987 1.00 32.46 ? 23   ASP A N   1 
ATOM   230  C  CA  A ASP A 1 26  ? 57.326 72.430 -28.371 0.70 34.12 ? 23   ASP A CA  1 
ATOM   231  C  CA  B ASP A 1 26  ? 57.313 72.405 -28.385 0.30 33.50 ? 23   ASP A CA  1 
ATOM   232  C  C   . ASP A 1 26  ? 58.809 72.468 -28.652 1.00 34.97 ? 23   ASP A C   1 
ATOM   233  O  O   . ASP A 1 26  ? 59.263 72.044 -29.736 1.00 37.57 ? 23   ASP A O   1 
ATOM   234  C  CB  A ASP A 1 26  ? 56.715 73.817 -28.681 0.70 34.52 ? 23   ASP A CB  1 
ATOM   235  C  CB  B ASP A 1 26  ? 56.633 73.747 -28.748 0.30 33.38 ? 23   ASP A CB  1 
ATOM   236  C  CG  A ASP A 1 26  ? 55.221 73.762 -28.944 0.70 37.32 ? 23   ASP A CG  1 
ATOM   237  C  CG  B ASP A 1 26  ? 56.822 74.142 -30.229 0.30 34.40 ? 23   ASP A CG  1 
ATOM   238  O  OD1 A ASP A 1 26  ? 54.635 72.649 -28.944 0.70 46.22 ? 23   ASP A OD1 1 
ATOM   239  O  OD1 B ASP A 1 26  ? 56.372 73.407 -31.129 0.30 33.19 ? 23   ASP A OD1 1 
ATOM   240  O  OD2 A ASP A 1 26  ? 54.600 74.834 -29.135 0.70 42.16 ? 23   ASP A OD2 1 
ATOM   241  O  OD2 B ASP A 1 26  ? 57.408 75.207 -30.482 0.30 33.45 ? 23   ASP A OD2 1 
ATOM   242  N  N   . LYS A 1 27  ? 59.568 72.986 -27.693 1.00 33.93 ? 24   LYS A N   1 
ATOM   243  C  CA  A LYS A 1 27  ? 60.993 73.255 -27.951 0.50 34.84 ? 24   LYS A CA  1 
ATOM   244  C  CA  B LYS A 1 27  ? 61.011 73.299 -27.864 0.50 34.52 ? 24   LYS A CA  1 
ATOM   245  C  C   . LYS A 1 27  ? 61.965 72.173 -27.474 1.00 34.06 ? 24   LYS A C   1 
ATOM   246  O  O   . LYS A 1 27  ? 63.120 72.111 -27.927 1.00 35.81 ? 24   LYS A O   1 
ATOM   247  C  CB  A LYS A 1 27  ? 61.378 74.633 -27.387 0.50 35.49 ? 24   LYS A CB  1 
ATOM   248  C  CB  B LYS A 1 27  ? 61.378 74.509 -26.985 0.50 34.60 ? 24   LYS A CB  1 
ATOM   249  C  CG  A LYS A 1 27  ? 61.558 74.729 -25.892 0.50 37.79 ? 24   LYS A CG  1 
ATOM   250  C  CG  B LYS A 1 27  ? 60.981 75.873 -27.510 0.50 37.28 ? 24   LYS A CG  1 
ATOM   251  C  CD  A LYS A 1 27  ? 61.574 76.195 -25.461 0.50 39.22 ? 24   LYS A CD  1 
ATOM   252  C  CD  B LYS A 1 27  ? 60.058 75.764 -28.660 0.50 41.48 ? 24   LYS A CD  1 
ATOM   253  C  CE  A LYS A 1 27  ? 61.869 76.342 -23.989 0.50 37.18 ? 24   LYS A CE  1 
ATOM   254  C  CE  B LYS A 1 27  ? 60.169 76.986 -29.570 0.50 42.33 ? 24   LYS A CE  1 
ATOM   255  N  NZ  A LYS A 1 27  ? 61.983 77.760 -23.605 0.50 36.63 ? 24   LYS A NZ  1 
ATOM   256  N  NZ  B LYS A 1 27  ? 58.949 77.117 -30.384 0.50 44.79 ? 24   LYS A NZ  1 
ATOM   257  N  N   . ASP A 1 28  ? 61.519 71.316 -26.569 1.00 32.90 ? 25   ASP A N   1 
ATOM   258  C  CA  . ASP A 1 28  ? 62.403 70.361 -25.941 1.00 32.28 ? 25   ASP A CA  1 
ATOM   259  C  C   . ASP A 1 28  ? 61.950 68.938 -26.257 1.00 33.37 ? 25   ASP A C   1 
ATOM   260  O  O   . ASP A 1 28  ? 61.045 68.391 -25.642 1.00 29.97 ? 25   ASP A O   1 
ATOM   261  C  CB  . ASP A 1 28  ? 62.446 70.644 -24.431 1.00 31.80 ? 25   ASP A CB  1 
ATOM   262  C  CG  . ASP A 1 28  ? 63.338 69.695 -23.655 1.00 32.04 ? 25   ASP A CG  1 
ATOM   263  O  OD1 . ASP A 1 28  ? 64.049 68.858 -24.237 1.00 34.52 ? 25   ASP A OD1 1 
ATOM   264  O  OD2 . ASP A 1 28  ? 63.361 69.842 -22.416 1.00 33.70 ? 25   ASP A OD2 1 
ATOM   265  N  N   . ASP A 1 29  ? 62.575 68.313 -27.231 1.00 34.79 ? 26   ASP A N   1 
ATOM   266  C  CA  . ASP A 1 29  ? 62.172 66.973 -27.634 1.00 34.94 ? 26   ASP A CA  1 
ATOM   267  C  C   . ASP A 1 29  ? 62.596 65.908 -26.626 1.00 34.13 ? 26   ASP A C   1 
ATOM   268  O  O   . ASP A 1 29  ? 62.228 64.752 -26.794 1.00 35.92 ? 26   ASP A O   1 
ATOM   269  C  CB  . ASP A 1 29  ? 62.606 66.619 -29.089 1.00 37.76 ? 26   ASP A CB  1 
ATOM   270  C  CG  . ASP A 1 29  ? 64.088 66.434 -29.283 1.00 42.13 ? 26   ASP A CG  1 
ATOM   271  O  OD1 . ASP A 1 29  ? 64.898 66.507 -28.331 1.00 49.46 ? 26   ASP A OD1 1 
ATOM   272  O  OD2 . ASP A 1 29  ? 64.456 66.233 -30.477 1.00 51.39 ? 26   ASP A OD2 1 
ATOM   273  N  N   . LYS A 1 30  ? 63.327 66.289 -25.577 1.00 31.89 ? 27   LYS A N   1 
ATOM   274  C  CA  A LYS A 1 30  ? 63.674 65.337 -24.526 0.60 31.86 ? 27   LYS A CA  1 
ATOM   275  C  CA  B LYS A 1 30  ? 63.675 65.340 -24.523 0.40 31.32 ? 27   LYS A CA  1 
ATOM   276  C  C   . LYS A 1 30  ? 62.886 65.591 -23.235 1.00 29.57 ? 27   LYS A C   1 
ATOM   277  O  O   . LYS A 1 30  ? 63.207 65.056 -22.194 1.00 28.94 ? 27   LYS A O   1 
ATOM   278  C  CB  A LYS A 1 30  ? 65.174 65.313 -24.258 0.60 33.11 ? 27   LYS A CB  1 
ATOM   279  C  CB  B LYS A 1 30  ? 65.174 65.348 -24.269 0.40 32.14 ? 27   LYS A CB  1 
ATOM   280  C  CG  A LYS A 1 30  ? 66.039 64.697 -25.422 0.60 36.92 ? 27   LYS A CG  1 
ATOM   281  C  CG  B LYS A 1 30  ? 65.967 65.012 -25.548 0.40 33.81 ? 27   LYS A CG  1 
ATOM   282  C  CD  A LYS A 1 30  ? 65.458 63.344 -25.926 0.60 40.65 ? 27   LYS A CD  1 
ATOM   283  C  CD  B LYS A 1 30  ? 67.421 64.679 -25.309 0.40 35.37 ? 27   LYS A CD  1 
ATOM   284  C  CE  A LYS A 1 30  ? 66.481 62.360 -26.473 0.60 43.93 ? 27   LYS A CE  1 
ATOM   285  C  CE  B LYS A 1 30  ? 68.021 64.086 -26.583 0.40 35.60 ? 27   LYS A CE  1 
ATOM   286  N  NZ  A LYS A 1 30  ? 65.912 60.952 -26.613 0.60 43.79 ? 27   LYS A NZ  1 
ATOM   287  N  NZ  B LYS A 1 30  ? 69.465 64.365 -26.674 0.40 39.70 ? 27   LYS A NZ  1 
ATOM   288  N  N   . ARG A 1 31  ? 61.828 66.384 -23.321 1.00 28.39 ? 28   ARG A N   1 
ATOM   289  C  CA  . ARG A 1 31  ? 61.128 66.761 -22.095 1.00 27.62 ? 28   ARG A CA  1 
ATOM   290  C  C   . ARG A 1 31  ? 60.620 65.550 -21.315 1.00 25.42 ? 28   ARG A C   1 
ATOM   291  O  O   . ARG A 1 31  ? 60.786 65.493 -20.072 1.00 25.09 ? 28   ARG A O   1 
ATOM   292  C  CB  . ARG A 1 31  ? 60.025 67.759 -22.337 1.00 26.92 ? 28   ARG A CB  1 
ATOM   293  C  CG  . ARG A 1 31  ? 59.397 68.199 -21.018 1.00 28.48 ? 28   ARG A CG  1 
ATOM   294  C  CD  . ARG A 1 31  ? 58.686 69.402 -21.048 1.00 28.63 ? 28   ARG A CD  1 
ATOM   295  N  NE  . ARG A 1 31  ? 58.099 69.739 -19.738 1.00 27.00 ? 28   ARG A NE  1 
ATOM   296  C  CZ  . ARG A 1 31  ? 58.573 70.600 -18.834 1.00 24.85 ? 28   ARG A CZ  1 
ATOM   297  N  NH1 . ARG A 1 31  ? 59.718 71.277 -19.003 1.00 26.67 ? 28   ARG A NH1 1 
ATOM   298  N  NH2 . ARG A 1 31  ? 57.860 70.853 -17.756 1.00 23.18 ? 28   ARG A NH2 1 
ATOM   299  N  N   . VAL A 1 32  ? 59.978 64.595 -21.998 1.00 25.18 ? 29   VAL A N   1 
ATOM   300  C  CA  . VAL A 1 32  ? 59.432 63.432 -21.272 1.00 24.97 ? 29   VAL A CA  1 
ATOM   301  C  C   . VAL A 1 32  ? 60.555 62.561 -20.690 1.00 24.44 ? 29   VAL A C   1 
ATOM   302  O  O   . VAL A 1 32  ? 60.510 62.187 -19.500 1.00 23.84 ? 29   VAL A O   1 
ATOM   303  C  CB  . VAL A 1 32  ? 58.415 62.620 -22.098 1.00 23.77 ? 29   VAL A CB  1 
ATOM   304  C  CG1 . VAL A 1 32  ? 57.899 61.342 -21.331 1.00 24.06 ? 29   VAL A CG1 1 
ATOM   305  C  CG2 . VAL A 1 32  ? 57.217 63.519 -22.467 1.00 23.98 ? 29   VAL A CG2 1 
ATOM   306  N  N   . GLU A 1 33  ? 61.597 62.343 -21.478 1.00 25.96 ? 30   GLU A N   1 
ATOM   307  C  CA  . GLU A 1 33  ? 62.747 61.525 -21.037 1.00 27.19 ? 30   GLU A CA  1 
ATOM   308  C  C   . GLU A 1 33  ? 63.354 62.142 -19.782 1.00 26.44 ? 30   GLU A C   1 
ATOM   309  O  O   . GLU A 1 33  ? 63.642 61.427 -18.817 1.00 26.19 ? 30   GLU A O   1 
ATOM   310  C  CB  . GLU A 1 33  ? 63.782 61.374 -22.190 1.00 29.58 ? 30   GLU A CB  1 
ATOM   311  C  CG  . GLU A 1 33  ? 64.869 60.383 -21.868 1.00 35.64 ? 30   GLU A CG  1 
ATOM   312  C  CD  . GLU A 1 33  ? 65.892 60.240 -22.990 1.00 43.27 ? 30   GLU A CD  1 
ATOM   313  O  OE1 . GLU A 1 33  ? 65.499 59.856 -24.113 1.00 50.28 ? 30   GLU A OE1 1 
ATOM   314  O  OE2 . GLU A 1 33  ? 67.072 60.508 -22.711 1.00 48.63 ? 30   GLU A OE2 1 
ATOM   315  N  N   . LYS A 1 34  ? 63.491 63.466 -19.764 1.00 26.35 ? 31   LYS A N   1 
ATOM   316  C  CA  . LYS A 1 34  ? 64.102 64.167 -18.630 1.00 27.24 ? 31   LYS A CA  1 
ATOM   317  C  C   . LYS A 1 34  ? 63.234 64.070 -17.376 1.00 25.64 ? 31   LYS A C   1 
ATOM   318  O  O   . LYS A 1 34  ? 63.749 63.911 -16.267 1.00 25.68 ? 31   LYS A O   1 
ATOM   319  C  CB  . LYS A 1 34  ? 64.322 65.649 -18.946 1.00 29.40 ? 31   LYS A CB  1 
ATOM   320  C  CG  . LYS A 1 34  ? 65.464 65.998 -19.938 1.00 33.95 ? 31   LYS A CG  1 
ATOM   321  C  CD  . LYS A 1 34  ? 65.232 67.520 -20.284 1.00 33.60 ? 31   LYS A CD  1 
ATOM   322  C  CE  . LYS A 1 34  ? 66.150 68.228 -21.194 1.00 41.52 ? 31   LYS A CE  1 
ATOM   323  N  NZ  . LYS A 1 34  ? 65.777 69.679 -21.005 1.00 39.64 ? 31   LYS A NZ  1 
ATOM   324  N  N   . PHE A 1 35  ? 61.917 64.160 -17.578 1.00 24.05 ? 32   PHE A N   1 
ATOM   325  C  CA  . PHE A 1 35  ? 60.956 64.368 -16.461 1.00 23.24 ? 32   PHE A CA  1 
ATOM   326  C  C   . PHE A 1 35  ? 59.950 63.235 -16.329 1.00 22.69 ? 32   PHE A C   1 
ATOM   327  O  O   . PHE A 1 35  ? 58.756 63.444 -16.053 1.00 22.23 ? 32   PHE A O   1 
ATOM   328  C  CB  . PHE A 1 35  ? 60.291 65.734 -16.616 1.00 24.33 ? 32   PHE A CB  1 
ATOM   329  C  CG  . PHE A 1 35  ? 61.284 66.895 -16.675 1.00 24.85 ? 32   PHE A CG  1 
ATOM   330  C  CD1 . PHE A 1 35  ? 62.309 67.024 -15.739 1.00 25.49 ? 32   PHE A CD1 1 
ATOM   331  C  CD2 . PHE A 1 35  ? 61.160 67.838 -17.642 1.00 26.53 ? 32   PHE A CD2 1 
ATOM   332  C  CE1 . PHE A 1 35  ? 63.229 68.111 -15.811 1.00 25.49 ? 32   PHE A CE1 1 
ATOM   333  C  CE2 . PHE A 1 35  ? 62.078 68.880 -17.766 1.00 25.81 ? 32   PHE A CE2 1 
ATOM   334  C  CZ  . PHE A 1 35  ? 63.088 69.035 -16.855 1.00 24.93 ? 32   PHE A CZ  1 
ATOM   335  N  N   . SER A 1 36  ? 60.465 62.016 -16.444 1.00 21.61 ? 33   SER A N   1 
ATOM   336  C  CA  . SER A 1 36  ? 59.714 60.821 -16.134 1.00 21.63 ? 33   SER A CA  1 
ATOM   337  C  C   . SER A 1 36  ? 60.675 59.780 -15.575 1.00 22.07 ? 33   SER A C   1 
ATOM   338  O  O   . SER A 1 36  ? 61.912 59.803 -15.867 1.00 22.86 ? 33   SER A O   1 
ATOM   339  C  CB  . SER A 1 36  ? 58.955 60.270 -17.339 1.00 22.03 ? 33   SER A CB  1 
ATOM   340  O  OG  . SER A 1 36  ? 59.843 59.781 -18.371 1.00 24.16 ? 33   SER A OG  1 
ATOM   341  N  N   . LEU A 1 37  ? 60.130 58.855 -14.801 1.00 21.40 ? 34   LEU A N   1 
ATOM   342  C  CA  . LEU A 1 37  ? 60.890 57.782 -14.181 1.00 21.94 ? 34   LEU A CA  1 
ATOM   343  C  C   . LEU A 1 37  ? 60.051 56.517 -14.218 1.00 21.59 ? 34   LEU A C   1 
ATOM   344  O  O   . LEU A 1 37  ? 58.801 56.577 -14.323 1.00 21.53 ? 34   LEU A O   1 
ATOM   345  C  CB  . LEU A 1 37  ? 61.228 58.097 -12.726 1.00 21.80 ? 34   LEU A CB  1 
ATOM   346  C  CG  . LEU A 1 37  ? 62.172 59.265 -12.455 1.00 23.83 ? 34   LEU A CG  1 
ATOM   347  C  CD1 . LEU A 1 37  ? 62.099 59.690 -10.988 1.00 21.28 ? 34   LEU A CD1 1 
ATOM   348  C  CD2 . LEU A 1 37  ? 63.629 58.815 -12.839 1.00 22.61 ? 34   LEU A CD2 1 
ATOM   349  N  N   . LYS A 1 38  ? 60.722 55.366 -14.134 1.00 21.94 ? 35   LYS A N   1 
ATOM   350  C  CA  . LYS A 1 38  ? 60.053 54.115 -14.057 1.00 23.49 ? 35   LYS A CA  1 
ATOM   351  C  C   . LYS A 1 38  ? 60.541 53.356 -12.836 1.00 21.39 ? 35   LYS A C   1 
ATOM   352  O  O   . LYS A 1 38  ? 61.747 53.315 -12.567 1.00 24.01 ? 35   LYS A O   1 
ATOM   353  C  CB  . LYS A 1 38  ? 60.330 53.258 -15.276 1.00 25.10 ? 35   LYS A CB  1 
ATOM   354  C  CG  . LYS A 1 38  ? 59.826 53.841 -16.575 1.00 30.29 ? 35   LYS A CG  1 
ATOM   355  C  CD  . LYS A 1 38  ? 60.124 52.880 -17.780 1.00 39.83 ? 35   LYS A CD  1 
ATOM   356  C  CE  . LYS A 1 38  ? 61.579 52.391 -17.850 1.00 44.09 ? 35   LYS A CE  1 
ATOM   357  N  NZ  . LYS A 1 38  ? 61.999 51.950 -19.231 1.00 47.37 ? 35   LYS A NZ  1 
ATOM   358  N  N   . HIS A 1 39  ? 59.604 52.682 -12.185 1.00 20.45 ? 36   HIS A N   1 
ATOM   359  C  CA  . HIS A 1 39  ? 59.946 51.718 -11.162 1.00 19.66 ? 36   HIS A CA  1 
ATOM   360  C  C   . HIS A 1 39  ? 59.144 50.454 -11.467 1.00 18.14 ? 36   HIS A C   1 
ATOM   361  O  O   . HIS A 1 39  ? 57.904 50.421 -11.297 1.00 18.48 ? 36   HIS A O   1 
ATOM   362  C  CB  . HIS A 1 39  ? 59.660 52.174 -9.750  1.00 20.46 ? 36   HIS A CB  1 
ATOM   363  C  CG  . HIS A 1 39  ? 59.673 51.039 -8.758  1.00 19.84 ? 36   HIS A CG  1 
ATOM   364  N  ND1 . HIS A 1 39  ? 60.829 50.342 -8.469  1.00 20.16 ? 36   HIS A ND1 1 
ATOM   365  C  CD2 . HIS A 1 39  ? 58.686 50.494 -7.993  1.00 20.93 ? 36   HIS A CD2 1 
ATOM   366  C  CE1 . HIS A 1 39  ? 60.535 49.404 -7.560  1.00 19.38 ? 36   HIS A CE1 1 
ATOM   367  N  NE2 . HIS A 1 39  ? 59.251 49.477 -7.253  1.00 18.87 ? 36   HIS A NE2 1 
ATOM   368  N  N   . GLN A 1 40  ? 59.831 49.413 -11.938 1.00 19.89 ? 37   GLN A N   1 
ATOM   369  C  CA  . GLN A 1 40  ? 59.180 48.190 -12.363 1.00 20.64 ? 37   GLN A CA  1 
ATOM   370  C  C   . GLN A 1 40  ? 58.059 48.569 -13.323 1.00 22.42 ? 37   GLN A C   1 
ATOM   371  O  O   . GLN A 1 40  ? 58.374 49.176 -14.351 1.00 23.28 ? 37   GLN A O   1 
ATOM   372  C  CB  . GLN A 1 40  ? 58.773 47.334 -11.167 1.00 20.66 ? 37   GLN A CB  1 
ATOM   373  C  CG  . GLN A 1 40  ? 60.034 46.939 -10.365 1.00 20.82 ? 37   GLN A CG  1 
ATOM   374  C  CD  . GLN A 1 40  ? 59.861 46.128 -9.119  1.00 20.68 ? 37   GLN A CD  1 
ATOM   375  O  OE1 . GLN A 1 40  ? 60.871 45.689 -8.513  1.00 27.11 ? 37   GLN A OE1 1 
ATOM   376  N  NE2 . GLN A 1 40  ? 58.692 45.907 -8.713  1.00 18.35 ? 37   GLN A NE2 1 
ATOM   377  N  N   . ASN A 1 41  ? 56.829 48.203 -13.030 1.00 21.75 ? 38   ASN A N   1 
ATOM   378  C  CA  . ASN A 1 41  ? 55.732 48.464 -13.945 1.00 24.07 ? 38   ASN A CA  1 
ATOM   379  C  C   . ASN A 1 41  ? 54.917 49.676 -13.550 1.00 22.68 ? 38   ASN A C   1 
ATOM   380  O  O   . ASN A 1 41  ? 53.748 49.804 -13.971 1.00 25.56 ? 38   ASN A O   1 
ATOM   381  C  CB  . ASN A 1 41  ? 54.814 47.265 -14.062 1.00 24.04 ? 38   ASN A CB  1 
ATOM   382  C  CG  . ASN A 1 41  ? 55.514 46.039 -14.632 1.00 28.68 ? 38   ASN A CG  1 
ATOM   383  O  OD1 . ASN A 1 41  ? 56.224 46.116 -15.585 1.00 35.18 ? 38   ASN A OD1 1 
ATOM   384  N  ND2 . ASN A 1 41  ? 55.353 44.919 -13.935 1.00 37.06 ? 38   ASN A ND2 1 
ATOM   385  N  N   . ILE A 1 42  ? 55.505 50.576 -12.780 1.00 19.51 ? 39   ILE A N   1 
ATOM   386  C  CA  . ILE A 1 42  ? 54.920 51.923 -12.557 1.00 18.22 ? 39   ILE A CA  1 
ATOM   387  C  C   . ILE A 1 42  ? 55.679 52.956 -13.346 1.00 19.38 ? 39   ILE A C   1 
ATOM   388  O  O   . ILE A 1 42  ? 56.938 52.967 -13.319 1.00 20.43 ? 39   ILE A O   1 
ATOM   389  C  CB  . ILE A 1 42  ? 54.946 52.301 -11.116 1.00 18.23 ? 39   ILE A CB  1 
ATOM   390  C  CG1 . ILE A 1 42  ? 53.968 51.405 -10.313 1.00 19.33 ? 39   ILE A CG1 1 
ATOM   391  C  CG2 . ILE A 1 42  ? 54.583 53.792 -10.897 1.00 19.22 ? 39   ILE A CG2 1 
ATOM   392  C  CD1 . ILE A 1 42  ? 53.911 51.564 -8.820  1.00 21.81 ? 39   ILE A CD1 1 
ATOM   393  N  N   . TYR A 1 43  ? 54.941 53.772 -14.105 1.00 17.42 ? 40   TYR A N   1 
ATOM   394  C  CA  . TYR A 1 43  ? 55.493 54.871 -14.869 1.00 18.12 ? 40   TYR A CA  1 
ATOM   395  C  C   . TYR A 1 43  ? 55.099 56.187 -14.191 1.00 17.70 ? 40   TYR A C   1 
ATOM   396  O  O   . TYR A 1 43  ? 53.898 56.418 -13.943 1.00 18.81 ? 40   TYR A O   1 
ATOM   397  C  CB  . TYR A 1 43  ? 55.024 54.826 -16.335 1.00 19.63 ? 40   TYR A CB  1 
ATOM   398  C  CG  . TYR A 1 43  ? 55.376 55.975 -17.213 1.00 20.17 ? 40   TYR A CG  1 
ATOM   399  C  CD1 . TYR A 1 43  ? 56.710 56.231 -17.524 1.00 20.28 ? 40   TYR A CD1 1 
ATOM   400  C  CD2 . TYR A 1 43  ? 54.407 56.700 -17.894 1.00 19.19 ? 40   TYR A CD2 1 
ATOM   401  C  CE1 . TYR A 1 43  ? 57.075 57.206 -18.413 1.00 22.95 ? 40   TYR A CE1 1 
ATOM   402  C  CE2 . TYR A 1 43  ? 54.768 57.695 -18.795 1.00 21.55 ? 40   TYR A CE2 1 
ATOM   403  C  CZ  . TYR A 1 43  ? 56.128 57.936 -19.042 1.00 21.33 ? 40   TYR A CZ  1 
ATOM   404  O  OH  . TYR A 1 43  ? 56.437 58.911 -19.937 1.00 22.05 ? 40   TYR A OH  1 
ATOM   405  N  N   . PHE A 1 44  ? 56.088 56.995 -13.821 1.00 17.73 ? 41   PHE A N   1 
ATOM   406  C  CA  . PHE A 1 44  ? 55.884 58.253 -13.145 1.00 17.24 ? 41   PHE A CA  1 
ATOM   407  C  C   . PHE A 1 44  ? 56.218 59.381 -14.083 1.00 18.30 ? 41   PHE A C   1 
ATOM   408  O  O   . PHE A 1 44  ? 57.382 59.615 -14.343 1.00 20.22 ? 41   PHE A O   1 
ATOM   409  C  CB  . PHE A 1 44  ? 56.770 58.288 -11.899 1.00 17.93 ? 41   PHE A CB  1 
ATOM   410  C  CG  . PHE A 1 44  ? 56.700 59.553 -11.110 1.00 18.30 ? 41   PHE A CG  1 
ATOM   411  C  CD1 . PHE A 1 44  ? 55.614 59.810 -10.303 1.00 19.19 ? 41   PHE A CD1 1 
ATOM   412  C  CD2 . PHE A 1 44  ? 57.746 60.441 -11.106 1.00 20.27 ? 41   PHE A CD2 1 
ATOM   413  C  CE1 . PHE A 1 44  ? 55.555 60.958 -9.568  1.00 20.30 ? 41   PHE A CE1 1 
ATOM   414  C  CE2 . PHE A 1 44  ? 57.703 61.600 -10.338 1.00 20.99 ? 41   PHE A CE2 1 
ATOM   415  C  CZ  . PHE A 1 44  ? 56.559 61.867 -9.603  1.00 21.26 ? 41   PHE A CZ  1 
ATOM   416  N  N   . ASP A 1 45  ? 55.202 60.047 -14.618 1.00 17.70 ? 42   ASP A N   1 
ATOM   417  C  CA  . ASP A 1 45  ? 55.388 61.118 -15.611 1.00 18.24 ? 42   ASP A CA  1 
ATOM   418  C  C   . ASP A 1 45  ? 55.113 62.460 -14.979 1.00 19.01 ? 42   ASP A C   1 
ATOM   419  O  O   . ASP A 1 45  ? 53.948 62.781 -14.677 1.00 17.26 ? 42   ASP A O   1 
ATOM   420  C  CB  . ASP A 1 45  ? 54.449 60.906 -16.826 1.00 18.63 ? 42   ASP A CB  1 
ATOM   421  C  CG  . ASP A 1 45  ? 54.506 62.051 -17.806 1.00 19.21 ? 42   ASP A CG  1 
ATOM   422  O  OD1 . ASP A 1 45  ? 55.332 62.977 -17.581 1.00 20.10 ? 42   ASP A OD1 1 
ATOM   423  O  OD2 . ASP A 1 45  ? 53.698 62.028 -18.780 1.00 19.78 ? 42   ASP A OD2 1 
ATOM   424  N  N   . TYR A 1 46  ? 56.178 63.203 -14.628 1.00 19.14 ? 43   TYR A N   1 
ATOM   425  C  CA  . TYR A 1 46  ? 56.057 64.521 -14.026 1.00 18.76 ? 43   TYR A CA  1 
ATOM   426  C  C   . TYR A 1 46  ? 56.356 65.662 -14.997 1.00 18.86 ? 43   TYR A C   1 
ATOM   427  O  O   . TYR A 1 46  ? 56.505 66.813 -14.589 1.00 20.51 ? 43   TYR A O   1 
ATOM   428  C  CB  . TYR A 1 46  ? 56.864 64.574 -12.709 1.00 18.77 ? 43   TYR A CB  1 
ATOM   429  C  CG  . TYR A 1 46  ? 58.388 64.518 -12.792 1.00 19.67 ? 43   TYR A CG  1 
ATOM   430  C  CD1 . TYR A 1 46  ? 59.115 65.702 -12.677 1.00 20.98 ? 43   TYR A CD1 1 
ATOM   431  C  CD2 . TYR A 1 46  ? 59.074 63.319 -12.908 1.00 20.60 ? 43   TYR A CD2 1 
ATOM   432  C  CE1 . TYR A 1 46  ? 60.495 65.686 -12.722 1.00 22.75 ? 43   TYR A CE1 1 
ATOM   433  C  CE2 . TYR A 1 46  ? 60.485 63.299 -12.943 1.00 22.03 ? 43   TYR A CE2 1 
ATOM   434  C  CZ  . TYR A 1 46  ? 61.153 64.479 -12.875 1.00 20.78 ? 43   TYR A CZ  1 
ATOM   435  O  OH  . TYR A 1 46  ? 62.543 64.546 -12.858 1.00 24.86 ? 43   TYR A OH  1 
ATOM   436  N  N   . SER A 1 47  ? 56.299 65.344 -16.277 1.00 19.28 ? 44   SER A N   1 
ATOM   437  C  CA  . SER A 1 47  ? 56.683 66.289 -17.276 1.00 19.49 ? 44   SER A CA  1 
ATOM   438  C  C   . SER A 1 47  ? 55.715 67.465 -17.504 1.00 20.07 ? 44   SER A C   1 
ATOM   439  O  O   . SER A 1 47  ? 56.136 68.480 -18.070 1.00 20.73 ? 44   SER A O   1 
ATOM   440  C  CB  . SER A 1 47  ? 56.943 65.571 -18.611 1.00 20.19 ? 44   SER A CB  1 
ATOM   441  O  OG  . SER A 1 47  ? 55.775 65.060 -19.184 1.00 20.45 ? 44   SER A OG  1 
ATOM   442  N  N   . LYS A 1 48  ? 54.454 67.324 -17.080 1.00 19.44 ? 45   LYS A N   1 
ATOM   443  C  CA  . LYS A 1 48  ? 53.500 68.420 -17.143 1.00 18.88 ? 45   LYS A CA  1 
ATOM   444  C  C   . LYS A 1 48  ? 53.553 69.320 -15.917 1.00 19.44 ? 45   LYS A C   1 
ATOM   445  O  O   . LYS A 1 48  ? 52.661 70.133 -15.689 1.00 20.31 ? 45   LYS A O   1 
ATOM   446  C  CB  . LYS A 1 48  ? 52.079 67.930 -17.378 1.00 19.03 ? 45   LYS A CB  1 
ATOM   447  C  CG  . LYS A 1 48  ? 51.886 67.130 -18.642 1.00 18.11 ? 45   LYS A CG  1 
ATOM   448  C  CD  . LYS A 1 48  ? 50.412 66.984 -19.002 1.00 19.08 ? 45   LYS A CD  1 
ATOM   449  C  CE  . LYS A 1 48  ? 50.033 65.939 -20.033 1.00 19.97 ? 45   LYS A CE  1 
ATOM   450  N  NZ  . LYS A 1 48  ? 50.108 64.521 -19.552 1.00 18.65 ? 45   LYS A NZ  1 
ATOM   451  N  N   . ASN A 1 49  ? 54.608 69.194 -15.126 1.00 19.49 ? 46   ASN A N   1 
ATOM   452  C  CA  . ASN A 1 49  ? 54.809 70.122 -14.024 1.00 19.32 ? 46   ASN A CA  1 
ATOM   453  C  C   . ASN A 1 49  ? 55.566 71.387 -14.457 1.00 20.28 ? 46   ASN A C   1 
ATOM   454  O  O   . ASN A 1 49  ? 56.234 71.380 -15.478 1.00 20.74 ? 46   ASN A O   1 
ATOM   455  C  CB  . ASN A 1 49  ? 55.542 69.420 -12.890 1.00 18.03 ? 46   ASN A CB  1 
ATOM   456  C  CG  . ASN A 1 49  ? 54.624 68.508 -12.132 1.00 17.89 ? 46   ASN A CG  1 
ATOM   457  O  OD1 . ASN A 1 49  ? 54.675 67.263 -12.323 1.00 21.16 ? 46   ASN A OD1 1 
ATOM   458  N  ND2 . ASN A 1 49  ? 53.750 69.075 -11.330 1.00 16.54 ? 46   ASN A ND2 1 
ATOM   459  N  N   . LEU A 1 50  ? 55.394 72.441 -13.673 1.00 20.28 ? 47   LEU A N   1 
ATOM   460  C  CA  . LEU A 1 50  ? 55.950 73.757 -13.976 1.00 21.87 ? 47   LEU A CA  1 
ATOM   461  C  C   . LEU A 1 50  ? 57.425 73.840 -13.598 1.00 22.62 ? 47   LEU A C   1 
ATOM   462  O  O   . LEU A 1 50  ? 57.824 74.610 -12.722 1.00 24.25 ? 47   LEU A O   1 
ATOM   463  C  CB  . LEU A 1 50  ? 55.096 74.866 -13.375 1.00 22.35 ? 47   LEU A CB  1 
ATOM   464  C  CG  . LEU A 1 50  ? 53.665 75.046 -13.943 1.00 22.83 ? 47   LEU A CG  1 
ATOM   465  C  CD1 . LEU A 1 50  ? 52.838 75.934 -13.034 1.00 25.02 ? 47   LEU A CD1 1 
ATOM   466  C  CD2 . LEU A 1 50  ? 53.637 75.607 -15.399 1.00 24.72 ? 47   LEU A CD2 1 
ATOM   467  N  N   . ILE A 1 51  ? 58.198 73.018 -14.276 1.00 23.57 ? 48   ILE A N   1 
ATOM   468  C  CA  . ILE A 1 51  ? 59.630 72.891 -14.033 1.00 24.57 ? 48   ILE A CA  1 
ATOM   469  C  C   . ILE A 1 51  ? 60.347 72.879 -15.374 1.00 26.12 ? 48   ILE A C   1 
ATOM   470  O  O   . ILE A 1 51  ? 59.782 72.679 -16.451 1.00 25.78 ? 48   ILE A O   1 
ATOM   471  C  CB  . ILE A 1 51  ? 59.957 71.624 -13.260 1.00 25.15 ? 48   ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 51  ? 59.567 70.383 -14.095 1.00 25.18 ? 48   ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 51  ? 59.304 71.688 -11.873 1.00 24.63 ? 48   ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 51  ? 60.011 69.075 -13.528 1.00 28.40 ? 48   ILE A CD1 1 
ATOM   475  N  N   . ASN A 1 52  ? 61.639 73.199 -15.291 1.00 27.78 ? 49   ASN A N   1 
ATOM   476  C  CA  . ASN A 1 52  ? 62.589 72.951 -16.334 1.00 28.28 ? 49   ASN A CA  1 
ATOM   477  C  C   . ASN A 1 52  ? 63.866 72.432 -15.634 1.00 27.59 ? 49   ASN A C   1 
ATOM   478  O  O   . ASN A 1 52  ? 63.901 72.185 -14.437 1.00 25.49 ? 49   ASN A O   1 
ATOM   479  C  CB  . ASN A 1 52  ? 62.820 74.223 -17.133 1.00 29.27 ? 49   ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 52  ? 63.347 75.396 -16.298 1.00 31.03 ? 49   ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 52  ? 63.713 75.252 -15.146 1.00 30.59 ? 49   ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 52  ? 63.464 76.561 -16.939 1.00 28.92 ? 49   ASN A ND2 1 
ATOM   483  N  N   . ASP A 1 53  ? 64.952 72.310 -16.386 1.00 27.84 ? 50   ASP A N   1 
ATOM   484  C  CA  . ASP A 1 53  ? 66.165 71.789 -15.790 1.00 29.27 ? 50   ASP A CA  1 
ATOM   485  C  C   . ASP A 1 53  ? 66.628 72.659 -14.600 1.00 29.40 ? 50   ASP A C   1 
ATOM   486  O  O   . ASP A 1 53  ? 67.046 72.142 -13.598 1.00 27.92 ? 50   ASP A O   1 
ATOM   487  C  CB  . ASP A 1 53  ? 67.319 71.802 -16.798 1.00 30.87 ? 50   ASP A CB  1 
ATOM   488  C  CG  . ASP A 1 53  ? 67.148 70.794 -17.956 1.00 35.97 ? 50   ASP A CG  1 
ATOM   489  O  OD1 . ASP A 1 53  ? 66.487 69.777 -17.810 1.00 39.38 ? 50   ASP A OD1 1 
ATOM   490  O  OD2 . ASP A 1 53  ? 67.778 71.011 -19.025 1.00 44.40 ? 50   ASP A OD2 1 
ATOM   491  N  N   . TYR A 1 54  ? 66.599 73.968 -14.731 1.00 29.78 ? 51   TYR A N   1 
ATOM   492  C  CA  . TYR A 1 54  ? 67.130 74.860 -13.676 1.00 29.87 ? 51   TYR A CA  1 
ATOM   493  C  C   . TYR A 1 54  ? 66.337 74.749 -12.383 1.00 29.06 ? 51   TYR A C   1 
ATOM   494  O  O   . TYR A 1 54  ? 66.900 74.679 -11.301 1.00 27.99 ? 51   TYR A O   1 
ATOM   495  C  CB  . TYR A 1 54  ? 67.073 76.265 -14.155 1.00 30.86 ? 51   TYR A CB  1 
ATOM   496  C  CG  . TYR A 1 54  ? 67.348 77.297 -13.159 1.00 32.34 ? 51   TYR A CG  1 
ATOM   497  C  CD1 . TYR A 1 54  ? 68.602 77.353 -12.505 1.00 34.90 ? 51   TYR A CD1 1 
ATOM   498  C  CD2 . TYR A 1 54  ? 66.424 78.271 -12.891 1.00 33.63 ? 51   TYR A CD2 1 
ATOM   499  C  CE1 . TYR A 1 54  ? 68.891 78.391 -11.640 1.00 39.37 ? 51   TYR A CE1 1 
ATOM   500  C  CE2 . TYR A 1 54  ? 66.688 79.297 -11.996 1.00 39.52 ? 51   TYR A CE2 1 
ATOM   501  C  CZ  . TYR A 1 54  ? 67.954 79.380 -11.417 1.00 39.81 ? 51   TYR A CZ  1 
ATOM   502  O  OH  . TYR A 1 54  ? 68.237 80.415 -10.566 1.00 44.22 ? 51   TYR A OH  1 
ATOM   503  N  N   . ILE A 1 55  ? 65.027 74.649 -12.523 1.00 26.44 ? 52   ILE A N   1 
ATOM   504  C  CA  . ILE A 1 55  ? 64.199 74.529 -11.339 1.00 24.98 ? 52   ILE A CA  1 
ATOM   505  C  C   . ILE A 1 55  ? 64.418 73.191 -10.692 1.00 25.71 ? 52   ILE A C   1 
ATOM   506  O  O   . ILE A 1 55  ? 64.543 73.114 -9.485  1.00 25.03 ? 52   ILE A O   1 
ATOM   507  C  CB  . ILE A 1 55  ? 62.726 74.736 -11.703 1.00 25.37 ? 52   ILE A CB  1 
ATOM   508  C  CG1 . ILE A 1 55  ? 62.488 76.183 -12.111 1.00 25.05 ? 52   ILE A CG1 1 
ATOM   509  C  CG2 . ILE A 1 55  ? 61.849 74.342 -10.530 1.00 24.11 ? 52   ILE A CG2 1 
ATOM   510  C  CD1 . ILE A 1 55  ? 61.127 76.412 -12.875 1.00 27.47 ? 52   ILE A CD1 1 
ATOM   511  N  N   . LEU A 1 56  ? 64.479 72.115 -11.481 1.00 25.90 ? 53   LEU A N   1 
ATOM   512  C  CA  . LEU A 1 56  ? 64.630 70.803 -10.877 1.00 25.99 ? 53   LEU A CA  1 
ATOM   513  C  C   . LEU A 1 56  ? 65.965 70.708 -10.219 1.00 26.88 ? 53   LEU A C   1 
ATOM   514  O  O   . LEU A 1 56  ? 66.115 70.149 -9.150  1.00 26.30 ? 53   LEU A O   1 
ATOM   515  C  CB  . LEU A 1 56  ? 64.503 69.694 -11.896 1.00 26.76 ? 53   LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 56  ? 64.574 68.242 -11.422 1.00 32.08 ? 53   LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 56  ? 63.472 67.991 -10.388 1.00 34.24 ? 53   LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 56  ? 64.478 67.255 -12.561 1.00 34.65 ? 53   LEU A CD2 1 
ATOM   519  N  N   . LYS A 1 57  ? 66.989 71.271 -10.852 1.00 28.23 ? 54   LYS A N   1 
ATOM   520  C  CA  A LYS A 1 57  ? 68.326 71.268 -10.259 0.70 28.71 ? 54   LYS A CA  1 
ATOM   521  C  CA  B LYS A 1 57  ? 68.291 71.154 -10.228 0.30 28.60 ? 54   LYS A CA  1 
ATOM   522  C  C   . LYS A 1 57  ? 68.377 71.948 -8.923  1.00 28.43 ? 54   LYS A C   1 
ATOM   523  O  O   . LYS A 1 57  ? 69.043 71.477 -7.959  1.00 28.56 ? 54   LYS A O   1 
ATOM   524  C  CB  A LYS A 1 57  ? 69.339 71.972 -11.176 0.70 30.31 ? 54   LYS A CB  1 
ATOM   525  C  CB  B LYS A 1 57  ? 69.434 71.441 -11.211 0.30 29.74 ? 54   LYS A CB  1 
ATOM   526  C  CG  A LYS A 1 57  ? 70.691 72.260 -10.510 0.70 34.39 ? 54   LYS A CG  1 
ATOM   527  C  CG  B LYS A 1 57  ? 70.249 70.180 -11.533 0.30 31.52 ? 54   LYS A CG  1 
ATOM   528  C  CD  A LYS A 1 57  ? 71.702 72.661 -11.572 0.70 39.09 ? 54   LYS A CD  1 
ATOM   529  C  CD  B LYS A 1 57  ? 69.395 68.901 -11.391 0.30 30.40 ? 54   LYS A CD  1 
ATOM   530  C  CE  A LYS A 1 57  ? 72.253 71.409 -12.262 0.70 43.30 ? 54   LYS A CE  1 
ATOM   531  C  CE  B LYS A 1 57  ? 70.058 67.689 -11.998 0.30 31.13 ? 54   LYS A CE  1 
ATOM   532  N  NZ  A LYS A 1 57  ? 73.232 70.648 -11.406 0.70 44.73 ? 54   LYS A NZ  1 
ATOM   533  N  NZ  B LYS A 1 57  ? 69.108 66.639 -12.481 0.30 29.29 ? 54   LYS A NZ  1 
ATOM   534  N  N   . SER A 1 58  ? 67.714 73.079 -8.850  1.00 28.43 ? 55   SER A N   1 
ATOM   535  C  CA  A SER A 1 58  ? 67.672 73.872 -7.616  0.60 29.07 ? 55   SER A CA  1 
ATOM   536  C  CA  B SER A 1 58  ? 67.718 73.847 -7.624  0.40 28.48 ? 55   SER A CA  1 
ATOM   537  C  C   . SER A 1 58  ? 66.987 73.075 -6.522  1.00 28.49 ? 55   SER A C   1 
ATOM   538  O  O   . SER A 1 58  ? 67.434 73.051 -5.391  1.00 26.29 ? 55   SER A O   1 
ATOM   539  C  CB  A SER A 1 58  ? 66.954 75.205 -7.823  0.60 30.47 ? 55   SER A CB  1 
ATOM   540  C  CB  B SER A 1 58  ? 67.131 75.225 -7.876  0.40 29.52 ? 55   SER A CB  1 
ATOM   541  O  OG  A SER A 1 58  ? 66.877 75.950 -6.605  0.60 33.51 ? 55   SER A OG  1 
ATOM   542  O  OG  B SER A 1 58  ? 67.767 75.818 -9.000  0.40 29.72 ? 55   SER A OG  1 
ATOM   543  N  N   . LEU A 1 59  ? 65.871 72.448 -6.867  1.00 25.33 ? 56   LEU A N   1 
ATOM   544  C  CA  . LEU A 1 59  ? 65.161 71.649 -5.887  1.00 24.14 ? 56   LEU A CA  1 
ATOM   545  C  C   . LEU A 1 59  ? 66.016 70.467 -5.436  1.00 24.47 ? 56   LEU A C   1 
ATOM   546  O  O   . LEU A 1 59  ? 66.057 70.130 -4.227  1.00 24.39 ? 56   LEU A O   1 
ATOM   547  C  CB  . LEU A 1 59  ? 63.801 71.174 -6.441  1.00 21.86 ? 56   LEU A CB  1 
ATOM   548  C  CG  . LEU A 1 59  ? 62.826 72.290 -6.757  1.00 22.63 ? 56   LEU A CG  1 
ATOM   549  C  CD1 . LEU A 1 59  ? 61.631 71.653 -7.515  1.00 23.94 ? 56   LEU A CD1 1 
ATOM   550  C  CD2 . LEU A 1 59  ? 62.417 73.075 -5.560  1.00 27.51 ? 56   LEU A CD2 1 
ATOM   551  N  N   . LEU A 1 60  ? 66.610 69.744 -6.353  1.00 24.43 ? 57   LEU A N   1 
ATOM   552  C  CA  . LEU A 1 60  ? 67.480 68.631 -5.961  1.00 25.30 ? 57   LEU A CA  1 
ATOM   553  C  C   . LEU A 1 60  ? 68.671 69.068 -5.101  1.00 27.44 ? 57   LEU A C   1 
ATOM   554  O  O   . LEU A 1 60  ? 69.059 68.335 -4.179  1.00 26.17 ? 57   LEU A O   1 
ATOM   555  C  CB  . LEU A 1 60  ? 67.955 67.843 -7.164  1.00 26.14 ? 57   LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 60  ? 66.882 67.047 -7.928  1.00 26.50 ? 57   LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 60  ? 67.315 66.616 -9.318  1.00 28.13 ? 57   LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 60  ? 66.542 65.826 -7.132  1.00 24.31 ? 57   LEU A CD2 1 
ATOM   559  N  N   . GLU A 1 61  ? 69.247 70.241 -5.388  1.00 28.08 ? 58   GLU A N   1 
ATOM   560  C  CA  . GLU A 1 61  ? 70.303 70.800 -4.493  1.00 30.80 ? 58   GLU A CA  1 
ATOM   561  C  C   . GLU A 1 61  ? 69.830 70.980 -3.094  1.00 30.83 ? 58   GLU A C   1 
ATOM   562  O  O   . GLU A 1 61  ? 70.544 70.665 -2.176  1.00 30.25 ? 58   GLU A O   1 
ATOM   563  C  CB  . GLU A 1 61  ? 70.807 72.148 -4.993  1.00 32.93 ? 58   GLU A CB  1 
ATOM   564  C  CG  . GLU A 1 61  ? 71.661 72.020 -6.159  1.00 37.92 ? 58   GLU A CG  1 
ATOM   565  C  CD  . GLU A 1 61  ? 72.055 73.371 -6.767  1.00 43.74 ? 58   GLU A CD  1 
ATOM   566  O  OE1 . GLU A 1 61  ? 71.401 74.441 -6.517  1.00 45.51 ? 58   GLU A OE1 1 
ATOM   567  O  OE2 . GLU A 1 61  ? 73.014 73.322 -7.542  1.00 42.87 ? 58   GLU A OE2 1 
ATOM   568  N  N   . SER A 1 62  ? 68.610 71.459 -2.908  1.00 30.45 ? 59   SER A N   1 
ATOM   569  C  CA  A SER A 1 62  ? 68.018 71.590 -1.582  0.70 30.67 ? 59   SER A CA  1 
ATOM   570  C  CA  B SER A 1 62  ? 68.041 71.596 -1.571  0.30 30.29 ? 59   SER A CA  1 
ATOM   571  C  C   . SER A 1 62  ? 67.938 70.222 -0.899  1.00 29.22 ? 59   SER A C   1 
ATOM   572  O  O   . SER A 1 62  ? 68.302 70.077 0.280   1.00 30.19 ? 59   SER A O   1 
ATOM   573  C  CB  A SER A 1 62  ? 66.623 72.237 -1.663  0.70 31.04 ? 59   SER A CB  1 
ATOM   574  C  CB  B SER A 1 62  ? 66.670 72.290 -1.605  0.30 30.31 ? 59   SER A CB  1 
ATOM   575  O  OG  A SER A 1 62  ? 66.754 73.538 -2.188  0.70 34.25 ? 59   SER A OG  1 
ATOM   576  O  OG  B SER A 1 62  ? 65.723 71.503 -2.292  0.30 30.84 ? 59   SER A OG  1 
ATOM   577  N  N   . ALA A 1 63  ? 67.481 69.213 -1.628  1.00 27.19 ? 60   ALA A N   1 
ATOM   578  C  CA  . ALA A 1 63  ? 67.417 67.860 -1.054  1.00 24.87 ? 60   ALA A CA  1 
ATOM   579  C  C   . ALA A 1 63  ? 68.819 67.389 -0.691  1.00 25.94 ? 60   ALA A C   1 
ATOM   580  O  O   . ALA A 1 63  ? 69.021 66.826 0.397   1.00 26.28 ? 60   ALA A O   1 
ATOM   581  C  CB  . ALA A 1 63  ? 66.744 66.873 -2.026  1.00 24.07 ? 60   ALA A CB  1 
ATOM   582  N  N   . GLU A 1 64  ? 69.761 67.607 -1.575  1.00 25.12 ? 61   GLU A N   1 
ATOM   583  C  CA  . GLU A 1 64  ? 71.150 67.145 -1.313  1.00 26.00 ? 61   GLU A CA  1 
ATOM   584  C  C   . GLU A 1 64  ? 71.760 67.853 -0.129  1.00 27.31 ? 61   GLU A C   1 
ATOM   585  O  O   . GLU A 1 64  ? 72.587 67.231 0.625   1.00 27.92 ? 61   GLU A O   1 
ATOM   586  C  CB  . GLU A 1 64  ? 72.012 67.324 -2.554  1.00 26.92 ? 61   GLU A CB  1 
ATOM   587  C  CG  . GLU A 1 64  ? 71.636 66.399 -3.742  1.00 26.42 ? 61   GLU A CG  1 
ATOM   588  C  CD  . GLU A 1 64  ? 71.940 64.921 -3.574  1.00 33.51 ? 61   GLU A CD  1 
ATOM   589  O  OE1 . GLU A 1 64  ? 72.679 64.557 -2.624  1.00 34.51 ? 61   GLU A OE1 1 
ATOM   590  O  OE2 . GLU A 1 64  ? 71.463 64.127 -4.425  1.00 32.57 ? 61   GLU A OE2 1 
ATOM   591  N  N   . LYS A 1 65  ? 71.416 69.126 0.076   1.00 27.81 ? 62   LYS A N   1 
ATOM   592  C  CA  A LYS A 1 65  ? 71.983 69.934 1.160   0.70 29.79 ? 62   LYS A CA  1 
ATOM   593  C  CA  B LYS A 1 65  ? 72.008 69.933 1.135   0.30 29.35 ? 62   LYS A CA  1 
ATOM   594  C  C   . LYS A 1 65  ? 71.338 69.655 2.501   1.00 29.41 ? 62   LYS A C   1 
ATOM   595  O  O   . LYS A 1 65  ? 71.896 69.974 3.562   1.00 30.99 ? 62   LYS A O   1 
ATOM   596  C  CB  A LYS A 1 65  ? 71.904 71.442 0.844   0.70 31.40 ? 62   LYS A CB  1 
ATOM   597  C  CB  B LYS A 1 65  ? 71.937 71.426 0.753   0.30 30.30 ? 62   LYS A CB  1 
ATOM   598  C  CG  A LYS A 1 65  ? 73.032 71.926 -0.035  0.70 35.39 ? 62   LYS A CG  1 
ATOM   599  C  CG  B LYS A 1 65  ? 72.758 71.869 -0.512  0.30 31.79 ? 62   LYS A CG  1 
ATOM   600  C  CD  A LYS A 1 65  ? 72.800 73.322 -0.636  0.70 37.73 ? 62   LYS A CD  1 
ATOM   601  C  CD  B LYS A 1 65  ? 73.181 70.718 -1.453  0.30 32.58 ? 62   LYS A CD  1 
ATOM   602  C  CE  A LYS A 1 65  ? 73.885 73.628 -1.668  0.70 40.54 ? 62   LYS A CE  1 
ATOM   603  C  CE  B LYS A 1 65  ? 73.643 71.171 -2.821  0.30 32.12 ? 62   LYS A CE  1 
ATOM   604  N  NZ  A LYS A 1 65  ? 73.439 74.568 -2.726  0.70 43.65 ? 62   LYS A NZ  1 
ATOM   605  N  NZ  B LYS A 1 65  ? 73.943 69.989 -3.692  0.30 29.54 ? 62   LYS A NZ  1 
ATOM   606  N  N   . SER A 1 66  ? 70.158 69.043 2.460   1.00 27.23 ? 63   SER A N   1 
ATOM   607  C  CA  . SER A 1 66  ? 69.387 68.759 3.640   1.00 26.27 ? 63   SER A CA  1 
ATOM   608  C  C   . SER A 1 66  ? 69.936 67.517 4.364   1.00 26.28 ? 63   SER A C   1 
ATOM   609  O  O   . SER A 1 66  ? 70.859 66.858 3.897   1.00 25.10 ? 63   SER A O   1 
ATOM   610  C  CB  . SER A 1 66  ? 67.921 68.499 3.272   1.00 26.56 ? 63   SER A CB  1 
ATOM   611  O  OG  . SER A 1 66  ? 67.754 67.204 2.693   1.00 23.89 ? 63   SER A OG  1 
ATOM   612  N  N   . SER A 1 67  ? 69.242 67.188 5.443   1.00 25.73 ? 64   SER A N   1 
ATOM   613  C  CA  . SER A 1 67  ? 69.555 65.987 6.209   1.00 25.81 ? 64   SER A CA  1 
ATOM   614  C  C   . SER A 1 67  ? 68.927 64.720 5.636   1.00 24.02 ? 64   SER A C   1 
ATOM   615  O  O   . SER A 1 67  ? 68.990 63.674 6.257   1.00 22.61 ? 64   SER A O   1 
ATOM   616  C  CB  . SER A 1 67  ? 69.101 66.193 7.642   1.00 26.15 ? 64   SER A CB  1 
ATOM   617  O  OG  . SER A 1 67  ? 67.713 66.350 7.700   1.00 29.22 ? 64   SER A OG  1 
ATOM   618  N  N   . LEU A 1 68  ? 68.303 64.810 4.462   1.00 22.70 ? 65   LEU A N   1 
ATOM   619  C  CA  . LEU A 1 68  ? 67.506 63.717 3.954   1.00 20.33 ? 65   LEU A CA  1 
ATOM   620  C  C   . LEU A 1 68  ? 68.268 62.402 3.823   1.00 20.17 ? 65   LEU A C   1 
ATOM   621  O  O   . LEU A 1 68  ? 67.773 61.376 4.251   1.00 21.25 ? 65   LEU A O   1 
ATOM   622  C  CB  . LEU A 1 68  ? 66.866 64.092 2.613   1.00 20.23 ? 65   LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 68  ? 65.951 63.043 2.004   1.00 20.18 ? 65   LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 68  ? 64.779 62.678 2.932   1.00 18.90 ? 65   LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 68  ? 65.382 63.582 0.656   1.00 21.29 ? 65   LEU A CD2 1 
ATOM   626  N  N   . LYS A 1 69  ? 69.469 62.432 3.245   1.00 21.81 ? 66   LYS A N   1 
ATOM   627  C  CA  . LYS A 1 69  ? 70.251 61.234 3.061   1.00 21.78 ? 66   LYS A CA  1 
ATOM   628  C  C   . LYS A 1 69  ? 70.426 60.519 4.425   1.00 20.98 ? 66   LYS A C   1 
ATOM   629  O  O   . LYS A 1 69  ? 70.199 59.287 4.552   1.00 20.11 ? 66   LYS A O   1 
ATOM   630  C  CB  . LYS A 1 69  ? 71.593 61.604 2.464   1.00 23.81 ? 66   LYS A CB  1 
ATOM   631  C  CG  . LYS A 1 69  ? 72.613 60.488 2.446   1.00 25.64 ? 66   LYS A CG  1 
ATOM   632  C  CD  . LYS A 1 69  ? 74.014 60.980 2.047   1.00 28.91 ? 66   LYS A CD  1 
ATOM   633  C  CE  . LYS A 1 69  ? 74.691 61.979 3.129   1.00 31.76 ? 66   LYS A CE  1 
ATOM   634  N  NZ  . LYS A 1 69  ? 76.151 62.381 2.872   1.00 32.70 ? 66   LYS A NZ  1 
ATOM   635  N  N   . ASP A 1 70  ? 70.773 61.287 5.445   1.00 22.47 ? 67   ASP A N   1 
ATOM   636  C  CA  A ASP A 1 70  ? 70.965 60.723 6.793   0.60 22.11 ? 67   ASP A CA  1 
ATOM   637  C  CA  B ASP A 1 70  ? 70.975 60.675 6.753   0.40 22.30 ? 67   ASP A CA  1 
ATOM   638  C  C   . ASP A 1 70  ? 69.649 60.220 7.366   1.00 20.82 ? 67   ASP A C   1 
ATOM   639  O  O   . ASP A 1 70  ? 69.595 59.133 8.010   1.00 20.19 ? 67   ASP A O   1 
ATOM   640  C  CB  A ASP A 1 70  ? 71.524 61.760 7.766   0.60 22.16 ? 67   ASP A CB  1 
ATOM   641  C  CB  B ASP A 1 70  ? 71.691 61.613 7.704   0.40 22.99 ? 67   ASP A CB  1 
ATOM   642  C  CG  A ASP A 1 70  ? 72.956 62.155 7.447   0.60 27.05 ? 67   ASP A CG  1 
ATOM   643  C  CG  B ASP A 1 70  ? 72.306 60.881 8.879   0.40 26.74 ? 67   ASP A CG  1 
ATOM   644  O  OD1 A ASP A 1 70  ? 73.677 61.366 6.825   0.60 29.56 ? 67   ASP A OD1 1 
ATOM   645  O  OD1 B ASP A 1 70  ? 72.981 59.830 8.683   0.40 31.20 ? 67   ASP A OD1 1 
ATOM   646  O  OD2 A ASP A 1 70  ? 73.320 63.282 7.800   0.60 32.15 ? 67   ASP A OD2 1 
ATOM   647  O  OD2 B ASP A 1 70  ? 72.101 61.370 10.001  0.40 30.26 ? 67   ASP A OD2 1 
ATOM   648  N  N   . LYS A 1 71  ? 68.583 61.017 7.169   1.00 20.02 ? 68   LYS A N   1 
ATOM   649  C  CA  . LYS A 1 71  ? 67.283 60.652 7.737   1.00 20.13 ? 68   LYS A CA  1 
ATOM   650  C  C   . LYS A 1 71  ? 66.720 59.374 7.146   1.00 18.05 ? 68   LYS A C   1 
ATOM   651  O  O   . LYS A 1 71  ? 66.080 58.593 7.861   1.00 18.42 ? 68   LYS A O   1 
ATOM   652  C  CB  . LYS A 1 71  ? 66.277 61.788 7.646   1.00 21.22 ? 68   LYS A CB  1 
ATOM   653  C  CG  . LYS A 1 71  ? 66.569 62.967 8.552   1.00 26.00 ? 68   LYS A CG  1 
ATOM   654  C  CD  . LYS A 1 71  ? 66.461 62.618 10.018  1.00 33.83 ? 68   LYS A CD  1 
ATOM   655  C  CE  . LYS A 1 71  ? 66.873 63.771 10.912  1.00 39.07 ? 68   LYS A CE  1 
ATOM   656  N  NZ  . LYS A 1 71  ? 67.238 63.191 12.243  1.00 43.31 ? 68   LYS A NZ  1 
ATOM   657  N  N   . ILE A 1 72  ? 66.947 59.126 5.847   1.00 18.50 ? 69   ILE A N   1 
ATOM   658  C  CA  . ILE A 1 72  ? 66.525 57.856 5.236   1.00 17.78 ? 69   ILE A CA  1 
ATOM   659  C  C   . ILE A 1 72  ? 67.205 56.659 5.957   1.00 19.17 ? 69   ILE A C   1 
ATOM   660  O  O   . ILE A 1 72  ? 66.582 55.683 6.328   1.00 18.53 ? 69   ILE A O   1 
ATOM   661  C  CB  . ILE A 1 72  ? 66.784 57.838 3.709   1.00 18.56 ? 69   ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 72  ? 65.951 58.892 3.036   1.00 18.42 ? 69   ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 72  ? 66.481 56.482 3.147   1.00 21.98 ? 69   ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 72  ? 66.270 59.090 1.536   1.00 20.91 ? 69   ILE A CD1 1 
ATOM   665  N  N   . LYS A 1 73  ? 68.504 56.771 6.140   1.00 19.28 ? 70   LYS A N   1 
ATOM   666  C  CA  A LYS A 1 73  ? 69.253 55.722 6.799   0.70 21.35 ? 70   LYS A CA  1 
ATOM   667  C  CA  B LYS A 1 73  ? 69.274 55.738 6.790   0.30 20.05 ? 70   LYS A CA  1 
ATOM   668  C  C   . LYS A 1 73  ? 68.740 55.526 8.208   1.00 19.68 ? 70   LYS A C   1 
ATOM   669  O  O   . LYS A 1 73  ? 68.526 54.389 8.657   1.00 20.33 ? 70   LYS A O   1 
ATOM   670  C  CB  A LYS A 1 73  ? 70.759 56.025 6.811   0.70 23.00 ? 70   LYS A CB  1 
ATOM   671  C  CB  B LYS A 1 73  ? 70.756 56.136 6.787   0.30 20.90 ? 70   LYS A CB  1 
ATOM   672  C  CG  A LYS A 1 73  ? 71.380 55.884 5.465   0.70 26.56 ? 70   LYS A CG  1 
ATOM   673  C  CG  B LYS A 1 73  ? 71.671 55.186 7.512   0.30 20.16 ? 70   LYS A CG  1 
ATOM   674  C  CD  A LYS A 1 73  ? 72.896 56.018 5.461   0.70 30.39 ? 70   LYS A CD  1 
ATOM   675  C  CD  B LYS A 1 73  ? 73.140 55.614 7.374   0.30 22.67 ? 70   LYS A CD  1 
ATOM   676  C  CE  A LYS A 1 73  ? 73.429 55.877 4.039   0.70 33.74 ? 70   LYS A CE  1 
ATOM   677  C  CE  B LYS A 1 73  ? 74.017 54.804 8.306   0.30 24.88 ? 70   LYS A CE  1 
ATOM   678  N  NZ  A LYS A 1 73  ? 73.068 57.024 3.107   0.70 31.81 ? 70   LYS A NZ  1 
ATOM   679  N  NZ  B LYS A 1 73  ? 75.449 55.181 8.192   0.30 28.02 ? 70   LYS A NZ  1 
ATOM   680  N  N   . GLN A 1 74  ? 68.501 56.626 8.921   1.00 19.31 ? 71   GLN A N   1 
ATOM   681  C  CA  . GLN A 1 74  ? 68.006 56.579 10.317  1.00 19.25 ? 71   GLN A CA  1 
ATOM   682  C  C   . GLN A 1 74  ? 66.640 55.874 10.403  1.00 19.33 ? 71   GLN A C   1 
ATOM   683  O  O   . GLN A 1 74  ? 66.388 55.086 11.315  1.00 18.96 ? 71   GLN A O   1 
ATOM   684  C  CB  . GLN A 1 74  ? 67.894 57.962 10.936  1.00 19.71 ? 71   GLN A CB  1 
ATOM   685  C  CG  . GLN A 1 74  ? 69.284 58.576 11.253  1.00 22.66 ? 71   GLN A CG  1 
ATOM   686  C  CD  . GLN A 1 74  ? 69.212 60.036 11.698  1.00 27.65 ? 71   GLN A CD  1 
ATOM   687  O  OE1 . GLN A 1 74  ? 68.192 60.521 12.168  1.00 36.06 ? 71   GLN A OE1 1 
ATOM   688  N  NE2 . GLN A 1 74  ? 70.349 60.726 11.592  1.00 33.99 ? 71   GLN A NE2 1 
ATOM   689  N  N   . MET A 1 75  ? 65.743 56.206 9.470   1.00 17.68 ? 72   MET A N   1 
ATOM   690  C  CA  . MET A 1 75  ? 64.436 55.580 9.475   1.00 18.06 ? 72   MET A CA  1 
ATOM   691  C  C   . MET A 1 75  ? 64.611 54.070 9.362   1.00 18.14 ? 72   MET A C   1 
ATOM   692  O  O   . MET A 1 75  ? 64.113 53.288 10.214  1.00 16.95 ? 72   MET A O   1 
ATOM   693  C  CB  . MET A 1 75  ? 63.561 56.050 8.307   1.00 18.08 ? 72   MET A CB  1 
ATOM   694  C  CG  . MET A 1 75  ? 62.306 55.140 8.209   1.00 16.42 ? 72   MET A CG  1 
ATOM   695  S  SD  . MET A 1 75  ? 61.149 55.565 6.877   1.00 21.06 ? 72   MET A SD  1 
ATOM   696  C  CE  . MET A 1 75  ? 60.383 56.809 7.665   1.00 18.50 ? 72   MET A CE  1 
ATOM   697  N  N   . PHE A 1 76  ? 65.350 53.635 8.342   1.00 18.39 ? 73   PHE A N   1 
ATOM   698  C  CA  . PHE A 1 76  ? 65.424 52.180 8.098   1.00 18.22 ? 73   PHE A CA  1 
ATOM   699  C  C   . PHE A 1 76  ? 66.172 51.441 9.208   1.00 19.70 ? 73   PHE A C   1 
ATOM   700  O  O   . PHE A 1 76  ? 65.888 50.247 9.439   1.00 20.26 ? 73   PHE A O   1 
ATOM   701  C  CB  . PHE A 1 76  ? 66.038 51.898 6.705   1.00 19.10 ? 73   PHE A CB  1 
ATOM   702  C  CG  . PHE A 1 76  ? 65.074 52.016 5.570   1.00 18.81 ? 73   PHE A CG  1 
ATOM   703  C  CD1 . PHE A 1 76  ? 64.366 50.907 5.143   1.00 18.31 ? 73   PHE A CD1 1 
ATOM   704  C  CD2 . PHE A 1 76  ? 64.885 53.217 4.888   1.00 19.67 ? 73   PHE A CD2 1 
ATOM   705  C  CE1 . PHE A 1 76  ? 63.511 51.002 4.074   1.00 18.25 ? 73   PHE A CE1 1 
ATOM   706  C  CE2 . PHE A 1 76  ? 64.011 53.288 3.841   1.00 19.64 ? 73   PHE A CE2 1 
ATOM   707  C  CZ  . PHE A 1 76  ? 63.292 52.161 3.447   1.00 18.86 ? 73   PHE A CZ  1 
ATOM   708  N  N   . ASN A 1 77  ? 67.124 52.113 9.851   1.00 19.42 ? 74   ASN A N   1 
ATOM   709  C  CA  . ASN A 1 77  ? 67.962 51.516 10.891  1.00 18.68 ? 74   ASN A CA  1 
ATOM   710  C  C   . ASN A 1 77  ? 67.316 51.483 12.266  1.00 17.33 ? 74   ASN A C   1 
ATOM   711  O  O   . ASN A 1 77  ? 67.919 51.018 13.218  1.00 18.89 ? 74   ASN A O   1 
ATOM   712  C  CB  . ASN A 1 77  ? 69.290 52.241 10.958  1.00 20.64 ? 74   ASN A CB  1 
ATOM   713  C  CG  . ASN A 1 77  ? 70.237 51.819 9.861   1.00 26.23 ? 74   ASN A CG  1 
ATOM   714  O  OD1 . ASN A 1 77  ? 70.068 50.758 9.234   1.00 32.08 ? 74   ASN A OD1 1 
ATOM   715  N  ND2 . ASN A 1 77  ? 71.250 52.675 9.613   1.00 29.83 ? 74   ASN A ND2 1 
ATOM   716  N  N   . GLY A 1 78  ? 66.148 52.093 12.384  1.00 18.01 ? 75   GLY A N   1 
ATOM   717  C  CA  . GLY A 1 78  ? 65.412 52.110 13.650  1.00 17.53 ? 75   GLY A CA  1 
ATOM   718  C  C   . GLY A 1 78  ? 65.819 53.160 14.647  1.00 17.44 ? 75   GLY A C   1 
ATOM   719  O  O   . GLY A 1 78  ? 65.570 53.022 15.853  1.00 18.71 ? 75   GLY A O   1 
ATOM   720  N  N   . ALA A 1 79  ? 66.468 54.214 14.172  1.00 18.34 ? 76   ALA A N   1 
ATOM   721  C  CA  . ALA A 1 79  ? 66.720 55.357 15.029  1.00 17.78 ? 76   ALA A CA  1 
ATOM   722  C  C   . ALA A 1 79  ? 65.395 55.980 15.458  1.00 19.11 ? 76   ALA A C   1 
ATOM   723  O  O   . ALA A 1 79  ? 64.381 55.868 14.777  1.00 17.65 ? 76   ALA A O   1 
ATOM   724  C  CB  . ALA A 1 79  ? 67.601 56.410 14.283  1.00 20.38 ? 76   ALA A CB  1 
ATOM   725  N  N   . LYS A 1 80  ? 65.408 56.670 16.586  1.00 20.65 ? 77   LYS A N   1 
ATOM   726  C  CA  A LYS A 1 80  ? 64.197 57.199 17.171  0.70 20.90 ? 77   LYS A CA  1 
ATOM   727  C  CA  B LYS A 1 80  ? 64.199 57.210 17.179  0.30 20.80 ? 77   LYS A CA  1 
ATOM   728  C  C   . LYS A 1 80  ? 63.859 58.557 16.545  1.00 20.67 ? 77   LYS A C   1 
ATOM   729  O  O   . LYS A 1 80  ? 63.865 59.614 17.207  1.00 22.54 ? 77   LYS A O   1 
ATOM   730  C  CB  A LYS A 1 80  ? 64.306 57.228 18.699  0.70 21.02 ? 77   LYS A CB  1 
ATOM   731  C  CB  B LYS A 1 80  ? 64.346 57.309 18.699  0.30 21.26 ? 77   LYS A CB  1 
ATOM   732  C  CG  A LYS A 1 80  ? 64.375 55.825 19.280  0.70 25.17 ? 77   LYS A CG  1 
ATOM   733  C  CG  B LYS A 1 80  ? 64.514 55.955 19.367  0.30 23.49 ? 77   LYS A CG  1 
ATOM   734  C  CD  A LYS A 1 80  ? 64.468 55.830 20.820  0.70 30.33 ? 77   LYS A CD  1 
ATOM   735  C  CD  B LYS A 1 80  ? 64.778 56.080 20.875  0.30 26.25 ? 77   LYS A CD  1 
ATOM   736  C  CE  A LYS A 1 80  ? 64.270 54.426 21.354  0.70 34.78 ? 77   LYS A CE  1 
ATOM   737  C  CE  B LYS A 1 80  ? 64.487 54.768 21.590  0.30 29.16 ? 77   LYS A CE  1 
ATOM   738  N  NZ  A LYS A 1 80  ? 65.420 53.590 20.894  0.70 36.27 ? 77   LYS A NZ  1 
ATOM   739  N  NZ  B LYS A 1 80  ? 64.674 54.826 23.060  0.30 29.87 ? 77   LYS A NZ  1 
ATOM   740  N  N   . ILE A 1 81  ? 63.533 58.508 15.262  1.00 19.33 ? 78   ILE A N   1 
ATOM   741  C  CA  . ILE A 1 81  ? 63.188 59.724 14.506  1.00 18.93 ? 78   ILE A CA  1 
ATOM   742  C  C   . ILE A 1 81  ? 61.862 60.330 14.858  1.00 20.14 ? 78   ILE A C   1 
ATOM   743  O  O   . ILE A 1 81  ? 61.647 61.512 14.542  1.00 21.87 ? 78   ILE A O   1 
ATOM   744  C  CB  . ILE A 1 81  ? 63.358 59.523 12.985  1.00 20.58 ? 78   ILE A CB  1 
ATOM   745  C  CG1 . ILE A 1 81  ? 62.358 58.573 12.423  1.00 20.12 ? 78   ILE A CG1 1 
ATOM   746  C  CG2 . ILE A 1 81  ? 64.806 59.119 12.648  1.00 19.80 ? 78   ILE A CG2 1 
ATOM   747  C  CD1 . ILE A 1 81  ? 62.274 58.619 10.888  1.00 20.74 ? 78   ILE A CD1 1 
ATOM   748  N  N   . ASN A 1 82  ? 60.985 59.570 15.538  1.00 18.45 ? 79   ASN A N   1 
ATOM   749  C  CA  . ASN A 1 82  ? 59.815 60.144 16.150  1.00 17.27 ? 79   ASN A CA  1 
ATOM   750  C  C   . ASN A 1 82  ? 60.302 60.690 17.487  1.00 19.76 ? 79   ASN A C   1 
ATOM   751  O  O   . ASN A 1 82  ? 60.212 60.026 18.489  1.00 19.32 ? 79   ASN A O   1 
ATOM   752  C  CB  . ASN A 1 82  ? 58.664 59.105 16.304  1.00 17.00 ? 79   ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 82  ? 57.458 59.664 16.978  1.00 17.16 ? 79   ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 82  ? 57.459 60.799 17.493  1.00 18.17 ? 79   ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 82  ? 56.434 58.813 17.105  1.00 16.59 ? 79   ASN A ND2 1 
ATOM   756  N  N   . SER A 1 83  ? 60.782 61.928 17.457  1.00 20.22 ? 80   SER A N   1 
ATOM   757  C  CA  . SER A 1 83  ? 61.610 62.430 18.539  1.00 22.13 ? 80   SER A CA  1 
ATOM   758  C  C   . SER A 1 83  ? 60.788 62.863 19.713  1.00 22.93 ? 80   SER A C   1 
ATOM   759  O  O   . SER A 1 83  ? 61.262 62.893 20.825  1.00 26.22 ? 80   SER A O   1 
ATOM   760  C  CB  . SER A 1 83  ? 62.499 63.584 18.038  1.00 24.72 ? 80   SER A CB  1 
ATOM   761  O  OG  . SER A 1 83  ? 61.742 64.531 17.416  1.00 26.87 ? 80   SER A OG  1 
ATOM   762  N  N   . THR A 1 84  ? 59.549 63.254 19.512  1.00 19.63 ? 81   THR A N   1 
ATOM   763  C  CA  . THR A 1 84  ? 58.747 63.712 20.614  1.00 19.63 ? 81   THR A CA  1 
ATOM   764  C  C   . THR A 1 84  ? 58.124 62.588 21.441  1.00 20.41 ? 81   THR A C   1 
ATOM   765  O  O   . THR A 1 84  ? 57.917 62.776 22.634  1.00 22.78 ? 81   THR A O   1 
ATOM   766  C  CB  . THR A 1 84  ? 57.578 64.605 20.116  1.00 18.62 ? 81   THR A CB  1 
ATOM   767  O  OG1 . THR A 1 84  ? 56.673 63.818 19.321  1.00 18.22 ? 81   THR A OG1 1 
ATOM   768  C  CG2 . THR A 1 84  ? 58.134 65.772 19.290  1.00 19.84 ? 81   THR A CG2 1 
ATOM   769  N  N   . GLU A 1 85  ? 57.945 61.399 20.852  1.00 19.92 ? 82   GLU A N   1 
ATOM   770  C  CA  . GLU A 1 85  ? 57.458 60.212 21.570  1.00 19.89 ? 82   GLU A CA  1 
ATOM   771  C  C   . GLU A 1 85  ? 58.609 59.223 21.840  1.00 20.26 ? 82   GLU A C   1 
ATOM   772  O  O   . GLU A 1 85  ? 58.382 58.169 22.438  1.00 21.79 ? 82   GLU A O   1 
ATOM   773  C  CB  . GLU A 1 85  ? 56.314 59.550 20.807  1.00 19.67 ? 82   GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 85  ? 55.013 60.415 20.693  1.00 20.17 ? 82   GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 85  ? 53.908 59.791 19.903  1.00 22.37 ? 82   GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 85  ? 54.216 59.165 18.913  1.00 21.67 ? 82   GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 85  ? 52.687 59.897 20.275  1.00 25.16 ? 82   GLU A OE2 1 
ATOM   778  N  N   . HIS A 1 86  ? 59.807 59.558 21.386  1.00 21.89 ? 83   HIS A N   1 
ATOM   779  C  CA  . HIS A 1 86  ? 61.012 58.749 21.525  1.00 22.08 ? 83   HIS A CA  1 
ATOM   780  C  C   . HIS A 1 86  ? 60.803 57.333 20.989  1.00 21.19 ? 83   HIS A C   1 
ATOM   781  O  O   . HIS A 1 86  ? 60.993 56.331 21.714  1.00 21.83 ? 83   HIS A O   1 
ATOM   782  C  CB  . HIS A 1 86  ? 61.458 58.704 22.972  1.00 23.66 ? 83   HIS A CB  1 
ATOM   783  C  CG  . HIS A 1 86  ? 61.525 60.066 23.587  1.00 29.13 ? 83   HIS A CG  1 
ATOM   784  N  ND1 . HIS A 1 86  ? 62.469 60.994 23.208  1.00 37.40 ? 83   HIS A ND1 1 
ATOM   785  C  CD2 . HIS A 1 86  ? 60.706 60.686 24.469  1.00 35.49 ? 83   HIS A CD2 1 
ATOM   786  C  CE1 . HIS A 1 86  ? 62.253 62.124 23.865  1.00 39.69 ? 83   HIS A CE1 1 
ATOM   787  N  NE2 . HIS A 1 86  ? 61.184 61.964 24.628  1.00 40.08 ? 83   HIS A NE2 1 
ATOM   788  N  N   . ARG A 1 87  ? 60.382 57.276 19.746  1.00 19.27 ? 84   ARG A N   1 
ATOM   789  C  CA  . ARG A 1 87  ? 60.074 56.020 19.063  1.00 18.28 ? 84   ARG A CA  1 
ATOM   790  C  C   . ARG A 1 87  ? 60.787 55.932 17.721  1.00 17.28 ? 84   ARG A C   1 
ATOM   791  O  O   . ARG A 1 87  ? 60.979 56.930 17.013  1.00 17.44 ? 84   ARG A O   1 
ATOM   792  C  CB  . ARG A 1 87  ? 58.549 55.901 18.798  1.00 18.65 ? 84   ARG A CB  1 
ATOM   793  C  CG  . ARG A 1 87  ? 57.739 55.760 20.051  1.00 21.36 ? 84   ARG A CG  1 
ATOM   794  C  CD  . ARG A 1 87  ? 56.272 55.720 19.751  1.00 20.13 ? 84   ARG A CD  1 
ATOM   795  N  NE  . ARG A 1 87  ? 55.510 55.563 20.942  1.00 22.02 ? 84   ARG A NE  1 
ATOM   796  C  CZ  . ARG A 1 87  ? 54.186 55.611 20.990  1.00 25.33 ? 84   ARG A CZ  1 
ATOM   797  N  NH1 . ARG A 1 87  ? 53.464 55.689 19.888  1.00 22.72 ? 84   ARG A NH1 1 
ATOM   798  N  NH2 . ARG A 1 87  ? 53.584 55.528 22.194  1.00 29.82 ? 84   ARG A NH2 1 
ATOM   799  N  N   . ALA A 1 88  ? 61.066 54.688 17.335  1.00 16.80 ? 85   ALA A N   1 
ATOM   800  C  CA  . ALA A 1 88  ? 61.467 54.387 15.988  1.00 15.79 ? 85   ALA A CA  1 
ATOM   801  C  C   . ALA A 1 88  ? 60.249 54.495 15.088  1.00 15.92 ? 85   ALA A C   1 
ATOM   802  O  O   . ALA A 1 88  ? 59.070 54.577 15.561  1.00 16.35 ? 85   ALA A O   1 
ATOM   803  C  CB  . ALA A 1 88  ? 62.091 52.987 15.896  1.00 15.83 ? 85   ALA A CB  1 
ATOM   804  N  N   . VAL A 1 89  ? 60.490 54.487 13.783  1.00 15.59 ? 86   VAL A N   1 
ATOM   805  C  CA  . VAL A 1 89  ? 59.457 54.654 12.777  1.00 14.63 ? 86   VAL A CA  1 
ATOM   806  C  C   . VAL A 1 89  ? 59.747 53.580 11.744  1.00 15.24 ? 86   VAL A C   1 
ATOM   807  O  O   . VAL A 1 89  ? 60.550 53.735 10.836  1.00 15.67 ? 86   VAL A O   1 
ATOM   808  C  CB  . VAL A 1 89  ? 59.438 56.071 12.172  1.00 14.45 ? 86   VAL A CB  1 
ATOM   809  C  CG1 . VAL A 1 89  ? 58.441 56.122 10.970  1.00 14.85 ? 86   VAL A CG1 1 
ATOM   810  C  CG2 . VAL A 1 89  ? 59.146 57.122 13.278  1.00 16.64 ? 86   VAL A CG2 1 
ATOM   811  N  N   . LEU A 1 90  ? 59.099 52.431 11.901  1.00 14.67 ? 87   LEU A N   1 
ATOM   812  C  CA  . LEU A 1 90  ? 59.524 51.181 11.303  1.00 14.12 ? 87   LEU A CA  1 
ATOM   813  C  C   . LEU A 1 90  ? 58.402 50.451 10.558  1.00 13.85 ? 87   LEU A C   1 
ATOM   814  O  O   . LEU A 1 90  ? 58.455 49.208 10.442  1.00 15.08 ? 87   LEU A O   1 
ATOM   815  C  CB  . LEU A 1 90  ? 60.233 50.252 12.328  1.00 14.65 ? 87   LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 90  ? 61.672 50.627 12.680  1.00 16.73 ? 87   LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 90  ? 62.186 49.711 13.798  1.00 18.13 ? 87   LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 90  ? 62.621 50.538 11.512  1.00 17.24 ? 87   LEU A CD2 1 
ATOM   819  N  N   . HIS A 1 91  ? 57.448 51.196 9.982   1.00 13.62 ? 88   HIS A N   1 
ATOM   820  C  CA  . HIS A 1 91  ? 56.526 50.570 9.080   1.00 13.22 ? 88   HIS A CA  1 
ATOM   821  C  C   . HIS A 1 91  ? 57.258 49.861 7.927   1.00 13.69 ? 88   HIS A C   1 
ATOM   822  O  O   . HIS A 1 91  ? 56.760 48.801 7.467   1.00 14.34 ? 88   HIS A O   1 
ATOM   823  C  CB  . HIS A 1 91  ? 55.453 51.507 8.568   1.00 13.58 ? 88   HIS A CB  1 
ATOM   824  C  CG  . HIS A 1 91  ? 55.987 52.810 8.090   1.00 13.32 ? 88   HIS A CG  1 
ATOM   825  N  ND1 . HIS A 1 91  ? 56.311 53.842 8.941   1.00 13.95 ? 88   HIS A ND1 1 
ATOM   826  C  CD2 . HIS A 1 91  ? 56.186 53.267 6.832   1.00 14.08 ? 88   HIS A CD2 1 
ATOM   827  C  CE1 . HIS A 1 91  ? 56.733 54.861 8.222   1.00 15.00 ? 88   HIS A CE1 1 
ATOM   828  N  NE2 . HIS A 1 91  ? 56.679 54.543 6.938   1.00 15.94 ? 88   HIS A NE2 1 
ATOM   829  N  N   . THR A 1 92  ? 58.406 50.391 7.500   1.00 14.31 ? 89   THR A N   1 
ATOM   830  C  CA  . THR A 1 92  ? 59.187 49.685 6.498   1.00 15.03 ? 89   THR A CA  1 
ATOM   831  C  C   . THR A 1 92  ? 59.534 48.254 6.902   1.00 14.51 ? 89   THR A C   1 
ATOM   832  O  O   . THR A 1 92  ? 59.537 47.329 6.077   1.00 15.39 ? 89   THR A O   1 
ATOM   833  C  CB  . THR A 1 92  ? 60.460 50.462 6.122   1.00 15.76 ? 89   THR A CB  1 
ATOM   834  O  OG1 . THR A 1 92  ? 61.205 50.795 7.287   1.00 15.46 ? 89   THR A OG1 1 
ATOM   835  C  CG2 . THR A 1 92  ? 60.140 51.728 5.297   1.00 16.68 ? 89   THR A CG2 1 
ATOM   836  N  N   . ALA A 1 93  ? 59.848 48.032 8.167   1.00 14.95 ? 90   ALA A N   1 
ATOM   837  C  CA  . ALA A 1 93  ? 60.259 46.726 8.593   1.00 14.07 ? 90   ALA A CA  1 
ATOM   838  C  C   . ALA A 1 93  ? 59.157 45.701 8.492   1.00 13.47 ? 90   ALA A C   1 
ATOM   839  O  O   . ALA A 1 93  ? 59.417 44.504 8.303   1.00 14.83 ? 90   ALA A O   1 
ATOM   840  C  CB  . ALA A 1 93  ? 60.782 46.790 10.058  1.00 14.77 ? 90   ALA A CB  1 
ATOM   841  N  N   . LEU A 1 94  ? 57.885 46.141 8.523   1.00 13.15 ? 91   LEU A N   1 
ATOM   842  C  CA  . LEU A 1 94  ? 56.759 45.243 8.456   1.00 12.91 ? 91   LEU A CA  1 
ATOM   843  C  C   . LEU A 1 94  ? 56.714 44.493 7.124   1.00 13.61 ? 91   LEU A C   1 
ATOM   844  O  O   . LEU A 1 94  ? 56.143 43.415 7.032   1.00 15.07 ? 91   LEU A O   1 
ATOM   845  C  CB  . LEU A 1 94  ? 55.458 46.039 8.605   1.00 14.38 ? 91   LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 94  ? 55.322 46.770 9.923   1.00 12.24 ? 91   LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 94  ? 54.140 47.743 9.815   1.00 14.59 ? 91   LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 94  ? 55.115 45.771 11.076  1.00 13.92 ? 91   LEU A CD2 1 
ATOM   849  N  N   . ARG A 1 95  ? 57.292 45.074 6.071   1.00 13.28 ? 92   ARG A N   1 
ATOM   850  C  CA  . ARG A 1 95  ? 57.279 44.452 4.725   1.00 13.94 ? 92   ARG A CA  1 
ATOM   851  C  C   . ARG A 1 95  ? 58.659 44.096 4.224   1.00 15.25 ? 92   ARG A C   1 
ATOM   852  O  O   . ARG A 1 95  ? 58.853 43.775 3.072   1.00 15.38 ? 92   ARG A O   1 
ATOM   853  C  CB  . ARG A 1 95  ? 56.555 45.361 3.741   1.00 13.30 ? 92   ARG A CB  1 
ATOM   854  C  CG  . ARG A 1 95  ? 57.181 46.725 3.484   1.00 14.37 ? 92   ARG A CG  1 
ATOM   855  C  CD  . ARG A 1 95  ? 56.342 47.866 4.077   1.00 13.96 ? 92   ARG A CD  1 
ATOM   856  N  NE  . ARG A 1 95  ? 56.858 49.156 3.624   1.00 12.83 ? 92   ARG A NE  1 
ATOM   857  C  CZ  . ARG A 1 95  ? 56.214 50.301 3.716   1.00 13.82 ? 92   ARG A CZ  1 
ATOM   858  N  NH1 . ARG A 1 95  ? 56.741 51.423 3.235   1.00 14.60 ? 92   ARG A NH1 1 
ATOM   859  N  NH2 . ARG A 1 95  ? 55.049 50.378 4.318   1.00 14.56 ? 92   ARG A NH2 1 
ATOM   860  N  N   . ASP A 1 96  ? 59.643 44.074 5.135   1.00 14.07 ? 93   ASP A N   1 
ATOM   861  C  CA  . ASP A 1 96  ? 61.007 43.806 4.690   1.00 15.13 ? 93   ASP A CA  1 
ATOM   862  C  C   . ASP A 1 96  ? 61.180 42.413 4.060   1.00 16.06 ? 93   ASP A C   1 
ATOM   863  O  O   . ASP A 1 96  ? 60.680 41.388 4.544   1.00 16.55 ? 93   ASP A O   1 
ATOM   864  C  CB  . ASP A 1 96  ? 61.971 43.863 5.855   1.00 16.30 ? 93   ASP A CB  1 
ATOM   865  C  CG  . ASP A 1 96  ? 63.374 43.426 5.461   1.00 14.89 ? 93   ASP A CG  1 
ATOM   866  O  OD1 . ASP A 1 96  ? 63.986 44.240 4.702   1.00 16.97 ? 93   ASP A OD1 1 
ATOM   867  O  OD2 . ASP A 1 96  ? 63.799 42.335 5.864   1.00 16.77 ? 93   ASP A OD2 1 
ATOM   868  N  N   . LEU A 1 97  ? 61.963 42.405 2.973   1.00 16.03 ? 94   LEU A N   1 
ATOM   869  C  CA  . LEU A 1 97  ? 62.434 41.159 2.318   1.00 17.06 ? 94   LEU A CA  1 
ATOM   870  C  C   . LEU A 1 97  ? 63.937 41.079 2.266   1.00 18.92 ? 94   LEU A C   1 
ATOM   871  O  O   . LEU A 1 97  ? 64.440 40.091 1.746   1.00 21.36 ? 94   LEU A O   1 
ATOM   872  C  CB  . LEU A 1 97  ? 61.870 41.067 0.885   1.00 17.21 ? 94   LEU A CB  1 
ATOM   873  C  CG  . LEU A 1 97  ? 60.362 40.856 0.866   1.00 19.60 ? 94   LEU A CG  1 
ATOM   874  C  CD1 . LEU A 1 97  ? 59.859 41.052 -0.603  1.00 20.34 ? 94   LEU A CD1 1 
ATOM   875  C  CD2 . LEU A 1 97  ? 59.989 39.465 1.369   1.00 20.66 ? 94   LEU A CD2 1 
ATOM   876  N  N   . SER A 1 98  ? 64.645 42.102 2.760   1.00 18.33 ? 95   SER A N   1 
ATOM   877  C  CA  . SER A 1 98  ? 66.140 42.083 2.739   1.00 18.95 ? 95   SER A CA  1 
ATOM   878  C  C   . SER A 1 98  ? 66.762 41.123 3.721   1.00 19.91 ? 95   SER A C   1 
ATOM   879  O  O   . SER A 1 98  ? 67.870 40.588 3.475   1.00 20.84 ? 95   SER A O   1 
ATOM   880  C  CB  . SER A 1 98  ? 66.690 43.460 3.002   1.00 18.65 ? 95   SER A CB  1 
ATOM   881  O  OG  . SER A 1 98  ? 66.629 43.837 4.388   1.00 18.79 ? 95   SER A OG  1 
ATOM   882  N  N   . SER A 1 99  ? 66.118 40.954 4.869   1.00 18.69 ? 96   SER A N   1 
ATOM   883  C  CA  A SER A 1 99  ? 66.589 40.134 5.968   0.70 20.75 ? 96   SER A CA  1 
ATOM   884  C  CA  B SER A 1 99  ? 66.597 40.120 5.969   0.30 19.83 ? 96   SER A CA  1 
ATOM   885  C  C   . SER A 1 99  ? 67.921 40.614 6.563   1.00 20.06 ? 96   SER A C   1 
ATOM   886  O  O   . SER A 1 99  ? 68.598 39.840 7.259   1.00 20.39 ? 96   SER A O   1 
ATOM   887  C  CB  A SER A 1 99  ? 66.698 38.661 5.568   0.70 21.94 ? 96   SER A CB  1 
ATOM   888  C  CB  B SER A 1 99  ? 66.726 38.643 5.554   0.30 20.50 ? 96   SER A CB  1 
ATOM   889  O  OG  A SER A 1 99  ? 65.418 38.140 5.235   0.70 27.12 ? 96   SER A OG  1 
ATOM   890  O  OG  B SER A 1 99  ? 66.631 37.763 6.679   0.30 22.11 ? 96   SER A OG  1 
ATOM   891  N  N   . THR A 1 100 ? 68.247 41.880 6.376   1.00 18.63 ? 97   THR A N   1 
ATOM   892  C  CA  . THR A 1 100 ? 69.453 42.426 6.991   1.00 18.86 ? 97   THR A CA  1 
ATOM   893  C  C   . THR A 1 100 ? 69.277 42.507 8.508   1.00 18.18 ? 97   THR A C   1 
ATOM   894  O  O   . THR A 1 100 ? 68.157 42.529 9.040   1.00 19.82 ? 97   THR A O   1 
ATOM   895  C  CB  . THR A 1 100 ? 69.820 43.796 6.442   1.00 18.43 ? 97   THR A CB  1 
ATOM   896  O  OG1 . THR A 1 100 ? 68.771 44.739 6.685   1.00 19.60 ? 97   THR A OG1 1 
ATOM   897  C  CG2 . THR A 1 100 ? 70.141 43.744 4.958   1.00 20.58 ? 97   THR A CG2 1 
ATOM   898  N  N   . PRO A 1 101 ? 70.389 42.502 9.279   1.00 19.70 ? 98   PRO A N   1 
ATOM   899  C  CA  . PRO A 1 101 ? 70.192 42.577 10.701  1.00 19.25 ? 98   PRO A CA  1 
ATOM   900  C  C   . PRO A 1 101 ? 69.512 43.843 11.190  1.00 19.20 ? 98   PRO A C   1 
ATOM   901  O  O   . PRO A 1 101 ? 69.827 44.967 10.760  1.00 21.78 ? 98   PRO A O   1 
ATOM   902  C  CB  . PRO A 1 101 ? 71.624 42.528 11.240  1.00 20.13 ? 98   PRO A CB  1 
ATOM   903  C  CG  . PRO A 1 101 ? 72.474 42.035 10.118  1.00 21.90 ? 98   PRO A CG  1 
ATOM   904  C  CD  . PRO A 1 101 ? 71.795 42.448 8.887   1.00 18.64 ? 98   PRO A CD  1 
ATOM   905  N  N   . LEU A 1 102 ? 68.557 43.686 12.139  1.00 18.35 ? 99   LEU A N   1 
ATOM   906  C  CA  . LEU A 1 102 ? 67.881 44.868 12.644  1.00 17.44 ? 99   LEU A CA  1 
ATOM   907  C  C   . LEU A 1 102 ? 67.415 44.604 14.066  1.00 18.93 ? 99   LEU A C   1 
ATOM   908  O  O   . LEU A 1 102 ? 66.543 43.777 14.300  1.00 18.14 ? 99   LEU A O   1 
ATOM   909  C  CB  . LEU A 1 102 ? 66.693 45.292 11.775  1.00 17.16 ? 99   LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 102 ? 65.900 46.552 12.175  1.00 18.11 ? 99   LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 102 ? 66.820 47.802 12.172  1.00 19.98 ? 99   LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 102 ? 64.696 46.761 11.262  1.00 20.08 ? 99   LEU A CD2 1 
ATOM   913  N  N   . ILE A 1 103 ? 68.074 45.263 15.002  1.00 21.28 ? 100  ILE A N   1 
ATOM   914  C  CA  . ILE A 1 103 ? 67.837 45.091 16.446  1.00 22.33 ? 100  ILE A CA  1 
ATOM   915  C  C   . ILE A 1 103 ? 67.467 46.469 16.952  1.00 23.84 ? 100  ILE A C   1 
ATOM   916  O  O   . ILE A 1 103 ? 68.253 47.429 16.783  1.00 28.20 ? 100  ILE A O   1 
ATOM   917  C  CB  . ILE A 1 103 ? 69.057 44.566 17.211  1.00 22.41 ? 100  ILE A CB  1 
ATOM   918  C  CG1 . ILE A 1 103 ? 69.513 43.237 16.688  1.00 25.07 ? 100  ILE A CG1 1 
ATOM   919  C  CG2 . ILE A 1 103 ? 68.737 44.481 18.735  1.00 25.22 ? 100  ILE A CG2 1 
ATOM   920  C  CD1 . ILE A 1 103 ? 70.832 42.803 17.169  1.00 28.95 ? 100  ILE A CD1 1 
ATOM   921  N  N   . VAL A 1 104 ? 66.296 46.583 17.526  1.00 24.98 ? 101  VAL A N   1 
ATOM   922  C  CA  . VAL A 1 104 ? 65.827 47.857 18.048  1.00 25.72 ? 101  VAL A CA  1 
ATOM   923  C  C   . VAL A 1 104 ? 65.242 47.634 19.432  1.00 25.83 ? 101  VAL A C   1 
ATOM   924  O  O   . VAL A 1 104 ? 64.345 46.819 19.609  1.00 25.46 ? 101  VAL A O   1 
ATOM   925  C  CB  . VAL A 1 104 ? 64.819 48.518 17.086  1.00 27.21 ? 101  VAL A CB  1 
ATOM   926  C  CG1 . VAL A 1 104 ? 64.300 49.857 17.731  1.00 29.80 ? 101  VAL A CG1 1 
ATOM   927  C  CG2 . VAL A 1 104 ? 65.486 48.680 15.743  1.00 27.49 ? 101  VAL A CG2 1 
ATOM   928  N  N   . ASP A 1 105 ? 65.781 48.400 20.381  1.00 29.14 ? 102  ASP A N   1 
ATOM   929  C  CA  A ASP A 1 105 ? 65.357 48.342 21.794  0.70 30.26 ? 102  ASP A CA  1 
ATOM   930  C  CA  B ASP A 1 105 ? 65.238 48.351 21.727  0.30 29.18 ? 102  ASP A CA  1 
ATOM   931  C  C   . ASP A 1 105 ? 65.282 46.887 22.202  1.00 28.45 ? 102  ASP A C   1 
ATOM   932  O  O   . ASP A 1 105 ? 64.317 46.365 22.796  1.00 27.70 ? 102  ASP A O   1 
ATOM   933  C  CB  A ASP A 1 105 ? 63.988 48.970 22.016  0.70 31.79 ? 102  ASP A CB  1 
ATOM   934  C  CB  B ASP A 1 105 ? 63.795 48.901 21.689  0.30 29.88 ? 102  ASP A CB  1 
ATOM   935  C  CG  A ASP A 1 105 ? 64.015 50.476 21.977  0.70 34.64 ? 102  ASP A CG  1 
ATOM   936  C  CG  B ASP A 1 105 ? 63.014 48.616 22.954  0.30 32.13 ? 102  ASP A CG  1 
ATOM   937  O  OD1 A ASP A 1 105 ? 65.050 51.106 22.345  0.70 37.10 ? 102  ASP A OD1 1 
ATOM   938  O  OD1 B ASP A 1 105 ? 63.523 48.912 24.055  0.30 34.73 ? 102  ASP A OD1 1 
ATOM   939  O  OD2 A ASP A 1 105 ? 62.970 51.013 21.548  0.70 37.47 ? 102  ASP A OD2 1 
ATOM   940  O  OD2 B ASP A 1 105 ? 61.888 48.100 22.821  0.30 34.54 ? 102  ASP A OD2 1 
ATOM   941  N  N   . GLY A 1 106 ? 66.370 46.212 21.909  1.00 23.26 ? 103  GLY A N   1 
ATOM   942  C  CA  . GLY A 1 106 ? 66.516 44.833 22.329  1.00 19.78 ? 103  GLY A CA  1 
ATOM   943  C  C   . GLY A 1 106 ? 65.808 43.762 21.575  1.00 19.84 ? 103  GLY A C   1 
ATOM   944  O  O   . GLY A 1 106 ? 66.080 42.597 21.813  1.00 19.40 ? 103  GLY A O   1 
ATOM   945  N  N   . GLN A 1 107 ? 64.989 44.108 20.598  1.00 19.89 ? 104  GLN A N   1 
ATOM   946  C  CA  A GLN A 1 107 ? 64.206 43.125 19.860  0.70 21.52 ? 104  GLN A CA  1 
ATOM   947  C  CA  B GLN A 1 107 ? 64.231 43.089 19.884  0.30 20.64 ? 104  GLN A CA  1 
ATOM   948  C  C   . GLN A 1 107 ? 64.818 42.870 18.501  1.00 19.23 ? 104  GLN A C   1 
ATOM   949  O  O   . GLN A 1 107 ? 65.242 43.816 17.860  1.00 20.03 ? 104  GLN A O   1 
ATOM   950  C  CB  A GLN A 1 107 ? 62.768 43.599 19.696  0.70 24.40 ? 104  GLN A CB  1 
ATOM   951  C  CB  B GLN A 1 107 ? 62.760 43.469 19.781  0.30 21.88 ? 104  GLN A CB  1 
ATOM   952  C  CG  A GLN A 1 107 ? 61.974 43.431 20.973  0.70 27.10 ? 104  GLN A CG  1 
ATOM   953  C  CG  B GLN A 1 107 ? 62.103 43.790 21.116  0.30 23.92 ? 104  GLN A CG  1 
ATOM   954  C  CD  A GLN A 1 107 ? 60.473 43.472 20.770  0.70 30.50 ? 104  GLN A CD  1 
ATOM   955  C  CD  B GLN A 1 107 ? 61.832 42.550 21.953  0.30 27.06 ? 104  GLN A CD  1 
ATOM   956  O  OE1 A GLN A 1 107 ? 59.948 44.289 20.008  0.70 33.02 ? 104  GLN A OE1 1 
ATOM   957  O  OE1 B GLN A 1 107 ? 62.043 41.416 21.507  0.30 30.06 ? 104  GLN A OE1 1 
ATOM   958  N  NE2 A GLN A 1 107 ? 59.777 42.644 21.512  0.70 36.13 ? 104  GLN A NE2 1 
ATOM   959  N  NE2 B GLN A 1 107 ? 61.321 42.763 23.163  0.30 31.10 ? 104  GLN A NE2 1 
ATOM   960  N  N   . ASP A 1 108 ? 64.858 41.617 18.095  1.00 18.42 ? 105  ASP A N   1 
ATOM   961  C  CA  . ASP A 1 108 ? 65.239 41.260 16.757  1.00 18.77 ? 105  ASP A CA  1 
ATOM   962  C  C   . ASP A 1 108 ? 63.990 41.543 15.903  1.00 18.11 ? 105  ASP A C   1 
ATOM   963  O  O   . ASP A 1 108 ? 63.029 40.779 15.934  1.00 18.46 ? 105  ASP A O   1 
ATOM   964  C  CB  . ASP A 1 108 ? 65.626 39.818 16.679  1.00 19.79 ? 105  ASP A CB  1 
ATOM   965  C  CG  . ASP A 1 108 ? 66.091 39.435 15.314  1.00 22.50 ? 105  ASP A CG  1 
ATOM   966  O  OD1 . ASP A 1 108 ? 65.622 39.972 14.281  1.00 19.98 ? 105  ASP A OD1 1 
ATOM   967  O  OD2 . ASP A 1 108 ? 66.996 38.588 15.274  1.00 27.11 ? 105  ASP A OD2 1 
ATOM   968  N  N   . ILE A 1 109 ? 64.016 42.659 15.178  1.00 16.78 ? 106  ILE A N   1 
ATOM   969  C  CA  . ILE A 1 109 ? 62.828 43.112 14.437  1.00 16.72 ? 106  ILE A CA  1 
ATOM   970  C  C   . ILE A 1 109 ? 62.485 42.127 13.348  1.00 17.49 ? 106  ILE A C   1 
ATOM   971  O  O   . ILE A 1 109 ? 61.263 41.853 13.115  1.00 16.96 ? 106  ILE A O   1 
ATOM   972  C  CB  . ILE A 1 109 ? 63.048 44.499 13.882  1.00 16.35 ? 106  ILE A CB  1 
ATOM   973  C  CG1 . ILE A 1 109 ? 63.395 45.517 14.971  1.00 18.09 ? 106  ILE A CG1 1 
ATOM   974  C  CG2 . ILE A 1 109 ? 61.811 44.936 13.006  1.00 16.33 ? 106  ILE A CG2 1 
ATOM   975  C  CD1 . ILE A 1 109 ? 62.350 45.628 16.016  1.00 22.78 ? 106  ILE A CD1 1 
ATOM   976  N  N   . ARG A 1 110 ? 63.488 41.514 12.690  1.00 17.06 ? 107  ARG A N   1 
ATOM   977  C  CA  . ARG A 1 110 ? 63.201 40.541 11.654  1.00 18.05 ? 107  ARG A CA  1 
ATOM   978  C  C   . ARG A 1 110 ? 62.416 39.370 12.208  1.00 17.85 ? 107  ARG A C   1 
ATOM   979  O  O   . ARG A 1 110 ? 61.410 38.936 11.652  1.00 19.17 ? 107  ARG A O   1 
ATOM   980  C  CB  . ARG A 1 110 ? 64.462 40.041 10.948  1.00 19.87 ? 107  ARG A CB  1 
ATOM   981  C  CG  . ARG A 1 110 ? 65.334 41.163 10.407  1.00 20.24 ? 107  ARG A CG  1 
ATOM   982  C  CD  . ARG A 1 110 ? 64.591 42.040 9.507   1.00 19.40 ? 107  ARG A CD  1 
ATOM   983  N  NE  . ARG A 1 110 ? 65.483 42.983 8.827   1.00 17.90 ? 107  ARG A NE  1 
ATOM   984  C  CZ  . ARG A 1 110 ? 65.107 44.158 8.364   1.00 16.56 ? 107  ARG A CZ  1 
ATOM   985  N  NH1 . ARG A 1 110 ? 63.857 44.551 8.480   1.00 16.37 ? 107  ARG A NH1 1 
ATOM   986  N  NH2 . ARG A 1 110 ? 65.975 44.977 7.758   1.00 17.55 ? 107  ARG A NH2 1 
ATOM   987  N  N   . GLN A 1 111 ? 62.877 38.834 13.343  1.00 17.92 ? 108  GLN A N   1 
ATOM   988  C  CA  . GLN A 1 111 ? 62.226 37.690 13.983  1.00 20.42 ? 108  GLN A CA  1 
ATOM   989  C  C   . GLN A 1 111 ? 60.832 38.091 14.448  1.00 19.34 ? 108  GLN A C   1 
ATOM   990  O  O   . GLN A 1 111 ? 59.878 37.311 14.248  1.00 20.09 ? 108  GLN A O   1 
ATOM   991  C  CB  . GLN A 1 111 ? 62.994 37.138 15.196  1.00 22.31 ? 108  GLN A CB  1 
ATOM   992  C  CG  . GLN A 1 111 ? 64.273 36.464 14.876  1.00 29.21 ? 108  GLN A CG  1 
ATOM   993  C  CD  . GLN A 1 111 ? 64.792 35.662 16.089  1.00 35.87 ? 108  GLN A CD  1 
ATOM   994  O  OE1 . GLN A 1 111 ? 63.998 35.172 16.919  1.00 41.29 ? 108  GLN A OE1 1 
ATOM   995  N  NE2 . GLN A 1 111 ? 66.105 35.538 16.195  1.00 39.39 ? 108  GLN A NE2 1 
ATOM   996  N  N   . GLU A 1 112 ? 60.690 39.254 15.074  1.00 18.21 ? 109  GLU A N   1 
ATOM   997  C  CA  A GLU A 1 112 ? 59.403 39.691 15.625  0.60 18.99 ? 109  GLU A CA  1 
ATOM   998  C  CA  B GLU A 1 112 ? 59.396 39.648 15.626  0.40 18.17 ? 109  GLU A CA  1 
ATOM   999  C  C   . GLU A 1 112 ? 58.369 39.825 14.507  1.00 17.08 ? 109  GLU A C   1 
ATOM   1000 O  O   . GLU A 1 112 ? 57.217 39.332 14.649  1.00 17.21 ? 109  GLU A O   1 
ATOM   1001 C  CB  A GLU A 1 112 ? 59.547 41.000 16.407  0.60 20.96 ? 109  GLU A CB  1 
ATOM   1002 C  CB  B GLU A 1 112 ? 59.492 40.911 16.469  0.40 19.17 ? 109  GLU A CB  1 
ATOM   1003 C  CG  A GLU A 1 112 ? 59.871 40.819 17.897  0.60 25.68 ? 109  GLU A CG  1 
ATOM   1004 C  CG  B GLU A 1 112 ? 60.513 40.889 17.595  0.40 20.28 ? 109  GLU A CG  1 
ATOM   1005 C  CD  A GLU A 1 112 ? 58.628 40.413 18.713  0.60 30.04 ? 109  GLU A CD  1 
ATOM   1006 C  CD  B GLU A 1 112 ? 60.128 39.978 18.746  0.40 23.76 ? 109  GLU A CD  1 
ATOM   1007 O  OE1 A GLU A 1 112 ? 58.432 39.175 18.859  0.60 31.34 ? 109  GLU A OE1 1 
ATOM   1008 O  OE1 B GLU A 1 112 ? 59.454 38.943 18.523  0.40 30.89 ? 109  GLU A OE1 1 
ATOM   1009 O  OE2 A GLU A 1 112 ? 57.849 41.282 19.224  0.60 33.15 ? 109  GLU A OE2 1 
ATOM   1010 O  OE2 B GLU A 1 112 ? 60.546 40.291 19.881  0.40 28.02 ? 109  GLU A OE2 1 
ATOM   1011 N  N   . VAL A 1 113 ? 58.741 40.484 13.426  1.00 16.50 ? 110  VAL A N   1 
ATOM   1012 C  CA  . VAL A 1 113 ? 57.830 40.716 12.313  1.00 15.40 ? 110  VAL A CA  1 
ATOM   1013 C  C   . VAL A 1 113 ? 57.435 39.388 11.697  1.00 16.68 ? 110  VAL A C   1 
ATOM   1014 O  O   . VAL A 1 113 ? 56.222 39.161 11.433  1.00 15.84 ? 110  VAL A O   1 
ATOM   1015 C  CB  . VAL A 1 113 ? 58.438 41.692 11.302  1.00 15.32 ? 110  VAL A CB  1 
ATOM   1016 C  CG1 . VAL A 1 113 ? 57.687 41.643 9.949   1.00 16.39 ? 110  VAL A CG1 1 
ATOM   1017 C  CG2 . VAL A 1 113 ? 58.471 43.081 11.879  1.00 17.29 ? 110  VAL A CG2 1 
ATOM   1018 N  N   . THR A 1 114 ? 58.402 38.541 11.419  1.00 16.79 ? 111  THR A N   1 
ATOM   1019 C  CA  . THR A 1 114 ? 58.161 37.243 10.757  1.00 17.25 ? 111  THR A CA  1 
ATOM   1020 C  C   . THR A 1 114 ? 57.267 36.342 11.620  1.00 17.82 ? 111  THR A C   1 
ATOM   1021 O  O   . THR A 1 114 ? 56.297 35.748 11.109  1.00 18.21 ? 111  THR A O   1 
ATOM   1022 C  CB  . THR A 1 114 ? 59.443 36.587 10.396  1.00 20.00 ? 111  THR A CB  1 
ATOM   1023 O  OG1 . THR A 1 114 ? 60.093 37.405 9.423   1.00 21.66 ? 111  THR A OG1 1 
ATOM   1024 C  CG2 . THR A 1 114 ? 59.195 35.156 9.787   1.00 21.40 ? 111  THR A CG2 1 
ATOM   1025 N  N   . LYS A 1 115 ? 57.528 36.289 12.910  1.00 18.28 ? 112  LYS A N   1 
ATOM   1026 C  CA  A LYS A 1 115 ? 56.758 35.413 13.797  0.70 18.67 ? 112  LYS A CA  1 
ATOM   1027 C  CA  B LYS A 1 115 ? 56.761 35.410 13.789  0.30 18.50 ? 112  LYS A CA  1 
ATOM   1028 C  C   . LYS A 1 115 ? 55.316 35.868 13.855  1.00 18.62 ? 112  LYS A C   1 
ATOM   1029 O  O   . LYS A 1 115 ? 54.387 35.034 13.831  1.00 18.63 ? 112  LYS A O   1 
ATOM   1030 C  CB  A LYS A 1 115 ? 57.329 35.415 15.202  0.70 19.23 ? 112  LYS A CB  1 
ATOM   1031 C  CB  B LYS A 1 115 ? 57.370 35.338 15.189  0.30 18.91 ? 112  LYS A CB  1 
ATOM   1032 C  CG  A LYS A 1 115 ? 56.431 34.773 16.274  0.70 21.84 ? 112  LYS A CG  1 
ATOM   1033 C  CG  B LYS A 1 115 ? 58.607 34.474 15.236  0.30 19.96 ? 112  LYS A CG  1 
ATOM   1034 C  CD  A LYS A 1 115 ? 57.203 34.769 17.610  0.70 28.33 ? 112  LYS A CD  1 
ATOM   1035 C  CD  B LYS A 1 115 ? 59.310 34.487 16.583  0.30 21.78 ? 112  LYS A CD  1 
ATOM   1036 C  CE  A LYS A 1 115 ? 56.228 34.621 18.764  0.70 34.09 ? 112  LYS A CE  1 
ATOM   1037 C  CE  B LYS A 1 115 ? 60.706 33.905 16.518  0.30 22.24 ? 112  LYS A CE  1 
ATOM   1038 N  NZ  A LYS A 1 115 ? 56.969 34.139 19.924  0.70 37.63 ? 112  LYS A NZ  1 
ATOM   1039 N  NZ  B LYS A 1 115 ? 61.415 34.099 17.833  0.30 23.43 ? 112  LYS A NZ  1 
ATOM   1040 N  N   . GLU A 1 116 ? 55.090 37.169 13.914  1.00 16.66 ? 113  GLU A N   1 
ATOM   1041 C  CA  A GLU A 1 116 ? 53.733 37.651 14.002  0.50 16.12 ? 113  GLU A CA  1 
ATOM   1042 C  CA  B GLU A 1 116 ? 53.691 37.665 13.988  0.50 16.63 ? 113  GLU A CA  1 
ATOM   1043 C  C   . GLU A 1 116 ? 52.963 37.401 12.675  1.00 16.34 ? 113  GLU A C   1 
ATOM   1044 O  O   . GLU A 1 116 ? 51.789 37.016 12.697  1.00 16.98 ? 113  GLU A O   1 
ATOM   1045 C  CB  A GLU A 1 116 ? 53.765 39.077 14.466  0.50 16.40 ? 113  GLU A CB  1 
ATOM   1046 C  CB  B GLU A 1 116 ? 53.541 39.121 14.434  0.50 16.72 ? 113  GLU A CB  1 
ATOM   1047 C  CG  A GLU A 1 116 ? 52.485 39.666 14.651  0.50 15.64 ? 113  GLU A CG  1 
ATOM   1048 C  CG  B GLU A 1 116 ? 53.961 39.347 15.888  0.50 20.45 ? 113  GLU A CG  1 
ATOM   1049 C  CD  A GLU A 1 116 ? 51.578 39.096 15.668  0.50 18.10 ? 113  GLU A CD  1 
ATOM   1050 C  CD  B GLU A 1 116 ? 53.273 38.359 16.856  0.50 14.83 ? 113  GLU A CD  1 
ATOM   1051 O  OE1 A GLU A 1 116 ? 51.898 38.351 16.587  0.50 18.75 ? 113  GLU A OE1 1 
ATOM   1052 O  OE1 B GLU A 1 116 ? 51.996 38.414 16.847  0.50 22.52 ? 113  GLU A OE1 1 
ATOM   1053 O  OE2 A GLU A 1 116 ? 50.412 39.505 15.551  0.50 15.79 ? 113  GLU A OE2 1 
ATOM   1054 O  OE2 B GLU A 1 116 ? 54.000 37.578 17.566  0.50 20.42 ? 113  GLU A OE2 1 
ATOM   1055 N  N   . LYS A 1 117 ? 53.623 37.568 11.534  1.00 16.29 ? 114  LYS A N   1 
ATOM   1056 C  CA  . LYS A 1 117 ? 53.006 37.204 10.248  1.00 16.74 ? 114  LYS A CA  1 
ATOM   1057 C  C   . LYS A 1 117 ? 52.600 35.775 10.225  1.00 16.76 ? 114  LYS A C   1 
ATOM   1058 O  O   . LYS A 1 117 ? 51.508 35.448 9.748   1.00 16.97 ? 114  LYS A O   1 
ATOM   1059 C  CB  . LYS A 1 117 ? 53.932 37.486 9.037   1.00 17.58 ? 114  LYS A CB  1 
ATOM   1060 C  CG  . LYS A 1 117 ? 54.154 38.953 8.750   1.00 19.70 ? 114  LYS A CG  1 
ATOM   1061 C  CD  . LYS A 1 117 ? 55.270 39.079 7.643   1.00 24.34 ? 114  LYS A CD  1 
ATOM   1062 C  CE  . LYS A 1 117 ? 55.735 40.480 7.272   1.00 27.94 ? 114  LYS A CE  1 
ATOM   1063 N  NZ  . LYS A 1 117 ? 56.644 40.751 6.051   1.00 25.57 ? 114  LYS A NZ  1 
ATOM   1064 N  N   . GLN A 1 118 ? 53.451 34.890 10.706  1.00 17.48 ? 115  GLN A N   1 
ATOM   1065 C  CA  A GLN A 1 118 ? 53.118 33.481 10.709  0.60 17.35 ? 115  GLN A CA  1 
ATOM   1066 C  CA  B GLN A 1 118 ? 53.161 33.462 10.771  0.40 17.85 ? 115  GLN A CA  1 
ATOM   1067 C  C   . GLN A 1 118 ? 51.879 33.234 11.586  1.00 18.24 ? 115  GLN A C   1 
ATOM   1068 O  O   . GLN A 1 118 ? 51.023 32.444 11.209  1.00 18.64 ? 115  GLN A O   1 
ATOM   1069 C  CB  A GLN A 1 118 ? 54.289 32.637 11.155  0.60 18.80 ? 115  GLN A CB  1 
ATOM   1070 C  CB  B GLN A 1 118 ? 54.339 32.703 11.393  0.40 19.03 ? 115  GLN A CB  1 
ATOM   1071 C  CG  A GLN A 1 118 ? 54.048 31.115 11.024  0.60 21.13 ? 115  GLN A CG  1 
ATOM   1072 C  CG  B GLN A 1 118 ? 55.552 32.581 10.475  0.40 22.26 ? 115  GLN A CG  1 
ATOM   1073 C  CD  A GLN A 1 118 ? 53.560 30.646 9.612   0.60 27.99 ? 115  GLN A CD  1 
ATOM   1074 C  CD  B GLN A 1 118 ? 56.786 32.028 11.156  0.40 26.03 ? 115  GLN A CD  1 
ATOM   1075 O  OE1 A GLN A 1 118 ? 54.171 30.958 8.572   0.60 28.72 ? 115  GLN A OE1 1 
ATOM   1076 O  OE1 B GLN A 1 118 ? 56.856 31.919 12.388  0.40 28.41 ? 115  GLN A OE1 1 
ATOM   1077 N  NE2 A GLN A 1 118 ? 52.410 29.944 9.586   0.60 32.88 ? 115  GLN A NE2 1 
ATOM   1078 N  NE2 B GLN A 1 118 ? 57.781 31.668 10.348  0.40 30.22 ? 115  GLN A NE2 1 
ATOM   1079 N  N   . ARG A 1 119 ? 51.761 33.938 12.732  1.00 16.46 ? 116  ARG A N   1 
ATOM   1080 C  CA  . ARG A 1 119 ? 50.548 33.812 13.556  1.00 16.42 ? 116  ARG A CA  1 
ATOM   1081 C  C   . ARG A 1 119 ? 49.284 34.287 12.836  1.00 16.34 ? 116  ARG A C   1 
ATOM   1082 O  O   . ARG A 1 119 ? 48.257 33.606 12.926  1.00 16.19 ? 116  ARG A O   1 
ATOM   1083 C  CB  . ARG A 1 119 ? 50.688 34.548 14.882  1.00 16.08 ? 116  ARG A CB  1 
ATOM   1084 C  CG  . ARG A 1 119 ? 51.756 33.966 15.769  1.00 19.71 ? 116  ARG A CG  1 
ATOM   1085 C  CD  . ARG A 1 119 ? 51.819 34.746 17.019  1.00 20.83 ? 116  ARG A CD  1 
ATOM   1086 N  NE  . ARG A 1 119 ? 50.548 34.496 17.762  1.00 24.45 ? 116  ARG A NE  1 
ATOM   1087 C  CZ  . ARG A 1 119 ? 49.862 35.421 18.405  1.00 23.13 ? 116  ARG A CZ  1 
ATOM   1088 N  NH1 . ARG A 1 119 ? 50.243 36.732 18.404  1.00 24.22 ? 116  ARG A NH1 1 
ATOM   1089 N  NH2 . ARG A 1 119 ? 48.773 34.978 19.100  1.00 26.94 ? 116  ARG A NH2 1 
ATOM   1090 N  N   . VAL A 1 120 ? 49.345 35.422 12.143  1.00 15.80 ? 117  VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 120 ? 48.182 35.917 11.412  1.00 15.18 ? 117  VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 120 ? 47.807 34.936 10.287  1.00 15.62 ? 117  VAL A C   1 
ATOM   1093 O  O   . VAL A 1 120 ? 46.630 34.602 10.119  1.00 16.29 ? 117  VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 120 ? 48.387 37.323 10.903  1.00 13.71 ? 117  VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 120 ? 47.188 37.788 10.069  1.00 15.38 ? 117  VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 120 ? 48.603 38.293 12.116  1.00 16.69 ? 117  VAL A CG2 1 
ATOM   1097 N  N   . LYS A 1 121 ? 48.821 34.456 9.559   1.00 16.19 ? 118  LYS A N   1 
ATOM   1098 C  CA  . LYS A 1 121 ? 48.609 33.532 8.463   1.00 17.05 ? 118  LYS A CA  1 
ATOM   1099 C  C   . LYS A 1 121 ? 47.894 32.284 9.012   1.00 16.83 ? 118  LYS A C   1 
ATOM   1100 O  O   . LYS A 1 121 ? 46.952 31.789 8.403   1.00 18.14 ? 118  LYS A O   1 
ATOM   1101 C  CB  . LYS A 1 121 ? 49.925 33.169 7.788   1.00 16.41 ? 118  LYS A CB  1 
ATOM   1102 C  CG  . LYS A 1 121 ? 49.762 32.179 6.686   1.00 18.29 ? 118  LYS A CG  1 
ATOM   1103 C  CD  . LYS A 1 121 ? 51.062 31.891 5.957   1.00 22.97 ? 118  LYS A CD  1 
ATOM   1104 C  CE  . LYS A 1 121 ? 50.833 30.833 4.849   1.00 29.98 ? 118  LYS A CE  1 
ATOM   1105 N  NZ  . LYS A 1 121 ? 52.046 30.765 3.975   1.00 33.80 ? 118  LYS A NZ  1 
ATOM   1106 N  N   . GLU A 1 122 ? 48.340 31.768 10.161  1.00 16.88 ? 119  GLU A N   1 
ATOM   1107 C  CA  A GLU A 1 122 ? 47.723 30.582 10.751  0.60 17.90 ? 119  GLU A CA  1 
ATOM   1108 C  CA  B GLU A 1 122 ? 47.731 30.582 10.770  0.40 17.90 ? 119  GLU A CA  1 
ATOM   1109 C  C   . GLU A 1 122 ? 46.279 30.832 11.154  1.00 17.31 ? 119  GLU A C   1 
ATOM   1110 O  O   . GLU A 1 122 ? 45.430 29.971 11.003  1.00 17.37 ? 119  GLU A O   1 
ATOM   1111 C  CB  A GLU A 1 122 ? 48.564 30.067 11.947  0.60 19.20 ? 119  GLU A CB  1 
ATOM   1112 C  CB  B GLU A 1 122 ? 48.529 30.146 12.018  0.40 18.92 ? 119  GLU A CB  1 
ATOM   1113 C  CG  A GLU A 1 122 ? 49.875 29.485 11.455  0.60 22.63 ? 119  GLU A CG  1 
ATOM   1114 C  CG  B GLU A 1 122 ? 47.959 28.948 12.759  0.40 22.42 ? 119  GLU A CG  1 
ATOM   1115 C  CD  A GLU A 1 122 ? 50.934 29.189 12.536  0.60 30.66 ? 119  GLU A CD  1 
ATOM   1116 C  CD  B GLU A 1 122 ? 48.893 28.449 13.844  0.40 28.45 ? 119  GLU A CD  1 
ATOM   1117 O  OE1 A GLU A 1 122 ? 50.677 29.483 13.729  0.60 35.53 ? 119  GLU A OE1 1 
ATOM   1118 O  OE1 B GLU A 1 122 ? 50.041 28.069 13.519  0.40 30.73 ? 119  GLU A OE1 1 
ATOM   1119 O  OE2 A GLU A 1 122 ? 52.044 28.690 12.155  0.60 30.87 ? 119  GLU A OE2 1 
ATOM   1120 O  OE2 B GLU A 1 122 ? 48.465 28.420 15.002  0.40 32.50 ? 119  GLU A OE2 1 
ATOM   1121 N  N   . LEU A 1 123 ? 46.002 31.999 11.711  1.00 16.91 ? 120  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 123 ? 44.628 32.338 12.070  1.00 17.22 ? 120  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 123 ? 43.756 32.372 10.836  1.00 16.34 ? 120  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 123 ? 42.681 31.767 10.849  1.00 17.05 ? 120  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 123 ? 44.602 33.736 12.756  1.00 16.50 ? 120  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 123 ? 43.218 34.319 13.020  1.00 16.98 ? 120  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 123 ? 42.474 33.470 14.026  1.00 18.57 ? 120  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 123 ? 43.278 35.797 13.415  1.00 18.73 ? 120  LEU A CD2 1 
ATOM   1129 N  N   . VAL A 1 124 ? 44.195 33.035 9.778   1.00 16.87 ? 121  VAL A N   1 
ATOM   1130 C  CA  . VAL A 1 124 ? 43.387 33.147 8.578   1.00 16.64 ? 121  VAL A CA  1 
ATOM   1131 C  C   . VAL A 1 124 ? 43.124 31.749 8.043   1.00 17.68 ? 121  VAL A C   1 
ATOM   1132 O  O   . VAL A 1 124 ? 41.972 31.467 7.684   1.00 18.86 ? 121  VAL A O   1 
ATOM   1133 C  CB  . VAL A 1 124 ? 44.033 34.087 7.550   1.00 16.17 ? 121  VAL A CB  1 
ATOM   1134 C  CG1 . VAL A 1 124 ? 43.288 34.086 6.237   1.00 17.39 ? 121  VAL A CG1 1 
ATOM   1135 C  CG2 . VAL A 1 124 ? 44.072 35.492 8.164   1.00 16.70 ? 121  VAL A CG2 1 
ATOM   1136 N  N   . GLU A 1 125 ? 44.149 30.908 7.966   1.00 18.18 ? 122  GLU A N   1 
ATOM   1137 C  CA  A GLU A 1 125 ? 43.999 29.558 7.430   0.60 19.20 ? 122  GLU A CA  1 
ATOM   1138 C  CA  B GLU A 1 125 ? 43.999 29.556 7.407   0.40 19.49 ? 122  GLU A CA  1 
ATOM   1139 C  C   . GLU A 1 125 ? 43.046 28.725 8.240   1.00 20.36 ? 122  GLU A C   1 
ATOM   1140 O  O   . GLU A 1 125 ? 42.250 27.951 7.668   1.00 20.76 ? 122  GLU A O   1 
ATOM   1141 C  CB  A GLU A 1 125 ? 45.341 28.865 7.335   0.60 20.64 ? 122  GLU A CB  1 
ATOM   1142 C  CB  B GLU A 1 125 ? 45.348 28.837 7.247   0.40 20.82 ? 122  GLU A CB  1 
ATOM   1143 C  CG  A GLU A 1 125 ? 46.228 29.570 6.354   0.60 23.00 ? 122  GLU A CG  1 
ATOM   1144 C  CG  B GLU A 1 125 ? 45.290 27.288 7.034   0.40 24.31 ? 122  GLU A CG  1 
ATOM   1145 C  CD  A GLU A 1 125 ? 47.571 28.879 6.100   0.60 25.73 ? 122  GLU A CD  1 
ATOM   1146 C  CD  B GLU A 1 125 ? 44.852 26.869 5.664   0.40 29.26 ? 122  GLU A CD  1 
ATOM   1147 O  OE1 A GLU A 1 125 ? 48.179 28.204 6.995   0.60 30.38 ? 122  GLU A OE1 1 
ATOM   1148 O  OE1 B GLU A 1 125 ? 44.998 27.679 4.727   0.40 32.56 ? 122  GLU A OE1 1 
ATOM   1149 O  OE2 A GLU A 1 125 ? 48.051 29.098 4.980   0.60 26.52 ? 122  GLU A OE2 1 
ATOM   1150 O  OE2 B GLU A 1 125 ? 44.372 25.721 5.517   0.40 30.34 ? 122  GLU A OE2 1 
ATOM   1151 N  N   . LYS A 1 126 ? 43.118 28.851 9.563   1.00 19.02 ? 123  LYS A N   1 
ATOM   1152 C  CA  A LYS A 1 126 ? 42.282 28.081 10.477  0.60 20.06 ? 123  LYS A CA  1 
ATOM   1153 C  CA  B LYS A 1 126 ? 42.262 28.074 10.458  0.40 19.74 ? 123  LYS A CA  1 
ATOM   1154 C  C   . LYS A 1 126 ? 40.814 28.490 10.282  1.00 19.68 ? 123  LYS A C   1 
ATOM   1155 O  O   . LYS A 1 126 ? 39.914 27.654 10.272  1.00 20.47 ? 123  LYS A O   1 
ATOM   1156 C  CB  A LYS A 1 126 ? 42.756 28.320 11.939  0.60 21.64 ? 123  LYS A CB  1 
ATOM   1157 C  CB  B LYS A 1 126 ? 42.649 28.280 11.928  0.40 20.69 ? 123  LYS A CB  1 
ATOM   1158 C  CG  A LYS A 1 126 ? 42.022 27.543 13.031  0.60 25.68 ? 123  LYS A CG  1 
ATOM   1159 C  CG  B LYS A 1 126 ? 43.757 27.398 12.426  0.40 22.57 ? 123  LYS A CG  1 
ATOM   1160 C  CD  A LYS A 1 126 ? 42.471 27.962 14.450  0.60 30.14 ? 123  LYS A CD  1 
ATOM   1161 C  CD  B LYS A 1 126 ? 43.966 27.700 13.893  0.40 23.62 ? 123  LYS A CD  1 
ATOM   1162 C  CE  A LYS A 1 126 ? 41.564 27.381 15.580  0.60 33.96 ? 123  LYS A CE  1 
ATOM   1163 C  CE  B LYS A 1 126 ? 42.637 27.697 14.653  0.40 28.25 ? 123  LYS A CE  1 
ATOM   1164 N  NZ  A LYS A 1 126 ? 42.246 27.476 16.938  0.60 35.22 ? 123  LYS A NZ  1 
ATOM   1165 N  NZ  B LYS A 1 126 ? 42.117 26.319 14.984  0.40 32.00 ? 123  LYS A NZ  1 
ATOM   1166 N  N   . VAL A 1 127 ? 40.595 29.784 10.158  1.00 17.41 ? 124  VAL A N   1 
ATOM   1167 C  CA  . VAL A 1 127 ? 39.227 30.295 9.964   1.00 17.89 ? 124  VAL A CA  1 
ATOM   1168 C  C   . VAL A 1 127 ? 38.658 29.923 8.577   1.00 20.16 ? 124  VAL A C   1 
ATOM   1169 O  O   . VAL A 1 127 ? 37.555 29.366 8.450   1.00 20.46 ? 124  VAL A O   1 
ATOM   1170 C  CB  . VAL A 1 127 ? 39.142 31.815 10.215  1.00 17.67 ? 124  VAL A CB  1 
ATOM   1171 C  CG1 . VAL A 1 127 ? 37.773 32.374 9.747   1.00 21.13 ? 124  VAL A CG1 1 
ATOM   1172 C  CG2 . VAL A 1 127 ? 39.408 32.081 11.676  1.00 19.01 ? 124  VAL A CG2 1 
ATOM   1173 N  N   . VAL A 1 128 ? 39.448 30.124 7.547   1.00 20.23 ? 125  VAL A N   1 
ATOM   1174 C  CA  . VAL A 1 128 ? 38.959 29.871 6.185   1.00 22.45 ? 125  VAL A CA  1 
ATOM   1175 C  C   . VAL A 1 128 ? 38.733 28.370 5.973   1.00 24.69 ? 125  VAL A C   1 
ATOM   1176 O  O   . VAL A 1 128 ? 37.738 28.001 5.303   1.00 27.00 ? 125  VAL A O   1 
ATOM   1177 C  CB  . VAL A 1 128 ? 39.944 30.491 5.154   1.00 22.86 ? 125  VAL A CB  1 
ATOM   1178 C  CG1 . VAL A 1 128 ? 39.611 30.065 3.699   1.00 25.04 ? 125  VAL A CG1 1 
ATOM   1179 C  CG2 . VAL A 1 128 ? 39.978 32.003 5.250   1.00 21.36 ? 125  VAL A CG2 1 
ATOM   1180 N  N   . SER A 1 129 ? 39.600 27.508 6.535   1.00 22.89 ? 126  SER A N   1 
ATOM   1181 C  CA  . SER A 1 129 ? 39.497 26.053 6.364   1.00 24.49 ? 126  SER A CA  1 
ATOM   1182 C  C   . SER A 1 129 ? 38.328 25.461 7.165   1.00 26.28 ? 126  SER A C   1 
ATOM   1183 O  O   . SER A 1 129 ? 37.946 24.296 6.970   1.00 29.09 ? 126  SER A O   1 
ATOM   1184 C  CB  . SER A 1 129 ? 40.774 25.361 6.782   1.00 25.10 ? 126  SER A CB  1 
ATOM   1185 O  OG  . SER A 1 129 ? 41.004 25.441 8.176   1.00 25.61 ? 126  SER A OG  1 
ATOM   1186 N  N   . GLY A 1 130 ? 37.774 26.236 8.090   1.00 25.45 ? 127  GLY A N   1 
ATOM   1187 C  CA  . GLY A 1 130 ? 36.780 25.700 9.007   1.00 26.89 ? 127  GLY A CA  1 
ATOM   1188 C  C   . GLY A 1 130 ? 37.279 24.991 10.217  1.00 28.81 ? 127  GLY A C   1 
ATOM   1189 O  O   . GLY A 1 130 ? 36.479 24.377 10.951  1.00 30.83 ? 127  GLY A O   1 
ATOM   1190 N  N   . ARG A 1 131 ? 38.581 24.985 10.474  1.00 27.23 ? 128  ARG A N   1 
ATOM   1191 C  CA  . ARG A 1 131 ? 39.115 24.457 11.715  1.00 28.51 ? 128  ARG A CA  1 
ATOM   1192 C  C   . ARG A 1 131 ? 38.748 25.280 12.929  1.00 29.58 ? 128  ARG A C   1 
ATOM   1193 O  O   . ARG A 1 131 ? 38.555 24.707 14.038  1.00 32.41 ? 128  ARG A O   1 
ATOM   1194 C  CB  . ARG A 1 131 ? 40.608 24.250 11.654  1.00 30.00 ? 128  ARG A CB  1 
ATOM   1195 C  CG  . ARG A 1 131 ? 41.004 23.129 10.688  1.00 34.72 ? 128  ARG A CG  1 
ATOM   1196 C  CD  . ARG A 1 131 ? 42.441 22.745 10.849  1.00 42.32 ? 128  ARG A CD  1 
ATOM   1197 N  NE  . ARG A 1 131 ? 43.317 23.900 10.740  1.00 46.47 ? 128  ARG A NE  1 
ATOM   1198 C  CZ  . ARG A 1 131 ? 43.777 24.411 9.606   1.00 49.63 ? 128  ARG A CZ  1 
ATOM   1199 N  NH1 . ARG A 1 131 ? 43.449 23.884 8.424   1.00 51.63 ? 128  ARG A NH1 1 
ATOM   1200 N  NH2 . ARG A 1 131 ? 44.579 25.468 9.659   1.00 49.27 ? 128  ARG A NH2 1 
ATOM   1201 N  N   . TRP A 1 132 ? 38.728 26.598 12.765  1.00 25.79 ? 129  TRP A N   1 
ATOM   1202 C  CA  . TRP A 1 132 ? 38.143 27.519 13.738  1.00 26.40 ? 129  TRP A CA  1 
ATOM   1203 C  C   . TRP A 1 132 ? 36.649 27.508 13.604  1.00 27.24 ? 129  TRP A C   1 
ATOM   1204 O  O   . TRP A 1 132 ? 36.095 27.834 12.537  1.00 31.22 ? 129  TRP A O   1 
ATOM   1205 C  CB  . TRP A 1 132 ? 38.653 28.953 13.500  1.00 27.49 ? 129  TRP A CB  1 
ATOM   1206 C  CG  . TRP A 1 132 ? 38.239 29.959 14.531  1.00 26.09 ? 129  TRP A CG  1 
ATOM   1207 C  CD1 . TRP A 1 132 ? 36.994 30.353 14.835  1.00 25.23 ? 129  TRP A CD1 1 
ATOM   1208 C  CD2 . TRP A 1 132 ? 39.119 30.689 15.391  1.00 24.30 ? 129  TRP A CD2 1 
ATOM   1209 N  NE1 . TRP A 1 132 ? 37.019 31.317 15.826  1.00 24.57 ? 129  TRP A NE1 1 
ATOM   1210 C  CE2 . TRP A 1 132 ? 38.314 31.532 16.183  1.00 24.65 ? 129  TRP A CE2 1 
ATOM   1211 C  CE3 . TRP A 1 132 ? 40.499 30.744 15.539  1.00 30.34 ? 129  TRP A CE3 1 
ATOM   1212 C  CZ2 . TRP A 1 132 ? 38.858 32.400 17.128  1.00 26.77 ? 129  TRP A CZ2 1 
ATOM   1213 C  CZ3 . TRP A 1 132 ? 41.034 31.593 16.482  1.00 29.75 ? 129  TRP A CZ3 1 
ATOM   1214 C  CH2 . TRP A 1 132 ? 40.214 32.436 17.231  1.00 27.74 ? 129  TRP A CH2 1 
ATOM   1215 N  N   . ARG A 1 133 ? 35.952 27.145 14.660  1.00 26.01 ? 130  ARG A N   1 
ATOM   1216 C  CA  . ARG A 1 133 ? 34.478 27.168 14.670  1.00 26.60 ? 130  ARG A CA  1 
ATOM   1217 C  C   . ARG A 1 133 ? 33.976 28.180 15.700  1.00 25.75 ? 130  ARG A C   1 
ATOM   1218 O  O   . ARG A 1 133 ? 34.635 28.495 16.704  1.00 26.64 ? 130  ARG A O   1 
ATOM   1219 C  CB  . ARG A 1 133 ? 33.903 25.781 15.009  1.00 29.26 ? 130  ARG A CB  1 
ATOM   1220 C  CG  . ARG A 1 133 ? 34.206 24.622 13.973  1.00 30.38 ? 130  ARG A CG  1 
ATOM   1221 C  CD  . ARG A 1 133 ? 33.700 24.933 12.597  1.00 34.52 ? 130  ARG A CD  1 
ATOM   1222 N  NE  . ARG A 1 133 ? 34.016 23.887 11.625  1.00 35.53 ? 130  ARG A NE  1 
ATOM   1223 C  CZ  . ARG A 1 133 ? 33.126 23.096 11.032  1.00 45.22 ? 130  ARG A CZ  1 
ATOM   1224 N  NH1 . ARG A 1 133 ? 31.829 23.211 11.296  1.00 43.82 ? 130  ARG A NH1 1 
ATOM   1225 N  NH2 . ARG A 1 133 ? 33.543 22.155 10.180  1.00 47.92 ? 130  ARG A NH2 1 
ATOM   1226 N  N   . GLY A 1 134 ? 32.771 28.690 15.485  1.00 24.76 ? 131  GLY A N   1 
ATOM   1227 C  CA  . GLY A 1 134 ? 32.126 29.419 16.513  1.00 24.44 ? 131  GLY A CA  1 
ATOM   1228 C  C   . GLY A 1 134 ? 31.740 28.590 17.697  1.00 25.01 ? 131  GLY A C   1 
ATOM   1229 O  O   . GLY A 1 134 ? 31.927 27.357 17.723  1.00 26.47 ? 131  GLY A O   1 
ATOM   1230 N  N   . PHE A 1 135 ? 31.216 29.242 18.732  1.00 24.66 ? 132  PHE A N   1 
ATOM   1231 C  CA  . PHE A 1 135 ? 30.953 28.576 19.994  1.00 25.43 ? 132  PHE A CA  1 
ATOM   1232 C  C   . PHE A 1 135 ? 29.913 27.462 19.841  1.00 26.37 ? 132  PHE A C   1 
ATOM   1233 O  O   . PHE A 1 135 ? 29.968 26.423 20.530  1.00 29.13 ? 132  PHE A O   1 
ATOM   1234 C  CB  . PHE A 1 135 ? 30.525 29.611 21.029  1.00 25.91 ? 132  PHE A CB  1 
ATOM   1235 C  CG  . PHE A 1 135 ? 30.360 29.063 22.421  1.00 27.79 ? 132  PHE A CG  1 
ATOM   1236 C  CD1 . PHE A 1 135 ? 31.469 28.628 23.133  1.00 27.33 ? 132  PHE A CD1 1 
ATOM   1237 C  CD2 . PHE A 1 135 ? 29.100 28.996 23.026  1.00 30.38 ? 132  PHE A CD2 1 
ATOM   1238 C  CE1 . PHE A 1 135 ? 31.330 28.118 24.452  1.00 29.10 ? 132  PHE A CE1 1 
ATOM   1239 C  CE2 . PHE A 1 135 ? 28.950 28.515 24.305  1.00 33.96 ? 132  PHE A CE2 1 
ATOM   1240 C  CZ  . PHE A 1 135 ? 30.073 28.073 25.016  1.00 31.43 ? 132  PHE A CZ  1 
ATOM   1241 N  N   . SER A 1 136 ? 29.002 27.626 18.897  1.00 25.33 ? 133  SER A N   1 
ATOM   1242 C  CA  . SER A 1 136 ? 28.008 26.538 18.619  1.00 26.62 ? 133  SER A CA  1 
ATOM   1243 C  C   . SER A 1 136 ? 28.468 25.548 17.550  1.00 26.99 ? 133  SER A C   1 
ATOM   1244 O  O   . SER A 1 136 ? 27.701 24.655 17.200  1.00 30.32 ? 133  SER A O   1 
ATOM   1245 C  CB  . SER A 1 136 ? 26.665 27.117 18.207  1.00 26.69 ? 133  SER A CB  1 
ATOM   1246 O  OG  . SER A 1 136 ? 26.713 27.775 16.965  1.00 25.92 ? 133  SER A OG  1 
ATOM   1247 N  N   . GLY A 1 137 ? 29.711 25.653 17.103  1.00 26.78 ? 134  GLY A N   1 
ATOM   1248 C  CA  . GLY A 1 137 ? 30.327 24.694 16.207  1.00 26.12 ? 134  GLY A CA  1 
ATOM   1249 C  C   . GLY A 1 137 ? 30.227 25.003 14.744  1.00 26.59 ? 134  GLY A C   1 
ATOM   1250 O  O   . GLY A 1 137 ? 30.594 24.162 13.939  1.00 28.26 ? 134  GLY A O   1 
ATOM   1251 N  N   . LYS A 1 138 ? 29.770 26.208 14.385  1.00 24.93 ? 135  LYS A N   1 
ATOM   1252 C  CA  . LYS A 1 138 ? 29.559 26.549 12.986  1.00 24.33 ? 135  LYS A CA  1 
ATOM   1253 C  C   . LYS A 1 138 ? 30.789 27.207 12.401  1.00 24.61 ? 135  LYS A C   1 
ATOM   1254 O  O   . LYS A 1 138 ? 31.520 27.906 13.136  1.00 24.29 ? 135  LYS A O   1 
ATOM   1255 C  CB  . LYS A 1 138 ? 28.357 27.479 12.844  1.00 24.88 ? 135  LYS A CB  1 
ATOM   1256 C  CG  . LYS A 1 138 ? 27.083 26.834 13.313  1.00 27.68 ? 135  LYS A CG  1 
ATOM   1257 C  CD  . LYS A 1 138 ? 25.917 27.670 12.920  1.00 28.41 ? 135  LYS A CD  1 
ATOM   1258 C  CE  . LYS A 1 138 ? 24.599 27.072 13.422  1.00 34.54 ? 135  LYS A CE  1 
ATOM   1259 N  NZ  . LYS A 1 138 ? 23.479 28.060 13.260  1.00 36.94 ? 135  LYS A NZ  1 
ATOM   1260 N  N   . LYS A 1 139 ? 31.007 26.983 11.098  1.00 23.93 ? 136  LYS A N   1 
ATOM   1261 C  CA  A LYS A 1 139 ? 32.074 27.655 10.354  0.70 24.27 ? 136  LYS A CA  1 
ATOM   1262 C  CA  B LYS A 1 139 ? 32.079 27.669 10.389  0.30 23.14 ? 136  LYS A CA  1 
ATOM   1263 C  C   . LYS A 1 139 ? 31.792 29.176 10.282  1.00 21.65 ? 136  LYS A C   1 
ATOM   1264 O  O   . LYS A 1 139 ? 30.648 29.624 10.163  1.00 22.03 ? 136  LYS A O   1 
ATOM   1265 C  CB  A LYS A 1 139 ? 32.166 27.069 8.931   0.70 25.76 ? 136  LYS A CB  1 
ATOM   1266 C  CB  B LYS A 1 139 ? 32.281 27.085 8.991   0.30 23.66 ? 136  LYS A CB  1 
ATOM   1267 C  CG  A LYS A 1 139 ? 33.349 27.550 8.048   0.70 30.08 ? 136  LYS A CG  1 
ATOM   1268 C  CG  B LYS A 1 139 ? 32.777 25.656 8.975   0.30 25.24 ? 136  LYS A CG  1 
ATOM   1269 C  CD  A LYS A 1 139 ? 33.025 27.503 6.538   0.70 35.14 ? 136  LYS A CD  1 
ATOM   1270 C  CD  B LYS A 1 139 ? 33.154 25.216 7.563   0.30 27.12 ? 136  LYS A CD  1 
ATOM   1271 C  CE  A LYS A 1 139 ? 34.261 27.664 5.625   0.70 35.23 ? 136  LYS A CE  1 
ATOM   1272 C  CE  B LYS A 1 139 ? 33.398 23.714 7.503   0.30 30.36 ? 136  LYS A CE  1 
ATOM   1273 N  NZ  A LYS A 1 139 ? 35.063 26.427 5.522   0.70 39.09 ? 136  LYS A NZ  1 
ATOM   1274 N  NZ  B LYS A 1 139 ? 33.525 23.215 6.101   0.30 32.13 ? 136  LYS A NZ  1 
ATOM   1275 N  N   . ILE A 1 140 ? 32.855 29.955 10.356  1.00 19.62 ? 137  ILE A N   1 
ATOM   1276 C  CA  . ILE A 1 140 ? 32.766 31.398 10.273  1.00 18.86 ? 137  ILE A CA  1 
ATOM   1277 C  C   . ILE A 1 140 ? 32.517 31.806 8.835   1.00 19.05 ? 137  ILE A C   1 
ATOM   1278 O  O   . ILE A 1 140 ? 33.128 31.284 7.905   1.00 20.37 ? 137  ILE A O   1 
ATOM   1279 C  CB  . ILE A 1 140 ? 34.062 32.008 10.772  1.00 18.88 ? 137  ILE A CB  1 
ATOM   1280 C  CG1 . ILE A 1 140 ? 34.332 31.642 12.247  1.00 18.15 ? 137  ILE A CG1 1 
ATOM   1281 C  CG2 . ILE A 1 140 ? 34.053 33.563 10.596  1.00 17.40 ? 137  ILE A CG2 1 
ATOM   1282 C  CD1 . ILE A 1 140 ? 33.202 31.982 13.211  1.00 21.32 ? 137  ILE A CD1 1 
ATOM   1283 N  N   . THR A 1 141 ? 31.611 32.760 8.654   1.00 18.72 ? 138  THR A N   1 
ATOM   1284 C  CA  . THR A 1 141 ? 31.289 33.303 7.329   1.00 18.14 ? 138  THR A CA  1 
ATOM   1285 C  C   . THR A 1 141 ? 31.544 34.802 7.205   1.00 17.20 ? 138  THR A C   1 
ATOM   1286 O  O   . THR A 1 141 ? 31.609 35.324 6.104   1.00 17.72 ? 138  THR A O   1 
ATOM   1287 C  CB  . THR A 1 141 ? 29.818 33.056 7.021   1.00 19.48 ? 138  THR A CB  1 
ATOM   1288 O  OG1 . THR A 1 141 ? 29.000 33.679 8.002   1.00 18.61 ? 138  THR A OG1 1 
ATOM   1289 C  CG2 . THR A 1 141 ? 29.464 31.567 7.014   1.00 22.67 ? 138  THR A CG2 1 
ATOM   1290 N  N   . ASP A 1 142 ? 31.707 35.507 8.342   1.00 16.97 ? 139  ASP A N   1 
ATOM   1291 C  CA  . ASP A 1 142 ? 31.797 36.938 8.387   1.00 16.23 ? 139  ASP A CA  1 
ATOM   1292 C  C   . ASP A 1 142 ? 32.859 37.373 9.389   1.00 14.76 ? 139  ASP A C   1 
ATOM   1293 O  O   . ASP A 1 142 ? 32.944 36.822 10.454  1.00 16.50 ? 139  ASP A O   1 
ATOM   1294 C  CB  . ASP A 1 142 ? 30.447 37.637 8.753   1.00 15.41 ? 139  ASP A CB  1 
ATOM   1295 C  CG  . ASP A 1 142 ? 29.401 37.502 7.662   1.00 17.14 ? 139  ASP A CG  1 
ATOM   1296 O  OD1 . ASP A 1 142 ? 29.283 38.376 6.778   1.00 18.27 ? 139  ASP A OD1 1 
ATOM   1297 O  OD2 . ASP A 1 142 ? 28.682 36.465 7.739   1.00 18.98 ? 139  ASP A OD2 1 
ATOM   1298 N  N   . ILE A 1 143 ? 33.585 38.416 9.021   1.00 14.69 ? 140  ILE A N   1 
ATOM   1299 C  CA  . ILE A 1 143 ? 34.610 39.039 9.839   1.00 13.72 ? 140  ILE A CA  1 
ATOM   1300 C  C   . ILE A 1 143 ? 34.214 40.488 10.030  1.00 14.27 ? 140  ILE A C   1 
ATOM   1301 O  O   . ILE A 1 143 ? 33.883 41.168 9.075   1.00 14.87 ? 140  ILE A O   1 
ATOM   1302 C  CB  . ILE A 1 143 ? 35.969 39.020 9.117   1.00 14.74 ? 140  ILE A CB  1 
ATOM   1303 C  CG1 . ILE A 1 143 ? 36.380 37.635 8.678   1.00 14.61 ? 140  ILE A CG1 1 
ATOM   1304 C  CG2 . ILE A 1 143 ? 37.085 39.700 9.980   1.00 16.70 ? 140  ILE A CG2 1 
ATOM   1305 C  CD1 . ILE A 1 143 ? 36.608 36.632 9.814   1.00 16.05 ? 140  ILE A CD1 1 
ATOM   1306 N  N   . VAL A 1 144 ? 34.239 40.971 11.268  1.00 14.20 ? 141  VAL A N   1 
ATOM   1307 C  CA  . VAL A 1 144 ? 33.934 42.378 11.572  1.00 14.64 ? 141  VAL A CA  1 
ATOM   1308 C  C   . VAL A 1 144 ? 35.124 42.991 12.257  1.00 14.14 ? 141  VAL A C   1 
ATOM   1309 O  O   . VAL A 1 144 ? 35.475 42.596 13.398  1.00 14.48 ? 141  VAL A O   1 
ATOM   1310 C  CB  . VAL A 1 144 ? 32.686 42.520 12.438  1.00 14.32 ? 141  VAL A CB  1 
ATOM   1311 C  CG1 . VAL A 1 144 ? 32.411 44.015 12.705  1.00 16.86 ? 141  VAL A CG1 1 
ATOM   1312 C  CG2 . VAL A 1 144 ? 31.457 41.801 11.763  1.00 15.25 ? 141  VAL A CG2 1 
ATOM   1313 N  N   . ASN A 1 145 ? 35.754 43.935 11.597  1.00 13.26 ? 142  ASN A N   1 
ATOM   1314 C  CA  . ASN A 1 145 ? 36.861 44.702 12.184  1.00 12.39 ? 142  ASN A CA  1 
ATOM   1315 C  C   . ASN A 1 145 ? 36.274 45.847 12.937  1.00 13.42 ? 142  ASN A C   1 
ATOM   1316 O  O   . ASN A 1 145 ? 35.397 46.564 12.402  1.00 13.83 ? 142  ASN A O   1 
ATOM   1317 C  CB  . ASN A 1 145 ? 37.771 45.230 11.096  1.00 13.54 ? 142  ASN A CB  1 
ATOM   1318 C  CG  . ASN A 1 145 ? 39.051 45.840 11.612  1.00 14.51 ? 142  ASN A CG  1 
ATOM   1319 O  OD1 . ASN A 1 145 ? 39.936 45.098 12.021  1.00 14.73 ? 142  ASN A OD1 1 
ATOM   1320 N  ND2 . ASN A 1 145 ? 39.152 47.171 11.631  1.00 15.11 ? 142  ASN A ND2 1 
ATOM   1321 N  N   . ILE A 1 146 ? 36.681 46.036 14.184  1.00 12.62 ? 143  ILE A N   1 
ATOM   1322 C  CA  . ILE A 1 146 ? 36.245 47.165 15.037  1.00 13.02 ? 143  ILE A CA  1 
ATOM   1323 C  C   . ILE A 1 146 ? 37.485 47.994 15.325  1.00 14.15 ? 143  ILE A C   1 
ATOM   1324 O  O   . ILE A 1 146 ? 38.382 47.555 16.039  1.00 13.41 ? 143  ILE A O   1 
ATOM   1325 C  CB  . ILE A 1 146 ? 35.543 46.734 16.329  1.00 13.12 ? 143  ILE A CB  1 
ATOM   1326 C  CG1 . ILE A 1 146 ? 34.428 45.744 16.016  1.00 14.76 ? 143  ILE A CG1 1 
ATOM   1327 C  CG2 . ILE A 1 146 ? 35.032 47.950 17.093  1.00 15.80 ? 143  ILE A CG2 1 
ATOM   1328 C  CD1 . ILE A 1 146 ? 33.768 45.173 17.263  1.00 17.40 ? 143  ILE A CD1 1 
ATOM   1329 N  N   . GLY A 1 147 ? 37.523 49.188 14.803  1.00 13.32 ? 144  GLY A N   1 
ATOM   1330 C  CA  . GLY A 1 147 ? 38.650 50.089 15.004  1.00 13.92 ? 144  GLY A CA  1 
ATOM   1331 C  C   . GLY A 1 147 ? 38.412 51.404 14.332  1.00 12.50 ? 144  GLY A C   1 
ATOM   1332 O  O   . GLY A 1 147 ? 37.510 51.499 13.496  1.00 12.49 ? 144  GLY A O   1 
ATOM   1333 N  N   . ILE A 1 148 ? 39.231 52.403 14.627  1.00 12.01 ? 145  ILE A N   1 
ATOM   1334 C  CA  . ILE A 1 148 ? 39.004 53.712 14.007  1.00 12.05 ? 145  ILE A CA  1 
ATOM   1335 C  C   . ILE A 1 148 ? 40.325 54.322 13.556  1.00 12.15 ? 145  ILE A C   1 
ATOM   1336 O  O   . ILE A 1 148 ? 41.384 53.971 14.113  1.00 12.73 ? 145  ILE A O   1 
ATOM   1337 C  CB  . ILE A 1 148 ? 38.201 54.674 14.933  1.00 12.94 ? 145  ILE A CB  1 
ATOM   1338 C  CG1 . ILE A 1 148 ? 37.591 55.897 14.213  1.00 12.75 ? 145  ILE A CG1 1 
ATOM   1339 C  CG2 . ILE A 1 148 ? 38.990 55.005 16.208  1.00 14.35 ? 145  ILE A CG2 1 
ATOM   1340 C  CD1 . ILE A 1 148 ? 36.457 56.535 15.006  1.00 15.17 ? 145  ILE A CD1 1 
ATOM   1341 N  N   . GLY A 1 149 ? 40.288 55.251 12.608  1.00 12.31 ? 146  GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 149 ? 41.510 55.905 12.165  1.00 12.91 ? 146  GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 149 ? 42.475 54.924 11.522  1.00 12.69 ? 146  GLY A C   1 
ATOM   1344 O  O   . GLY A 1 149 ? 42.136 54.151 10.627  1.00 13.00 ? 146  GLY A O   1 
ATOM   1345 N  N   . GLY A 1 150 ? 43.684 54.918 12.027  1.00 12.35 ? 147  GLY A N   1 
ATOM   1346 C  CA  . GLY A 1 150 ? 44.692 53.985 11.551  1.00 13.36 ? 147  GLY A CA  1 
ATOM   1347 C  C   . GLY A 1 150 ? 44.332 52.533 11.705  1.00 12.60 ? 147  GLY A C   1 
ATOM   1348 O  O   . GLY A 1 150 ? 44.869 51.679 11.022  1.00 13.72 ? 147  GLY A O   1 
ATOM   1349 N  N   . SER A 1 151 ? 43.423 52.212 12.634  1.00 12.79 ? 148  SER A N   1 
ATOM   1350 C  CA  . SER A 1 151 ? 42.949 50.846 12.820  1.00 13.11 ? 148  SER A CA  1 
ATOM   1351 C  C   . SER A 1 151 ? 41.731 50.475 12.015  1.00 13.96 ? 148  SER A C   1 
ATOM   1352 O  O   . SER A 1 151 ? 41.131 49.417 12.247  1.00 14.42 ? 148  SER A O   1 
ATOM   1353 C  CB  . SER A 1 151 ? 42.711 50.616 14.308  1.00 13.64 ? 148  SER A CB  1 
ATOM   1354 O  OG  . SER A 1 151 ? 44.008 50.598 14.984  1.00 13.81 ? 148  SER A OG  1 
ATOM   1355 N  N   . ASP A 1 152 ? 41.371 51.302 11.062  1.00 12.03 ? 149  ASP A N   1 
ATOM   1356 C  CA  . ASP A 1 152 ? 40.200 51.133 10.200  1.00 12.72 ? 149  ASP A CA  1 
ATOM   1357 C  C   . ASP A 1 152 ? 40.493 51.380 8.726   1.00 12.90 ? 149  ASP A C   1 
ATOM   1358 O  O   . ASP A 1 152 ? 40.227 50.523 7.854   1.00 13.12 ? 149  ASP A O   1 
ATOM   1359 C  CB  . ASP A 1 152 ? 39.085 52.104 10.656  1.00 12.99 ? 149  ASP A CB  1 
ATOM   1360 C  CG  . ASP A 1 152 ? 37.941 52.252 9.649   1.00 14.25 ? 149  ASP A CG  1 
ATOM   1361 O  OD1 . ASP A 1 152 ? 37.155 51.260 9.428   1.00 14.36 ? 149  ASP A OD1 1 
ATOM   1362 O  OD2 . ASP A 1 152 ? 37.764 53.362 9.074   1.00 16.74 ? 149  ASP A OD2 1 
ATOM   1363 N  N   . LEU A 1 153 ? 40.994 52.565 8.409   1.00 12.21 ? 150  LEU A N   1 
ATOM   1364 C  CA  . LEU A 1 153 ? 40.867 53.087 7.038   1.00 12.93 ? 150  LEU A CA  1 
ATOM   1365 C  C   . LEU A 1 153 ? 41.787 52.364 6.049   1.00 12.02 ? 150  LEU A C   1 
ATOM   1366 O  O   . LEU A 1 153 ? 41.385 52.102 4.898   1.00 12.12 ? 150  LEU A O   1 
ATOM   1367 C  CB  . LEU A 1 153 ? 41.083 54.604 6.996   1.00 13.58 ? 150  LEU A CB  1 
ATOM   1368 C  CG  . LEU A 1 153 ? 40.864 55.271 5.654   1.00 13.99 ? 150  LEU A CG  1 
ATOM   1369 C  CD1 . LEU A 1 153 ? 39.549 54.943 4.977   1.00 16.94 ? 150  LEU A CD1 1 
ATOM   1370 C  CD2 . LEU A 1 153 ? 40.948 56.784 5.894   1.00 16.59 ? 150  LEU A CD2 1 
ATOM   1371 N  N   . GLY A 1 154 ? 43.012 52.021 6.434   1.00 12.00 ? 151  GLY A N   1 
ATOM   1372 C  CA  . GLY A 1 154 ? 43.886 51.291 5.522   1.00 12.25 ? 151  GLY A CA  1 
ATOM   1373 C  C   . GLY A 1 154 ? 43.325 49.973 5.153   1.00 11.95 ? 151  GLY A C   1 
ATOM   1374 O  O   . GLY A 1 154 ? 43.200 49.674 3.961   1.00 12.27 ? 151  GLY A O   1 
ATOM   1375 N  N   . PRO A 1 155 ? 42.931 49.133 6.107   1.00 11.97 ? 152  PRO A N   1 
ATOM   1376 C  CA  . PRO A 1 155 ? 42.316 47.847 5.754   1.00 13.19 ? 152  PRO A CA  1 
ATOM   1377 C  C   . PRO A 1 155 ? 41.059 48.022 4.889   1.00 11.82 ? 152  PRO A C   1 
ATOM   1378 O  O   . PRO A 1 155 ? 40.906 47.328 3.904   1.00 13.63 ? 152  PRO A O   1 
ATOM   1379 C  CB  . PRO A 1 155 ? 42.059 47.226 7.128   1.00 13.97 ? 152  PRO A CB  1 
ATOM   1380 C  CG  . PRO A 1 155 ? 43.213 47.793 7.980   1.00 14.79 ? 152  PRO A CG  1 
ATOM   1381 C  CD  . PRO A 1 155 ? 43.321 49.198 7.531   1.00 12.36 ? 152  PRO A CD  1 
ATOM   1382 N  N   . LYS A 1 156 ? 40.212 48.988 5.229   1.00 11.90 ? 153  LYS A N   1 
ATOM   1383 C  CA  . LYS A 1 156 ? 38.949 49.211 4.486   1.00 12.29 ? 153  LYS A CA  1 
ATOM   1384 C  C   . LYS A 1 156 ? 39.303 49.592 3.061   1.00 12.88 ? 153  LYS A C   1 
ATOM   1385 O  O   . LYS A 1 156 ? 38.735 49.035 2.092   1.00 12.90 ? 153  LYS A O   1 
ATOM   1386 C  CB  . LYS A 1 156 ? 38.139 50.305 5.187   1.00 13.39 ? 153  LYS A CB  1 
ATOM   1387 C  CG  . LYS A 1 156 ? 36.821 50.552 4.509   1.00 14.75 ? 153  LYS A CG  1 
ATOM   1388 C  CD  . LYS A 1 156 ? 35.949 51.576 5.254   1.00 19.70 ? 153  LYS A CD  1 
ATOM   1389 C  CE  . LYS A 1 156 ? 36.491 52.966 5.042   1.00 29.42 ? 153  LYS A CE  1 
ATOM   1390 N  NZ  . LYS A 1 156 ? 35.468 54.093 5.029   1.00 35.29 ? 153  LYS A NZ  1 
ATOM   1391 N  N   . MET A 1 157 ? 40.252 50.511 2.877   1.00 11.79 ? 154  MET A N   1 
ATOM   1392 C  CA  . MET A 1 157 ? 40.600 50.969 1.545   1.00 11.94 ? 154  MET A CA  1 
ATOM   1393 C  C   . MET A 1 157 ? 41.165 49.823 0.695   1.00 11.97 ? 154  MET A C   1 
ATOM   1394 O  O   . MET A 1 157 ? 40.848 49.673 -0.501  1.00 12.78 ? 154  MET A O   1 
ATOM   1395 C  CB  . MET A 1 157 ? 41.638 52.102 1.681   1.00 11.96 ? 154  MET A CB  1 
ATOM   1396 C  CG  . MET A 1 157 ? 42.154 52.669 0.360   1.00 12.50 ? 154  MET A CG  1 
ATOM   1397 S  SD  . MET A 1 157 ? 43.535 51.792 -0.389  1.00 13.64 ? 154  MET A SD  1 
ATOM   1398 C  CE  . MET A 1 157 ? 44.851 52.387 0.725   1.00 15.88 ? 154  MET A CE  1 
ATOM   1399 N  N   . VAL A 1 158 ? 42.059 49.026 1.282   1.00 10.93 ? 155  VAL A N   1 
ATOM   1400 C  CA  . VAL A 1 158 ? 42.742 47.936 0.563   1.00 11.50 ? 155  VAL A CA  1 
ATOM   1401 C  C   . VAL A 1 158 ? 41.753 46.803 0.209   1.00 12.34 ? 155  VAL A C   1 
ATOM   1402 O  O   . VAL A 1 158 ? 41.794 46.244 -0.912  1.00 13.54 ? 155  VAL A O   1 
ATOM   1403 C  CB  . VAL A 1 158 ? 43.959 47.446 1.350   1.00 11.25 ? 155  VAL A CB  1 
ATOM   1404 C  CG1 . VAL A 1 158 ? 44.554 46.207 0.674   1.00 13.26 ? 155  VAL A CG1 1 
ATOM   1405 C  CG2 . VAL A 1 158 ? 45.043 48.564 1.450   1.00 12.80 ? 155  VAL A CG2 1 
ATOM   1406 N  N   . VAL A 1 159 ? 40.860 46.467 1.139   1.00 11.67 ? 156  VAL A N   1 
ATOM   1407 C  CA  . VAL A 1 159 ? 39.850 45.450 0.892   1.00 12.18 ? 156  VAL A CA  1 
ATOM   1408 C  C   . VAL A 1 159 ? 39.029 45.885 -0.338  1.00 12.65 ? 156  VAL A C   1 
ATOM   1409 O  O   . VAL A 1 159 ? 38.759 45.039 -1.247  1.00 13.82 ? 156  VAL A O   1 
ATOM   1410 C  CB  . VAL A 1 159 ? 38.999 45.183 2.099   1.00 11.17 ? 156  VAL A CB  1 
ATOM   1411 C  CG1 . VAL A 1 159 ? 37.753 44.302 1.776   1.00 13.26 ? 156  VAL A CG1 1 
ATOM   1412 C  CG2 . VAL A 1 159 ? 39.862 44.384 3.101   1.00 13.07 ? 156  VAL A CG2 1 
ATOM   1413 N  N   . ARG A 1 160 ? 38.594 47.132 -0.399  1.00 12.35 ? 157  ARG A N   1 
ATOM   1414 C  CA  . ARG A 1 160 ? 37.880 47.592 -1.612  1.00 12.60 ? 157  ARG A CA  1 
ATOM   1415 C  C   . ARG A 1 160 ? 38.735 47.584 -2.819  1.00 12.08 ? 157  ARG A C   1 
ATOM   1416 O  O   . ARG A 1 160 ? 38.281 47.146 -3.914  1.00 12.54 ? 157  ARG A O   1 
ATOM   1417 C  CB  . ARG A 1 160 ? 37.315 48.984 -1.397  1.00 13.27 ? 157  ARG A CB  1 
ATOM   1418 C  CG  . ARG A 1 160 ? 36.571 49.558 -2.595  1.00 13.31 ? 157  ARG A CG  1 
ATOM   1419 C  CD  . ARG A 1 160 ? 35.398 48.776 -2.988  1.00 14.58 ? 157  ARG A CD  1 
ATOM   1420 N  NE  . ARG A 1 160 ? 34.752 49.174 -4.252  1.00 16.84 ? 157  ARG A NE  1 
ATOM   1421 C  CZ  . ARG A 1 160 ? 34.982 48.571 -5.421  1.00 15.83 ? 157  ARG A CZ  1 
ATOM   1422 N  NH1 . ARG A 1 160 ? 35.914 47.671 -5.586  1.00 14.46 ? 157  ARG A NH1 1 
ATOM   1423 N  NH2 . ARG A 1 160 ? 34.219 48.927 -6.487  1.00 16.98 ? 157  ARG A NH2 1 
ATOM   1424 N  N   . ALA A 1 161 ? 39.964 48.073 -2.708  1.00 11.56 ? 158  ALA A N   1 
ATOM   1425 C  CA  . ALA A 1 161 ? 40.831 48.260 -3.879  1.00 11.71 ? 158  ALA A CA  1 
ATOM   1426 C  C   . ALA A 1 161 ? 41.165 46.942 -4.519  1.00 11.85 ? 158  ALA A C   1 
ATOM   1427 O  O   . ALA A 1 161 ? 41.403 46.878 -5.751  1.00 14.19 ? 158  ALA A O   1 
ATOM   1428 C  CB  . ALA A 1 161 ? 42.134 49.013 -3.483  1.00 11.89 ? 158  ALA A CB  1 
ATOM   1429 N  N   . LEU A 1 162 ? 41.208 45.872 -3.727  1.00 12.09 ? 159  LEU A N   1 
ATOM   1430 C  CA  . LEU A 1 162 ? 41.546 44.525 -4.154  1.00 12.47 ? 159  LEU A CA  1 
ATOM   1431 C  C   . LEU A 1 162 ? 40.360 43.582 -4.188  1.00 12.83 ? 159  LEU A C   1 
ATOM   1432 O  O   . LEU A 1 162 ? 40.500 42.368 -4.216  1.00 13.99 ? 159  LEU A O   1 
ATOM   1433 C  CB  . LEU A 1 162 ? 42.701 43.964 -3.295  1.00 13.05 ? 159  LEU A CB  1 
ATOM   1434 C  CG  . LEU A 1 162 ? 43.928 44.824 -3.241  1.00 11.78 ? 159  LEU A CG  1 
ATOM   1435 C  CD1 . LEU A 1 162 ? 44.984 44.210 -2.312  1.00 13.34 ? 159  LEU A CD1 1 
ATOM   1436 C  CD2 . LEU A 1 162 ? 44.517 44.969 -4.610  1.00 14.05 ? 159  LEU A CD2 1 
ATOM   1437 N  N   . GLN A 1 163 ? 39.161 44.155 -4.388  1.00 13.43 ? 160  GLN A N   1 
ATOM   1438 C  CA  . GLN A 1 163 ? 37.971 43.371 -4.482  1.00 13.05 ? 160  GLN A CA  1 
ATOM   1439 C  C   . GLN A 1 163 ? 38.022 42.229 -5.507  1.00 12.99 ? 160  GLN A C   1 
ATOM   1440 O  O   . GLN A 1 163 ? 37.530 41.133 -5.237  1.00 14.41 ? 160  GLN A O   1 
ATOM   1441 C  CB  . GLN A 1 163 ? 36.742 44.231 -4.638  1.00 13.95 ? 160  GLN A CB  1 
ATOM   1442 C  CG  . GLN A 1 163 ? 35.406 43.528 -4.426  1.00 15.55 ? 160  GLN A CG  1 
ATOM   1443 C  CD  . GLN A 1 163 ? 34.267 44.494 -4.466  1.00 21.91 ? 160  GLN A CD  1 
ATOM   1444 O  OE1 . GLN A 1 163 ? 34.011 45.224 -3.481  1.00 24.37 ? 160  GLN A OE1 1 
ATOM   1445 N  NE2 . GLN A 1 163 ? 33.557 44.517 -5.585  1.00 23.71 ? 160  GLN A NE2 1 
ATOM   1446 N  N   . PRO A 1 164 ? 38.637 42.448 -6.663  1.00 13.15 ? 161  PRO A N   1 
ATOM   1447 C  CA  . PRO A 1 164 ? 38.668 41.339 -7.591  1.00 14.05 ? 161  PRO A CA  1 
ATOM   1448 C  C   . PRO A 1 164 ? 39.441 40.092 -7.126  1.00 14.28 ? 161  PRO A C   1 
ATOM   1449 O  O   . PRO A 1 164 ? 39.259 38.978 -7.701  1.00 15.78 ? 161  PRO A O   1 
ATOM   1450 C  CB  . PRO A 1 164 ? 39.377 41.943 -8.814  1.00 15.64 ? 161  PRO A CB  1 
ATOM   1451 C  CG  . PRO A 1 164 ? 38.957 43.380 -8.747  1.00 14.45 ? 161  PRO A CG  1 
ATOM   1452 C  CD  . PRO A 1 164 ? 39.094 43.706 -7.272  1.00 13.94 ? 161  PRO A CD  1 
ATOM   1453 N  N   . TYR A 1 165 ? 40.295 40.313 -6.117  1.00 14.00 ? 162  TYR A N   1 
ATOM   1454 C  CA  . TYR A 1 165 ? 41.145 39.283 -5.558  1.00 14.06 ? 162  TYR A CA  1 
ATOM   1455 C  C   . TYR A 1 165 ? 40.513 38.634 -4.326  1.00 15.63 ? 162  TYR A C   1 
ATOM   1456 O  O   . TYR A 1 165 ? 41.185 37.796 -3.692  1.00 16.16 ? 162  TYR A O   1 
ATOM   1457 C  CB  . TYR A 1 165 ? 42.535 39.858 -5.235  1.00 14.80 ? 162  TYR A CB  1 
ATOM   1458 C  CG  . TYR A 1 165 ? 43.227 40.366 -6.469  1.00 13.56 ? 162  TYR A CG  1 
ATOM   1459 C  CD1 . TYR A 1 165 ? 44.057 39.551 -7.182  1.00 16.40 ? 162  TYR A CD1 1 
ATOM   1460 C  CD2 . TYR A 1 165 ? 43.030 41.633 -6.908  1.00 14.30 ? 162  TYR A CD2 1 
ATOM   1461 C  CE1 . TYR A 1 165 ? 44.686 39.990 -8.325  1.00 16.96 ? 162  TYR A CE1 1 
ATOM   1462 C  CE2 . TYR A 1 165 ? 43.629 42.125 -8.083  1.00 14.69 ? 162  TYR A CE2 1 
ATOM   1463 C  CZ  . TYR A 1 165 ? 44.449 41.288 -8.774  1.00 16.14 ? 162  TYR A CZ  1 
ATOM   1464 O  OH  . TYR A 1 165 ? 45.051 41.845 -9.909  1.00 18.39 ? 162  TYR A OH  1 
ATOM   1465 N  N   . HIS A 1 166 ? 39.284 39.008 -3.959  1.00 15.17 ? 163  HIS A N   1 
ATOM   1466 C  CA  . HIS A 1 166 ? 38.644 38.390 -2.762  1.00 16.55 ? 163  HIS A CA  1 
ATOM   1467 C  C   . HIS A 1 166 ? 38.496 36.889 -3.056  1.00 18.04 ? 163  HIS A C   1 
ATOM   1468 O  O   . HIS A 1 166 ? 38.083 36.491 -4.129  1.00 18.33 ? 163  HIS A O   1 
ATOM   1469 C  CB  . HIS A 1 166 ? 37.315 38.986 -2.426  1.00 16.69 ? 163  HIS A CB  1 
ATOM   1470 C  CG  . HIS A 1 166 ? 37.404 40.371 -1.823  1.00 18.46 ? 163  HIS A CG  1 
ATOM   1471 N  ND1 . HIS A 1 166 ? 36.317 40.960 -1.186  1.00 24.19 ? 163  HIS A ND1 1 
ATOM   1472 C  CD2 . HIS A 1 166 ? 38.412 41.257 -1.747  1.00 19.60 ? 163  HIS A CD2 1 
ATOM   1473 C  CE1 . HIS A 1 166 ? 36.659 42.192 -0.820  1.00 22.15 ? 163  HIS A CE1 1 
ATOM   1474 N  NE2 . HIS A 1 166 ? 37.937 42.374 -1.104  1.00 19.18 ? 163  HIS A NE2 1 
ATOM   1475 N  N   . CYS A 1 167 ? 38.824 36.036 -2.099  1.00 17.13 ? 164  CYS A N   1 
ATOM   1476 C  CA  . CYS A 1 167 ? 38.862 34.584 -2.386  1.00 18.09 ? 164  CYS A CA  1 
ATOM   1477 C  C   . CYS A 1 167 ? 38.705 33.657 -1.229  1.00 19.39 ? 164  CYS A C   1 
ATOM   1478 O  O   . CYS A 1 167 ? 38.934 32.430 -1.396  1.00 23.65 ? 164  CYS A O   1 
ATOM   1479 C  CB  . CYS A 1 167 ? 40.182 34.267 -3.080  1.00 18.61 ? 164  CYS A CB  1 
ATOM   1480 S  SG  . CYS A 1 167 ? 41.646 34.647 -2.111  1.00 20.06 ? 164  CYS A SG  1 
ATOM   1481 N  N   . THR A 1 168 ? 38.296 34.157 -0.068  1.00 18.90 ? 165  THR A N   1 
ATOM   1482 C  CA  . THR A 1 168 ? 38.208 33.351 1.136   1.00 19.14 ? 165  THR A CA  1 
ATOM   1483 C  C   . THR A 1 168 ? 36.823 32.887 1.459   1.00 19.78 ? 165  THR A C   1 
ATOM   1484 O  O   . THR A 1 168 ? 36.650 32.156 2.443   1.00 22.33 ? 165  THR A O   1 
ATOM   1485 C  CB  . THR A 1 168 ? 38.659 34.156 2.318   1.00 18.56 ? 165  THR A CB  1 
ATOM   1486 O  OG1 . THR A 1 168 ? 37.877 35.350 2.358   1.00 17.66 ? 165  THR A OG1 1 
ATOM   1487 C  CG2 . THR A 1 168 ? 40.167 34.512 2.225   1.00 21.29 ? 165  THR A CG2 1 
ATOM   1488 N  N   . ASP A 1 169 ? 35.811 33.343 0.708   1.00 20.91 ? 166  ASP A N   1 
ATOM   1489 C  CA  . ASP A 1 169 ? 34.407 33.074 1.030   1.00 23.57 ? 166  ASP A CA  1 
ATOM   1490 C  C   . ASP A 1 169 ? 33.918 33.740 2.330   1.00 23.90 ? 166  ASP A C   1 
ATOM   1491 O  O   . ASP A 1 169 ? 32.820 33.457 2.834   1.00 26.67 ? 166  ASP A O   1 
ATOM   1492 C  CB  . ASP A 1 169 ? 34.085 31.589 0.973   1.00 25.72 ? 166  ASP A CB  1 
ATOM   1493 C  CG  . ASP A 1 169 ? 34.194 31.026 -0.455  1.00 31.48 ? 166  ASP A CG  1 
ATOM   1494 O  OD1 . ASP A 1 169 ? 33.888 31.754 -1.441  1.00 37.02 ? 166  ASP A OD1 1 
ATOM   1495 O  OD2 . ASP A 1 169 ? 34.629 29.876 -0.536  1.00 38.74 ? 166  ASP A OD2 1 
ATOM   1496 N  N   . LEU A 1 170 ? 34.704 34.685 2.837   1.00 19.69 ? 167  LEU A N   1 
ATOM   1497 C  CA  . LEU A 1 170 ? 34.315 35.458 4.010   1.00 19.88 ? 167  LEU A CA  1 
ATOM   1498 C  C   . LEU A 1 170 ? 33.929 36.840 3.559   1.00 19.22 ? 167  LEU A C   1 
ATOM   1499 O  O   . LEU A 1 170 ? 34.590 37.409 2.675   1.00 22.43 ? 167  LEU A O   1 
ATOM   1500 C  CB  . LEU A 1 170 ? 35.490 35.620 4.993   1.00 19.41 ? 167  LEU A CB  1 
ATOM   1501 C  CG  . LEU A 1 170 ? 35.996 34.313 5.568   1.00 19.46 ? 167  LEU A CG  1 
ATOM   1502 C  CD1 . LEU A 1 170 ? 37.288 34.560 6.344   1.00 17.76 ? 167  LEU A CD1 1 
ATOM   1503 C  CD2 . LEU A 1 170 ? 34.928 33.658 6.471   1.00 19.93 ? 167  LEU A CD2 1 
ATOM   1504 N  N   . LYS A 1 171 ? 32.924 37.413 4.211   1.00 17.89 ? 168  LYS A N   1 
ATOM   1505 C  CA  . LYS A 1 171 ? 32.589 38.816 4.009   1.00 17.60 ? 168  LYS A CA  1 
ATOM   1506 C  C   . LYS A 1 171 ? 33.203 39.580 5.168   1.00 17.10 ? 168  LYS A C   1 
ATOM   1507 O  O   . LYS A 1 171 ? 33.049 39.159 6.332   1.00 17.84 ? 168  LYS A O   1 
ATOM   1508 C  CB  . LYS A 1 171 ? 31.094 39.010 3.975   1.00 19.48 ? 168  LYS A CB  1 
ATOM   1509 C  CG  . LYS A 1 171 ? 30.429 38.349 2.709   1.00 22.42 ? 168  LYS A CG  1 
ATOM   1510 C  CD  . LYS A 1 171 ? 28.902 38.570 2.795   1.00 27.99 ? 168  LYS A CD  1 
ATOM   1511 C  CE  . LYS A 1 171 ? 28.154 37.826 1.700   1.00 34.86 ? 168  LYS A CE  1 
ATOM   1512 N  NZ  . LYS A 1 171 ? 26.837 38.497 1.387   1.00 38.12 ? 168  LYS A NZ  1 
ATOM   1513 N  N   . VAL A 1 172 ? 33.875 40.682 4.840   1.00 15.17 ? 169  VAL A N   1 
ATOM   1514 C  CA  . VAL A 1 172 ? 34.617 41.467 5.783   1.00 15.09 ? 169  VAL A CA  1 
ATOM   1515 C  C   . VAL A 1 172 ? 33.937 42.808 5.918   1.00 16.06 ? 169  VAL A C   1 
ATOM   1516 O  O   . VAL A 1 172 ? 33.660 43.479 4.889   1.00 18.88 ? 169  VAL A O   1 
ATOM   1517 C  CB  . VAL A 1 172 ? 36.072 41.654 5.332   1.00 15.84 ? 169  VAL A CB  1 
ATOM   1518 C  CG1 . VAL A 1 172 ? 36.835 42.438 6.369   1.00 16.14 ? 169  VAL A CG1 1 
ATOM   1519 C  CG2 . VAL A 1 172 ? 36.761 40.311 5.159   1.00 17.03 ? 169  VAL A CG2 1 
ATOM   1520 N  N   . HIS A 1 173 ? 33.638 43.233 7.131   1.00 13.84 ? 170  HIS A N   1 
ATOM   1521 C  CA  . HIS A 1 173 ? 32.921 44.422 7.417   1.00 13.77 ? 170  HIS A CA  1 
ATOM   1522 C  C   . HIS A 1 173 ? 33.769 45.313 8.347   1.00 14.69 ? 170  HIS A C   1 
ATOM   1523 O  O   . HIS A 1 173 ? 34.537 44.778 9.177   1.00 16.51 ? 170  HIS A O   1 
ATOM   1524 C  CB  . HIS A 1 173 ? 31.627 44.119 8.164   1.00 15.10 ? 170  HIS A CB  1 
ATOM   1525 C  CG  . HIS A 1 173 ? 30.851 42.987 7.587   1.00 16.60 ? 170  HIS A CG  1 
ATOM   1526 N  ND1 . HIS A 1 173 ? 29.714 43.190 6.817   1.00 19.91 ? 170  HIS A ND1 1 
ATOM   1527 C  CD2 . HIS A 1 173 ? 31.018 41.647 7.677   1.00 16.08 ? 170  HIS A CD2 1 
ATOM   1528 C  CE1 . HIS A 1 173 ? 29.249 41.994 6.439   1.00 18.92 ? 170  HIS A CE1 1 
ATOM   1529 N  NE2 . HIS A 1 173 ? 30.038 41.050 6.931   1.00 18.28 ? 170  HIS A NE2 1 
ATOM   1530 N  N   . PHE A 1 174 ? 33.557 46.613 8.277   1.00 13.91 ? 171  PHE A N   1 
ATOM   1531 C  CA  . PHE A 1 174 ? 34.360 47.588 9.025   1.00 12.61 ? 171  PHE A CA  1 
ATOM   1532 C  C   . PHE A 1 174 ? 33.444 48.472 9.907   1.00 14.30 ? 171  PHE A C   1 
ATOM   1533 O  O   . PHE A 1 174 ? 32.609 49.203 9.368   1.00 15.76 ? 171  PHE A O   1 
ATOM   1534 C  CB  . PHE A 1 174 ? 35.217 48.421 8.085   1.00 13.25 ? 171  PHE A CB  1 
ATOM   1535 C  CG  . PHE A 1 174 ? 36.242 47.622 7.381   1.00 12.64 ? 171  PHE A CG  1 
ATOM   1536 C  CD1 . PHE A 1 174 ? 37.441 47.383 8.015   1.00 14.58 ? 171  PHE A CD1 1 
ATOM   1537 C  CD2 . PHE A 1 174 ? 36.019 47.021 6.197   1.00 14.36 ? 171  PHE A CD2 1 
ATOM   1538 C  CE1 . PHE A 1 174 ? 38.397 46.577 7.417   1.00 16.01 ? 171  PHE A CE1 1 
ATOM   1539 C  CE2 . PHE A 1 174 ? 36.988 46.208 5.611   1.00 15.87 ? 171  PHE A CE2 1 
ATOM   1540 C  CZ  . PHE A 1 174 ? 38.144 45.982 6.248   1.00 14.74 ? 171  PHE A CZ  1 
ATOM   1541 N  N   . VAL A 1 175 ? 33.614 48.443 11.198  1.00 13.73 ? 172  VAL A N   1 
ATOM   1542 C  CA  . VAL A 1 175 ? 32.888 49.221 12.177  1.00 12.98 ? 172  VAL A CA  1 
ATOM   1543 C  C   . VAL A 1 175 ? 33.911 50.189 12.755  1.00 14.72 ? 172  VAL A C   1 
ATOM   1544 O  O   . VAL A 1 175 ? 34.997 49.745 13.173  1.00 14.16 ? 172  VAL A O   1 
ATOM   1545 C  CB  . VAL A 1 175 ? 32.297 48.354 13.268  1.00 14.06 ? 172  VAL A CB  1 
ATOM   1546 C  CG1 . VAL A 1 175 ? 31.774 49.220 14.482  1.00 13.56 ? 172  VAL A CG1 1 
ATOM   1547 C  CG2 . VAL A 1 175 ? 31.219 47.393 12.653  1.00 14.59 ? 172  VAL A CG2 1 
ATOM   1548 N  N   . SER A 1 176 ? 33.599 51.475 12.812  1.00 12.35 ? 173  SER A N   1 
ATOM   1549 C  CA  . SER A 1 176 ? 34.579 52.458 13.206  1.00 11.94 ? 173  SER A CA  1 
ATOM   1550 C  C   . SER A 1 176 ? 33.994 53.606 14.057  1.00 13.40 ? 173  SER A C   1 
ATOM   1551 O  O   . SER A 1 176 ? 34.332 53.787 15.232  1.00 13.30 ? 173  SER A O   1 
ATOM   1552 C  CB  . SER A 1 176 ? 35.338 52.998 12.019  1.00 12.80 ? 173  SER A CB  1 
ATOM   1553 O  OG  . SER A 1 176 ? 34.409 53.582 11.068  1.00 13.32 ? 173  SER A OG  1 
ATOM   1554 N  N   . ASN A 1 177 ? 33.143 54.426 13.433  1.00 13.20 ? 174  ASN A N   1 
ATOM   1555 C  CA  . ASN A 1 177 ? 32.580 55.566 14.113  1.00 13.14 ? 174  ASN A CA  1 
ATOM   1556 C  C   . ASN A 1 177 ? 31.895 55.138 15.392  1.00 13.36 ? 174  ASN A C   1 
ATOM   1557 O  O   . ASN A 1 177 ? 31.317 54.058 15.492  1.00 13.10 ? 174  ASN A O   1 
ATOM   1558 C  CB  . ASN A 1 177 ? 31.512 56.207 13.164  1.00 12.85 ? 174  ASN A CB  1 
ATOM   1559 C  CG  . ASN A 1 177 ? 31.258 57.645 13.421  1.00 13.56 ? 174  ASN A CG  1 
ATOM   1560 O  OD1 . ASN A 1 177 ? 31.388 58.152 14.541  1.00 12.89 ? 174  ASN A OD1 1 
ATOM   1561 N  ND2 . ASN A 1 177 ? 30.841 58.357 12.357  1.00 12.87 ? 174  ASN A ND2 1 
ATOM   1562 N  N   . VAL A 1 178 ? 31.949 56.001 16.401  1.00 12.60 ? 175  VAL A N   1 
ATOM   1563 C  CA  . VAL A 1 178 ? 31.097 55.795 17.559  1.00 14.22 ? 175  VAL A CA  1 
ATOM   1564 C  C   . VAL A 1 178 ? 29.612 55.916 17.204  1.00 14.03 ? 175  VAL A C   1 
ATOM   1565 O  O   . VAL A 1 178 ? 28.784 55.319 17.852  1.00 14.87 ? 175  VAL A O   1 
ATOM   1566 C  CB  . VAL A 1 178 ? 31.480 56.644 18.747  1.00 14.75 ? 175  VAL A CB  1 
ATOM   1567 C  CG1 . VAL A 1 178 ? 31.206 58.120 18.519  1.00 16.79 ? 175  VAL A CG1 1 
ATOM   1568 C  CG2 . VAL A 1 178 ? 30.793 56.197 20.031  1.00 15.97 ? 175  VAL A CG2 1 
ATOM   1569 N  N   . ASP A 1 179 ? 29.244 56.700 16.183  1.00 13.53 ? 176  ASP A N   1 
ATOM   1570 C  CA  . ASP A 1 179 ? 27.861 56.719 15.698  1.00 13.48 ? 176  ASP A CA  1 
ATOM   1571 C  C   . ASP A 1 179 ? 27.445 55.272 15.478  1.00 12.35 ? 176  ASP A C   1 
ATOM   1572 O  O   . ASP A 1 179 ? 28.065 54.555 14.657  1.00 12.99 ? 176  ASP A O   1 
ATOM   1573 C  CB  . ASP A 1 179 ? 27.853 57.457 14.365  1.00 13.14 ? 176  ASP A CB  1 
ATOM   1574 C  CG  . ASP A 1 179 ? 26.468 57.505 13.712  1.00 14.75 ? 176  ASP A CG  1 
ATOM   1575 O  OD1 . ASP A 1 179 ? 25.513 56.922 14.220  1.00 14.92 ? 176  ASP A OD1 1 
ATOM   1576 O  OD2 . ASP A 1 179 ? 26.409 58.136 12.621  1.00 15.37 ? 176  ASP A OD2 1 
ATOM   1577 N  N   . ALA A 1 180 ? 26.390 54.835 16.187  1.00 13.68 ? 177  ALA A N   1 
ATOM   1578 C  CA  . ALA A 1 180 ? 26.027 53.430 16.177  1.00 13.40 ? 177  ALA A CA  1 
ATOM   1579 C  C   . ALA A 1 180 ? 25.502 52.942 14.827  1.00 13.60 ? 177  ALA A C   1 
ATOM   1580 O  O   . ALA A 1 180 ? 25.393 51.759 14.586  1.00 15.42 ? 177  ALA A O   1 
ATOM   1581 C  CB  . ALA A 1 180 ? 25.078 53.045 17.317  1.00 14.06 ? 177  ALA A CB  1 
ATOM   1582 N  N   . ASP A 1 181 ? 25.232 53.879 13.930  1.00 14.01 ? 178  ASP A N   1 
ATOM   1583 C  CA  . ASP A 1 181 ? 24.956 53.468 12.549  1.00 14.39 ? 178  ASP A CA  1 
ATOM   1584 C  C   . ASP A 1 181 ? 26.067 52.550 12.018  1.00 14.48 ? 178  ASP A C   1 
ATOM   1585 O  O   . ASP A 1 181 ? 25.797 51.611 11.287  1.00 14.35 ? 178  ASP A O   1 
ATOM   1586 C  CB  . ASP A 1 181 ? 24.766 54.695 11.636  1.00 14.50 ? 178  ASP A CB  1 
ATOM   1587 C  CG  . ASP A 1 181 ? 24.243 54.322 10.276  1.00 15.45 ? 178  ASP A CG  1 
ATOM   1588 O  OD1 . ASP A 1 181 ? 23.005 54.115 10.245  1.00 16.80 ? 178  ASP A OD1 1 
ATOM   1589 O  OD2 . ASP A 1 181 ? 25.023 54.222 9.302   1.00 15.49 ? 178  ASP A OD2 1 
ATOM   1590 N  N   . SER A 1 182 ? 27.344 52.822 12.347  1.00 13.01 ? 179  SER A N   1 
ATOM   1591 C  CA  . SER A 1 182 ? 28.461 52.010 11.882  1.00 13.87 ? 179  SER A CA  1 
ATOM   1592 C  C   . SER A 1 182 ? 28.383 50.563 12.351  1.00 14.71 ? 179  SER A C   1 
ATOM   1593 O  O   . SER A 1 182 ? 28.365 49.609 11.569  1.00 14.18 ? 179  SER A O   1 
ATOM   1594 C  CB  . SER A 1 182 ? 29.759 52.663 12.311  1.00 13.22 ? 179  SER A CB  1 
ATOM   1595 O  OG  . SER A 1 182 ? 30.838 51.957 11.682  1.00 14.33 ? 179  SER A OG  1 
ATOM   1596 N  N   . LEU A 1 183 ? 28.243 50.401 13.647  1.00 14.82 ? 180  LEU A N   1 
ATOM   1597 C  CA  . LEU A 1 183 ? 28.075 49.043 14.217  1.00 15.55 ? 180  LEU A CA  1 
ATOM   1598 C  C   . LEU A 1 183 ? 26.848 48.363 13.658  1.00 15.18 ? 180  LEU A C   1 
ATOM   1599 O  O   . LEU A 1 183 ? 26.923 47.185 13.267  1.00 15.98 ? 180  LEU A O   1 
ATOM   1600 C  CB  . LEU A 1 183 ? 27.942 49.139 15.753  1.00 15.62 ? 180  LEU A CB  1 
ATOM   1601 C  CG  . LEU A 1 183 ? 27.761 47.802 16.511  1.00 18.08 ? 180  LEU A CG  1 
ATOM   1602 C  CD1 . LEU A 1 183 ? 28.912 46.859 16.347  1.00 19.50 ? 180  LEU A CD1 1 
ATOM   1603 C  CD2 . LEU A 1 183 ? 27.478 48.095 18.001  1.00 21.14 ? 180  LEU A CD2 1 
ATOM   1604 N  N   . LEU A 1 184 ? 25.760 49.101 13.544  1.00 15.78 ? 181  LEU A N   1 
ATOM   1605 C  CA  . LEU A 1 184 ? 24.503 48.488 13.068  1.00 15.88 ? 181  LEU A CA  1 
ATOM   1606 C  C   . LEU A 1 184 ? 24.551 48.030 11.635  1.00 14.81 ? 181  LEU A C   1 
ATOM   1607 O  O   . LEU A 1 184 ? 23.951 47.024 11.315  1.00 17.62 ? 181  LEU A O   1 
ATOM   1608 C  CB  . LEU A 1 184 ? 23.322 49.412 13.292  1.00 17.13 ? 181  LEU A CB  1 
ATOM   1609 C  CG  . LEU A 1 184 ? 22.926 49.571 14.736  1.00 19.05 ? 181  LEU A CG  1 
ATOM   1610 C  CD1 . LEU A 1 184 ? 21.911 50.696 14.949  1.00 23.79 ? 181  LEU A CD1 1 
ATOM   1611 C  CD2 . LEU A 1 184 ? 22.303 48.287 15.318  1.00 23.51 ? 181  LEU A CD2 1 
ATOM   1612 N  N   . GLN A 1 185 ? 25.326 48.705 10.798  1.00 15.27 ? 182  GLN A N   1 
ATOM   1613 C  CA  . GLN A 1 185 ? 25.414 48.265 9.401   1.00 15.82 ? 182  GLN A CA  1 
ATOM   1614 C  C   . GLN A 1 185 ? 26.016 46.877 9.305   1.00 17.91 ? 182  GLN A C   1 
ATOM   1615 O  O   . GLN A 1 185 ? 25.662 46.080 8.453   1.00 18.98 ? 182  GLN A O   1 
ATOM   1616 C  CB  . GLN A 1 185 ? 26.196 49.199 8.510   1.00 16.76 ? 182  GLN A CB  1 
ATOM   1617 C  CG  . GLN A 1 185 ? 25.630 50.562 8.289   1.00 17.84 ? 182  GLN A CG  1 
ATOM   1618 C  CD  . GLN A 1 185 ? 24.140 50.540 8.098   1.00 21.52 ? 182  GLN A CD  1 
ATOM   1619 O  OE1 . GLN A 1 185 ? 23.647 49.947 7.123   1.00 23.15 ? 182  GLN A OE1 1 
ATOM   1620 N  NE2 . GLN A 1 185 ? 23.394 51.093 9.056   1.00 21.15 ? 182  GLN A NE2 1 
ATOM   1621 N  N   . ALA A 1 186 ? 26.928 46.559 10.224  1.00 16.25 ? 183  ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 186 ? 27.473 45.224 10.296  1.00 16.85 ? 183  ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 186 ? 26.521 44.261 10.985  1.00 16.85 ? 183  ALA A C   1 
ATOM   1624 O  O   . ALA A 1 186 ? 26.224 43.162 10.471  1.00 17.85 ? 183  ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 186 ? 28.850 45.222 11.083  1.00 16.89 ? 183  ALA A CB  1 
ATOM   1626 N  N   . LEU A 1 187 ? 26.051 44.611 12.185  1.00 17.39 ? 184  LEU A N   1 
ATOM   1627 C  CA  . LEU A 1 187 ? 25.210 43.675 12.964  1.00 18.59 ? 184  LEU A CA  1 
ATOM   1628 C  C   . LEU A 1 187 ? 23.940 43.319 12.235  1.00 19.37 ? 184  LEU A C   1 
ATOM   1629 O  O   . LEU A 1 187 ? 23.429 42.203 12.373  1.00 22.11 ? 184  LEU A O   1 
ATOM   1630 C  CB  . LEU A 1 187 ? 24.880 44.172 14.374  1.00 19.83 ? 184  LEU A CB  1 
ATOM   1631 C  CG  . LEU A 1 187 ? 26.100 44.466 15.246  1.00 20.02 ? 184  LEU A CG  1 
ATOM   1632 C  CD1 . LEU A 1 187 ? 25.570 44.866 16.638  1.00 22.38 ? 184  LEU A CD1 1 
ATOM   1633 C  CD2 . LEU A 1 187 ? 27.129 43.314 15.267  1.00 22.12 ? 184  LEU A CD2 1 
ATOM   1634 N  N   . HIS A 1 188 ? 23.423 44.212 11.413  1.00 18.42 ? 185  HIS A N   1 
ATOM   1635 C  CA  . HIS A 1 188 ? 22.177 43.898 10.663  1.00 20.58 ? 185  HIS A CA  1 
ATOM   1636 C  C   . HIS A 1 188 ? 22.351 42.775 9.637   1.00 22.00 ? 185  HIS A C   1 
ATOM   1637 O  O   . HIS A 1 188 ? 21.316 42.189 9.222   1.00 24.69 ? 185  HIS A O   1 
ATOM   1638 C  CB  . HIS A 1 188 ? 21.667 45.125 9.902   1.00 20.64 ? 185  HIS A CB  1 
ATOM   1639 C  CG  . HIS A 1 188 ? 21.011 46.165 10.741  1.00 21.03 ? 185  HIS A CG  1 
ATOM   1640 N  ND1 . HIS A 1 188 ? 20.820 47.447 10.260  1.00 23.13 ? 185  HIS A ND1 1 
ATOM   1641 C  CD2 . HIS A 1 188 ? 20.497 46.147 11.984  1.00 24.19 ? 185  HIS A CD2 1 
ATOM   1642 C  CE1 . HIS A 1 188 ? 20.206 48.162 11.183  1.00 23.50 ? 185  HIS A CE1 1 
ATOM   1643 N  NE2 . HIS A 1 188 ? 20.008 47.402 12.243  1.00 23.19 ? 185  HIS A NE2 1 
ATOM   1644 N  N   . VAL A 1 189 ? 23.562 42.431 9.261   1.00 20.72 ? 186  VAL A N   1 
ATOM   1645 C  CA  . VAL A 1 189 ? 23.810 41.489 8.167   1.00 21.61 ? 186  VAL A CA  1 
ATOM   1646 C  C   . VAL A 1 189 ? 24.688 40.315 8.596   1.00 21.26 ? 186  VAL A C   1 
ATOM   1647 O  O   . VAL A 1 189 ? 25.068 39.503 7.734   1.00 22.62 ? 186  VAL A O   1 
ATOM   1648 C  CB  . VAL A 1 189 ? 24.390 42.141 6.899   1.00 21.45 ? 186  VAL A CB  1 
ATOM   1649 C  CG1 . VAL A 1 189 ? 23.344 43.113 6.299   1.00 25.35 ? 186  VAL A CG1 1 
ATOM   1650 C  CG2 . VAL A 1 189 ? 25.740 42.804 7.093   1.00 19.34 ? 186  VAL A CG2 1 
ATOM   1651 N  N   . VAL A 1 190 ? 24.968 40.214 9.902   1.00 19.63 ? 187  VAL A N   1 
ATOM   1652 C  CA  . VAL A 1 190 ? 25.793 39.102 10.373  1.00 18.31 ? 187  VAL A CA  1 
ATOM   1653 C  C   . VAL A 1 190 ? 25.135 38.379 11.529  1.00 20.53 ? 187  VAL A C   1 
ATOM   1654 O  O   . VAL A 1 190 ? 24.278 38.925 12.227  1.00 22.16 ? 187  VAL A O   1 
ATOM   1655 C  CB  . VAL A 1 190 ? 27.223 39.537 10.774  1.00 17.91 ? 187  VAL A CB  1 
ATOM   1656 C  CG1 . VAL A 1 190 ? 27.984 40.200 9.620   1.00 17.83 ? 187  VAL A CG1 1 
ATOM   1657 C  CG2 . VAL A 1 190 ? 27.257 40.406 12.059  1.00 21.00 ? 187  VAL A CG2 1 
ATOM   1658 N  N   . ASP A 1 191 ? 25.511 37.108 11.711  1.00 20.79 ? 188  ASP A N   1 
ATOM   1659 C  CA  . ASP A 1 191 ? 24.950 36.194 12.708  1.00 21.93 ? 188  ASP A CA  1 
ATOM   1660 C  C   . ASP A 1 191 ? 26.002 35.953 13.787  1.00 21.34 ? 188  ASP A C   1 
ATOM   1661 O  O   . ASP A 1 191 ? 27.130 35.621 13.448  1.00 20.87 ? 188  ASP A O   1 
ATOM   1662 C  CB  . ASP A 1 191 ? 24.656 34.840 11.936  1.00 23.45 ? 188  ASP A CB  1 
ATOM   1663 C  CG  . ASP A 1 191 ? 24.084 33.688 12.760  1.00 29.93 ? 188  ASP A CG  1 
ATOM   1664 O  OD1 . ASP A 1 191 ? 24.180 33.608 13.999  1.00 31.80 ? 188  ASP A OD1 1 
ATOM   1665 O  OD2 . ASP A 1 191 ? 23.501 32.760 12.086  1.00 36.20 ? 188  ASP A OD2 1 
ATOM   1666 N  N   . PRO A 1 192 ? 25.646 36.113 15.054  1.00 21.77 ? 189  PRO A N   1 
ATOM   1667 C  CA  . PRO A 1 192 ? 26.635 35.902 16.097  1.00 20.52 ? 189  PRO A CA  1 
ATOM   1668 C  C   . PRO A 1 192 ? 27.311 34.540 16.024  1.00 21.77 ? 189  PRO A C   1 
ATOM   1669 O  O   . PRO A 1 192 ? 28.494 34.428 16.402  1.00 21.46 ? 189  PRO A O   1 
ATOM   1670 C  CB  . PRO A 1 192 ? 25.855 36.060 17.401  1.00 23.36 ? 189  PRO A CB  1 
ATOM   1671 C  CG  . PRO A 1 192 ? 24.439 36.279 17.012  1.00 26.32 ? 189  PRO A CG  1 
ATOM   1672 C  CD  . PRO A 1 192 ? 24.310 36.452 15.569  1.00 22.99 ? 189  PRO A CD  1 
ATOM   1673 N  N   . GLU A 1 193 ? 26.609 33.487 15.579  1.00 21.34 ? 190  GLU A N   1 
ATOM   1674 C  CA  . GLU A 1 193 ? 27.215 32.162 15.576  1.00 21.09 ? 190  GLU A CA  1 
ATOM   1675 C  C   . GLU A 1 193 ? 28.268 31.942 14.485  1.00 20.54 ? 190  GLU A C   1 
ATOM   1676 O  O   . GLU A 1 193 ? 29.055 30.990 14.619  1.00 20.10 ? 190  GLU A O   1 
ATOM   1677 C  CB  . GLU A 1 193 ? 26.108 31.085 15.481  1.00 21.61 ? 190  GLU A CB  1 
ATOM   1678 C  CG  . GLU A 1 193 ? 25.231 31.102 16.702  1.00 23.46 ? 190  GLU A CG  1 
ATOM   1679 C  CD  . GLU A 1 193 ? 24.281 29.894 16.820  1.00 29.57 ? 190  GLU A CD  1 
ATOM   1680 O  OE1 . GLU A 1 193 ? 24.494 28.785 16.240  1.00 30.49 ? 190  GLU A OE1 1 
ATOM   1681 O  OE2 . GLU A 1 193 ? 23.310 30.048 17.608  1.00 38.00 ? 190  GLU A OE2 1 
ATOM   1682 N  N   . THR A 1 194 ? 28.321 32.809 13.488  1.00 18.37 ? 191  THR A N   1 
ATOM   1683 C  CA  . THR A 1 194 ? 29.193 32.659 12.332  1.00 19.11 ? 191  THR A CA  1 
ATOM   1684 C  C   . THR A 1 194 ? 30.108 33.848 12.054  1.00 17.48 ? 191  THR A C   1 
ATOM   1685 O  O   . THR A 1 194 ? 30.600 34.016 10.936  1.00 18.13 ? 191  THR A O   1 
ATOM   1686 C  CB  . THR A 1 194 ? 28.349 32.279 11.089  1.00 19.90 ? 191  THR A CB  1 
ATOM   1687 O  OG1 . THR A 1 194 ? 27.371 33.273 10.852  1.00 22.36 ? 191  THR A OG1 1 
ATOM   1688 C  CG2 . THR A 1 194 ? 27.639 30.889 11.292  1.00 20.71 ? 191  THR A CG2 1 
ATOM   1689 N  N   . THR A 1 195 ? 30.288 34.708 13.067  1.00 17.48 ? 192  THR A N   1 
ATOM   1690 C  CA  . THR A 1 195 ? 31.041 35.947 12.906  1.00 16.25 ? 192  THR A CA  1 
ATOM   1691 C  C   . THR A 1 195 ? 32.248 35.954 13.872  1.00 15.94 ? 192  THR A C   1 
ATOM   1692 O  O   . THR A 1 195 ? 32.131 35.659 15.064  1.00 17.34 ? 192  THR A O   1 
ATOM   1693 C  CB  . THR A 1 195 ? 30.167 37.139 13.228  1.00 17.49 ? 192  THR A CB  1 
ATOM   1694 O  OG1 . THR A 1 195 ? 29.071 37.133 12.304  1.00 18.55 ? 192  THR A OG1 1 
ATOM   1695 C  CG2 . THR A 1 195 ? 30.890 38.463 13.080  1.00 16.68 ? 192  THR A CG2 1 
ATOM   1696 N  N   . LEU A 1 196 ? 33.394 36.316 13.330  1.00 16.54 ? 193  LEU A N   1 
ATOM   1697 C  CA  . LEU A 1 196 ? 34.586 36.615 14.118  1.00 16.33 ? 193  LEU A CA  1 
ATOM   1698 C  C   . LEU A 1 196 ? 34.787 38.115 14.151  1.00 15.37 ? 193  LEU A C   1 
ATOM   1699 O  O   . LEU A 1 196 ? 34.855 38.749 13.107  1.00 15.67 ? 193  LEU A O   1 
ATOM   1700 C  CB  . LEU A 1 196 ? 35.820 35.885 13.526  1.00 16.62 ? 193  LEU A CB  1 
ATOM   1701 C  CG  . LEU A 1 196 ? 37.123 36.153 14.272  1.00 17.03 ? 193  LEU A CG  1 
ATOM   1702 C  CD1 . LEU A 1 196 ? 37.059 35.686 15.758  1.00 18.71 ? 193  LEU A CD1 1 
ATOM   1703 C  CD2 . LEU A 1 196 ? 38.305 35.414 13.555  1.00 19.41 ? 193  LEU A CD2 1 
ATOM   1704 N  N   . LEU A 1 197 ? 34.894 38.672 15.354  1.00 15.36 ? 194  LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 197 ? 35.056 40.076 15.614  1.00 16.42 ? 194  LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 197 ? 36.528 40.323 15.964  1.00 15.69 ? 194  LEU A C   1 
ATOM   1707 O  O   . LEU A 1 197 ? 37.121 39.586 16.726  1.00 16.45 ? 194  LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 197 ? 34.156 40.540 16.761  1.00 18.26 ? 194  LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 197 ? 32.699 40.354 16.325  1.00 19.99 ? 194  LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 197 ? 32.107 39.517 17.259  1.00 24.84 ? 194  LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 197 ? 31.908 41.538 16.124  1.00 20.62 ? 194  LEU A CD2 1 
ATOM   1712 N  N   . ILE A 1 198 ? 37.062 41.380 15.386  1.00 14.38 ? 195  ILE A N   1 
ATOM   1713 C  CA  . ILE A 1 198 ? 38.490 41.814 15.559  1.00 13.65 ? 195  ILE A CA  1 
ATOM   1714 C  C   . ILE A 1 198 ? 38.444 43.135 16.257  1.00 14.54 ? 195  ILE A C   1 
ATOM   1715 O  O   . ILE A 1 198 ? 37.853 44.096 15.740  1.00 15.27 ? 195  ILE A O   1 
ATOM   1716 C  CB  . ILE A 1 198 ? 39.226 42.019 14.260  1.00 13.66 ? 195  ILE A CB  1 
ATOM   1717 C  CG1 . ILE A 1 198 ? 39.241 40.756 13.451  1.00 14.89 ? 195  ILE A CG1 1 
ATOM   1718 C  CG2 . ILE A 1 198 ? 40.635 42.528 14.537  1.00 15.03 ? 195  ILE A CG2 1 
ATOM   1719 C  CD1 . ILE A 1 198 ? 39.645 40.945 11.983  1.00 16.62 ? 195  ILE A CD1 1 
ATOM   1720 N  N   . ILE A 1 199 ? 39.068 43.229 17.433  1.00 14.09 ? 196  ILE A N   1 
ATOM   1721 C  CA  . ILE A 1 199 ? 39.206 44.542 18.097  1.00 14.29 ? 196  ILE A CA  1 
ATOM   1722 C  C   . ILE A 1 199 ? 40.596 45.088 17.706  1.00 15.66 ? 196  ILE A C   1 
ATOM   1723 O  O   . ILE A 1 199 ? 41.602 44.561 18.229  1.00 15.47 ? 196  ILE A O   1 
ATOM   1724 C  CB  . ILE A 1 199 ? 39.009 44.514 19.606  1.00 15.09 ? 196  ILE A CB  1 
ATOM   1725 C  CG1 . ILE A 1 199 ? 37.724 43.869 20.030  1.00 15.70 ? 196  ILE A CG1 1 
ATOM   1726 C  CG2 . ILE A 1 199 ? 39.137 45.982 20.150  1.00 16.92 ? 196  ILE A CG2 1 
ATOM   1727 C  CD1 . ILE A 1 199 ? 37.634 43.763 21.545  1.00 17.71 ? 196  ILE A CD1 1 
ATOM   1728 N  N   . ALA A 1 200 ? 40.662 46.078 16.824  1.00 13.59 ? 197  ALA A N   1 
ATOM   1729 C  CA  . ALA A 1 200 ? 41.939 46.601 16.288  1.00 12.61 ? 197  ALA A CA  1 
ATOM   1730 C  C   . ALA A 1 200 ? 42.196 47.892 17.018  1.00 13.55 ? 197  ALA A C   1 
ATOM   1731 O  O   . ALA A 1 200 ? 41.533 48.887 16.749  1.00 14.07 ? 197  ALA A O   1 
ATOM   1732 C  CB  . ALA A 1 200 ? 41.790 46.811 14.762  1.00 13.24 ? 197  ALA A CB  1 
ATOM   1733 N  N   . SER A 1 201 ? 43.172 47.867 17.937  1.00 14.02 ? 198  SER A N   1 
ATOM   1734 C  CA  . SER A 1 201 ? 43.493 49.097 18.655  1.00 14.64 ? 198  SER A CA  1 
ATOM   1735 C  C   . SER A 1 201 ? 44.888 49.042 19.236  1.00 14.23 ? 198  SER A C   1 
ATOM   1736 O  O   . SER A 1 201 ? 45.150 48.291 20.179  1.00 15.93 ? 198  SER A O   1 
ATOM   1737 C  CB  . SER A 1 201 ? 42.491 49.338 19.770  1.00 14.74 ? 198  SER A CB  1 
ATOM   1738 O  OG  . SER A 1 201 ? 42.736 50.537 20.470  1.00 15.56 ? 198  SER A OG  1 
ATOM   1739 N  N   . LYS A 1 202 ? 45.759 49.861 18.684  1.00 14.77 ? 199  LYS A N   1 
ATOM   1740 C  CA  . LYS A 1 202 ? 47.153 49.930 19.157  1.00 14.78 ? 199  LYS A CA  1 
ATOM   1741 C  C   . LYS A 1 202 ? 47.185 50.220 20.612  1.00 16.10 ? 199  LYS A C   1 
ATOM   1742 O  O   . LYS A 1 202 ? 47.892 49.527 21.374  1.00 16.98 ? 199  LYS A O   1 
ATOM   1743 C  CB  . LYS A 1 202 ? 47.888 51.005 18.360  1.00 16.06 ? 199  LYS A CB  1 
ATOM   1744 C  CG  . LYS A 1 202 ? 49.371 51.123 18.734  1.00 16.19 ? 199  LYS A CG  1 
ATOM   1745 C  CD  . LYS A 1 202 ? 50.069 52.207 17.938  1.00 15.39 ? 199  LYS A CD  1 
ATOM   1746 C  CE  . LYS A 1 202 ? 51.540 52.353 18.349  1.00 15.80 ? 199  LYS A CE  1 
ATOM   1747 N  NZ  . LYS A 1 202 ? 52.225 53.425 17.487  1.00 15.45 ? 199  LYS A NZ  1 
ATOM   1748 N  N   . SER A 1 203 ? 46.452 51.223 21.044  1.00 16.23 ? 200  SER A N   1 
ATOM   1749 C  CA  . SER A 1 203 ? 46.441 51.630 22.458  1.00 16.53 ? 200  SER A CA  1 
ATOM   1750 C  C   . SER A 1 203 ? 45.531 50.816 23.359  1.00 17.72 ? 200  SER A C   1 
ATOM   1751 O  O   . SER A 1 203 ? 45.685 50.796 24.591  1.00 18.74 ? 200  SER A O   1 
ATOM   1752 C  CB  . SER A 1 203 ? 45.998 53.089 22.557  1.00 17.69 ? 200  SER A CB  1 
ATOM   1753 O  OG  . SER A 1 203 ? 44.650 53.290 22.145  1.00 17.78 ? 200  SER A OG  1 
ATOM   1754 N  N   . PHE A 1 204 ? 44.492 50.218 22.792  1.00 17.70 ? 201  PHE A N   1 
ATOM   1755 C  CA  . PHE A 1 204 ? 43.417 49.593 23.476  1.00 18.48 ? 201  PHE A CA  1 
ATOM   1756 C  C   . PHE A 1 204 ? 42.675 50.527 24.432  1.00 20.08 ? 201  PHE A C   1 
ATOM   1757 O  O   . PHE A 1 204 ? 42.067 50.078 25.399  1.00 22.98 ? 201  PHE A O   1 
ATOM   1758 C  CB  . PHE A 1 204 ? 43.832 48.260 24.189  1.00 18.98 ? 201  PHE A CB  1 
ATOM   1759 C  CG  . PHE A 1 204 ? 42.925 47.097 23.820  1.00 19.60 ? 201  PHE A CG  1 
ATOM   1760 C  CD1 . PHE A 1 204 ? 42.974 46.630 22.536  1.00 18.12 ? 201  PHE A CD1 1 
ATOM   1761 C  CD2 . PHE A 1 204 ? 42.012 46.558 24.703  1.00 20.95 ? 201  PHE A CD2 1 
ATOM   1762 C  CE1 . PHE A 1 204 ? 42.114 45.599 22.087  1.00 20.10 ? 201  PHE A CE1 1 
ATOM   1763 C  CE2 . PHE A 1 204 ? 41.173 45.492 24.275  1.00 22.30 ? 201  PHE A CE2 1 
ATOM   1764 C  CZ  . PHE A 1 204 ? 41.246 45.067 22.960  1.00 19.03 ? 201  PHE A CZ  1 
ATOM   1765 N  N   . SER A 1 205 ? 42.681 51.842 24.164  1.00 19.51 ? 202  SER A N   1 
ATOM   1766 C  CA  . SER A 1 205 ? 41.921 52.752 25.013  1.00 20.76 ? 202  SER A CA  1 
ATOM   1767 C  C   . SER A 1 205 ? 41.164 53.853 24.269  1.00 20.41 ? 202  SER A C   1 
ATOM   1768 O  O   . SER A 1 205 ? 40.739 54.865 24.861  1.00 24.42 ? 202  SER A O   1 
ATOM   1769 C  CB  . SER A 1 205 ? 42.803 53.387 26.051  1.00 24.82 ? 202  SER A CB  1 
ATOM   1770 O  OG  . SER A 1 205 ? 43.835 54.082 25.447  1.00 24.82 ? 202  SER A OG  1 
ATOM   1771 N  N   . THR A 1 206 ? 40.889 53.621 23.005  1.00 18.15 ? 203  THR A N   1 
ATOM   1772 C  CA  . THR A 1 206 ? 40.242 54.635 22.172  1.00 15.09 ? 203  THR A CA  1 
ATOM   1773 C  C   . THR A 1 206 ? 38.742 54.563 22.416  1.00 16.55 ? 203  THR A C   1 
ATOM   1774 O  O   . THR A 1 206 ? 38.184 53.470 22.355  1.00 18.45 ? 203  THR A O   1 
ATOM   1775 C  CB  . THR A 1 206 ? 40.536 54.355 20.718  1.00 15.23 ? 203  THR A CB  1 
ATOM   1776 O  OG1 . THR A 1 206 ? 41.955 54.435 20.528  1.00 16.29 ? 203  THR A OG1 1 
ATOM   1777 C  CG2 . THR A 1 206 ? 39.862 55.390 19.783  1.00 15.98 ? 203  THR A CG2 1 
ATOM   1778 N  N   . GLU A 1 207 ? 38.137 55.702 22.772  1.00 18.29 ? 204  GLU A N   1 
ATOM   1779 C  CA  A GLU A 1 207 ? 36.716 55.787 23.159  0.60 18.67 ? 204  GLU A CA  1 
ATOM   1780 C  CA  B GLU A 1 207 ? 36.755 55.632 23.230  0.40 18.37 ? 204  GLU A CA  1 
ATOM   1781 C  C   . GLU A 1 207 ? 35.783 55.051 22.205  1.00 17.88 ? 204  GLU A C   1 
ATOM   1782 O  O   . GLU A 1 207 ? 34.960 54.233 22.597  1.00 17.70 ? 204  GLU A O   1 
ATOM   1783 C  CB  A GLU A 1 207 ? 36.268 57.275 23.218  0.60 20.06 ? 204  GLU A CB  1 
ATOM   1784 C  CB  B GLU A 1 207 ? 36.272 56.979 23.748  0.40 19.85 ? 204  GLU A CB  1 
ATOM   1785 C  CG  A GLU A 1 207 ? 34.817 57.445 23.788  0.60 24.01 ? 204  GLU A CG  1 
ATOM   1786 C  CG  B GLU A 1 207 ? 36.975 57.411 25.006  0.40 22.66 ? 204  GLU A CG  1 
ATOM   1787 C  CD  A GLU A 1 207 ? 34.180 58.839 23.650  0.60 27.77 ? 204  GLU A CD  1 
ATOM   1788 C  CD  B GLU A 1 207 ? 36.477 56.671 26.249  0.40 27.14 ? 204  GLU A CD  1 
ATOM   1789 O  OE1 A GLU A 1 207 ? 34.553 59.623 22.772  0.60 30.31 ? 204  GLU A OE1 1 
ATOM   1790 O  OE1 B GLU A 1 207 ? 35.286 56.309 26.306  0.40 30.69 ? 204  GLU A OE1 1 
ATOM   1791 O  OE2 A GLU A 1 207 ? 33.257 59.149 24.433  0.60 32.95 ? 204  GLU A OE2 1 
ATOM   1792 O  OE2 B GLU A 1 207 ? 37.267 56.460 27.174  0.40 33.60 ? 204  GLU A OE2 1 
ATOM   1793 N  N   . GLU A 1 208 ? 35.921 55.345 20.925  1.00 16.35 ? 205  GLU A N   1 
ATOM   1794 C  CA  . GLU A 1 208 ? 34.965 54.774 19.946  1.00 15.57 ? 205  GLU A CA  1 
ATOM   1795 C  C   . GLU A 1 208 ? 35.054 53.254 19.879  1.00 15.34 ? 205  GLU A C   1 
ATOM   1796 O  O   . GLU A 1 208 ? 34.057 52.562 19.828  1.00 15.41 ? 205  GLU A O   1 
ATOM   1797 C  CB  . GLU A 1 208 ? 35.157 55.365 18.552  1.00 14.83 ? 205  GLU A CB  1 
ATOM   1798 C  CG  . GLU A 1 208 ? 34.949 56.865 18.487  1.00 15.56 ? 205  GLU A CG  1 
ATOM   1799 C  CD  . GLU A 1 208 ? 36.227 57.728 18.615  1.00 17.80 ? 205  GLU A CD  1 
ATOM   1800 O  OE1 . GLU A 1 208 ? 37.154 57.355 19.429  1.00 16.89 ? 205  GLU A OE1 1 
ATOM   1801 O  OE2 . GLU A 1 208 ? 36.280 58.792 17.956  1.00 14.45 ? 205  GLU A OE2 1 
ATOM   1802 N  N   . THR A 1 209 ? 36.279 52.757 19.851  1.00 15.72 ? 206  THR A N   1 
ATOM   1803 C  CA  . THR A 1 209 ? 36.544 51.342 19.725  1.00 14.80 ? 206  THR A CA  1 
ATOM   1804 C  C   . THR A 1 209 ? 36.134 50.625 21.036  1.00 15.92 ? 206  THR A C   1 
ATOM   1805 O  O   . THR A 1 209 ? 35.591 49.546 20.956  1.00 16.68 ? 206  THR A O   1 
ATOM   1806 C  CB  . THR A 1 209 ? 37.988 51.142 19.393  1.00 15.33 ? 206  THR A CB  1 
ATOM   1807 O  OG1 . THR A 1 209 ? 38.270 51.823 18.167  1.00 14.84 ? 206  THR A OG1 1 
ATOM   1808 C  CG2 . THR A 1 209 ? 38.304 49.616 19.220  1.00 16.32 ? 206  THR A CG2 1 
ATOM   1809 N  N   . LEU A 1 210 ? 36.318 51.238 22.221  1.00 16.58 ? 207  LEU A N   1 
ATOM   1810 C  CA  . LEU A 1 210 ? 35.824 50.689 23.480  1.00 19.23 ? 207  LEU A CA  1 
ATOM   1811 C  C   . LEU A 1 210 ? 34.317 50.530 23.400  1.00 17.90 ? 207  LEU A C   1 
ATOM   1812 O  O   . LEU A 1 210 ? 33.778 49.433 23.689  1.00 17.92 ? 207  LEU A O   1 
ATOM   1813 C  CB  . LEU A 1 210 ? 36.267 51.644 24.615  1.00 22.26 ? 207  LEU A CB  1 
ATOM   1814 C  CG  . LEU A 1 210 ? 37.737 51.769 25.076  1.00 30.43 ? 207  LEU A CG  1 
ATOM   1815 C  CD1 . LEU A 1 210 ? 38.027 53.103 25.866  1.00 33.55 ? 207  LEU A CD1 1 
ATOM   1816 C  CD2 . LEU A 1 210 ? 38.129 50.614 25.948  1.00 37.72 ? 207  LEU A CD2 1 
ATOM   1817 N  N   . LEU A 1 211 ? 33.626 51.601 23.035  1.00 17.24 ? 208  LEU A N   1 
ATOM   1818 C  CA  . LEU A 1 211 ? 32.157 51.561 23.062  1.00 17.10 ? 208  LEU A CA  1 
ATOM   1819 C  C   . LEU A 1 211 ? 31.654 50.544 22.021  1.00 15.05 ? 208  LEU A C   1 
ATOM   1820 O  O   . LEU A 1 211 ? 30.710 49.775 22.290  1.00 16.31 ? 208  LEU A O   1 
ATOM   1821 C  CB  . LEU A 1 211 ? 31.516 52.915 22.807  1.00 18.03 ? 208  LEU A CB  1 
ATOM   1822 C  CG  . LEU A 1 211 ? 31.143 53.811 23.918  1.00 25.74 ? 208  LEU A CG  1 
ATOM   1823 C  CD1 . LEU A 1 211 ? 32.361 54.231 24.725  1.00 28.81 ? 208  LEU A CD1 1 
ATOM   1824 C  CD2 . LEU A 1 211 ? 30.295 54.988 23.445  1.00 27.27 ? 208  LEU A CD2 1 
ATOM   1825 N  N   . ASN A 1 212 ? 32.227 50.563 20.834  1.00 14.95 ? 209  ASN A N   1 
ATOM   1826 C  CA  . ASN A 1 212 ? 31.813 49.622 19.803  1.00 14.28 ? 209  ASN A CA  1 
ATOM   1827 C  C   . ASN A 1 212 ? 32.075 48.154 20.196  1.00 15.46 ? 209  ASN A C   1 
ATOM   1828 O  O   . ASN A 1 212 ? 31.234 47.275 20.018  1.00 14.71 ? 209  ASN A O   1 
ATOM   1829 C  CB  . ASN A 1 212 ? 32.517 49.903 18.487  1.00 13.44 ? 209  ASN A CB  1 
ATOM   1830 C  CG  . ASN A 1 212 ? 31.897 51.061 17.688  1.00 14.71 ? 209  ASN A CG  1 
ATOM   1831 O  OD1 . ASN A 1 212 ? 30.684 51.242 17.779  1.00 15.80 ? 209  ASN A OD1 1 
ATOM   1832 N  ND2 . ASN A 1 212 ? 32.707 51.821 16.961  1.00 13.05 ? 209  ASN A ND2 1 
ATOM   1833 N  N   . SER A 1 213 ? 33.236 47.894 20.832  1.00 15.99 ? 210  SER A N   1 
ATOM   1834 C  CA  A SER A 1 213 ? 33.581 46.532 21.235  0.60 16.46 ? 210  SER A CA  1 
ATOM   1835 C  CA  B SER A 1 213 ? 33.608 46.540 21.225  0.40 16.23 ? 210  SER A CA  1 
ATOM   1836 C  C   . SER A 1 213 ? 32.695 46.037 22.367  1.00 15.94 ? 210  SER A C   1 
ATOM   1837 O  O   . SER A 1 213 ? 32.245 44.871 22.360  1.00 17.21 ? 210  SER A O   1 
ATOM   1838 C  CB  A SER A 1 213 ? 35.025 46.482 21.705  0.60 16.44 ? 210  SER A CB  1 
ATOM   1839 C  CB  B SER A 1 213 ? 35.115 46.487 21.594  0.40 15.90 ? 210  SER A CB  1 
ATOM   1840 O  OG  A SER A 1 213 ? 35.893 46.738 20.646  0.60 16.13 ? 210  SER A OG  1 
ATOM   1841 O  OG  B SER A 1 213 ? 35.477 47.416 22.620  0.40 16.99 ? 210  SER A OG  1 
ATOM   1842 N  N   . ILE A 1 214 ? 32.372 46.907 23.329  1.00 16.25 ? 211  ILE A N   1 
ATOM   1843 C  CA  . ILE A 1 214 ? 31.452 46.576 24.416  1.00 17.32 ? 211  ILE A CA  1 
ATOM   1844 C  C   . ILE A 1 214 ? 30.069 46.299 23.844  1.00 17.14 ? 211  ILE A C   1 
ATOM   1845 O  O   . ILE A 1 214 ? 29.420 45.307 24.225  1.00 17.83 ? 211  ILE A O   1 
ATOM   1846 C  CB  . ILE A 1 214 ? 31.432 47.679 25.483  1.00 18.28 ? 211  ILE A CB  1 
ATOM   1847 C  CG1 . ILE A 1 214 ? 32.784 47.703 26.250  1.00 20.82 ? 211  ILE A CG1 1 
ATOM   1848 C  CG2 . ILE A 1 214 ? 30.294 47.505 26.457  1.00 22.25 ? 211  ILE A CG2 1 
ATOM   1849 C  CD1 . ILE A 1 214 ? 32.988 48.999 27.020  1.00 26.49 ? 211  ILE A CD1 1 
ATOM   1850 N  N   . SER A 1 215 ? 29.601 47.159 22.929  1.00 16.98 ? 212  SER A N   1 
ATOM   1851 C  CA  . SER A 1 215 ? 28.328 46.886 22.308  1.00 16.58 ? 212  SER A CA  1 
ATOM   1852 C  C   . SER A 1 215 ? 28.267 45.588 21.489  1.00 17.19 ? 212  SER A C   1 
ATOM   1853 O  O   . SER A 1 215 ? 27.280 44.863 21.534  1.00 18.34 ? 212  SER A O   1 
ATOM   1854 C  CB  . SER A 1 215 ? 27.888 48.095 21.479  1.00 17.19 ? 212  SER A CB  1 
ATOM   1855 O  OG  . SER A 1 215 ? 27.606 49.209 22.316  1.00 17.35 ? 212  SER A OG  1 
ATOM   1856 N  N   . ALA A 1 216 ? 29.352 45.261 20.799  1.00 16.60 ? 213  ALA A N   1 
ATOM   1857 C  CA  . ALA A 1 216 ? 29.421 44.034 20.033  1.00 15.89 ? 213  ALA A CA  1 
ATOM   1858 C  C   . ALA A 1 216 ? 29.437 42.837 20.960  1.00 18.08 ? 213  ALA A C   1 
ATOM   1859 O  O   . ALA A 1 216 ? 28.830 41.830 20.679  1.00 18.31 ? 213  ALA A O   1 
ATOM   1860 C  CB  . ALA A 1 216 ? 30.689 44.032 19.127  1.00 16.91 ? 213  ALA A CB  1 
ATOM   1861 N  N   . ARG A 1 217 ? 30.131 42.934 22.073  1.00 18.73 ? 214  ARG A N   1 
ATOM   1862 C  CA  A ARG A 1 217 ? 30.182 41.844 23.007  0.70 18.68 ? 214  ARG A CA  1 
ATOM   1863 C  CA  B ARG A 1 217 ? 30.191 41.853 23.062  0.30 19.56 ? 214  ARG A CA  1 
ATOM   1864 C  C   . ARG A 1 217 ? 28.799 41.634 23.631  1.00 20.85 ? 214  ARG A C   1 
ATOM   1865 O  O   . ARG A 1 217 ? 28.364 40.490 23.819  1.00 20.49 ? 214  ARG A O   1 
ATOM   1866 C  CB  A ARG A 1 217 ? 31.255 42.104 24.072  0.70 19.97 ? 214  ARG A CB  1 
ATOM   1867 C  CB  B ARG A 1 217 ? 31.188 42.161 24.210  0.30 20.58 ? 214  ARG A CB  1 
ATOM   1868 C  CG  A ARG A 1 217 ? 31.425 40.975 25.092  0.70 21.70 ? 214  ARG A CG  1 
ATOM   1869 C  CG  B ARG A 1 217 ? 31.304 41.047 25.310  0.30 22.87 ? 214  ARG A CG  1 
ATOM   1870 C  CD  A ARG A 1 217 ? 32.512 41.350 26.090  0.70 22.34 ? 214  ARG A CD  1 
ATOM   1871 C  CD  B ARG A 1 217 ? 32.176 41.489 26.512  0.30 25.95 ? 214  ARG A CD  1 
ATOM   1872 N  NE  A ARG A 1 217 ? 32.023 42.446 26.922  0.70 24.75 ? 214  ARG A NE  1 
ATOM   1873 N  NE  B ARG A 1 217 ? 32.941 40.403 27.151  0.30 29.54 ? 214  ARG A NE  1 
ATOM   1874 C  CZ  A ARG A 1 217 ? 32.762 43.273 27.658  0.70 27.86 ? 214  ARG A CZ  1 
ATOM   1875 C  CZ  B ARG A 1 217 ? 32.667 39.855 28.335  0.30 34.07 ? 214  ARG A CZ  1 
ATOM   1876 N  NH1 A ARG A 1 217 ? 34.057 43.119 27.773  0.70 31.22 ? 214  ARG A NH1 1 
ATOM   1877 N  NH1 B ARG A 1 217 ? 33.450 38.895 28.802  0.30 33.75 ? 214  ARG A NH1 1 
ATOM   1878 N  NH2 A ARG A 1 217 ? 32.163 44.217 28.360  0.70 31.85 ? 214  ARG A NH2 1 
ATOM   1879 N  NH2 B ARG A 1 217 ? 31.620 40.245 29.053  0.30 36.93 ? 214  ARG A NH2 1 
ATOM   1880 N  N   . GLU A 1 218 ? 28.095 42.732 23.918  1.00 20.38 ? 215  GLU A N   1 
ATOM   1881 C  CA  . GLU A 1 218 ? 26.731 42.625 24.450  1.00 20.96 ? 215  GLU A CA  1 
ATOM   1882 C  C   . GLU A 1 218 ? 25.797 41.940 23.453  1.00 20.85 ? 215  GLU A C   1 
ATOM   1883 O  O   . GLU A 1 218 ? 25.013 41.105 23.827  1.00 22.46 ? 215  GLU A O   1 
ATOM   1884 C  CB  . GLU A 1 218 ? 26.231 44.008 24.826  1.00 22.33 ? 215  GLU A CB  1 
ATOM   1885 C  CG  . GLU A 1 218 ? 26.871 44.488 26.064  1.00 25.94 ? 215  GLU A CG  1 
ATOM   1886 C  CD  . GLU A 1 218 ? 26.452 45.904 26.485  1.00 37.75 ? 215  GLU A CD  1 
ATOM   1887 O  OE1 . GLU A 1 218 ? 25.809 46.612 25.671  1.00 44.58 ? 215  GLU A OE1 1 
ATOM   1888 O  OE2 . GLU A 1 218 ? 26.855 46.335 27.592  1.00 40.92 ? 215  GLU A OE2 1 
ATOM   1889 N  N   . TRP A 1 219 ? 25.945 42.227 22.164  1.00 18.72 ? 216  TRP A N   1 
ATOM   1890 C  CA  . TRP A 1 219 ? 25.178 41.570 21.109  1.00 19.01 ? 216  TRP A CA  1 
ATOM   1891 C  C   . TRP A 1 219 ? 25.463 40.081 21.060  1.00 19.93 ? 216  TRP A C   1 
ATOM   1892 O  O   . TRP A 1 219 ? 24.559 39.247 20.985  1.00 21.06 ? 216  TRP A O   1 
ATOM   1893 C  CB  . TRP A 1 219 ? 25.514 42.221 19.779  1.00 18.74 ? 216  TRP A CB  1 
ATOM   1894 C  CG  . TRP A 1 219 ? 25.146 41.553 18.537  1.00 18.66 ? 216  TRP A CG  1 
ATOM   1895 C  CD1 . TRP A 1 219 ? 23.920 41.614 17.900  1.00 20.00 ? 216  TRP A CD1 1 
ATOM   1896 C  CD2 . TRP A 1 219 ? 25.988 40.750 17.704  1.00 18.87 ? 216  TRP A CD2 1 
ATOM   1897 N  NE1 . TRP A 1 219 ? 23.969 40.912 16.725  1.00 21.24 ? 216  TRP A NE1 1 
ATOM   1898 C  CE2 . TRP A 1 219 ? 25.221 40.383 16.557  1.00 20.32 ? 216  TRP A CE2 1 
ATOM   1899 C  CE3 . TRP A 1 219 ? 27.337 40.373 17.757  1.00 20.29 ? 216  TRP A CE3 1 
ATOM   1900 C  CZ2 . TRP A 1 219 ? 25.758 39.648 15.489  1.00 20.38 ? 216  TRP A CZ2 1 
ATOM   1901 C  CZ3 . TRP A 1 219 ? 27.857 39.623 16.692  1.00 19.38 ? 216  TRP A CZ3 1 
ATOM   1902 C  CH2 . TRP A 1 219 ? 27.084 39.295 15.565  1.00 20.10 ? 216  TRP A CH2 1 
ATOM   1903 N  N   . LEU A 1 220 ? 26.757 39.748 21.155  1.00 19.15 ? 217  LEU A N   1 
ATOM   1904 C  CA  . LEU A 1 220 ? 27.173 38.342 21.097  1.00 20.10 ? 217  LEU A CA  1 
ATOM   1905 C  C   . LEU A 1 220 ? 26.595 37.597 22.268  1.00 21.08 ? 217  LEU A C   1 
ATOM   1906 O  O   . LEU A 1 220 ? 26.074 36.464 22.142  1.00 21.70 ? 217  LEU A O   1 
ATOM   1907 C  CB  . LEU A 1 220 ? 28.720 38.229 21.088  1.00 19.79 ? 217  LEU A CB  1 
ATOM   1908 C  CG  . LEU A 1 220 ? 29.243 36.808 20.873  1.00 21.97 ? 217  LEU A CG  1 
ATOM   1909 C  CD1 . LEU A 1 220 ? 29.269 36.400 19.432  1.00 24.25 ? 217  LEU A CD1 1 
ATOM   1910 C  CD2 . LEU A 1 220 ? 30.651 36.633 21.547  1.00 26.20 ? 217  LEU A CD2 1 
ATOM   1911 N  N   . LEU A 1 221 ? 26.718 38.162 23.460  1.00 21.47 ? 218  LEU A N   1 
ATOM   1912 C  CA  . LEU A 1 221 ? 26.268 37.515 24.703  1.00 23.92 ? 218  LEU A CA  1 
ATOM   1913 C  C   . LEU A 1 221 ? 24.763 37.530 24.868  1.00 22.80 ? 218  LEU A C   1 
ATOM   1914 O  O   . LEU A 1 221 ? 24.209 36.640 25.531  1.00 24.11 ? 218  LEU A O   1 
ATOM   1915 C  CB  . LEU A 1 221 ? 26.982 38.118 25.917  1.00 24.40 ? 218  LEU A CB  1 
ATOM   1916 C  CG  . LEU A 1 221 ? 28.516 37.876 25.852  1.00 28.45 ? 218  LEU A CG  1 
ATOM   1917 C  CD1 . LEU A 1 221 ? 29.180 38.395 27.141  1.00 29.57 ? 218  LEU A CD1 1 
ATOM   1918 C  CD2 . LEU A 1 221 ? 28.934 36.376 25.563  1.00 34.19 ? 218  LEU A CD2 1 
ATOM   1919 N  N   . ASP A 1 222 ? 24.084 38.526 24.280  1.00 23.50 ? 219  ASP A N   1 
ATOM   1920 C  CA  . ASP A 1 222 ? 22.616 38.466 24.233  1.00 24.76 ? 219  ASP A CA  1 
ATOM   1921 C  C   . ASP A 1 222 ? 22.179 37.194 23.527  1.00 24.58 ? 219  ASP A C   1 
ATOM   1922 O  O   . ASP A 1 222 ? 21.182 36.573 23.905  1.00 27.12 ? 219  ASP A O   1 
ATOM   1923 C  CB  . ASP A 1 222 ? 22.029 39.696 23.510  1.00 26.41 ? 219  ASP A CB  1 
ATOM   1924 C  CG  . ASP A 1 222 ? 20.561 39.540 23.191  1.00 30.62 ? 219  ASP A CG  1 
ATOM   1925 O  OD1 . ASP A 1 222 ? 19.792 39.656 24.161  1.00 36.97 ? 219  ASP A OD1 1 
ATOM   1926 O  OD2 . ASP A 1 222 ? 20.223 39.258 22.013  1.00 35.03 ? 219  ASP A OD2 1 
ATOM   1927 N  N   . HIS A 1 223 ? 22.898 36.806 22.483  1.00 23.75 ? 220  HIS A N   1 
ATOM   1928 C  CA  . HIS A 1 223 ? 22.570 35.609 21.767  1.00 23.34 ? 220  HIS A CA  1 
ATOM   1929 C  C   . HIS A 1 223 ? 22.917 34.351 22.534  1.00 23.91 ? 220  HIS A C   1 
ATOM   1930 O  O   . HIS A 1 223 ? 22.085 33.470 22.734  1.00 25.23 ? 220  HIS A O   1 
ATOM   1931 C  CB  . HIS A 1 223 ? 23.249 35.583 20.431  1.00 23.72 ? 220  HIS A CB  1 
ATOM   1932 C  CG  . HIS A 1 223 ? 22.974 34.345 19.671  1.00 27.12 ? 220  HIS A CG  1 
ATOM   1933 N  ND1 . HIS A 1 223 ? 21.754 34.120 19.059  1.00 31.35 ? 220  HIS A ND1 1 
ATOM   1934 C  CD2 . HIS A 1 223 ? 23.697 33.206 19.513  1.00 28.48 ? 220  HIS A CD2 1 
ATOM   1935 C  CE1 . HIS A 1 223 ? 21.755 32.910 18.533  1.00 32.28 ? 220  HIS A CE1 1 
ATOM   1936 N  NE2 . HIS A 1 223 ? 22.926 32.336 18.780  1.00 32.48 ? 220  HIS A NE2 1 
ATOM   1937 N  N   . TYR A 1 224 ? 24.190 34.231 22.895  1.00 23.00 ? 221  TYR A N   1 
ATOM   1938 C  CA  . TYR A 1 224 ? 24.665 33.010 23.522  1.00 24.52 ? 221  TYR A CA  1 
ATOM   1939 C  C   . TYR A 1 224 ? 24.384 32.863 24.992  1.00 25.63 ? 221  TYR A C   1 
ATOM   1940 O  O   . TYR A 1 224 ? 24.310 31.753 25.481  1.00 26.92 ? 221  TYR A O   1 
ATOM   1941 C  CB  . TYR A 1 224 ? 26.153 32.933 23.323  1.00 23.70 ? 221  TYR A CB  1 
ATOM   1942 C  CG  . TYR A 1 224 ? 26.631 32.480 21.988  1.00 22.85 ? 221  TYR A CG  1 
ATOM   1943 C  CD1 . TYR A 1 224 ? 26.448 31.171 21.629  1.00 23.13 ? 221  TYR A CD1 1 
ATOM   1944 C  CD2 . TYR A 1 224 ? 27.345 33.297 21.152  1.00 21.88 ? 221  TYR A CD2 1 
ATOM   1945 C  CE1 . TYR A 1 224 ? 26.964 30.671 20.445  1.00 23.44 ? 221  TYR A CE1 1 
ATOM   1946 C  CE2 . TYR A 1 224 ? 27.869 32.826 19.928  1.00 20.27 ? 221  TYR A CE2 1 
ATOM   1947 C  CZ  . TYR A 1 224 ? 27.717 31.461 19.635  1.00 20.55 ? 221  TYR A CZ  1 
ATOM   1948 O  OH  . TYR A 1 224 ? 28.279 30.902 18.513  1.00 23.73 ? 221  TYR A OH  1 
ATOM   1949 N  N   . GLU A 1 225 ? 24.278 33.960 25.743  1.00 25.14 ? 222  GLU A N   1 
ATOM   1950 C  CA  . GLU A 1 225 ? 24.006 33.901 27.171  1.00 26.75 ? 222  GLU A CA  1 
ATOM   1951 C  C   . GLU A 1 225 ? 25.080 33.078 27.938  1.00 27.51 ? 222  GLU A C   1 
ATOM   1952 O  O   . GLU A 1 225 ? 24.778 32.426 28.952  1.00 30.00 ? 222  GLU A O   1 
ATOM   1953 C  CB  . GLU A 1 225 ? 22.569 33.367 27.397  1.00 28.66 ? 222  GLU A CB  1 
ATOM   1954 C  CG  . GLU A 1 225 ? 21.511 34.154 26.659  1.00 29.14 ? 222  GLU A CG  1 
ATOM   1955 C  CD  . GLU A 1 225 ? 20.097 33.619 26.901  1.00 30.24 ? 222  GLU A CD  1 
ATOM   1956 O  OE1 . GLU A 1 225 ? 19.958 32.579 27.491  1.00 33.44 ? 222  GLU A OE1 1 
ATOM   1957 O  OE2 . GLU A 1 225 ? 19.124 34.248 26.421  1.00 33.88 ? 222  GLU A OE2 1 
ATOM   1958 N  N   . ASP A 1 226 ? 26.307 33.115 27.425  1.00 27.91 ? 223  ASP A N   1 
ATOM   1959 C  CA  . ASP A 1 226 ? 27.407 32.294 27.964  1.00 28.56 ? 223  ASP A CA  1 
ATOM   1960 C  C   . ASP A 1 226 ? 28.701 33.032 27.634  1.00 29.21 ? 223  ASP A C   1 
ATOM   1961 O  O   . ASP A 1 226 ? 29.060 33.170 26.462  1.00 26.84 ? 223  ASP A O   1 
ATOM   1962 C  CB  . ASP A 1 226 ? 27.421 30.892 27.324  1.00 28.93 ? 223  ASP A CB  1 
ATOM   1963 C  CG  . ASP A 1 226 ? 28.350 29.914 28.047  1.00 31.67 ? 223  ASP A CG  1 
ATOM   1964 O  OD1 . ASP A 1 226 ? 29.326 30.403 28.650  1.00 30.38 ? 223  ASP A OD1 1 
ATOM   1965 O  OD2 . ASP A 1 226 ? 28.059 28.694 27.974  1.00 33.41 ? 223  ASP A OD2 1 
ATOM   1966 N  N   . GLU A 1 227 ? 29.367 33.536 28.665  1.00 30.75 ? 224  GLU A N   1 
ATOM   1967 C  CA  . GLU A 1 227 ? 30.663 34.256 28.518  1.00 31.99 ? 224  GLU A CA  1 
ATOM   1968 C  C   . GLU A 1 227 ? 31.748 33.474 27.803  1.00 30.45 ? 224  GLU A C   1 
ATOM   1969 O  O   . GLU A 1 227 ? 32.637 34.085 27.153  1.00 30.77 ? 224  GLU A O   1 
ATOM   1970 C  CB  . GLU A 1 227 ? 31.113 34.690 29.935  1.00 34.59 ? 224  GLU A CB  1 
ATOM   1971 C  CG  . GLU A 1 227 ? 30.930 36.222 30.110  1.00 42.52 ? 224  GLU A CG  1 
ATOM   1972 C  CD  . GLU A 1 227 ? 30.352 36.658 31.442  1.00 51.57 ? 224  GLU A CD  1 
ATOM   1973 O  OE1 . GLU A 1 227 ? 30.944 36.318 32.488  1.00 57.12 ? 224  GLU A OE1 1 
ATOM   1974 O  OE2 . GLU A 1 227 ? 29.316 37.382 31.429  1.00 58.08 ? 224  GLU A OE2 1 
ATOM   1975 N  N   . LYS A 1 228 ? 31.679 32.139 27.867  1.00 30.50 ? 225  LYS A N   1 
ATOM   1976 C  CA  A LYS A 1 228 ? 32.657 31.302 27.190  0.60 30.05 ? 225  LYS A CA  1 
ATOM   1977 C  CA  B LYS A 1 228 ? 32.641 31.277 27.191  0.40 29.61 ? 225  LYS A CA  1 
ATOM   1978 C  C   . LYS A 1 228 ? 32.649 31.482 25.676  1.00 27.94 ? 225  LYS A C   1 
ATOM   1979 O  O   . LYS A 1 228 ? 33.635 31.203 25.014  1.00 27.88 ? 225  LYS A O   1 
ATOM   1980 C  CB  A LYS A 1 228 ? 32.516 29.824 27.589  0.60 32.07 ? 225  LYS A CB  1 
ATOM   1981 C  CB  B LYS A 1 228 ? 32.397 29.796 27.525  0.40 31.17 ? 225  LYS A CB  1 
ATOM   1982 C  CG  A LYS A 1 228 ? 32.897 29.556 29.029  0.60 35.45 ? 225  LYS A CG  1 
ATOM   1983 C  CG  B LYS A 1 228 ? 32.560 29.419 28.994  0.40 32.66 ? 225  LYS A CG  1 
ATOM   1984 C  CD  A LYS A 1 228 ? 32.462 28.169 29.480  0.60 40.22 ? 225  LYS A CD  1 
ATOM   1985 C  CD  B LYS A 1 228 ? 32.045 27.999 29.221  0.40 34.96 ? 225  LYS A CD  1 
ATOM   1986 C  CE  A LYS A 1 228 ? 32.996 27.817 30.862  0.60 42.10 ? 225  LYS A CE  1 
ATOM   1987 C  CE  B LYS A 1 228 ? 32.642 27.042 28.193  0.40 34.17 ? 225  LYS A CE  1 
ATOM   1988 N  NZ  A LYS A 1 228 ? 33.469 29.029 31.590  0.60 44.05 ? 225  LYS A NZ  1 
ATOM   1989 N  NZ  B LYS A 1 228 ? 31.632 26.096 27.663  0.40 33.16 ? 225  LYS A NZ  1 
ATOM   1990 N  N   . ALA A 1 229 ? 31.546 31.986 25.102  1.00 25.80 ? 226  ALA A N   1 
ATOM   1991 C  CA  . ALA A 1 229 ? 31.503 32.249 23.675  1.00 24.97 ? 226  ALA A CA  1 
ATOM   1992 C  C   . ALA A 1 229 ? 32.453 33.310 23.178  1.00 23.08 ? 226  ALA A C   1 
ATOM   1993 O  O   . ALA A 1 229 ? 32.800 33.341 22.009  1.00 23.86 ? 226  ALA A O   1 
ATOM   1994 C  CB  . ALA A 1 229 ? 30.034 32.633 23.256  1.00 25.64 ? 226  ALA A CB  1 
ATOM   1995 N  N   . VAL A 1 230 ? 32.863 34.249 24.042  1.00 23.30 ? 227  VAL A N   1 
ATOM   1996 C  CA  . VAL A 1 230 ? 33.866 35.235 23.622  1.00 23.87 ? 227  VAL A CA  1 
ATOM   1997 C  C   . VAL A 1 230 ? 35.119 34.614 23.006  1.00 22.98 ? 227  VAL A C   1 
ATOM   1998 O  O   . VAL A 1 230 ? 35.722 35.171 22.082  1.00 22.72 ? 227  VAL A O   1 
ATOM   1999 C  CB  . VAL A 1 230 ? 34.248 36.164 24.815  1.00 24.56 ? 227  VAL A CB  1 
ATOM   2000 C  CG1 . VAL A 1 230 ? 35.478 37.060 24.452  1.00 25.05 ? 227  VAL A CG1 1 
ATOM   2001 C  CG2 . VAL A 1 230 ? 33.057 37.063 25.183  1.00 27.29 ? 227  VAL A CG2 1 
ATOM   2002 N  N   . ALA A 1 231 ? 35.523 33.467 23.517  1.00 23.24 ? 228  ALA A N   1 
ATOM   2003 C  CA  . ALA A 1 231 ? 36.734 32.821 23.064  1.00 24.67 ? 228  ALA A CA  1 
ATOM   2004 C  C   . ALA A 1 231 ? 36.683 32.483 21.596  1.00 24.75 ? 228  ALA A C   1 
ATOM   2005 O  O   . ALA A 1 231 ? 37.694 32.574 20.892  1.00 26.81 ? 228  ALA A O   1 
ATOM   2006 C  CB  . ALA A 1 231 ? 37.018 31.532 23.902  1.00 25.94 ? 228  ALA A CB  1 
ATOM   2007 N  N   . ASN A 1 232 ? 35.510 32.095 21.096  1.00 22.74 ? 229  ASN A N   1 
ATOM   2008 C  CA  . ASN A 1 232 ? 35.434 31.675 19.709  1.00 22.08 ? 229  ASN A CA  1 
ATOM   2009 C  C   . ASN A 1 232 ? 35.111 32.832 18.780  1.00 21.37 ? 229  ASN A C   1 
ATOM   2010 O  O   . ASN A 1 232 ? 35.173 32.674 17.588  1.00 23.24 ? 229  ASN A O   1 
ATOM   2011 C  CB  . ASN A 1 232 ? 34.320 30.627 19.511  1.00 23.95 ? 229  ASN A CB  1 
ATOM   2012 C  CG  . ASN A 1 232 ? 34.526 29.387 20.307  1.00 25.03 ? 229  ASN A CG  1 
ATOM   2013 O  OD1 . ASN A 1 232 ? 34.420 29.382 21.522  1.00 26.81 ? 229  ASN A OD1 1 
ATOM   2014 N  ND2 . ASN A 1 232 ? 34.814 28.295 19.602  1.00 28.91 ? 229  ASN A ND2 1 
ATOM   2015 N  N   . HIS A 1 233 ? 34.787 34.004 19.315  1.00 19.88 ? 230  HIS A N   1 
ATOM   2016 C  CA  . HIS A 1 233 ? 34.230 35.063 18.476  1.00 18.37 ? 230  HIS A CA  1 
ATOM   2017 C  C   . HIS A 1 233 ? 34.983 36.403 18.504  1.00 17.78 ? 230  HIS A C   1 
ATOM   2018 O  O   . HIS A 1 233 ? 34.574 37.327 17.818  1.00 16.55 ? 230  HIS A O   1 
ATOM   2019 C  CB  . HIS A 1 233 ? 32.746 35.227 18.794  1.00 18.47 ? 230  HIS A CB  1 
ATOM   2020 C  CG  . HIS A 1 233 ? 31.936 34.069 18.356  1.00 18.77 ? 230  HIS A CG  1 
ATOM   2021 N  ND1 . HIS A 1 233 ? 31.622 33.860 17.026  1.00 19.28 ? 230  HIS A ND1 1 
ATOM   2022 C  CD2 . HIS A 1 233 ? 31.415 33.036 19.046  1.00 21.28 ? 230  HIS A CD2 1 
ATOM   2023 C  CE1 . HIS A 1 233 ? 30.922 32.736 16.939  1.00 19.83 ? 230  HIS A CE1 1 
ATOM   2024 N  NE2 . HIS A 1 233 ? 30.789 32.207 18.143  1.00 22.00 ? 230  HIS A NE2 1 
ATOM   2025 N  N   . PHE A 1 234 ? 36.083 36.481 19.284  1.00 17.43 ? 231  PHE A N   1 
ATOM   2026 C  CA  . PHE A 1 234 ? 36.883 37.711 19.347  1.00 16.72 ? 231  PHE A CA  1 
ATOM   2027 C  C   . PHE A 1 234 ? 38.339 37.416 19.246  1.00 16.16 ? 231  PHE A C   1 
ATOM   2028 O  O   . PHE A 1 234 ? 38.839 36.478 19.916  1.00 17.45 ? 231  PHE A O   1 
ATOM   2029 C  CB  . PHE A 1 234 ? 36.660 38.480 20.680  1.00 19.19 ? 231  PHE A CB  1 
ATOM   2030 C  CG  . PHE A 1 234 ? 35.430 39.333 20.730  1.00 20.18 ? 231  PHE A CG  1 
ATOM   2031 C  CD1 . PHE A 1 234 ? 35.468 40.655 20.306  1.00 20.97 ? 231  PHE A CD1 1 
ATOM   2032 C  CD2 . PHE A 1 234 ? 34.266 38.852 21.274  1.00 22.69 ? 231  PHE A CD2 1 
ATOM   2033 C  CE1 . PHE A 1 234 ? 34.374 41.444 20.327  1.00 24.02 ? 231  PHE A CE1 1 
ATOM   2034 C  CE2 . PHE A 1 234 ? 33.139 39.646 21.313  1.00 24.75 ? 231  PHE A CE2 1 
ATOM   2035 C  CZ  . PHE A 1 234 ? 33.199 40.961 20.841  1.00 24.99 ? 231  PHE A CZ  1 
ATOM   2036 N  N   . VAL A 1 235 ? 39.044 38.251 18.491  1.00 15.17 ? 232  VAL A N   1 
ATOM   2037 C  CA  . VAL A 1 235 ? 40.500 38.395 18.575  1.00 15.56 ? 232  VAL A CA  1 
ATOM   2038 C  C   . VAL A 1 235 ? 40.800 39.860 18.746  1.00 15.86 ? 232  VAL A C   1 
ATOM   2039 O  O   . VAL A 1 235 ? 39.932 40.728 18.466  1.00 15.44 ? 232  VAL A O   1 
ATOM   2040 C  CB  . VAL A 1 235 ? 41.234 37.787 17.364  1.00 14.91 ? 232  VAL A CB  1 
ATOM   2041 C  CG1 . VAL A 1 235 ? 41.027 36.275 17.296  1.00 16.49 ? 232  VAL A CG1 1 
ATOM   2042 C  CG2 . VAL A 1 235 ? 40.866 38.448 16.045  1.00 16.49 ? 232  VAL A CG2 1 
ATOM   2043 N  N   . ALA A 1 236 ? 42.020 40.184 19.166  1.00 15.78 ? 233  ALA A N   1 
ATOM   2044 C  CA  . ALA A 1 236 ? 42.441 41.570 19.397  1.00 14.30 ? 233  ALA A CA  1 
ATOM   2045 C  C   . ALA A 1 236 ? 43.772 41.793 18.719  1.00 15.89 ? 233  ALA A C   1 
ATOM   2046 O  O   . ALA A 1 236 ? 44.591 40.871 18.646  1.00 16.22 ? 233  ALA A O   1 
ATOM   2047 C  CB  . ALA A 1 236 ? 42.571 41.835 20.900  1.00 17.23 ? 233  ALA A CB  1 
ATOM   2048 N  N   . ILE A 1 237 ? 44.008 43.025 18.304  1.00 16.12 ? 234  ILE A N   1 
ATOM   2049 C  CA  . ILE A 1 237 ? 45.283 43.481 17.749  1.00 15.05 ? 234  ILE A CA  1 
ATOM   2050 C  C   . ILE A 1 237 ? 45.698 44.678 18.558  1.00 15.37 ? 234  ILE A C   1 
ATOM   2051 O  O   . ILE A 1 237 ? 44.995 45.703 18.546  1.00 15.09 ? 234  ILE A O   1 
ATOM   2052 C  CB  . ILE A 1 237 ? 45.190 43.864 16.298  1.00 15.75 ? 234  ILE A CB  1 
ATOM   2053 C  CG1 . ILE A 1 237 ? 44.555 42.747 15.473  1.00 16.55 ? 234  ILE A CG1 1 
ATOM   2054 C  CG2 . ILE A 1 237 ? 46.600 44.120 15.697  1.00 17.07 ? 234  ILE A CG2 1 
ATOM   2055 C  CD1 . ILE A 1 237 ? 44.006 43.157 14.162  1.00 16.00 ? 234  ILE A CD1 1 
ATOM   2056 N  N   . SER A 1 238 ? 46.857 44.627 19.248  1.00 16.89 ? 235  SER A N   1 
ATOM   2057 C  CA  . SER A 1 238 ? 47.248 45.757 20.057  1.00 16.48 ? 235  SER A CA  1 
ATOM   2058 C  C   . SER A 1 238 ? 48.724 45.757 20.298  1.00 19.62 ? 235  SER A C   1 
ATOM   2059 O  O   . SER A 1 238 ? 49.389 44.711 20.079  1.00 19.59 ? 235  SER A O   1 
ATOM   2060 C  CB  . SER A 1 238 ? 46.469 45.675 21.330  1.00 17.29 ? 235  SER A CB  1 
ATOM   2061 O  OG  . SER A 1 238 ? 46.550 46.874 22.138  1.00 18.27 ? 235  SER A OG  1 
ATOM   2062 N  N   . SER A 1 239 ? 49.232 46.910 20.746  1.00 20.22 ? 236  SER A N   1 
ATOM   2063 C  CA  . SER A 1 239 ? 50.579 46.990 21.350  1.00 21.81 ? 236  SER A CA  1 
ATOM   2064 C  C   . SER A 1 239 ? 50.514 46.867 22.857  1.00 22.48 ? 236  SER A C   1 
ATOM   2065 O  O   . SER A 1 239 ? 51.568 46.732 23.509  1.00 25.71 ? 236  SER A O   1 
ATOM   2066 C  CB  . SER A 1 239 ? 51.253 48.304 20.940  1.00 22.66 ? 236  SER A CB  1 
ATOM   2067 O  OG  . SER A 1 239 ? 50.735 49.388 21.668  1.00 26.20 ? 236  SER A OG  1 
ATOM   2068 N  N   . LYS A 1 240 ? 49.302 46.874 23.415  1.00 23.60 ? 237  LYS A N   1 
ATOM   2069 C  CA  . LYS A 1 240 ? 49.037 46.924 24.848  1.00 25.27 ? 237  LYS A CA  1 
ATOM   2070 C  C   . LYS A 1 240 ? 48.345 45.669 25.348  1.00 25.75 ? 237  LYS A C   1 
ATOM   2071 O  O   . LYS A 1 240 ? 47.201 45.649 25.763  1.00 25.48 ? 237  LYS A O   1 
ATOM   2072 C  CB  . LYS A 1 240 ? 48.251 48.202 25.278  1.00 26.31 ? 237  LYS A CB  1 
ATOM   2073 C  CG  . LYS A 1 240 ? 48.936 49.505 24.885  1.00 28.38 ? 237  LYS A CG  1 
ATOM   2074 C  CD  . LYS A 1 240 ? 50.289 49.699 25.577  1.00 32.24 ? 237  LYS A CD  1 
ATOM   2075 C  CE  . LYS A 1 240 ? 50.766 51.156 25.440  1.00 35.43 ? 237  LYS A CE  1 
ATOM   2076 N  NZ  . LYS A 1 240 ? 52.187 51.305 25.901  1.00 41.35 ? 237  LYS A NZ  1 
ATOM   2077 N  N   . LEU A 1 241 ? 49.110 44.583 25.427  1.00 28.41 ? 238  LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 241 ? 48.505 43.289 25.700  1.00 28.89 ? 238  LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 241 ? 47.897 43.165 27.095  1.00 29.42 ? 238  LEU A C   1 
ATOM   2080 O  O   . LEU A 1 241 ? 46.965 42.414 27.278  1.00 27.95 ? 238  LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 241 ? 49.500 42.148 25.392  1.00 31.70 ? 238  LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 241 ? 49.598 41.832 23.884  1.00 34.03 ? 238  LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 241 ? 50.095 42.966 23.086  1.00 39.03 ? 238  LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 241 ? 50.422 40.569 23.571  1.00 39.45 ? 238  LEU A CD2 1 
ATOM   2085 N  N   . ASP A 1 242 ? 48.430 43.865 28.094  1.00 31.05 ? 239  ASP A N   1 
ATOM   2086 C  CA  . ASP A 1 242 ? 47.829 43.839 29.414  1.00 32.97 ? 239  ASP A CA  1 
ATOM   2087 C  C   . ASP A 1 242 ? 46.429 44.362 29.407  1.00 31.80 ? 239  ASP A C   1 
ATOM   2088 O  O   . ASP A 1 242 ? 45.578 43.904 30.159  1.00 31.76 ? 239  ASP A O   1 
ATOM   2089 C  CB  . ASP A 1 242 ? 48.673 44.655 30.434  1.00 34.57 ? 239  ASP A CB  1 
ATOM   2090 C  CG  . ASP A 1 242 ? 49.963 43.950 30.846  1.00 41.51 ? 239  ASP A CG  1 
ATOM   2091 O  OD1 . ASP A 1 242 ? 50.141 42.751 30.534  1.00 48.93 ? 239  ASP A OD1 1 
ATOM   2092 O  OD2 . ASP A 1 242 ? 50.811 44.612 31.514  1.00 48.08 ? 239  ASP A OD2 1 
ATOM   2093 N  N   . LYS A 1 243 ? 46.147 45.348 28.541  1.00 30.62 ? 240  LYS A N   1 
ATOM   2094 C  CA  . LYS A 1 243 ? 44.804 45.906 28.448  1.00 30.43 ? 240  LYS A CA  1 
ATOM   2095 C  C   . LYS A 1 243 ? 43.815 44.975 27.728  1.00 28.76 ? 240  LYS A C   1 
ATOM   2096 O  O   . LYS A 1 243 ? 42.617 44.988 27.973  1.00 28.25 ? 240  LYS A O   1 
ATOM   2097 C  CB  . LYS A 1 243 ? 44.876 47.267 27.704  1.00 29.74 ? 240  LYS A CB  1 
ATOM   2098 C  CG  . LYS A 1 243 ? 45.606 48.356 28.497  1.00 33.46 ? 240  LYS A CG  1 
ATOM   2099 C  CD  . LYS A 1 243 ? 45.489 49.757 27.846  1.00 37.34 ? 240  LYS A CD  1 
ATOM   2100 C  CE  . LYS A 1 243 ? 45.477 50.854 28.908  1.00 44.26 ? 240  LYS A CE  1 
ATOM   2101 N  NZ  . LYS A 1 243 ? 44.140 50.878 29.585  1.00 47.90 ? 240  LYS A NZ  1 
ATOM   2102 N  N   . VAL A 1 244 ? 44.320 44.139 26.842  1.00 27.64 ? 241  VAL A N   1 
ATOM   2103 C  CA  . VAL A 1 244 ? 43.452 43.186 26.181  1.00 27.00 ? 241  VAL A CA  1 
ATOM   2104 C  C   . VAL A 1 244 ? 42.918 42.132 27.124  1.00 29.43 ? 241  VAL A C   1 
ATOM   2105 O  O   . VAL A 1 244 ? 41.717 41.780 27.111  1.00 26.55 ? 241  VAL A O   1 
ATOM   2106 C  CB  . VAL A 1 244 ? 44.201 42.542 25.025  1.00 25.03 ? 241  VAL A CB  1 
ATOM   2107 C  CG1 . VAL A 1 244 ? 43.360 41.437 24.370  1.00 26.83 ? 241  VAL A CG1 1 
ATOM   2108 C  CG2 . VAL A 1 244 ? 44.679 43.600 24.035  1.00 23.29 ? 241  VAL A CG2 1 
ATOM   2109 N  N   . LYS A 1 245 ? 43.825 41.619 27.972  1.00 31.96 ? 242  LYS A N   1 
ATOM   2110 C  CA  A LYS A 1 245 ? 43.457 40.613 28.945  0.70 34.17 ? 242  LYS A CA  1 
ATOM   2111 C  CA  B LYS A 1 245 ? 43.425 40.592 28.925  0.30 33.80 ? 242  LYS A CA  1 
ATOM   2112 C  C   . LYS A 1 245 ? 42.381 41.196 29.864  1.00 35.31 ? 242  LYS A C   1 
ATOM   2113 O  O   . LYS A 1 245 ? 41.360 40.572 30.194  1.00 34.07 ? 242  LYS A O   1 
ATOM   2114 C  CB  A LYS A 1 245 ? 44.690 40.208 29.774  0.70 35.34 ? 242  LYS A CB  1 
ATOM   2115 C  CB  B LYS A 1 245 ? 44.638 40.031 29.688  0.30 34.55 ? 242  LYS A CB  1 
ATOM   2116 C  CG  A LYS A 1 245 ? 45.806 39.530 29.016  0.70 37.74 ? 242  LYS A CG  1 
ATOM   2117 C  CG  B LYS A 1 245 ? 44.312 38.860 30.631  0.30 36.68 ? 242  LYS A CG  1 
ATOM   2118 C  CD  A LYS A 1 245 ? 46.871 38.940 29.987  0.70 42.40 ? 242  LYS A CD  1 
ATOM   2119 C  CD  B LYS A 1 245 ? 43.040 38.131 30.212  0.30 38.23 ? 242  LYS A CD  1 
ATOM   2120 C  CE  A LYS A 1 245 ? 47.690 40.030 30.708  0.70 44.88 ? 242  LYS A CE  1 
ATOM   2121 C  CE  B LYS A 1 245 ? 43.033 36.656 30.537  0.30 39.19 ? 242  LYS A CE  1 
ATOM   2122 N  NZ  A LYS A 1 245 ? 46.961 40.734 31.830  0.70 46.89 ? 242  LYS A NZ  1 
ATOM   2123 N  NZ  B LYS A 1 245 ? 41.732 36.070 30.098  0.30 39.93 ? 242  LYS A NZ  1 
ATOM   2124 N  N   . GLU A 1 246 ? 42.598 42.443 30.249  1.00 36.61 ? 243  GLU A N   1 
ATOM   2125 C  CA  A GLU A 1 246 ? 41.670 43.100 31.120  0.60 37.82 ? 243  GLU A CA  1 
ATOM   2126 C  CA  B GLU A 1 246 ? 41.644 43.111 31.110  0.40 37.63 ? 243  GLU A CA  1 
ATOM   2127 C  C   . GLU A 1 246 ? 40.240 43.128 30.507  1.00 37.78 ? 243  GLU A C   1 
ATOM   2128 O  O   . GLU A 1 246 ? 39.279 43.038 31.219  1.00 38.57 ? 243  GLU A O   1 
ATOM   2129 C  CB  A GLU A 1 246 ? 42.276 44.467 31.549  0.60 38.70 ? 243  GLU A CB  1 
ATOM   2130 C  CB  B GLU A 1 246 ? 42.109 44.529 31.455  0.40 38.40 ? 243  GLU A CB  1 
ATOM   2131 C  CG  A GLU A 1 246 ? 43.533 44.272 32.448  0.60 41.24 ? 243  GLU A CG  1 
ATOM   2132 C  CG  B GLU A 1 246 ? 41.208 45.225 32.471  0.40 39.90 ? 243  GLU A CG  1 
ATOM   2133 C  CD  A GLU A 1 246 ? 44.346 45.538 32.764  0.60 43.78 ? 243  GLU A CD  1 
ATOM   2134 C  CD  B GLU A 1 246 ? 41.854 46.458 33.047  0.40 42.48 ? 243  GLU A CD  1 
ATOM   2135 O  OE1 A GLU A 1 246 ? 44.408 46.474 31.929  0.60 44.01 ? 243  GLU A OE1 1 
ATOM   2136 O  OE1 B GLU A 1 246 ? 42.989 46.768 32.636  0.40 43.82 ? 243  GLU A OE1 1 
ATOM   2137 O  OE2 A GLU A 1 246 ? 44.960 45.564 33.866  0.60 45.57 ? 243  GLU A OE2 1 
ATOM   2138 O  OE2 B GLU A 1 246 ? 41.237 47.112 33.910  0.40 44.14 ? 243  GLU A OE2 1 
ATOM   2139 N  N   . PHE A 1 247 ? 40.101 43.230 29.161  1.00 35.70 ? 244  PHE A N   1 
ATOM   2140 C  CA  . PHE A 1 247 ? 38.793 43.141 28.460  1.00 34.51 ? 244  PHE A CA  1 
ATOM   2141 C  C   . PHE A 1 247 ? 38.164 41.736 28.350  1.00 35.09 ? 244  PHE A C   1 
ATOM   2142 O  O   . PHE A 1 247 ? 36.966 41.583 28.090  1.00 36.58 ? 244  PHE A O   1 
ATOM   2143 C  CB  . PHE A 1 247 ? 38.960 43.769 27.009  1.00 34.24 ? 244  PHE A CB  1 
ATOM   2144 C  CG  . PHE A 1 247 ? 37.684 43.797 26.148  1.00 34.02 ? 244  PHE A CG  1 
ATOM   2145 C  CD1 . PHE A 1 247 ? 36.842 44.911 26.130  1.00 38.01 ? 244  PHE A CD1 1 
ATOM   2146 C  CD2 . PHE A 1 247 ? 37.350 42.720 25.317  1.00 36.42 ? 244  PHE A CD2 1 
ATOM   2147 C  CE1 . PHE A 1 247 ? 35.692 44.939 25.299  1.00 34.52 ? 244  PHE A CE1 1 
ATOM   2148 C  CE2 . PHE A 1 247 ? 36.203 42.707 24.509  1.00 39.07 ? 244  PHE A CE2 1 
ATOM   2149 C  CZ  . PHE A 1 247 ? 35.356 43.835 24.499  1.00 36.64 ? 244  PHE A CZ  1 
ATOM   2150 N  N   . GLY A 1 248 ? 38.943 40.690 28.582  1.00 34.02 ? 245  GLY A N   1 
ATOM   2151 C  CA  . GLY A 1 248 ? 38.425 39.328 28.504  1.00 34.15 ? 245  GLY A CA  1 
ATOM   2152 C  C   . GLY A 1 248 ? 38.898 38.431 27.379  1.00 32.95 ? 245  GLY A C   1 
ATOM   2153 O  O   . GLY A 1 248 ? 38.361 37.329 27.175  1.00 34.60 ? 245  GLY A O   1 
ATOM   2154 N  N   . ILE A 1 249 ? 39.907 38.907 26.641  1.00 29.92 ? 246  ILE A N   1 
ATOM   2155 C  CA  . ILE A 1 249 ? 40.476 38.144 25.549  1.00 27.35 ? 246  ILE A CA  1 
ATOM   2156 C  C   . ILE A 1 249 ? 41.844 37.659 25.997  1.00 27.55 ? 246  ILE A C   1 
ATOM   2157 O  O   . ILE A 1 249 ? 42.652 38.437 26.493  1.00 27.48 ? 246  ILE A O   1 
ATOM   2158 C  CB  . ILE A 1 249 ? 40.571 39.018 24.311  1.00 25.22 ? 246  ILE A CB  1 
ATOM   2159 C  CG1 . ILE A 1 249 ? 39.141 39.316 23.800  1.00 24.44 ? 246  ILE A CG1 1 
ATOM   2160 C  CG2 . ILE A 1 249 ? 41.372 38.352 23.206  1.00 24.10 ? 246  ILE A CG2 1 
ATOM   2161 C  CD1 . ILE A 1 249 ? 39.153 40.467 22.747  1.00 23.12 ? 246  ILE A CD1 1 
ATOM   2162 N  N   . ASP A 1 250 ? 42.092 36.384 25.792  1.00 27.51 ? 247  ASP A N   1 
ATOM   2163 C  CA  . ASP A 1 250 ? 43.379 35.862 26.240  1.00 28.47 ? 247  ASP A CA  1 
ATOM   2164 C  C   . ASP A 1 250 ? 44.489 36.059 25.266  1.00 27.21 ? 247  ASP A C   1 
ATOM   2165 O  O   . ASP A 1 250 ? 44.264 36.453 24.099  1.00 25.91 ? 247  ASP A O   1 
ATOM   2166 C  CB  . ASP A 1 250 ? 43.290 34.425 26.700  1.00 29.85 ? 247  ASP A CB  1 
ATOM   2167 C  CG  . ASP A 1 250 ? 43.131 33.422 25.572  1.00 32.80 ? 247  ASP A CG  1 
ATOM   2168 O  OD1 . ASP A 1 250 ? 43.472 33.712 24.399  1.00 32.66 ? 247  ASP A OD1 1 
ATOM   2169 O  OD2 . ASP A 1 250 ? 42.736 32.267 25.903  1.00 39.05 ? 247  ASP A OD2 1 
ATOM   2170 N  N   . LEU A 1 251 ? 45.700 35.829 25.742  1.00 27.82 ? 248  LEU A N   1 
ATOM   2171 C  CA  A LEU A 1 251 ? 46.881 36.137 24.955  0.60 27.35 ? 248  LEU A CA  1 
ATOM   2172 C  CA  B LEU A 1 251 ? 46.908 36.124 24.988  0.40 26.81 ? 248  LEU A CA  1 
ATOM   2173 C  C   . LEU A 1 251 ? 46.948 35.338 23.675  1.00 24.73 ? 248  LEU A C   1 
ATOM   2174 O  O   . LEU A 1 251 ? 47.449 35.833 22.660  1.00 22.48 ? 248  LEU A O   1 
ATOM   2175 C  CB  A LEU A 1 251 ? 48.182 35.964 25.774  0.60 29.90 ? 248  LEU A CB  1 
ATOM   2176 C  CB  B LEU A 1 251 ? 48.176 35.871 25.856  0.40 28.76 ? 248  LEU A CB  1 
ATOM   2177 C  CG  A LEU A 1 251 ? 49.068 37.216 25.756  0.60 32.71 ? 248  LEU A CG  1 
ATOM   2178 C  CG  B LEU A 1 251 ? 48.369 36.770 27.108  0.40 30.49 ? 248  LEU A CG  1 
ATOM   2179 C  CD1 A LEU A 1 251 ? 48.208 38.450 26.078  0.60 34.49 ? 248  LEU A CD1 1 
ATOM   2180 C  CD1 B LEU A 1 251 ? 49.495 36.268 28.042  0.40 34.10 ? 248  LEU A CD1 1 
ATOM   2181 C  CD2 A LEU A 1 251 ? 50.245 37.051 26.751  0.60 35.59 ? 248  LEU A CD2 1 
ATOM   2182 C  CD2 B LEU A 1 251 ? 48.600 38.235 26.763  0.40 33.19 ? 248  LEU A CD2 1 
ATOM   2183 N  N   . GLU A 1 252 ? 46.397 34.139 23.674  1.00 24.19 ? 249  GLU A N   1 
ATOM   2184 C  CA  A GLU A 1 252 ? 46.472 33.315 22.475  0.60 25.00 ? 249  GLU A CA  1 
ATOM   2185 C  CA  B GLU A 1 252 ? 46.422 33.273 22.515  0.40 24.47 ? 249  GLU A CA  1 
ATOM   2186 C  C   . GLU A 1 252 ? 45.583 33.890 21.363  1.00 24.11 ? 249  GLU A C   1 
ATOM   2187 O  O   . GLU A 1 252 ? 45.756 33.564 20.195  1.00 24.07 ? 249  GLU A O   1 
ATOM   2188 C  CB  A GLU A 1 252 ? 46.135 31.850 22.738  0.60 26.76 ? 249  GLU A CB  1 
ATOM   2189 C  CB  B GLU A 1 252 ? 45.900 31.884 22.908  0.40 25.87 ? 249  GLU A CB  1 
ATOM   2190 C  CG  A GLU A 1 252 ? 47.340 31.040 23.281  0.60 33.26 ? 249  GLU A CG  1 
ATOM   2191 C  CG  B GLU A 1 252 ? 46.780 31.103 23.947  0.40 28.94 ? 249  GLU A CG  1 
ATOM   2192 C  CD  A GLU A 1 252 ? 48.415 30.794 22.229  0.60 39.52 ? 249  GLU A CD  1 
ATOM   2193 C  CD  B GLU A 1 252 ? 47.063 31.823 25.281  0.40 32.47 ? 249  GLU A CD  1 
ATOM   2194 O  OE1 A GLU A 1 252 ? 48.057 30.304 21.130  0.60 44.34 ? 249  GLU A OE1 1 
ATOM   2195 O  OE1 B GLU A 1 252 ? 46.117 32.251 25.966  0.40 30.21 ? 249  GLU A OE1 1 
ATOM   2196 O  OE2 A GLU A 1 252 ? 49.611 31.093 22.482  0.60 42.82 ? 249  GLU A OE2 1 
ATOM   2197 O  OE2 B GLU A 1 252 ? 48.264 31.931 25.659  0.40 37.06 ? 249  GLU A OE2 1 
ATOM   2198 N  N   . HIS A 1 253 ? 44.651 34.754 21.744  1.00 22.37 ? 250  HIS A N   1 
ATOM   2199 C  CA  . HIS A 1 253 ? 43.772 35.426 20.777  1.00 21.11 ? 250  HIS A CA  1 
ATOM   2200 C  C   . HIS A 1 253 ? 44.204 36.884 20.547  1.00 19.91 ? 250  HIS A C   1 
ATOM   2201 O  O   . HIS A 1 253 ? 43.424 37.673 19.998  1.00 17.90 ? 250  HIS A O   1 
ATOM   2202 C  CB  . HIS A 1 253 ? 42.339 35.403 21.337  1.00 22.20 ? 250  HIS A CB  1 
ATOM   2203 C  CG  . HIS A 1 253 ? 41.704 34.050 21.375  1.00 24.28 ? 250  HIS A CG  1 
ATOM   2204 N  ND1 . HIS A 1 253 ? 42.052 33.087 22.301  1.00 29.09 ? 250  HIS A ND1 1 
ATOM   2205 C  CD2 . HIS A 1 253 ? 40.634 33.555 20.709  1.00 27.69 ? 250  HIS A CD2 1 
ATOM   2206 C  CE1 . HIS A 1 253 ? 41.305 32.007 22.092  1.00 33.03 ? 250  HIS A CE1 1 
ATOM   2207 N  NE2 . HIS A 1 253 ? 40.460 32.263 21.105  1.00 30.69 ? 250  HIS A NE2 1 
ATOM   2208 N  N   . CYS A 1 254 ? 45.430 37.249 20.955  1.00 19.10 ? 251  CYS A N   1 
ATOM   2209 C  CA  A CYS A 1 254 ? 45.924 38.613 20.814  0.60 19.22 ? 251  CYS A CA  1 
ATOM   2210 C  CA  B CYS A 1 254 ? 45.992 38.607 20.837  0.40 19.74 ? 251  CYS A CA  1 
ATOM   2211 C  C   . CYS A 1 254 ? 47.089 38.602 19.805  1.00 20.60 ? 251  CYS A C   1 
ATOM   2212 O  O   . CYS A 1 254 ? 47.940 37.702 19.811  1.00 22.16 ? 251  CYS A O   1 
ATOM   2213 C  CB  A CYS A 1 254 ? 46.335 39.179 22.175  0.60 20.46 ? 251  CYS A CB  1 
ATOM   2214 C  CB  B CYS A 1 254 ? 46.681 39.031 22.122  0.40 20.81 ? 251  CYS A CB  1 
ATOM   2215 S  SG  A CYS A 1 254 ? 46.699 40.963 22.177  0.60 24.67 ? 251  CYS A SG  1 
ATOM   2216 S  SG  B CYS A 1 254 ? 45.619 39.504 23.364  0.40 25.25 ? 251  CYS A SG  1 
ATOM   2217 N  N   . TYR A 1 255 ? 47.079 39.578 18.943  1.00 17.52 ? 252  TYR A N   1 
ATOM   2218 C  CA  . TYR A 1 255 ? 48.006 39.739 17.800  1.00 17.56 ? 252  TYR A CA  1 
ATOM   2219 C  C   . TYR A 1 255 ? 48.710 41.040 18.010  1.00 20.59 ? 252  TYR A C   1 
ATOM   2220 O  O   . TYR A 1 255 ? 48.149 42.028 18.390  1.00 23.07 ? 252  TYR A O   1 
ATOM   2221 C  CB  . TYR A 1 255 ? 47.271 39.607 16.480  1.00 18.15 ? 252  TYR A CB  1 
ATOM   2222 C  CG  . TYR A 1 255 ? 46.755 38.209 16.359  1.00 16.90 ? 252  TYR A CG  1 
ATOM   2223 C  CD1 . TYR A 1 255 ? 47.496 37.224 15.720  1.00 17.57 ? 252  TYR A CD1 1 
ATOM   2224 C  CD2 . TYR A 1 255 ? 45.514 37.819 16.928  1.00 15.41 ? 252  TYR A CD2 1 
ATOM   2225 C  CE1 . TYR A 1 255 ? 47.063 35.945 15.633  1.00 17.70 ? 252  TYR A CE1 1 
ATOM   2226 C  CE2 . TYR A 1 255 ? 45.104 36.530 16.868  1.00 16.77 ? 252  TYR A CE2 1 
ATOM   2227 C  CZ  . TYR A 1 255 ? 45.867 35.576 16.278  1.00 17.18 ? 252  TYR A CZ  1 
ATOM   2228 O  OH  . TYR A 1 255 ? 45.414 34.296 16.221  1.00 19.47 ? 252  TYR A OH  1 
ATOM   2229 N  N   . LYS A 1 256 ? 50.014 41.053 17.775  1.00 22.36 ? 253  LYS A N   1 
ATOM   2230 C  CA  A LYS A 1 256 ? 50.855 42.147 18.232  0.60 22.45 ? 253  LYS A CA  1 
ATOM   2231 C  CA  B LYS A 1 256 ? 50.834 42.151 18.274  0.40 22.27 ? 253  LYS A CA  1 
ATOM   2232 C  C   . LYS A 1 256 ? 51.109 43.147 17.192  1.00 21.63 ? 253  LYS A C   1 
ATOM   2233 O  O   . LYS A 1 256 ? 51.316 42.775 16.010  1.00 21.40 ? 253  LYS A O   1 
ATOM   2234 C  CB  A LYS A 1 256 ? 52.230 41.588 18.622  0.60 23.86 ? 253  LYS A CB  1 
ATOM   2235 C  CB  B LYS A 1 256 ? 52.172 41.609 18.851  0.40 23.38 ? 253  LYS A CB  1 
ATOM   2236 C  CG  A LYS A 1 256 ? 52.238 40.967 19.966  0.60 27.70 ? 253  LYS A CG  1 
ATOM   2237 C  CG  B LYS A 1 256 ? 53.120 42.659 19.501  0.40 25.61 ? 253  LYS A CG  1 
ATOM   2238 C  CD  A LYS A 1 256 ? 53.616 40.355 20.259  0.60 31.12 ? 253  LYS A CD  1 
ATOM   2239 C  CD  B LYS A 1 256 ? 52.543 43.330 20.774  0.40 26.26 ? 253  LYS A CD  1 
ATOM   2240 C  CE  A LYS A 1 256 ? 53.469 39.078 21.087  0.60 33.47 ? 253  LYS A CE  1 
ATOM   2241 C  CE  B LYS A 1 256 ? 53.626 43.894 21.747  0.40 27.06 ? 253  LYS A CE  1 
ATOM   2242 N  NZ  A LYS A 1 256 ? 53.294 37.775 20.278  0.60 36.14 ? 253  LYS A NZ  1 
ATOM   2243 N  NZ  B LYS A 1 256 ? 54.247 45.227 21.527  0.40 25.74 ? 253  LYS A NZ  1 
ATOM   2244 N  N   . MET A 1 257 ? 51.189 44.392 17.645  1.00 20.48 ? 254  MET A N   1 
ATOM   2245 C  CA  A MET A 1 257 ? 51.909 45.411 16.888  0.60 19.38 ? 254  MET A CA  1 
ATOM   2246 C  CA  B MET A 1 257 ? 51.890 45.423 16.900  0.40 20.28 ? 254  MET A CA  1 
ATOM   2247 C  C   . MET A 1 257 ? 52.779 46.165 17.911  1.00 20.10 ? 254  MET A C   1 
ATOM   2248 O  O   . MET A 1 257 ? 52.751 45.882 19.084  1.00 21.32 ? 254  MET A O   1 
ATOM   2249 C  CB  A MET A 1 257 ? 50.926 46.333 16.185  0.60 19.52 ? 254  MET A CB  1 
ATOM   2250 C  CB  B MET A 1 257 ? 50.894 46.346 16.208  0.40 20.82 ? 254  MET A CB  1 
ATOM   2251 C  CG  A MET A 1 257 ? 50.130 47.244 17.124  0.60 18.75 ? 254  MET A CG  1 
ATOM   2252 C  CG  B MET A 1 257 ? 49.697 46.768 17.052  0.40 22.86 ? 254  MET A CG  1 
ATOM   2253 S  SD  A MET A 1 257 ? 48.627 47.886 16.287  0.60 15.19 ? 254  MET A SD  1 
ATOM   2254 S  SD  B MET A 1 257 ? 48.930 48.185 16.260  0.40 26.36 ? 254  MET A SD  1 
ATOM   2255 C  CE  A MET A 1 257 ? 49.451 49.158 15.190  0.60 13.79 ? 254  MET A CE  1 
ATOM   2256 C  CE  B MET A 1 257 ? 50.389 49.222 16.415  0.40 14.40 ? 254  MET A CE  1 
ATOM   2257 N  N   . TRP A 1 258 ? 53.599 47.043 17.432  1.00 17.39 ? 255  TRP A N   1 
ATOM   2258 C  CA  . TRP A 1 258 ? 54.611 47.658 18.232  1.00 17.43 ? 255  TRP A CA  1 
ATOM   2259 C  C   . TRP A 1 258 ? 54.497 49.164 18.204  1.00 16.00 ? 255  TRP A C   1 
ATOM   2260 O  O   . TRP A 1 258 ? 53.886 49.760 17.324  1.00 15.81 ? 255  TRP A O   1 
ATOM   2261 C  CB  . TRP A 1 258 ? 55.988 47.249 17.638  1.00 18.56 ? 255  TRP A CB  1 
ATOM   2262 C  CG  . TRP A 1 258 ? 56.115 45.743 17.639  1.00 19.81 ? 255  TRP A CG  1 
ATOM   2263 C  CD1 . TRP A 1 258 ? 56.512 45.018 18.685  1.00 22.90 ? 255  TRP A CD1 1 
ATOM   2264 C  CD2 . TRP A 1 258 ? 55.817 44.823 16.584  1.00 17.14 ? 255  TRP A CD2 1 
ATOM   2265 N  NE1 . TRP A 1 258 ? 56.501 43.659 18.368  1.00 25.39 ? 255  TRP A NE1 1 
ATOM   2266 C  CE2 . TRP A 1 258 ? 56.068 43.526 17.088  1.00 19.85 ? 255  TRP A CE2 1 
ATOM   2267 C  CE3 . TRP A 1 258 ? 55.374 44.948 15.268  1.00 17.25 ? 255  TRP A CE3 1 
ATOM   2268 C  CZ2 . TRP A 1 258 ? 55.880 42.372 16.288  1.00 20.52 ? 255  TRP A CZ2 1 
ATOM   2269 C  CZ3 . TRP A 1 258 ? 55.161 43.821 14.507  1.00 20.25 ? 255  TRP A CZ3 1 
ATOM   2270 C  CH2 . TRP A 1 258 ? 55.433 42.541 15.048  1.00 18.10 ? 255  TRP A CH2 1 
ATOM   2271 N  N   . ASP A 1 259 ? 55.162 49.798 19.159  1.00 16.67 ? 256  ASP A N   1 
ATOM   2272 C  CA  A ASP A 1 259 ? 55.066 51.261 19.253  0.60 17.12 ? 256  ASP A CA  1 
ATOM   2273 C  CA  B ASP A 1 259 ? 55.179 51.273 19.315  0.40 17.06 ? 256  ASP A CA  1 
ATOM   2274 C  C   . ASP A 1 259 ? 55.593 51.986 18.041  1.00 16.13 ? 256  ASP A C   1 
ATOM   2275 O  O   . ASP A 1 259 ? 55.104 53.085 17.740  1.00 16.06 ? 256  ASP A O   1 
ATOM   2276 C  CB  A ASP A 1 259 ? 55.655 51.818 20.570  0.60 18.07 ? 256  ASP A CB  1 
ATOM   2277 C  CB  B ASP A 1 259 ? 56.182 51.697 20.416  0.40 17.54 ? 256  ASP A CB  1 
ATOM   2278 C  CG  A ASP A 1 259 ? 57.191 51.733 20.676  0.60 21.30 ? 256  ASP A CG  1 
ATOM   2279 C  CG  B ASP A 1 259 ? 55.732 51.331 21.838  0.40 21.07 ? 256  ASP A CG  1 
ATOM   2280 O  OD1 A ASP A 1 259 ? 57.886 51.144 19.814  0.60 22.81 ? 256  ASP A OD1 1 
ATOM   2281 O  OD1 B ASP A 1 259 ? 54.609 50.837 22.027  0.40 24.22 ? 256  ASP A OD1 1 
ATOM   2282 O  OD2 A ASP A 1 259 ? 57.720 52.179 21.758  0.60 24.17 ? 256  ASP A OD2 1 
ATOM   2283 O  OD2 B ASP A 1 259 ? 56.562 51.519 22.784  0.40 25.91 ? 256  ASP A OD2 1 
ATOM   2284 N  N   . TRP A 1 260 ? 56.514 51.350 17.296  1.00 16.14 ? 257  TRP A N   1 
ATOM   2285 C  CA  . TRP A 1 260 ? 57.103 51.910 16.108  1.00 15.28 ? 257  TRP A CA  1 
ATOM   2286 C  C   . TRP A 1 260 ? 56.288 51.757 14.827  1.00 15.01 ? 257  TRP A C   1 
ATOM   2287 O  O   . TRP A 1 260 ? 56.734 52.124 13.758  1.00 14.57 ? 257  TRP A O   1 
ATOM   2288 C  CB  . TRP A 1 260 ? 58.545 51.371 15.944  1.00 16.19 ? 257  TRP A CB  1 
ATOM   2289 C  CG  . TRP A 1 260 ? 58.727 49.894 16.118  1.00 15.93 ? 257  TRP A CG  1 
ATOM   2290 C  CD1 . TRP A 1 260 ? 59.358 49.322 17.184  1.00 17.58 ? 257  TRP A CD1 1 
ATOM   2291 C  CD2 . TRP A 1 260 ? 58.417 48.801 15.218  1.00 15.14 ? 257  TRP A CD2 1 
ATOM   2292 N  NE1 . TRP A 1 260 ? 59.381 47.939 17.046  1.00 18.35 ? 257  TRP A NE1 1 
ATOM   2293 C  CE2 . TRP A 1 260 ? 58.830 47.603 15.852  1.00 16.05 ? 257  TRP A CE2 1 
ATOM   2294 C  CE3 . TRP A 1 260 ? 57.795 48.721 13.961  1.00 15.07 ? 257  TRP A CE3 1 
ATOM   2295 C  CZ2 . TRP A 1 260 ? 58.699 46.359 15.239  1.00 17.18 ? 257  TRP A CZ2 1 
ATOM   2296 C  CZ3 . TRP A 1 260 ? 57.661 47.508 13.392  1.00 16.45 ? 257  TRP A CZ3 1 
ATOM   2297 C  CH2 . TRP A 1 260 ? 58.098 46.360 14.026  1.00 16.19 ? 257  TRP A CH2 1 
ATOM   2298 N  N   . VAL A 1 261 ? 55.087 51.211 14.966  1.00 13.34 ? 258  VAL A N   1 
ATOM   2299 C  CA  . VAL A 1 261 ? 54.090 51.170 13.878  1.00 13.82 ? 258  VAL A CA  1 
ATOM   2300 C  C   . VAL A 1 261 ? 53.079 52.278 14.115  1.00 13.72 ? 258  VAL A C   1 
ATOM   2301 O  O   . VAL A 1 261 ? 52.208 52.160 15.004  1.00 14.79 ? 258  VAL A O   1 
ATOM   2302 C  CB  . VAL A 1 261 ? 53.320 49.850 13.866  1.00 12.79 ? 258  VAL A CB  1 
ATOM   2303 C  CG1 . VAL A 1 261 ? 52.348 49.822 12.693  1.00 14.86 ? 258  VAL A CG1 1 
ATOM   2304 C  CG2 . VAL A 1 261 ? 54.287 48.653 13.750  1.00 15.43 ? 258  VAL A CG2 1 
ATOM   2305 N  N   . GLY A 1 262 ? 53.187 53.379 13.388  1.00 13.55 ? 259  GLY A N   1 
ATOM   2306 C  CA  . GLY A 1 262 ? 52.178 54.445 13.487  1.00 14.47 ? 259  GLY A CA  1 
ATOM   2307 C  C   . GLY A 1 262 ? 50.853 53.941 12.965  1.00 14.45 ? 259  GLY A C   1 
ATOM   2308 O  O   . GLY A 1 262 ? 50.846 53.166 11.991  1.00 13.43 ? 259  GLY A O   1 
ATOM   2309 N  N   . GLY A 1 263 ? 49.734 54.336 13.605  1.00 15.73 ? 260  GLY A N   1 
ATOM   2310 C  CA  . GLY A 1 263 ? 48.410 53.882 13.151  1.00 14.94 ? 260  GLY A CA  1 
ATOM   2311 C  C   . GLY A 1 263 ? 48.188 54.094 11.643  1.00 12.99 ? 260  GLY A C   1 
ATOM   2312 O  O   . GLY A 1 263 ? 47.756 53.227 10.854  1.00 13.52 ? 260  GLY A O   1 
ATOM   2313 N  N   . ARG A 1 264 ? 48.526 55.297 11.156  1.00 12.50 ? 261  ARG A N   1 
ATOM   2314 C  CA  . ARG A 1 264 ? 48.346 55.658 9.755   1.00 12.71 ? 261  ARG A CA  1 
ATOM   2315 C  C   . ARG A 1 264 ? 49.351 55.007 8.776   1.00 13.27 ? 261  ARG A C   1 
ATOM   2316 O  O   . ARG A 1 264 ? 49.261 55.232 7.563   1.00 14.06 ? 261  ARG A O   1 
ATOM   2317 C  CB  . ARG A 1 264 ? 48.325 57.208 9.586   1.00 13.81 ? 261  ARG A CB  1 
ATOM   2318 C  CG  . ARG A 1 264 ? 49.639 57.886 9.997   1.00 14.68 ? 261  ARG A CG  1 
ATOM   2319 C  CD  . ARG A 1 264 ? 49.532 59.386 9.888   1.00 12.84 ? 261  ARG A CD  1 
ATOM   2320 N  NE  . ARG A 1 264 ? 50.600 60.097 10.599  1.00 13.85 ? 261  ARG A NE  1 
ATOM   2321 C  CZ  . ARG A 1 264 ? 50.650 60.352 11.885  1.00 14.19 ? 261  ARG A CZ  1 
ATOM   2322 N  NH1 . ARG A 1 264 ? 51.670 61.019 12.355  1.00 14.44 ? 261  ARG A NH1 1 
ATOM   2323 N  NH2 . ARG A 1 264 ? 49.679 59.967 12.699  1.00 14.95 ? 261  ARG A NH2 1 
ATOM   2324 N  N   . TYR A 1 265 ? 50.248 54.190 9.326   1.00 13.02 ? 262  TYR A N   1 
ATOM   2325 C  CA  . TYR A 1 265 ? 51.203 53.377 8.601   1.00 13.21 ? 262  TYR A CA  1 
ATOM   2326 C  C   . TYR A 1 265 ? 51.098 51.921 9.040   1.00 13.20 ? 262  TYR A C   1 
ATOM   2327 O  O   . TYR A 1 265 ? 52.074 51.181 8.957   1.00 13.42 ? 262  TYR A O   1 
ATOM   2328 C  CB  . TYR A 1 265 ? 52.602 53.902 8.870   1.00 13.23 ? 262  TYR A CB  1 
ATOM   2329 C  CG  . TYR A 1 265 ? 52.814 55.345 8.454   1.00 12.21 ? 262  TYR A CG  1 
ATOM   2330 C  CD1 . TYR A 1 265 ? 52.956 55.686 7.129   1.00 14.11 ? 262  TYR A CD1 1 
ATOM   2331 C  CD2 . TYR A 1 265 ? 52.857 56.371 9.391   1.00 13.22 ? 262  TYR A CD2 1 
ATOM   2332 C  CE1 . TYR A 1 265 ? 53.108 56.999 6.726   1.00 14.29 ? 262  TYR A CE1 1 
ATOM   2333 C  CE2 . TYR A 1 265 ? 53.032 57.693 9.012   1.00 13.98 ? 262  TYR A CE2 1 
ATOM   2334 C  CZ  . TYR A 1 265 ? 53.133 57.993 7.682   1.00 13.99 ? 262  TYR A CZ  1 
ATOM   2335 O  OH  . TYR A 1 265 ? 53.310 59.303 7.210   1.00 14.92 ? 262  TYR A OH  1 
ATOM   2336 N  N   . SER A 1 266 ? 49.938 51.493 9.506   1.00 12.10 ? 263  SER A N   1 
ATOM   2337 C  CA  . SER A 1 266 ? 49.778 50.186 10.135  1.00 13.06 ? 263  SER A CA  1 
ATOM   2338 C  C   . SER A 1 266 ? 49.128 49.052 9.349   1.00 12.46 ? 263  SER A C   1 
ATOM   2339 O  O   . SER A 1 266 ? 49.144 47.930 9.839   1.00 13.24 ? 263  SER A O   1 
ATOM   2340 C  CB  . SER A 1 266 ? 49.045 50.333 11.478  1.00 12.72 ? 263  SER A CB  1 
ATOM   2341 O  OG  . SER A 1 266 ? 47.640 50.593 11.292  1.00 12.83 ? 263  SER A OG  1 
ATOM   2342 N  N   . LEU A 1 267 ? 48.602 49.310 8.157   1.00 12.06 ? 264  LEU A N   1 
ATOM   2343 C  CA  . LEU A 1 267 ? 47.913 48.241 7.455   1.00 11.48 ? 264  LEU A CA  1 
ATOM   2344 C  C   . LEU A 1 267 ? 48.842 47.070 7.131   1.00 12.04 ? 264  LEU A C   1 
ATOM   2345 O  O   . LEU A 1 267 ? 48.368 45.962 6.945   1.00 12.82 ? 264  LEU A O   1 
ATOM   2346 C  CB  . LEU A 1 267 ? 47.224 48.789 6.211   1.00 12.94 ? 264  LEU A CB  1 
ATOM   2347 C  CG  . LEU A 1 267 ? 48.083 49.235 5.056   1.00 12.01 ? 264  LEU A CG  1 
ATOM   2348 C  CD1 . LEU A 1 267 ? 48.457 48.031 4.142   1.00 12.91 ? 264  LEU A CD1 1 
ATOM   2349 C  CD2 . LEU A 1 267 ? 47.330 50.307 4.205   1.00 14.90 ? 264  LEU A CD2 1 
ATOM   2350 N  N   . TRP A 1 268 ? 50.157 47.339 7.101   1.00 12.83 ? 265  TRP A N   1 
ATOM   2351 C  CA  . TRP A 1 268 ? 51.178 46.358 6.789   1.00 11.95 ? 265  TRP A CA  1 
ATOM   2352 C  C   . TRP A 1 268 ? 51.416 45.365 7.938   1.00 12.73 ? 265  TRP A C   1 
ATOM   2353 O  O   . TRP A 1 268 ? 52.069 44.348 7.760   1.00 14.17 ? 265  TRP A O   1 
ATOM   2354 C  CB  . TRP A 1 268 ? 52.491 47.036 6.435   1.00 12.06 ? 265  TRP A CB  1 
ATOM   2355 C  CG  . TRP A 1 268 ? 52.319 48.266 5.655   1.00 12.32 ? 265  TRP A CG  1 
ATOM   2356 C  CD1 . TRP A 1 268 ? 52.315 49.539 6.102   1.00 12.66 ? 265  TRP A CD1 1 
ATOM   2357 C  CD2 . TRP A 1 268 ? 52.107 48.343 4.241   1.00 12.76 ? 265  TRP A CD2 1 
ATOM   2358 N  NE1 . TRP A 1 268 ? 52.066 50.423 5.074   1.00 13.05 ? 265  TRP A NE1 1 
ATOM   2359 C  CE2 . TRP A 1 268 ? 51.968 49.700 3.912   1.00 12.45 ? 265  TRP A CE2 1 
ATOM   2360 C  CE3 . TRP A 1 268 ? 52.029 47.374 3.200   1.00 13.47 ? 265  TRP A CE3 1 
ATOM   2361 C  CZ2 . TRP A 1 268 ? 51.768 50.139 2.575   1.00 12.17 ? 265  TRP A CZ2 1 
ATOM   2362 C  CZ3 . TRP A 1 268 ? 51.804 47.821 1.916   1.00 13.41 ? 265  TRP A CZ3 1 
ATOM   2363 C  CH2 . TRP A 1 268 ? 51.692 49.173 1.619   1.00 12.43 ? 265  TRP A CH2 1 
ATOM   2364 N  N   . SER A 1 269 ? 50.957 45.749 9.147   1.00 12.14 ? 266  SER A N   1 
ATOM   2365 C  CA  . SER A 1 269 ? 51.138 44.971 10.398  1.00 12.40 ? 266  SER A CA  1 
ATOM   2366 C  C   . SER A 1 269 ? 49.995 43.991 10.599  1.00 13.60 ? 266  SER A C   1 
ATOM   2367 O  O   . SER A 1 269 ? 49.190 43.744 9.673   1.00 13.06 ? 266  SER A O   1 
ATOM   2368 C  CB  . SER A 1 269 ? 51.213 45.940 11.574  1.00 12.99 ? 266  SER A CB  1 
ATOM   2369 O  OG  . SER A 1 269 ? 49.936 46.487 11.927  1.00 12.95 ? 266  SER A OG  1 
ATOM   2370 N  N   . SER A 1 270 ? 49.877 43.430 11.787  1.00 13.52 ? 267  SER A N   1 
ATOM   2371 C  CA  . SER A 1 270 ? 48.720 42.581 12.131  1.00 13.84 ? 267  SER A CA  1 
ATOM   2372 C  C   . SER A 1 270 ? 47.395 43.319 11.962  1.00 13.93 ? 267  SER A C   1 
ATOM   2373 O  O   . SER A 1 270 ? 46.345 42.700 11.845  1.00 13.75 ? 267  SER A O   1 
ATOM   2374 C  CB  . SER A 1 270 ? 48.855 42.041 13.527  1.00 14.72 ? 267  SER A CB  1 
ATOM   2375 O  OG  . SER A 1 270 ? 49.974 41.141 13.522  1.00 16.07 ? 267  SER A OG  1 
ATOM   2376 N  N   . ILE A 1 271 ? 47.427 44.673 12.002  1.00 12.96 ? 268  ILE A N   1 
ATOM   2377 C  CA  . ILE A 1 271 ? 46.225 45.457 11.743  1.00 12.81 ? 268  ILE A CA  1 
ATOM   2378 C  C   . ILE A 1 271 ? 45.651 45.121 10.376  1.00 13.43 ? 268  ILE A C   1 
ATOM   2379 O  O   . ILE A 1 271 ? 44.425 45.210 10.165  1.00 15.16 ? 268  ILE A O   1 
ATOM   2380 C  CB  . ILE A 1 271 ? 46.542 46.966 11.838  1.00 12.59 ? 268  ILE A CB  1 
ATOM   2381 C  CG1 . ILE A 1 271 ? 46.858 47.349 13.263  1.00 14.31 ? 268  ILE A CG1 1 
ATOM   2382 C  CG2 . ILE A 1 271 ? 45.371 47.824 11.215  1.00 13.87 ? 268  ILE A CG2 1 
ATOM   2383 C  CD1 . ILE A 1 271 ? 45.625 47.334 14.230  1.00 15.34 ? 268  ILE A CD1 1 
ATOM   2384 N  N   . GLY A 1 272 ? 46.479 44.692 9.441   1.00 13.62 ? 269  GLY A N   1 
ATOM   2385 C  CA  . GLY A 1 272 ? 45.991 44.272 8.139   1.00 14.59 ? 269  GLY A CA  1 
ATOM   2386 C  C   . GLY A 1 272 ? 45.327 42.880 8.107   1.00 14.49 ? 269  GLY A C   1 
ATOM   2387 O  O   . GLY A 1 272 ? 45.073 42.339 7.034   1.00 15.29 ? 269  GLY A O   1 
ATOM   2388 N  N   . MET A 1 273 ? 45.060 42.247 9.241   1.00 12.87 ? 270  MET A N   1 
ATOM   2389 C  CA  . MET A 1 273 ? 44.532 40.893 9.234   1.00 15.00 ? 270  MET A CA  1 
ATOM   2390 C  C   . MET A 1 273 ? 43.213 40.869 8.435   1.00 13.89 ? 270  MET A C   1 
ATOM   2391 O  O   . MET A 1 273 ? 42.967 39.905 7.736   1.00 13.97 ? 270  MET A O   1 
ATOM   2392 C  CB  . MET A 1 273 ? 44.421 40.338 10.638  1.00 18.86 ? 270  MET A CB  1 
ATOM   2393 C  CG  . MET A 1 273 ? 43.501 40.737 11.508  1.00 22.46 ? 270  MET A CG  1 
ATOM   2394 S  SD  . MET A 1 273 ? 43.032 39.505 12.871  1.00 17.36 ? 270  MET A SD  1 
ATOM   2395 C  CE  . MET A 1 273 ? 44.650 39.220 13.618  1.00 20.00 ? 270  MET A CE  1 
ATOM   2396 N  N   . SER A 1 274 ? 42.364 41.885 8.583   1.00 13.15 ? 271  SER A N   1 
ATOM   2397 C  CA  . SER A 1 274 ? 41.112 41.937 7.807   1.00 13.55 ? 271  SER A CA  1 
ATOM   2398 C  C   . SER A 1 274 ? 41.342 41.934 6.308   1.00 12.88 ? 271  SER A C   1 
ATOM   2399 O  O   . SER A 1 274 ? 40.512 41.428 5.535   1.00 13.74 ? 271  SER A O   1 
ATOM   2400 C  CB  . SER A 1 274 ? 40.220 43.086 8.312   1.00 14.07 ? 271  SER A CB  1 
ATOM   2401 O  OG  . SER A 1 274 ? 40.905 44.320 8.212   1.00 14.81 ? 271  SER A OG  1 
ATOM   2402 N  N   . ILE A 1 275 ? 42.477 42.500 5.860   1.00 13.35 ? 272  ILE A N   1 
ATOM   2403 C  CA  . ILE A 1 275 ? 42.818 42.424 4.432   1.00 12.70 ? 272  ILE A CA  1 
ATOM   2404 C  C   . ILE A 1 275 ? 43.081 40.962 4.078   1.00 12.98 ? 272  ILE A C   1 
ATOM   2405 O  O   . ILE A 1 275 ? 42.509 40.450 3.087   1.00 13.90 ? 272  ILE A O   1 
ATOM   2406 C  CB  . ILE A 1 275 ? 44.079 43.234 4.124   1.00 12.91 ? 272  ILE A CB  1 
ATOM   2407 C  CG1 . ILE A 1 275 ? 43.877 44.711 4.362   1.00 13.28 ? 272  ILE A CG1 1 
ATOM   2408 C  CG2 . ILE A 1 275 ? 44.503 42.947 2.676   1.00 13.36 ? 272  ILE A CG2 1 
ATOM   2409 C  CD1 . ILE A 1 275 ? 45.179 45.551 4.417   1.00 12.65 ? 272  ILE A CD1 1 
ATOM   2410 N  N   . ALA A 1 276 ? 43.898 40.249 4.863   1.00 12.82 ? 273  ALA A N   1 
ATOM   2411 C  CA  . ALA A 1 276 ? 44.160 38.843 4.605   1.00 13.48 ? 273  ALA A CA  1 
ATOM   2412 C  C   . ALA A 1 276 ? 42.903 37.994 4.628   1.00 13.46 ? 273  ALA A C   1 
ATOM   2413 O  O   . ALA A 1 276 ? 42.752 37.019 3.905   1.00 15.07 ? 273  ALA A O   1 
ATOM   2414 C  CB  . ALA A 1 276 ? 45.233 38.297 5.604   1.00 14.71 ? 273  ALA A CB  1 
ATOM   2415 N  N   . PHE A 1 277 ? 41.971 38.358 5.506   1.00 13.51 ? 274  PHE A N   1 
ATOM   2416 C  CA  . PHE A 1 277 ? 40.723 37.589 5.597   1.00 13.47 ? 274  PHE A CA  1 
ATOM   2417 C  C   . PHE A 1 277 ? 39.874 37.767 4.322   1.00 14.92 ? 274  PHE A C   1 
ATOM   2418 O  O   . PHE A 1 277 ? 38.971 36.916 4.073   1.00 17.72 ? 274  PHE A O   1 
ATOM   2419 C  CB  . PHE A 1 277 ? 39.866 38.009 6.822   1.00 13.41 ? 274  PHE A CB  1 
ATOM   2420 C  CG  . PHE A 1 277 ? 40.197 37.308 8.112   1.00 13.23 ? 274  PHE A CG  1 
ATOM   2421 C  CD1 . PHE A 1 277 ? 40.066 35.957 8.194   1.00 15.99 ? 274  PHE A CD1 1 
ATOM   2422 C  CD2 . PHE A 1 277 ? 40.597 38.031 9.219   1.00 15.37 ? 274  PHE A CD2 1 
ATOM   2423 C  CE1 . PHE A 1 277 ? 40.332 35.297 9.411   1.00 17.22 ? 274  PHE A CE1 1 
ATOM   2424 C  CE2 . PHE A 1 277 ? 40.825 37.374 10.439  1.00 16.84 ? 274  PHE A CE2 1 
ATOM   2425 C  CZ  . PHE A 1 277 ? 40.703 36.043 10.504  1.00 15.85 ? 274  PHE A CZ  1 
ATOM   2426 N  N   . ALA A 1 278 ? 40.092 38.843 3.560   1.00 14.43 ? 275  ALA A N   1 
ATOM   2427 C  CA  . ALA A 1 278 ? 39.369 39.052 2.279   1.00 15.83 ? 275  ALA A CA  1 
ATOM   2428 C  C   . ALA A 1 278 ? 40.099 38.416 1.113   1.00 15.51 ? 275  ALA A C   1 
ATOM   2429 O  O   . ALA A 1 278 ? 39.483 37.675 0.333   1.00 16.10 ? 275  ALA A O   1 
ATOM   2430 C  CB  . ALA A 1 278 ? 39.141 40.550 2.010   1.00 14.70 ? 275  ALA A CB  1 
ATOM   2431 N  N   . ILE A 1 279 ? 41.386 38.688 1.032   1.00 14.67 ? 276  ILE A N   1 
ATOM   2432 C  CA  . ILE A 1 279 ? 42.163 38.317 -0.163  1.00 14.75 ? 276  ILE A CA  1 
ATOM   2433 C  C   . ILE A 1 279 ? 43.080 37.120 -0.003  1.00 15.24 ? 276  ILE A C   1 
ATOM   2434 O  O   . ILE A 1 279 ? 43.712 36.714 -0.989  1.00 14.72 ? 276  ILE A O   1 
ATOM   2435 C  CB  . ILE A 1 279 ? 42.987 39.513 -0.736  1.00 14.25 ? 276  ILE A CB  1 
ATOM   2436 C  CG1 . ILE A 1 279 ? 44.096 39.903 0.171   1.00 14.65 ? 276  ILE A CG1 1 
ATOM   2437 C  CG2 . ILE A 1 279 ? 42.052 40.736 -1.100  1.00 17.03 ? 276  ILE A CG2 1 
ATOM   2438 C  CD1 . ILE A 1 279 ? 44.950 41.143 -0.326  1.00 17.94 ? 276  ILE A CD1 1 
ATOM   2439 N  N   . GLY A 1 280 ? 43.143 36.534 1.204   1.00 15.83 ? 277  GLY A N   1 
ATOM   2440 C  CA  . GLY A 1 280 ? 44.054 35.449 1.528   1.00 15.69 ? 277  GLY A CA  1 
ATOM   2441 C  C   . GLY A 1 280 ? 45.432 35.951 1.878   1.00 15.00 ? 277  GLY A C   1 
ATOM   2442 O  O   . GLY A 1 280 ? 45.841 37.027 1.487   1.00 14.94 ? 277  GLY A O   1 
ATOM   2443 N  N   . TYR A 1 281 ? 46.156 35.146 2.634   1.00 15.60 ? 278  TYR A N   1 
ATOM   2444 C  CA  . TYR A 1 281 ? 47.475 35.551 3.090   1.00 16.52 ? 278  TYR A CA  1 
ATOM   2445 C  C   . TYR A 1 281 ? 48.455 35.653 1.956   1.00 14.94 ? 278  TYR A C   1 
ATOM   2446 O  O   . TYR A 1 281 ? 49.339 36.546 1.978   1.00 16.07 ? 278  TYR A O   1 
ATOM   2447 C  CB  . TYR A 1 281 ? 47.959 34.680 4.266   1.00 16.16 ? 278  TYR A CB  1 
ATOM   2448 C  CG  . TYR A 1 281 ? 48.880 35.488 5.141   1.00 16.02 ? 278  TYR A CG  1 
ATOM   2449 C  CD1 . TYR A 1 281 ? 48.392 36.330 6.094   1.00 16.07 ? 278  TYR A CD1 1 
ATOM   2450 C  CD2 . TYR A 1 281 ? 50.247 35.527 4.897   1.00 15.81 ? 278  TYR A CD2 1 
ATOM   2451 C  CE1 . TYR A 1 281 ? 49.228 37.134 6.833   1.00 16.09 ? 278  TYR A CE1 1 
ATOM   2452 C  CE2 . TYR A 1 281 ? 51.093 36.342 5.609   1.00 16.52 ? 278  TYR A CE2 1 
ATOM   2453 C  CZ  . TYR A 1 281 ? 50.580 37.144 6.573   1.00 16.81 ? 278  TYR A CZ  1 
ATOM   2454 O  OH  . TYR A 1 281 ? 51.387 38.039 7.265   1.00 18.85 ? 278  TYR A OH  1 
ATOM   2455 N  N   . ASP A 1 282 ? 48.382 34.792 0.960   1.00 16.56 ? 279  ASP A N   1 
ATOM   2456 C  CA  . ASP A 1 282 ? 49.324 34.928 -0.143  1.00 16.76 ? 279  ASP A CA  1 
ATOM   2457 C  C   . ASP A 1 282 ? 49.261 36.310 -0.808  1.00 14.88 ? 279  ASP A C   1 
ATOM   2458 O  O   . ASP A 1 282 ? 50.293 36.948 -1.108  1.00 16.68 ? 279  ASP A O   1 
ATOM   2459 C  CB  . ASP A 1 282 ? 49.112 33.839 -1.195  1.00 18.43 ? 279  ASP A CB  1 
ATOM   2460 C  CG  . ASP A 1 282 ? 49.572 32.444 -0.770  1.00 26.55 ? 279  ASP A CG  1 
ATOM   2461 O  OD1 . ASP A 1 282 ? 50.301 32.247 0.204   1.00 31.54 ? 279  ASP A OD1 1 
ATOM   2462 O  OD2 . ASP A 1 282 ? 49.198 31.499 -1.534  1.00 35.32 ? 279  ASP A OD2 1 
ATOM   2463 N  N   . ASN A 1 283 ? 48.056 36.794 -1.062  1.00 15.99 ? 280  ASN A N   1 
ATOM   2464 C  CA  . ASN A 1 283 ? 47.875 38.104 -1.649  1.00 14.33 ? 280  ASN A CA  1 
ATOM   2465 C  C   . ASN A 1 283 ? 48.306 39.208 -0.696  1.00 14.22 ? 280  ASN A C   1 
ATOM   2466 O  O   . ASN A 1 283 ? 48.812 40.227 -1.146  1.00 14.43 ? 280  ASN A O   1 
ATOM   2467 C  CB  . ASN A 1 283 ? 46.476 38.300 -2.142  1.00 14.25 ? 280  ASN A CB  1 
ATOM   2468 C  CG  . ASN A 1 283 ? 46.192 37.583 -3.463  1.00 15.81 ? 280  ASN A CG  1 
ATOM   2469 O  OD1 . ASN A 1 283 ? 47.083 37.488 -4.314  1.00 17.83 ? 280  ASN A OD1 1 
ATOM   2470 N  ND2 . ASN A 1 283 ? 44.929 37.183 -3.655  1.00 14.93 ? 280  ASN A ND2 1 
ATOM   2471 N  N   . PHE A 1 284 ? 48.095 39.017 0.609   1.00 15.29 ? 281  PHE A N   1 
ATOM   2472 C  CA  . PHE A 1 284 ? 48.608 39.981 1.593   1.00 14.20 ? 281  PHE A CA  1 
ATOM   2473 C  C   . PHE A 1 284 ? 50.164 40.061 1.487   1.00 13.91 ? 281  PHE A C   1 
ATOM   2474 O  O   . PHE A 1 284 ? 50.719 41.155 1.483   1.00 13.77 ? 281  PHE A O   1 
ATOM   2475 C  CB  . PHE A 1 284 ? 48.152 39.610 3.001   1.00 14.22 ? 281  PHE A CB  1 
ATOM   2476 C  CG  . PHE A 1 284 ? 48.552 40.627 4.042   1.00 13.21 ? 281  PHE A CG  1 
ATOM   2477 C  CD1 . PHE A 1 284 ? 47.929 41.838 4.143   1.00 14.23 ? 281  PHE A CD1 1 
ATOM   2478 C  CD2 . PHE A 1 284 ? 49.612 40.375 4.900   1.00 15.45 ? 281  PHE A CD2 1 
ATOM   2479 C  CE1 . PHE A 1 284 ? 48.321 42.791 5.079   1.00 13.71 ? 281  PHE A CE1 1 
ATOM   2480 C  CE2 . PHE A 1 284 ? 50.007 41.362 5.841   1.00 15.07 ? 281  PHE A CE2 1 
ATOM   2481 C  CZ  . PHE A 1 284 ? 49.368 42.525 5.935   1.00 14.01 ? 281  PHE A CZ  1 
ATOM   2482 N  N   . GLU A 1 285 ? 50.821 38.921 1.316   1.00 15.58 ? 282  GLU A N   1 
ATOM   2483 C  CA  . GLU A 1 285 ? 52.304 38.925 1.143   1.00 16.00 ? 282  GLU A CA  1 
ATOM   2484 C  C   . GLU A 1 285 ? 52.665 39.688 -0.131  1.00 14.74 ? 282  GLU A C   1 
ATOM   2485 O  O   . GLU A 1 285 ? 53.698 40.364 -0.165  1.00 16.38 ? 282  GLU A O   1 
ATOM   2486 C  CB  . GLU A 1 285 ? 52.906 37.547 1.159   1.00 17.23 ? 282  GLU A CB  1 
ATOM   2487 C  CG  . GLU A 1 285 ? 52.680 36.933 2.530   1.00 20.76 ? 282  GLU A CG  1 
ATOM   2488 C  CD  . GLU A 1 285 ? 53.606 35.902 3.010   1.00 32.59 ? 282  GLU A CD  1 
ATOM   2489 O  OE1 . GLU A 1 285 ? 54.520 36.258 3.812   1.00 31.66 ? 282  GLU A OE1 1 
ATOM   2490 O  OE2 . GLU A 1 285 ? 53.331 34.743 2.676   1.00 34.26 ? 282  GLU A OE2 1 
ATOM   2491 N  N   . LYS A 1 286 ? 51.857 39.567 -1.190  1.00 14.19 ? 283  LYS A N   1 
ATOM   2492 C  CA  . LYS A 1 286 ? 52.170 40.301 -2.417  1.00 14.72 ? 283  LYS A CA  1 
ATOM   2493 C  C   . LYS A 1 286 ? 52.033 41.812 -2.215  1.00 14.02 ? 283  LYS A C   1 
ATOM   2494 O  O   . LYS A 1 286 ? 52.856 42.561 -2.749  1.00 13.68 ? 283  LYS A O   1 
ATOM   2495 C  CB  . LYS A 1 286 ? 51.308 39.800 -3.573  1.00 14.47 ? 283  LYS A CB  1 
ATOM   2496 C  CG  . LYS A 1 286 ? 51.557 38.358 -4.022  1.00 17.02 ? 283  LYS A CG  1 
ATOM   2497 C  CD  . LYS A 1 286 ? 50.611 37.957 -5.147  1.00 21.22 ? 283  LYS A CD  1 
ATOM   2498 C  CE  . LYS A 1 286 ? 50.651 36.478 -5.455  1.00 31.20 ? 283  LYS A CE  1 
ATOM   2499 N  NZ  . LYS A 1 286 ? 51.944 36.105 -5.896  1.00 37.03 ? 283  LYS A NZ  1 
ATOM   2500 N  N   . LEU A 1 287 ? 50.996 42.247 -1.510  1.00 13.69 ? 284  LEU A N   1 
ATOM   2501 C  CA  . LEU A 1 287 ? 50.822 43.661 -1.088  1.00 12.53 ? 284  LEU A CA  1 
ATOM   2502 C  C   . LEU A 1 287 ? 52.102 44.194 -0.376  1.00 12.88 ? 284  LEU A C   1 
ATOM   2503 O  O   . LEU A 1 287 ? 52.684 45.241 -0.782  1.00 14.24 ? 284  LEU A O   1 
ATOM   2504 C  CB  . LEU A 1 287 ? 49.566 43.762 -0.214  1.00 13.45 ? 284  LEU A CB  1 
ATOM   2505 C  CG  . LEU A 1 287 ? 49.354 45.120 0.416   1.00 12.26 ? 284  LEU A CG  1 
ATOM   2506 C  CD1 . LEU A 1 287 ? 48.818 46.118 -0.578  1.00 14.35 ? 284  LEU A CD1 1 
ATOM   2507 C  CD2 . LEU A 1 287 ? 48.376 44.946 1.604   1.00 13.93 ? 284  LEU A CD2 1 
ATOM   2508 N  N   . LEU A 1 288 ? 52.579 43.404 0.563   1.00 13.36 ? 285  LEU A N   1 
ATOM   2509 C  CA  . LEU A 1 288 ? 53.788 43.778 1.280   1.00 13.62 ? 285  LEU A CA  1 
ATOM   2510 C  C   . LEU A 1 288 ? 55.023 43.800 0.351   1.00 13.97 ? 285  LEU A C   1 
ATOM   2511 O  O   . LEU A 1 288 ? 55.866 44.707 0.453   1.00 14.18 ? 285  LEU A O   1 
ATOM   2512 C  CB  . LEU A 1 288 ? 53.969 42.910 2.536   1.00 15.06 ? 285  LEU A CB  1 
ATOM   2513 C  CG  . LEU A 1 288 ? 53.188 43.366 3.845   1.00 16.57 ? 285  LEU A CG  1 
ATOM   2514 C  CD1 . LEU A 1 288 ? 51.607 43.656 3.594   1.00 18.02 ? 285  LEU A CD1 1 
ATOM   2515 C  CD2 . LEU A 1 288 ? 53.520 42.432 4.911   1.00 23.34 ? 285  LEU A CD2 1 
ATOM   2516 N  N   . ALA A 1 289 ? 55.157 42.805 -0.548  1.00 13.96 ? 286  ALA A N   1 
ATOM   2517 C  CA  . ALA A 1 289 ? 56.273 42.805 -1.442  1.00 13.86 ? 286  ALA A CA  1 
ATOM   2518 C  C   . ALA A 1 289 ? 56.295 43.992 -2.379  1.00 14.93 ? 286  ALA A C   1 
ATOM   2519 O  O   . ALA A 1 289 ? 57.367 44.501 -2.725  1.00 15.24 ? 286  ALA A O   1 
ATOM   2520 C  CB  . ALA A 1 289 ? 56.244 41.530 -2.279  1.00 15.43 ? 286  ALA A CB  1 
ATOM   2521 N  N   . GLY A 1 290 ? 55.114 44.461 -2.791  1.00 14.63 ? 287  GLY A N   1 
ATOM   2522 C  CA  . GLY A 1 290 ? 55.086 45.640 -3.655  1.00 15.96 ? 287  GLY A CA  1 
ATOM   2523 C  C   . GLY A 1 290 ? 55.603 46.881 -2.917  1.00 14.14 ? 287  GLY A C   1 
ATOM   2524 O  O   . GLY A 1 290 ? 56.363 47.693 -3.449  1.00 14.81 ? 287  GLY A O   1 
ATOM   2525 N  N   . ALA A 1 291 ? 55.221 47.019 -1.643  1.00 14.13 ? 288  ALA A N   1 
ATOM   2526 C  CA  . ALA A 1 291 ? 55.771 48.095 -0.826  1.00 13.50 ? 288  ALA A CA  1 
ATOM   2527 C  C   . ALA A 1 291 ? 57.261 47.960 -0.635  1.00 12.98 ? 288  ALA A C   1 
ATOM   2528 O  O   . ALA A 1 291 ? 57.984 48.929 -0.741  1.00 14.20 ? 288  ALA A O   1 
ATOM   2529 C  CB  . ALA A 1 291 ? 55.078 48.123 0.551   1.00 14.71 ? 288  ALA A CB  1 
ATOM   2530 N  N   . TYR A 1 292 ? 57.743 46.752 -0.376  1.00 13.93 ? 289  TYR A N   1 
ATOM   2531 C  CA  . TYR A 1 292 ? 59.194 46.518 -0.251  1.00 13.97 ? 289  TYR A CA  1 
ATOM   2532 C  C   . TYR A 1 292 ? 59.900 47.004 -1.496  1.00 14.32 ? 289  TYR A C   1 
ATOM   2533 O  O   . TYR A 1 292 ? 60.976 47.617 -1.409  1.00 15.41 ? 289  TYR A O   1 
ATOM   2534 C  CB  . TYR A 1 292 ? 59.549 45.039 -0.013  1.00 15.50 ? 289  TYR A CB  1 
ATOM   2535 C  CG  . TYR A 1 292 ? 61.047 44.833 0.012   1.00 14.50 ? 289  TYR A CG  1 
ATOM   2536 C  CD1 . TYR A 1 292 ? 61.781 45.275 1.119   1.00 16.11 ? 289  TYR A CD1 1 
ATOM   2537 C  CD2 . TYR A 1 292 ? 61.727 44.297 -1.074  1.00 17.86 ? 289  TYR A CD2 1 
ATOM   2538 C  CE1 . TYR A 1 292 ? 63.160 45.193 1.111   1.00 17.18 ? 289  TYR A CE1 1 
ATOM   2539 C  CE2 . TYR A 1 292 ? 63.105 44.183 -1.064  1.00 18.06 ? 289  TYR A CE2 1 
ATOM   2540 C  CZ  . TYR A 1 292 ? 63.802 44.653 0.047   1.00 19.37 ? 289  TYR A CZ  1 
ATOM   2541 O  OH  . TYR A 1 292 ? 65.188 44.554 -0.005  1.00 20.60 ? 289  TYR A OH  1 
ATOM   2542 N  N   . SER A 1 293 ? 59.326 46.746 -2.680  1.00 15.11 ? 290  SER A N   1 
ATOM   2543 C  CA  . SER A 1 293 ? 60.048 47.144 -3.900  1.00 16.44 ? 290  SER A CA  1 
ATOM   2544 C  C   . SER A 1 293 ? 60.311 48.624 -3.919  1.00 15.45 ? 290  SER A C   1 
ATOM   2545 O  O   . SER A 1 293 ? 61.380 49.089 -4.356  1.00 16.45 ? 290  SER A O   1 
ATOM   2546 C  CB  . SER A 1 293 ? 59.316 46.698 -5.147  1.00 16.30 ? 290  SER A CB  1 
ATOM   2547 O  OG  . SER A 1 293 ? 58.178 47.467 -5.481  1.00 17.05 ? 290  SER A OG  1 
ATOM   2548 N  N   . VAL A 1 294 ? 59.335 49.388 -3.458  1.00 15.24 ? 291  VAL A N   1 
ATOM   2549 C  CA  . VAL A 1 294 ? 59.435 50.834 -3.378  1.00 14.51 ? 291  VAL A CA  1 
ATOM   2550 C  C   . VAL A 1 294 ? 60.345 51.288 -2.262  1.00 14.82 ? 291  VAL A C   1 
ATOM   2551 O  O   . VAL A 1 294 ? 61.121 52.242 -2.404  1.00 16.30 ? 291  VAL A O   1 
ATOM   2552 C  CB  . VAL A 1 294 ? 58.069 51.442 -3.283  1.00 14.35 ? 291  VAL A CB  1 
ATOM   2553 C  CG1 . VAL A 1 294 ? 58.132 52.951 -2.892  1.00 14.43 ? 291  VAL A CG1 1 
ATOM   2554 C  CG2 . VAL A 1 294 ? 57.352 51.316 -4.662  1.00 15.72 ? 291  VAL A CG2 1 
ATOM   2555 N  N   . ASP A 1 295 ? 60.328 50.599 -1.128  1.00 14.37 ? 292  ASP A N   1 
ATOM   2556 C  CA  . ASP A 1 295 ? 61.264 50.875 -0.061  1.00 15.35 ? 292  ASP A CA  1 
ATOM   2557 C  C   . ASP A 1 295 ? 62.716 50.760 -0.558  1.00 15.82 ? 292  ASP A C   1 
ATOM   2558 O  O   . ASP A 1 295 ? 63.548 51.617 -0.228  1.00 16.91 ? 292  ASP A O   1 
ATOM   2559 C  CB  . ASP A 1 295 ? 61.076 49.866 1.100   1.00 15.01 ? 292  ASP A CB  1 
ATOM   2560 C  CG  . ASP A 1 295 ? 59.780 50.043 1.842   1.00 15.91 ? 292  ASP A CG  1 
ATOM   2561 O  OD1 . ASP A 1 295 ? 59.159 51.116 1.764   1.00 15.45 ? 292  ASP A OD1 1 
ATOM   2562 O  OD2 . ASP A 1 295 ? 59.432 49.090 2.573   1.00 15.46 ? 292  ASP A OD2 1 
ATOM   2563 N  N   . LYS A 1 296 ? 63.029 49.687 -1.295  1.00 16.27 ? 293  LYS A N   1 
ATOM   2564 C  CA  . LYS A 1 296 ? 64.365 49.501 -1.849  1.00 17.93 ? 293  LYS A CA  1 
ATOM   2565 C  C   . LYS A 1 296 ? 64.739 50.595 -2.844  1.00 18.34 ? 293  LYS A C   1 
ATOM   2566 O  O   . LYS A 1 296 ? 65.817 51.172 -2.752  1.00 18.29 ? 293  LYS A O   1 
ATOM   2567 C  CB  . LYS A 1 296 ? 64.443 48.129 -2.507  1.00 17.58 ? 293  LYS A CB  1 
ATOM   2568 C  CG  . LYS A 1 296 ? 65.822 47.772 -3.094  1.00 20.23 ? 293  LYS A CG  1 
ATOM   2569 C  CD  . LYS A 1 296 ? 65.828 46.334 -3.577  1.00 23.73 ? 293  LYS A CD  1 
ATOM   2570 C  CE  . LYS A 1 296 ? 67.113 45.999 -4.376  1.00 33.36 ? 293  LYS A CE  1 
ATOM   2571 N  NZ  . LYS A 1 296 ? 68.272 46.006 -3.475  1.00 37.37 ? 293  LYS A NZ  1 
ATOM   2572 N  N   . HIS A 1 297 ? 63.805 50.951 -3.723  1.00 17.42 ? 294  HIS A N   1 
ATOM   2573 C  CA  . HIS A 1 297 ? 63.957 52.076 -4.637  1.00 16.84 ? 294  HIS A CA  1 
ATOM   2574 C  C   . HIS A 1 297 ? 64.302 53.359 -3.877  1.00 17.11 ? 294  HIS A C   1 
ATOM   2575 O  O   . HIS A 1 297 ? 65.281 54.052 -4.169  1.00 18.10 ? 294  HIS A O   1 
ATOM   2576 C  CB  . HIS A 1 297 ? 62.696 52.246 -5.479  1.00 18.08 ? 294  HIS A CB  1 
ATOM   2577 C  CG  . HIS A 1 297 ? 62.622 53.533 -6.243  1.00 18.05 ? 294  HIS A CG  1 
ATOM   2578 N  ND1 . HIS A 1 297 ? 63.175 53.689 -7.497  1.00 22.86 ? 294  HIS A ND1 1 
ATOM   2579 C  CD2 . HIS A 1 297 ? 62.002 54.709 -5.960  1.00 18.20 ? 294  HIS A CD2 1 
ATOM   2580 C  CE1 . HIS A 1 297 ? 62.907 54.916 -7.930  1.00 20.56 ? 294  HIS A CE1 1 
ATOM   2581 N  NE2 . HIS A 1 297 ? 62.232 55.560 -7.009  1.00 18.99 ? 294  HIS A NE2 1 
ATOM   2582 N  N   . PHE A 1 298 ? 63.522 53.673 -2.864  1.00 16.49 ? 295  PHE A N   1 
ATOM   2583 C  CA  . PHE A 1 298 ? 63.651 54.924 -2.121  1.00 17.53 ? 295  PHE A CA  1 
ATOM   2584 C  C   . PHE A 1 298 ? 64.965 54.954 -1.378  1.00 18.48 ? 295  PHE A C   1 
ATOM   2585 O  O   . PHE A 1 298 ? 65.648 55.992 -1.354  1.00 19.78 ? 295  PHE A O   1 
ATOM   2586 C  CB  . PHE A 1 298 ? 62.442 55.044 -1.146  1.00 16.35 ? 295  PHE A CB  1 
ATOM   2587 C  CG  . PHE A 1 298 ? 62.507 56.212 -0.209  1.00 17.93 ? 295  PHE A CG  1 
ATOM   2588 C  CD1 . PHE A 1 298 ? 62.611 57.518 -0.718  1.00 16.64 ? 295  PHE A CD1 1 
ATOM   2589 C  CD2 . PHE A 1 298 ? 62.454 56.030 1.151   1.00 16.75 ? 295  PHE A CD2 1 
ATOM   2590 C  CE1 . PHE A 1 298 ? 62.668 58.586 0.164   1.00 17.59 ? 295  PHE A CE1 1 
ATOM   2591 C  CE2 . PHE A 1 298 ? 62.494 57.124 2.012   1.00 15.99 ? 295  PHE A CE2 1 
ATOM   2592 C  CZ  . PHE A 1 298 ? 62.592 58.394 1.501   1.00 17.43 ? 295  PHE A CZ  1 
ATOM   2593 N  N   . LYS A 1 299 ? 65.285 53.853 -0.696  1.00 18.48 ? 296  LYS A N   1 
ATOM   2594 C  CA  . LYS A 1 299 ? 66.502 53.769 0.094   1.00 20.33 ? 296  LYS A CA  1 
ATOM   2595 C  C   . LYS A 1 299 ? 67.780 53.845 -0.727  1.00 19.72 ? 296  LYS A C   1 
ATOM   2596 O  O   . LYS A 1 299 ? 68.823 54.375 -0.255  1.00 21.04 ? 296  LYS A O   1 
ATOM   2597 C  CB  . LYS A 1 299 ? 66.491 52.474 0.931   1.00 19.46 ? 296  LYS A CB  1 
ATOM   2598 C  CG  . LYS A 1 299 ? 67.626 52.252 1.940   1.00 24.41 ? 296  LYS A CG  1 
ATOM   2599 C  CD  . LYS A 1 299 ? 67.370 50.879 2.659   1.00 27.44 ? 296  LYS A CD  1 
ATOM   2600 C  CE  . LYS A 1 299 ? 68.412 50.473 3.686   1.00 32.93 ? 296  LYS A CE  1 
ATOM   2601 N  NZ  . LYS A 1 299 ? 69.734 50.206 3.064   1.00 36.73 ? 296  LYS A NZ  1 
ATOM   2602 N  N   . GLU A 1 300 ? 67.758 53.299 -1.943  1.00 20.21 ? 297  GLU A N   1 
ATOM   2603 C  CA  . GLU A 1 300 ? 69.003 53.067 -2.700  1.00 20.84 ? 297  GLU A CA  1 
ATOM   2604 C  C   . GLU A 1 300 ? 69.228 54.020 -3.859  1.00 21.01 ? 297  GLU A C   1 
ATOM   2605 O  O   . GLU A 1 300 ? 70.389 54.110 -4.335  1.00 23.25 ? 297  GLU A O   1 
ATOM   2606 C  CB  . GLU A 1 300 ? 69.015 51.635 -3.231  1.00 20.69 ? 297  GLU A CB  1 
ATOM   2607 C  CG  . GLU A 1 300 ? 69.059 50.588 -2.166  1.00 22.19 ? 297  GLU A CG  1 
ATOM   2608 C  CD  . GLU A 1 300 ? 69.189 49.144 -2.723  1.00 26.98 ? 297  GLU A CD  1 
ATOM   2609 O  OE1 . GLU A 1 300 ? 69.058 48.915 -3.938  1.00 30.83 ? 297  GLU A OE1 1 
ATOM   2610 O  OE2 . GLU A 1 300 ? 69.379 48.244 -1.896  1.00 33.23 ? 297  GLU A OE2 1 
ATOM   2611 N  N   . THR A 1 301 ? 68.217 54.789 -4.264  1.00 21.14 ? 298  THR A N   1 
ATOM   2612 C  CA  . THR A 1 301 ? 68.302 55.523 -5.537  1.00 20.32 ? 298  THR A CA  1 
ATOM   2613 C  C   . THR A 1 301 ? 68.683 56.966 -5.319  1.00 20.67 ? 298  THR A C   1 
ATOM   2614 O  O   . THR A 1 301 ? 68.159 57.679 -4.429  1.00 21.74 ? 298  THR A O   1 
ATOM   2615 C  CB  . THR A 1 301 ? 66.973 55.440 -6.319  1.00 21.65 ? 298  THR A CB  1 
ATOM   2616 O  OG1 . THR A 1 301 ? 66.603 54.053 -6.489  1.00 21.61 ? 298  THR A OG1 1 
ATOM   2617 C  CG2 . THR A 1 301 ? 67.113 56.088 -7.725  1.00 22.82 ? 298  THR A CG2 1 
ATOM   2618 N  N   . GLU A 1 302 ? 69.666 57.420 -6.130  1.00 21.04 ? 299  GLU A N   1 
ATOM   2619 C  CA  . GLU A 1 302 ? 70.043 58.832 -6.113  1.00 23.75 ? 299  GLU A CA  1 
ATOM   2620 C  C   . GLU A 1 302 ? 68.839 59.744 -6.262  1.00 22.29 ? 299  GLU A C   1 
ATOM   2621 O  O   . GLU A 1 302 ? 67.900 59.410 -6.974  1.00 22.21 ? 299  GLU A O   1 
ATOM   2622 C  CB  . GLU A 1 302 ? 71.076 59.157 -7.219  1.00 24.74 ? 299  GLU A CB  1 
ATOM   2623 C  CG  . GLU A 1 302 ? 70.542 59.079 -8.653  1.00 28.27 ? 299  GLU A CG  1 
ATOM   2624 C  CD  . GLU A 1 302 ? 71.653 59.152 -9.672  1.00 39.53 ? 299  GLU A CD  1 
ATOM   2625 O  OE1 . GLU A 1 302 ? 72.658 59.829 -9.370  1.00 44.75 ? 299  GLU A OE1 1 
ATOM   2626 O  OE2 . GLU A 1 302 ? 71.517 58.521 -10.752 1.00 43.76 ? 299  GLU A OE2 1 
ATOM   2627 N  N   . PHE A 1 303 ? 68.850 60.894 -5.583  1.00 22.36 ? 300  PHE A N   1 
ATOM   2628 C  CA  . PHE A 1 303 ? 67.654 61.729 -5.508  1.00 21.05 ? 300  PHE A CA  1 
ATOM   2629 C  C   . PHE A 1 303 ? 67.078 62.140 -6.858  1.00 22.20 ? 300  PHE A C   1 
ATOM   2630 O  O   . PHE A 1 303 ? 65.853 62.207 -7.032  1.00 22.04 ? 300  PHE A O   1 
ATOM   2631 C  CB  . PHE A 1 303 ? 67.866 62.964 -4.662  1.00 21.23 ? 300  PHE A CB  1 
ATOM   2632 C  CG  . PHE A 1 303 ? 68.176 62.677 -3.203  1.00 23.13 ? 300  PHE A CG  1 
ATOM   2633 C  CD1 . PHE A 1 303 ? 67.809 61.477 -2.573  1.00 22.12 ? 300  PHE A CD1 1 
ATOM   2634 C  CD2 . PHE A 1 303 ? 68.769 63.664 -2.417  1.00 24.77 ? 300  PHE A CD2 1 
ATOM   2635 C  CE1 . PHE A 1 303 ? 68.092 61.280 -1.211  1.00 21.45 ? 300  PHE A CE1 1 
ATOM   2636 C  CE2 . PHE A 1 303 ? 69.081 63.424 -1.073  1.00 24.64 ? 300  PHE A CE2 1 
ATOM   2637 C  CZ  . PHE A 1 303 ? 68.709 62.253 -0.484  1.00 22.97 ? 300  PHE A CZ  1 
ATOM   2638 N  N   . SER A 1 304 ? 67.933 62.388 -7.835  1.00 23.10 ? 301  SER A N   1 
ATOM   2639 C  CA  . SER A 1 304 ? 67.446 62.826 -9.166  1.00 24.15 ? 301  SER A CA  1 
ATOM   2640 C  C   . SER A 1 304 ? 66.616 61.765 -9.921  1.00 23.60 ? 301  SER A C   1 
ATOM   2641 O  O   . SER A 1 304 ? 65.934 62.101 -10.910 1.00 25.64 ? 301  SER A O   1 
ATOM   2642 C  CB  . SER A 1 304 ? 68.634 63.217 -10.060 1.00 25.33 ? 301  SER A CB  1 
ATOM   2643 O  OG  . SER A 1 304 ? 69.411 62.082 -10.356 1.00 27.66 ? 301  SER A OG  1 
ATOM   2644 N  N   . LYS A 1 305 ? 66.636 60.518 -9.455  1.00 22.48 ? 302  LYS A N   1 
ATOM   2645 C  CA  A LYS A 1 305 ? 65.936 59.411 -10.083 0.60 22.49 ? 302  LYS A CA  1 
ATOM   2646 C  CA  B LYS A 1 305 ? 65.923 59.417 -10.084 0.40 22.22 ? 302  LYS A CA  1 
ATOM   2647 C  C   . LYS A 1 305 ? 64.998 58.695 -9.093  1.00 20.80 ? 302  LYS A C   1 
ATOM   2648 O  O   . LYS A 1 305 ? 64.537 57.588 -9.347  1.00 21.15 ? 302  LYS A O   1 
ATOM   2649 C  CB  A LYS A 1 305 ? 66.939 58.427 -10.685 0.60 23.59 ? 302  LYS A CB  1 
ATOM   2650 C  CB  B LYS A 1 305 ? 66.923 58.443 -10.700 0.40 23.07 ? 302  LYS A CB  1 
ATOM   2651 C  CG  A LYS A 1 305 ? 67.984 59.082 -11.641 0.60 27.12 ? 302  LYS A CG  1 
ATOM   2652 C  CG  B LYS A 1 305 ? 67.752 59.065 -11.836 0.40 25.07 ? 302  LYS A CG  1 
ATOM   2653 C  CD  A LYS A 1 305 ? 67.376 59.799 -12.844 0.60 29.27 ? 302  LYS A CD  1 
ATOM   2654 C  CD  B LYS A 1 305 ? 68.670 58.041 -12.457 0.40 27.12 ? 302  LYS A CD  1 
ATOM   2655 C  CE  A LYS A 1 305 ? 68.512 60.480 -13.679 0.60 33.12 ? 302  LYS A CE  1 
ATOM   2656 C  CE  B LYS A 1 305 ? 69.404 58.652 -13.645 0.40 29.61 ? 302  LYS A CE  1 
ATOM   2657 N  NZ  A LYS A 1 305 ? 68.083 61.584 -14.550 0.60 35.40 ? 302  LYS A NZ  1 
ATOM   2658 N  NZ  B LYS A 1 305 ? 68.526 59.573 -14.424 0.40 33.08 ? 302  LYS A NZ  1 
ATOM   2659 N  N   . ASN A 1 306 ? 64.723 59.360 -7.977  1.00 19.86 ? 303  ASN A N   1 
ATOM   2660 C  CA  . ASN A 1 306 ? 64.032 58.748 -6.815  1.00 18.37 ? 303  ASN A CA  1 
ATOM   2661 C  C   . ASN A 1 306 ? 62.590 59.303 -6.799  1.00 17.85 ? 303  ASN A C   1 
ATOM   2662 O  O   . ASN A 1 306 ? 62.369 60.452 -6.512  1.00 19.08 ? 303  ASN A O   1 
ATOM   2663 C  CB  . ASN A 1 306 ? 64.818 59.156 -5.580  1.00 19.16 ? 303  ASN A CB  1 
ATOM   2664 C  CG  . ASN A 1 306 ? 64.380 58.455 -4.335  1.00 19.20 ? 303  ASN A CG  1 
ATOM   2665 O  OD1 . ASN A 1 306 ? 63.163 58.400 -4.030  1.00 19.34 ? 303  ASN A OD1 1 
ATOM   2666 N  ND2 . ASN A 1 306 ? 65.359 57.962 -3.533  1.00 20.01 ? 303  ASN A ND2 1 
ATOM   2667 N  N   . ILE A 1 307 ? 61.619 58.445 -7.066  1.00 17.01 ? 304  ILE A N   1 
ATOM   2668 C  CA  . ILE A 1 307 ? 60.236 58.892 -7.305  1.00 17.29 ? 304  ILE A CA  1 
ATOM   2669 C  C   . ILE A 1 307 ? 59.660 59.626 -6.097  1.00 16.00 ? 304  ILE A C   1 
ATOM   2670 O  O   . ILE A 1 307 ? 59.174 60.739 -6.245  1.00 16.47 ? 304  ILE A O   1 
ATOM   2671 C  CB  . ILE A 1 307 ? 59.353 57.744 -7.842  1.00 16.39 ? 304  ILE A CB  1 
ATOM   2672 C  CG1 . ILE A 1 307 ? 59.816 57.311 -9.223  1.00 16.90 ? 304  ILE A CG1 1 
ATOM   2673 C  CG2 . ILE A 1 307 ? 57.892 58.245 -7.884  1.00 16.54 ? 304  ILE A CG2 1 
ATOM   2674 C  CD1 . ILE A 1 307 ? 59.217 56.018 -9.721  1.00 18.08 ? 304  ILE A CD1 1 
ATOM   2675 N  N   . PRO A 1 308 ? 59.727 59.039 -4.889  1.00 16.36 ? 305  PRO A N   1 
ATOM   2676 C  CA  . PRO A 1 308 ? 59.195 59.785 -3.739  1.00 17.05 ? 305  PRO A CA  1 
ATOM   2677 C  C   . PRO A 1 308 ? 59.856 61.125 -3.461  1.00 16.76 ? 305  PRO A C   1 
ATOM   2678 O  O   . PRO A 1 308 ? 59.205 62.070 -3.045  1.00 16.21 ? 305  PRO A O   1 
ATOM   2679 C  CB  . PRO A 1 308 ? 59.383 58.814 -2.564  1.00 16.88 ? 305  PRO A CB  1 
ATOM   2680 C  CG  . PRO A 1 308 ? 59.432 57.462 -3.202  1.00 16.98 ? 305  PRO A CG  1 
ATOM   2681 C  CD  . PRO A 1 308 ? 60.112 57.661 -4.516  1.00 16.32 ? 305  PRO A CD  1 
ATOM   2682 N  N   . VAL A 1 309 ? 61.162 61.176 -3.675  1.00 17.06 ? 306  VAL A N   1 
ATOM   2683 C  CA  . VAL A 1 309 ? 61.849 62.453 -3.505  1.00 17.98 ? 306  VAL A CA  1 
ATOM   2684 C  C   . VAL A 1 309 ? 61.335 63.503 -4.497  1.00 17.52 ? 306  VAL A C   1 
ATOM   2685 O  O   . VAL A 1 309 ? 61.071 64.645 -4.143  1.00 18.31 ? 306  VAL A O   1 
ATOM   2686 C  CB  . VAL A 1 309 ? 63.356 62.274 -3.605  1.00 19.07 ? 306  VAL A CB  1 
ATOM   2687 C  CG1 . VAL A 1 309 ? 64.050 63.660 -3.518  1.00 20.97 ? 306  VAL A CG1 1 
ATOM   2688 C  CG2 . VAL A 1 309 ? 63.832 61.359 -2.441  1.00 18.89 ? 306  VAL A CG2 1 
ATOM   2689 N  N   . ILE A 1 310 ? 61.211 63.146 -5.769  1.00 17.13 ? 307  ILE A N   1 
ATOM   2690 C  CA  . ILE A 1 310 ? 60.677 64.073 -6.769  1.00 18.39 ? 307  ILE A CA  1 
ATOM   2691 C  C   . ILE A 1 310 ? 59.230 64.465 -6.397  1.00 17.81 ? 307  ILE A C   1 
ATOM   2692 O  O   . ILE A 1 310 ? 58.861 65.627 -6.493  1.00 17.76 ? 307  ILE A O   1 
ATOM   2693 C  CB  . ILE A 1 310 ? 60.770 63.451 -8.147  1.00 19.17 ? 307  ILE A CB  1 
ATOM   2694 C  CG1 . ILE A 1 310 ? 62.228 63.179 -8.565  1.00 23.69 ? 307  ILE A CG1 1 
ATOM   2695 C  CG2 . ILE A 1 310 ? 60.095 64.355 -9.196  1.00 20.69 ? 307  ILE A CG2 1 
ATOM   2696 C  CD1 . ILE A 1 310 ? 63.056 64.321 -8.658  1.00 27.70 ? 307  ILE A CD1 1 
ATOM   2697 N  N   . MET A 1 311 ? 58.404 63.509 -5.992  1.00 16.76 ? 308  MET A N   1 
ATOM   2698 C  CA  . MET A 1 311 ? 57.036 63.843 -5.595  1.00 16.13 ? 308  MET A CA  1 
ATOM   2699 C  C   . MET A 1 311 ? 57.050 64.919 -4.500  1.00 15.85 ? 308  MET A C   1 
ATOM   2700 O  O   . MET A 1 311 ? 56.284 65.923 -4.510  1.00 16.90 ? 308  MET A O   1 
ATOM   2701 C  CB  . MET A 1 311 ? 56.314 62.585 -5.069  1.00 16.94 ? 308  MET A CB  1 
ATOM   2702 C  CG  . MET A 1 311 ? 55.975 61.588 -6.140  1.00 17.61 ? 308  MET A CG  1 
ATOM   2703 S  SD  . MET A 1 311 ? 55.504 59.959 -5.548  1.00 17.94 ? 308  MET A SD  1 
ATOM   2704 C  CE  . MET A 1 311 ? 53.836 60.264 -4.933  1.00 19.01 ? 308  MET A CE  1 
ATOM   2705 N  N   . ALA A 1 312 ? 57.902 64.672 -3.493  1.00 15.40 ? 309  ALA A N   1 
ATOM   2706 C  CA  . ALA A 1 312 ? 57.963 65.566 -2.336  1.00 16.12 ? 309  ALA A CA  1 
ATOM   2707 C  C   . ALA A 1 312 ? 58.484 66.962 -2.761  1.00 17.85 ? 309  ALA A C   1 
ATOM   2708 O  O   . ALA A 1 312 ? 57.969 68.007 -2.297  1.00 17.80 ? 309  ALA A O   1 
ATOM   2709 C  CB  . ALA A 1 312 ? 58.881 64.964 -1.256  1.00 16.17 ? 309  ALA A CB  1 
ATOM   2710 N  N   . LEU A 1 313 ? 59.556 66.989 -3.552  1.00 17.95 ? 310  LEU A N   1 
ATOM   2711 C  CA  . LEU A 1 313 ? 60.115 68.277 -3.974  1.00 18.47 ? 310  LEU A CA  1 
ATOM   2712 C  C   . LEU A 1 313 ? 59.114 69.084 -4.794  1.00 18.30 ? 310  LEU A C   1 
ATOM   2713 O  O   . LEU A 1 313 ? 58.987 70.292 -4.593  1.00 18.95 ? 310  LEU A O   1 
ATOM   2714 C  CB  . LEU A 1 313 ? 61.375 68.128 -4.816  1.00 18.67 ? 310  LEU A CB  1 
ATOM   2715 C  CG  . LEU A 1 313 ? 62.538 67.581 -3.998  1.00 19.66 ? 310  LEU A CG  1 
ATOM   2716 C  CD1 . LEU A 1 313 ? 63.686 67.149 -4.928  1.00 21.73 ? 310  LEU A CD1 1 
ATOM   2717 C  CD2 . LEU A 1 313 ? 63.038 68.693 -3.051  1.00 22.06 ? 310  LEU A CD2 1 
ATOM   2718 N  N   . LEU A 1 314 ? 58.383 68.445 -5.706  1.00 18.39 ? 311  LEU A N   1 
ATOM   2719 C  CA  . LEU A 1 314 ? 57.378 69.177 -6.485  1.00 18.37 ? 311  LEU A CA  1 
ATOM   2720 C  C   . LEU A 1 314 ? 56.331 69.750 -5.556  1.00 18.53 ? 311  LEU A C   1 
ATOM   2721 O  O   . LEU A 1 314 ? 55.955 70.918 -5.641  1.00 18.51 ? 311  LEU A O   1 
ATOM   2722 C  CB  . LEU A 1 314 ? 56.762 68.250 -7.532  1.00 18.00 ? 311  LEU A CB  1 
ATOM   2723 C  CG  . LEU A 1 314 ? 57.662 67.779 -8.651  1.00 19.77 ? 311  LEU A CG  1 
ATOM   2724 C  CD1 . LEU A 1 314 ? 57.003 66.626 -9.442  1.00 21.84 ? 311  LEU A CD1 1 
ATOM   2725 C  CD2 . LEU A 1 314 ? 58.081 68.939 -9.637  1.00 25.03 ? 311  LEU A CD2 1 
ATOM   2726 N  N   . ALA A 1 315 ? 55.787 68.920 -4.654  1.00 17.00 ? 312  ALA A N   1 
ATOM   2727 C  CA  . ALA A 1 315 ? 54.697 69.347 -3.813  1.00 17.36 ? 312  ALA A CA  1 
ATOM   2728 C  C   . ALA A 1 315 ? 55.109 70.525 -2.933  1.00 17.52 ? 312  ALA A C   1 
ATOM   2729 O  O   . ALA A 1 315 ? 54.437 71.517 -2.836  1.00 18.70 ? 312  ALA A O   1 
ATOM   2730 C  CB  . ALA A 1 315 ? 54.169 68.154 -2.965  1.00 17.58 ? 312  ALA A CB  1 
ATOM   2731 N  N   . SER A 1 316 ? 56.259 70.401 -2.271  1.00 17.26 ? 313  SER A N   1 
ATOM   2732 C  CA  . SER A 1 316 ? 56.716 71.451 -1.389  1.00 17.80 ? 313  SER A CA  1 
ATOM   2733 C  C   . SER A 1 316 ? 57.146 72.700 -2.154  1.00 19.50 ? 313  SER A C   1 
ATOM   2734 O  O   . SER A 1 316 ? 56.982 73.803 -1.654  1.00 19.81 ? 313  SER A O   1 
ATOM   2735 C  CB  . SER A 1 316 ? 57.846 70.921 -0.532  1.00 17.62 ? 313  SER A CB  1 
ATOM   2736 O  OG  . SER A 1 316 ? 57.404 69.866 0.339   1.00 19.36 ? 313  SER A OG  1 
ATOM   2737 N  N   . TYR A 1 317 ? 57.665 72.516 -3.346  1.00 19.99 ? 314  TYR A N   1 
ATOM   2738 C  CA  . TYR A 1 317 ? 57.964 73.672 -4.204  1.00 19.89 ? 314  TYR A CA  1 
ATOM   2739 C  C   . TYR A 1 317 ? 56.677 74.472 -4.452  1.00 20.08 ? 314  TYR A C   1 
ATOM   2740 O  O   . TYR A 1 317 ? 56.652 75.711 -4.290  1.00 20.08 ? 314  TYR A O   1 
ATOM   2741 C  CB  . TYR A 1 317 ? 58.593 73.220 -5.536  1.00 20.42 ? 314  TYR A CB  1 
ATOM   2742 C  CG  . TYR A 1 317 ? 58.716 74.311 -6.590  1.00 21.83 ? 314  TYR A CG  1 
ATOM   2743 C  CD1 . TYR A 1 317 ? 59.443 75.457 -6.344  1.00 23.64 ? 314  TYR A CD1 1 
ATOM   2744 C  CD2 . TYR A 1 317 ? 58.089 74.194 -7.816  1.00 22.00 ? 314  TYR A CD2 1 
ATOM   2745 C  CE1 . TYR A 1 317 ? 59.596 76.433 -7.287  1.00 24.30 ? 314  TYR A CE1 1 
ATOM   2746 C  CE2 . TYR A 1 317 ? 58.238 75.182 -8.788  1.00 23.91 ? 314  TYR A CE2 1 
ATOM   2747 C  CZ  . TYR A 1 317 ? 58.985 76.303 -8.490  1.00 22.91 ? 314  TYR A CZ  1 
ATOM   2748 O  OH  . TYR A 1 317 ? 59.119 77.310 -9.432  1.00 25.26 ? 314  TYR A OH  1 
ATOM   2749 N  N   . TYR A 1 318 ? 55.595 73.793 -4.866  1.00 19.30 ? 315  TYR A N   1 
ATOM   2750 C  CA  . TYR A 1 318 ? 54.383 74.518 -5.145  1.00 19.03 ? 315  TYR A CA  1 
ATOM   2751 C  C   . TYR A 1 318 ? 53.838 75.233 -3.920  1.00 19.38 ? 315  TYR A C   1 
ATOM   2752 O  O   . TYR A 1 318 ? 53.454 76.412 -3.987  1.00 21.59 ? 315  TYR A O   1 
ATOM   2753 C  CB  . TYR A 1 318 ? 53.352 73.568 -5.696  1.00 18.49 ? 315  TYR A CB  1 
ATOM   2754 C  CG  . TYR A 1 318 ? 53.613 73.048 -7.079  1.00 18.12 ? 315  TYR A CG  1 
ATOM   2755 C  CD1 . TYR A 1 318 ? 53.977 73.907 -8.134  1.00 20.53 ? 315  TYR A CD1 1 
ATOM   2756 C  CD2 . TYR A 1 318 ? 53.458 71.715 -7.387  1.00 17.39 ? 315  TYR A CD2 1 
ATOM   2757 C  CE1 . TYR A 1 318 ? 54.193 73.449 -9.390  1.00 20.39 ? 315  TYR A CE1 1 
ATOM   2758 C  CE2 . TYR A 1 318 ? 53.672 71.240 -8.671  1.00 20.23 ? 315  TYR A CE2 1 
ATOM   2759 C  CZ  . TYR A 1 318 ? 54.035 72.123 -9.693  1.00 19.59 ? 315  TYR A CZ  1 
ATOM   2760 O  OH  . TYR A 1 318 ? 54.234 71.686 -10.984 1.00 19.71 ? 315  TYR A OH  1 
ATOM   2761 N  N   . SER A 1 319 ? 53.813 74.511 -2.794  1.00 19.05 ? 316  SER A N   1 
ATOM   2762 C  CA  . SER A 1 319 ? 53.178 75.075 -1.614  1.00 19.31 ? 316  SER A CA  1 
ATOM   2763 C  C   . SER A 1 319 ? 53.986 76.202 -0.981  1.00 21.18 ? 316  SER A C   1 
ATOM   2764 O  O   . SER A 1 319 ? 53.402 77.069 -0.342  1.00 23.89 ? 316  SER A O   1 
ATOM   2765 C  CB  . SER A 1 319 ? 52.662 74.008 -0.639  1.00 18.84 ? 316  SER A CB  1 
ATOM   2766 O  OG  . SER A 1 319 ? 53.761 73.274 -0.041  1.00 19.73 ? 316  SER A OG  1 
ATOM   2767 N  N   . CYS A 1 320 ? 55.298 76.208 -1.240  1.00 20.05 ? 317  CYS A N   1 
ATOM   2768 C  CA  . CYS A 1 320 ? 56.200 77.321 -0.928  1.00 22.85 ? 317  CYS A CA  1 
ATOM   2769 C  C   . CYS A 1 320 ? 56.020 78.485 -1.896  1.00 24.22 ? 317  CYS A C   1 
ATOM   2770 O  O   . CYS A 1 320 ? 55.664 79.590 -1.486  1.00 29.38 ? 317  CYS A O   1 
ATOM   2771 C  CB  . CYS A 1 320 ? 57.670 76.844 -0.955  1.00 22.67 ? 317  CYS A CB  1 
ATOM   2772 S  SG  . CYS A 1 320 ? 58.862 78.176 -0.748  1.00 27.76 ? 317  CYS A SG  1 
ATOM   2773 N  N   . THR A 1 321 ? 56.271 78.240 -3.162  1.00 23.69 ? 318  THR A N   1 
ATOM   2774 C  CA  A THR A 1 321 ? 56.480 79.299 -4.125  0.70 24.49 ? 318  THR A CA  1 
ATOM   2775 C  CA  B THR A 1 321 ? 56.480 79.341 -4.117  0.30 24.13 ? 318  THR A CA  1 
ATOM   2776 C  C   . THR A 1 321 ? 55.198 79.896 -4.675  1.00 23.69 ? 318  THR A C   1 
ATOM   2777 O  O   . THR A 1 321 ? 55.118 81.104 -4.953  1.00 24.22 ? 318  THR A O   1 
ATOM   2778 C  CB  A THR A 1 321 ? 57.420 78.750 -5.210  0.70 25.25 ? 318  THR A CB  1 
ATOM   2779 C  CB  B THR A 1 321 ? 57.431 78.988 -5.307  0.30 24.69 ? 318  THR A CB  1 
ATOM   2780 O  OG1 A THR A 1 321 ? 58.612 78.304 -4.560  0.70 29.26 ? 318  THR A OG1 1 
ATOM   2781 O  OG1 B THR A 1 321 ? 56.891 77.916 -6.084  0.30 23.97 ? 318  THR A OG1 1 
ATOM   2782 C  CG2 A THR A 1 321 ? 57.816 79.790 -6.162  0.70 24.75 ? 318  THR A CG2 1 
ATOM   2783 C  CG2 B THR A 1 321 ? 58.801 78.618 -4.807  0.30 24.86 ? 318  THR A CG2 1 
ATOM   2784 N  N   . TYR A 1 322 ? 54.169 79.031 -4.828  1.00 22.83 ? 319  TYR A N   1 
ATOM   2785 C  CA  . TYR A 1 322 ? 52.888 79.465 -5.325  1.00 23.11 ? 319  TYR A CA  1 
ATOM   2786 C  C   . TYR A 1 322 ? 51.897 79.764 -4.152  1.00 22.80 ? 319  TYR A C   1 
ATOM   2787 O  O   . TYR A 1 322 ? 50.820 80.275 -4.371  1.00 23.96 ? 319  TYR A O   1 
ATOM   2788 C  CB  . TYR A 1 322 ? 52.327 78.440 -6.318  1.00 22.89 ? 319  TYR A CB  1 
ATOM   2789 C  CG  . TYR A 1 322 ? 53.064 78.386 -7.624  1.00 24.87 ? 319  TYR A CG  1 
ATOM   2790 C  CD1 . TYR A 1 322 ? 52.593 79.082 -8.724  1.00 30.72 ? 319  TYR A CD1 1 
ATOM   2791 C  CD2 . TYR A 1 322 ? 54.210 77.662 -7.769  1.00 25.11 ? 319  TYR A CD2 1 
ATOM   2792 C  CE1 . TYR A 1 322 ? 53.295 79.093 -9.923  1.00 34.31 ? 319  TYR A CE1 1 
ATOM   2793 C  CE2 . TYR A 1 322 ? 54.922 77.624 -8.932  1.00 28.60 ? 319  TYR A CE2 1 
ATOM   2794 C  CZ  . TYR A 1 322 ? 54.436 78.342 -10.041 1.00 29.38 ? 319  TYR A CZ  1 
ATOM   2795 O  OH  . TYR A 1 322 ? 55.117 78.318 -11.209 1.00 32.25 ? 319  TYR A OH  1 
ATOM   2796 N  N   . ASN A 1 323 ? 52.309 79.455 -2.921  1.00 23.08 ? 320  ASN A N   1 
ATOM   2797 C  CA  . ASN A 1 323 ? 51.489 79.623 -1.693  1.00 23.88 ? 320  ASN A CA  1 
ATOM   2798 C  C   . ASN A 1 323 ? 50.157 78.864 -1.798  1.00 22.44 ? 320  ASN A C   1 
ATOM   2799 O  O   . ASN A 1 323 ? 49.148 79.205 -1.155  1.00 23.15 ? 320  ASN A O   1 
ATOM   2800 C  CB  . ASN A 1 323 ? 51.259 81.102 -1.371  1.00 25.31 ? 320  ASN A CB  1 
ATOM   2801 C  CG  . ASN A 1 323 ? 52.543 81.847 -1.165  1.00 29.57 ? 320  ASN A CG  1 
ATOM   2802 O  OD1 . ASN A 1 323 ? 53.408 81.403 -0.411  1.00 31.12 ? 320  ASN A OD1 1 
ATOM   2803 N  ND2 . ASN A 1 323 ? 52.676 83.005 -1.833  1.00 32.19 ? 320  ASN A ND2 1 
ATOM   2804 N  N   . SER A 1 324 ? 50.167 77.819 -2.597  1.00 21.90 ? 321  SER A N   1 
ATOM   2805 C  CA  . SER A 1 324 ? 48.996 76.924 -2.659  1.00 19.07 ? 321  SER A CA  1 
ATOM   2806 C  C   . SER A 1 324 ? 48.770 76.244 -1.311  1.00 19.22 ? 321  SER A C   1 
ATOM   2807 O  O   . SER A 1 324 ? 49.711 75.993 -0.545  1.00 19.40 ? 321  SER A O   1 
ATOM   2808 C  CB  . SER A 1 324 ? 49.160 75.907 -3.768  1.00 19.31 ? 321  SER A CB  1 
ATOM   2809 O  OG  . SER A 1 324 ? 50.392 75.257 -3.724  1.00 20.41 ? 321  SER A OG  1 
ATOM   2810 N  N   . GLN A 1 325 ? 47.506 75.961 -1.018  1.00 17.35 ? 322  GLN A N   1 
ATOM   2811 C  CA  . GLN A 1 325 ? 47.075 75.406 0.262   1.00 16.63 ? 322  GLN A CA  1 
ATOM   2812 C  C   . GLN A 1 325 ? 46.348 74.059 0.127   1.00 16.58 ? 322  GLN A C   1 
ATOM   2813 O  O   . GLN A 1 325 ? 45.790 73.537 1.106   1.00 17.13 ? 322  GLN A O   1 
ATOM   2814 C  CB  . GLN A 1 325 ? 46.217 76.432 1.061   1.00 17.90 ? 322  GLN A CB  1 
ATOM   2815 C  CG  . GLN A 1 325 ? 46.898 77.701 1.334   1.00 21.14 ? 322  GLN A CG  1 
ATOM   2816 C  CD  . GLN A 1 325 ? 45.948 78.701 1.974   1.00 23.67 ? 322  GLN A CD  1 
ATOM   2817 O  OE1 . GLN A 1 325 ? 44.727 78.356 2.165   1.00 29.51 ? 322  GLN A OE1 1 
ATOM   2818 N  NE2 . GLN A 1 325 ? 46.321 79.919 1.878   1.00 27.21 ? 322  GLN A NE2 1 
ATOM   2819 N  N   . SER A 1 326 ? 46.391 73.472 -1.073  1.00 15.98 ? 323  SER A N   1 
ATOM   2820 C  CA  . SER A 1 326 ? 45.825 72.155 -1.299  1.00 15.95 ? 323  SER A CA  1 
ATOM   2821 C  C   . SER A 1 326 ? 46.456 71.472 -2.464  1.00 16.14 ? 323  SER A C   1 
ATOM   2822 O  O   . SER A 1 326 ? 47.160 72.105 -3.285  1.00 16.02 ? 323  SER A O   1 
ATOM   2823 C  CB  . SER A 1 326 ? 44.285 72.253 -1.540  1.00 17.47 ? 323  SER A CB  1 
ATOM   2824 O  OG  . SER A 1 326 ? 43.977 72.619 -2.863  1.00 17.70 ? 323  SER A OG  1 
ATOM   2825 N  N   . GLN A 1 327 ? 46.269 70.158 -2.518  1.00 15.55 ? 324  GLN A N   1 
ATOM   2826 C  CA  . GLN A 1 327 ? 46.687 69.337 -3.647  1.00 15.87 ? 324  GLN A CA  1 
ATOM   2827 C  C   . GLN A 1 327 ? 45.549 68.404 -3.976  1.00 15.82 ? 324  GLN A C   1 
ATOM   2828 O  O   . GLN A 1 327 ? 44.868 67.897 -3.052  1.00 14.98 ? 324  GLN A O   1 
ATOM   2829 C  CB  . GLN A 1 327 ? 47.873 68.461 -3.277  1.00 18.17 ? 324  GLN A CB  1 
ATOM   2830 C  CG  . GLN A 1 327 ? 49.182 69.127 -3.130  1.00 18.98 ? 324  GLN A CG  1 
ATOM   2831 C  CD  . GLN A 1 327 ? 50.232 68.136 -2.596  1.00 20.64 ? 324  GLN A CD  1 
ATOM   2832 O  OE1 . GLN A 1 327 ? 50.981 67.536 -3.371  1.00 18.96 ? 324  GLN A OE1 1 
ATOM   2833 N  NE2 . GLN A 1 327 ? 50.233 67.893 -1.252  1.00 18.28 ? 324  GLN A NE2 1 
ATOM   2834 N  N   . ALA A 1 328 ? 45.321 68.135 -5.273  1.00 14.45 ? 325  ALA A N   1 
ATOM   2835 C  CA  . ALA A 1 328 ? 44.257 67.244 -5.734  1.00 13.48 ? 325  ALA A CA  1 
ATOM   2836 C  C   . ALA A 1 328 ? 44.844 65.927 -6.212  1.00 15.15 ? 325  ALA A C   1 
ATOM   2837 O  O   . ALA A 1 328 ? 45.856 65.905 -6.920  1.00 16.14 ? 325  ALA A O   1 
ATOM   2838 C  CB  . ALA A 1 328 ? 43.488 67.922 -6.859  1.00 14.81 ? 325  ALA A CB  1 
ATOM   2839 N  N   . LEU A 1 329 ? 44.193 64.818 -5.834  1.00 13.16 ? 326  LEU A N   1 
ATOM   2840 C  CA  . LEU A 1 329 ? 44.580 63.462 -6.165  1.00 13.75 ? 326  LEU A CA  1 
ATOM   2841 C  C   . LEU A 1 329 ? 43.359 62.821 -6.835  1.00 13.87 ? 326  LEU A C   1 
ATOM   2842 O  O   . LEU A 1 329 ? 42.278 62.790 -6.249  1.00 13.29 ? 326  LEU A O   1 
ATOM   2843 C  CB  . LEU A 1 329 ? 44.941 62.721 -4.878  1.00 15.08 ? 326  LEU A CB  1 
ATOM   2844 C  CG  . LEU A 1 329 ? 45.235 61.251 -5.047  1.00 14.64 ? 326  LEU A CG  1 
ATOM   2845 C  CD1 . LEU A 1 329 ? 46.412 60.974 -5.975  1.00 17.57 ? 326  LEU A CD1 1 
ATOM   2846 C  CD2 . LEU A 1 329 ? 45.505 60.689 -3.655  1.00 18.18 ? 326  LEU A CD2 1 
ATOM   2847 N  N   . LEU A 1 330 ? 43.554 62.369 -8.061  1.00 13.55 ? 327  LEU A N   1 
ATOM   2848 C  CA  . LEU A 1 330 ? 42.481 61.957 -8.974  1.00 12.32 ? 327  LEU A CA  1 
ATOM   2849 C  C   . LEU A 1 330 ? 42.679 60.515 -9.432  1.00 14.08 ? 327  LEU A C   1 
ATOM   2850 O  O   . LEU A 1 330 ? 43.315 60.266 -10.454 1.00 13.55 ? 327  LEU A O   1 
ATOM   2851 C  CB  . LEU A 1 330 ? 42.337 62.909 -10.153 1.00 13.08 ? 327  LEU A CB  1 
ATOM   2852 C  CG  . LEU A 1 330 ? 42.350 64.410 -9.828  1.00 13.30 ? 327  LEU A CG  1 
ATOM   2853 C  CD1 . LEU A 1 330 ? 42.272 65.191 -11.168 1.00 14.38 ? 327  LEU A CD1 1 
ATOM   2854 C  CD2 . LEU A 1 330 ? 41.148 64.766 -8.920  1.00 15.64 ? 327  LEU A CD2 1 
ATOM   2855 N  N   . PRO A 1 331 ? 42.190 59.539 -8.689  1.00 12.50 ? 328  PRO A N   1 
ATOM   2856 C  CA  . PRO A 1 331 ? 42.343 58.155 -9.095  1.00 13.53 ? 328  PRO A CA  1 
ATOM   2857 C  C   . PRO A 1 331 ? 41.316 57.741 -10.112 1.00 13.20 ? 328  PRO A C   1 
ATOM   2858 O  O   . PRO A 1 331 ? 40.127 57.811 -9.853  1.00 13.90 ? 328  PRO A O   1 
ATOM   2859 C  CB  . PRO A 1 331 ? 42.186 57.366 -7.784  1.00 14.13 ? 328  PRO A CB  1 
ATOM   2860 C  CG  . PRO A 1 331 ? 42.096 58.394 -6.688  1.00 15.54 ? 328  PRO A CG  1 
ATOM   2861 C  CD  . PRO A 1 331 ? 41.644 59.655 -7.322  1.00 12.36 ? 328  PRO A CD  1 
ATOM   2862 N  N   . TYR A 1 332 ? 41.796 57.371 -11.297 1.00 12.77 ? 329  TYR A N   1 
ATOM   2863 C  CA  . TYR A 1 332 ? 40.902 56.960 -12.412 1.00 13.02 ? 329  TYR A CA  1 
ATOM   2864 C  C   . TYR A 1 332 ? 40.601 55.472 -12.368 1.00 13.71 ? 329  TYR A C   1 
ATOM   2865 O  O   . TYR A 1 332 ? 40.763 54.708 -13.352 1.00 14.46 ? 329  TYR A O   1 
ATOM   2866 C  CB  . TYR A 1 332 ? 41.505 57.421 -13.768 1.00 14.52 ? 329  TYR A CB  1 
ATOM   2867 C  CG  . TYR A 1 332 ? 41.061 58.836 -14.122 1.00 13.19 ? 329  TYR A CG  1 
ATOM   2868 C  CD1 . TYR A 1 332 ? 41.425 59.930 -13.354 1.00 13.15 ? 329  TYR A CD1 1 
ATOM   2869 C  CD2 . TYR A 1 332 ? 40.262 59.064 -15.264 1.00 13.49 ? 329  TYR A CD2 1 
ATOM   2870 C  CE1 . TYR A 1 332 ? 41.000 61.198 -13.685 1.00 13.96 ? 329  TYR A CE1 1 
ATOM   2871 C  CE2 . TYR A 1 332 ? 39.837 60.320 -15.615 1.00 15.08 ? 329  TYR A CE2 1 
ATOM   2872 C  CZ  . TYR A 1 332 ? 40.185 61.386 -14.812 1.00 13.92 ? 329  TYR A CZ  1 
ATOM   2873 O  OH  . TYR A 1 332 ? 39.753 62.653 -15.141 1.00 15.50 ? 329  TYR A OH  1 
ATOM   2874 N  N   . ASP A 1 333 ? 40.088 55.028 -11.205 1.00 13.04 ? 330  ASP A N   1 
ATOM   2875 C  CA  . ASP A 1 333 ? 39.628 53.631 -11.058 1.00 12.84 ? 330  ASP A CA  1 
ATOM   2876 C  C   . ASP A 1 333 ? 38.723 53.565 -9.861  1.00 12.63 ? 330  ASP A C   1 
ATOM   2877 O  O   . ASP A 1 333 ? 39.092 54.031 -8.774  1.00 12.97 ? 330  ASP A O   1 
ATOM   2878 C  CB  . ASP A 1 333 ? 40.820 52.671 -10.929 1.00 13.90 ? 330  ASP A CB  1 
ATOM   2879 C  CG  . ASP A 1 333 ? 40.437 51.237 -11.095 1.00 15.12 ? 330  ASP A CG  1 
ATOM   2880 O  OD1 . ASP A 1 333 ? 39.780 50.695 -10.176 1.00 14.77 ? 330  ASP A OD1 1 
ATOM   2881 O  OD2 . ASP A 1 333 ? 40.750 50.609 -12.147 1.00 15.43 ? 330  ASP A OD2 1 
ATOM   2882 N  N   . GLU A 1 334 ? 37.559 53.050 -10.083 1.00 12.40 ? 331  GLU A N   1 
ATOM   2883 C  CA  . GLU A 1 334 ? 36.523 52.865 -9.044  1.00 12.35 ? 331  GLU A CA  1 
ATOM   2884 C  C   . GLU A 1 334 ? 37.037 52.139 -7.808  1.00 12.34 ? 331  GLU A C   1 
ATOM   2885 O  O   . GLU A 1 334 ? 36.524 52.391 -6.700  1.00 12.97 ? 331  GLU A O   1 
ATOM   2886 C  CB  . GLU A 1 334 ? 35.410 52.022 -9.600  1.00 13.67 ? 331  GLU A CB  1 
ATOM   2887 C  CG  . GLU A 1 334 ? 34.499 52.720 -10.546 1.00 15.39 ? 331  GLU A CG  1 
ATOM   2888 C  CD  . GLU A 1 334 ? 33.633 53.714 -9.802  1.00 15.27 ? 331  GLU A CD  1 
ATOM   2889 O  OE1 . GLU A 1 334 ? 32.792 53.264 -8.935  1.00 15.95 ? 331  GLU A OE1 1 
ATOM   2890 O  OE2 . GLU A 1 334 ? 33.729 54.949 -9.984  1.00 16.36 ? 331  GLU A OE2 1 
ATOM   2891 N  N   . ARG A 1 335 ? 37.987 51.215 -7.984  1.00 12.23 ? 332  ARG A N   1 
ATOM   2892 C  CA  . ARG A 1 335 ? 38.469 50.431 -6.883  1.00 12.43 ? 332  ARG A CA  1 
ATOM   2893 C  C   . ARG A 1 335 ? 39.225 51.268 -5.886  1.00 13.33 ? 332  ARG A C   1 
ATOM   2894 O  O   . ARG A 1 335 ? 39.361 50.867 -4.724  1.00 13.44 ? 332  ARG A O   1 
ATOM   2895 C  CB  . ARG A 1 335 ? 39.304 49.256 -7.378  1.00 11.93 ? 332  ARG A CB  1 
ATOM   2896 C  CG  . ARG A 1 335 ? 38.483 48.252 -8.183  1.00 13.57 ? 332  ARG A CG  1 
ATOM   2897 C  CD  . ARG A 1 335 ? 39.420 47.273 -8.908  1.00 13.73 ? 332  ARG A CD  1 
ATOM   2898 N  NE  . ARG A 1 335 ? 40.157 47.893 -9.979  1.00 14.56 ? 332  ARG A NE  1 
ATOM   2899 C  CZ  . ARG A 1 335 ? 41.021 47.232 -10.721 1.00 14.28 ? 332  ARG A CZ  1 
ATOM   2900 N  NH1 . ARG A 1 335 ? 41.362 45.975 -10.467 1.00 14.92 ? 332  ARG A NH1 1 
ATOM   2901 N  NH2 . ARG A 1 335 ? 41.558 47.860 -11.771 1.00 14.73 ? 332  ARG A NH2 1 
ATOM   2902 N  N   . LEU A 1 336 ? 39.690 52.424 -6.330  1.00 12.49 ? 333  LEU A N   1 
ATOM   2903 C  CA  . LEU A 1 336 ? 40.440 53.375 -5.515  1.00 11.55 ? 333  LEU A CA  1 
ATOM   2904 C  C   . LEU A 1 336 ? 39.530 54.418 -4.873  1.00 12.07 ? 333  LEU A C   1 
ATOM   2905 O  O   . LEU A 1 336 ? 39.996 55.491 -4.430  1.00 12.75 ? 333  LEU A O   1 
ATOM   2906 C  CB  . LEU A 1 336 ? 41.586 53.982 -6.328  1.00 12.12 ? 333  LEU A CB  1 
ATOM   2907 C  CG  . LEU A 1 336 ? 42.651 53.007 -6.740  1.00 13.28 ? 333  LEU A CG  1 
ATOM   2908 C  CD1 . LEU A 1 336 ? 43.675 53.658 -7.700  1.00 14.15 ? 333  LEU A CD1 1 
ATOM   2909 C  CD2 . LEU A 1 336 ? 43.454 52.520 -5.494  1.00 14.39 ? 333  LEU A CD2 1 
ATOM   2910 N  N   . CYS A 1 337 ? 38.265 54.070 -4.623  1.00 13.17 ? 334  CYS A N   1 
ATOM   2911 C  CA  A CYS A 1 337 ? 37.354 55.034 -4.029  0.60 12.69 ? 334  CYS A CA  1 
ATOM   2912 C  CA  B CYS A 1 337 ? 37.348 55.045 -4.045  0.40 15.13 ? 334  CYS A CA  1 
ATOM   2913 C  C   . CYS A 1 337 ? 37.642 55.495 -2.595  1.00 13.81 ? 334  CYS A C   1 
ATOM   2914 O  O   . CYS A 1 337 ? 37.180 56.589 -2.239  1.00 16.01 ? 334  CYS A O   1 
ATOM   2915 C  CB  A CYS A 1 337 ? 35.932 54.556 -4.112  0.60 14.97 ? 334  CYS A CB  1 
ATOM   2916 C  CB  B CYS A 1 337 ? 35.894 54.610 -4.214  0.40 16.99 ? 334  CYS A CB  1 
ATOM   2917 S  SG  A CYS A 1 337 ? 35.595 53.021 -3.348  0.60 11.48 ? 334  CYS A SG  1 
ATOM   2918 S  SG  B CYS A 1 337 ? 35.103 53.845 -2.801  0.40 27.00 ? 334  CYS A SG  1 
ATOM   2919 N  N   . TYR A 1 338 ? 38.429 54.704 -1.833  1.00 12.31 ? 335  TYR A N   1 
ATOM   2920 C  CA  . TYR A 1 338 ? 38.851 55.146 -0.526  1.00 12.03 ? 335  TYR A CA  1 
ATOM   2921 C  C   . TYR A 1 338 ? 40.314 55.642 -0.481  1.00 11.93 ? 335  TYR A C   1 
ATOM   2922 O  O   . TYR A 1 338 ? 40.860 55.981 0.580   1.00 12.34 ? 335  TYR A O   1 
ATOM   2923 C  CB  . TYR A 1 338 ? 38.677 54.054 0.533   1.00 11.72 ? 335  TYR A CB  1 
ATOM   2924 C  CG  . TYR A 1 338 ? 37.274 53.615 0.803   1.00 13.72 ? 335  TYR A CG  1 
ATOM   2925 C  CD1 . TYR A 1 338 ? 36.451 54.387 1.508   1.00 19.05 ? 335  TYR A CD1 1 
ATOM   2926 C  CD2 . TYR A 1 338 ? 36.853 52.442 0.370   1.00 14.87 ? 335  TYR A CD2 1 
ATOM   2927 C  CE1 . TYR A 1 338 ? 35.143 53.925 1.830   1.00 23.41 ? 335  TYR A CE1 1 
ATOM   2928 C  CE2 . TYR A 1 338 ? 35.564 51.976 0.608   1.00 18.07 ? 335  TYR A CE2 1 
ATOM   2929 C  CZ  . TYR A 1 338 ? 34.736 52.719 1.332   1.00 24.38 ? 335  TYR A CZ  1 
ATOM   2930 O  OH  . TYR A 1 338 ? 33.457 52.246 1.581   1.00 28.83 ? 335  TYR A OH  1 
ATOM   2931 N  N   . PHE A 1 339 ? 41.001 55.683 -1.600  1.00 12.15 ? 336  PHE A N   1 
ATOM   2932 C  CA  . PHE A 1 339 ? 42.403 56.019 -1.657  1.00 12.17 ? 336  PHE A CA  1 
ATOM   2933 C  C   . PHE A 1 339 ? 42.660 57.467 -1.256  1.00 12.62 ? 336  PHE A C   1 
ATOM   2934 O  O   . PHE A 1 339 ? 43.570 57.721 -0.500  1.00 13.37 ? 336  PHE A O   1 
ATOM   2935 C  CB  . PHE A 1 339 ? 42.941 55.684 -3.050  1.00 13.94 ? 336  PHE A CB  1 
ATOM   2936 C  CG  . PHE A 1 339 ? 44.412 55.772 -3.193  1.00 15.04 ? 336  PHE A CG  1 
ATOM   2937 C  CD1 . PHE A 1 339 ? 45.245 54.827 -2.620  1.00 15.91 ? 336  PHE A CD1 1 
ATOM   2938 C  CD2 . PHE A 1 339 ? 44.960 56.767 -3.949  1.00 17.52 ? 336  PHE A CD2 1 
ATOM   2939 C  CE1 . PHE A 1 339 ? 46.624 54.911 -2.745  1.00 17.48 ? 336  PHE A CE1 1 
ATOM   2940 C  CE2 . PHE A 1 339 ? 46.345 56.858 -4.118  1.00 18.73 ? 336  PHE A CE2 1 
ATOM   2941 C  CZ  . PHE A 1 339 ? 47.158 55.927 -3.498  1.00 18.01 ? 336  PHE A CZ  1 
ATOM   2942 N  N   . VAL A 1 340 ? 41.925 58.421 -1.798  1.00 12.67 ? 337  VAL A N   1 
ATOM   2943 C  CA  . VAL A 1 340 ? 42.044 59.806 -1.312  1.00 13.30 ? 337  VAL A CA  1 
ATOM   2944 C  C   . VAL A 1 340 ? 41.838 59.916 0.204   1.00 12.57 ? 337  VAL A C   1 
ATOM   2945 O  O   . VAL A 1 340 ? 42.637 60.504 0.896   1.00 13.11 ? 337  VAL A O   1 
ATOM   2946 C  CB  . VAL A 1 340 ? 41.113 60.761 -2.059  1.00 13.24 ? 337  VAL A CB  1 
ATOM   2947 C  CG1 . VAL A 1 340 ? 41.097 62.147 -1.406  1.00 15.94 ? 337  VAL A CG1 1 
ATOM   2948 C  CG2 . VAL A 1 340 ? 41.485 60.819 -3.581  1.00 15.24 ? 337  VAL A CG2 1 
ATOM   2949 N  N   . ASP A 1 341 ? 40.769 59.289 0.743   1.00 12.91 ? 338  ASP A N   1 
ATOM   2950 C  CA  A ASP A 1 341 ? 40.512 59.357 2.175   0.60 13.02 ? 338  ASP A CA  1 
ATOM   2951 C  CA  B ASP A 1 341 ? 40.508 59.362 2.182   0.40 12.94 ? 338  ASP A CA  1 
ATOM   2952 C  C   . ASP A 1 341 ? 41.722 58.844 2.968   1.00 12.74 ? 338  ASP A C   1 
ATOM   2953 O  O   . ASP A 1 341 ? 42.107 59.419 4.003   1.00 12.87 ? 338  ASP A O   1 
ATOM   2954 C  CB  A ASP A 1 341 ? 39.303 58.532 2.516   0.60 14.93 ? 338  ASP A CB  1 
ATOM   2955 C  CB  B ASP A 1 341 ? 39.280 58.556 2.572   0.40 14.46 ? 338  ASP A CB  1 
ATOM   2956 C  CG  A ASP A 1 341 ? 38.005 59.195 2.133   0.60 19.44 ? 338  ASP A CG  1 
ATOM   2957 C  CG  B ASP A 1 341 ? 38.029 58.945 1.791   0.40 16.80 ? 338  ASP A CG  1 
ATOM   2958 O  OD1 A ASP A 1 341 ? 38.034 60.387 1.811   0.60 20.13 ? 338  ASP A OD1 1 
ATOM   2959 O  OD1 B ASP A 1 341 ? 37.088 59.481 2.426   0.40 18.95 ? 338  ASP A OD1 1 
ATOM   2960 O  OD2 A ASP A 1 341 ? 36.982 58.491 2.219   0.60 19.89 ? 338  ASP A OD2 1 
ATOM   2961 O  OD2 B ASP A 1 341 ? 38.005 58.707 0.569   0.40 18.57 ? 338  ASP A OD2 1 
ATOM   2962 N  N   . TYR A 1 342 ? 42.279 57.719 2.521   1.00 10.89 ? 339  TYR A N   1 
ATOM   2963 C  CA  . TYR A 1 342 ? 43.420 57.090 3.153   1.00 11.16 ? 339  TYR A CA  1 
ATOM   2964 C  C   . TYR A 1 342 ? 44.616 57.994 3.181   1.00 12.01 ? 339  TYR A C   1 
ATOM   2965 O  O   . TYR A 1 342 ? 45.258 58.165 4.206   1.00 12.74 ? 339  TYR A O   1 
ATOM   2966 C  CB  . TYR A 1 342 ? 43.730 55.732 2.481   1.00 11.48 ? 339  TYR A CB  1 
ATOM   2967 C  CG  . TYR A 1 342 ? 44.923 55.098 3.164   1.00 12.29 ? 339  TYR A CG  1 
ATOM   2968 C  CD1 . TYR A 1 342 ? 44.782 54.404 4.378   1.00 13.19 ? 339  TYR A CD1 1 
ATOM   2969 C  CD2 . TYR A 1 342 ? 46.181 55.237 2.634   1.00 13.34 ? 339  TYR A CD2 1 
ATOM   2970 C  CE1 . TYR A 1 342 ? 45.899 53.852 5.008   1.00 12.90 ? 339  TYR A CE1 1 
ATOM   2971 C  CE2 . TYR A 1 342 ? 47.303 54.682 3.263   1.00 13.40 ? 339  TYR A CE2 1 
ATOM   2972 C  CZ  . TYR A 1 342 ? 47.128 54.011 4.432   1.00 12.65 ? 339  TYR A CZ  1 
ATOM   2973 O  OH  . TYR A 1 342 ? 48.179 53.430 5.111   1.00 14.66 ? 339  TYR A OH  1 
ATOM   2974 N  N   . LEU A 1 343 ? 44.944 58.556 2.042   1.00 12.60 ? 340  LEU A N   1 
ATOM   2975 C  CA  . LEU A 1 343 ? 46.132 59.450 1.905   1.00 13.78 ? 340  LEU A CA  1 
ATOM   2976 C  C   . LEU A 1 343 ? 45.860 60.773 2.590   1.00 14.46 ? 340  LEU A C   1 
ATOM   2977 O  O   . LEU A 1 343 ? 46.820 61.417 3.078   1.00 15.61 ? 340  LEU A O   1 
ATOM   2978 C  CB  . LEU A 1 343 ? 46.636 59.570 0.496   1.00 15.33 ? 340  LEU A CB  1 
ATOM   2979 C  CG  . LEU A 1 343 ? 47.267 58.300 -0.029  1.00 16.22 ? 340  LEU A CG  1 
ATOM   2980 C  CD1 . LEU A 1 343 ? 47.757 58.599 -1.422  1.00 20.43 ? 340  LEU A CD1 1 
ATOM   2981 C  CD2 . LEU A 1 343 ? 48.404 57.691 0.774   1.00 17.46 ? 340  LEU A CD2 1 
ATOM   2982 N  N   . GLN A 1 344 ? 44.632 61.244 2.643   1.00 13.49 ? 341  GLN A N   1 
ATOM   2983 C  CA  A GLN A 1 344 ? 44.316 62.404 3.404   0.60 15.78 ? 341  GLN A CA  1 
ATOM   2984 C  CA  B GLN A 1 344 ? 44.241 62.424 3.446   0.40 15.08 ? 341  GLN A CA  1 
ATOM   2985 C  C   . GLN A 1 344 ? 44.733 62.243 4.872   1.00 15.33 ? 341  GLN A C   1 
ATOM   2986 O  O   . GLN A 1 344 ? 45.371 63.104 5.458   1.00 16.14 ? 341  GLN A O   1 
ATOM   2987 C  CB  A GLN A 1 344 ? 42.882 62.674 3.243   0.60 15.94 ? 341  GLN A CB  1 
ATOM   2988 C  CB  B GLN A 1 344 ? 42.730 62.704 3.432   0.40 15.28 ? 341  GLN A CB  1 
ATOM   2989 C  CG  A GLN A 1 344 ? 42.459 63.930 3.777   0.60 17.59 ? 341  GLN A CG  1 
ATOM   2990 C  CG  B GLN A 1 344 ? 42.234 63.430 2.176   0.40 14.87 ? 341  GLN A CG  1 
ATOM   2991 C  CD  A GLN A 1 344 ? 40.993 64.045 3.580   0.60 18.35 ? 341  GLN A CD  1 
ATOM   2992 C  CD  B GLN A 1 344 ? 40.716 63.661 2.136   0.40 15.03 ? 341  GLN A CD  1 
ATOM   2993 O  OE1 A GLN A 1 344 ? 40.238 63.279 4.181   0.60 19.09 ? 341  GLN A OE1 1 
ATOM   2994 O  OE1 B GLN A 1 344 ? 39.916 62.758 2.420   0.40 15.56 ? 341  GLN A OE1 1 
ATOM   2995 N  NE2 A GLN A 1 344 ? 40.555 64.932 2.673   0.60 18.16 ? 341  GLN A NE2 1 
ATOM   2996 N  NE2 B GLN A 1 344 ? 40.301 64.887 1.780   0.40 13.78 ? 341  GLN A NE2 1 
ATOM   2997 N  N   . GLN A 1 345 ? 44.443 61.090 5.482   1.00 14.47 ? 342  GLN A N   1 
ATOM   2998 C  CA  . GLN A 1 345 ? 44.950 60.813 6.766   1.00 14.13 ? 342  GLN A CA  1 
ATOM   2999 C  C   . GLN A 1 345 ? 46.475 60.737 6.795   1.00 14.70 ? 342  GLN A C   1 
ATOM   3000 O  O   . GLN A 1 345 ? 47.113 61.402 7.636   1.00 15.19 ? 342  GLN A O   1 
ATOM   3001 C  CB  . GLN A 1 345 ? 44.330 59.496 7.277   1.00 14.18 ? 342  GLN A CB  1 
ATOM   3002 C  CG  . GLN A 1 345 ? 44.909 59.069 8.592   1.00 13.97 ? 342  GLN A CG  1 
ATOM   3003 C  CD  . GLN A 1 345 ? 44.152 57.961 9.340   1.00 17.81 ? 342  GLN A CD  1 
ATOM   3004 O  OE1 . GLN A 1 345 ? 43.187 57.371 8.847   1.00 17.73 ? 342  GLN A OE1 1 
ATOM   3005 N  NE2 . GLN A 1 345 ? 44.611 57.708 10.549  1.00 18.71 ? 342  GLN A NE2 1 
ATOM   3006 N  N   . ALA A 1 346 ? 47.045 59.891 5.931   1.00 12.91 ? 343  ALA A N   1 
ATOM   3007 C  CA  . ALA A 1 346 ? 48.513 59.717 5.996   1.00 13.78 ? 343  ALA A CA  1 
ATOM   3008 C  C   . ALA A 1 346 ? 49.245 61.031 5.873   1.00 14.33 ? 343  ALA A C   1 
ATOM   3009 O  O   . ALA A 1 346 ? 50.231 61.282 6.591   1.00 15.51 ? 343  ALA A O   1 
ATOM   3010 C  CB  . ALA A 1 346 ? 49.011 58.782 4.921   1.00 13.58 ? 343  ALA A CB  1 
ATOM   3011 N  N   . ASP A 1 347 ? 48.809 61.868 4.944   1.00 13.75 ? 344  ASP A N   1 
ATOM   3012 C  CA  . ASP A 1 347 ? 49.498 63.141 4.643   1.00 13.53 ? 344  ASP A CA  1 
ATOM   3013 C  C   . ASP A 1 347 ? 49.170 64.174 5.709   1.00 14.50 ? 344  ASP A C   1 
ATOM   3014 O  O   . ASP A 1 347 ? 50.074 64.658 6.401   1.00 14.98 ? 344  ASP A O   1 
ATOM   3015 C  CB  . ASP A 1 347 ? 49.070 63.579 3.247   1.00 13.51 ? 344  ASP A CB  1 
ATOM   3016 C  CG  . ASP A 1 347 ? 49.783 64.748 2.731   1.00 17.43 ? 344  ASP A CG  1 
ATOM   3017 O  OD1 . ASP A 1 347 ? 50.516 65.397 3.462   1.00 18.11 ? 344  ASP A OD1 1 
ATOM   3018 O  OD2 . ASP A 1 347 ? 49.621 65.016 1.526   1.00 18.00 ? 344  ASP A OD2 1 
ATOM   3019 N  N   . MET A 1 348 ? 47.902 64.552 5.846   1.00 13.93 ? 345  MET A N   1 
ATOM   3020 C  CA  . MET A 1 348 ? 47.560 65.713 6.710   1.00 13.97 ? 345  MET A CA  1 
ATOM   3021 C  C   . MET A 1 348 ? 47.848 65.448 8.169   1.00 15.37 ? 345  MET A C   1 
ATOM   3022 O  O   . MET A 1 348 ? 48.211 66.376 8.911   1.00 15.11 ? 345  MET A O   1 
ATOM   3023 C  CB  . MET A 1 348 ? 46.084 66.079 6.519   1.00 13.93 ? 345  MET A CB  1 
ATOM   3024 C  CG  . MET A 1 348 ? 45.821 66.512 5.105   1.00 13.61 ? 345  MET A CG  1 
ATOM   3025 S  SD  . MET A 1 348 ? 44.104 66.993 4.773   1.00 16.26 ? 345  MET A SD  1 
ATOM   3026 C  CE  . MET A 1 348 ? 43.864 68.329 5.664   1.00 17.96 ? 345  MET A CE  1 
ATOM   3027 N  N   . GLU A 1 349 ? 47.602 64.233 8.639   1.00 14.16 ? 346  GLU A N   1 
ATOM   3028 C  CA  . GLU A 1 349 ? 47.903 63.943 10.040  1.00 14.44 ? 346  GLU A CA  1 
ATOM   3029 C  C   . GLU A 1 349 ? 49.428 63.920 10.275  1.00 15.47 ? 346  GLU A C   1 
ATOM   3030 O  O   . GLU A 1 349 ? 49.885 64.236 11.377  1.00 16.65 ? 346  GLU A O   1 
ATOM   3031 C  CB  . GLU A 1 349 ? 47.286 62.618 10.488  1.00 15.69 ? 346  GLU A CB  1 
ATOM   3032 C  CG  . GLU A 1 349 ? 47.261 62.497 11.973  1.00 16.73 ? 346  GLU A CG  1 
ATOM   3033 C  CD  . GLU A 1 349 ? 46.745 61.165 12.450  1.00 21.21 ? 346  GLU A CD  1 
ATOM   3034 O  OE1 . GLU A 1 349 ? 46.495 60.262 11.616  1.00 19.91 ? 346  GLU A OE1 1 
ATOM   3035 O  OE2 . GLU A 1 349 ? 46.765 60.987 13.674  1.00 24.43 ? 346  GLU A OE2 1 
ATOM   3036 N  N   . SER A 1 350 ? 50.217 63.537 9.297   1.00 13.94 ? 347  SER A N   1 
ATOM   3037 C  CA  . SER A 1 350 ? 51.642 63.603 9.453   1.00 13.76 ? 347  SER A CA  1 
ATOM   3038 C  C   . SER A 1 350 ? 52.189 65.003 9.467   1.00 14.28 ? 347  SER A C   1 
ATOM   3039 O  O   . SER A 1 350 ? 53.025 65.362 10.319  1.00 15.05 ? 347  SER A O   1 
ATOM   3040 C  CB  . SER A 1 350 ? 52.374 62.779 8.388   1.00 14.16 ? 347  SER A CB  1 
ATOM   3041 O  OG  . SER A 1 350 ? 51.994 61.401 8.420   1.00 14.78 ? 347  SER A OG  1 
ATOM   3042 N  N   . ASN A 1 351 ? 51.834 65.759 8.445   1.00 15.01 ? 348  ASN A N   1 
ATOM   3043 C  CA  . ASN A 1 351 ? 52.542 67.012 8.172   1.00 14.87 ? 348  ASN A CA  1 
ATOM   3044 C  C   . ASN A 1 351 ? 51.770 68.297 8.539   1.00 15.13 ? 348  ASN A C   1 
ATOM   3045 O  O   . ASN A 1 351 ? 52.321 69.417 8.343   1.00 15.80 ? 348  ASN A O   1 
ATOM   3046 C  CB  . ASN A 1 351 ? 53.050 67.017 6.749   1.00 15.43 ? 348  ASN A CB  1 
ATOM   3047 C  CG  . ASN A 1 351 ? 54.181 65.995 6.539   1.00 17.44 ? 348  ASN A CG  1 
ATOM   3048 O  OD1 . ASN A 1 351 ? 54.765 65.542 7.519   1.00 17.65 ? 348  ASN A OD1 1 
ATOM   3049 N  ND2 . ASN A 1 351 ? 54.532 65.688 5.279   1.00 14.94 ? 348  ASN A ND2 1 
ATOM   3050 N  N   . GLY A 1 352 ? 50.595 68.160 9.157   1.00 14.65 ? 349  GLY A N   1 
ATOM   3051 C  CA  . GLY A 1 352 ? 49.912 69.275 9.782   1.00 14.68 ? 349  GLY A CA  1 
ATOM   3052 C  C   . GLY A 1 352 ? 50.470 69.627 11.149  1.00 15.71 ? 349  GLY A C   1 
ATOM   3053 O  O   . GLY A 1 352 ? 49.900 69.256 12.153  1.00 16.38 ? 349  GLY A O   1 
ATOM   3054 N  N   . LYS A 1 353 ? 51.612 70.301 11.141  1.00 16.35 ? 350  LYS A N   1 
ATOM   3055 C  CA  . LYS A 1 353 ? 52.438 70.591 12.299  1.00 17.10 ? 350  LYS A CA  1 
ATOM   3056 C  C   . LYS A 1 353 ? 52.940 72.025 12.200  1.00 16.96 ? 350  LYS A C   1 
ATOM   3057 O  O   . LYS A 1 353 ? 53.258 72.492 11.091  1.00 19.98 ? 350  LYS A O   1 
ATOM   3058 C  CB  . LYS A 1 353 ? 53.648 69.652 12.339  1.00 16.93 ? 350  LYS A CB  1 
ATOM   3059 C  CG  . LYS A 1 353 ? 53.346 68.190 12.283  1.00 16.72 ? 350  LYS A CG  1 
ATOM   3060 C  CD  . LYS A 1 353 ? 52.639 67.702 13.543  1.00 15.86 ? 350  LYS A CD  1 
ATOM   3061 C  CE  . LYS A 1 353 ? 51.954 66.359 13.340  1.00 16.04 ? 350  LYS A CE  1 
ATOM   3062 N  NZ  . LYS A 1 353 ? 52.926 65.211 13.066  1.00 16.05 ? 350  LYS A NZ  1 
ATOM   3063 N  N   . SER A 1 354 ? 52.965 72.706 13.338  1.00 17.39 ? 351  SER A N   1 
ATOM   3064 C  CA  . SER A 1 354 ? 53.325 74.134 13.363  1.00 19.33 ? 351  SER A CA  1 
ATOM   3065 C  C   . SER A 1 354 ? 54.694 74.395 13.966  1.00 20.47 ? 351  SER A C   1 
ATOM   3066 O  O   . SER A 1 354 ? 55.162 75.547 13.940  1.00 21.15 ? 351  SER A O   1 
ATOM   3067 C  CB  . SER A 1 354 ? 52.252 74.900 14.136  1.00 20.20 ? 351  SER A CB  1 
ATOM   3068 O  OG  . SER A 1 354 ? 51.104 75.107 13.304  1.00 23.53 ? 351  SER A OG  1 
ATOM   3069 N  N   . VAL A 1 355 ? 55.281 73.379 14.612  1.00 19.60 ? 352  VAL A N   1 
ATOM   3070 C  CA  . VAL A 1 355 ? 56.608 73.499 15.193  1.00 20.23 ? 352  VAL A CA  1 
ATOM   3071 C  C   . VAL A 1 355 ? 57.557 72.518 14.565  1.00 20.40 ? 352  VAL A C   1 
ATOM   3072 O  O   . VAL A 1 355 ? 57.165 71.465 14.071  1.00 19.75 ? 352  VAL A O   1 
ATOM   3073 C  CB  . VAL A 1 355 ? 56.620 73.324 16.729  1.00 20.15 ? 352  VAL A CB  1 
ATOM   3074 C  CG1 . VAL A 1 355 ? 55.687 74.340 17.417  1.00 22.62 ? 352  VAL A CG1 1 
ATOM   3075 C  CG2 . VAL A 1 355 ? 56.266 71.894 17.160  1.00 21.30 ? 352  VAL A CG2 1 
ATOM   3076 N  N   . ASN A 1 356 ? 58.835 72.898 14.573  1.00 21.30 ? 353  ASN A N   1 
ATOM   3077 C  CA  . ASN A 1 356 ? 59.897 72.029 14.107  1.00 20.56 ? 353  ASN A CA  1 
ATOM   3078 C  C   . ASN A 1 356 ? 60.343 71.039 15.190  1.00 21.12 ? 353  ASN A C   1 
ATOM   3079 O  O   . ASN A 1 356 ? 59.773 70.997 16.295  1.00 20.79 ? 353  ASN A O   1 
ATOM   3080 C  CB  . ASN A 1 356 ? 61.053 72.818 13.523  1.00 20.34 ? 353  ASN A CB  1 
ATOM   3081 C  CG  . ASN A 1 356 ? 61.708 73.715 14.522  1.00 23.00 ? 353  ASN A CG  1 
ATOM   3082 O  OD1 . ASN A 1 356 ? 61.671 73.467 15.742  1.00 23.62 ? 353  ASN A OD1 1 
ATOM   3083 N  ND2 . ASN A 1 356 ? 62.459 74.725 14.005  1.00 24.81 ? 353  ASN A ND2 1 
ATOM   3084 N  N   . ILE A 1 357 ? 61.326 70.217 14.850  1.00 21.77 ? 354  ILE A N   1 
ATOM   3085 C  CA  . ILE A 1 357 ? 61.802 69.181 15.772  1.00 22.94 ? 354  ILE A CA  1 
ATOM   3086 C  C   . ILE A 1 357 ? 62.246 69.780 17.088  1.00 22.90 ? 354  ILE A C   1 
ATOM   3087 O  O   . ILE A 1 357 ? 62.032 69.156 18.111  1.00 23.46 ? 354  ILE A O   1 
ATOM   3088 C  CB  . ILE A 1 357 ? 62.947 68.380 15.145  1.00 23.45 ? 354  ILE A CB  1 
ATOM   3089 C  CG1 . ILE A 1 357 ? 62.452 67.600 13.917  1.00 26.32 ? 354  ILE A CG1 1 
ATOM   3090 C  CG2 . ILE A 1 357 ? 63.615 67.454 16.154  1.00 25.27 ? 354  ILE A CG2 1 
ATOM   3091 C  CD1 . ILE A 1 357 ? 61.429 66.643 14.213  1.00 27.30 ? 354  ILE A CD1 1 
ATOM   3092 N  N   . ALA A 1 358 ? 62.818 70.988 17.055  1.00 22.42 ? 355  ALA A N   1 
ATOM   3093 C  CA  . ALA A 1 358 ? 63.288 71.686 18.247  1.00 24.25 ? 355  ALA A CA  1 
ATOM   3094 C  C   . ALA A 1 358 ? 62.154 72.350 19.030  1.00 24.50 ? 355  ALA A C   1 
ATOM   3095 O  O   . ALA A 1 358 ? 62.443 72.954 20.086  1.00 27.10 ? 355  ALA A O   1 
ATOM   3096 C  CB  . ALA A 1 358 ? 64.372 72.705 17.872  1.00 26.24 ? 355  ALA A CB  1 
ATOM   3097 N  N   . GLY A 1 359 ? 60.913 72.303 18.544  1.00 23.96 ? 356  GLY A N   1 
ATOM   3098 C  CA  . GLY A 1 359 ? 59.793 72.932 19.237  1.00 24.26 ? 356  GLY A CA  1 
ATOM   3099 C  C   . GLY A 1 359 ? 59.565 74.397 18.876  1.00 24.94 ? 356  GLY A C   1 
ATOM   3100 O  O   . GLY A 1 359 ? 58.720 75.039 19.501  1.00 28.07 ? 356  GLY A O   1 
ATOM   3101 N  N   . GLU A 1 360 ? 60.289 74.915 17.880  1.00 24.51 ? 357  GLU A N   1 
ATOM   3102 C  CA  . GLU A 1 360 ? 60.146 76.291 17.481  1.00 24.63 ? 357  GLU A CA  1 
ATOM   3103 C  C   . GLU A 1 360 ? 58.998 76.434 16.501  1.00 24.12 ? 357  GLU A C   1 
ATOM   3104 O  O   . GLU A 1 360 ? 58.867 75.626 15.575  1.00 24.10 ? 357  GLU A O   1 
ATOM   3105 C  CB  . GLU A 1 360 ? 61.433 76.781 16.801  1.00 25.62 ? 357  GLU A CB  1 
ATOM   3106 C  CG  . GLU A 1 360 ? 62.676 76.644 17.696  1.00 28.11 ? 357  GLU A CG  1 
ATOM   3107 C  CD  . GLU A 1 360 ? 63.987 76.765 16.964  1.00 31.56 ? 357  GLU A CD  1 
ATOM   3108 O  OE1 . GLU A 1 360 ? 64.103 76.467 15.767  1.00 30.80 ? 357  GLU A OE1 1 
ATOM   3109 O  OE2 . GLU A 1 360 ? 64.983 77.204 17.630  1.00 39.42 ? 357  GLU A OE2 1 
ATOM   3110 N  N   . THR A 1 361 ? 58.201 77.480 16.651  1.00 23.12 ? 358  THR A N   1 
ATOM   3111 C  CA  . THR A 1 361 ? 57.129 77.770 15.717  1.00 24.17 ? 358  THR A CA  1 
ATOM   3112 C  C   . THR A 1 361 ? 57.772 78.131 14.369  1.00 23.73 ? 358  THR A C   1 
ATOM   3113 O  O   . THR A 1 361 ? 58.618 79.070 14.292  1.00 26.38 ? 358  THR A O   1 
ATOM   3114 C  CB  . THR A 1 361 ? 56.247 78.914 16.241  1.00 24.39 ? 358  THR A CB  1 
ATOM   3115 O  OG1 . THR A 1 361 ? 55.622 78.509 17.468  1.00 29.48 ? 358  THR A OG1 1 
ATOM   3116 C  CG2 . THR A 1 361 ? 55.141 79.252 15.191  1.00 25.44 ? 358  THR A CG2 1 
ATOM   3117 N  N   . VAL A 1 362 ? 57.386 77.463 13.301  1.00 23.09 ? 359  VAL A N   1 
ATOM   3118 C  CA  . VAL A 1 362 ? 58.026 77.665 11.997  1.00 23.92 ? 359  VAL A CA  1 
ATOM   3119 C  C   . VAL A 1 362 ? 57.384 78.849 11.279  1.00 24.64 ? 359  VAL A C   1 
ATOM   3120 O  O   . VAL A 1 362 ? 56.200 79.106 11.440  1.00 24.63 ? 359  VAL A O   1 
ATOM   3121 C  CB  . VAL A 1 362 ? 58.034 76.409 11.087  1.00 24.01 ? 359  VAL A CB  1 
ATOM   3122 C  CG1 . VAL A 1 362 ? 58.823 75.261 11.782  1.00 26.38 ? 359  VAL A CG1 1 
ATOM   3123 C  CG2 . VAL A 1 362 ? 56.606 75.946 10.688  1.00 23.11 ? 359  VAL A CG2 1 
ATOM   3124 N  N   . ASN A 1 363 ? 58.182 79.589 10.501  1.00 25.82 ? 360  ASN A N   1 
ATOM   3125 C  CA  A ASN A 1 363 ? 57.630 80.757 9.800   0.60 26.02 ? 360  ASN A CA  1 
ATOM   3126 C  CA  B ASN A 1 363 ? 57.671 80.770 9.816   0.40 26.58 ? 360  ASN A CA  1 
ATOM   3127 C  C   . ASN A 1 363 ? 57.298 80.513 8.358   1.00 26.89 ? 360  ASN A C   1 
ATOM   3128 O  O   . ASN A 1 363 ? 57.102 81.455 7.582   1.00 30.53 ? 360  ASN A O   1 
ATOM   3129 C  CB  A ASN A 1 363 ? 58.552 81.987 9.902   0.60 27.80 ? 360  ASN A CB  1 
ATOM   3130 C  CB  B ASN A 1 363 ? 58.686 81.929 9.928   0.40 28.38 ? 360  ASN A CB  1 
ATOM   3131 C  CG  A ASN A 1 363 ? 59.948 81.726 9.371   0.60 31.27 ? 360  ASN A CG  1 
ATOM   3132 C  CG  B ASN A 1 363 ? 58.717 82.570 11.335  0.40 31.63 ? 360  ASN A CG  1 
ATOM   3133 O  OD1 A ASN A 1 363 ? 60.203 80.745 8.697   0.60 33.92 ? 360  ASN A OD1 1 
ATOM   3134 O  OD1 B ASN A 1 363 ? 57.725 82.545 12.071  0.40 36.65 ? 360  ASN A OD1 1 
ATOM   3135 N  ND2 A ASN A 1 363 ? 60.886 82.632 9.699   0.60 32.82 ? 360  ASN A ND2 1 
ATOM   3136 N  ND2 B ASN A 1 363 ? 59.831 83.177 11.677  0.40 36.87 ? 360  ASN A ND2 1 
ATOM   3137 N  N   . TYR A 1 364 ? 57.139 79.243 7.990   1.00 23.04 ? 361  TYR A N   1 
ATOM   3138 C  CA  . TYR A 1 364 ? 56.761 78.828 6.659   1.00 21.80 ? 361  TYR A CA  1 
ATOM   3139 C  C   . TYR A 1 364 ? 55.610 77.836 6.820   1.00 21.25 ? 361  TYR A C   1 
ATOM   3140 O  O   . TYR A 1 364 ? 55.457 77.150 7.827   1.00 20.97 ? 361  TYR A O   1 
ATOM   3141 C  CB  . TYR A 1 364 ? 57.892 78.145 5.892   1.00 21.58 ? 361  TYR A CB  1 
ATOM   3142 C  CG  . TYR A 1 364 ? 58.684 77.149 6.745   1.00 21.22 ? 361  TYR A CG  1 
ATOM   3143 C  CD1 . TYR A 1 364 ? 58.314 75.812 6.822   1.00 21.88 ? 361  TYR A CD1 1 
ATOM   3144 C  CD2 . TYR A 1 364 ? 59.800 77.515 7.429   1.00 22.53 ? 361  TYR A CD2 1 
ATOM   3145 C  CE1 . TYR A 1 364 ? 59.022 74.909 7.588   1.00 20.99 ? 361  TYR A CE1 1 
ATOM   3146 C  CE2 . TYR A 1 364 ? 60.488 76.643 8.198   1.00 22.63 ? 361  TYR A CE2 1 
ATOM   3147 C  CZ  . TYR A 1 364 ? 60.139 75.313 8.256   1.00 22.22 ? 361  TYR A CZ  1 
ATOM   3148 O  OH  . TYR A 1 364 ? 60.839 74.410 9.045   1.00 23.06 ? 361  TYR A OH  1 
ATOM   3149 N  N   . GLN A 1 365 ? 54.831 77.749 5.780   1.00 19.37 ? 362  GLN A N   1 
ATOM   3150 C  CA  . GLN A 1 365 ? 53.689 76.838 5.740   1.00 18.85 ? 362  GLN A CA  1 
ATOM   3151 C  C   . GLN A 1 365 ? 54.213 75.402 5.639   1.00 18.60 ? 362  GLN A C   1 
ATOM   3152 O  O   . GLN A 1 365 ? 55.212 75.136 4.956   1.00 19.44 ? 362  GLN A O   1 
ATOM   3153 C  CB  . GLN A 1 365 ? 52.855 77.180 4.501   1.00 19.02 ? 362  GLN A CB  1 
ATOM   3154 C  CG  . GLN A 1 365 ? 51.561 76.394 4.403   1.00 19.76 ? 362  GLN A CG  1 
ATOM   3155 C  CD  . GLN A 1 365 ? 50.749 76.780 3.167   1.00 19.98 ? 362  GLN A CD  1 
ATOM   3156 O  OE1 . GLN A 1 365 ? 49.843 77.638 3.239   1.00 20.96 ? 362  GLN A OE1 1 
ATOM   3157 N  NE2 . GLN A 1 365 ? 51.123 76.225 2.025   1.00 19.22 ? 362  GLN A NE2 1 
ATOM   3158 N  N   . THR A 1 366 ? 53.533 74.482 6.318   1.00 17.22 ? 363  THR A N   1 
ATOM   3159 C  CA  . THR A 1 366 ? 53.876 73.077 6.267   1.00 17.61 ? 363  THR A CA  1 
ATOM   3160 C  C   . THR A 1 366 ? 52.778 72.320 5.487   1.00 16.76 ? 363  THR A C   1 
ATOM   3161 O  O   . THR A 1 366 ? 52.426 72.713 4.364   1.00 17.48 ? 363  THR A O   1 
ATOM   3162 C  CB  . THR A 1 366 ? 54.130 72.527 7.708   1.00 17.04 ? 363  THR A CB  1 
ATOM   3163 O  OG1 . THR A 1 366 ? 52.979 72.754 8.518   1.00 17.12 ? 363  THR A OG1 1 
ATOM   3164 C  CG2 . THR A 1 366 ? 55.391 73.234 8.319   1.00 19.46 ? 363  THR A CG2 1 
ATOM   3165 N  N   . GLY A 1 367 ? 52.242 71.228 6.014   1.00 15.99 ? 364  GLY A N   1 
ATOM   3166 C  CA  . GLY A 1 367 ? 51.366 70.398 5.237   1.00 14.89 ? 364  GLY A CA  1 
ATOM   3167 C  C   . GLY A 1 367 ? 50.108 71.097 4.793   1.00 15.83 ? 364  GLY A C   1 
ATOM   3168 O  O   . GLY A 1 367 ? 49.546 71.885 5.561   1.00 16.22 ? 364  GLY A O   1 
ATOM   3169 N  N   . VAL A 1 368 ? 49.673 70.770 3.564   1.00 16.27 ? 365  VAL A N   1 
ATOM   3170 C  CA  . VAL A 1 368 ? 48.489 71.390 2.998   1.00 16.27 ? 365  VAL A CA  1 
ATOM   3171 C  C   . VAL A 1 368 ? 47.368 70.367 2.927   1.00 15.74 ? 365  VAL A C   1 
ATOM   3172 O  O   . VAL A 1 368 ? 47.524 69.177 3.227   1.00 15.58 ? 365  VAL A O   1 
ATOM   3173 C  CB  . VAL A 1 368 ? 48.765 72.004 1.619   1.00 16.35 ? 365  VAL A CB  1 
ATOM   3174 C  CG1 . VAL A 1 368 ? 49.956 73.034 1.747   1.00 16.87 ? 365  VAL A CG1 1 
ATOM   3175 C  CG2 . VAL A 1 368 ? 48.989 70.963 0.549   1.00 18.08 ? 365  VAL A CG2 1 
ATOM   3176 N  N   . VAL A 1 369 ? 46.197 70.828 2.501   1.00 15.19 ? 366  VAL A N   1 
ATOM   3177 C  CA  . VAL A 1 369 ? 45.046 69.976 2.413   1.00 14.04 ? 366  VAL A CA  1 
ATOM   3178 C  C   . VAL A 1 369 ? 45.167 69.031 1.223   1.00 14.28 ? 366  VAL A C   1 
ATOM   3179 O  O   . VAL A 1 369 ? 45.480 69.463 0.096   1.00 16.49 ? 366  VAL A O   1 
ATOM   3180 C  CB  . VAL A 1 369 ? 43.770 70.805 2.244   1.00 14.85 ? 366  VAL A CB  1 
ATOM   3181 C  CG1 . VAL A 1 369 ? 42.498 69.911 1.987   1.00 15.88 ? 366  VAL A CG1 1 
ATOM   3182 C  CG2 . VAL A 1 369 ? 43.541 71.696 3.502   1.00 14.69 ? 366  VAL A CG2 1 
ATOM   3183 N  N   . LEU A 1 370 ? 44.901 67.764 1.418   1.00 14.69 ? 367  LEU A N   1 
ATOM   3184 C  CA  . LEU A 1 370 ? 44.843 66.792 0.334   1.00 13.54 ? 367  LEU A CA  1 
ATOM   3185 C  C   . LEU A 1 370 ? 43.376 66.461 0.109   1.00 15.20 ? 367  LEU A C   1 
ATOM   3186 O  O   . LEU A 1 370 ? 42.643 66.166 1.060   1.00 15.99 ? 367  LEU A O   1 
ATOM   3187 C  CB  . LEU A 1 370 ? 45.571 65.489 0.651   1.00 14.19 ? 367  LEU A CB  1 
ATOM   3188 C  CG  . LEU A 1 370 ? 45.741 64.457 -0.460  1.00 15.80 ? 367  LEU A CG  1 
ATOM   3189 C  CD1 . LEU A 1 370 ? 46.523 64.983 -1.667  1.00 17.83 ? 367  LEU A CD1 1 
ATOM   3190 C  CD2 . LEU A 1 370 ? 46.408 63.180 0.067   1.00 19.32 ? 367  LEU A CD2 1 
ATOM   3191 N  N   . TRP A 1 371 ? 42.948 66.474 -1.144  1.00 13.74 ? 368  TRP A N   1 
ATOM   3192 C  CA  . TRP A 1 371 ? 41.578 66.184 -1.525  1.00 13.66 ? 368  TRP A CA  1 
ATOM   3193 C  C   . TRP A 1 371 ? 41.547 65.597 -2.912  1.00 13.96 ? 368  TRP A C   1 
ATOM   3194 O  O   . TRP A 1 371 ? 42.595 65.513 -3.600  1.00 14.90 ? 368  TRP A O   1 
ATOM   3195 C  CB  . TRP A 1 371 ? 40.721 67.453 -1.404  1.00 14.04 ? 368  TRP A CB  1 
ATOM   3196 C  CG  . TRP A 1 371 ? 41.093 68.515 -2.387  1.00 14.15 ? 368  TRP A CG  1 
ATOM   3197 C  CD1 . TRP A 1 371 ? 42.153 69.380 -2.331  1.00 14.08 ? 368  TRP A CD1 1 
ATOM   3198 C  CD2 . TRP A 1 371 ? 40.457 68.761 -3.663  1.00 13.88 ? 368  TRP A CD2 1 
ATOM   3199 N  NE1 . TRP A 1 371 ? 42.223 70.132 -3.462  1.00 15.13 ? 368  TRP A NE1 1 
ATOM   3200 C  CE2 . TRP A 1 371 ? 41.173 69.796 -4.293  1.00 14.33 ? 368  TRP A CE2 1 
ATOM   3201 C  CE3 . TRP A 1 371 ? 39.310 68.253 -4.284  1.00 14.41 ? 368  TRP A CE3 1 
ATOM   3202 C  CZ2 . TRP A 1 371 ? 40.834 70.302 -5.535  1.00 16.31 ? 368  TRP A CZ2 1 
ATOM   3203 C  CZ3 . TRP A 1 371 ? 38.979 68.757 -5.538  1.00 15.53 ? 368  TRP A CZ3 1 
ATOM   3204 C  CH2 . TRP A 1 371 ? 39.718 69.752 -6.161  1.00 17.14 ? 368  TRP A CH2 1 
ATOM   3205 N  N   . GLY A 1 372 ? 40.357 65.261 -3.382  1.00 13.32 ? 369  GLY A N   1 
ATOM   3206 C  CA  . GLY A 1 372 ? 40.255 64.814 -4.759  1.00 13.80 ? 369  GLY A CA  1 
ATOM   3207 C  C   . GLY A 1 372 ? 39.011 63.983 -4.969  1.00 16.41 ? 369  GLY A C   1 
ATOM   3208 O  O   . GLY A 1 372 ? 37.970 64.250 -4.379  1.00 20.57 ? 369  GLY A O   1 
ATOM   3209 N  N   . GLY A 1 373 ? 39.093 63.077 -5.928  1.00 15.20 ? 370  GLY A N   1 
ATOM   3210 C  CA  . GLY A 1 373 ? 37.970 62.256 -6.243  1.00 15.87 ? 370  GLY A CA  1 
ATOM   3211 C  C   . GLY A 1 373 ? 38.201 61.396 -7.480  1.00 14.31 ? 370  GLY A C   1 
ATOM   3212 O  O   . GLY A 1 373 ? 39.109 61.685 -8.281  1.00 14.60 ? 370  GLY A O   1 
ATOM   3213 N  N   . VAL A 1 374 ? 37.434 60.314 -7.556  1.00 13.22 ? 371  VAL A N   1 
ATOM   3214 C  CA  . VAL A 1 374 ? 37.590 59.351 -8.633  1.00 11.94 ? 371  VAL A CA  1 
ATOM   3215 C  C   . VAL A 1 374 ? 37.171 59.937 -9.977  1.00 12.42 ? 371  VAL A C   1 
ATOM   3216 O  O   . VAL A 1 374 ? 36.169 60.624 -10.096 1.00 12.79 ? 371  VAL A O   1 
ATOM   3217 C  CB  . VAL A 1 374 ? 36.781 58.089 -8.281  1.00 11.89 ? 371  VAL A CB  1 
ATOM   3218 C  CG1 . VAL A 1 374 ? 36.623 57.099 -9.447  1.00 14.91 ? 371  VAL A CG1 1 
ATOM   3219 C  CG2 . VAL A 1 374 ? 37.410 57.364 -7.104  1.00 14.93 ? 371  VAL A CG2 1 
ATOM   3220 N  N   . GLY A 1 375 ? 37.984 59.602 -10.985 1.00 12.46 ? 372  GLY A N   1 
ATOM   3221 C  CA  . GLY A 1 375 ? 37.694 59.894 -12.377 1.00 12.89 ? 372  GLY A CA  1 
ATOM   3222 C  C   . GLY A 1 375 ? 37.079 58.656 -13.031 1.00 12.40 ? 372  GLY A C   1 
ATOM   3223 O  O   . GLY A 1 375 ? 37.448 57.540 -12.689 1.00 12.84 ? 372  GLY A O   1 
ATOM   3224 N  N   . THR A 1 376 ? 36.176 58.827 -13.985 1.00 12.52 ? 373  THR A N   1 
ATOM   3225 C  CA  . THR A 1 376 ? 35.890 60.089 -14.650 1.00 13.94 ? 373  THR A CA  1 
ATOM   3226 C  C   . THR A 1 376 ? 34.878 61.003 -13.940 1.00 13.60 ? 373  THR A C   1 
ATOM   3227 O  O   . THR A 1 376 ? 34.662 62.154 -14.358 1.00 13.64 ? 373  THR A O   1 
ATOM   3228 C  CB  . THR A 1 376 ? 35.398 59.900 -16.077 1.00 14.61 ? 373  THR A CB  1 
ATOM   3229 O  OG1 . THR A 1 376 ? 34.089 59.322 -16.056 1.00 13.92 ? 373  THR A OG1 1 
ATOM   3230 C  CG2 . THR A 1 376 ? 36.365 59.067 -16.959 1.00 13.98 ? 373  THR A CG2 1 
ATOM   3231 N  N   . ASN A 1 377 ? 34.256 60.500 -12.876 1.00 14.35 ? 374  ASN A N   1 
ATOM   3232 C  CA  . ASN A 1 377 ? 33.182 61.258 -12.256 1.00 13.96 ? 374  ASN A CA  1 
ATOM   3233 C  C   . ASN A 1 377 ? 33.581 62.714 -11.893 1.00 13.35 ? 374  ASN A C   1 
ATOM   3234 O  O   . ASN A 1 377 ? 32.771 63.607 -12.105 1.00 14.02 ? 374  ASN A O   1 
ATOM   3235 C  CB  . ASN A 1 377 ? 32.714 60.583 -10.975 1.00 13.37 ? 374  ASN A CB  1 
ATOM   3236 C  CG  . ASN A 1 377 ? 32.187 59.208 -11.213 1.00 15.30 ? 374  ASN A CG  1 
ATOM   3237 O  OD1 . ASN A 1 377 ? 32.936 58.313 -11.701 1.00 15.81 ? 374  ASN A OD1 1 
ATOM   3238 N  ND2 . ASN A 1 377 ? 30.881 58.988 -10.881 1.00 13.90 ? 374  ASN A ND2 1 
ATOM   3239 N  N   . GLY A 1 378 ? 34.808 62.921 -11.407 1.00 12.97 ? 375  GLY A N   1 
ATOM   3240 C  CA  . GLY A 1 378 ? 35.191 64.265 -11.008 1.00 13.29 ? 375  GLY A CA  1 
ATOM   3241 C  C   . GLY A 1 378 ? 35.145 65.271 -12.103 1.00 13.18 ? 375  GLY A C   1 
ATOM   3242 O  O   . GLY A 1 378 ? 34.975 66.469 -11.898 1.00 14.55 ? 375  GLY A O   1 
ATOM   3243 N  N   . GLN A 1 379 ? 35.277 64.808 -13.351 1.00 13.77 ? 376  GLN A N   1 
ATOM   3244 C  CA  . GLN A 1 379 ? 35.228 65.678 -14.553 1.00 14.86 ? 376  GLN A CA  1 
ATOM   3245 C  C   . GLN A 1 379 ? 33.901 66.399 -14.670 1.00 15.91 ? 376  GLN A C   1 
ATOM   3246 O  O   . GLN A 1 379 ? 33.837 67.403 -15.410 1.00 16.80 ? 376  GLN A O   1 
ATOM   3247 C  CB  . GLN A 1 379 ? 35.453 64.895 -15.832 1.00 15.36 ? 376  GLN A CB  1 
ATOM   3248 C  CG  . GLN A 1 379 ? 36.757 64.151 -15.915 1.00 14.00 ? 376  GLN A CG  1 
ATOM   3249 C  CD  . GLN A 1 379 ? 36.921 63.185 -17.080 1.00 13.55 ? 376  GLN A CD  1 
ATOM   3250 O  OE1 . GLN A 1 379 ? 37.918 62.447 -17.062 1.00 16.19 ? 376  GLN A OE1 1 
ATOM   3251 N  NE2 . GLN A 1 379 ? 36.021 63.174 -18.082 1.00 14.20 ? 376  GLN A NE2 1 
ATOM   3252 N  N   . HIS A 1 380 ? 32.880 65.843 -14.014 1.00 14.94 ? 377  HIS A N   1 
ATOM   3253 C  CA  . HIS A 1 380 ? 31.535 66.381 -14.067 1.00 15.82 ? 377  HIS A CA  1 
ATOM   3254 C  C   . HIS A 1 380 ? 31.266 67.272 -12.914 1.00 18.52 ? 377  HIS A C   1 
ATOM   3255 O  O   . HIS A 1 380 ? 30.140 67.740 -12.783 1.00 18.88 ? 377  HIS A O   1 
ATOM   3256 C  CB  . HIS A 1 380 ? 30.537 65.206 -14.164 1.00 15.11 ? 377  HIS A CB  1 
ATOM   3257 C  CG  . HIS A 1 380 ? 30.785 64.377 -15.374 1.00 13.03 ? 377  HIS A CG  1 
ATOM   3258 N  ND1 . HIS A 1 380 ? 30.090 64.579 -16.572 1.00 14.33 ? 377  HIS A ND1 1 
ATOM   3259 C  CD2 . HIS A 1 380 ? 31.705 63.406 -15.621 1.00 13.72 ? 377  HIS A CD2 1 
ATOM   3260 C  CE1 . HIS A 1 380 ? 30.554 63.736 -17.470 1.00 13.95 ? 377  HIS A CE1 1 
ATOM   3261 N  NE2 . HIS A 1 380 ? 31.544 63.026 -16.938 1.00 13.91 ? 377  HIS A NE2 1 
ATOM   3262 N  N   . ALA A 1 381 ? 32.279 67.531 -12.088 1.00 18.97 ? 378  ALA A N   1 
ATOM   3263 C  CA  . ALA A 1 381 ? 31.991 68.151 -10.832 1.00 19.50 ? 378  ALA A CA  1 
ATOM   3264 C  C   A ALA A 1 381 ? 33.173 69.108 -10.629 0.70 17.72 ? 378  ALA A C   1 
ATOM   3265 C  C   B ALA A 1 381 ? 32.811 69.077 -10.046 0.30 18.86 ? 378  ALA A C   1 
ATOM   3266 O  O   A ALA A 1 381 ? 33.292 70.150 -11.294 0.70 15.08 ? 378  ALA A O   1 
ATOM   3267 O  O   B ALA A 1 381 ? 32.203 69.870 -9.390  0.30 21.12 ? 378  ALA A O   1 
ATOM   3268 C  CB  . ALA A 1 381 ? 31.861 67.034 -9.850  1.00 17.67 ? 378  ALA A CB  1 
ATOM   3269 N  N   A PHE A 1 382 ? 34.057 68.789 -9.701  0.70 15.17 ? 379  PHE A N   1 
ATOM   3270 N  N   B PHE A 1 382 ? 34.091 68.781 -9.847  0.30 17.00 ? 379  PHE A N   1 
ATOM   3271 C  CA  . PHE A 1 382 ? 35.031 69.753 -9.313  1.00 15.88 ? 379  PHE A CA  1 
ATOM   3272 C  C   . PHE A 1 382 ? 36.103 70.019 -10.337 1.00 14.72 ? 379  PHE A C   1 
ATOM   3273 O  O   . PHE A 1 382 ? 36.874 70.982 -10.184 1.00 14.63 ? 379  PHE A O   1 
ATOM   3274 C  CB  . PHE A 1 382 ? 35.606 69.337 -7.970  1.00 16.02 ? 379  PHE A CB  1 
ATOM   3275 C  CG  . PHE A 1 382 ? 36.233 67.986 -7.993  1.00 14.99 ? 379  PHE A CG  1 
ATOM   3276 C  CD1 . PHE A 1 382 ? 37.487 67.795 -8.545  1.00 15.67 ? 379  PHE A CD1 1 
ATOM   3277 C  CD2 . PHE A 1 382 ? 35.537 66.897 -7.515  1.00 13.86 ? 379  PHE A CD2 1 
ATOM   3278 C  CE1 . PHE A 1 382 ? 38.066 66.560 -8.570  1.00 17.81 ? 379  PHE A CE1 1 
ATOM   3279 C  CE2 . PHE A 1 382 ? 36.092 65.618 -7.601  1.00 17.41 ? 379  PHE A CE2 1 
ATOM   3280 C  CZ  . PHE A 1 382 ? 37.385 65.466 -8.125  1.00 16.18 ? 379  PHE A CZ  1 
ATOM   3281 N  N   . HIS A 1 383 ? 36.194 69.205 -11.409 1.00 15.03 ? 380  HIS A N   1 
ATOM   3282 C  CA  . HIS A 1 383 ? 37.185 69.596 -12.461 1.00 13.85 ? 380  HIS A CA  1 
ATOM   3283 C  C   . HIS A 1 383 ? 36.866 70.966 -13.032 1.00 15.02 ? 380  HIS A C   1 
ATOM   3284 O  O   . HIS A 1 383 ? 37.763 71.638 -13.557 1.00 15.27 ? 380  HIS A O   1 
ATOM   3285 C  CB  . HIS A 1 383 ? 37.340 68.567 -13.572 1.00 13.71 ? 380  HIS A CB  1 
ATOM   3286 C  CG  . HIS A 1 383 ? 38.064 67.315 -13.187 1.00 13.53 ? 380  HIS A CG  1 
ATOM   3287 N  ND1 . HIS A 1 383 ? 38.820 66.604 -14.096 1.00 14.31 ? 380  HIS A ND1 1 
ATOM   3288 C  CD2 . HIS A 1 383 ? 38.044 66.575 -12.056 1.00 15.05 ? 380  HIS A CD2 1 
ATOM   3289 C  CE1 . HIS A 1 383 ? 39.287 65.513 -13.491 1.00 14.76 ? 380  HIS A CE1 1 
ATOM   3290 N  NE2 . HIS A 1 383 ? 38.814 65.461 -12.258 1.00 15.03 ? 380  HIS A NE2 1 
ATOM   3291 N  N   . GLN A 1 384 ? 35.597 71.388 -12.995 1.00 14.19 ? 381  GLN A N   1 
ATOM   3292 C  CA  . GLN A 1 384 ? 35.303 72.779 -13.412 1.00 14.72 ? 381  GLN A CA  1 
ATOM   3293 C  C   . GLN A 1 384 ? 36.234 73.760 -12.715 1.00 14.85 ? 381  GLN A C   1 
ATOM   3294 O  O   . GLN A 1 384 ? 36.729 74.678 -13.371 1.00 16.53 ? 381  GLN A O   1 
ATOM   3295 C  CB  . GLN A 1 384 ? 33.859 73.114 -13.094 1.00 15.41 ? 381  GLN A CB  1 
ATOM   3296 C  CG  . GLN A 1 384 ? 33.497 74.598 -13.143 1.00 15.35 ? 381  GLN A CG  1 
ATOM   3297 C  CD  . GLN A 1 384 ? 33.602 75.180 -14.508 1.00 16.19 ? 381  GLN A CD  1 
ATOM   3298 O  OE1 . GLN A 1 384 ? 33.317 74.514 -15.511 1.00 17.10 ? 381  GLN A OE1 1 
ATOM   3299 N  NE2 . GLN A 1 384 ? 34.032 76.450 -14.564 1.00 15.75 ? 381  GLN A NE2 1 
ATOM   3300 N  N   . LEU A 1 385 ? 36.447 73.616 -11.409 1.00 14.46 ? 382  LEU A N   1 
ATOM   3301 C  CA  . LEU A 1 385 ? 37.276 74.516 -10.653 1.00 14.68 ? 382  LEU A CA  1 
ATOM   3302 C  C   . LEU A 1 385 ? 38.744 74.325 -11.022 1.00 15.79 ? 382  LEU A C   1 
ATOM   3303 O  O   . LEU A 1 385 ? 39.524 75.305 -11.114 1.00 15.83 ? 382  LEU A O   1 
ATOM   3304 C  CB  . LEU A 1 385 ? 36.972 74.416 -9.140  1.00 15.33 ? 382  LEU A CB  1 
ATOM   3305 C  CG  . LEU A 1 385 ? 37.735 75.424 -8.243  1.00 17.31 ? 382  LEU A CG  1 
ATOM   3306 C  CD1 . LEU A 1 385 ? 36.884 75.807 -7.063  1.00 18.55 ? 382  LEU A CD1 1 
ATOM   3307 C  CD2 . LEU A 1 385 ? 39.057 74.840 -7.828  1.00 18.36 ? 382  LEU A CD2 1 
ATOM   3308 N  N   . LEU A 1 386 ? 39.175 73.082 -11.263 1.00 14.60 ? 383  LEU A N   1 
ATOM   3309 C  CA  . LEU A 1 386 ? 40.552 72.846 -11.740 1.00 14.61 ? 383  LEU A CA  1 
ATOM   3310 C  C   . LEU A 1 386 ? 40.835 73.505 -13.062 1.00 15.85 ? 383  LEU A C   1 
ATOM   3311 O  O   . LEU A 1 386 ? 41.960 73.960 -13.266 1.00 17.42 ? 383  LEU A O   1 
ATOM   3312 C  CB  . LEU A 1 386 ? 40.847 71.327 -11.829 1.00 13.89 ? 383  LEU A CB  1 
ATOM   3313 C  CG  . LEU A 1 386 ? 40.736 70.527 -10.527 1.00 14.10 ? 383  LEU A CG  1 
ATOM   3314 C  CD1 . LEU A 1 386 ? 41.050 69.018 -10.859 1.00 16.30 ? 383  LEU A CD1 1 
ATOM   3315 C  CD2 . LEU A 1 386 ? 41.656 71.079 -9.408  1.00 16.93 ? 383  LEU A CD2 1 
ATOM   3316 N  N   . HIS A 1 387 ? 39.843 73.617 -13.938 1.00 15.69 ? 384  HIS A N   1 
ATOM   3317 C  CA  . HIS A 1 387 ? 40.042 74.232 -15.269 1.00 16.87 ? 384  HIS A CA  1 
ATOM   3318 C  C   . HIS A 1 387 ? 39.833 75.736 -15.279 1.00 16.32 ? 384  HIS A C   1 
ATOM   3319 O  O   . HIS A 1 387 ? 40.557 76.453 -16.010 1.00 18.05 ? 384  HIS A O   1 
ATOM   3320 C  CB  . HIS A 1 387 ? 39.132 73.588 -16.306 1.00 17.48 ? 384  HIS A CB  1 
ATOM   3321 C  CG  . HIS A 1 387 ? 39.459 72.172 -16.604 1.00 15.35 ? 384  HIS A CG  1 
ATOM   3322 N  ND1 . HIS A 1 387 ? 40.702 71.773 -17.055 1.00 19.10 ? 384  HIS A ND1 1 
ATOM   3323 C  CD2 . HIS A 1 387 ? 38.729 71.033 -16.488 1.00 17.64 ? 384  HIS A CD2 1 
ATOM   3324 C  CE1 . HIS A 1 387 ? 40.713 70.460 -17.219 1.00 19.58 ? 384  HIS A CE1 1 
ATOM   3325 N  NE2 . HIS A 1 387 ? 39.515 69.992 -16.915 1.00 17.96 ? 384  HIS A NE2 1 
ATOM   3326 N  N   . GLN A 1 388 ? 38.815 76.253 -14.599 1.00 16.05 ? 385  GLN A N   1 
ATOM   3327 C  CA  . GLN A 1 388 ? 38.438 77.660 -14.676 1.00 16.72 ? 385  GLN A CA  1 
ATOM   3328 C  C   . GLN A 1 388 ? 38.351 78.432 -13.392 1.00 16.68 ? 385  GLN A C   1 
ATOM   3329 O  O   . GLN A 1 388 ? 37.999 79.622 -13.427 1.00 18.57 ? 385  GLN A O   1 
ATOM   3330 C  CB  . GLN A 1 388 ? 37.085 77.787 -15.390 1.00 17.39 ? 385  GLN A CB  1 
ATOM   3331 C  CG  . GLN A 1 388 ? 37.092 77.499 -16.900 1.00 17.89 ? 385  GLN A CG  1 
ATOM   3332 C  CD  . GLN A 1 388 ? 35.788 77.947 -17.558 1.00 17.87 ? 385  GLN A CD  1 
ATOM   3333 O  OE1 . GLN A 1 388 ? 34.684 77.623 -17.125 1.00 18.29 ? 385  GLN A OE1 1 
ATOM   3334 N  NE2 . GLN A 1 388 ? 35.923 78.671 -18.667 1.00 17.96 ? 385  GLN A NE2 1 
ATOM   3335 N  N   . GLY A 1 389 ? 38.603 77.799 -12.233 1.00 15.99 ? 386  GLY A N   1 
ATOM   3336 C  CA  . GLY A 1 389 ? 38.760 78.570 -11.014 1.00 16.19 ? 386  GLY A CA  1 
ATOM   3337 C  C   . GLY A 1 389 ? 40.038 79.365 -11.035 1.00 17.24 ? 386  GLY A C   1 
ATOM   3338 O  O   . GLY A 1 389 ? 40.829 79.268 -11.990 1.00 18.51 ? 386  GLY A O   1 
ATOM   3339 N  N   . ASN A 1 390 ? 40.265 80.101 -9.964  1.00 18.19 ? 387  ASN A N   1 
ATOM   3340 C  CA  . ASN A 1 390 ? 41.482 80.908 -9.855  1.00 18.69 ? 387  ASN A CA  1 
ATOM   3341 C  C   . ASN A 1 390 ? 42.278 80.585 -8.613  1.00 19.78 ? 387  ASN A C   1 
ATOM   3342 O  O   . ASN A 1 390 ? 42.948 81.491 -8.056  1.00 21.19 ? 387  ASN A O   1 
ATOM   3343 C  CB  . ASN A 1 390 ? 41.144 82.391 -10.038 1.00 19.41 ? 387  ASN A CB  1 
ATOM   3344 C  CG  . ASN A 1 390 ? 40.138 82.972 -9.074  1.00 19.09 ? 387  ASN A CG  1 
ATOM   3345 O  OD1 . ASN A 1 390 ? 39.856 82.456 -8.011  1.00 18.88 ? 387  ASN A OD1 1 
ATOM   3346 N  ND2 . ASN A 1 390 ? 39.612 84.168 -9.449  1.00 20.38 ? 387  ASN A ND2 1 
ATOM   3347 N  N   . ILE A 1 391 ? 42.269 79.305 -8.281  1.00 18.59 ? 388  ILE A N   1 
ATOM   3348 C  CA  . ILE A 1 391 ? 43.057 78.677 -7.187  1.00 18.59 ? 388  ILE A CA  1 
ATOM   3349 C  C   . ILE A 1 391 ? 44.155 77.845 -7.853  1.00 19.64 ? 388  ILE A C   1 
ATOM   3350 O  O   . ILE A 1 391 ? 43.891 77.009 -8.707  1.00 18.47 ? 388  ILE A O   1 
ATOM   3351 C  CB  . ILE A 1 391 ? 42.258 77.721 -6.330  1.00 19.27 ? 388  ILE A CB  1 
ATOM   3352 C  CG1 . ILE A 1 391 ? 40.852 78.197 -5.934  1.00 24.82 ? 388  ILE A CG1 1 
ATOM   3353 C  CG2 . ILE A 1 391 ? 43.084 77.384 -5.053  1.00 22.57 ? 388  ILE A CG2 1 
ATOM   3354 C  CD1 . ILE A 1 391 ? 40.840 79.488 -5.142  1.00 24.60 ? 388  ILE A CD1 1 
ATOM   3355 N  N   . PHE A 1 392 ? 45.398 78.003 -7.397  1.00 18.72 ? 389  PHE A N   1 
ATOM   3356 C  CA  . PHE A 1 392 ? 46.510 77.176 -7.869  1.00 18.89 ? 389  PHE A CA  1 
ATOM   3357 C  C   . PHE A 1 392 ? 46.522 75.879 -7.060  1.00 18.16 ? 389  PHE A C   1 
ATOM   3358 O  O   . PHE A 1 392 ? 46.607 75.890 -5.827  1.00 17.29 ? 389  PHE A O   1 
ATOM   3359 C  CB  . PHE A 1 392 ? 47.860 77.852 -7.654  1.00 19.11 ? 389  PHE A CB  1 
ATOM   3360 C  CG  . PHE A 1 392 ? 48.984 77.140 -8.310  1.00 20.78 ? 389  PHE A CG  1 
ATOM   3361 C  CD1 . PHE A 1 392 ? 49.373 77.454 -9.628  1.00 23.72 ? 389  PHE A CD1 1 
ATOM   3362 C  CD2 . PHE A 1 392 ? 49.682 76.174 -7.643  1.00 19.85 ? 389  PHE A CD2 1 
ATOM   3363 C  CE1 . PHE A 1 392 ? 50.415 76.757 -10.240 1.00 23.66 ? 389  PHE A CE1 1 
ATOM   3364 C  CE2 . PHE A 1 392 ? 50.727 75.469 -8.264  1.00 19.92 ? 389  PHE A CE2 1 
ATOM   3365 C  CZ  . PHE A 1 392 ? 51.081 75.765 -9.574  1.00 21.96 ? 389  PHE A CZ  1 
ATOM   3366 N  N   . ILE A 1 393 ? 46.368 74.764 -7.777  1.00 16.22 ? 390  ILE A N   1 
ATOM   3367 C  CA  . ILE A 1 393 ? 46.219 73.430 -7.187  1.00 16.72 ? 390  ILE A CA  1 
ATOM   3368 C  C   . ILE A 1 393 ? 47.063 72.441 -8.005  1.00 16.51 ? 390  ILE A C   1 
ATOM   3369 O  O   . ILE A 1 393 ? 46.672 72.077 -9.130  1.00 17.39 ? 390  ILE A O   1 
ATOM   3370 C  CB  . ILE A 1 393 ? 44.739 72.978 -7.170  1.00 16.30 ? 390  ILE A CB  1 
ATOM   3371 C  CG1 . ILE A 1 393 ? 43.875 74.025 -6.490  1.00 18.42 ? 390  ILE A CG1 1 
ATOM   3372 C  CG2 . ILE A 1 393 ? 44.619 71.575 -6.493  1.00 17.26 ? 390  ILE A CG2 1 
ATOM   3373 C  CD1 . ILE A 1 393 ? 42.357 73.824 -6.706  1.00 20.03 ? 390  ILE A CD1 1 
ATOM   3374 N  N   . PRO A 1 394 ? 48.145 71.894 -7.424  1.00 15.93 ? 391  PRO A N   1 
ATOM   3375 C  CA  . PRO A 1 394 ? 48.820 70.758 -8.076  1.00 16.19 ? 391  PRO A CA  1 
ATOM   3376 C  C   . PRO A 1 394 ? 47.921 69.517 -8.184  1.00 15.74 ? 391  PRO A C   1 
ATOM   3377 O  O   . PRO A 1 394 ? 47.121 69.298 -7.268  1.00 15.72 ? 391  PRO A O   1 
ATOM   3378 C  CB  . PRO A 1 394 ? 49.992 70.462 -7.143  1.00 16.96 ? 391  PRO A CB  1 
ATOM   3379 C  CG  . PRO A 1 394 ? 50.173 71.756 -6.310  1.00 17.01 ? 391  PRO A CG  1 
ATOM   3380 C  CD  . PRO A 1 394 ? 48.800 72.276 -6.143  1.00 16.56 ? 391  PRO A CD  1 
ATOM   3381 N  N   . VAL A 1 395 ? 48.030 68.775 -9.266  1.00 16.03 ? 392  VAL A N   1 
ATOM   3382 C  CA  . VAL A 1 395 ? 47.169 67.626 -9.519  1.00 14.73 ? 392  VAL A CA  1 
ATOM   3383 C  C   . VAL A 1 395 ? 47.951 66.381 -9.807  1.00 15.29 ? 392  VAL A C   1 
ATOM   3384 O  O   . VAL A 1 395 ? 48.865 66.397 -10.659 1.00 16.35 ? 392  VAL A O   1 
ATOM   3385 C  CB  . VAL A 1 395 ? 46.245 67.915 -10.715 1.00 15.41 ? 392  VAL A CB  1 
ATOM   3386 C  CG1 . VAL A 1 395 ? 45.499 66.620 -11.177 1.00 17.16 ? 392  VAL A CG1 1 
ATOM   3387 C  CG2 . VAL A 1 395 ? 45.297 69.103 -10.398 1.00 16.37 ? 392  VAL A CG2 1 
ATOM   3388 N  N   . ASP A 1 396 ? 47.630 65.290 -9.091  1.00 14.24 ? 393  ASP A N   1 
ATOM   3389 C  CA  . ASP A 1 396 ? 48.147 63.954 -9.427  1.00 14.86 ? 393  ASP A CA  1 
ATOM   3390 C  C   . ASP A 1 396 ? 46.997 63.144 -10.022 1.00 14.66 ? 393  ASP A C   1 
ATOM   3391 O  O   . ASP A 1 396 ? 45.913 63.074 -9.380  1.00 15.04 ? 393  ASP A O   1 
ATOM   3392 C  CB  . ASP A 1 396 ? 48.631 63.171 -8.166  1.00 16.01 ? 393  ASP A CB  1 
ATOM   3393 C  CG  . ASP A 1 396 ? 49.998 63.532 -7.670  1.00 17.58 ? 393  ASP A CG  1 
ATOM   3394 O  OD1 . ASP A 1 396 ? 50.721 64.384 -8.261  1.00 17.48 ? 393  ASP A OD1 1 
ATOM   3395 O  OD2 . ASP A 1 396 ? 50.353 62.961 -6.597  1.00 17.48 ? 393  ASP A OD2 1 
ATOM   3396 N  N   . PHE A 1 397 ? 47.207 62.502 -11.164 1.00 14.41 ? 394  PHE A N   1 
ATOM   3397 C  CA  . PHE A 1 397 ? 46.309 61.493 -11.695 1.00 13.37 ? 394  PHE A CA  1 
ATOM   3398 C  C   . PHE A 1 397 ? 46.905 60.126 -11.475 1.00 13.88 ? 394  PHE A C   1 
ATOM   3399 O  O   . PHE A 1 397 ? 48.094 59.940 -11.693 1.00 15.29 ? 394  PHE A O   1 
ATOM   3400 C  CB  . PHE A 1 397 ? 46.187 61.646 -13.226 1.00 15.27 ? 394  PHE A CB  1 
ATOM   3401 C  CG  . PHE A 1 397 ? 45.494 62.902 -13.691 1.00 13.68 ? 394  PHE A CG  1 
ATOM   3402 C  CD1 . PHE A 1 397 ? 44.150 62.885 -13.989 1.00 14.42 ? 394  PHE A CD1 1 
ATOM   3403 C  CD2 . PHE A 1 397 ? 46.172 64.114 -13.869 1.00 15.47 ? 394  PHE A CD2 1 
ATOM   3404 C  CE1 . PHE A 1 397 ? 43.480 63.996 -14.414 1.00 16.47 ? 394  PHE A CE1 1 
ATOM   3405 C  CE2 . PHE A 1 397 ? 45.486 65.270 -14.287 1.00 16.70 ? 394  PHE A CE2 1 
ATOM   3406 C  CZ  . PHE A 1 397 ? 44.148 65.205 -14.566 1.00 16.53 ? 394  PHE A CZ  1 
ATOM   3407 N  N   . ILE A 1 398 ? 46.088 59.168 -11.063 1.00 13.90 ? 395  ILE A N   1 
ATOM   3408 C  CA  . ILE A 1 398 ? 46.470 57.760 -11.003 1.00 14.36 ? 395  ILE A CA  1 
ATOM   3409 C  C   . ILE A 1 398 ? 45.706 57.013 -12.077 1.00 15.12 ? 395  ILE A C   1 
ATOM   3410 O  O   . ILE A 1 398 ? 44.455 57.064 -12.083 1.00 15.72 ? 395  ILE A O   1 
ATOM   3411 C  CB  . ILE A 1 398 ? 46.198 57.107 -9.660  1.00 14.25 ? 395  ILE A CB  1 
ATOM   3412 C  CG1 . ILE A 1 398 ? 46.668 57.965 -8.497  1.00 17.14 ? 395  ILE A CG1 1 
ATOM   3413 C  CG2 . ILE A 1 398 ? 46.801 55.669 -9.636  1.00 15.10 ? 395  ILE A CG2 1 
ATOM   3414 C  CD1 . ILE A 1 398 ? 48.095 58.272 -8.488  1.00 17.67 ? 395  ILE A CD1 1 
ATOM   3415 N  N   . ALA A 1 399 ? 46.411 56.392 -13.029 1.00 15.06 ? 396  ALA A N   1 
ATOM   3416 C  CA  . ALA A 1 399 ? 45.807 55.633 -14.113 1.00 14.95 ? 396  ALA A CA  1 
ATOM   3417 C  C   . ALA A 1 399 ? 46.273 54.204 -14.030 1.00 14.92 ? 396  ALA A C   1 
ATOM   3418 O  O   . ALA A 1 399 ? 47.407 53.922 -13.603 1.00 14.44 ? 396  ALA A O   1 
ATOM   3419 C  CB  . ALA A 1 399 ? 46.242 56.232 -15.500 1.00 17.31 ? 396  ALA A CB  1 
ATOM   3420 N  N   . ILE A 1 400 ? 45.369 53.322 -14.407 1.00 14.87 ? 397  ILE A N   1 
ATOM   3421 C  CA  . ILE A 1 400 ? 45.604 51.877 -14.383 1.00 15.18 ? 397  ILE A CA  1 
ATOM   3422 C  C   . ILE A 1 400 ? 45.463 51.358 -15.820 1.00 15.45 ? 397  ILE A C   1 
ATOM   3423 O  O   . ILE A 1 400 ? 44.369 51.494 -16.411 1.00 16.72 ? 397  ILE A O   1 
ATOM   3424 C  CB  . ILE A 1 400 ? 44.572 51.156 -13.473 1.00 15.26 ? 397  ILE A CB  1 
ATOM   3425 C  CG1 . ILE A 1 400 ? 44.417 51.819 -12.121 1.00 15.61 ? 397  ILE A CG1 1 
ATOM   3426 C  CG2 . ILE A 1 400 ? 44.930 49.662 -13.365 1.00 15.93 ? 397  ILE A CG2 1 
ATOM   3427 C  CD1 . ILE A 1 400 ? 45.697 51.890 -11.195 1.00 16.00 ? 397  ILE A CD1 1 
ATOM   3428 N  N   . ALA A 1 401 ? 46.536 50.798 -16.400 1.00 17.22 ? 398  ALA A N   1 
ATOM   3429 C  CA  . ALA A 1 401 ? 46.509 50.493 -17.833 1.00 17.95 ? 398  ALA A CA  1 
ATOM   3430 C  C   . ALA A 1 401 ? 45.493 49.399 -18.190 1.00 17.47 ? 398  ALA A C   1 
ATOM   3431 O  O   . ALA A 1 401 ? 44.732 49.517 -19.169 1.00 18.00 ? 398  ALA A O   1 
ATOM   3432 C  CB  . ALA A 1 401 ? 47.921 50.097 -18.333 1.00 18.80 ? 398  ALA A CB  1 
ATOM   3433 N  N   . THR A 1 402 ? 45.402 48.366 -17.323 1.00 17.91 ? 399  THR A N   1 
ATOM   3434 C  CA  A THR A 1 402 ? 44.494 47.263 -17.582 0.70 18.11 ? 399  THR A CA  1 
ATOM   3435 C  CA  B THR A 1 402 ? 44.582 47.183 -17.580 0.30 18.08 ? 399  THR A CA  1 
ATOM   3436 C  C   . THR A 1 402 ? 43.699 46.980 -16.350 1.00 18.13 ? 399  THR A C   1 
ATOM   3437 O  O   . THR A 1 402 ? 44.212 47.055 -15.238 1.00 18.94 ? 399  THR A O   1 
ATOM   3438 C  CB  A THR A 1 402 ? 45.186 46.021 -18.008 0.70 19.76 ? 399  THR A CB  1 
ATOM   3439 C  CB  B THR A 1 402 ? 45.446 45.901 -17.811 0.30 19.18 ? 399  THR A CB  1 
ATOM   3440 O  OG1 A THR A 1 402 ? 46.056 45.599 -16.953 0.70 21.91 ? 399  THR A OG1 1 
ATOM   3441 O  OG1 B THR A 1 402 ? 46.366 46.074 -18.914 0.30 19.85 ? 399  THR A OG1 1 
ATOM   3442 C  CG2 A THR A 1 402 ? 45.960 46.274 -19.348 0.70 20.27 ? 399  THR A CG2 1 
ATOM   3443 C  CG2 B THR A 1 402 ? 44.542 44.722 -18.097 0.30 19.79 ? 399  THR A CG2 1 
ATOM   3444 N  N   . SER A 1 403 ? 42.401 46.746 -16.548 1.00 16.90 ? 400  SER A N   1 
ATOM   3445 C  CA  . SER A 1 403 ? 41.446 46.501 -15.477 1.00 16.50 ? 400  SER A CA  1 
ATOM   3446 C  C   . SER A 1 403 ? 41.230 45.014 -15.323 1.00 19.05 ? 400  SER A C   1 
ATOM   3447 O  O   . SER A 1 403 ? 42.174 44.199 -15.561 1.00 21.49 ? 400  SER A O   1 
ATOM   3448 C  CB  . SER A 1 403 ? 40.137 47.301 -15.734 1.00 17.24 ? 400  SER A CB  1 
ATOM   3449 O  OG  . SER A 1 403 ? 39.189 47.094 -14.711 1.00 16.69 ? 400  SER A OG  1 
ATOM   3450 N  N   . HIS A 1 404 ? 40.128 44.625 -14.725 1.00 18.42 ? 401  HIS A N   1 
ATOM   3451 C  CA  . HIS A 1 404 ? 39.877 43.247 -14.341 1.00 18.34 ? 401  HIS A CA  1 
ATOM   3452 C  C   . HIS A 1 404 ? 38.734 42.605 -15.102 1.00 20.15 ? 401  HIS A C   1 
ATOM   3453 O  O   . HIS A 1 404 ? 38.053 41.709 -14.593 1.00 24.20 ? 401  HIS A O   1 
ATOM   3454 C  CB  . HIS A 1 404 ? 39.615 43.161 -12.827 1.00 18.53 ? 401  HIS A CB  1 
ATOM   3455 C  CG  . HIS A 1 404 ? 38.399 43.869 -12.354 1.00 17.59 ? 401  HIS A CG  1 
ATOM   3456 N  ND1 . HIS A 1 404 ? 37.237 43.189 -12.078 1.00 23.14 ? 401  HIS A ND1 1 
ATOM   3457 C  CD2 . HIS A 1 404 ? 38.149 45.177 -12.101 1.00 17.57 ? 401  HIS A CD2 1 
ATOM   3458 C  CE1 . HIS A 1 404 ? 36.323 44.064 -11.658 1.00 27.23 ? 401  HIS A CE1 1 
ATOM   3459 N  NE2 . HIS A 1 404 ? 36.850 45.274 -11.668 1.00 18.13 ? 401  HIS A NE2 1 
ATOM   3460 N  N   . HIS A 1 405 ? 38.404 43.150 -16.266 1.00 17.36 ? 402  HIS A N   1 
ATOM   3461 C  CA  . HIS A 1 405 ? 37.249 42.760 -17.052 1.00 18.29 ? 402  HIS A CA  1 
ATOM   3462 C  C   . HIS A 1 405 ? 37.611 42.957 -18.519 1.00 18.02 ? 402  HIS A C   1 
ATOM   3463 O  O   . HIS A 1 405 ? 38.685 43.473 -18.851 1.00 17.98 ? 402  HIS A O   1 
ATOM   3464 C  CB  . HIS A 1 405 ? 36.049 43.617 -16.694 1.00 17.12 ? 402  HIS A CB  1 
ATOM   3465 C  CG  . HIS A 1 405 ? 36.293 45.053 -16.933 1.00 16.70 ? 402  HIS A CG  1 
ATOM   3466 N  ND1 . HIS A 1 405 ? 36.345 45.563 -18.215 1.00 17.62 ? 402  HIS A ND1 1 
ATOM   3467 C  CD2 . HIS A 1 405 ? 36.642 46.054 -16.104 1.00 16.90 ? 402  HIS A CD2 1 
ATOM   3468 C  CE1 . HIS A 1 405 ? 36.657 46.847 -18.136 1.00 15.42 ? 402  HIS A CE1 1 
ATOM   3469 N  NE2 . HIS A 1 405 ? 36.852 47.177 -16.866 1.00 16.96 ? 402  HIS A NE2 1 
ATOM   3470 N  N   . ASN A 1 406 ? 36.694 42.564 -19.394 1.00 18.10 ? 403  ASN A N   1 
ATOM   3471 C  CA  . ASN A 1 406 ? 36.891 42.614 -20.846 1.00 18.70 ? 403  ASN A CA  1 
ATOM   3472 C  C   . ASN A 1 406 ? 36.047 43.642 -21.579 1.00 18.53 ? 403  ASN A C   1 
ATOM   3473 O  O   . ASN A 1 406 ? 35.859 43.544 -22.820 1.00 19.85 ? 403  ASN A O   1 
ATOM   3474 C  CB  . ASN A 1 406 ? 36.713 41.240 -21.505 1.00 19.23 ? 403  ASN A CB  1 
ATOM   3475 C  CG  . ASN A 1 406 ? 37.794 40.280 -21.048 1.00 21.50 ? 403  ASN A CG  1 
ATOM   3476 O  OD1 . ASN A 1 406 ? 38.978 40.584 -21.159 1.00 23.00 ? 403  ASN A OD1 1 
ATOM   3477 N  ND2 . ASN A 1 406 ? 37.384 39.183 -20.430 1.00 24.96 ? 403  ASN A ND2 1 
ATOM   3478 N  N   . TYR A 1 407 ? 35.557 44.630 -20.843 1.00 17.70 ? 404  TYR A N   1 
ATOM   3479 C  CA  . TYR A 1 407 ? 34.893 45.806 -21.467 1.00 17.88 ? 404  TYR A CA  1 
ATOM   3480 C  C   . TYR A 1 407 ? 35.951 46.797 -21.930 1.00 17.61 ? 404  TYR A C   1 
ATOM   3481 O  O   . TYR A 1 407 ? 36.180 47.861 -21.371 1.00 17.80 ? 404  TYR A O   1 
ATOM   3482 C  CB  . TYR A 1 407 ? 33.877 46.456 -20.488 1.00 16.93 ? 404  TYR A CB  1 
ATOM   3483 C  CG  . TYR A 1 407 ? 32.643 45.637 -20.256 1.00 18.10 ? 404  TYR A CG  1 
ATOM   3484 C  CD1 . TYR A 1 407 ? 31.493 45.919 -20.966 1.00 21.52 ? 404  TYR A CD1 1 
ATOM   3485 C  CD2 . TYR A 1 407 ? 32.603 44.635 -19.306 1.00 24.22 ? 404  TYR A CD2 1 
ATOM   3486 C  CE1 . TYR A 1 407 ? 30.343 45.243 -20.738 1.00 25.33 ? 404  TYR A CE1 1 
ATOM   3487 C  CE2 . TYR A 1 407 ? 31.427 43.864 -19.116 1.00 29.22 ? 404  TYR A CE2 1 
ATOM   3488 C  CZ  . TYR A 1 407 ? 30.305 44.239 -19.826 1.00 28.04 ? 404  TYR A CZ  1 
ATOM   3489 O  OH  . TYR A 1 407 ? 29.128 43.567 -19.656 1.00 34.81 ? 404  TYR A OH  1 
ATOM   3490 N  N   . ASP A 1 408 ? 36.650 46.395 -22.986 1.00 18.31 ? 405  ASP A N   1 
ATOM   3491 C  CA  . ASP A 1 408 ? 37.830 47.109 -23.432 1.00 18.32 ? 405  ASP A CA  1 
ATOM   3492 C  C   . ASP A 1 408 ? 37.463 48.549 -23.894 1.00 16.75 ? 405  ASP A C   1 
ATOM   3493 O  O   . ASP A 1 408 ? 38.262 49.459 -23.719 1.00 17.78 ? 405  ASP A O   1 
ATOM   3494 C  CB  . ASP A 1 408 ? 38.520 46.334 -24.565 1.00 20.60 ? 405  ASP A CB  1 
ATOM   3495 C  CG  . ASP A 1 408 ? 39.178 45.030 -24.105 1.00 25.35 ? 405  ASP A CG  1 
ATOM   3496 O  OD1 . ASP A 1 408 ? 39.388 44.847 -22.907 1.00 26.10 ? 405  ASP A OD1 1 
ATOM   3497 O  OD2 . ASP A 1 408 ? 39.523 44.230 -25.037 1.00 30.12 ? 405  ASP A OD2 1 
ATOM   3498 N  N   . ASN A 1 409 ? 36.281 48.724 -24.505 1.00 17.77 ? 406  ASN A N   1 
ATOM   3499 C  CA  . ASN A 1 409 ? 35.856 50.069 -24.884 1.00 16.57 ? 406  ASN A CA  1 
ATOM   3500 C  C   . ASN A 1 409 ? 35.710 51.001 -23.693 1.00 16.39 ? 406  ASN A C   1 
ATOM   3501 O  O   . ASN A 1 409 ? 36.093 52.174 -23.775 1.00 17.31 ? 406  ASN A O   1 
ATOM   3502 C  CB  . ASN A 1 409 ? 34.579 50.063 -25.708 1.00 17.17 ? 406  ASN A CB  1 
ATOM   3503 C  CG  . ASN A 1 409 ? 33.395 49.503 -24.990 1.00 22.06 ? 406  ASN A CG  1 
ATOM   3504 O  OD1 . ASN A 1 409 ? 33.500 48.551 -24.151 1.00 22.06 ? 406  ASN A OD1 1 
ATOM   3505 N  ND2 . ASN A 1 409 ? 32.231 50.164 -25.237 1.00 26.63 ? 406  ASN A ND2 1 
ATOM   3506 N  N   . HIS A 1 410 ? 35.229 50.472 -22.557 1.00 16.99 ? 407  HIS A N   1 
ATOM   3507 C  CA  . HIS A 1 410 ? 35.101 51.284 -21.366 1.00 14.75 ? 407  HIS A CA  1 
ATOM   3508 C  C   . HIS A 1 410 ? 36.475 51.669 -20.866 1.00 15.85 ? 407  HIS A C   1 
ATOM   3509 O  O   . HIS A 1 410 ? 36.724 52.814 -20.429 1.00 16.41 ? 407  HIS A O   1 
ATOM   3510 C  CB  . HIS A 1 410 ? 34.350 50.485 -20.292 1.00 14.20 ? 407  HIS A CB  1 
ATOM   3511 C  CG  . HIS A 1 410 ? 32.855 50.398 -20.471 1.00 15.57 ? 407  HIS A CG  1 
ATOM   3512 N  ND1 . HIS A 1 410 ? 31.961 51.071 -19.648 1.00 15.35 ? 407  HIS A ND1 1 
ATOM   3513 C  CD2 . HIS A 1 410 ? 32.100 49.690 -21.341 1.00 16.07 ? 407  HIS A CD2 1 
ATOM   3514 C  CE1 . HIS A 1 410 ? 30.720 50.782 -20.032 1.00 14.10 ? 407  HIS A CE1 1 
ATOM   3515 N  NE2 . HIS A 1 410 ? 30.767 49.964 -21.072 1.00 14.88 ? 407  HIS A NE2 1 
ATOM   3516 N  N   . GLN A 1 411 ? 37.385 50.687 -20.808 1.00 15.15 ? 408  GLN A N   1 
ATOM   3517 C  CA  . GLN A 1 411 ? 38.716 50.915 -20.258 1.00 14.82 ? 408  GLN A CA  1 
ATOM   3518 C  C   . GLN A 1 411 ? 39.468 51.950 -21.135 1.00 15.78 ? 408  GLN A C   1 
ATOM   3519 O  O   . GLN A 1 411 ? 40.138 52.832 -20.611 1.00 16.21 ? 408  GLN A O   1 
ATOM   3520 C  CB  . GLN A 1 411 ? 39.471 49.601 -20.120 1.00 15.43 ? 408  GLN A CB  1 
ATOM   3521 C  CG  . GLN A 1 411 ? 40.899 49.764 -19.571 1.00 16.55 ? 408  GLN A CG  1 
ATOM   3522 C  CD  . GLN A 1 411 ? 40.975 50.186 -18.102 1.00 17.25 ? 408  GLN A CD  1 
ATOM   3523 O  OE1 . GLN A 1 411 ? 39.964 50.251 -17.381 1.00 16.82 ? 408  GLN A OE1 1 
ATOM   3524 N  NE2 . GLN A 1 411 ? 42.215 50.442 -17.649 1.00 18.09 ? 408  GLN A NE2 1 
ATOM   3525 N  N   . GLN A 1 412 ? 39.356 51.815 -22.464 1.00 17.50 ? 409  GLN A N   1 
ATOM   3526 C  CA  . GLN A 1 412 ? 40.006 52.751 -23.361 1.00 18.99 ? 409  GLN A CA  1 
ATOM   3527 C  C   . GLN A 1 412 ? 39.465 54.171 -23.161 1.00 18.33 ? 409  GLN A C   1 
ATOM   3528 O  O   . GLN A 1 412 ? 40.245 55.118 -23.095 1.00 18.28 ? 409  GLN A O   1 
ATOM   3529 C  CB  . GLN A 1 412 ? 39.839 52.345 -24.816 1.00 20.95 ? 409  GLN A CB  1 
ATOM   3530 C  CG  . GLN A 1 412 ? 40.770 53.154 -25.691 1.00 26.06 ? 409  GLN A CG  1 
ATOM   3531 C  CD  . GLN A 1 412 ? 40.774 52.708 -27.103 1.00 31.84 ? 409  GLN A CD  1 
ATOM   3532 O  OE1 . GLN A 1 412 ? 39.773 52.782 -27.723 1.00 33.38 ? 409  GLN A OE1 1 
ATOM   3533 N  NE2 . GLN A 1 412 ? 41.944 52.289 -27.620 1.00 36.71 ? 409  GLN A NE2 1 
ATOM   3534 N  N   . ALA A 1 413 ? 38.151 54.306 -22.969 1.00 18.06 ? 410  ALA A N   1 
ATOM   3535 C  CA  . ALA A 1 413 ? 37.556 55.594 -22.727 1.00 16.92 ? 410  ALA A CA  1 
ATOM   3536 C  C   . ALA A 1 413 ? 38.011 56.201 -21.414 1.00 15.44 ? 410  ALA A C   1 
ATOM   3537 O  O   . ALA A 1 413 ? 38.256 57.415 -21.315 1.00 16.54 ? 410  ALA A O   1 
ATOM   3538 C  CB  . ALA A 1 413 ? 36.025 55.548 -22.769 1.00 16.64 ? 410  ALA A CB  1 
ATOM   3539 N  N   . LEU A 1 414 ? 38.110 55.363 -20.371 1.00 15.19 ? 411  LEU A N   1 
ATOM   3540 C  CA  . LEU A 1 414 ? 38.566 55.792 -19.046 1.00 15.57 ? 411  LEU A CA  1 
ATOM   3541 C  C   . LEU A 1 414 ? 39.971 56.408 -19.159 1.00 14.85 ? 411  LEU A C   1 
ATOM   3542 O  O   . LEU A 1 414 ? 40.179 57.545 -18.699 1.00 15.18 ? 411  LEU A O   1 
ATOM   3543 C  CB  . LEU A 1 414 ? 38.523 54.612 -18.103 1.00 14.53 ? 411  LEU A CB  1 
ATOM   3544 C  CG  . LEU A 1 414 ? 39.037 54.829 -16.695 1.00 14.93 ? 411  LEU A CG  1 
ATOM   3545 C  CD1 . LEU A 1 414 ? 38.197 55.879 -15.869 1.00 15.12 ? 411  LEU A CD1 1 
ATOM   3546 C  CD2 . LEU A 1 414 ? 39.159 53.423 -15.963 1.00 15.48 ? 411  LEU A CD2 1 
ATOM   3547 N  N   . LEU A 1 415 ? 40.875 55.710 -19.819 1.00 15.61 ? 412  LEU A N   1 
ATOM   3548 C  CA  . LEU A 1 415 ? 42.251 56.199 -20.024 1.00 15.67 ? 412  LEU A CA  1 
ATOM   3549 C  C   . LEU A 1 415 ? 42.319 57.416 -20.916 1.00 16.07 ? 412  LEU A C   1 
ATOM   3550 O  O   . LEU A 1 415 ? 43.046 58.364 -20.576 1.00 16.16 ? 412  LEU A O   1 
ATOM   3551 C  CB  . LEU A 1 415 ? 43.131 55.082 -20.540 1.00 16.87 ? 412  LEU A CB  1 
ATOM   3552 C  CG  . LEU A 1 415 ? 43.347 53.913 -19.576 1.00 16.24 ? 412  LEU A CG  1 
ATOM   3553 C  CD1 . LEU A 1 415 ? 43.877 52.695 -20.347 1.00 17.61 ? 412  LEU A CD1 1 
ATOM   3554 C  CD2 . LEU A 1 415 ? 44.248 54.329 -18.416 1.00 18.58 ? 412  LEU A CD2 1 
ATOM   3555 N  N   . ALA A 1 416 ? 41.549 57.395 -21.997 1.00 16.32 ? 413  ALA A N   1 
ATOM   3556 C  CA  . ALA A 1 416 ? 41.539 58.552 -22.894 1.00 17.08 ? 413  ALA A CA  1 
ATOM   3557 C  C   . ALA A 1 416 ? 41.148 59.803 -22.165 1.00 16.90 ? 413  ALA A C   1 
ATOM   3558 O  O   . ALA A 1 416 ? 41.699 60.886 -22.349 1.00 18.28 ? 413  ALA A O   1 
ATOM   3559 C  CB  . ALA A 1 416 ? 40.595 58.306 -24.111 1.00 16.49 ? 413  ALA A CB  1 
ATOM   3560 N  N   . ASN A 1 417 ? 40.141 59.667 -21.304 1.00 16.00 ? 414  ASN A N   1 
ATOM   3561 C  CA  . ASN A 1 417 ? 39.656 60.801 -20.480 1.00 16.11 ? 414  ASN A CA  1 
ATOM   3562 C  C   . ASN A 1 417 ? 40.744 61.250 -19.495 1.00 14.92 ? 414  ASN A C   1 
ATOM   3563 O  O   . ASN A 1 417 ? 40.969 62.469 -19.318 1.00 16.25 ? 414  ASN A O   1 
ATOM   3564 C  CB  . ASN A 1 417 ? 38.382 60.453 -19.725 1.00 15.74 ? 414  ASN A CB  1 
ATOM   3565 C  CG  . ASN A 1 417 ? 37.148 60.710 -20.545 1.00 20.77 ? 414  ASN A CG  1 
ATOM   3566 O  OD1 . ASN A 1 417 ? 36.658 61.842 -20.607 1.00 18.99 ? 414  ASN A OD1 1 
ATOM   3567 N  ND2 . ASN A 1 417 ? 36.666 59.669 -21.284 1.00 23.76 ? 414  ASN A ND2 1 
ATOM   3568 N  N   . CYS A 1 418 ? 41.384 60.310 -18.807 1.00 15.62 ? 415  CYS A N   1 
ATOM   3569 C  CA  . CYS A 1 418 ? 42.460 60.660 -17.890 1.00 15.67 ? 415  CYS A CA  1 
ATOM   3570 C  C   . CYS A 1 418 ? 43.511 61.504 -18.603 1.00 16.12 ? 415  CYS A C   1 
ATOM   3571 O  O   . CYS A 1 418 ? 43.879 62.580 -18.128 1.00 17.19 ? 415  CYS A O   1 
ATOM   3572 C  CB  . CYS A 1 418 ? 43.099 59.394 -17.336 1.00 15.51 ? 415  CYS A CB  1 
ATOM   3573 S  SG  . CYS A 1 418 ? 44.385 59.683 -16.104 1.00 17.56 ? 415  CYS A SG  1 
ATOM   3574 N  N   . PHE A 1 419 ? 43.956 61.003 -19.736 1.00 17.00 ? 416  PHE A N   1 
ATOM   3575 C  CA  . PHE A 1 419 ? 45.070 61.687 -20.448 1.00 17.46 ? 416  PHE A CA  1 
ATOM   3576 C  C   . PHE A 1 419 ? 44.571 62.995 -21.044 1.00 17.71 ? 416  PHE A C   1 
ATOM   3577 O  O   . PHE A 1 419 ? 45.295 64.008 -21.083 1.00 17.67 ? 416  PHE A O   1 
ATOM   3578 C  CB  . PHE A 1 419 ? 45.672 60.772 -21.505 1.00 17.83 ? 416  PHE A CB  1 
ATOM   3579 C  CG  . PHE A 1 419 ? 46.161 59.454 -20.982 1.00 17.20 ? 416  PHE A CG  1 
ATOM   3580 C  CD1 . PHE A 1 419 ? 46.516 59.250 -19.694 1.00 17.74 ? 416  PHE A CD1 1 
ATOM   3581 C  CD2 . PHE A 1 419 ? 46.229 58.354 -21.873 1.00 19.08 ? 416  PHE A CD2 1 
ATOM   3582 C  CE1 . PHE A 1 419 ? 46.991 57.976 -19.282 1.00 17.66 ? 416  PHE A CE1 1 
ATOM   3583 C  CE2 . PHE A 1 419 ? 46.660 57.125 -21.447 1.00 20.44 ? 416  PHE A CE2 1 
ATOM   3584 C  CZ  . PHE A 1 419 ? 47.027 56.953 -20.152 1.00 19.06 ? 416  PHE A CZ  1 
ATOM   3585 N  N   . ALA A 1 420 ? 43.317 63.037 -21.505 1.00 17.45 ? 417  ALA A N   1 
ATOM   3586 C  CA  . ALA A 1 420 ? 42.760 64.290 -21.985 1.00 18.24 ? 417  ALA A CA  1 
ATOM   3587 C  C   . ALA A 1 420 ? 42.674 65.394 -20.962 1.00 17.80 ? 417  ALA A C   1 
ATOM   3588 O  O   . ALA A 1 420 ? 42.829 66.588 -21.280 1.00 19.13 ? 417  ALA A O   1 
ATOM   3589 C  CB  . ALA A 1 420 ? 41.356 64.045 -22.594 1.00 18.29 ? 417  ALA A CB  1 
ATOM   3590 N  N   . GLN A 1 421 ? 42.379 65.036 -19.717 1.00 16.92 ? 418  GLN A N   1 
ATOM   3591 C  CA  . GLN A 1 421 ? 42.233 65.988 -18.682 1.00 16.52 ? 418  GLN A CA  1 
ATOM   3592 C  C   . GLN A 1 421 ? 43.562 66.642 -18.314 1.00 16.61 ? 418  GLN A C   1 
ATOM   3593 O  O   . GLN A 1 421 ? 43.609 67.843 -18.110 1.00 16.94 ? 418  GLN A O   1 
ATOM   3594 C  CB  . GLN A 1 421 ? 41.563 65.393 -17.435 1.00 16.91 ? 418  GLN A CB  1 
ATOM   3595 C  CG  . GLN A 1 421 ? 40.075 65.051 -17.695 1.00 17.10 ? 418  GLN A CG  1 
ATOM   3596 C  CD  . GLN A 1 421 ? 39.172 66.276 -17.642 1.00 15.54 ? 418  GLN A CD  1 
ATOM   3597 O  OE1 . GLN A 1 421 ? 39.415 67.158 -16.809 1.00 17.10 ? 418  GLN A OE1 1 
ATOM   3598 N  NE2 . GLN A 1 421 ? 38.118 66.342 -18.475 1.00 16.29 ? 418  GLN A NE2 1 
ATOM   3599 N  N   . SER A 1 422 ? 44.616 65.823 -18.184 1.00 17.04 ? 419  SER A N   1 
ATOM   3600 C  CA  . SER A 1 422 ? 45.938 66.397 -17.940 1.00 16.79 ? 419  SER A CA  1 
ATOM   3601 C  C   . SER A 1 422 ? 46.402 67.229 -19.089 1.00 17.86 ? 419  SER A C   1 
ATOM   3602 O  O   . SER A 1 422 ? 46.991 68.295 -18.880 1.00 18.33 ? 419  SER A O   1 
ATOM   3603 C  CB  . SER A 1 422 ? 46.955 65.351 -17.554 1.00 16.73 ? 419  SER A CB  1 
ATOM   3604 O  OG  . SER A 1 422 ? 47.176 64.423 -18.577 1.00 17.38 ? 419  SER A OG  1 
ATOM   3605 N  N   . GLN A 1 423 ? 46.077 66.793 -20.307 1.00 18.83 ? 420  GLN A N   1 
ATOM   3606 C  CA  . GLN A 1 423 ? 46.435 67.555 -21.502 1.00 19.95 ? 420  GLN A CA  1 
ATOM   3607 C  C   . GLN A 1 423 ? 45.705 68.889 -21.481 1.00 19.71 ? 420  GLN A C   1 
ATOM   3608 O  O   . GLN A 1 423 ? 46.299 69.946 -21.737 1.00 20.62 ? 420  GLN A O   1 
ATOM   3609 C  CB  . GLN A 1 423 ? 46.141 66.782 -22.759 1.00 20.65 ? 420  GLN A CB  1 
ATOM   3610 C  CG  . GLN A 1 423 ? 46.712 67.473 -24.004 1.00 22.34 ? 420  GLN A CG  1 
ATOM   3611 C  CD  . GLN A 1 423 ? 46.275 66.793 -25.293 1.00 22.55 ? 420  GLN A CD  1 
ATOM   3612 O  OE1 . GLN A 1 423 ? 45.103 66.523 -25.514 1.00 22.89 ? 420  GLN A OE1 1 
ATOM   3613 N  NE2 . GLN A 1 423 ? 47.222 66.556 -26.181 1.00 24.00 ? 420  GLN A NE2 1 
ATOM   3614 N  N   . ALA A 1 424 ? 44.426 68.888 -21.108 1.00 18.05 ? 421  ALA A N   1 
ATOM   3615 C  CA  . ALA A 1 424 ? 43.617 70.123 -21.081 1.00 19.11 ? 421  ALA A CA  1 
ATOM   3616 C  C   . ALA A 1 424 ? 44.093 71.089 -19.979 1.00 18.07 ? 421  ALA A C   1 
ATOM   3617 O  O   . ALA A 1 424 ? 44.072 72.331 -20.192 1.00 19.15 ? 421  ALA A O   1 
ATOM   3618 C  CB  . ALA A 1 424 ? 42.141 69.794 -20.872 1.00 20.30 ? 421  ALA A CB  1 
ATOM   3619 N  N   . LEU A 1 425 ? 44.512 70.571 -18.820 1.00 17.45 ? 422  LEU A N   1 
ATOM   3620 C  CA  . LEU A 1 425 ? 45.111 71.401 -17.797 1.00 17.11 ? 422  LEU A CA  1 
ATOM   3621 C  C   . LEU A 1 425 ? 46.345 72.126 -18.360 1.00 18.04 ? 422  LEU A C   1 
ATOM   3622 O  O   . LEU A 1 425 ? 46.549 73.311 -18.112 1.00 19.09 ? 422  LEU A O   1 
ATOM   3623 C  CB  . LEU A 1 425 ? 45.525 70.563 -16.590 1.00 16.06 ? 422  LEU A CB  1 
ATOM   3624 C  CG  . LEU A 1 425 ? 44.370 70.183 -15.668 1.00 15.91 ? 422  LEU A CG  1 
ATOM   3625 C  CD1 . LEU A 1 425 ? 44.847 69.130 -14.645 1.00 16.21 ? 422  LEU A CD1 1 
ATOM   3626 C  CD2 . LEU A 1 425 ? 43.728 71.374 -14.932 1.00 16.87 ? 422  LEU A CD2 1 
ATOM   3627 N  N   . MET A 1 426 ? 47.134 71.409 -19.130 1.00 18.26 ? 423  MET A N   1 
ATOM   3628 C  CA  . MET A 1 426 ? 48.381 71.970 -19.717 1.00 18.82 ? 423  MET A CA  1 
ATOM   3629 C  C   . MET A 1 426 ? 48.065 73.009 -20.791 1.00 21.58 ? 423  MET A C   1 
ATOM   3630 O  O   . MET A 1 426 ? 48.684 74.099 -20.783 1.00 23.06 ? 423  MET A O   1 
ATOM   3631 C  CB  . MET A 1 426 ? 49.285 70.837 -20.256 1.00 20.02 ? 423  MET A CB  1 
ATOM   3632 C  CG  . MET A 1 426 ? 50.334 71.330 -21.211 1.00 23.55 ? 423  MET A CG  1 
ATOM   3633 S  SD  . MET A 1 426 ? 51.691 70.183 -21.212 1.00 28.59 ? 423  MET A SD  1 
ATOM   3634 C  CE  . MET A 1 426 ? 51.103 68.973 -22.311 1.00 22.27 ? 423  MET A CE  1 
ATOM   3635 N  N   . PHE A 1 427 ? 47.160 72.716 -21.732 1.00 20.54 ? 424  PHE A N   1 
ATOM   3636 C  CA  . PHE A 1 427 ? 46.958 73.621 -22.866 1.00 22.21 ? 424  PHE A CA  1 
ATOM   3637 C  C   . PHE A 1 427 ? 45.901 74.686 -22.727 1.00 22.21 ? 424  PHE A C   1 
ATOM   3638 O  O   . PHE A 1 427 ? 46.050 75.787 -23.282 1.00 23.38 ? 424  PHE A O   1 
ATOM   3639 C  CB  . PHE A 1 427 ? 46.696 72.762 -24.108 1.00 23.13 ? 424  PHE A CB  1 
ATOM   3640 C  CG  . PHE A 1 427 ? 47.932 72.070 -24.613 1.00 27.68 ? 424  PHE A CG  1 
ATOM   3641 C  CD1 . PHE A 1 427 ? 49.018 72.829 -25.066 1.00 36.90 ? 424  PHE A CD1 1 
ATOM   3642 C  CD2 . PHE A 1 427 ? 48.031 70.711 -24.676 1.00 29.11 ? 424  PHE A CD2 1 
ATOM   3643 C  CE1 . PHE A 1 427 ? 50.160 72.208 -25.544 1.00 38.85 ? 424  PHE A CE1 1 
ATOM   3644 C  CE2 . PHE A 1 427 ? 49.118 70.101 -25.151 1.00 31.24 ? 424  PHE A CE2 1 
ATOM   3645 C  CZ  . PHE A 1 427 ? 50.213 70.846 -25.594 1.00 36.10 ? 424  PHE A CZ  1 
ATOM   3646 N  N   . GLY A 1 428 ? 44.793 74.339 -22.086 1.00 21.29 ? 425  GLY A N   1 
ATOM   3647 C  CA  . GLY A 1 428 ? 43.657 75.228 -22.071 1.00 21.58 ? 425  GLY A CA  1 
ATOM   3648 C  C   . GLY A 1 428 ? 43.155 75.500 -23.462 1.00 21.91 ? 425  GLY A C   1 
ATOM   3649 O  O   . GLY A 1 428 ? 43.360 74.688 -24.372 1.00 23.84 ? 425  GLY A O   1 
ATOM   3650 N  N   . GLN A 1 429 ? 42.425 76.595 -23.570 1.00 21.70 ? 426  GLN A N   1 
ATOM   3651 C  CA  A GLN A 1 429 ? 41.792 77.057 -24.825 0.70 22.30 ? 426  GLN A CA  1 
ATOM   3652 C  CA  B GLN A 1 429 ? 41.886 77.071 -24.848 0.30 22.18 ? 426  GLN A CA  1 
ATOM   3653 C  C   . GLN A 1 429 ? 41.745 78.578 -24.800 1.00 23.22 ? 426  GLN A C   1 
ATOM   3654 O  O   . GLN A 1 429 ? 41.131 79.162 -23.893 1.00 23.19 ? 426  GLN A O   1 
ATOM   3655 C  CB  A GLN A 1 429 ? 40.358 76.484 -24.935 0.70 23.67 ? 426  GLN A CB  1 
ATOM   3656 C  CB  B GLN A 1 429 ? 40.563 76.383 -25.238 0.30 22.51 ? 426  GLN A CB  1 
ATOM   3657 C  CG  A GLN A 1 429 ? 40.253 74.976 -25.273 0.70 25.90 ? 426  GLN A CG  1 
ATOM   3658 C  CG  B GLN A 1 429 ? 39.338 76.681 -24.358 0.30 21.47 ? 426  GLN A CG  1 
ATOM   3659 C  CD  A GLN A 1 429 ? 38.893 74.560 -25.870 0.70 31.34 ? 426  GLN A CD  1 
ATOM   3660 C  CD  B GLN A 1 429 ? 38.086 75.915 -24.822 0.30 22.88 ? 426  GLN A CD  1 
ATOM   3661 O  OE1 A GLN A 1 429 ? 37.854 75.125 -25.538 0.70 32.11 ? 426  GLN A OE1 1 
ATOM   3662 O  OE1 B GLN A 1 429 ? 38.055 75.394 -25.942 0.30 25.59 ? 426  GLN A OE1 1 
ATOM   3663 N  NE2 A GLN A 1 429 ? 38.914 73.560 -26.753 0.70 31.79 ? 426  GLN A NE2 1 
ATOM   3664 N  NE2 B GLN A 1 429 ? 37.051 75.859 -23.974 0.30 24.59 ? 426  GLN A NE2 1 
ATOM   3665 N  N   . SER A 1 430 ? 42.358 79.224 -25.804 1.00 24.11 ? 427  SER A N   1 
ATOM   3666 C  CA  . SER A 1 430 ? 42.447 80.651 -25.807 1.00 25.03 ? 427  SER A CA  1 
ATOM   3667 C  C   . SER A 1 430 ? 41.161 81.287 -26.321 1.00 25.88 ? 427  SER A C   1 
ATOM   3668 O  O   . SER A 1 430 ? 40.321 80.621 -26.947 1.00 26.81 ? 427  SER A O   1 
ATOM   3669 C  CB  . SER A 1 430 ? 43.617 81.079 -26.702 1.00 27.79 ? 427  SER A CB  1 
ATOM   3670 O  OG  . SER A 1 430 ? 43.270 80.857 -28.057 1.00 28.22 ? 427  SER A OG  1 
ATOM   3671 N  N   . TYR A 1 431 ? 41.029 82.591 -26.059 1.00 27.12 ? 428  TYR A N   1 
ATOM   3672 C  CA  . TYR A 1 431 ? 39.930 83.381 -26.603 1.00 28.28 ? 428  TYR A CA  1 
ATOM   3673 C  C   . TYR A 1 431 ? 39.799 83.189 -28.113 1.00 28.48 ? 428  TYR A C   1 
ATOM   3674 O  O   . TYR A 1 431 ? 38.700 82.948 -28.627 1.00 28.02 ? 428  TYR A O   1 
ATOM   3675 C  CB  . TYR A 1 431 ? 40.093 84.873 -26.295 1.00 29.40 ? 428  TYR A CB  1 
ATOM   3676 C  CG  . TYR A 1 431 ? 38.945 85.734 -26.757 1.00 29.96 ? 428  TYR A CG  1 
ATOM   3677 C  CD1 . TYR A 1 431 ? 37.922 86.092 -25.882 1.00 29.78 ? 428  TYR A CD1 1 
ATOM   3678 C  CD2 . TYR A 1 431 ? 38.901 86.236 -28.049 1.00 34.27 ? 428  TYR A CD2 1 
ATOM   3679 C  CE1 . TYR A 1 431 ? 36.850 86.876 -26.298 1.00 32.79 ? 428  TYR A CE1 1 
ATOM   3680 C  CE2 . TYR A 1 431 ? 37.837 87.042 -28.459 1.00 34.83 ? 428  TYR A CE2 1 
ATOM   3681 C  CZ  . TYR A 1 431 ? 36.821 87.343 -27.574 1.00 35.16 ? 428  TYR A CZ  1 
ATOM   3682 O  OH  . TYR A 1 431 ? 35.782 88.145 -28.000 1.00 38.84 ? 428  TYR A OH  1 
ATOM   3683 N  N   . ASP A 1 432 ? 40.908 83.279 -28.845 1.00 31.14 ? 429  ASP A N   1 
ATOM   3684 C  CA  . ASP A 1 432 ? 40.836 83.146 -30.288 1.00 32.66 ? 429  ASP A CA  1 
ATOM   3685 C  C   . ASP A 1 432 ? 40.353 81.769 -30.733 1.00 31.86 ? 429  ASP A C   1 
ATOM   3686 O  O   . ASP A 1 432 ? 39.499 81.648 -31.609 1.00 31.12 ? 429  ASP A O   1 
ATOM   3687 C  CB  . ASP A 1 432 ? 42.198 83.459 -30.920 1.00 34.62 ? 429  ASP A CB  1 
ATOM   3688 C  CG  . ASP A 1 432 ? 42.515 84.939 -30.958 1.00 40.15 ? 429  ASP A CG  1 
ATOM   3689 O  OD1 . ASP A 1 432 ? 41.677 85.807 -30.601 1.00 44.79 ? 429  ASP A OD1 1 
ATOM   3690 O  OD2 . ASP A 1 432 ? 43.665 85.234 -31.379 1.00 45.80 ? 429  ASP A OD2 1 
ATOM   3691 N  N   . MET A 1 433 ? 40.841 80.725 -30.085 1.00 30.44 ? 430  MET A N   1 
ATOM   3692 C  CA  . MET A 1 433 ? 40.423 79.374 -30.401 1.00 30.29 ? 430  MET A CA  1 
ATOM   3693 C  C   . MET A 1 433 ? 38.936 79.253 -30.137 1.00 29.86 ? 430  MET A C   1 
ATOM   3694 O  O   . MET A 1 433 ? 38.206 78.739 -30.973 1.00 29.01 ? 430  MET A O   1 
ATOM   3695 C  CB  . MET A 1 433 ? 41.195 78.358 -29.536 1.00 31.71 ? 430  MET A CB  1 
ATOM   3696 C  CG  . MET A 1 433 ? 40.741 76.896 -29.740 1.00 35.59 ? 430  MET A CG  1 
ATOM   3697 S  SD  . MET A 1 433 ? 41.691 75.674 -28.812 1.00 43.21 ? 430  MET A SD  1 
ATOM   3698 C  CE  . MET A 1 433 ? 40.961 74.120 -29.388 1.00 47.81 ? 430  MET A CE  1 
ATOM   3699 N  N   . VAL A 1 434 ? 38.500 79.690 -28.950 1.00 28.98 ? 431  VAL A N   1 
ATOM   3700 C  CA  . VAL A 1 434 ? 37.086 79.591 -28.587 1.00 28.53 ? 431  VAL A CA  1 
ATOM   3701 C  C   . VAL A 1 434 ? 36.192 80.390 -29.533 1.00 30.23 ? 431  VAL A C   1 
ATOM   3702 O  O   . VAL A 1 434 ? 35.160 79.885 -30.021 1.00 30.98 ? 431  VAL A O   1 
ATOM   3703 C  CB  . VAL A 1 434 ? 36.852 80.056 -27.131 1.00 27.55 ? 431  VAL A CB  1 
ATOM   3704 C  CG1 . VAL A 1 434 ? 35.330 80.359 -26.953 1.00 31.08 ? 431  VAL A CG1 1 
ATOM   3705 C  CG2 . VAL A 1 434 ? 37.424 79.016 -26.173 1.00 27.95 ? 431  VAL A CG2 1 
ATOM   3706 N  N   . TYR A 1 435 ? 36.563 81.639 -29.790 1.00 28.47 ? 432  TYR A N   1 
ATOM   3707 C  CA  . TYR A 1 435 ? 35.794 82.516 -30.658 1.00 30.92 ? 432  TYR A CA  1 
ATOM   3708 C  C   . TYR A 1 435 ? 35.611 81.901 -32.055 1.00 31.67 ? 432  TYR A C   1 
ATOM   3709 O  O   . TYR A 1 435 ? 34.493 81.845 -32.587 1.00 31.42 ? 432  TYR A O   1 
ATOM   3710 C  CB  . TYR A 1 435 ? 36.497 83.849 -30.752 1.00 30.45 ? 432  TYR A CB  1 
ATOM   3711 C  CG  . TYR A 1 435 ? 35.817 84.839 -31.668 1.00 34.07 ? 432  TYR A CG  1 
ATOM   3712 C  CD1 . TYR A 1 435 ? 34.772 85.636 -31.215 1.00 34.83 ? 432  TYR A CD1 1 
ATOM   3713 C  CD2 . TYR A 1 435 ? 36.261 84.993 -32.955 1.00 36.93 ? 432  TYR A CD2 1 
ATOM   3714 C  CE1 . TYR A 1 435 ? 34.161 86.566 -32.053 1.00 37.80 ? 432  TYR A CE1 1 
ATOM   3715 C  CE2 . TYR A 1 435 ? 35.667 85.924 -33.804 1.00 39.26 ? 432  TYR A CE2 1 
ATOM   3716 C  CZ  . TYR A 1 435 ? 34.609 86.703 -33.341 1.00 40.06 ? 432  TYR A CZ  1 
ATOM   3717 O  OH  . TYR A 1 435 ? 34.008 87.636 -34.188 1.00 43.83 ? 432  TYR A OH  1 
ATOM   3718 N  N   . ASN A 1 436 ? 36.689 81.401 -32.634 1.00 32.68 ? 433  ASN A N   1 
ATOM   3719 C  CA  . ASN A 1 436 ? 36.595 80.813 -33.965 1.00 35.45 ? 433  ASN A CA  1 
ATOM   3720 C  C   . ASN A 1 436 ? 35.748 79.541 -33.970 1.00 35.55 ? 433  ASN A C   1 
ATOM   3721 O  O   . ASN A 1 436 ? 35.002 79.307 -34.914 1.00 36.34 ? 433  ASN A O   1 
ATOM   3722 C  CB  . ASN A 1 436 ? 37.992 80.552 -34.511 1.00 36.95 ? 433  ASN A CB  1 
ATOM   3723 C  CG  . ASN A 1 436 ? 38.700 81.832 -34.914 1.00 40.34 ? 433  ASN A CG  1 
ATOM   3724 O  OD1 . ASN A 1 436 ? 38.105 82.729 -35.488 1.00 46.54 ? 433  ASN A OD1 1 
ATOM   3725 N  ND2 . ASN A 1 436 ? 39.992 81.909 -34.618 1.00 48.87 ? 433  ASN A ND2 1 
ATOM   3726 N  N   . GLU A 1 437 ? 35.796 78.761 -32.893 1.00 34.61 ? 434  GLU A N   1 
ATOM   3727 C  CA  A GLU A 1 437 ? 34.954 77.573 -32.787 0.70 35.36 ? 434  GLU A CA  1 
ATOM   3728 C  CA  B GLU A 1 437 ? 34.945 77.576 -32.768 0.30 34.89 ? 434  GLU A CA  1 
ATOM   3729 C  C   . GLU A 1 437 ? 33.472 77.970 -32.686 1.00 35.06 ? 434  GLU A C   1 
ATOM   3730 O  O   . GLU A 1 437 ? 32.616 77.284 -33.234 1.00 36.88 ? 434  GLU A O   1 
ATOM   3731 C  CB  A GLU A 1 437 ? 35.397 76.662 -31.624 0.70 34.50 ? 434  GLU A CB  1 
ATOM   3732 C  CB  B GLU A 1 437 ? 35.333 76.749 -31.539 0.30 33.90 ? 434  GLU A CB  1 
ATOM   3733 C  CG  A GLU A 1 437 ? 36.801 76.011 -31.841 0.70 38.22 ? 434  GLU A CG  1 
ATOM   3734 C  CG  B GLU A 1 437 ? 34.601 75.408 -31.413 0.30 34.11 ? 434  GLU A CG  1 
ATOM   3735 C  CD  A GLU A 1 437 ? 37.117 74.834 -30.909 0.70 41.09 ? 434  GLU A CD  1 
ATOM   3736 C  CD  B GLU A 1 437 ? 34.997 74.652 -30.152 0.30 35.30 ? 434  GLU A CD  1 
ATOM   3737 O  OE1 A GLU A 1 437 ? 36.314 74.537 -30.014 0.70 40.64 ? 434  GLU A OE1 1 
ATOM   3738 O  OE1 B GLU A 1 437 ? 35.568 75.286 -29.233 0.30 36.64 ? 434  GLU A OE1 1 
ATOM   3739 O  OE2 A GLU A 1 437 ? 38.178 74.185 -31.086 0.70 45.80 ? 434  GLU A OE2 1 
ATOM   3740 O  OE2 B GLU A 1 437 ? 34.738 73.428 -30.073 0.30 37.23 ? 434  GLU A OE2 1 
ATOM   3741 N  N   . LEU A 1 438 ? 33.175 79.091 -32.022 1.00 34.55 ? 435  LEU A N   1 
ATOM   3742 C  CA  . LEU A 1 438 ? 31.785 79.533 -31.869 1.00 32.89 ? 435  LEU A CA  1 
ATOM   3743 C  C   . LEU A 1 438 ? 31.223 79.987 -33.197 1.00 34.56 ? 435  LEU A C   1 
ATOM   3744 O  O   . LEU A 1 438 ? 30.078 79.667 -33.519 1.00 34.99 ? 435  LEU A O   1 
ATOM   3745 C  CB  . LEU A 1 438 ? 31.636 80.664 -30.866 1.00 31.59 ? 435  LEU A CB  1 
ATOM   3746 C  CG  . LEU A 1 438 ? 31.851 80.272 -29.396 1.00 28.75 ? 435  LEU A CG  1 
ATOM   3747 C  CD1 . LEU A 1 438 ? 31.792 81.507 -28.508 1.00 27.36 ? 435  LEU A CD1 1 
ATOM   3748 C  CD2 . LEU A 1 438 ? 30.820 79.197 -28.985 1.00 29.43 ? 435  LEU A CD2 1 
ATOM   3749 N  N   . LEU A 1 439 ? 32.026 80.730 -33.959 1.00 36.21 ? 436  LEU A N   1 
ATOM   3750 C  CA  . LEU A 1 439 ? 31.627 81.125 -35.314 1.00 38.23 ? 436  LEU A CA  1 
ATOM   3751 C  C   . LEU A 1 439 ? 31.362 79.906 -36.175 1.00 40.83 ? 436  LEU A C   1 
ATOM   3752 O  O   . LEU A 1 439 ? 30.384 79.892 -36.934 1.00 42.36 ? 436  LEU A O   1 
ATOM   3753 C  CB  . LEU A 1 439 ? 32.713 81.970 -35.984 1.00 37.72 ? 436  LEU A CB  1 
ATOM   3754 C  CG  . LEU A 1 439 ? 32.989 83.336 -35.376 1.00 38.20 ? 436  LEU A CG  1 
ATOM   3755 C  CD1 . LEU A 1 439 ? 34.088 84.021 -36.105 1.00 40.01 ? 436  LEU A CD1 1 
ATOM   3756 C  CD2 . LEU A 1 439 ? 31.720 84.208 -35.358 1.00 38.86 ? 436  LEU A CD2 1 
ATOM   3757 N  N   . LYS A 1 440 ? 32.250 78.915 -36.113 1.00 41.87 ? 437  LYS A N   1 
ATOM   3758 C  CA  A LYS A 1 440 ? 32.118 77.683 -36.898 0.60 43.54 ? 437  LYS A CA  1 
ATOM   3759 C  CA  B LYS A 1 440 ? 32.095 77.709 -36.923 0.40 43.30 ? 437  LYS A CA  1 
ATOM   3760 C  C   . LYS A 1 440 ? 30.865 76.890 -36.513 1.00 43.46 ? 437  LYS A C   1 
ATOM   3761 O  O   . LYS A 1 440 ? 30.281 76.184 -37.344 1.00 45.01 ? 437  LYS A O   1 
ATOM   3762 C  CB  A LYS A 1 440 ? 33.361 76.800 -36.714 0.60 44.22 ? 437  LYS A CB  1 
ATOM   3763 C  CB  B LYS A 1 440 ? 33.375 76.865 -36.895 0.40 43.77 ? 437  LYS A CB  1 
ATOM   3764 C  CG  A LYS A 1 440 ? 33.502 75.666 -37.726 0.60 46.51 ? 437  LYS A CG  1 
ATOM   3765 C  CG  B LYS A 1 440 ? 34.352 77.248 -37.999 0.40 45.27 ? 437  LYS A CG  1 
ATOM   3766 C  CD  A LYS A 1 440 ? 34.790 74.907 -37.473 0.60 49.22 ? 437  LYS A CD  1 
ATOM   3767 C  CD  B LYS A 1 440 ? 35.785 76.846 -37.671 0.40 46.70 ? 437  LYS A CD  1 
ATOM   3768 C  CE  A LYS A 1 440 ? 34.894 73.645 -38.318 0.60 50.35 ? 437  LYS A CE  1 
ATOM   3769 C  CE  B LYS A 1 440 ? 36.663 78.072 -37.457 0.40 47.37 ? 437  LYS A CE  1 
ATOM   3770 N  NZ  A LYS A 1 440 ? 36.004 72.796 -37.813 0.60 50.90 ? 437  LYS A NZ  1 
ATOM   3771 N  NZ  B LYS A 1 440 ? 38.066 77.824 -37.856 0.40 47.94 ? 437  LYS A NZ  1 
ATOM   3772 N  N   . SER A 1 441 ? 30.448 76.999 -35.252 1.00 43.14 ? 438  SER A N   1 
ATOM   3773 C  CA  . SER A 1 441 ? 29.222 76.335 -34.771 1.00 43.29 ? 438  SER A CA  1 
ATOM   3774 C  C   . SER A 1 441 ? 27.938 77.035 -35.204 1.00 43.61 ? 438  SER A C   1 
ATOM   3775 O  O   . SER A 1 441 ? 26.854 76.492 -34.987 1.00 45.06 ? 438  SER A O   1 
ATOM   3776 C  CB  . SER A 1 441 ? 29.203 76.284 -33.258 1.00 42.06 ? 438  SER A CB  1 
ATOM   3777 O  OG  . SER A 1 441 ? 29.025 77.581 -32.747 1.00 43.48 ? 438  SER A OG  1 
ATOM   3778 N  N   . GLY A 1 442 ? 28.049 78.248 -35.732 1.00 43.28 ? 439  GLY A N   1 
ATOM   3779 C  CA  . GLY A 1 442 ? 26.898 78.968 -36.273 1.00 43.40 ? 439  GLY A CA  1 
ATOM   3780 C  C   . GLY A 1 442 ? 26.538 80.240 -35.535 1.00 42.53 ? 439  GLY A C   1 
ATOM   3781 O  O   . GLY A 1 442 ? 25.575 80.906 -35.899 1.00 43.30 ? 439  GLY A O   1 
ATOM   3782 N  N   . LEU A 1 443 ? 27.271 80.592 -34.476 1.00 40.96 ? 440  LEU A N   1 
ATOM   3783 C  CA  . LEU A 1 443 ? 26.982 81.860 -33.803 1.00 40.22 ? 440  LEU A CA  1 
ATOM   3784 C  C   . LEU A 1 443 ? 27.453 82.981 -34.686 1.00 40.61 ? 440  LEU A C   1 
ATOM   3785 O  O   . LEU A 1 443 ? 28.461 82.858 -35.402 1.00 41.75 ? 440  LEU A O   1 
ATOM   3786 C  CB  . LEU A 1 443 ? 27.673 81.980 -32.433 1.00 38.81 ? 440  LEU A CB  1 
ATOM   3787 C  CG  . LEU A 1 443 ? 27.181 81.072 -31.309 1.00 39.54 ? 440  LEU A CG  1 
ATOM   3788 C  CD1 . LEU A 1 443 ? 27.909 81.400 -30.027 1.00 36.56 ? 440  LEU A CD1 1 
ATOM   3789 C  CD2 . LEU A 1 443 ? 25.662 81.174 -31.104 1.00 41.31 ? 440  LEU A CD2 1 
ATOM   3790 N  N   . ASN A 1 444 ? 26.725 84.092 -34.664 1.00 40.15 ? 441  ASN A N   1 
ATOM   3791 C  CA  . ASN A 1 444 ? 27.205 85.278 -35.351 1.00 41.15 ? 441  ASN A CA  1 
ATOM   3792 C  C   . ASN A 1 444 ? 28.256 85.941 -34.496 1.00 40.47 ? 441  ASN A C   1 
ATOM   3793 O  O   . ASN A 1 444 ? 28.535 85.482 -33.378 1.00 37.38 ? 441  ASN A O   1 
ATOM   3794 C  CB  . ASN A 1 444 ? 26.070 86.252 -35.765 1.00 42.10 ? 441  ASN A CB  1 
ATOM   3795 C  CG  . ASN A 1 444 ? 25.384 86.944 -34.576 1.00 44.27 ? 441  ASN A CG  1 
ATOM   3796 O  OD1 . ASN A 1 444 ? 25.997 87.239 -33.537 1.00 41.36 ? 441  ASN A OD1 1 
ATOM   3797 N  ND2 . ASN A 1 444 ? 24.102 87.229 -34.744 1.00 42.51 ? 441  ASN A ND2 1 
ATOM   3798 N  N   . GLU A 1 445 ? 28.869 86.983 -35.026 1.00 41.08 ? 442  GLU A N   1 
ATOM   3799 C  CA  . GLU A 1 445 ? 29.981 87.659 -34.360 1.00 42.09 ? 442  GLU A CA  1 
ATOM   3800 C  C   . GLU A 1 445 ? 29.595 88.286 -33.022 1.00 41.03 ? 442  GLU A C   1 
ATOM   3801 O  O   . GLU A 1 445 ? 30.380 88.210 -32.095 1.00 38.64 ? 442  GLU A O   1 
ATOM   3802 C  CB  . GLU A 1 445 ? 30.657 88.684 -35.292 1.00 44.64 ? 442  GLU A CB  1 
ATOM   3803 C  CG  . GLU A 1 445 ? 31.494 87.991 -36.415 1.00 48.43 ? 442  GLU A CG  1 
ATOM   3804 C  CD  . GLU A 1 445 ? 32.148 88.933 -37.425 1.00 55.17 ? 442  GLU A CD  1 
ATOM   3805 O  OE1 . GLU A 1 445 ? 31.651 90.064 -37.616 1.00 60.39 ? 442  GLU A OE1 1 
ATOM   3806 O  OE2 . GLU A 1 445 ? 33.159 88.517 -38.051 1.00 58.13 ? 442  GLU A OE2 1 
ATOM   3807 N  N   . THR A 1 446 ? 28.397 88.864 -32.898 1.00 40.57 ? 443  THR A N   1 
ATOM   3808 C  CA  . THR A 1 446 ? 27.990 89.498 -31.635 1.00 40.37 ? 443  THR A CA  1 
ATOM   3809 C  C   . THR A 1 446 ? 27.830 88.431 -30.547 1.00 37.59 ? 443  THR A C   1 
ATOM   3810 O  O   . THR A 1 446 ? 28.324 88.579 -29.417 1.00 37.53 ? 443  THR A O   1 
ATOM   3811 C  CB  . THR A 1 446 ? 26.695 90.270 -31.779 1.00 41.08 ? 443  THR A CB  1 
ATOM   3812 O  OG1 . THR A 1 446 ? 26.841 91.215 -32.844 1.00 44.96 ? 443  THR A OG1 1 
ATOM   3813 C  CG2 . THR A 1 446 ? 26.353 91.016 -30.465 1.00 43.16 ? 443  THR A CG2 1 
ATOM   3814 N  N   . GLN A 1 447 ? 27.136 87.359 -30.915 1.00 36.05 ? 444  GLN A N   1 
ATOM   3815 C  CA  . GLN A 1 447 ? 26.938 86.242 -30.025 1.00 33.77 ? 444  GLN A CA  1 
ATOM   3816 C  C   . GLN A 1 447 ? 28.260 85.598 -29.604 1.00 31.96 ? 444  GLN A C   1 
ATOM   3817 O  O   . GLN A 1 447 ? 28.418 85.216 -28.435 1.00 29.14 ? 444  GLN A O   1 
ATOM   3818 C  CB  . GLN A 1 447 ? 26.063 85.177 -30.674 1.00 34.91 ? 444  GLN A CB  1 
ATOM   3819 C  CG  . GLN A 1 447 ? 24.623 85.599 -30.968 1.00 39.55 ? 444  GLN A CG  1 
ATOM   3820 C  CD  . GLN A 1 447 ? 23.933 84.539 -31.821 1.00 42.26 ? 444  GLN A CD  1 
ATOM   3821 O  OE1 . GLN A 1 447 ? 24.489 84.086 -32.828 1.00 41.58 ? 444  GLN A OE1 1 
ATOM   3822 N  NE2 . GLN A 1 447 ? 22.766 84.084 -31.376 1.00 45.85 ? 444  GLN A NE2 1 
ATOM   3823 N  N   . ALA A 1 448 ? 29.175 85.409 -30.546 1.00 30.74 ? 445  ALA A N   1 
ATOM   3824 C  CA  . ALA A 1 448 ? 30.453 84.779 -30.236 1.00 30.92 ? 445  ALA A CA  1 
ATOM   3825 C  C   . ALA A 1 448 ? 31.279 85.673 -29.307 1.00 31.56 ? 445  ALA A C   1 
ATOM   3826 O  O   . ALA A 1 448 ? 31.922 85.158 -28.364 1.00 29.08 ? 445  ALA A O   1 
ATOM   3827 C  CB  . ALA A 1 448 ? 31.236 84.412 -31.470 1.00 31.55 ? 445  ALA A CB  1 
ATOM   3828 N  N   . LYS A 1 449 ? 31.240 86.988 -29.515 1.00 33.94 ? 446  LYS A N   1 
ATOM   3829 C  CA  A LYS A 1 449 ? 31.973 87.923 -28.647 0.60 34.74 ? 446  LYS A CA  1 
ATOM   3830 C  CA  B LYS A 1 449 ? 31.981 87.913 -28.647 0.40 34.39 ? 446  LYS A CA  1 
ATOM   3831 C  C   . LYS A 1 449 ? 31.440 87.929 -27.220 1.00 33.90 ? 446  LYS A C   1 
ATOM   3832 O  O   . LYS A 1 449 ? 32.211 88.064 -26.270 1.00 34.85 ? 446  LYS A O   1 
ATOM   3833 C  CB  A LYS A 1 449 ? 31.940 89.353 -29.201 0.60 36.55 ? 446  LYS A CB  1 
ATOM   3834 C  CB  B LYS A 1 449 ? 31.987 89.329 -29.233 0.40 35.84 ? 446  LYS A CB  1 
ATOM   3835 C  CG  A LYS A 1 449 ? 32.568 90.366 -28.239 0.60 38.30 ? 446  LYS A CG  1 
ATOM   3836 C  CG  B LYS A 1 449 ? 32.914 89.456 -30.430 0.40 36.68 ? 446  LYS A CG  1 
ATOM   3837 C  CD  A LYS A 1 449 ? 33.469 91.401 -28.912 0.60 43.00 ? 446  LYS A CD  1 
ATOM   3838 C  CD  B LYS A 1 449 ? 32.897 90.826 -31.053 0.40 39.79 ? 446  LYS A CD  1 
ATOM   3839 C  CE  A LYS A 1 449 ? 34.476 91.937 -27.885 0.60 43.09 ? 446  LYS A CE  1 
ATOM   3840 C  CE  B LYS A 1 449 ? 33.331 90.720 -32.500 0.40 40.96 ? 446  LYS A CE  1 
ATOM   3841 N  NZ  A LYS A 1 449 ? 33.812 92.213 -26.571 0.60 45.16 ? 446  LYS A NZ  1 
ATOM   3842 N  NZ  B LYS A 1 449 ? 32.374 91.431 -33.391 0.40 42.80 ? 446  LYS A NZ  1 
ATOM   3843 N  N   . GLU A 1 450 ? 30.126 87.784 -27.073 1.00 34.10 ? 447  GLU A N   1 
ATOM   3844 C  CA  A GLU A 1 450 ? 29.469 87.793 -25.764 0.60 33.72 ? 447  GLU A CA  1 
ATOM   3845 C  CA  B GLU A 1 450 ? 29.494 87.809 -25.746 0.40 33.18 ? 447  GLU A CA  1 
ATOM   3846 C  C   . GLU A 1 450 ? 29.814 86.556 -24.947 1.00 31.74 ? 447  GLU A C   1 
ATOM   3847 O  O   . GLU A 1 450 ? 29.898 86.617 -23.693 1.00 31.71 ? 447  GLU A O   1 
ATOM   3848 C  CB  A GLU A 1 450 ? 27.954 87.817 -25.940 0.60 35.00 ? 447  GLU A CB  1 
ATOM   3849 C  CB  B GLU A 1 450 ? 27.974 87.930 -25.847 0.40 34.04 ? 447  GLU A CB  1 
ATOM   3850 C  CG  A GLU A 1 450 ? 27.239 88.813 -25.051 0.60 39.24 ? 447  GLU A CG  1 
ATOM   3851 C  CG  B GLU A 1 450 ? 27.254 88.089 -24.498 0.40 35.26 ? 447  GLU A CG  1 
ATOM   3852 C  CD  A GLU A 1 450 ? 25.867 89.165 -25.583 0.60 42.10 ? 447  GLU A CD  1 
ATOM   3853 C  CD  B GLU A 1 450 ? 27.602 89.401 -23.787 0.40 38.50 ? 447  GLU A CD  1 
ATOM   3854 O  OE1 A GLU A 1 450 ? 25.733 90.207 -26.277 0.60 45.58 ? 447  GLU A OE1 1 
ATOM   3855 O  OE1 B GLU A 1 450 ? 27.799 90.419 -24.486 0.40 41.46 ? 447  GLU A OE1 1 
ATOM   3856 O  OE2 A GLU A 1 450 ? 24.931 88.381 -25.320 0.60 42.65 ? 447  GLU A OE2 1 
ATOM   3857 O  OE2 B GLU A 1 450 ? 27.648 89.418 -22.534 0.40 41.10 ? 447  GLU A OE2 1 
ATOM   3858 N  N   . LEU A 1 451 ? 29.978 85.441 -25.646 1.00 27.43 ? 448  LEU A N   1 
ATOM   3859 C  CA  . LEU A 1 451 ? 30.202 84.145 -24.960 1.00 25.51 ? 448  LEU A CA  1 
ATOM   3860 C  C   . LEU A 1 451 ? 31.670 83.715 -24.776 1.00 24.32 ? 448  LEU A C   1 
ATOM   3861 O  O   . LEU A 1 451 ? 32.020 83.040 -23.781 1.00 23.62 ? 448  LEU A O   1 
ATOM   3862 C  CB  . LEU A 1 451 ? 29.449 83.065 -25.682 1.00 25.42 ? 448  LEU A CB  1 
ATOM   3863 C  CG  . LEU A 1 451 ? 29.526 81.656 -25.180 1.00 25.70 ? 448  LEU A CG  1 
ATOM   3864 C  CD1 . LEU A 1 451 ? 29.052 81.662 -23.665 1.00 23.99 ? 448  LEU A CD1 1 
ATOM   3865 C  CD2 . LEU A 1 451 ? 28.678 80.687 -26.031 1.00 26.97 ? 448  LEU A CD2 1 
ATOM   3866 N  N   . ALA A 1 452 ? 32.528 84.102 -25.707 1.00 24.43 ? 449  ALA A N   1 
ATOM   3867 C  CA  . ALA A 1 452 ? 33.845 83.530 -25.779 1.00 23.66 ? 449  ALA A CA  1 
ATOM   3868 C  C   . ALA A 1 452 ? 34.636 83.638 -24.481 1.00 23.47 ? 449  ALA A C   1 
ATOM   3869 O  O   . ALA A 1 452 ? 35.286 82.674 -24.117 1.00 23.30 ? 449  ALA A O   1 
ATOM   3870 C  CB  . ALA A 1 452 ? 34.639 84.159 -26.985 1.00 25.28 ? 449  ALA A CB  1 
ATOM   3871 N  N   . ALA A 1 453 ? 34.602 84.790 -23.794 1.00 23.88 ? 450  ALA A N   1 
ATOM   3872 C  CA  . ALA A 1 453 ? 35.437 84.957 -22.610 1.00 24.55 ? 450  ALA A CA  1 
ATOM   3873 C  C   . ALA A 1 453 ? 35.051 83.952 -21.556 1.00 23.42 ? 450  ALA A C   1 
ATOM   3874 O  O   . ALA A 1 453 ? 35.923 83.525 -20.790 1.00 24.43 ? 450  ALA A O   1 
ATOM   3875 C  CB  . ALA A 1 453 ? 35.308 86.378 -22.041 1.00 26.05 ? 450  ALA A CB  1 
ATOM   3876 N  N   . HIS A 1 454 ? 33.771 83.553 -21.551 1.00 21.69 ? 451  HIS A N   1 
ATOM   3877 C  CA  . HIS A 1 454 ? 33.289 82.587 -20.520 1.00 20.36 ? 451  HIS A CA  1 
ATOM   3878 C  C   . HIS A 1 454 ? 33.776 81.186 -20.770 1.00 20.53 ? 451  HIS A C   1 
ATOM   3879 O  O   . HIS A 1 454 ? 33.806 80.396 -19.851 1.00 19.44 ? 451  HIS A O   1 
ATOM   3880 C  CB  . HIS A 1 454 ? 31.781 82.582 -20.511 1.00 20.15 ? 451  HIS A CB  1 
ATOM   3881 C  CG  . HIS A 1 454 ? 31.201 83.878 -20.082 1.00 20.43 ? 451  HIS A CG  1 
ATOM   3882 N  ND1 . HIS A 1 454 ? 31.064 84.235 -18.757 1.00 19.13 ? 451  HIS A ND1 1 
ATOM   3883 C  CD2 . HIS A 1 454 ? 30.863 84.968 -20.806 1.00 21.43 ? 451  HIS A CD2 1 
ATOM   3884 C  CE1 . HIS A 1 454 ? 30.591 85.458 -18.690 1.00 21.05 ? 451  HIS A CE1 1 
ATOM   3885 N  NE2 . HIS A 1 454 ? 30.473 85.944 -19.925 1.00 23.91 ? 451  HIS A NE2 1 
ATOM   3886 N  N   . LYS A 1 455 ? 34.179 80.874 -21.994 1.00 20.00 ? 452  LYS A N   1 
ATOM   3887 C  CA  . LYS A 1 455 ? 34.682 79.571 -22.364 1.00 21.08 ? 452  LYS A CA  1 
ATOM   3888 C  C   . LYS A 1 455 ? 36.199 79.479 -22.355 1.00 20.79 ? 452  LYS A C   1 
ATOM   3889 O  O   . LYS A 1 455 ? 36.728 78.382 -22.503 1.00 21.27 ? 452  LYS A O   1 
ATOM   3890 C  CB  . LYS A 1 455 ? 34.187 79.156 -23.722 1.00 22.77 ? 452  LYS A CB  1 
ATOM   3891 C  CG  . LYS A 1 455 ? 32.655 79.060 -23.792 1.00 23.47 ? 452  LYS A CG  1 
ATOM   3892 C  CD  . LYS A 1 455 ? 32.138 78.457 -25.047 1.00 24.50 ? 452  LYS A CD  1 
ATOM   3893 C  CE  . LYS A 1 455 ? 32.564 77.061 -25.278 1.00 25.53 ? 452  LYS A CE  1 
ATOM   3894 N  NZ  . LYS A 1 455 ? 32.037 76.493 -26.583 1.00 30.33 ? 452  LYS A NZ  1 
ATOM   3895 N  N   . VAL A 1 456 ? 36.897 80.616 -22.170 1.00 21.45 ? 453  VAL A N   1 
ATOM   3896 C  CA  . VAL A 1 456 ? 38.364 80.575 -22.148 1.00 22.46 ? 453  VAL A CA  1 
ATOM   3897 C  C   . VAL A 1 456 ? 38.814 79.675 -21.006 1.00 20.50 ? 453  VAL A C   1 
ATOM   3898 O  O   . VAL A 1 456 ? 38.356 79.792 -19.857 1.00 20.59 ? 453  VAL A O   1 
ATOM   3899 C  CB  . VAL A 1 456 ? 38.964 81.971 -22.054 1.00 22.04 ? 453  VAL A CB  1 
ATOM   3900 C  CG1 . VAL A 1 456 ? 40.467 81.918 -21.718 1.00 24.19 ? 453  VAL A CG1 1 
ATOM   3901 C  CG2 . VAL A 1 456 ? 38.747 82.679 -23.389 1.00 24.71 ? 453  VAL A CG2 1 
ATOM   3902 N  N   . ILE A 1 457 ? 39.778 78.805 -21.293 1.00 21.08 ? 454  ILE A N   1 
ATOM   3903 C  CA  . ILE A 1 457 ? 40.342 77.934 -20.287 1.00 20.41 ? 454  ILE A CA  1 
ATOM   3904 C  C   . ILE A 1 457 ? 41.832 78.310 -20.205 1.00 22.22 ? 454  ILE A C   1 
ATOM   3905 O  O   . ILE A 1 457 ? 42.581 78.141 -21.173 1.00 21.93 ? 454  ILE A O   1 
ATOM   3906 C  CB  . ILE A 1 457 ? 40.224 76.469 -20.687 1.00 19.64 ? 454  ILE A CB  1 
ATOM   3907 C  CG1 . ILE A 1 457 ? 38.808 76.042 -21.108 1.00 24.41 ? 454  ILE A CG1 1 
ATOM   3908 C  CG2 . ILE A 1 457 ? 40.815 75.549 -19.543 1.00 19.22 ? 454  ILE A CG2 1 
ATOM   3909 C  CD1 . ILE A 1 457 ? 37.894 75.891 -20.084 1.00 25.48 ? 454  ILE A CD1 1 
ATOM   3910 N  N   . PRO A 1 458 ? 42.251 78.855 -19.080 1.00 22.40 ? 455  PRO A N   1 
ATOM   3911 C  CA  . PRO A 1 458 ? 43.585 79.470 -19.140 1.00 23.83 ? 455  PRO A CA  1 
ATOM   3912 C  C   . PRO A 1 458 ? 44.743 78.551 -19.404 1.00 22.42 ? 455  PRO A C   1 
ATOM   3913 O  O   . PRO A 1 458 ? 45.702 78.959 -20.053 1.00 22.61 ? 455  PRO A O   1 
ATOM   3914 C  CB  . PRO A 1 458 ? 43.772 80.069 -17.775 1.00 24.84 ? 455  PRO A CB  1 
ATOM   3915 C  CG  . PRO A 1 458 ? 42.803 79.551 -16.984 1.00 25.85 ? 455  PRO A CG  1 
ATOM   3916 C  CD  . PRO A 1 458 ? 41.591 79.205 -17.820 1.00 24.18 ? 455  PRO A CD  1 
ATOM   3917 N  N   . GLY A 1 459 ? 44.687 77.328 -18.864 1.00 21.10 ? 456  GLY A N   1 
ATOM   3918 C  CA  . GLY A 1 459 ? 45.724 76.368 -19.113 1.00 20.82 ? 456  GLY A CA  1 
ATOM   3919 C  C   . GLY A 1 459 ? 47.027 76.728 -18.382 1.00 21.06 ? 456  GLY A C   1 
ATOM   3920 O  O   . GLY A 1 459 ? 47.046 77.548 -17.456 1.00 21.29 ? 456  GLY A O   1 
ATOM   3921 N  N   . ASN A 1 460 ? 48.091 76.042 -18.767 1.00 20.35 ? 457  ASN A N   1 
ATOM   3922 C  CA  . ASN A 1 460 ? 49.373 76.136 -18.106 1.00 20.83 ? 457  ASN A CA  1 
ATOM   3923 C  C   . ASN A 1 460 ? 49.293 75.691 -16.647 1.00 21.73 ? 457  ASN A C   1 
ATOM   3924 O  O   . ASN A 1 460 ? 50.044 76.165 -15.765 1.00 21.28 ? 457  ASN A O   1 
ATOM   3925 C  CB  . ASN A 1 460 ? 49.983 77.532 -18.222 1.00 22.49 ? 457  ASN A CB  1 
ATOM   3926 C  CG  . ASN A 1 460 ? 51.502 77.465 -18.233 1.00 23.33 ? 457  ASN A CG  1 
ATOM   3927 O  OD1 . ASN A 1 460 ? 52.079 76.588 -18.906 1.00 26.35 ? 457  ASN A OD1 1 
ATOM   3928 N  ND2 . ASN A 1 460 ? 52.182 78.344 -17.427 1.00 23.79 ? 457  ASN A ND2 1 
ATOM   3929 N  N   . ARG A 1 461 ? 48.402 74.726 -16.393 1.00 20.39 ? 458  ARG A N   1 
ATOM   3930 C  CA  . ARG A 1 461 ? 48.223 74.175 -15.047 1.00 19.12 ? 458  ARG A CA  1 
ATOM   3931 C  C   . ARG A 1 461 ? 48.868 72.808 -14.945 1.00 18.65 ? 458  ARG A C   1 
ATOM   3932 O  O   . ARG A 1 461 ? 48.731 71.967 -15.839 1.00 19.57 ? 458  ARG A O   1 
ATOM   3933 C  CB  . ARG A 1 461 ? 46.724 74.147 -14.658 1.00 19.06 ? 458  ARG A CB  1 
ATOM   3934 C  CG  . ARG A 1 461 ? 46.098 75.532 -14.651 1.00 20.43 ? 458  ARG A CG  1 
ATOM   3935 C  CD  . ARG A 1 461 ? 44.727 75.605 -14.178 1.00 19.33 ? 458  ARG A CD  1 
ATOM   3936 N  NE  . ARG A 1 461 ? 44.369 77.038 -14.157 1.00 20.42 ? 458  ARG A NE  1 
ATOM   3937 C  CZ  . ARG A 1 461 ? 43.349 77.576 -13.501 1.00 20.25 ? 458  ARG A CZ  1 
ATOM   3938 N  NH1 . ARG A 1 461 ? 42.487 76.815 -12.854 1.00 21.03 ? 458  ARG A NH1 1 
ATOM   3939 N  NH2 . ARG A 1 461 ? 43.182 78.900 -13.477 1.00 22.02 ? 458  ARG A NH2 1 
ATOM   3940 N  N   . PRO A 1 462 ? 49.549 72.554 -13.821 1.00 18.50 ? 459  PRO A N   1 
ATOM   3941 C  CA  . PRO A 1 462 ? 50.443 71.415 -13.739 1.00 18.75 ? 459  PRO A CA  1 
ATOM   3942 C  C   . PRO A 1 462 ? 49.743 70.114 -13.394 1.00 18.62 ? 459  PRO A C   1 
ATOM   3943 O  O   . PRO A 1 462 ? 48.694 70.110 -12.730 1.00 18.40 ? 459  PRO A O   1 
ATOM   3944 C  CB  . PRO A 1 462 ? 51.363 71.808 -12.615 1.00 18.94 ? 459  PRO A CB  1 
ATOM   3945 C  CG  . PRO A 1 462 ? 50.548 72.599 -11.720 1.00 20.13 ? 459  PRO A CG  1 
ATOM   3946 C  CD  . PRO A 1 462 ? 49.739 73.456 -12.699 1.00 18.95 ? 459  PRO A CD  1 
ATOM   3947 N  N   . SER A 1 463 ? 50.332 69.012 -13.802 1.00 18.07 ? 460  SER A N   1 
ATOM   3948 C  CA  . SER A 1 463 ? 49.885 67.697 -13.322 1.00 16.86 ? 460  SER A CA  1 
ATOM   3949 C  C   . SER A 1 463 ? 51.010 66.680 -13.387 1.00 17.06 ? 460  SER A C   1 
ATOM   3950 O  O   . SER A 1 463 ? 51.986 66.849 -14.143 1.00 17.11 ? 460  SER A O   1 
ATOM   3951 C  CB  . SER A 1 463 ? 48.711 67.203 -14.149 1.00 16.59 ? 460  SER A CB  1 
ATOM   3952 O  OG  . SER A 1 463 ? 49.048 66.958 -15.488 1.00 17.65 ? 460  SER A OG  1 
ATOM   3953 N  N   . THR A 1 464 ? 50.883 65.622 -12.599 1.00 16.66 ? 461  THR A N   1 
ATOM   3954 C  CA  . THR A 1 464 ? 51.670 64.411 -12.655 1.00 15.86 ? 461  THR A CA  1 
ATOM   3955 C  C   . THR A 1 464 ? 50.720 63.305 -13.013 1.00 15.56 ? 461  THR A C   1 
ATOM   3956 O  O   . THR A 1 464 ? 49.588 63.306 -12.508 1.00 16.02 ? 461  THR A O   1 
ATOM   3957 C  CB  . THR A 1 464 ? 52.283 64.123 -11.290 1.00 16.71 ? 461  THR A CB  1 
ATOM   3958 O  OG1 . THR A 1 464 ? 53.217 65.180 -11.001 1.00 18.31 ? 461  THR A OG1 1 
ATOM   3959 C  CG2 . THR A 1 464 ? 53.013 62.748 -11.238 1.00 18.25 ? 461  THR A CG2 1 
ATOM   3960 N  N   . THR A 1 465 ? 51.163 62.350 -13.816 1.00 15.99 ? 462  THR A N   1 
ATOM   3961 C  CA  . THR A 1 465 ? 50.409 61.127 -14.052 1.00 15.45 ? 462  THR A CA  1 
ATOM   3962 C  C   . THR A 1 465 ? 51.243 59.938 -13.587 1.00 17.14 ? 462  THR A C   1 
ATOM   3963 O  O   . THR A 1 465 ? 52.370 59.746 -14.051 1.00 17.55 ? 462  THR A O   1 
ATOM   3964 C  CB  . THR A 1 465 ? 49.945 60.992 -15.491 1.00 16.54 ? 462  THR A CB  1 
ATOM   3965 O  OG1 . THR A 1 465 ? 49.078 62.086 -15.795 1.00 16.60 ? 462  THR A OG1 1 
ATOM   3966 C  CG2 . THR A 1 465 ? 49.150 59.646 -15.696 1.00 17.79 ? 462  THR A CG2 1 
ATOM   3967 N  N   . ILE A 1 466 ? 50.662 59.113 -12.740 1.00 16.12 ? 463  ILE A N   1 
ATOM   3968 C  CA  . ILE A 1 466 ? 51.275 57.870 -12.279 1.00 15.52 ? 463  ILE A CA  1 
ATOM   3969 C  C   . ILE A 1 466 ? 50.456 56.753 -12.903 1.00 16.93 ? 463  ILE A C   1 
ATOM   3970 O  O   . ILE A 1 466 ? 49.253 56.619 -12.633 1.00 16.47 ? 463  ILE A O   1 
ATOM   3971 C  CB  . ILE A 1 466 ? 51.279 57.751 -10.756 1.00 16.04 ? 463  ILE A CB  1 
ATOM   3972 C  CG1 . ILE A 1 466 ? 51.873 58.996 -10.097 1.00 18.87 ? 463  ILE A CG1 1 
ATOM   3973 C  CG2 . ILE A 1 466 ? 51.973 56.471 -10.298 1.00 17.94 ? 463  ILE A CG2 1 
ATOM   3974 C  CD1 . ILE A 1 466 ? 52.049 58.951 -8.584  1.00 19.90 ? 463  ILE A CD1 1 
ATOM   3975 N  N   . LEU A 1 467 ? 51.101 55.984 -13.767 1.00 16.02 ? 464  LEU A N   1 
ATOM   3976 C  CA  . LEU A 1 467 ? 50.472 54.903 -14.517 1.00 16.23 ? 464  LEU A CA  1 
ATOM   3977 C  C   . LEU A 1 467 ? 50.959 53.539 -14.025 1.00 17.24 ? 464  LEU A C   1 
ATOM   3978 O  O   . LEU A 1 467 ? 52.161 53.247 -14.087 1.00 17.85 ? 464  LEU A O   1 
ATOM   3979 C  CB  . LEU A 1 467 ? 50.795 55.050 -16.029 1.00 16.86 ? 464  LEU A CB  1 
ATOM   3980 C  CG  . LEU A 1 467 ? 50.202 53.984 -16.923 1.00 16.82 ? 464  LEU A CG  1 
ATOM   3981 C  CD1 . LEU A 1 467 ? 48.678 53.961 -17.008 1.00 19.24 ? 464  LEU A CD1 1 
ATOM   3982 C  CD2 . LEU A 1 467 ? 50.815 54.191 -18.387 1.00 20.02 ? 464  LEU A CD2 1 
ATOM   3983 N  N   . LEU A 1 468 ? 50.017 52.712 -13.535 1.00 15.43 ? 465  LEU A N   1 
ATOM   3984 C  CA  . LEU A 1 468 ? 50.278 51.353 -13.131 1.00 16.12 ? 465  LEU A CA  1 
ATOM   3985 C  C   . LEU A 1 468 ? 49.903 50.433 -14.289 1.00 16.07 ? 465  LEU A C   1 
ATOM   3986 O  O   . LEU A 1 468 ? 48.955 50.725 -15.048 1.00 18.32 ? 465  LEU A O   1 
ATOM   3987 C  CB  . LEU A 1 468 ? 49.447 51.004 -11.916 1.00 14.51 ? 465  LEU A CB  1 
ATOM   3988 C  CG  . LEU A 1 468 ? 50.002 51.374 -10.569 1.00 15.60 ? 465  LEU A CG  1 
ATOM   3989 C  CD1 . LEU A 1 468 ? 50.338 52.866 -10.460 1.00 18.68 ? 465  LEU A CD1 1 
ATOM   3990 C  CD2 . LEU A 1 468 ? 49.051 50.951 -9.412  1.00 15.61 ? 465  LEU A CD2 1 
ATOM   3991 N  N   . ASP A 1 469 ? 50.574 49.289 -14.399 1.00 16.37 ? 466  ASP A N   1 
ATOM   3992 C  CA  . ASP A 1 469 ? 50.148 48.309 -15.401 1.00 17.04 ? 466  ASP A CA  1 
ATOM   3993 C  C   . ASP A 1 469 ? 48.774 47.692 -15.079 1.00 16.95 ? 466  ASP A C   1 
ATOM   3994 O  O   . ASP A 1 469 ? 47.960 47.497 -15.985 1.00 17.52 ? 466  ASP A O   1 
ATOM   3995 C  CB  . ASP A 1 469 ? 51.196 47.210 -15.619 1.00 20.35 ? 466  ASP A CB  1 
ATOM   3996 C  CG  . ASP A 1 469 ? 51.514 46.432 -14.383 1.00 22.10 ? 466  ASP A CG  1 
ATOM   3997 O  OD1 . ASP A 1 469 ? 51.402 46.827 -13.205 1.00 23.30 ? 466  ASP A OD1 1 
ATOM   3998 O  OD2 . ASP A 1 469 ? 52.008 45.303 -14.692 1.00 30.30 ? 466  ASP A OD2 1 
ATOM   3999 N  N   . GLU A 1 470 ? 48.528 47.464 -13.809 1.00 17.08 ? 467  GLU A N   1 
ATOM   4000 C  CA  . GLU A 1 470 ? 47.293 46.885 -13.310 1.00 16.27 ? 467  GLU A CA  1 
ATOM   4001 C  C   . GLU A 1 470 ? 47.176 47.266 -11.848 1.00 16.55 ? 467  GLU A C   1 
ATOM   4002 O  O   . GLU A 1 470 ? 48.201 47.686 -11.270 1.00 16.59 ? 467  GLU A O   1 
ATOM   4003 C  CB  . GLU A 1 470 ? 47.293 45.346 -13.488 1.00 16.72 ? 467  GLU A CB  1 
ATOM   4004 C  CG  . GLU A 1 470 ? 48.376 44.632 -12.757 1.00 19.09 ? 467  GLU A CG  1 
ATOM   4005 C  CD  . GLU A 1 470 ? 48.369 43.129 -12.960 1.00 26.33 ? 467  GLU A CD  1 
ATOM   4006 O  OE1 . GLU A 1 470 ? 47.800 42.672 -13.953 1.00 31.85 ? 467  GLU A OE1 1 
ATOM   4007 O  OE2 . GLU A 1 470 ? 49.035 42.446 -12.193 1.00 25.68 ? 467  GLU A OE2 1 
ATOM   4008 N  N   . LEU A 1 471 ? 46.025 47.046 -11.253 1.00 15.69 ? 468  LEU A N   1 
ATOM   4009 C  CA  . LEU A 1 471 ? 45.812 47.277 -9.809  1.00 14.40 ? 468  LEU A CA  1 
ATOM   4010 C  C   . LEU A 1 471 ? 45.727 45.922 -9.108  1.00 14.89 ? 468  LEU A C   1 
ATOM   4011 O  O   . LEU A 1 471 ? 44.695 45.316 -8.996  1.00 17.35 ? 468  LEU A O   1 
ATOM   4012 C  CB  . LEU A 1 471 ? 44.586 48.129 -9.526  1.00 13.69 ? 468  LEU A CB  1 
ATOM   4013 C  CG  . LEU A 1 471 ? 44.397 48.584 -8.086  1.00 14.11 ? 468  LEU A CG  1 
ATOM   4014 C  CD1 . LEU A 1 471 ? 45.541 49.523 -7.670  1.00 15.37 ? 468  LEU A CD1 1 
ATOM   4015 C  CD2 . LEU A 1 471 ? 43.084 49.236 -7.914  1.00 15.65 ? 468  LEU A CD2 1 
ATOM   4016 N  N   . SER A 1 472 ? 46.890 45.410 -8.753  1.00 15.21 ? 469  SER A N   1 
ATOM   4017 C  CA  . SER A 1 472 ? 47.076 44.118 -8.108  1.00 14.59 ? 469  SER A CA  1 
ATOM   4018 C  C   . SER A 1 472 ? 47.469 44.367 -6.682  1.00 14.42 ? 469  SER A C   1 
ATOM   4019 O  O   . SER A 1 472 ? 47.816 45.512 -6.297  1.00 14.02 ? 469  SER A O   1 
ATOM   4020 C  CB  . SER A 1 472 ? 48.172 43.370 -8.816  1.00 15.20 ? 469  SER A CB  1 
ATOM   4021 O  OG  . SER A 1 472 ? 49.413 44.089 -8.741  1.00 16.35 ? 469  SER A OG  1 
ATOM   4022 N  N   . PRO A 1 473 ? 47.463 43.307 -5.842  1.00 14.01 ? 470  PRO A N   1 
ATOM   4023 C  CA  . PRO A 1 473 ? 48.021 43.468 -4.488  1.00 14.32 ? 470  PRO A CA  1 
ATOM   4024 C  C   . PRO A 1 473 ? 49.420 44.137 -4.545  1.00 13.40 ? 470  PRO A C   1 
ATOM   4025 O  O   . PRO A 1 473 ? 49.678 45.110 -3.810  1.00 13.32 ? 470  PRO A O   1 
ATOM   4026 C  CB  . PRO A 1 473 ? 48.011 42.037 -3.936  1.00 15.09 ? 470  PRO A CB  1 
ATOM   4027 C  CG  . PRO A 1 473 ? 46.861 41.381 -4.638  1.00 13.86 ? 470  PRO A CG  1 
ATOM   4028 C  CD  . PRO A 1 473 ? 46.906 41.942 -6.056  1.00 14.44 ? 470  PRO A CD  1 
ATOM   4029 N  N   . TYR A 1 474 ? 50.301 43.621 -5.387  1.00 14.11 ? 471  TYR A N   1 
ATOM   4030 C  CA  . TYR A 1 474 ? 51.675 44.144 -5.450  1.00 14.38 ? 471  TYR A CA  1 
ATOM   4031 C  C   . TYR A 1 474 ? 51.716 45.594 -5.884  1.00 14.21 ? 471  TYR A C   1 
ATOM   4032 O  O   . TYR A 1 474 ? 52.404 46.423 -5.274  1.00 13.87 ? 471  TYR A O   1 
ATOM   4033 C  CB  . TYR A 1 474 ? 52.478 43.244 -6.398  1.00 15.38 ? 471  TYR A CB  1 
ATOM   4034 C  CG  . TYR A 1 474 ? 53.957 43.525 -6.494  1.00 15.36 ? 471  TYR A CG  1 
ATOM   4035 C  CD1 . TYR A 1 474 ? 54.880 42.802 -5.750  1.00 15.20 ? 471  TYR A CD1 1 
ATOM   4036 C  CD2 . TYR A 1 474 ? 54.446 44.532 -7.308  1.00 17.52 ? 471  TYR A CD2 1 
ATOM   4037 C  CE1 . TYR A 1 474 ? 56.217 43.004 -5.865  1.00 16.32 ? 471  TYR A CE1 1 
ATOM   4038 C  CE2 . TYR A 1 474 ? 55.794 44.754 -7.423  1.00 16.12 ? 471  TYR A CE2 1 
ATOM   4039 C  CZ  . TYR A 1 474 ? 56.688 44.010 -6.700  1.00 16.13 ? 471  TYR A CZ  1 
ATOM   4040 O  OH  . TYR A 1 474 ? 58.035 44.155 -6.847  1.00 17.29 ? 471  TYR A OH  1 
ATOM   4041 N  N   . SER A 1 475 ? 51.019 45.954 -6.982  1.00 14.07 ? 472  SER A N   1 
ATOM   4042 C  CA  . SER A 1 475 ? 51.129 47.328 -7.466  1.00 14.48 ? 472  SER A CA  1 
ATOM   4043 C  C   . SER A 1 475 ? 50.481 48.320 -6.532  1.00 13.70 ? 472  SER A C   1 
ATOM   4044 O  O   . SER A 1 475 ? 50.946 49.423 -6.409  1.00 14.25 ? 472  SER A O   1 
ATOM   4045 C  CB  . SER A 1 475 ? 50.553 47.464 -8.865  1.00 14.10 ? 472  SER A CB  1 
ATOM   4046 O  OG  . SER A 1 475 ? 49.138 47.338 -8.861  1.00 17.50 ? 472  SER A OG  1 
ATOM   4047 N  N   . LEU A 1 476 ? 49.410 47.933 -5.838  1.00 13.15 ? 473  LEU A N   1 
ATOM   4048 C  CA  . LEU A 1 476 ? 48.782 48.773 -4.828  1.00 12.66 ? 473  LEU A CA  1 
ATOM   4049 C  C   . LEU A 1 476 ? 49.758 48.997 -3.682  1.00 12.25 ? 473  LEU A C   1 
ATOM   4050 O  O   . LEU A 1 476 ? 49.900 50.120 -3.165  1.00 12.92 ? 473  LEU A O   1 
ATOM   4051 C  CB  . LEU A 1 476 ? 47.485 48.177 -4.298  1.00 14.18 ? 473  LEU A CB  1 
ATOM   4052 C  CG  . LEU A 1 476 ? 46.814 48.970 -3.202  1.00 11.60 ? 473  LEU A CG  1 
ATOM   4053 C  CD1 . LEU A 1 476 ? 46.405 50.377 -3.592  1.00 12.06 ? 473  LEU A CD1 1 
ATOM   4054 C  CD2 . LEU A 1 476 ? 45.593 48.230 -2.673  1.00 13.44 ? 473  LEU A CD2 1 
ATOM   4055 N  N   . GLY A 1 477 ? 50.436 47.946 -3.224  1.00 13.17 ? 474  GLY A N   1 
ATOM   4056 C  CA  . GLY A 1 477 ? 51.403 48.144 -2.180  1.00 13.13 ? 474  GLY A CA  1 
ATOM   4057 C  C   . GLY A 1 477 ? 52.515 49.082 -2.540  1.00 12.96 ? 474  GLY A C   1 
ATOM   4058 O  O   . GLY A 1 477 ? 52.901 49.957 -1.747  1.00 12.56 ? 474  GLY A O   1 
ATOM   4059 N  N   . ALA A 1 478 ? 53.009 48.999 -3.774  1.00 12.58 ? 475  ALA A N   1 
ATOM   4060 C  CA  . ALA A 1 478 ? 54.021 49.937 -4.306  1.00 13.04 ? 475  ALA A CA  1 
ATOM   4061 C  C   . ALA A 1 478 ? 53.468 51.330 -4.332  1.00 12.75 ? 475  ALA A C   1 
ATOM   4062 O  O   . ALA A 1 478 ? 54.104 52.249 -3.861  1.00 14.32 ? 475  ALA A O   1 
ATOM   4063 C  CB  . ALA A 1 478 ? 54.423 49.492 -5.710  1.00 14.79 ? 475  ALA A CB  1 
ATOM   4064 N  N   . LEU A 1 479 ? 52.258 51.504 -4.812  1.00 12.97 ? 476  LEU A N   1 
ATOM   4065 C  CA  . LEU A 1 479 ? 51.635 52.826 -4.893  1.00 13.10 ? 476  LEU A CA  1 
ATOM   4066 C  C   . LEU A 1 479 ? 51.486 53.512 -3.541  1.00 13.51 ? 476  LEU A C   1 
ATOM   4067 O  O   . LEU A 1 479 ? 51.838 54.704 -3.382  1.00 14.19 ? 476  LEU A O   1 
ATOM   4068 C  CB  . LEU A 1 479 ? 50.283 52.735 -5.620  1.00 12.73 ? 476  LEU A CB  1 
ATOM   4069 C  CG  . LEU A 1 479 ? 49.502 53.985 -5.751  1.00 14.19 ? 476  LEU A CG  1 
ATOM   4070 C  CD1 . LEU A 1 479 ? 50.206 55.037 -6.581  1.00 17.09 ? 476  LEU A CD1 1 
ATOM   4071 C  CD2 . LEU A 1 479 ? 48.110 53.649 -6.331  1.00 16.33 ? 476  LEU A CD2 1 
ATOM   4072 N  N   . ILE A 1 480 ? 51.003 52.782 -2.530  1.00 12.75 ? 477  ILE A N   1 
ATOM   4073 C  CA  . ILE A 1 480 ? 50.849 53.373 -1.208  1.00 12.53 ? 477  ILE A CA  1 
ATOM   4074 C  C   . ILE A 1 480 ? 52.217 53.767 -0.694  1.00 13.22 ? 477  ILE A C   1 
ATOM   4075 O  O   . ILE A 1 480 ? 52.376 54.848 -0.103  1.00 13.06 ? 477  ILE A O   1 
ATOM   4076 C  CB  . ILE A 1 480 ? 50.167 52.418 -0.272  1.00 13.54 ? 477  ILE A CB  1 
ATOM   4077 C  CG1 . ILE A 1 480 ? 48.778 52.065 -0.750  1.00 13.02 ? 477  ILE A CG1 1 
ATOM   4078 C  CG2 . ILE A 1 480 ? 50.053 53.012 1.122   1.00 13.97 ? 477  ILE A CG2 1 
ATOM   4079 C  CD1 . ILE A 1 480 ? 48.235 50.761 -0.037  1.00 13.11 ? 477  ILE A CD1 1 
ATOM   4080 N  N   . ALA A 1 481 ? 53.216 52.903 -0.853  1.00 12.88 ? 478  ALA A N   1 
ATOM   4081 C  CA  . ALA A 1 481 ? 54.557 53.180 -0.317  1.00 14.05 ? 478  ALA A CA  1 
ATOM   4082 C  C   . ALA A 1 481 ? 55.181 54.406 -0.954  1.00 13.49 ? 478  ALA A C   1 
ATOM   4083 O  O   . ALA A 1 481 ? 55.898 55.159 -0.268  1.00 14.62 ? 478  ALA A O   1 
ATOM   4084 C  CB  . ALA A 1 481 ? 55.470 51.933 -0.526  1.00 15.51 ? 478  ALA A CB  1 
ATOM   4085 N  N   . LEU A 1 482 ? 54.923 54.682 -2.238  1.00 14.33 ? 479  LEU A N   1 
ATOM   4086 C  CA  . LEU A 1 482 ? 55.462 55.896 -2.850  1.00 13.17 ? 479  LEU A CA  1 
ATOM   4087 C  C   . LEU A 1 482 ? 54.990 57.117 -2.081  1.00 13.34 ? 479  LEU A C   1 
ATOM   4088 O  O   . LEU A 1 482 ? 55.762 58.019 -1.807  1.00 15.32 ? 479  LEU A O   1 
ATOM   4089 C  CB  . LEU A 1 482 ? 54.987 56.048 -4.308  1.00 13.27 ? 479  LEU A CB  1 
ATOM   4090 C  CG  . LEU A 1 482 ? 55.558 55.104 -5.315  1.00 14.70 ? 479  LEU A CG  1 
ATOM   4091 C  CD1 . LEU A 1 482 ? 54.819 55.229 -6.657  1.00 18.55 ? 479  LEU A CD1 1 
ATOM   4092 C  CD2 . LEU A 1 482 ? 57.084 55.314 -5.528  1.00 16.62 ? 479  LEU A CD2 1 
ATOM   4093 N  N   . TYR A 1 483 ? 53.696 57.172 -1.740  1.00 12.70 ? 480  TYR A N   1 
ATOM   4094 C  CA  . TYR A 1 483 ? 53.146 58.288 -0.994  1.00 14.14 ? 480  TYR A CA  1 
ATOM   4095 C  C   . TYR A 1 483 ? 53.631 58.319 0.461   1.00 13.45 ? 480  TYR A C   1 
ATOM   4096 O  O   . TYR A 1 483 ? 53.884 59.396 1.014   1.00 14.77 ? 480  TYR A O   1 
ATOM   4097 C  CB  . TYR A 1 483 ? 51.611 58.314 -1.102  1.00 13.61 ? 480  TYR A CB  1 
ATOM   4098 C  CG  . TYR A 1 483 ? 51.150 58.844 -2.430  1.00 13.48 ? 480  TYR A CG  1 
ATOM   4099 C  CD1 . TYR A 1 483 ? 51.044 60.204 -2.646  1.00 15.65 ? 480  TYR A CD1 1 
ATOM   4100 C  CD2 . TYR A 1 483 ? 50.783 58.008 -3.446  1.00 15.50 ? 480  TYR A CD2 1 
ATOM   4101 C  CE1 . TYR A 1 483 ? 50.639 60.721 -3.860  1.00 15.43 ? 480  TYR A CE1 1 
ATOM   4102 C  CE2 . TYR A 1 483 ? 50.417 58.489 -4.684  1.00 14.93 ? 480  TYR A CE2 1 
ATOM   4103 C  CZ  . TYR A 1 483 ? 50.331 59.854 -4.899  1.00 15.85 ? 480  TYR A CZ  1 
ATOM   4104 O  OH  . TYR A 1 483 ? 49.926 60.337 -6.155  1.00 15.97 ? 480  TYR A OH  1 
ATOM   4105 N  N   . GLU A 1 484 ? 53.780 57.143 1.092   1.00 13.56 ? 481  GLU A N   1 
ATOM   4106 C  CA  . GLU A 1 484 ? 54.376 57.128 2.413   1.00 13.75 ? 481  GLU A CA  1 
ATOM   4107 C  C   . GLU A 1 484 ? 55.714 57.844 2.401   1.00 13.88 ? 481  GLU A C   1 
ATOM   4108 O  O   . GLU A 1 484 ? 56.038 58.641 3.305   1.00 14.29 ? 481  GLU A O   1 
ATOM   4109 C  CB  . GLU A 1 484 ? 54.554 55.710 2.979   1.00 13.57 ? 481  GLU A CB  1 
ATOM   4110 C  CG  . GLU A 1 484 ? 53.214 55.053 3.272   1.00 13.56 ? 481  GLU A CG  1 
ATOM   4111 C  CD  . GLU A 1 484 ? 53.343 53.654 3.885   1.00 13.87 ? 481  GLU A CD  1 
ATOM   4112 O  OE1 . GLU A 1 484 ? 54.373 52.985 3.695   1.00 14.58 ? 481  GLU A OE1 1 
ATOM   4113 O  OE2 . GLU A 1 484 ? 52.380 53.217 4.588   1.00 12.93 ? 481  GLU A OE2 1 
ATOM   4114 N  N   . HIS A 1 485 ? 56.541 57.534 1.438   1.00 14.21 ? 482  HIS A N   1 
ATOM   4115 C  CA  . HIS A 1 485 ? 57.854 58.143 1.391   1.00 14.00 ? 482  HIS A CA  1 
ATOM   4116 C  C   . HIS A 1 485 ? 57.838 59.597 0.934   1.00 14.72 ? 482  HIS A C   1 
ATOM   4117 O  O   . HIS A 1 485 ? 58.656 60.382 1.427   1.00 15.04 ? 482  HIS A O   1 
ATOM   4118 C  CB  . HIS A 1 485 ? 58.808 57.288 0.583   1.00 14.47 ? 482  HIS A CB  1 
ATOM   4119 C  CG  . HIS A 1 485 ? 59.032 55.945 1.198   1.00 14.71 ? 482  HIS A CG  1 
ATOM   4120 N  ND1 . HIS A 1 485 ? 59.167 55.786 2.564   1.00 17.62 ? 482  HIS A ND1 1 
ATOM   4121 C  CD2 . HIS A 1 485 ? 59.175 54.716 0.653   1.00 15.10 ? 482  HIS A CD2 1 
ATOM   4122 C  CE1 . HIS A 1 485 ? 59.350 54.504 2.833   1.00 17.68 ? 482  HIS A CE1 1 
ATOM   4123 N  NE2 . HIS A 1 485 ? 59.414 53.844 1.691   1.00 15.82 ? 482  HIS A NE2 1 
ATOM   4124 N  N   . LYS A 1 486 ? 56.928 59.976 0.040   1.00 13.98 ? 483  LYS A N   1 
ATOM   4125 C  CA  . LYS A 1 486 ? 56.765 61.370 -0.252  1.00 14.42 ? 483  LYS A CA  1 
ATOM   4126 C  C   . LYS A 1 486 ? 56.537 62.219 1.012   1.00 13.43 ? 483  LYS A C   1 
ATOM   4127 O  O   . LYS A 1 486 ? 57.136 63.250 1.237   1.00 15.12 ? 483  LYS A O   1 
ATOM   4128 C  CB  . LYS A 1 486 ? 55.543 61.570 -1.184  1.00 14.73 ? 483  LYS A CB  1 
ATOM   4129 C  CG  . LYS A 1 486 ? 55.183 63.036 -1.448  1.00 13.92 ? 483  LYS A CG  1 
ATOM   4130 C  CD  . LYS A 1 486 ? 53.821 63.272 -2.062  1.00 15.56 ? 483  LYS A CD  1 
ATOM   4131 C  CE  . LYS A 1 486 ? 53.534 64.723 -2.349  1.00 15.72 ? 483  LYS A CE  1 
ATOM   4132 N  NZ  . LYS A 1 486 ? 52.118 64.840 -2.874  1.00 18.07 ? 483  LYS A NZ  1 
ATOM   4133 N  N   . ILE A 1 487 ? 55.626 61.735 1.861   1.00 13.23 ? 484  ILE A N   1 
ATOM   4134 C  CA  . ILE A 1 487 ? 55.219 62.422 3.079   1.00 13.78 ? 484  ILE A CA  1 
ATOM   4135 C  C   . ILE A 1 487 ? 56.442 62.548 4.010   1.00 14.29 ? 484  ILE A C   1 
ATOM   4136 O  O   . ILE A 1 487 ? 56.692 63.589 4.589   1.00 15.78 ? 484  ILE A O   1 
ATOM   4137 C  CB  . ILE A 1 487 ? 54.043 61.661 3.740   1.00 14.16 ? 484  ILE A CB  1 
ATOM   4138 C  CG1 . ILE A 1 487 ? 52.800 61.805 2.900   1.00 14.48 ? 484  ILE A CG1 1 
ATOM   4139 C  CG2 . ILE A 1 487 ? 53.809 62.154 5.167   1.00 15.41 ? 484  ILE A CG2 1 
ATOM   4140 C  CD1 . ILE A 1 487 ? 51.749 60.715 3.267   1.00 15.07 ? 484  ILE A CD1 1 
ATOM   4141 N  N   . PHE A 1 488 ? 57.198 61.462 4.125   1.00 15.67 ? 485  PHE A N   1 
ATOM   4142 C  CA  . PHE A 1 488 ? 58.429 61.441 4.918   1.00 15.92 ? 485  PHE A CA  1 
ATOM   4143 C  C   . PHE A 1 488 ? 59.416 62.516 4.435   1.00 15.46 ? 485  PHE A C   1 
ATOM   4144 O  O   . PHE A 1 488 ? 59.944 63.319 5.229   1.00 15.76 ? 485  PHE A O   1 
ATOM   4145 C  CB  . PHE A 1 488 ? 59.078 60.070 4.823   1.00 15.09 ? 485  PHE A CB  1 
ATOM   4146 C  CG  . PHE A 1 488 ? 60.436 59.925 5.484   1.00 17.55 ? 485  PHE A CG  1 
ATOM   4147 C  CD1 . PHE A 1 488 ? 60.732 60.429 6.749   1.00 18.18 ? 485  PHE A CD1 1 
ATOM   4148 C  CD2 . PHE A 1 488 ? 61.406 59.196 4.829   1.00 23.63 ? 485  PHE A CD2 1 
ATOM   4149 C  CE1 . PHE A 1 488 ? 61.999 60.239 7.310   1.00 18.99 ? 485  PHE A CE1 1 
ATOM   4150 C  CE2 . PHE A 1 488 ? 62.696 59.002 5.436   1.00 24.74 ? 485  PHE A CE2 1 
ATOM   4151 C  CZ  . PHE A 1 488 ? 62.949 59.561 6.619   1.00 19.24 ? 485  PHE A CZ  1 
ATOM   4152 N  N   . VAL A 1 489 ? 59.673 62.524 3.133   1.00 15.58 ? 486  VAL A N   1 
ATOM   4153 C  CA  . VAL A 1 489 ? 60.623 63.487 2.558   1.00 15.71 ? 486  VAL A CA  1 
ATOM   4154 C  C   . VAL A 1 489 ? 60.153 64.938 2.839   1.00 16.43 ? 486  VAL A C   1 
ATOM   4155 O  O   . VAL A 1 489 ? 60.924 65.788 3.263   1.00 16.76 ? 486  VAL A O   1 
ATOM   4156 C  CB  . VAL A 1 489 ? 60.832 63.269 1.082   1.00 15.88 ? 486  VAL A CB  1 
ATOM   4157 C  CG1 . VAL A 1 489 ? 61.709 64.415 0.466   1.00 17.05 ? 486  VAL A CG1 1 
ATOM   4158 C  CG2 . VAL A 1 489 ? 61.417 61.908 0.726   1.00 17.02 ? 486  VAL A CG2 1 
ATOM   4159 N  N   . GLN A 1 490 ? 58.862 65.211 2.630   1.00 15.33 ? 487  GLN A N   1 
ATOM   4160 C  CA  . GLN A 1 490 ? 58.372 66.565 2.904   1.00 16.91 ? 487  GLN A CA  1 
ATOM   4161 C  C   . GLN A 1 490 ? 58.606 66.958 4.334   1.00 17.04 ? 487  GLN A C   1 
ATOM   4162 O  O   . GLN A 1 490 ? 58.966 68.107 4.625   1.00 18.22 ? 487  GLN A O   1 
ATOM   4163 C  CB  . GLN A 1 490 ? 56.901 66.706 2.512   1.00 16.23 ? 487  GLN A CB  1 
ATOM   4164 C  CG  . GLN A 1 490 ? 56.640 66.636 1.014   1.00 16.14 ? 487  GLN A CG  1 
ATOM   4165 C  CD  . GLN A 1 490 ? 55.232 67.086 0.721   1.00 16.91 ? 487  GLN A CD  1 
ATOM   4166 O  OE1 . GLN A 1 490 ? 55.014 68.306 0.361   1.00 21.03 ? 487  GLN A OE1 1 
ATOM   4167 N  NE2 . GLN A 1 490 ? 54.294 66.229 0.973   1.00 14.36 ? 487  GLN A NE2 1 
ATOM   4168 N  N   . GLY A 1 491 ? 58.322 66.064 5.267   1.00 16.50 ? 488  GLY A N   1 
ATOM   4169 C  CA  . GLY A 1 491 ? 58.558 66.342 6.682   1.00 16.07 ? 488  GLY A CA  1 
ATOM   4170 C  C   . GLY A 1 491 ? 59.984 66.641 7.012   1.00 16.92 ? 488  GLY A C   1 
ATOM   4171 O  O   . GLY A 1 491 ? 60.298 67.538 7.776   1.00 18.08 ? 488  GLY A O   1 
ATOM   4172 N  N   . VAL A 1 492 ? 60.890 65.874 6.410   1.00 18.40 ? 489  VAL A N   1 
ATOM   4173 C  CA  . VAL A 1 492 ? 62.321 66.109 6.579   1.00 18.89 ? 489  VAL A CA  1 
ATOM   4174 C  C   . VAL A 1 492 ? 62.698 67.492 6.103   1.00 18.86 ? 489  VAL A C   1 
ATOM   4175 O  O   . VAL A 1 492 ? 63.391 68.256 6.798   1.00 19.98 ? 489  VAL A O   1 
ATOM   4176 C  CB  . VAL A 1 492 ? 63.167 65.016 5.911   1.00 19.53 ? 489  VAL A CB  1 
ATOM   4177 C  CG1 . VAL A 1 492 ? 64.722 65.391 5.933   1.00 21.99 ? 489  VAL A CG1 1 
ATOM   4178 C  CG2 . VAL A 1 492 ? 63.017 63.649 6.663   1.00 19.42 ? 489  VAL A CG2 1 
ATOM   4179 N  N   . LEU A 1 493 ? 62.248 67.830 4.907   1.00 18.81 ? 490  LEU A N   1 
ATOM   4180 C  CA  . LEU A 1 493 ? 62.640 69.121 4.360   1.00 18.91 ? 490  LEU A CA  1 
ATOM   4181 C  C   . LEU A 1 493 ? 62.065 70.289 5.157   1.00 18.51 ? 490  LEU A C   1 
ATOM   4182 O  O   . LEU A 1 493 ? 62.741 71.352 5.245   1.00 21.22 ? 490  LEU A O   1 
ATOM   4183 C  CB  . LEU A 1 493 ? 62.266 69.222 2.916   1.00 21.00 ? 490  LEU A CB  1 
ATOM   4184 C  CG  . LEU A 1 493 ? 62.910 68.200 1.974   1.00 23.23 ? 490  LEU A CG  1 
ATOM   4185 C  CD1 . LEU A 1 493 ? 62.257 68.314 0.615   1.00 25.81 ? 490  LEU A CD1 1 
ATOM   4186 C  CD2 . LEU A 1 493 ? 64.443 68.350 1.936   1.00 28.79 ? 490  LEU A CD2 1 
ATOM   4187 N  N   . TRP A 1 494 ? 60.896 70.139 5.757   1.00 18.11 ? 491  TRP A N   1 
ATOM   4188 C  CA  . TRP A 1 494 ? 60.295 71.124 6.648   1.00 18.08 ? 491  TRP A CA  1 
ATOM   4189 C  C   . TRP A 1 494 ? 60.809 71.081 8.101   1.00 19.68 ? 491  TRP A C   1 
ATOM   4190 O  O   . TRP A 1 494 ? 60.435 71.901 8.899   1.00 20.95 ? 491  TRP A O   1 
ATOM   4191 C  CB  . TRP A 1 494 ? 58.760 70.976 6.679   1.00 18.09 ? 491  TRP A CB  1 
ATOM   4192 C  CG  . TRP A 1 494 ? 58.066 71.447 5.405   1.00 17.63 ? 491  TRP A CG  1 
ATOM   4193 C  CD1 . TRP A 1 494 ? 58.472 72.454 4.544   1.00 20.78 ? 491  TRP A CD1 1 
ATOM   4194 C  CD2 . TRP A 1 494 ? 56.868 70.911 4.836   1.00 18.41 ? 491  TRP A CD2 1 
ATOM   4195 N  NE1 . TRP A 1 494 ? 57.586 72.584 3.517   1.00 19.65 ? 491  TRP A NE1 1 
ATOM   4196 C  CE2 . TRP A 1 494 ? 56.591 71.660 3.659   1.00 18.13 ? 491  TRP A CE2 1 
ATOM   4197 C  CE3 . TRP A 1 494 ? 56.001 69.861 5.198   1.00 15.69 ? 491  TRP A CE3 1 
ATOM   4198 C  CZ2 . TRP A 1 494 ? 55.499 71.364 2.820   1.00 18.53 ? 491  TRP A CZ2 1 
ATOM   4199 C  CZ3 . TRP A 1 494 ? 54.942 69.592 4.392   1.00 15.97 ? 491  TRP A CZ3 1 
ATOM   4200 C  CH2 . TRP A 1 494 ? 54.677 70.360 3.239   1.00 17.82 ? 491  TRP A CH2 1 
ATOM   4201 N  N   . ASP A 1 495 ? 61.654 70.099 8.436   1.00 20.10 ? 492  ASP A N   1 
ATOM   4202 C  CA  . ASP A 1 495 ? 62.226 69.923 9.759   1.00 21.06 ? 492  ASP A CA  1 
ATOM   4203 C  C   . ASP A 1 495 ? 61.131 69.729 10.802  1.00 19.62 ? 492  ASP A C   1 
ATOM   4204 O  O   . ASP A 1 495 ? 61.251 70.223 11.927  1.00 19.68 ? 492  ASP A O   1 
ATOM   4205 C  CB  . ASP A 1 495 ? 63.153 71.101 10.113  1.00 21.83 ? 492  ASP A CB  1 
ATOM   4206 C  CG  . ASP A 1 495 ? 64.098 70.794 11.235  1.00 25.78 ? 492  ASP A CG  1 
ATOM   4207 O  OD1 . ASP A 1 495 ? 64.502 69.592 11.343  1.00 30.58 ? 492  ASP A OD1 1 
ATOM   4208 O  OD2 . ASP A 1 495 ? 64.421 71.786 11.966  1.00 31.54 ? 492  ASP A OD2 1 
ATOM   4209 N  N   . ILE A 1 496 ? 60.064 68.989 10.475  1.00 18.35 ? 493  ILE A N   1 
ATOM   4210 C  CA  . ILE A 1 496 ? 59.005 68.648 11.415  1.00 18.38 ? 493  ILE A CA  1 
ATOM   4211 C  C   . ILE A 1 496 ? 59.041 67.168 11.744  1.00 18.08 ? 493  ILE A C   1 
ATOM   4212 O  O   . ILE A 1 496 ? 59.690 66.378 11.064  1.00 18.03 ? 493  ILE A O   1 
ATOM   4213 C  CB  . ILE A 1 496 ? 57.604 69.049 10.906  1.00 16.81 ? 493  ILE A CB  1 
ATOM   4214 C  CG1 . ILE A 1 496 ? 57.251 68.324 9.587   1.00 17.40 ? 493  ILE A CG1 1 
ATOM   4215 C  CG2 . ILE A 1 496 ? 57.538 70.613 10.812  1.00 19.00 ? 493  ILE A CG2 1 
ATOM   4216 C  CD1 . ILE A 1 496 ? 55.834 68.607 9.086   1.00 17.34 ? 493  ILE A CD1 1 
ATOM   4217 N  N   . ASN A 1 497 ? 58.268 66.790 12.756  1.00 18.38 ? 494  ASN A N   1 
ATOM   4218 C  CA  . ASN A 1 497 ? 58.089 65.373 13.091  1.00 17.69 ? 494  ASN A CA  1 
ATOM   4219 C  C   . ASN A 1 497 ? 56.814 64.869 12.450  1.00 17.47 ? 494  ASN A C   1 
ATOM   4220 O  O   . ASN A 1 497 ? 55.708 65.174 12.924  1.00 17.99 ? 494  ASN A O   1 
ATOM   4221 C  CB  . ASN A 1 497 ? 58.034 65.162 14.599  1.00 16.93 ? 494  ASN A CB  1 
ATOM   4222 C  CG  . ASN A 1 497 ? 57.913 63.689 15.000  1.00 16.72 ? 494  ASN A CG  1 
ATOM   4223 O  OD1 . ASN A 1 497 ? 58.038 62.818 14.144  1.00 17.84 ? 494  ASN A OD1 1 
ATOM   4224 N  ND2 . ASN A 1 497 ? 57.684 63.430 16.301  1.00 16.85 ? 494  ASN A ND2 1 
ATOM   4225 N  N   . SER A 1 498 ? 56.966 64.077 11.395  1.00 16.26 ? 495  SER A N   1 
ATOM   4226 C  CA  . SER A 1 498 ? 55.829 63.554 10.676  1.00 16.33 ? 495  SER A CA  1 
ATOM   4227 C  C   . SER A 1 498 ? 55.075 62.479 11.451  1.00 14.99 ? 495  SER A C   1 
ATOM   4228 O  O   . SER A 1 498 ? 53.982 62.074 11.019  1.00 16.14 ? 495  SER A O   1 
ATOM   4229 C  CB  . SER A 1 498 ? 56.209 62.964 9.350   1.00 15.68 ? 495  SER A CB  1 
ATOM   4230 O  OG  . SER A 1 498 ? 56.722 63.992 8.473   1.00 16.55 ? 495  SER A OG  1 
ATOM   4231 N  N   . TYR A 1 499 ? 55.642 62.000 12.558  1.00 15.00 ? 496  TYR A N   1 
ATOM   4232 C  CA  . TYR A 1 499 ? 55.186 60.721 13.128  1.00 14.26 ? 496  TYR A CA  1 
ATOM   4233 C  C   . TYR A 1 499 ? 54.445 60.806 14.460  1.00 14.46 ? 496  TYR A C   1 
ATOM   4234 O  O   . TYR A 1 499 ? 53.961 59.792 14.922  1.00 15.11 ? 496  TYR A O   1 
ATOM   4235 C  CB  . TYR A 1 499 ? 56.380 59.723 13.163  1.00 14.37 ? 496  TYR A CB  1 
ATOM   4236 C  CG  . TYR A 1 499 ? 56.828 59.526 11.742  1.00 13.36 ? 496  TYR A CG  1 
ATOM   4237 C  CD1 . TYR A 1 499 ? 56.003 58.913 10.821  1.00 13.22 ? 496  TYR A CD1 1 
ATOM   4238 C  CD2 . TYR A 1 499 ? 58.012 60.064 11.260  1.00 15.59 ? 496  TYR A CD2 1 
ATOM   4239 C  CE1 . TYR A 1 499 ? 56.350 58.816 9.466   1.00 15.02 ? 496  TYR A CE1 1 
ATOM   4240 C  CE2 . TYR A 1 499 ? 58.360 59.974 9.930   1.00 16.40 ? 496  TYR A CE2 1 
ATOM   4241 C  CZ  . TYR A 1 499 ? 57.526 59.368 9.018   1.00 15.76 ? 496  TYR A CZ  1 
ATOM   4242 O  OH  . TYR A 1 499 ? 57.870 59.302 7.672   1.00 17.39 ? 496  TYR A OH  1 
ATOM   4243 N  N   . ASP A 1 500 ? 54.340 62.002 15.040  1.00 15.21 ? 497  ASP A N   1 
ATOM   4244 C  CA  . ASP A 1 500 ? 53.496 62.258 16.206  1.00 15.41 ? 497  ASP A CA  1 
ATOM   4245 C  C   . ASP A 1 500 ? 52.146 62.847 15.715  1.00 14.56 ? 497  ASP A C   1 
ATOM   4246 O  O   . ASP A 1 500 ? 51.937 63.028 14.511  1.00 14.96 ? 497  ASP A O   1 
ATOM   4247 C  CB  . ASP A 1 500 ? 54.216 63.122 17.255  1.00 16.00 ? 497  ASP A CB  1 
ATOM   4248 C  CG  . ASP A 1 500 ? 54.543 64.527 16.800  1.00 16.72 ? 497  ASP A CG  1 
ATOM   4249 O  OD1 . ASP A 1 500 ? 54.029 64.954 15.713  1.00 17.28 ? 497  ASP A OD1 1 
ATOM   4250 O  OD2 . ASP A 1 500 ? 55.366 65.169 17.494  1.00 18.23 ? 497  ASP A OD2 1 
ATOM   4251 N  N   . GLN A 1 501 ? 51.235 63.035 16.659  1.00 15.77 ? 498  GLN A N   1 
ATOM   4252 C  CA  . GLN A 1 501 ? 49.903 63.606 16.332  1.00 16.00 ? 498  GLN A CA  1 
ATOM   4253 C  C   . GLN A 1 501 ? 49.284 64.175 17.566  1.00 16.39 ? 498  GLN A C   1 
ATOM   4254 O  O   . GLN A 1 501 ? 48.236 63.700 18.050  1.00 17.07 ? 498  GLN A O   1 
ATOM   4255 C  CB  . GLN A 1 501 ? 48.991 62.556 15.621  1.00 15.35 ? 498  GLN A CB  1 
ATOM   4256 C  CG  . GLN A 1 501 ? 48.749 61.274 16.380  1.00 15.28 ? 498  GLN A CG  1 
ATOM   4257 C  CD  . GLN A 1 501 ? 49.914 60.304 16.350  1.00 13.45 ? 498  GLN A CD  1 
ATOM   4258 O  OE1 . GLN A 1 501 ? 50.531 60.082 15.284  1.00 16.80 ? 498  GLN A OE1 1 
ATOM   4259 N  NE2 . GLN A 1 501 ? 50.230 59.728 17.504  1.00 15.74 ? 498  GLN A NE2 1 
ATOM   4260 N  N   . TRP A 1 502 ? 49.910 65.181 18.139  1.00 16.97 ? 499  TRP A N   1 
ATOM   4261 C  CA  . TRP A 1 502 ? 49.455 65.688 19.424  1.00 17.44 ? 499  TRP A CA  1 
ATOM   4262 C  C   . TRP A 1 502 ? 48.069 66.362 19.348  1.00 17.60 ? 499  TRP A C   1 
ATOM   4263 O  O   . TRP A 1 502 ? 47.380 66.450 20.397  1.00 20.60 ? 499  TRP A O   1 
ATOM   4264 C  CB  . TRP A 1 502 ? 50.511 66.587 20.095  1.00 19.31 ? 499  TRP A CB  1 
ATOM   4265 C  CG  . TRP A 1 502 ? 51.751 65.875 20.426  1.00 18.65 ? 499  TRP A CG  1 
ATOM   4266 C  CD1 . TRP A 1 502 ? 52.964 65.990 19.808  1.00 21.78 ? 499  TRP A CD1 1 
ATOM   4267 C  CD2 . TRP A 1 502 ? 51.896 64.859 21.377  1.00 18.28 ? 499  TRP A CD2 1 
ATOM   4268 N  NE1 . TRP A 1 502 ? 53.860 65.128 20.350  1.00 21.52 ? 499  TRP A NE1 1 
ATOM   4269 C  CE2 . TRP A 1 502 ? 53.235 64.419 21.328  1.00 19.62 ? 499  TRP A CE2 1 
ATOM   4270 C  CE3 . TRP A 1 502 ? 51.022 64.308 22.341  1.00 20.47 ? 499  TRP A CE3 1 
ATOM   4271 C  CZ2 . TRP A 1 502 ? 53.714 63.445 22.163  1.00 23.81 ? 499  TRP A CZ2 1 
ATOM   4272 C  CZ3 . TRP A 1 502 ? 51.504 63.350 23.168  1.00 25.42 ? 499  TRP A CZ3 1 
ATOM   4273 C  CH2 . TRP A 1 502 ? 52.850 62.916 23.068  1.00 27.39 ? 499  TRP A CH2 1 
ATOM   4274 N  N   A GLY A 1 503 ? 47.563 66.704 18.148  0.60 18.32 ? 500  GLY A N   1 
ATOM   4275 N  N   B GLY A 1 503 ? 47.818 67.011 18.233  0.40 18.42 ? 500  GLY A N   1 
ATOM   4276 C  CA  A GLY A 1 503 ? 46.136 67.129 17.948  0.60 16.95 ? 500  GLY A CA  1 
ATOM   4277 C  CA  B GLY A 1 503 ? 46.763 67.977 18.180  0.40 18.14 ? 500  GLY A CA  1 
ATOM   4278 C  C   A GLY A 1 503 ? 45.123 65.987 17.982  0.60 17.36 ? 500  GLY A C   1 
ATOM   4279 C  C   B GLY A 1 503 ? 45.446 67.333 18.517  0.40 17.44 ? 500  GLY A C   1 
ATOM   4280 O  O   A GLY A 1 503 ? 43.976 66.115 18.466  0.60 18.87 ? 500  GLY A O   1 
ATOM   4281 O  O   B GLY A 1 503 ? 44.485 68.022 18.814  0.40 16.95 ? 500  GLY A O   1 
ATOM   4282 N  N   A VAL A 1 504 ? 45.535 64.849 17.469  0.60 15.91 ? 501  VAL A N   1 
ATOM   4283 N  N   B VAL A 1 504 ? 45.411 66.010 18.501  0.40 17.86 ? 501  VAL A N   1 
ATOM   4284 C  CA  A VAL A 1 504 ? 44.738 63.630 17.564  0.60 15.13 ? 501  VAL A CA  1 
ATOM   4285 C  CA  B VAL A 1 504 ? 44.186 65.302 18.752  0.40 18.02 ? 501  VAL A CA  1 
ATOM   4286 C  C   A VAL A 1 504 ? 44.775 63.075 19.005  0.60 16.66 ? 501  VAL A C   1 
ATOM   4287 C  C   B VAL A 1 504 ? 43.884 65.086 20.219  0.40 18.62 ? 501  VAL A C   1 
ATOM   4288 O  O   A VAL A 1 504 ? 43.762 62.651 19.587  0.60 18.65 ? 501  VAL A O   1 
ATOM   4289 O  O   B VAL A 1 504 ? 42.759 64.729 20.564  0.40 18.84 ? 501  VAL A O   1 
ATOM   4290 C  CB  A VAL A 1 504 ? 45.179 62.614 16.489  0.60 14.09 ? 501  VAL A CB  1 
ATOM   4291 C  CB  B VAL A 1 504 ? 44.176 63.940 18.036  0.40 16.62 ? 501  VAL A CB  1 
ATOM   4292 C  CG1 A VAL A 1 504 ? 44.577 61.206 16.759  0.60 14.33 ? 501  VAL A CG1 1 
ATOM   4293 C  CG1 B VAL A 1 504 ? 44.373 64.144 16.524  0.40 15.88 ? 501  VAL A CG1 1 
ATOM   4294 C  CG2 A VAL A 1 504 ? 44.815 63.117 15.102  0.60 14.84 ? 501  VAL A CG2 1 
ATOM   4295 C  CG2 B VAL A 1 504 ? 45.212 62.961 18.596  0.40 17.71 ? 501  VAL A CG2 1 
ATOM   4296 N  N   A GLU A 1 505 ? 45.954 63.074 19.584  0.60 17.53 ? 502  GLU A N   1 
ATOM   4297 N  N   B GLU A 1 505 ? 44.852 65.275 21.108  0.40 19.59 ? 502  GLU A N   1 
ATOM   4298 C  CA  A GLU A 1 505 ? 46.026 62.693 20.973  0.60 17.93 ? 502  GLU A CA  1 
ATOM   4299 C  CA  B GLU A 1 505 ? 44.580 64.991 22.516  0.40 20.82 ? 502  GLU A CA  1 
ATOM   4300 C  C   A GLU A 1 505 ? 45.118 63.552 21.892  0.60 19.13 ? 502  GLU A C   1 
ATOM   4301 C  C   B GLU A 1 505 ? 43.542 65.942 23.161  0.40 20.94 ? 502  GLU A C   1 
ATOM   4302 O  O   A GLU A 1 505 ? 44.489 62.996 22.795  0.60 20.26 ? 502  GLU A O   1 
ATOM   4303 O  O   B GLU A 1 505 ? 42.706 65.523 23.960  0.40 21.58 ? 502  GLU A O   1 
ATOM   4304 C  CB  A GLU A 1 505 ? 47.477 62.656 21.455  0.60 18.11 ? 502  GLU A CB  1 
ATOM   4305 C  CB  B GLU A 1 505 ? 45.876 65.052 23.309  0.40 22.29 ? 502  GLU A CB  1 
ATOM   4306 C  CG  A GLU A 1 505 ? 48.383 61.791 20.719  0.60 18.48 ? 502  GLU A CG  1 
ATOM   4307 C  CG  B GLU A 1 505 ? 45.996 64.017 24.391  0.40 24.52 ? 502  GLU A CG  1 
ATOM   4308 C  CD  A GLU A 1 505 ? 48.024 60.313 20.737  0.60 21.78 ? 502  GLU A CD  1 
ATOM   4309 C  CD  B GLU A 1 505 ? 47.389 63.983 24.971  0.40 25.82 ? 502  GLU A CD  1 
ATOM   4310 O  OE1 A GLU A 1 505 ? 47.371 59.789 21.688  0.60 25.06 ? 502  GLU A OE1 1 
ATOM   4311 O  OE1 B GLU A 1 505 ? 48.051 64.995 24.857  0.40 24.30 ? 502  GLU A OE1 1 
ATOM   4312 O  OE2 A GLU A 1 505 ? 48.490 59.659 19.852  0.60 19.72 ? 502  GLU A OE2 1 
ATOM   4313 O  OE2 B GLU A 1 505 ? 47.835 62.935 25.532  0.40 32.17 ? 502  GLU A OE2 1 
ATOM   4314 N  N   A LEU A 1 506 ? 45.101 64.876 21.716  0.60 19.95 ? 503  LEU A N   1 
ATOM   4315 N  N   B LEU A 1 506 ? 43.618 67.229 22.844  0.40 20.56 ? 503  LEU A N   1 
ATOM   4316 C  CA  A LEU A 1 506 ? 44.190 65.730 22.477  0.60 21.41 ? 503  LEU A CA  1 
ATOM   4317 C  CA  B LEU A 1 506 ? 42.770 68.240 23.487  0.40 20.99 ? 503  LEU A CA  1 
ATOM   4318 C  C   A LEU A 1 506 ? 42.744 65.336 22.227  0.60 21.35 ? 503  LEU A C   1 
ATOM   4319 C  C   B LEU A 1 506 ? 41.285 67.908 23.289  0.40 19.54 ? 503  LEU A C   1 
ATOM   4320 O  O   A LEU A 1 506 ? 41.947 65.246 23.135  0.60 20.27 ? 503  LEU A O   1 
ATOM   4321 O  O   B LEU A 1 506 ? 40.517 67.880 24.247  0.40 19.82 ? 503  LEU A O   1 
ATOM   4322 C  CB  A LEU A 1 506 ? 44.359 67.206 22.122  0.60 22.94 ? 503  LEU A CB  1 
ATOM   4323 C  CB  B LEU A 1 506 ? 43.090 69.630 22.952  0.40 21.29 ? 503  LEU A CB  1 
ATOM   4324 C  CG  A LEU A 1 506 ? 43.500 68.153 23.015  0.60 26.29 ? 503  LEU A CG  1 
ATOM   4325 C  CG  B LEU A 1 506 ? 42.084 70.689 23.369  0.40 21.98 ? 503  LEU A CG  1 
ATOM   4326 C  CD1 A LEU A 1 506 ? 43.725 67.920 24.483  0.60 27.81 ? 503  LEU A CD1 1 
ATOM   4327 C  CD1 B LEU A 1 506 ? 42.098 70.749 24.893  0.40 25.59 ? 503  LEU A CD1 1 
ATOM   4328 C  CD2 A LEU A 1 506 ? 43.735 69.613 22.726  0.60 29.76 ? 503  LEU A CD2 1 
ATOM   4329 C  CD2 B LEU A 1 506 ? 42.403 72.056 22.721  0.40 23.24 ? 503  LEU A CD2 1 
ATOM   4330 N  N   A GLY A 1 507 ? 42.395 65.118 20.970  0.60 20.75 ? 504  GLY A N   1 
ATOM   4331 N  N   B GLY A 1 507 ? 40.897 67.594 22.055  0.40 18.41 ? 504  GLY A N   1 
ATOM   4332 C  CA  A GLY A 1 507 ? 41.020 64.754 20.631  0.60 21.22 ? 504  GLY A CA  1 
ATOM   4333 C  CA  B GLY A 1 507 ? 39.515 67.222 21.763  0.40 18.50 ? 504  GLY A CA  1 
ATOM   4334 C  C   A GLY A 1 507 ? 40.476 63.584 21.430  0.60 20.63 ? 504  GLY A C   1 
ATOM   4335 C  C   B GLY A 1 507 ? 39.037 66.019 22.580  0.40 18.01 ? 504  GLY A C   1 
ATOM   4336 O  O   A GLY A 1 507 ? 39.320 63.567 21.823  0.60 19.95 ? 504  GLY A O   1 
ATOM   4337 O  O   B GLY A 1 507 ? 37.874 65.968 22.986  0.40 18.55 ? 504  GLY A O   1 
ATOM   4338 N  N   A LYS A 1 508 ? 41.324 62.599 21.658  0.60 21.41 ? 505  LYS A N   1 
ATOM   4339 N  N   B LYS A 1 508 ? 39.921 65.061 22.864  0.40 17.44 ? 505  LYS A N   1 
ATOM   4340 C  CA  A LYS A 1 508 ? 40.968 61.393 22.422  0.60 21.94 ? 505  LYS A CA  1 
ATOM   4341 C  CA  B LYS A 1 508 ? 39.511 63.900 23.650  0.40 17.73 ? 505  LYS A CA  1 
ATOM   4342 C  C   A LYS A 1 508 ? 40.668 61.615 23.895  0.60 23.78 ? 505  LYS A C   1 
ATOM   4343 C  C   B LYS A 1 508 ? 39.199 64.323 25.095  0.40 18.56 ? 505  LYS A C   1 
ATOM   4344 O  O   A LYS A 1 508 ? 40.088 60.712 24.556  0.60 24.92 ? 505  LYS A O   1 
ATOM   4345 O  O   B LYS A 1 508 ? 38.262 63.816 25.707  0.40 20.06 ? 505  LYS A O   1 
ATOM   4346 C  CB  A LYS A 1 508 ? 42.109 60.402 22.321  0.60 22.97 ? 505  LYS A CB  1 
ATOM   4347 C  CB  B LYS A 1 508 ? 40.577 62.782 23.659  0.40 16.86 ? 505  LYS A CB  1 
ATOM   4348 C  CG  A LYS A 1 508 ? 42.230 59.885 20.944  0.60 23.41 ? 505  LYS A CG  1 
ATOM   4349 C  CG  B LYS A 1 508 ? 40.940 62.209 22.274  0.40 16.76 ? 505  LYS A CG  1 
ATOM   4350 C  CD  A LYS A 1 508 ? 43.226 58.769 20.835  0.60 25.31 ? 505  LYS A CD  1 
ATOM   4351 C  CD  B LYS A 1 508 ? 41.937 61.077 22.373  0.40 19.77 ? 505  LYS A CD  1 
ATOM   4352 C  CE  A LYS A 1 508 ? 42.733 57.811 19.811  0.60 24.84 ? 505  LYS A CE  1 
ATOM   4353 C  CE  B LYS A 1 508 ? 42.180 60.404 21.046  0.40 20.70 ? 505  LYS A CE  1 
ATOM   4354 N  NZ  A LYS A 1 508 ? 43.598 56.717 19.703  0.60 17.09 ? 505  LYS A NZ  1 
ATOM   4355 N  NZ  B LYS A 1 508 ? 43.455 59.664 21.105  0.40 23.21 ? 505  LYS A NZ  1 
ATOM   4356 N  N   A LYS A 1 509 ? 41.030 62.793 24.396  0.60 24.09 ? 506  LYS A N   1 
ATOM   4357 N  N   B LYS A 1 509 ? 40.028 65.211 25.655  0.40 19.66 ? 506  LYS A N   1 
ATOM   4358 C  CA  A LYS A 1 509 ? 40.819 63.155 25.781  0.60 25.52 ? 506  LYS A CA  1 
ATOM   4359 C  CA  B LYS A 1 509 ? 39.881 65.713 27.028  0.40 20.14 ? 506  LYS A CA  1 
ATOM   4360 C  C   A LYS A 1 509 ? 39.780 64.246 25.985  0.60 25.15 ? 506  LYS A C   1 
ATOM   4361 C  C   B LYS A 1 509 ? 38.591 66.490 27.257  0.40 19.91 ? 506  LYS A C   1 
ATOM   4362 O  O   A LYS A 1 509 ? 39.468 64.590 27.134  0.60 26.70 ? 506  LYS A O   1 
ATOM   4363 O  O   B LYS A 1 509 ? 37.879 66.295 28.290  0.40 20.36 ? 506  LYS A O   1 
ATOM   4364 C  CB  A LYS A 1 509 ? 42.172 63.551 26.419  0.60 26.06 ? 506  LYS A CB  1 
ATOM   4365 C  CB  B LYS A 1 509 ? 41.073 66.643 27.376  0.40 21.36 ? 506  LYS A CB  1 
ATOM   4366 C  CG  A LYS A 1 509 ? 43.197 62.416 26.372  0.60 28.54 ? 506  LYS A CG  1 
ATOM   4367 C  CG  B LYS A 1 509 ? 41.119 67.200 28.769  0.40 26.14 ? 506  LYS A CG  1 
ATOM   4368 C  CD  A LYS A 1 509 ? 44.515 62.772 27.052  0.60 35.40 ? 506  LYS A CD  1 
ATOM   4369 C  CD  B LYS A 1 509 ? 42.442 67.953 28.921  0.40 30.52 ? 506  LYS A CD  1 
ATOM   4370 C  CE  A LYS A 1 509 ? 45.265 61.518 27.522  0.60 38.84 ? 506  LYS A CE  1 
ATOM   4371 C  CE  B LYS A 1 509 ? 43.559 67.102 28.352  0.40 31.02 ? 506  LYS A CE  1 
ATOM   4372 N  NZ  A LYS A 1 509 ? 46.226 61.039 26.493  0.60 40.68 ? 506  LYS A NZ  1 
ATOM   4373 N  NZ  B LYS A 1 509 ? 44.475 67.874 27.478  0.40 34.08 ? 506  LYS A NZ  1 
ATOM   4374 N  N   A LEU A 1 510 ? 39.231 64.800 24.898  0.60 23.82 ? 507  LEU A N   1 
ATOM   4375 N  N   B LEU A 1 510 ? 38.340 67.432 26.345  0.40 19.95 ? 507  LEU A N   1 
ATOM   4376 C  CA  A LEU A 1 510 ? 38.321 65.939 25.030  0.60 25.00 ? 507  LEU A CA  1 
ATOM   4377 C  CA  B LEU A 1 510 ? 37.154 68.269 26.498  0.40 19.19 ? 507  LEU A CA  1 
ATOM   4378 C  C   A LEU A 1 510 ? 36.920 65.461 25.315  0.60 26.66 ? 507  LEU A C   1 
ATOM   4379 C  C   B LEU A 1 510 ? 35.944 67.422 26.161  0.40 19.32 ? 507  LEU A C   1 
ATOM   4380 O  O   A LEU A 1 510 ? 36.549 64.321 24.995  0.60 26.50 ? 507  LEU A O   1 
ATOM   4381 O  O   B LEU A 1 510 ? 34.847 67.787 26.542  0.40 21.45 ? 507  LEU A O   1 
ATOM   4382 C  CB  A LEU A 1 510 ? 38.224 66.750 23.733  0.60 23.11 ? 507  LEU A CB  1 
ATOM   4383 C  CB  B LEU A 1 510 ? 37.159 69.377 25.575  0.40 19.20 ? 507  LEU A CB  1 
ATOM   4384 C  CG  A LEU A 1 510 ? 39.447 67.481 23.200  0.60 23.48 ? 507  LEU A CG  1 
ATOM   4385 C  CG  B LEU A 1 510 ? 38.202 70.424 25.338  0.40 19.53 ? 507  LEU A CG  1 
ATOM   4386 C  CD1 A LEU A 1 510 ? 39.136 68.031 21.846  0.60 21.36 ? 507  LEU A CD1 1 
ATOM   4387 C  CD1 B LEU A 1 510 ? 37.158 71.005 24.250  0.40 11.81 ? 507  LEU A CD1 1 
ATOM   4388 C  CD2 A LEU A 1 510 ? 39.914 68.580 24.133  0.60 23.73 ? 507  LEU A CD2 1 
ATOM   4389 C  CD2 B LEU A 1 510 ? 38.555 71.271 26.623  0.40 20.76 ? 507  LEU A CD2 1 
ATOM   4390 N  N   A GLY A 1 511 ? 36.115 66.364 25.845  0.60 27.50 ? 508  GLY A N   1 
ATOM   4391 N  N   B GLY A 1 511 ? 36.152 66.306 25.464  0.40 19.44 ? 508  GLY A N   1 
ATOM   4392 C  CA  A GLY A 1 511 ? 34.694 66.077 25.914  0.60 29.40 ? 508  GLY A CA  1 
ATOM   4393 C  CA  B GLY A 1 511 ? 35.061 65.355 25.091  0.40 19.69 ? 508  GLY A CA  1 
ATOM   4394 C  C   A GLY A 1 511 ? 34.287 64.996 26.910  0.60 29.95 ? 508  GLY A C   1 
ATOM   4395 C  C   B GLY A 1 511 ? 34.610 64.569 26.319  0.40 22.14 ? 508  GLY A C   1 
ATOM   4396 O  O   A GLY A 1 511 ? 33.098 64.736 27.050  0.60 30.55 ? 508  GLY A O   1 
ATOM   4397 O  O   B GLY A 1 511 ? 33.419 64.431 26.577  0.40 20.56 ? 508  GLY A O   1 
ATOM   4398 N  N   A LYS A 1 512 ? 35.252 64.343 27.582  0.60 30.90 ? 509  LYS A N   1 
ATOM   4399 N  N   B LYS A 1 512 ? 35.567 64.130 27.136  0.40 23.59 ? 509  LYS A N   1 
ATOM   4400 C  CA  A LYS A 1 512 ? 34.919 63.664 28.828  0.60 31.13 ? 509  LYS A CA  1 
ATOM   4401 C  CA  B LYS A 1 512 ? 35.205 63.573 28.422  0.40 25.61 ? 509  LYS A CA  1 
ATOM   4402 C  C   A LYS A 1 512 ? 34.265 64.763 29.637  0.60 31.22 ? 509  LYS A C   1 
ATOM   4403 C  C   B LYS A 1 512 ? 34.472 64.591 29.308  0.40 25.77 ? 509  LYS A C   1 
ATOM   4404 O  O   A LYS A 1 512 ? 33.202 64.583 30.267  0.60 30.23 ? 509  LYS A O   1 
ATOM   4405 O  O   B LYS A 1 512 ? 33.548 64.231 30.047  0.40 26.38 ? 509  LYS A O   1 
ATOM   4406 C  CB  A LYS A 1 512 ? 36.170 63.097 29.529  0.60 31.64 ? 509  LYS A CB  1 
ATOM   4407 C  CB  B LYS A 1 512 ? 36.439 63.035 29.134  0.40 26.24 ? 509  LYS A CB  1 
ATOM   4408 C  CG  A LYS A 1 512 ? 36.845 61.905 28.776  0.60 32.16 ? 509  LYS A CG  1 
ATOM   4409 C  CG  B LYS A 1 512 ? 36.118 61.898 30.063  0.40 30.52 ? 509  LYS A CG  1 
ATOM   4410 C  CD  A LYS A 1 512 ? 38.173 61.460 29.464  0.60 36.27 ? 509  LYS A CD  1 
ATOM   4411 C  CD  B LYS A 1 512 ? 36.294 62.312 31.469  0.40 33.73 ? 509  LYS A CD  1 
ATOM   4412 C  CE  A LYS A 1 512 ? 39.035 60.638 28.522  0.60 34.70 ? 509  LYS A CE  1 
ATOM   4413 C  CE  B LYS A 1 512 ? 37.768 62.433 31.810  0.40 35.50 ? 509  LYS A CE  1 
ATOM   4414 N  NZ  A LYS A 1 512 ? 40.333 60.149 29.117  0.60 38.20 ? 509  LYS A NZ  1 
ATOM   4415 N  NZ  B LYS A 1 512 ? 37.972 63.233 33.021  0.40 36.52 ? 509  LYS A NZ  1 
ATOM   4416 N  N   A ASN A 1 513 ? 34.873 65.944 29.574  0.60 30.90 ? 510  ASN A N   1 
ATOM   4417 N  N   B ASN A 1 513 ? 34.883 65.857 29.245  0.40 26.86 ? 510  ASN A N   1 
ATOM   4418 C  CA  A ASN A 1 513 ? 34.299 67.090 30.236  0.60 31.81 ? 510  ASN A CA  1 
ATOM   4419 C  CA  B ASN A 1 513 ? 34.321 66.942 30.097  0.40 28.90 ? 510  ASN A CA  1 
ATOM   4420 C  C   . ASN A 1 513 ? 32.905 67.401 29.680  1.00 30.02 ? 510  ASN A C   1 
ATOM   4421 O  O   . ASN A 1 513 ? 31.995 67.702 30.461  1.00 28.87 ? 510  ASN A O   1 
ATOM   4422 C  CB  A ASN A 1 513 ? 35.213 68.325 30.114  0.60 32.81 ? 510  ASN A CB  1 
ATOM   4423 C  CB  B ASN A 1 513 ? 35.269 68.138 29.988  0.40 29.56 ? 510  ASN A CB  1 
ATOM   4424 C  CG  A ASN A 1 513 ? 36.533 68.188 30.904  0.60 37.09 ? 510  ASN A CG  1 
ATOM   4425 C  CG  B ASN A 1 513 ? 34.964 69.230 30.989  0.40 31.43 ? 510  ASN A CG  1 
ATOM   4426 O  OD1 A ASN A 1 513 ? 36.708 67.293 31.738  0.60 38.70 ? 510  ASN A OD1 1 
ATOM   4427 O  OD1 B ASN A 1 513 ? 35.567 69.279 32.069  0.40 33.93 ? 510  ASN A OD1 1 
ATOM   4428 N  ND2 A ASN A 1 513 ? 37.465 69.106 30.636  0.60 42.30 ? 510  ASN A ND2 1 
ATOM   4429 N  ND2 B ASN A 1 513 ? 34.061 70.134 30.630  0.40 36.10 ? 510  ASN A ND2 1 
ATOM   4430 N  N   . ILE A 1 514 ? 32.720 67.393 28.369  1.00 29.03 ? 511  ILE A N   1 
ATOM   4431 C  CA  . ILE A 1 514 ? 31.411 67.681 27.832  1.00 28.33 ? 511  ILE A CA  1 
ATOM   4432 C  C   . ILE A 1 514 ? 30.381 66.584 28.177  1.00 26.52 ? 511  ILE A C   1 
ATOM   4433 O  O   . ILE A 1 514 ? 29.237 66.892 28.490  1.00 26.55 ? 511  ILE A O   1 
ATOM   4434 C  CB  . ILE A 1 514 ? 31.500 68.012 26.293  1.00 27.89 ? 511  ILE A CB  1 
ATOM   4435 C  CG1 . ILE A 1 514 ? 32.097 69.457 26.153  1.00 31.95 ? 511  ILE A CG1 1 
ATOM   4436 C  CG2 . ILE A 1 514 ? 30.092 67.893 25.655  1.00 25.96 ? 511  ILE A CG2 1 
ATOM   4437 C  CD1 . ILE A 1 514 ? 32.376 69.841 24.712  1.00 32.41 ? 511  ILE A CD1 1 
ATOM   4438 N  N   . LEU A 1 515 ? 30.801 65.318 28.160  1.00 27.35 ? 512  LEU A N   1 
ATOM   4439 C  CA  . LEU A 1 515 ? 29.893 64.257 28.575  1.00 29.63 ? 512  LEU A CA  1 
ATOM   4440 C  C   . LEU A 1 515 ? 29.477 64.468 29.995  1.00 31.00 ? 512  LEU A C   1 
ATOM   4441 O  O   . LEU A 1 515 ? 28.325 64.309 30.311  1.00 30.69 ? 512  LEU A O   1 
ATOM   4442 C  CB  . LEU A 1 515 ? 30.540 62.860 28.448  1.00 30.38 ? 512  LEU A CB  1 
ATOM   4443 C  CG  . LEU A 1 515 ? 30.476 62.287 27.076  1.00 31.74 ? 512  LEU A CG  1 
ATOM   4444 C  CD1 . LEU A 1 515 ? 31.528 61.142 26.879  1.00 37.98 ? 512  LEU A CD1 1 
ATOM   4445 C  CD2 . LEU A 1 515 ? 29.014 61.810 26.744  1.00 31.14 ? 512  LEU A CD2 1 
ATOM   4446 N  N   . LYS A 1 516 ? 30.411 64.837 30.865  1.00 32.09 ? 513  LYS A N   1 
ATOM   4447 C  CA  A LYS A 1 516 ? 30.070 65.076 32.265  0.60 33.77 ? 513  LYS A CA  1 
ATOM   4448 C  CA  B LYS A 1 516 ? 30.078 65.083 32.271  0.40 33.14 ? 513  LYS A CA  1 
ATOM   4449 C  C   . LYS A 1 516 ? 29.048 66.206 32.377  1.00 34.00 ? 513  LYS A C   1 
ATOM   4450 O  O   . LYS A 1 516 ? 28.060 66.083 33.091  1.00 35.20 ? 513  LYS A O   1 
ATOM   4451 C  CB  A LYS A 1 516 ? 31.313 65.416 33.102  0.60 35.44 ? 513  LYS A CB  1 
ATOM   4452 C  CB  B LYS A 1 516 ? 31.333 65.443 33.082  0.40 34.17 ? 513  LYS A CB  1 
ATOM   4453 C  CG  A LYS A 1 516 ? 32.198 64.219 33.459  0.60 36.78 ? 513  LYS A CG  1 
ATOM   4454 C  CG  B LYS A 1 516 ? 31.213 65.277 34.609  0.40 34.11 ? 513  LYS A CG  1 
ATOM   4455 C  CD  A LYS A 1 516 ? 33.438 64.655 34.268  0.60 41.15 ? 513  LYS A CD  1 
ATOM   4456 C  CD  B LYS A 1 516 ? 32.571 64.858 35.187  0.40 36.05 ? 513  LYS A CD  1 
ATOM   4457 C  CE  A LYS A 1 516 ? 34.204 63.455 34.833  0.60 43.95 ? 513  LYS A CE  1 
ATOM   4458 C  CE  B LYS A 1 516 ? 32.469 64.296 36.597  0.40 37.30 ? 513  LYS A CE  1 
ATOM   4459 N  NZ  A LYS A 1 516 ? 34.760 62.620 33.730  0.60 45.33 ? 513  LYS A NZ  1 
ATOM   4460 N  NZ  B LYS A 1 516 ? 33.041 65.207 37.624  0.40 37.19 ? 513  LYS A NZ  1 
ATOM   4461 N  N   . ALA A 1 517 ? 29.282 67.307 31.654  1.00 32.20 ? 514  ALA A N   1 
ATOM   4462 C  CA  . ALA A 1 517 ? 28.349 68.419 31.554  1.00 31.86 ? 514  ALA A CA  1 
ATOM   4463 C  C   . ALA A 1 517 ? 26.984 68.047 31.012  1.00 32.39 ? 514  ALA A C   1 
ATOM   4464 O  O   . ALA A 1 517 ? 25.999 68.570 31.439  1.00 33.39 ? 514  ALA A O   1 
ATOM   4465 C  CB  . ALA A 1 517 ? 28.947 69.547 30.711  1.00 31.50 ? 514  ALA A CB  1 
ATOM   4466 N  N   . MET A 1 518 ? 26.938 67.191 30.000  1.00 30.96 ? 515  MET A N   1 
ATOM   4467 C  CA  . MET A 1 518 ? 25.697 66.712 29.448  1.00 31.12 ? 515  MET A CA  1 
ATOM   4468 C  C   . MET A 1 518 ? 24.897 65.900 30.444  1.00 34.33 ? 515  MET A C   1 
ATOM   4469 O  O   . MET A 1 518 ? 23.679 65.875 30.367  1.00 37.06 ? 515  MET A O   1 
ATOM   4470 C  CB  . MET A 1 518 ? 25.947 65.848 28.224  1.00 30.21 ? 515  MET A CB  1 
ATOM   4471 C  CG  . MET A 1 518 ? 26.393 66.636 27.013  1.00 26.02 ? 515  MET A CG  1 
ATOM   4472 S  SD  . MET A 1 518 ? 26.897 65.620 25.621  1.00 27.62 ? 515  MET A SD  1 
ATOM   4473 C  CE  . MET A 1 518 ? 25.404 65.484 24.671  1.00 33.52 ? 515  MET A CE  1 
ATOM   4474 N  N   . ASN A 1 519 ? 25.575 65.235 31.363  1.00 36.57 ? 516  ASN A N   1 
ATOM   4475 C  CA  . ASN A 1 519 ? 24.884 64.353 32.314  1.00 38.24 ? 516  ASN A CA  1 
ATOM   4476 C  C   . ASN A 1 519 ? 24.583 65.001 33.657  1.00 41.58 ? 516  ASN A C   1 
ATOM   4477 O  O   . ASN A 1 519 ? 23.820 64.442 34.448  1.00 42.73 ? 516  ASN A O   1 
ATOM   4478 C  CB  . ASN A 1 519 ? 25.625 63.005 32.384  1.00 39.20 ? 516  ASN A CB  1 
ATOM   4479 C  CG  . ASN A 1 519 ? 25.412 62.176 31.070  1.00 36.22 ? 516  ASN A CG  1 
ATOM   4480 O  OD1 . ASN A 1 519 ? 24.275 61.952 30.681  1.00 38.21 ? 516  ASN A OD1 1 
ATOM   4481 N  ND2 . ASN A 1 519 ? 26.479 61.843 30.353  1.00 40.72 ? 516  ASN A ND2 1 
ATOM   4482 N  N   . ASP A 1 520 ? 25.120 66.203 33.882  1.00 41.86 ? 517  ASP A N   1 
ATOM   4483 C  CA  . ASP A 1 520 ? 24.887 66.922 35.143  1.00 44.45 ? 517  ASP A CA  1 
ATOM   4484 C  C   . ASP A 1 520 ? 25.123 68.429 34.985  1.00 44.23 ? 517  ASP A C   1 
ATOM   4485 O  O   . ASP A 1 520 ? 26.272 68.882 35.018  1.00 43.84 ? 517  ASP A O   1 
ATOM   4486 C  CB  . ASP A 1 520 ? 25.815 66.355 36.219  1.00 44.87 ? 517  ASP A CB  1 
ATOM   4487 C  CG  . ASP A 1 520 ? 25.601 67.014 37.576  1.00 47.37 ? 517  ASP A CG  1 
ATOM   4488 O  OD1 . ASP A 1 520 ? 26.379 66.714 38.506  1.00 53.36 ? 517  ASP A OD1 1 
ATOM   4489 O  OD2 . ASP A 1 520 ? 24.657 67.828 37.686  1.00 49.71 ? 517  ASP A OD2 1 
ATOM   4490 N  N   . ASP A 1 521 ? 24.036 69.173 34.828  1.00 46.22 ? 518  ASP A N   1 
ATOM   4491 C  CA  . ASP A 1 521 ? 24.088 70.630 34.637  1.00 47.86 ? 518  ASP A CA  1 
ATOM   4492 C  C   . ASP A 1 521 ? 24.417 71.426 35.918  1.00 49.72 ? 518  ASP A C   1 
ATOM   4493 O  O   . ASP A 1 521 ? 24.496 72.653 35.863  1.00 50.81 ? 518  ASP A O   1 
ATOM   4494 C  CB  . ASP A 1 521 ? 22.787 71.147 33.979  1.00 48.26 ? 518  ASP A CB  1 
ATOM   4495 C  CG  . ASP A 1 521 ? 21.551 71.016 34.877  1.00 52.21 ? 518  ASP A CG  1 
ATOM   4496 O  OD1 . ASP A 1 521 ? 21.701 70.741 36.085  1.00 54.62 ? 518  ASP A OD1 1 
ATOM   4497 O  OD2 . ASP A 1 521 ? 20.423 71.191 34.354  1.00 56.10 ? 518  ASP A OD2 1 
ATOM   4498 N  N   . SER A 1 522 ? 24.609 70.730 37.045  1.00 50.27 ? 519  SER A N   1 
ATOM   4499 C  CA  . SER A 1 522 ? 25.075 71.337 38.285  1.00 51.59 ? 519  SER A CA  1 
ATOM   4500 C  C   . SER A 1 522 ? 26.590 71.144 38.453  1.00 51.10 ? 519  SER A C   1 
ATOM   4501 O  O   . SER A 1 522 ? 27.177 71.609 39.442  1.00 51.15 ? 519  SER A O   1 
ATOM   4502 C  CB  . SER A 1 522 ? 24.320 70.731 39.490  1.00 52.52 ? 519  SER A CB  1 
ATOM   4503 O  OG  . SER A 1 522 ? 24.938 69.516 39.933  1.00 52.38 ? 519  SER A OG  1 
ATOM   4504 N  N   . SER A 1 523 ? 27.232 70.462 37.497  1.00 49.05 ? 520  SER A N   1 
ATOM   4505 C  CA  . SER A 1 523 ? 28.643 70.146 37.630  1.00 48.71 ? 520  SER A CA  1 
ATOM   4506 C  C   . SER A 1 523 ? 29.487 71.381 37.399  1.00 49.54 ? 520  SER A C   1 
ATOM   4507 O  O   . SER A 1 523 ? 29.036 72.344 36.756  1.00 50.36 ? 520  SER A O   1 
ATOM   4508 C  CB  . SER A 1 523 ? 29.064 69.074 36.621  1.00 47.77 ? 520  SER A CB  1 
ATOM   4509 O  OG  . SER A 1 523 ? 28.757 69.448 35.263  1.00 45.12 ? 520  SER A OG  1 
ATOM   4510 N  N   . ASP A 1 524 ? 30.731 71.324 37.868  1.00 49.55 ? 521  ASP A N   1 
ATOM   4511 C  CA  . ASP A 1 524 ? 31.738 72.333 37.541  1.00 49.17 ? 521  ASP A CA  1 
ATOM   4512 C  C   . ASP A 1 524 ? 31.942 72.394 36.022  1.00 46.59 ? 521  ASP A C   1 
ATOM   4513 O  O   . ASP A 1 524 ? 32.058 73.461 35.435  1.00 46.69 ? 521  ASP A O   1 
ATOM   4514 C  CB  . ASP A 1 524 ? 33.070 71.984 38.181  1.00 49.91 ? 521  ASP A CB  1 
ATOM   4515 C  CG  . ASP A 1 524 ? 33.083 72.204 39.695  1.00 52.74 ? 521  ASP A CG  1 
ATOM   4516 O  OD1 . ASP A 1 524 ? 32.043 72.565 40.312  1.00 55.02 ? 521  ASP A OD1 1 
ATOM   4517 O  OD2 . ASP A 1 524 ? 34.178 72.015 40.241  1.00 56.33 ? 521  ASP A OD2 1 
ATOM   4518 N  N   . GLU A 1 525 ? 32.007 71.218 35.417  1.00 44.68 ? 522  GLU A N   1 
ATOM   4519 C  CA  . GLU A 1 525 ? 32.126 71.075 33.965  1.00 41.92 ? 522  GLU A CA  1 
ATOM   4520 C  C   . GLU A 1 525 ? 31.083 71.909 33.200  1.00 40.64 ? 522  GLU A C   1 
ATOM   4521 O  O   . GLU A 1 525 ? 31.427 72.574 32.224  1.00 39.53 ? 522  GLU A O   1 
ATOM   4522 C  CB  . GLU A 1 525 ? 31.986 69.592 33.578  1.00 41.30 ? 522  GLU A CB  1 
ATOM   4523 C  CG  . GLU A 1 525 ? 33.206 68.694 33.922  1.00 42.41 ? 522  GLU A CG  1 
ATOM   4524 C  CD  . GLU A 1 525 ? 33.347 68.291 35.403  1.00 46.72 ? 522  GLU A CD  1 
ATOM   4525 O  OE1 . GLU A 1 525 ? 32.387 68.438 36.206  1.00 45.78 ? 522  GLU A OE1 1 
ATOM   4526 O  OE2 . GLU A 1 525 ? 34.461 67.807 35.731  1.00 48.79 ? 522  GLU A OE2 1 
ATOM   4527 N  N   . TYR A 1 526 ? 29.827 71.828 33.608  1.00 38.98 ? 523  TYR A N   1 
ATOM   4528 C  CA  . TYR A 1 526 ? 28.771 72.572 32.950  1.00 38.37 ? 523  TYR A CA  1 
ATOM   4529 C  C   . TYR A 1 526 ? 28.908 74.072 33.180  1.00 38.50 ? 523  TYR A C   1 
ATOM   4530 O  O   . TYR A 1 526 ? 28.712 74.896 32.277  1.00 37.38 ? 523  TYR A O   1 
ATOM   4531 C  CB  . TYR A 1 526 ? 27.408 72.114 33.450  1.00 38.66 ? 523  TYR A CB  1 
ATOM   4532 C  CG  . TYR A 1 526 ? 26.258 72.739 32.724  1.00 40.81 ? 523  TYR A CG  1 
ATOM   4533 C  CD1 . TYR A 1 526 ? 25.681 72.110 31.629  1.00 39.79 ? 523  TYR A CD1 1 
ATOM   4534 C  CD2 . TYR A 1 526 ? 25.725 73.964 33.135  1.00 44.14 ? 523  TYR A CD2 1 
ATOM   4535 C  CE1 . TYR A 1 526 ? 24.617 72.678 30.948  1.00 41.74 ? 523  TYR A CE1 1 
ATOM   4536 C  CE2 . TYR A 1 526 ? 24.651 74.542 32.470  1.00 45.87 ? 523  TYR A CE2 1 
ATOM   4537 C  CZ  . TYR A 1 526 ? 24.095 73.894 31.398  1.00 43.53 ? 523  TYR A CZ  1 
ATOM   4538 O  OH  . TYR A 1 526 ? 23.050 74.459 30.709  1.00 45.62 ? 523  TYR A OH  1 
ATOM   4539 N  N   . GLN A 1 527 ? 29.219 74.436 34.421  1.00 38.84 ? 524  GLN A N   1 
ATOM   4540 C  CA  A GLN A 1 527 ? 29.379 75.836 34.763  0.60 39.88 ? 524  GLN A CA  1 
ATOM   4541 C  CA  B GLN A 1 527 ? 29.387 75.831 34.780  0.40 39.46 ? 524  GLN A CA  1 
ATOM   4542 C  C   . GLN A 1 527 ? 30.506 76.512 33.993  1.00 38.17 ? 524  GLN A C   1 
ATOM   4543 O  O   . GLN A 1 527 ? 30.379 77.677 33.627  1.00 40.14 ? 524  GLN A O   1 
ATOM   4544 C  CB  A GLN A 1 527 ? 29.594 76.003 36.288  0.60 41.34 ? 524  GLN A CB  1 
ATOM   4545 C  CB  B GLN A 1 527 ? 29.656 75.935 36.290  0.40 40.56 ? 524  GLN A CB  1 
ATOM   4546 C  CG  A GLN A 1 527 ? 28.378 76.486 37.033  0.60 43.96 ? 524  GLN A CG  1 
ATOM   4547 C  CG  B GLN A 1 527 ? 30.184 77.260 36.760  0.40 41.20 ? 524  GLN A CG  1 
ATOM   4548 C  CD  A GLN A 1 527 ? 27.092 75.769 36.666  0.60 45.37 ? 524  GLN A CD  1 
ATOM   4549 C  CD  B GLN A 1 527 ? 30.280 77.285 38.257  0.40 41.76 ? 524  GLN A CD  1 
ATOM   4550 O  OE1 A GLN A 1 527 ? 26.115 76.418 36.263  0.60 47.08 ? 524  GLN A OE1 1 
ATOM   4551 O  OE1 B GLN A 1 527 ? 31.366 77.189 38.814  0.40 40.67 ? 524  GLN A OE1 1 
ATOM   4552 N  NE2 A GLN A 1 527 ? 27.073 74.433 36.817  0.60 43.68 ? 524  GLN A NE2 1 
ATOM   4553 N  NE2 B GLN A 1 527 ? 29.135 77.349 38.915  0.40 42.41 ? 524  GLN A NE2 1 
ATOM   4554 N  N   . ASN A 1 528 ? 31.578 75.782 33.739  1.00 37.56 ? 525  ASN A N   1 
ATOM   4555 C  CA  . ASN A 1 528 ? 32.785 76.301 33.072  1.00 36.60 ? 525  ASN A CA  1 
ATOM   4556 C  C   . ASN A 1 528 ? 32.701 76.317 31.548  1.00 34.79 ? 525  ASN A C   1 
ATOM   4557 O  O   . ASN A 1 528 ? 33.646 76.733 30.877  1.00 33.69 ? 525  ASN A O   1 
ATOM   4558 C  CB  . ASN A 1 528 ? 34.000 75.472 33.495  1.00 37.91 ? 525  ASN A CB  1 
ATOM   4559 C  CG  . ASN A 1 528 ? 34.337 75.652 34.995  1.00 41.93 ? 525  ASN A CG  1 
ATOM   4560 O  OD1 . ASN A 1 528 ? 33.875 76.596 35.648  1.00 47.24 ? 525  ASN A OD1 1 
ATOM   4561 N  ND2 . ASN A 1 528 ? 35.127 74.715 35.535  1.00 48.85 ? 525  ASN A ND2 1 
ATOM   4562 N  N   . LEU A 1 529 ? 31.623 75.770 31.002  1.00 33.48 ? 526  LEU A N   1 
ATOM   4563 C  CA  . LEU A 1 529 ? 31.445 75.785 29.538  1.00 30.23 ? 526  LEU A CA  1 
ATOM   4564 C  C   . LEU A 1 529 ? 31.385 77.205 28.977  1.00 29.51 ? 526  LEU A C   1 
ATOM   4565 O  O   . LEU A 1 529 ? 30.864 78.137 29.605  1.00 30.62 ? 526  LEU A O   1 
ATOM   4566 C  CB  . LEU A 1 529 ? 30.162 75.058 29.106  1.00 29.21 ? 526  LEU A CB  1 
ATOM   4567 C  CG  . LEU A 1 529 ? 29.992 73.568 29.396  1.00 29.13 ? 526  LEU A CG  1 
ATOM   4568 C  CD1 . LEU A 1 529 ? 28.573 73.069 29.080  1.00 31.68 ? 526  LEU A CD1 1 
ATOM   4569 C  CD2 . LEU A 1 529 ? 31.049 72.744 28.715  1.00 28.57 ? 526  LEU A CD2 1 
ATOM   4570 N  N   . ASP A 1 530 ? 31.887 77.345 27.742  1.00 27.37 ? 527  ASP A N   1 
ATOM   4571 C  CA  . ASP A 1 530 ? 31.553 78.535 26.948  1.00 25.80 ? 527  ASP A CA  1 
ATOM   4572 C  C   . ASP A 1 530 ? 30.070 78.390 26.574  1.00 25.47 ? 527  ASP A C   1 
ATOM   4573 O  O   . ASP A 1 530 ? 29.517 77.301 26.547  1.00 25.11 ? 527  ASP A O   1 
ATOM   4574 C  CB  . ASP A 1 530 ? 32.373 78.621 25.683  1.00 24.07 ? 527  ASP A CB  1 
ATOM   4575 C  CG  . ASP A 1 530 ? 32.045 77.500 24.757  1.00 23.51 ? 527  ASP A CG  1 
ATOM   4576 O  OD1 . ASP A 1 530 ? 32.516 76.361 24.977  1.00 22.85 ? 527  ASP A OD1 1 
ATOM   4577 O  OD2 . ASP A 1 530 ? 31.182 77.724 23.855  1.00 23.32 ? 527  ASP A OD2 1 
ATOM   4578 N  N   . ASP A 1 531 ? 29.412 79.503 26.342  1.00 25.09 ? 528  ASP A N   1 
ATOM   4579 C  CA  . ASP A 1 531 ? 27.952 79.439 26.114  1.00 25.00 ? 528  ASP A CA  1 
ATOM   4580 C  C   . ASP A 1 531 ? 27.524 78.806 24.775  1.00 24.26 ? 528  ASP A C   1 
ATOM   4581 O  O   . ASP A 1 531 ? 26.415 78.354 24.682  1.00 23.72 ? 528  ASP A O   1 
ATOM   4582 C  CB  . ASP A 1 531 ? 27.327 80.805 26.258  1.00 25.51 ? 528  ASP A CB  1 
ATOM   4583 C  CG  . ASP A 1 531 ? 25.860 80.730 26.603  1.00 28.69 ? 528  ASP A CG  1 
ATOM   4584 O  OD1 . ASP A 1 531 ? 25.451 79.917 27.465  1.00 31.42 ? 528  ASP A OD1 1 
ATOM   4585 O  OD2 . ASP A 1 531 ? 25.090 81.514 25.980  1.00 30.81 ? 528  ASP A OD2 1 
ATOM   4586 N  N   . SER A 1 532 ? 28.394 78.758 23.774  1.00 22.95 ? 529  SER A N   1 
ATOM   4587 C  CA  . SER A 1 532 ? 28.039 78.111 22.509  1.00 22.17 ? 529  SER A CA  1 
ATOM   4588 C  C   . SER A 1 532 ? 27.892 76.625 22.819  1.00 22.21 ? 529  SER A C   1 
ATOM   4589 O  O   . SER A 1 532 ? 26.869 75.997 22.516  1.00 22.15 ? 529  SER A O   1 
ATOM   4590 C  CB  . SER A 1 532 ? 29.079 78.366 21.467  1.00 20.36 ? 529  SER A CB  1 
ATOM   4591 O  OG  . SER A 1 532 ? 28.878 77.478 20.330  1.00 20.29 ? 529  SER A OG  1 
ATOM   4592 N  N   . THR A 1 533 ? 28.912 76.032 23.464  1.00 21.04 ? 530  THR A N   1 
ATOM   4593 C  CA  . THR A 1 533 ? 28.821 74.634 23.827  1.00 20.12 ? 530  THR A CA  1 
ATOM   4594 C  C   . THR A 1 533 ? 27.625 74.377 24.745  1.00 22.59 ? 530  THR A C   1 
ATOM   4595 O  O   . THR A 1 533 ? 26.886 73.408 24.597  1.00 22.48 ? 530  THR A O   1 
ATOM   4596 C  CB  . THR A 1 533 ? 30.126 74.162 24.534  1.00 20.46 ? 530  THR A CB  1 
ATOM   4597 O  OG1 . THR A 1 533 ? 31.259 74.496 23.743  1.00 20.75 ? 530  THR A OG1 1 
ATOM   4598 C  CG2 . THR A 1 533 ? 30.121 72.670 24.826  1.00 22.53 ? 530  THR A CG2 1 
ATOM   4599 N  N   . ARG A 1 534 ? 27.409 75.245 25.736  1.00 23.04 ? 531  ARG A N   1 
ATOM   4600 C  CA  . ARG A 1 534 ? 26.296 75.050 26.645  1.00 24.82 ? 531  ARG A CA  1 
ATOM   4601 C  C   . ARG A 1 534 ? 24.932 75.045 25.949  1.00 25.06 ? 531  ARG A C   1 
ATOM   4602 O  O   . ARG A 1 534 ? 24.100 74.203 26.228  1.00 24.15 ? 531  ARG A O   1 
ATOM   4603 C  CB  . ARG A 1 534 ? 26.282 76.156 27.699  1.00 25.30 ? 531  ARG A CB  1 
ATOM   4604 C  CG  . ARG A 1 534 ? 25.170 75.992 28.776  1.00 28.80 ? 531  ARG A CG  1 
ATOM   4605 C  CD  . ARG A 1 534 ? 25.152 77.122 29.822  1.00 31.53 ? 531  ARG A CD  1 
ATOM   4606 N  NE  . ARG A 1 534 ? 26.386 77.049 30.614  1.00 32.89 ? 531  ARG A NE  1 
ATOM   4607 C  CZ  . ARG A 1 534 ? 27.456 77.836 30.454  1.00 34.39 ? 531  ARG A CZ  1 
ATOM   4608 N  NH1 . ARG A 1 534 ? 27.483 78.839 29.569  1.00 33.48 ? 531  ARG A NH1 1 
ATOM   4609 N  NH2 . ARG A 1 534 ? 28.515 77.639 31.229  1.00 34.72 ? 531  ARG A NH2 1 
ATOM   4610 N  N   . GLN A 1 535 ? 24.717 75.955 25.005  1.00 24.71 ? 532  GLN A N   1 
ATOM   4611 C  CA  . GLN A 1 535 ? 23.421 76.017 24.351  1.00 25.59 ? 532  GLN A CA  1 
ATOM   4612 C  C   . GLN A 1 535 ? 23.253 74.874 23.339  1.00 24.55 ? 532  GLN A C   1 
ATOM   4613 O  O   . GLN A 1 535 ? 22.119 74.416 23.133  1.00 26.81 ? 532  GLN A O   1 
ATOM   4614 C  CB  . GLN A 1 535 ? 23.173 77.374 23.703  1.00 26.16 ? 532  GLN A CB  1 
ATOM   4615 C  CG  . GLN A 1 535 ? 23.186 78.513 24.688  1.00 27.44 ? 532  GLN A CG  1 
ATOM   4616 C  CD  . GLN A 1 535 ? 22.273 78.306 25.869  1.00 33.03 ? 532  GLN A CD  1 
ATOM   4617 O  OE1 . GLN A 1 535 ? 21.150 77.832 25.742  1.00 32.79 ? 532  GLN A OE1 1 
ATOM   4618 N  NE2 . GLN A 1 535 ? 22.772 78.661 27.048  1.00 35.74 ? 532  GLN A NE2 1 
ATOM   4619 N  N   . LEU A 1 536 ? 24.335 74.371 22.735  1.00 22.87 ? 533  LEU A N   1 
ATOM   4620 C  CA  . LEU A 1 536 ? 24.255 73.166 21.904  1.00 21.58 ? 533  LEU A CA  1 
ATOM   4621 C  C   . LEU A 1 536 ? 23.834 71.959 22.738  1.00 23.42 ? 533  LEU A C   1 
ATOM   4622 O  O   . LEU A 1 536 ? 22.944 71.211 22.341  1.00 24.02 ? 533  LEU A O   1 
ATOM   4623 C  CB  . LEU A 1 536 ? 25.591 72.890 21.182  1.00 19.76 ? 533  LEU A CB  1 
ATOM   4624 C  CG  . LEU A 1 536 ? 25.904 73.850 20.026  1.00 19.18 ? 533  LEU A CG  1 
ATOM   4625 C  CD1 . LEU A 1 536 ? 27.394 73.828 19.678  1.00 19.78 ? 533  LEU A CD1 1 
ATOM   4626 C  CD2 . LEU A 1 536 ? 25.018 73.498 18.803  1.00 19.47 ? 533  LEU A CD2 1 
ATOM   4627 N  N   . ILE A 1 537 ? 24.430 71.780 23.918  1.00 24.54 ? 534  ILE A N   1 
ATOM   4628 C  CA  . ILE A 1 537 ? 24.029 70.696 24.815  1.00 26.64 ? 534  ILE A CA  1 
ATOM   4629 C  C   . ILE A 1 537 ? 22.550 70.868 25.200  1.00 28.69 ? 534  ILE A C   1 
ATOM   4630 O  O   . ILE A 1 537 ? 21.803 69.890 25.241  1.00 28.53 ? 534  ILE A O   1 
ATOM   4631 C  CB  . ILE A 1 537 ? 24.920 70.686 26.056  1.00 28.74 ? 534  ILE A CB  1 
ATOM   4632 C  CG1 . ILE A 1 537 ? 26.292 70.167 25.689  1.00 28.39 ? 534  ILE A CG1 1 
ATOM   4633 C  CG2 . ILE A 1 537 ? 24.260 69.938 27.244  1.00 29.31 ? 534  ILE A CG2 1 
ATOM   4634 C  CD1 . ILE A 1 537 ? 27.316 70.468 26.854  1.00 32.77 ? 534  ILE A CD1 1 
ATOM   4635 N  N   . ALA A 1 538 ? 22.124 72.110 25.499  1.00 29.79 ? 535  ALA A N   1 
ATOM   4636 C  CA  . ALA A 1 538 ? 20.750 72.341 25.895  1.00 31.15 ? 535  ALA A CA  1 
ATOM   4637 C  C   . ALA A 1 538 ? 19.804 71.930 24.791  1.00 32.33 ? 535  ALA A C   1 
ATOM   4638 O  O   . ALA A 1 538 ? 18.769 71.350 25.041  1.00 34.11 ? 535  ALA A O   1 
ATOM   4639 C  CB  . ALA A 1 538 ? 20.523 73.842 26.263  1.00 30.49 ? 535  ALA A CB  1 
ATOM   4640 N  N   . LYS A 1 539 ? 20.172 72.227 23.558  1.00 33.45 ? 536  LYS A N   1 
ATOM   4641 C  CA  . LYS A 1 539 ? 19.337 71.867 22.407  1.00 34.81 ? 536  LYS A CA  1 
ATOM   4642 C  C   . LYS A 1 539 ? 19.205 70.368 22.135  1.00 36.86 ? 536  LYS A C   1 
ATOM   4643 O  O   . LYS A 1 539 ? 18.136 69.961 21.641  1.00 37.73 ? 536  LYS A O   1 
ATOM   4644 C  CB  . LYS A 1 539 ? 19.828 72.622 21.197  1.00 33.59 ? 536  LYS A CB  1 
ATOM   4645 C  CG  . LYS A 1 539 ? 19.313 74.003 21.304  1.00 38.40 ? 536  LYS A CG  1 
ATOM   4646 C  CD  . LYS A 1 539 ? 19.875 74.923 20.392  1.00 38.74 ? 536  LYS A CD  1 
ATOM   4647 C  CE  . LYS A 1 539 ? 19.252 76.301 20.609  1.00 41.28 ? 536  LYS A CE  1 
ATOM   4648 N  NZ  . LYS A 1 539 ? 17.789 76.348 20.816  1.00 44.22 ? 536  LYS A NZ  1 
ATOM   4649 N  N   . VAL A 1 540 ? 20.222 69.566 22.474  1.00 37.52 ? 537  VAL A N   1 
ATOM   4650 C  CA  . VAL A 1 540 ? 20.152 68.080 22.349  1.00 38.54 ? 537  VAL A CA  1 
ATOM   4651 C  C   . VAL A 1 540 ? 19.564 67.356 23.564  1.00 43.91 ? 537  VAL A C   1 
ATOM   4652 O  O   . VAL A 1 540 ? 19.499 66.104 23.586  1.00 43.87 ? 537  VAL A O   1 
ATOM   4653 C  CB  . VAL A 1 540 ? 21.495 67.392 21.933  1.00 36.87 ? 537  VAL A CB  1 
ATOM   4654 C  CG1 . VAL A 1 540 ? 22.208 68.203 20.843  1.00 30.79 ? 537  VAL A CG1 1 
ATOM   4655 C  CG2 . VAL A 1 540 ? 22.439 67.102 23.092  1.00 38.15 ? 537  VAL A CG2 1 
ATOM   4656 N  N   . LYS A 1 541 ? 19.194 68.154 24.564  1.00 47.27 ? 538  LYS A N   1 
ATOM   4657 C  CA  A LYS A 1 541 ? 18.396 67.699 25.702  0.60 50.07 ? 538  LYS A CA  1 
ATOM   4658 C  CA  B LYS A 1 541 ? 18.398 67.696 25.704  0.40 49.97 ? 538  LYS A CA  1 
ATOM   4659 C  C   . LYS A 1 541 ? 16.928 67.888 25.368  1.00 51.55 ? 538  LYS A C   1 
ATOM   4660 O  O   . LYS A 1 541 ? 16.121 66.989 25.596  1.00 53.80 ? 538  LYS A O   1 
ATOM   4661 C  CB  A LYS A 1 541 ? 18.719 68.530 26.933  0.60 50.65 ? 538  LYS A CB  1 
ATOM   4662 C  CB  B LYS A 1 541 ? 18.727 68.489 26.974  0.40 50.64 ? 538  LYS A CB  1 
ATOM   4663 C  CG  A LYS A 1 541 ? 20.077 68.268 27.510  0.60 50.78 ? 538  LYS A CG  1 
ATOM   4664 C  CG  B LYS A 1 541 ? 19.649 67.776 27.946  0.40 50.98 ? 538  LYS A CG  1 
ATOM   4665 C  CD  A LYS A 1 541 ? 20.033 67.139 28.538  0.60 51.03 ? 538  LYS A CD  1 
ATOM   4666 C  CD  B LYS A 1 541 ? 19.183 67.946 29.403  0.40 51.39 ? 538  LYS A CD  1 
ATOM   4667 C  CE  A LYS A 1 541 ? 21.417 66.721 28.993  0.60 50.11 ? 538  LYS A CE  1 
ATOM   4668 C  CE  B LYS A 1 541 ? 19.266 69.390 29.888  0.40 51.94 ? 538  LYS A CE  1 
ATOM   4669 N  NZ  A LYS A 1 541 ? 22.394 67.849 29.032  0.60 46.69 ? 538  LYS A NZ  1 
ATOM   4670 N  NZ  B LYS A 1 541 ? 18.783 69.544 31.300  0.40 52.86 ? 538  LYS A NZ  1 
ATOM   4671 N  N   . ASN A 1 542 ? 16.594 69.073 24.827  1.00 53.08 ? 539  ASN A N   1 
ATOM   4672 C  CA  . ASN A 1 542 ? 15.219 69.428 24.483  1.00 55.17 ? 539  ASN A CA  1 
ATOM   4673 C  C   . ASN A 1 542 ? 15.058 69.360 22.965  0.70 54.37 ? 539  ASN A C   1 
ATOM   4674 O  O   . ASN A 1 542 ? 14.648 70.332 22.326  0.70 54.96 ? 539  ASN A O   1 
ATOM   4675 C  CB  . ASN A 1 542 ? 14.836 70.839 25.015  1.00 56.51 ? 539  ASN A CB  1 
ATOM   4676 C  CG  . ASN A 1 542 ? 15.334 71.111 26.456  1.00 59.83 ? 539  ASN A CG  1 
ATOM   4677 O  OD1 . ASN A 1 542 ? 14.823 70.544 27.435  1.00 64.21 ? 539  ASN A OD1 1 
ATOM   4678 N  ND2 . ASN A 1 542 ? 16.322 72.010 26.584  1.00 61.36 ? 539  ASN A ND2 1 
HETATM 4679 C  C1  . 6PG B 2 .   ? 47.285 57.530 13.526  1.00 17.73 ? 601  6PG A C1  1 
HETATM 4680 C  C2  . 6PG B 2 .   ? 46.552 58.024 14.740  1.00 16.10 ? 601  6PG A C2  1 
HETATM 4681 C  C3  . 6PG B 2 .   ? 45.066 57.593 14.895  1.00 14.88 ? 601  6PG A C3  1 
HETATM 4682 C  C4  . 6PG B 2 .   ? 44.878 56.202 15.522  1.00 13.48 ? 601  6PG A C4  1 
HETATM 4683 C  C5  . 6PG B 2 .   ? 43.423 55.964 16.001  1.00 12.66 ? 601  6PG A C5  1 
HETATM 4684 C  C6  . 6PG B 2 .   ? 43.163 54.582 16.578  1.00 13.73 ? 601  6PG A C6  1 
HETATM 4685 O  O1A . 6PG B 2 .   ? 48.257 56.805 13.655  1.00 20.80 ? 601  6PG A O1A 1 
HETATM 4686 O  O1  . 6PG B 2 .   ? 46.948 57.989 12.441  1.00 21.12 ? 601  6PG A O1  1 
HETATM 4687 O  O2  . 6PG B 2 .   ? 47.284 57.802 15.976  1.00 20.74 ? 601  6PG A O2  1 
HETATM 4688 O  O3  . 6PG B 2 .   ? 44.316 57.572 13.626  1.00 15.16 ? 601  6PG A O3  1 
HETATM 4689 O  O4  . 6PG B 2 .   ? 45.195 55.187 14.577  1.00 14.38 ? 601  6PG A O4  1 
HETATM 4690 O  O5  . 6PG B 2 .   ? 43.158 56.959 17.028  1.00 15.67 ? 601  6PG A O5  1 
HETATM 4691 O  O6  . 6PG B 2 .   ? 44.059 54.382 17.695  1.00 14.64 ? 601  6PG A O6  1 
HETATM 4692 P  P   . 6PG B 2 .   ? 44.133 52.933 18.324  1.00 14.27 ? 601  6PG A P   1 
HETATM 4693 O  O1P . 6PG B 2 .   ? 44.626 52.007 17.263  1.00 13.83 ? 601  6PG A O1P 1 
HETATM 4694 O  O2P . 6PG B 2 .   ? 42.739 52.590 18.794  1.00 14.85 ? 601  6PG A O2P 1 
HETATM 4695 O  O3P . 6PG B 2 .   ? 45.092 53.121 19.482  1.00 15.61 ? 601  6PG A O3P 1 
HETATM 4696 O  O1  . MES C 3 .   ? 70.068 47.129 14.155  0.70 21.61 ? 602  MES A O1  1 
HETATM 4697 C  C2  . MES C 3 .   ? 71.239 46.426 13.797  0.70 20.15 ? 602  MES A C2  1 
HETATM 4698 C  C3  . MES C 3 .   ? 71.792 46.868 12.391  0.70 22.84 ? 602  MES A C3  1 
HETATM 4699 N  N4  . MES C 3 .   ? 71.773 48.362 12.364  0.70 30.44 ? 602  MES A N4  1 
HETATM 4700 C  C5  . MES C 3 .   ? 70.627 49.139 12.919  0.70 27.81 ? 602  MES A C5  1 
HETATM 4701 C  C6  . MES C 3 .   ? 70.149 48.571 14.240  0.70 24.58 ? 602  MES A C6  1 
HETATM 4702 C  C7  . MES C 3 .   ? 72.621 49.251 11.532  0.70 33.27 ? 602  MES A C7  1 
HETATM 4703 C  C8  . MES C 3 .   ? 73.885 48.606 11.040  0.70 35.79 ? 602  MES A C8  1 
HETATM 4704 S  S   . MES C 3 .   ? 74.557 49.495 9.766   0.70 36.72 ? 602  MES A S   1 
HETATM 4705 O  O1S . MES C 3 .   ? 74.911 50.906 10.142  0.70 39.35 ? 602  MES A O1S 1 
HETATM 4706 O  O2S . MES C 3 .   ? 75.699 48.694 9.538   0.70 26.19 ? 602  MES A O2S 1 
HETATM 4707 O  O3S . MES C 3 .   ? 73.654 49.625 8.606   0.70 32.15 ? 602  MES A O3S 1 
HETATM 4708 O  O1  . MES D 3 .   ? 34.766 37.362 -4.386  0.85 38.74 ? 603  MES A O1  1 
HETATM 4709 C  C2  . MES D 3 .   ? 35.036 36.865 -5.669  0.85 37.06 ? 603  MES A C2  1 
HETATM 4710 C  C3  . MES D 3 .   ? 35.628 38.042 -6.401  0.85 31.50 ? 603  MES A C3  1 
HETATM 4711 N  N4  . MES D 3 .   ? 34.618 39.089 -6.508  0.85 32.39 ? 603  MES A N4  1 
HETATM 4712 C  C5  . MES D 3 .   ? 33.547 39.264 -5.539  0.85 37.50 ? 603  MES A C5  1 
HETATM 4713 C  C6  . MES D 3 .   ? 33.717 38.339 -4.314  0.85 38.36 ? 603  MES A C6  1 
HETATM 4714 C  C7  . MES D 3 .   ? 34.974 40.116 -7.493  0.85 26.77 ? 603  MES A C7  1 
HETATM 4715 C  C8  . MES D 3 .   ? 33.904 41.021 -8.008  0.85 23.93 ? 603  MES A C8  1 
HETATM 4716 S  S   . MES D 3 .   ? 34.679 42.387 -8.657  0.85 21.67 ? 603  MES A S   1 
HETATM 4717 O  O1S . MES D 3 .   ? 35.680 41.797 -9.595  0.85 25.41 ? 603  MES A O1S 1 
HETATM 4718 O  O2S . MES D 3 .   ? 33.754 43.077 -9.514  0.85 24.96 ? 603  MES A O2S 1 
HETATM 4719 O  O3S . MES D 3 .   ? 35.467 43.137 -7.656  0.85 18.51 ? 603  MES A O3S 1 
HETATM 4720 P  P   . PO4 E 4 .   ? 53.006 50.691 -17.358 0.60 42.11 ? 604  PO4 A P   1 
HETATM 4721 O  O1  . PO4 E 4 .   ? 51.734 50.617 -18.187 0.60 40.06 ? 604  PO4 A O1  1 
HETATM 4722 O  O2  . PO4 E 4 .   ? 53.211 49.330 -16.748 0.60 37.88 ? 604  PO4 A O2  1 
HETATM 4723 O  O3  . PO4 E 4 .   ? 53.106 51.730 -16.321 0.60 40.38 ? 604  PO4 A O3  1 
HETATM 4724 O  O4  . PO4 E 4 .   ? 54.172 50.968 -18.333 0.60 38.71 ? 604  PO4 A O4  1 
HETATM 4725 C  C1  . IPA F 5 .   ? 53.745 47.149 -9.551  1.00 18.28 ? 605  IPA A C1  1 
HETATM 4726 C  C2  . IPA F 5 .   ? 55.066 47.763 -9.832  1.00 24.12 ? 605  IPA A C2  1 
HETATM 4727 C  C3  . IPA F 5 .   ? 55.984 48.283 -8.768  1.00 25.48 ? 605  IPA A C3  1 
HETATM 4728 O  O2  . IPA F 5 .   ? 55.530 46.993 -10.853 1.00 24.78 ? 605  IPA A O2  1 
HETATM 4729 CA CA  . CA  G 6 .   ? 74.717 66.485 1.021   0.80 26.60 ? 606  CA  A CA  1 
HETATM 4730 O  O   . HOH H 7 .   ? 42.991 42.019 -13.726 1.00 30.81 ? 541  HOH A O   1 
HETATM 4731 O  O   . HOH H 7 .   ? 71.543 64.409 10.033  1.00 48.04 ? 542  HOH A O   1 
HETATM 4732 O  O   . HOH H 7 .   ? 48.507 39.267 -8.553  1.00 21.28 ? 543  HOH A O   1 
HETATM 4733 O  O   . HOH H 7 .   ? 52.919 39.908 -7.610  1.00 37.45 ? 544  HOH A O   1 
HETATM 4734 O  O   . HOH H 7 .   ? 34.546 61.963 -5.221  1.00 44.89 ? 545  HOH A O   1 
HETATM 4735 O  O   . HOH H 7 .   ? 54.706 37.680 -2.371  1.00 35.14 ? 546  HOH A O   1 
HETATM 4736 O  O   . HOH H 7 .   ? 33.982 54.685 -27.243 1.00 42.96 ? 547  HOH A O   1 
HETATM 4737 O  O   . HOH H 7 .   ? 27.150 85.978 -21.903 1.00 33.75 ? 548  HOH A O   1 
HETATM 4738 O  O   . HOH H 7 .   ? 25.345 27.866 21.976  1.00 41.29 ? 549  HOH A O   1 
HETATM 4739 O  O   . HOH H 7 .   ? 45.031 42.437 -20.183 1.00 43.65 ? 550  HOH A O   1 
HETATM 4740 O  O   . HOH H 7 .   ? 72.232 40.513 5.668   1.00 34.41 ? 551  HOH A O   1 
HETATM 4741 O  O   . HOH H 7 .   ? 22.495 64.393 25.883  1.00 38.07 ? 552  HOH A O   1 
HETATM 4742 O  O   . HOH H 7 .   ? 75.877 62.266 -0.952  1.00 41.49 ? 553  HOH A O   1 
HETATM 4743 O  O   . HOH H 7 .   ? 73.831 42.625 5.896   1.00 40.70 ? 554  HOH A O   1 
HETATM 4744 O  O   . HOH H 7 .   ? 43.791 46.176 -12.740 1.00 16.06 ? 555  HOH A O   1 
HETATM 4745 O  O   . HOH H 7 .   ? 43.063 75.978 -17.000 1.00 19.60 ? 556  HOH A O   1 
HETATM 4746 O  O   . HOH H 7 .   ? 59.280 63.194 7.897   1.00 19.94 ? 557  HOH A O   1 
HETATM 4747 O  O   . HOH H 7 .   ? 63.660 47.009 7.103   1.00 22.99 ? 558  HOH A O   1 
HETATM 4748 O  O   . HOH H 7 .   ? 47.042 37.448 -7.124  1.00 23.41 ? 559  HOH A O   1 
HETATM 4749 O  O   . HOH H 7 .   ? 56.193 76.090 2.587   1.00 26.04 ? 560  HOH A O   1 
HETATM 4750 O  O   . HOH H 7 .   ? 37.182 61.505 24.733  1.00 35.90 ? 561  HOH A O   1 
HETATM 4751 O  O   . HOH H 7 .   ? 73.045 62.788 -0.977  1.00 36.95 ? 562  HOH A O   1 
HETATM 4752 O  O   . HOH H 7 .   ? 57.237 43.632 -10.866 1.00 47.98 ? 563  HOH A O   1 
HETATM 4753 O  O   . HOH H 7 .   ? 63.908 62.330 -12.582 1.00 30.38 ? 564  HOH A O   1 
HETATM 4754 O  O   . HOH H 7 .   ? 35.418 59.852 -5.538  1.00 28.56 ? 565  HOH A O   1 
HETATM 4755 O  O   . HOH H 7 .   ? 43.933 55.785 22.776  1.00 33.15 ? 566  HOH A O   1 
HETATM 4756 O  O   . HOH H 7 .   ? 46.608 58.506 18.563  1.00 34.47 ? 567  HOH A O   1 
HETATM 4757 O  O   . HOH H 7 .   ? 65.162 51.483 -8.253  1.00 39.78 ? 568  HOH A O   1 
HETATM 4758 O  O   . HOH H 7 .   ? 35.077 45.281 -1.013  1.00 30.22 ? 569  HOH A O   1 
HETATM 4759 O  O   . HOH H 7 .   ? 32.536 51.093 7.442   1.00 28.48 ? 570  HOH A O   1 
HETATM 4760 O  O   . HOH H 7 .   ? 70.894 62.753 -7.675  1.00 30.43 ? 571  HOH A O   1 
HETATM 4761 O  O   . HOH H 7 .   ? 58.545 37.696 7.047   1.00 28.40 ? 572  HOH A O   1 
HETATM 4762 O  O   . HOH H 7 .   ? 74.803 65.656 -1.258  1.00 32.89 ? 573  HOH A O   1 
HETATM 4763 O  O   . HOH H 7 .   ? 73.775 66.788 3.200   1.00 41.32 ? 574  HOH A O   1 
HETATM 4764 O  O   . HOH H 7 .   ? 67.371 60.206 15.853  1.00 48.60 ? 575  HOH A O   1 
HETATM 4765 O  O   . HOH H 7 .   ? 29.597 28.065 6.229   1.00 35.52 ? 576  HOH A O   1 
HETATM 4766 O  O   . HOH H 7 .   ? 63.381 45.074 -5.916  1.00 34.80 ? 577  HOH A O   1 
HETATM 4767 O  O   . HOH H 7 .   ? 71.936 56.897 -3.582  1.00 52.00 ? 578  HOH A O   1 
HETATM 4768 O  O   . HOH H 7 .   ? 53.314 80.135 8.985   1.00 43.68 ? 579  HOH A O   1 
HETATM 4769 O  O   . HOH H 7 .   ? 50.873 55.743 19.537  1.00 40.86 ? 580  HOH A O   1 
HETATM 4770 O  O   . HOH H 7 .   ? 51.684 70.948 -2.529  1.00 18.57 ? 581  HOH A O   1 
HETATM 4771 O  O   . HOH H 7 .   ? 21.523 43.039 20.841  1.00 49.22 ? 582  HOH A O   1 
HETATM 4772 O  O   . HOH H 7 .   ? 61.029 79.079 10.955  1.00 38.46 ? 583  HOH A O   1 
HETATM 4773 O  O   . HOH H 7 .   ? 62.080 78.396 13.040  1.00 50.75 ? 584  HOH A O   1 
HETATM 4774 O  O   . HOH H 7 .   ? 43.310 43.796 -11.592 1.00 22.91 ? 585  HOH A O   1 
HETATM 4775 O  O   . HOH H 7 .   ? 57.219 74.257 1.187   1.00 23.96 ? 586  HOH A O   1 
HETATM 4776 O  O   . HOH H 7 .   ? 42.679 73.534 -17.997 1.00 20.78 ? 587  HOH A O   1 
HETATM 4777 O  O   . HOH H 7 .   ? 59.672 63.557 10.515  1.00 22.54 ? 588  HOH A O   1 
HETATM 4778 O  O   . HOH H 7 .   ? 63.313 49.160 8.472   1.00 19.69 ? 589  HOH A O   1 
HETATM 4779 O  O   . HOH H 7 .   ? 60.991 43.838 -6.098  1.00 25.17 ? 590  HOH A O   1 
HETATM 4780 O  O   . HOH H 7 .   ? 37.894 79.746 -8.141  1.00 16.58 ? 591  HOH A O   1 
HETATM 4781 O  O   . HOH H 7 .   ? 73.375 64.421 1.138   1.00 29.76 ? 592  HOH A O   1 
HETATM 4782 O  O   . HOH H 7 .   ? 42.168 45.279 -7.785  1.00 14.40 ? 593  HOH A O   1 
HETATM 4783 O  O   . HOH H 7 .   ? 55.485 53.788 11.690  1.00 14.64 ? 594  HOH A O   1 
HETATM 4784 O  O   . HOH H 7 .   ? 39.699 51.892 -2.181  1.00 12.96 ? 595  HOH A O   1 
HETATM 4785 O  O   . HOH H 7 .   ? 28.661 28.401 8.801   1.00 26.47 ? 596  HOH A O   1 
HETATM 4786 O  O   . HOH H 7 .   ? 55.926 39.825 1.362   1.00 18.43 ? 597  HOH A O   1 
HETATM 4787 O  O   . HOH H 7 .   ? 59.863 52.964 8.347   1.00 15.87 ? 598  HOH A O   1 
HETATM 4788 O  O   . HOH H 7 .   ? 62.725 39.979 6.768   1.00 18.63 ? 599  HOH A O   1 
HETATM 4789 O  O   . HOH H 7 .   ? 56.591 56.091 15.792  1.00 16.67 ? 600  HOH A O   1 
HETATM 4790 O  O   . HOH H 7 .   ? 37.880 65.241 -1.761  1.00 19.97 ? 607  HOH A O   1 
HETATM 4791 O  O   . HOH H 7 .   ? 57.393 41.306 3.181   1.00 20.64 ? 608  HOH A O   1 
HETATM 4792 O  O   . HOH H 7 .   ? 52.776 66.833 3.179   1.00 16.10 ? 609  HOH A O   1 
HETATM 4793 O  O   . HOH H 7 .   ? 29.065 52.170 15.818  1.00 14.82 ? 610  HOH A O   1 
HETATM 4794 O  O   . HOH H 7 .   ? 44.071 73.144 -11.551 1.00 18.27 ? 611  HOH A O   1 
HETATM 4795 O  O   . HOH H 7 .   ? 63.148 54.348 12.714  1.00 17.06 ? 612  HOH A O   1 
HETATM 4796 O  O   . HOH H 7 .   ? 57.692 56.461 5.029   1.00 16.16 ? 613  HOH A O   1 
HETATM 4797 O  O   . HOH H 7 .   ? 61.486 43.080 9.405   1.00 16.50 ? 614  HOH A O   1 
HETATM 4798 O  O   . HOH H 7 .   ? 49.533 67.729 4.946   1.00 16.75 ? 615  HOH A O   1 
HETATM 4799 O  O   . HOH H 7 .   ? 63.133 47.769 -5.964  1.00 21.87 ? 616  HOH A O   1 
HETATM 4800 O  O   . HOH H 7 .   ? 55.402 56.146 13.294  1.00 16.11 ? 617  HOH A O   1 
HETATM 4801 O  O   . HOH H 7 .   ? 52.967 65.138 -15.901 1.00 17.49 ? 618  HOH A O   1 
HETATM 4802 O  O   . HOH H 7 .   ? 41.301 51.052 -14.816 1.00 17.70 ? 619  HOH A O   1 
HETATM 4803 O  O   . HOH H 7 .   ? 33.203 80.647 -17.112 1.00 18.14 ? 620  HOH A O   1 
HETATM 4804 O  O   . HOH H 7 .   ? 21.696 54.206 7.849   1.00 14.93 ? 621  HOH A O   1 
HETATM 4805 O  O   . HOH H 7 .   ? 35.712 51.789 16.631  1.00 14.82 ? 622  HOH A O   1 
HETATM 4806 O  O   . HOH H 7 .   ? 38.552 59.381 20.533  1.00 20.38 ? 623  HOH A O   1 
HETATM 4807 O  O   . HOH H 7 .   ? 40.535 60.850 5.873   1.00 19.75 ? 624  HOH A O   1 
HETATM 4808 O  O   . HOH H 7 .   ? 60.981 47.250 3.768   1.00 16.90 ? 625  HOH A O   1 
HETATM 4809 O  O   . HOH H 7 .   ? 40.779 51.561 17.159  1.00 13.64 ? 626  HOH A O   1 
HETATM 4810 O  O   . HOH H 7 .   ? 41.341 76.954 -9.794  1.00 18.60 ? 627  HOH A O   1 
HETATM 4811 O  O   . HOH H 7 .   ? 51.888 66.557 16.646  1.00 17.83 ? 628  HOH A O   1 
HETATM 4812 O  O   . HOH H 7 .   ? 38.204 62.913 -11.031 1.00 16.58 ? 629  HOH A O   1 
HETATM 4813 O  O   . HOH H 7 .   ? 50.208 39.669 9.102   1.00 18.35 ? 630  HOH A O   1 
HETATM 4814 O  O   . HOH H 7 .   ? 36.996 49.058 11.078  1.00 14.26 ? 631  HOH A O   1 
HETATM 4815 O  O   . HOH H 7 .   ? 46.818 61.986 -17.410 1.00 17.95 ? 632  HOH A O   1 
HETATM 4816 O  O   . HOH H 7 .   ? 38.473 55.698 10.376  1.00 14.51 ? 633  HOH A O   1 
HETATM 4817 O  O   . HOH H 7 .   ? 46.685 72.029 -11.894 1.00 19.04 ? 634  HOH A O   1 
HETATM 4818 O  O   . HOH H 7 .   ? 49.797 72.863 -2.639  1.00 18.52 ? 635  HOH A O   1 
HETATM 4819 O  O   . HOH H 7 .   ? 24.575 57.256 16.757  1.00 15.36 ? 636  HOH A O   1 
HETATM 4820 O  O   . HOH H 7 .   ? 52.577 71.639 15.980  1.00 19.54 ? 637  HOH A O   1 
HETATM 4821 O  O   . HOH H 7 .   ? 27.629 53.229 8.738   1.00 16.30 ? 638  HOH A O   1 
HETATM 4822 O  O   . HOH H 7 .   ? 50.118 41.054 -6.918  1.00 17.92 ? 639  HOH A O   1 
HETATM 4823 O  O   . HOH H 7 .   ? 60.980 40.344 8.962   1.00 19.02 ? 640  HOH A O   1 
HETATM 4824 O  O   . HOH H 7 .   ? 54.129 41.510 11.502  1.00 19.51 ? 641  HOH A O   1 
HETATM 4825 O  O   . HOH H 7 .   ? 59.553 43.125 -3.809  1.00 18.86 ? 642  HOH A O   1 
HETATM 4826 O  O   . HOH H 7 .   ? 54.033 65.965 -6.087  1.00 18.14 ? 643  HOH A O   1 
HETATM 4827 O  O   . HOH H 7 .   ? 52.805 70.397 -0.048  1.00 18.75 ? 644  HOH A O   1 
HETATM 4828 O  O   . HOH H 7 .   ? 50.198 64.601 -16.494 1.00 17.51 ? 645  HOH A O   1 
HETATM 4829 O  O   . HOH H 7 .   ? 51.755 65.764 -0.030  1.00 18.37 ? 646  HOH A O   1 
HETATM 4830 O  O   . HOH H 7 .   ? 30.814 73.475 21.215  1.00 18.76 ? 647  HOH A O   1 
HETATM 4831 O  O   . HOH H 7 .   ? 45.242 32.477 3.396   1.00 22.33 ? 648  HOH A O   1 
HETATM 4832 O  O   . HOH H 7 .   ? 53.086 57.760 13.158  1.00 16.90 ? 649  HOH A O   1 
HETATM 4833 O  O   . HOH H 7 .   ? 63.360 50.733 -9.200  1.00 35.97 ? 650  HOH A O   1 
HETATM 4834 O  O   . HOH H 7 .   ? 42.081 44.098 10.638  1.00 15.52 ? 651  HOH A O   1 
HETATM 4835 O  O   . HOH H 7 .   ? 53.957 55.731 17.026  1.00 18.09 ? 652  HOH A O   1 
HETATM 4836 O  O   . HOH H 7 .   ? 51.411 68.927 2.012   1.00 17.78 ? 653  HOH A O   1 
HETATM 4837 O  O   . HOH H 7 .   ? 39.761 58.115 -3.762  1.00 16.55 ? 654  HOH A O   1 
HETATM 4838 O  O   . HOH H 7 .   ? 56.873 68.691 14.273  1.00 20.64 ? 655  HOH A O   1 
HETATM 4839 O  O   . HOH H 7 .   ? 48.882 69.334 -16.838 1.00 17.96 ? 656  HOH A O   1 
HETATM 4840 O  O   . HOH H 7 .   ? 53.499 74.351 2.431   1.00 19.07 ? 657  HOH A O   1 
HETATM 4841 O  O   . HOH H 7 .   ? 47.343 40.456 -10.802 1.00 21.53 ? 658  HOH A O   1 
HETATM 4842 O  O   . HOH H 7 .   ? 56.245 48.125 21.245  1.00 29.03 ? 659  HOH A O   1 
HETATM 4843 O  O   . HOH H 7 .   ? 48.973 67.680 1.296   1.00 16.88 ? 660  HOH A O   1 
HETATM 4844 O  O   . HOH H 7 .   ? 50.763 57.346 14.708  1.00 18.03 ? 661  HOH A O   1 
HETATM 4845 O  O   . HOH H 7 .   ? 62.698 73.926 6.013   1.00 26.02 ? 662  HOH A O   1 
HETATM 4846 O  O   . HOH H 7 .   ? 25.664 49.237 24.067  1.00 32.35 ? 663  HOH A O   1 
HETATM 4847 O  O   . HOH H 7 .   ? 67.812 40.882 12.799  1.00 20.51 ? 664  HOH A O   1 
HETATM 4848 O  O   . HOH H 7 .   ? 42.664 53.841 -15.121 1.00 16.88 ? 665  HOH A O   1 
HETATM 4849 O  O   . HOH H 7 .   ? 35.476 28.719 10.285  1.00 18.94 ? 666  HOH A O   1 
HETATM 4850 O  O   . HOH H 7 .   ? 51.507 40.390 11.362  1.00 19.25 ? 667  HOH A O   1 
HETATM 4851 O  O   . HOH H 7 .   ? 60.268 52.554 19.164  1.00 22.48 ? 668  HOH A O   1 
HETATM 4852 O  O   . HOH H 7 .   ? 55.788 58.932 6.014   1.00 15.80 ? 669  HOH A O   1 
HETATM 4853 O  O   . HOH H 7 .   ? 34.554 51.966 8.969   1.00 17.68 ? 670  HOH A O   1 
HETATM 4854 O  O   . HOH H 7 .   ? 54.123 42.778 9.006   1.00 17.75 ? 671  HOH A O   1 
HETATM 4855 O  O   . HOH H 7 .   ? 45.276 75.314 -10.457 1.00 19.79 ? 672  HOH A O   1 
HETATM 4856 O  O   . HOH H 7 .   ? 39.227 61.686 18.922  1.00 19.69 ? 673  HOH A O   1 
HETATM 4857 O  O   . HOH H 7 .   ? 25.088 77.340 20.826  1.00 22.69 ? 674  HOH A O   1 
HETATM 4858 O  O   . HOH H 7 .   ? 52.303 68.106 -5.815  1.00 21.57 ? 675  HOH A O   1 
HETATM 4859 O  O   . HOH H 7 .   ? 64.009 61.456 -15.073 1.00 32.79 ? 676  HOH A O   1 
HETATM 4860 O  O   . HOH H 7 .   ? 36.919 64.981 20.678  1.00 22.86 ? 677  HOH A O   1 
HETATM 4861 O  O   . HOH H 7 .   ? 38.548 49.076 -13.090 1.00 16.22 ? 678  HOH A O   1 
HETATM 4862 O  O   . HOH H 7 .   ? 55.737 67.902 16.794  1.00 19.35 ? 679  HOH A O   1 
HETATM 4863 O  O   . HOH H 7 .   ? 54.015 77.573 12.126  1.00 23.76 ? 680  HOH A O   1 
HETATM 4864 O  O   . HOH H 7 .   ? 48.092 41.331 8.652   1.00 18.58 ? 681  HOH A O   1 
HETATM 4865 O  O   . HOH H 7 .   ? 31.924 47.470 5.999   1.00 20.20 ? 682  HOH A O   1 
HETATM 4866 O  O   . HOH H 7 .   ? 63.604 46.907 4.429   1.00 18.78 ? 683  HOH A O   1 
HETATM 4867 O  O   . HOH H 7 .   ? 40.264 57.666 9.416   1.00 18.78 ? 684  HOH A O   1 
HETATM 4868 O  O   . HOH H 7 .   ? 59.018 69.914 2.528   1.00 20.74 ? 685  HOH A O   1 
HETATM 4869 O  O   . HOH H 7 .   ? 29.103 28.566 15.939  1.00 23.64 ? 686  HOH A O   1 
HETATM 4870 O  O   . HOH H 7 .   ? 32.663 66.954 -17.785 1.00 30.74 ? 687  HOH A O   1 
HETATM 4871 O  O   . HOH H 7 .   ? 43.984 81.958 -5.452  1.00 23.31 ? 688  HOH A O   1 
HETATM 4872 O  O   . HOH H 7 .   ? 47.266 32.384 15.188  1.00 23.21 ? 689  HOH A O   1 
HETATM 4873 O  O   . HOH H 7 .   ? 59.512 64.532 -24.958 1.00 28.31 ? 690  HOH A O   1 
HETATM 4874 O  O   . HOH H 7 .   ? 38.947 59.693 8.032   1.00 26.51 ? 691  HOH A O   1 
HETATM 4875 O  O   . HOH H 7 .   ? 46.723 66.797 -29.066 1.00 38.90 ? 692  HOH A O   1 
HETATM 4876 O  O   . HOH H 7 .   ? 29.832 49.239 9.259   1.00 19.91 ? 693  HOH A O   1 
HETATM 4877 O  O   . HOH H 7 .   ? 64.894 55.577 -11.197 1.00 26.09 ? 694  HOH A O   1 
HETATM 4878 O  O   . HOH H 7 .   ? 69.611 46.409 8.485   1.00 22.01 ? 695  HOH A O   1 
HETATM 4879 O  O   . HOH H 7 .   ? 69.347 70.371 7.601   1.00 36.37 ? 696  HOH A O   1 
HETATM 4880 O  O   . HOH H 7 .   ? 51.160 68.399 -10.222 1.00 21.95 ? 697  HOH A O   1 
HETATM 4881 O  O   . HOH H 7 .   ? 45.750 34.902 -1.366  1.00 18.74 ? 698  HOH A O   1 
HETATM 4882 O  O   . HOH H 7 .   ? 60.738 75.297 4.699   1.00 26.68 ? 699  HOH A O   1 
HETATM 4883 O  O   . HOH H 7 .   ? 68.107 57.486 -1.587  1.00 26.93 ? 700  HOH A O   1 
HETATM 4884 O  O   . HOH H 7 .   ? 31.365 52.906 9.223   1.00 19.43 ? 701  HOH A O   1 
HETATM 4885 O  O   . HOH H 7 .   ? 39.096 45.926 -20.331 1.00 21.85 ? 702  HOH A O   1 
HETATM 4886 O  O   . HOH H 7 .   ? 39.703 58.147 22.796  1.00 20.45 ? 703  HOH A O   1 
HETATM 4887 O  O   . HOH H 7 .   ? 50.016 63.578 -1.389  1.00 24.43 ? 704  HOH A O   1 
HETATM 4888 O  O   . HOH H 7 .   ? 47.751 51.974 7.456   1.00 14.09 ? 705  HOH A O   1 
HETATM 4889 O  O   . HOH H 7 .   ? 50.944 75.771 -21.419 1.00 25.84 ? 706  HOH A O   1 
HETATM 4890 O  O   . HOH H 7 .   ? 69.196 47.031 21.432  1.00 22.61 ? 707  HOH A O   1 
HETATM 4891 O  O   . HOH H 7 .   ? 55.569 78.926 3.173   1.00 25.80 ? 708  HOH A O   1 
HETATM 4892 O  O   . HOH H 7 .   ? 51.567 62.262 19.408  1.00 17.70 ? 709  HOH A O   1 
HETATM 4893 O  O   . HOH H 7 .   ? 55.163 39.058 4.017   1.00 31.42 ? 710  HOH A O   1 
HETATM 4894 O  O   . HOH H 7 .   ? 54.731 32.346 14.888  1.00 28.85 ? 711  HOH A O   1 
HETATM 4895 O  O   . HOH H 7 .   ? 48.491 66.414 -5.987  1.00 20.13 ? 712  HOH A O   1 
HETATM 4896 O  O   . HOH H 7 .   ? 70.575 64.461 -6.794  1.00 38.37 ? 713  HOH A O   1 
HETATM 4897 O  O   . HOH H 7 .   ? 27.293 35.859 9.925   1.00 29.92 ? 714  HOH A O   1 
HETATM 4898 O  O   . HOH H 7 .   ? 52.626 63.667 -5.333  1.00 18.07 ? 715  HOH A O   1 
HETATM 4899 O  O   . HOH H 7 .   ? 26.986 39.369 5.764   1.00 25.32 ? 716  HOH A O   1 
HETATM 4900 O  O   . HOH H 7 .   ? 52.733 58.185 16.919  1.00 17.14 ? 717  HOH A O   1 
HETATM 4901 O  O   . HOH H 7 .   ? 45.454 75.571 -3.402  1.00 26.41 ? 718  HOH A O   1 
HETATM 4902 O  O   . HOH H 7 .   ? 28.247 45.525 6.548   1.00 25.08 ? 719  HOH A O   1 
HETATM 4903 O  O   . HOH H 7 .   ? 29.079 50.499 24.709  1.00 27.82 ? 720  HOH A O   1 
HETATM 4904 O  O   . HOH H 7 .   ? 70.536 57.557 2.444   1.00 26.14 ? 721  HOH A O   1 
HETATM 4905 O  O   . HOH H 7 .   ? 70.578 64.892 1.902   1.00 25.50 ? 722  HOH A O   1 
HETATM 4906 O  O   . HOH H 7 .   ? 59.239 40.836 6.785   1.00 23.39 ? 723  HOH A O   1 
HETATM 4907 O  O   . HOH H 7 .   ? 29.507 47.595 7.271   1.00 29.97 ? 724  HOH A O   1 
HETATM 4908 O  O   . HOH H 7 .   ? 51.065 43.356 -10.658 1.00 25.84 ? 725  HOH A O   1 
HETATM 4909 O  O   . HOH H 7 .   ? 71.284 61.401 -4.065  1.00 26.70 ? 726  HOH A O   1 
HETATM 4910 O  O   . HOH H 7 .   ? 57.568 77.120 -11.710 1.00 25.91 ? 727  HOH A O   1 
HETATM 4911 O  O   . HOH H 7 .   ? 50.627 67.081 -7.813  1.00 19.45 ? 728  HOH A O   1 
HETATM 4912 O  O   . HOH H 7 .   ? 55.822 67.462 -27.302 1.00 32.09 ? 729  HOH A O   1 
HETATM 4913 O  O   . HOH H 7 .   ? 34.665 62.286 -8.114  1.00 18.87 ? 730  HOH A O   1 
HETATM 4914 O  O   . HOH H 7 .   ? 64.179 74.561 8.244   1.00 34.67 ? 731  HOH A O   1 
HETATM 4915 O  O   . HOH H 7 .   ? 67.872 56.910 18.085  1.00 25.06 ? 732  HOH A O   1 
HETATM 4916 O  O   . HOH H 7 .   ? 24.579 45.584 21.666  1.00 24.58 ? 733  HOH A O   1 
HETATM 4917 O  O   . HOH H 7 .   ? 41.142 48.877 -23.776 1.00 31.87 ? 734  HOH A O   1 
HETATM 4918 O  O   . HOH H 7 .   ? 53.502 64.600 -8.456  1.00 19.60 ? 735  HOH A O   1 
HETATM 4919 O  O   . HOH H 7 .   ? 50.312 54.802 4.981   1.00 14.89 ? 736  HOH A O   1 
HETATM 4920 O  O   . HOH H 7 .   ? 65.371 67.898 8.609   1.00 35.02 ? 737  HOH A O   1 
HETATM 4921 O  O   . HOH H 7 .   ? 37.670 38.465 -9.869  1.00 22.18 ? 738  HOH A O   1 
HETATM 4922 O  O   . HOH H 7 .   ? 36.741 60.866 22.017  1.00 27.09 ? 739  HOH A O   1 
HETATM 4923 O  O   . HOH H 7 .   ? 40.356 51.139 21.974  1.00 25.36 ? 740  HOH A O   1 
HETATM 4924 O  O   . HOH H 7 .   ? 62.569 75.183 11.113  1.00 29.60 ? 741  HOH A O   1 
HETATM 4925 O  O   . HOH H 7 .   ? 53.447 79.263 1.349   1.00 25.15 ? 742  HOH A O   1 
HETATM 4926 O  O   . HOH H 7 .   ? 61.249 38.334 5.037   1.00 27.33 ? 743  HOH A O   1 
HETATM 4927 O  O   . HOH H 7 .   ? 34.071 41.394 2.041   1.00 28.21 ? 744  HOH A O   1 
HETATM 4928 O  O   . HOH H 7 .   ? 63.406 39.864 19.850  1.00 25.41 ? 745  HOH A O   1 
HETATM 4929 O  O   . HOH H 7 .   ? 61.663 62.629 -24.441 1.00 28.93 ? 746  HOH A O   1 
HETATM 4930 O  O   . HOH H 7 .   ? 45.151 52.380 8.370   1.00 14.01 ? 747  HOH A O   1 
HETATM 4931 O  O   . HOH H 7 .   ? 49.105 64.152 -4.311  1.00 22.94 ? 748  HOH A O   1 
HETATM 4932 O  O   . HOH H 7 .   ? 46.027 80.201 -5.591  1.00 28.76 ? 749  HOH A O   1 
HETATM 4933 O  O   . HOH H 7 .   ? 41.625 46.390 -19.320 1.00 24.27 ? 750  HOH A O   1 
HETATM 4934 O  O   . HOH H 7 .   ? 67.096 69.130 6.649   1.00 32.56 ? 751  HOH A O   1 
HETATM 4935 O  O   . HOH H 7 .   ? 32.577 46.124 -24.304 1.00 38.91 ? 752  HOH A O   1 
HETATM 4936 O  O   . HOH H 7 .   ? 58.488 57.681 -21.569 1.00 30.41 ? 753  HOH A O   1 
HETATM 4937 O  O   . HOH H 7 .   ? 61.748 66.620 19.127  1.00 27.87 ? 754  HOH A O   1 
HETATM 4938 O  O   . HOH H 7 .   ? 56.407 38.581 17.209  1.00 23.08 ? 755  HOH A O   1 
HETATM 4939 O  O   . HOH H 7 .   ? 69.913 58.730 0.063   1.00 27.78 ? 756  HOH A O   1 
HETATM 4940 O  O   . HOH H 7 .   ? 37.045 81.953 -18.536 1.00 24.68 ? 757  HOH A O   1 
HETATM 4941 O  O   . HOH H 7 .   ? 41.294 65.581 16.968  1.00 20.55 ? 758  HOH A O   1 
HETATM 4942 O  O   . HOH H 7 .   ? 32.489 49.904 5.126   1.00 39.62 ? 759  HOH A O   1 
HETATM 4943 O  O   . HOH H 7 .   ? 50.636 55.727 17.205  1.00 23.74 ? 760  HOH A O   1 
HETATM 4944 O  O   . HOH H 7 .   ? 59.302 40.374 -4.268  1.00 30.02 ? 761  HOH A O   1 
HETATM 4945 O  O   . HOH H 7 .   ? 66.360 43.161 -1.868  1.00 30.92 ? 762  HOH A O   1 
HETATM 4946 O  O   . HOH H 7 .   ? 56.966 37.960 -0.472  1.00 26.78 ? 763  HOH A O   1 
HETATM 4947 O  O   . HOH H 7 .   ? 36.147 53.675 -26.126 1.00 27.73 ? 764  HOH A O   1 
HETATM 4948 O  O   . HOH H 7 .   ? 28.949 51.260 7.392   1.00 24.88 ? 765  HOH A O   1 
HETATM 4949 O  O   . HOH H 7 .   ? 32.748 51.190 -4.857  1.00 27.11 ? 766  HOH A O   1 
HETATM 4950 O  O   . HOH H 7 .   ? 21.637 47.951 7.618   1.00 25.05 ? 767  HOH A O   1 
HETATM 4951 O  O   . HOH H 7 .   ? 36.019 47.793 2.195   1.00 24.80 ? 768  HOH A O   1 
HETATM 4952 O  O   . HOH H 7 .   ? 39.202 48.964 23.494  1.00 37.50 ? 769  HOH A O   1 
HETATM 4953 O  O   . HOH H 7 .   ? 45.198 80.096 -10.339 1.00 36.46 ? 770  HOH A O   1 
HETATM 4954 O  O   . HOH H 7 .   ? 64.523 71.814 14.611  1.00 30.30 ? 771  HOH A O   1 
HETATM 4955 O  O   . HOH H 7 .   ? 66.514 75.377 -17.413 1.00 32.51 ? 772  HOH A O   1 
HETATM 4956 O  O   . HOH H 7 .   ? 29.081 42.070 27.942  1.00 38.47 ? 773  HOH A O   1 
HETATM 4957 O  O   . HOH H 7 .   ? 62.596 49.346 -12.398 1.00 32.16 ? 774  HOH A O   1 
HETATM 4958 O  O   . HOH H 7 .   ? 46.767 56.522 6.663   1.00 14.43 ? 775  HOH A O   1 
HETATM 4959 O  O   . HOH H 7 .   ? 46.197 79.103 -15.193 1.00 28.26 ? 776  HOH A O   1 
HETATM 4960 O  O   . HOH H 7 .   ? 43.103 50.984 -23.575 1.00 30.87 ? 777  HOH A O   1 
HETATM 4961 O  O   . HOH H 7 .   ? 43.790 66.091 -27.915 1.00 36.05 ? 778  HOH A O   1 
HETATM 4962 O  O   . HOH H 7 .   ? 28.959 25.428 9.712   1.00 32.90 ? 779  HOH A O   1 
HETATM 4963 O  O   . HOH H 7 .   ? 69.605 55.000 2.368   1.00 28.49 ? 780  HOH A O   1 
HETATM 4964 O  O   . HOH H 7 .   ? 44.708 49.353 -21.836 1.00 29.05 ? 781  HOH A O   1 
HETATM 4965 O  O   . HOH H 7 .   ? 38.505 58.541 -0.800  1.00 23.31 ? 782  HOH A O   1 
HETATM 4966 O  O   . HOH H 7 .   ? 33.813 53.233 -6.371  1.00 23.84 ? 783  HOH A O   1 
HETATM 4967 O  O   . HOH H 7 .   ? 22.419 40.499 14.152  1.00 30.94 ? 784  HOH A O   1 
HETATM 4968 O  O   . HOH H 7 .   ? 30.173 34.828 3.728   1.00 29.39 ? 785  HOH A O   1 
HETATM 4969 O  O   . HOH H 7 .   ? 65.221 49.478 -6.737  1.00 29.12 ? 786  HOH A O   1 
HETATM 4970 O  O   . HOH H 7 .   ? 63.665 53.195 -10.695 1.00 31.41 ? 787  HOH A O   1 
HETATM 4971 O  O   . HOH H 7 .   ? 65.544 70.996 5.912   1.00 33.41 ? 788  HOH A O   1 
HETATM 4972 O  O   . HOH H 7 .   ? 68.092 46.472 4.363   1.00 25.58 ? 789  HOH A O   1 
HETATM 4973 O  O   . HOH H 7 .   ? 57.788 79.239 -13.481 1.00 33.14 ? 790  HOH A O   1 
HETATM 4974 O  O   . HOH H 7 .   ? 52.315 43.325 13.324  1.00 20.55 ? 791  HOH A O   1 
HETATM 4975 O  O   . HOH H 7 .   ? 58.920 78.044 -20.645 1.00 29.76 ? 792  HOH A O   1 
HETATM 4976 O  O   . HOH H 7 .   ? 61.867 71.394 -20.850 1.00 30.66 ? 793  HOH A O   1 
HETATM 4977 O  O   . HOH H 7 .   ? 32.964 62.035 31.198  1.00 41.23 ? 794  HOH A O   1 
HETATM 4978 O  O   . HOH H 7 .   ? 72.066 64.123 4.910   1.00 30.05 ? 795  HOH A O   1 
HETATM 4979 O  O   . HOH H 7 .   ? 64.284 71.949 -19.291 1.00 38.62 ? 796  HOH A O   1 
HETATM 4980 O  O   . HOH H 7 .   ? 46.586 50.931 13.977  1.00 13.39 ? 797  HOH A O   1 
HETATM 4981 O  O   . HOH H 7 .   ? 30.349 51.576 27.046  1.00 35.82 ? 798  HOH A O   1 
HETATM 4982 O  O   . HOH H 7 .   ? 62.619 66.078 10.307  1.00 36.87 ? 799  HOH A O   1 
HETATM 4983 O  O   . HOH H 7 .   ? 52.588 45.586 -11.297 1.00 25.01 ? 800  HOH A O   1 
HETATM 4984 O  O   . HOH H 7 .   ? 35.571 33.497 26.889  1.00 37.86 ? 801  HOH A O   1 
HETATM 4985 O  O   . HOH H 7 .   ? 70.928 55.696 -7.985  1.00 32.06 ? 802  HOH A O   1 
HETATM 4986 O  O   . HOH H 7 .   ? 58.669 66.969 -26.055 1.00 33.36 ? 803  HOH A O   1 
HETATM 4987 O  O   . HOH H 7 .   ? 61.718 69.770 21.330  1.00 32.02 ? 804  HOH A O   1 
HETATM 4988 O  O   . HOH H 7 .   ? 71.665 60.517 -1.280  1.00 30.87 ? 805  HOH A O   1 
HETATM 4989 O  O   . HOH H 7 .   ? 50.896 57.889 19.892  1.00 29.38 ? 806  HOH A O   1 
HETATM 4990 O  O   . HOH H 7 .   ? 22.067 39.215 19.699  1.00 31.16 ? 807  HOH A O   1 
HETATM 4991 O  O   . HOH H 7 .   ? 35.527 30.383 4.192   1.00 30.04 ? 808  HOH A O   1 
HETATM 4992 O  O   . HOH H 7 .   ? 63.663 42.958 24.197  1.00 39.42 ? 809  HOH A O   1 
HETATM 4993 O  O   . HOH H 7 .   ? 43.252 74.994 -2.064  1.00 29.03 ? 810  HOH A O   1 
HETATM 4994 O  O   . HOH H 7 .   ? 45.539 30.292 14.930  1.00 35.81 ? 811  HOH A O   1 
HETATM 4995 O  O   . HOH H 7 .   ? 44.079 80.020 -22.716 1.00 32.21 ? 812  HOH A O   1 
HETATM 4996 O  O   . HOH H 7 .   ? 46.381 27.281 10.651  1.00 37.68 ? 813  HOH A O   1 
HETATM 4997 O  O   . HOH H 7 .   ? 52.260 79.355 12.928  1.00 38.07 ? 814  HOH A O   1 
HETATM 4998 O  O   . HOH H 7 .   ? 66.303 47.334 0.581   1.00 33.05 ? 815  HOH A O   1 
HETATM 4999 O  O   . HOH H 7 .   ? 46.539 53.064 15.679  1.00 14.89 ? 816  HOH A O   1 
HETATM 5000 O  O   . HOH H 7 .   ? 34.941 28.940 25.011  1.00 42.15 ? 817  HOH A O   1 
HETATM 5001 O  O   . HOH H 7 .   ? 42.450 47.551 -22.057 1.00 40.89 ? 818  HOH A O   1 
HETATM 5002 O  O   . HOH H 7 .   ? 65.923 47.745 3.141   1.00 31.12 ? 819  HOH A O   1 
HETATM 5003 O  O   . HOH H 7 .   ? 57.428 51.351 -15.935 1.00 36.60 ? 820  HOH A O   1 
HETATM 5004 O  O   . HOH H 7 .   ? 24.342 41.127 26.662  1.00 33.75 ? 821  HOH A O   1 
HETATM 5005 O  O   . HOH H 7 .   ? 58.627 38.779 4.266   1.00 27.76 ? 822  HOH A O   1 
HETATM 5006 O  O   . HOH H 7 .   ? 33.121 25.208 19.040  1.00 47.22 ? 823  HOH A O   1 
HETATM 5007 O  O   . HOH H 7 .   ? 62.634 36.625 9.179   1.00 32.57 ? 824  HOH A O   1 
HETATM 5008 O  O   . HOH H 7 .   ? 63.700 55.560 -14.025 1.00 29.12 ? 825  HOH A O   1 
HETATM 5009 O  O   . HOH H 7 .   ? 44.808 55.107 8.085   1.00 16.87 ? 826  HOH A O   1 
HETATM 5010 O  O   . HOH H 7 .   ? 64.373 38.054 7.846   1.00 28.82 ? 827  HOH A O   1 
HETATM 5011 O  O   . HOH H 7 .   ? 32.407 52.411 -27.374 1.00 35.57 ? 828  HOH A O   1 
HETATM 5012 O  O   . HOH H 7 .   ? 26.571 41.116 28.333  1.00 42.58 ? 829  HOH A O   1 
HETATM 5013 O  O   . HOH H 7 .   ? 19.306 34.286 23.261  1.00 36.54 ? 830  HOH A O   1 
HETATM 5014 O  O   . HOH H 7 .   ? 26.246 84.648 -26.692 1.00 36.94 ? 831  HOH A O   1 
HETATM 5015 O  O   . HOH H 7 .   ? 50.332 78.086 -14.144 1.00 44.86 ? 832  HOH A O   1 
HETATM 5016 O  O   . HOH H 7 .   ? 59.018 79.553 18.561  1.00 33.25 ? 833  HOH A O   1 
HETATM 5017 O  O   . HOH H 7 .   ? 33.638 72.608 31.373  1.00 42.95 ? 834  HOH A O   1 
HETATM 5018 O  O   . HOH H 7 .   ? 35.561 35.417 -1.379  1.00 34.95 ? 835  HOH A O   1 
HETATM 5019 O  O   . HOH H 7 .   ? 26.047 27.728 26.553  1.00 36.86 ? 836  HOH A O   1 
HETATM 5020 O  O   . HOH H 7 .   ? 27.673 35.701 5.199   1.00 32.10 ? 837  HOH A O   1 
HETATM 5021 O  O   . HOH H 7 .   ? 56.763 76.960 19.587  1.00 30.29 ? 838  HOH A O   1 
HETATM 5022 O  O   . HOH H 7 .   ? 35.375 30.067 6.854   1.00 30.64 ? 839  HOH A O   1 
HETATM 5023 O  O   . HOH H 7 .   ? 36.445 37.309 0.400   1.00 30.44 ? 840  HOH A O   1 
HETATM 5024 O  O   . HOH H 7 .   ? 36.114 54.501 7.498   1.00 27.97 ? 841  HOH A O   1 
HETATM 5025 O  O   . HOH H 7 .   ? 42.184 81.909 -13.829 1.00 31.69 ? 842  HOH A O   1 
HETATM 5026 O  O   . HOH H 7 .   ? 68.375 52.133 -7.238  1.00 38.15 ? 843  HOH A O   1 
HETATM 5027 O  O   . HOH H 7 .   ? 66.442 52.815 18.369  1.00 36.50 ? 844  HOH A O   1 
HETATM 5028 O  O   . HOH H 7 .   ? 67.965 49.626 -5.940  1.00 38.07 ? 845  HOH A O   1 
HETATM 5029 O  O   . HOH H 7 .   ? 67.562 54.560 -11.216 1.00 40.15 ? 846  HOH A O   1 
HETATM 5030 O  O   . HOH H 7 .   ? 64.374 60.490 19.760  1.00 36.93 ? 847  HOH A O   1 
HETATM 5031 O  O   . HOH H 7 .   ? 48.995 32.147 17.269  1.00 36.02 ? 848  HOH A O   1 
HETATM 5032 O  O   . HOH H 7 .   ? 71.614 69.791 6.417   1.00 35.39 ? 849  HOH A O   1 
HETATM 5033 O  O   . HOH H 7 .   ? 66.055 65.354 -15.457 1.00 34.28 ? 850  HOH A O   1 
HETATM 5034 O  O   . HOH H 7 .   ? 23.726 46.521 6.632   1.00 30.66 ? 851  HOH A O   1 
HETATM 5035 O  O   . HOH H 7 .   ? 24.107 46.605 24.063  1.00 39.00 ? 852  HOH A O   1 
HETATM 5036 O  O   . HOH H 7 .   ? 26.235 29.721 8.054   1.00 36.71 ? 853  HOH A O   1 
HETATM 5037 O  O   . HOH H 7 .   ? 46.307 32.654 0.344   1.00 28.76 ? 854  HOH A O   1 
HETATM 5038 O  O   . HOH H 7 .   ? 48.454 40.112 -14.808 1.00 30.07 ? 855  HOH A O   1 
HETATM 5039 O  O   . HOH H 7 .   ? 48.116 80.433 -4.091  1.00 32.83 ? 856  HOH A O   1 
HETATM 5040 O  O   . HOH H 7 .   ? 37.650 62.629 3.636   1.00 35.01 ? 857  HOH A O   1 
HETATM 5041 O  O   . HOH H 7 .   ? 52.678 35.600 -1.927  1.00 34.06 ? 858  HOH A O   1 
HETATM 5042 O  O   . HOH H 7 .   ? 31.880 46.848 -3.038  1.00 38.54 ? 859  HOH A O   1 
HETATM 5043 O  O   . HOH H 7 .   ? 63.890 63.538 14.575  1.00 46.18 ? 860  HOH A O   1 
HETATM 5044 O  O   . HOH H 7 .   ? 29.431 50.050 29.237  1.00 49.84 ? 861  HOH A O   1 
HETATM 5045 O  O   . HOH H 7 .   ? 29.298 81.196 29.725  1.00 37.07 ? 862  HOH A O   1 
HETATM 5046 O  O   . HOH H 7 .   ? 46.472 39.458 -17.392 1.00 40.04 ? 863  HOH A O   1 
HETATM 5047 O  O   . HOH H 7 .   ? 19.727 35.966 19.081  1.00 37.14 ? 864  HOH A O   1 
HETATM 5048 O  O   . HOH H 7 .   ? 57.167 81.147 3.274   1.00 36.62 ? 865  HOH A O   1 
HETATM 5049 O  O   . HOH H 7 .   ? 45.067 40.923 -14.029 1.00 34.36 ? 866  HOH A O   1 
HETATM 5050 O  O   . HOH H 7 .   ? 37.771 59.815 -3.837  1.00 27.14 ? 867  HOH A O   1 
HETATM 5051 O  O   . HOH H 7 .   ? 35.074 46.246 -25.978 1.00 37.83 ? 868  HOH A O   1 
HETATM 5052 O  O   . HOH H 7 .   ? 50.699 80.205 -15.855 1.00 41.79 ? 869  HOH A O   1 
HETATM 5053 O  O   . HOH H 7 .   ? 34.199 43.874 1.151   1.00 33.62 ? 870  HOH A O   1 
HETATM 5054 O  O   . HOH H 7 .   ? 69.729 52.241 6.519   1.00 33.00 ? 871  HOH A O   1 
HETATM 5055 O  O   . HOH H 7 .   ? 66.996 64.255 -13.160 1.00 38.77 ? 872  HOH A O   1 
HETATM 5056 O  O   . HOH H 7 .   ? 66.343 78.067 -17.923 1.00 38.88 ? 873  HOH A O   1 
HETATM 5057 O  O   . HOH H 7 .   ? 37.100 40.387 -11.668 1.00 31.74 ? 874  HOH A O   1 
HETATM 5058 O  O   . HOH H 7 .   ? 32.753 56.926 -8.536  1.00 34.61 ? 875  HOH A O   1 
HETATM 5059 O  O   . HOH H 7 .   ? 66.831 68.021 -15.656 1.00 44.76 ? 876  HOH A O   1 
HETATM 5060 O  O   . HOH H 7 .   ? 25.120 29.264 24.478  1.00 35.04 ? 877  HOH A O   1 
HETATM 5061 O  O   . HOH H 7 .   ? 61.163 62.332 11.891  1.00 36.99 ? 878  HOH A O   1 
HETATM 5062 O  O   . HOH H 7 .   ? 26.393 33.326 5.580   1.00 41.63 ? 879  HOH A O   1 
HETATM 5063 O  O   . HOH H 7 .   ? 62.703 77.110 -19.697 1.00 39.76 ? 880  HOH A O   1 
HETATM 5064 O  O   . HOH H 7 .   ? 52.666 30.730 14.208  1.00 49.65 ? 881  HOH A O   1 
HETATM 5065 O  O   . HOH H 7 .   ? 60.802 57.054 -17.825 1.00 37.50 ? 882  HOH A O   1 
HETATM 5066 O  O   . HOH H 7 .   ? 68.233 69.524 -13.900 1.00 43.94 ? 883  HOH A O   1 
HETATM 5067 O  O   . HOH H 7 .   ? 54.437 80.157 -15.391 1.00 33.18 ? 884  HOH A O   1 
HETATM 5068 O  O   . HOH H 7 .   ? 25.122 49.223 4.904   1.00 32.70 ? 885  HOH A O   1 
HETATM 5069 O  O   . HOH H 7 .   ? 22.195 33.142 15.606  1.00 45.29 ? 886  HOH A O   1 
HETATM 5070 O  O   . HOH H 7 .   ? 26.127 32.518 8.355   1.00 34.93 ? 887  HOH A O   1 
HETATM 5071 O  O   . HOH H 7 .   ? 69.384 74.912 -17.296 1.00 39.01 ? 888  HOH A O   1 
HETATM 5072 O  O   . HOH H 7 .   ? 29.138 76.629 -26.877 1.00 39.17 ? 889  HOH A O   1 
HETATM 5073 O  O   . HOH H 7 .   ? 47.996 78.525 -13.072 1.00 36.94 ? 890  HOH A O   1 
HETATM 5074 O  O   . HOH H 7 .   ? 63.428 40.064 23.204  1.00 38.66 ? 891  HOH A O   1 
HETATM 5075 O  O   . HOH H 7 .   ? 66.432 70.138 15.762  1.00 36.92 ? 892  HOH A O   1 
HETATM 5076 O  O   . HOH H 7 .   ? 42.949 83.980 -24.194 1.00 36.94 ? 893  HOH A O   1 
HETATM 5077 O  O   . HOH H 7 .   ? 56.342 61.558 24.962  1.00 38.92 ? 894  HOH A O   1 
HETATM 5078 O  O   . HOH H 7 .   ? 51.149 33.017 2.408   1.00 31.94 ? 895  HOH A O   1 
HETATM 5079 O  O   . HOH H 7 .   ? 37.025 22.012 13.309  1.00 44.25 ? 896  HOH A O   1 
HETATM 5080 O  O   . HOH H 7 .   ? 69.537 45.837 1.921   1.00 39.39 ? 897  HOH A O   1 
HETATM 5081 O  O   . HOH H 7 .   ? 38.419 85.182 -20.577 1.00 34.19 ? 898  HOH A O   1 
HETATM 5082 O  O   . HOH H 7 .   ? 60.685 79.772 -19.213 1.00 41.80 ? 899  HOH A O   1 
HETATM 5083 O  O   . HOH H 7 .   ? 28.087 49.542 5.290   1.00 33.56 ? 900  HOH A O   1 
HETATM 5084 O  O   . HOH H 7 .   ? 64.337 69.571 -29.056 1.00 43.78 ? 901  HOH A O   1 
HETATM 5085 O  O   . HOH H 7 .   ? 31.950 88.674 -22.575 1.00 47.85 ? 902  HOH A O   1 
HETATM 5086 O  O   . HOH H 7 .   ? 58.378 79.958 -22.565 1.00 40.22 ? 903  HOH A O   1 
HETATM 5087 O  O   . HOH H 7 .   ? 58.796 38.106 -2.524  1.00 36.78 ? 904  HOH A O   1 
HETATM 5088 O  O   . HOH H 7 .   ? 64.622 66.489 19.536  1.00 41.27 ? 905  HOH A O   1 
HETATM 5089 O  O   . HOH H 7 .   ? 57.719 81.867 -20.603 1.00 45.38 ? 906  HOH A O   1 
HETATM 5090 O  O   . HOH H 7 .   ? 33.675 74.960 -22.931 1.00 28.47 ? 907  HOH A O   1 
HETATM 5091 O  O   . HOH H 7 .   ? 64.312 52.986 -14.700 1.00 42.25 ? 908  HOH A O   1 
HETATM 5092 O  O   . HOH H 7 .   ? 76.200 62.222 6.769   1.00 37.12 ? 909  HOH A O   1 
HETATM 5093 O  O   . HOH H 7 .   ? 60.415 59.115 -23.012 1.00 42.29 ? 910  HOH A O   1 
HETATM 5094 O  O   . HOH H 7 .   ? 28.441 33.028 31.420  1.00 43.70 ? 911  HOH A O   1 
HETATM 5095 O  O   . HOH H 7 .   ? 66.387 59.922 -15.648 1.00 46.59 ? 912  HOH A O   1 
HETATM 5096 O  O   . HOH H 7 .   ? 32.657 53.594 4.490   1.00 34.62 ? 913  HOH A O   1 
HETATM 5097 O  O   . HOH H 7 .   ? 22.689 67.013 26.381  1.00 38.38 ? 914  HOH A O   1 
HETATM 5098 O  O   . HOH H 7 .   ? 40.942 26.613 3.041   1.00 49.84 ? 915  HOH A O   1 
HETATM 5099 O  O   . HOH H 7 .   ? 70.439 39.691 4.161   1.00 35.96 ? 916  HOH A O   1 
HETATM 5100 O  O   . HOH H 7 .   ? 21.582 67.523 34.709  1.00 52.38 ? 917  HOH A O   1 
HETATM 5101 O  O   . HOH H 7 .   ? 65.572 74.172 -19.835 1.00 49.03 ? 918  HOH A O   1 
HETATM 5102 O  O   . HOH H 7 .   ? 19.574 77.114 27.859  1.00 46.43 ? 919  HOH A O   1 
HETATM 5103 O  O   . HOH H 7 .   ? 64.664 74.067 10.890  1.00 38.97 ? 920  HOH A O   1 
HETATM 5104 O  O   . HOH H 7 .   ? 63.530 46.578 -9.695  1.00 39.14 ? 921  HOH A O   1 
HETATM 5105 O  O   . HOH H 7 .   ? 47.147 54.887 19.459  1.00 20.00 ? 922  HOH A O   1 
HETATM 5106 O  O   . HOH H 7 .   ? 48.053 55.142 16.788  1.00 20.68 ? 923  HOH A O   1 
HETATM 5107 O  O   . HOH H 7 .   ? 37.282 62.040 -2.308  1.00 31.37 ? 924  HOH A O   1 
HETATM 5108 O  O   . HOH H 7 .   ? 29.876 29.860 31.331  1.00 45.21 ? 925  HOH A O   1 
HETATM 5109 O  O   . HOH H 7 .   ? 22.494 81.992 25.290  1.00 39.64 ? 926  HOH A O   1 
HETATM 5110 O  O   . HOH H 7 .   ? 29.022 44.777 28.895  1.00 46.63 ? 927  HOH A O   1 
HETATM 5111 O  O   . HOH H 7 .   ? 50.119 37.222 22.206  1.00 42.58 ? 928  HOH A O   1 
HETATM 5112 O  O   . HOH H 7 .   ? 18.628 48.140 14.526  1.00 43.24 ? 929  HOH A O   1 
HETATM 5113 O  O   . HOH H 7 .   ? 52.131 44.567 25.655  1.00 37.96 ? 930  HOH A O   1 
HETATM 5114 O  O   . HOH H 7 .   ? 52.264 42.900 -13.841 1.00 41.23 ? 931  HOH A O   1 
HETATM 5115 O  O   . HOH H 7 .   ? 65.551 83.206 2.692   1.00 51.66 ? 932  HOH A O   1 
HETATM 5116 O  O   . HOH H 7 .   ? 23.314 69.141 31.059  1.00 43.86 ? 933  HOH A O   1 
HETATM 5117 O  O   . HOH H 7 .   ? 41.282 49.750 27.825  1.00 36.08 ? 934  HOH A O   1 
HETATM 5118 O  O   . HOH H 7 .   ? 53.060 81.516 -19.645 1.00 59.29 ? 935  HOH A O   1 
HETATM 5119 O  O   . HOH H 7 .   ? 60.794 46.276 19.037  1.00 30.61 ? 936  HOH A O   1 
HETATM 5120 O  O   . HOH H 7 .   ? 38.575 28.775 18.337  1.00 46.37 ? 937  HOH A O   1 
HETATM 5121 O  O   . HOH H 7 .   ? 32.351 36.478 -0.078  1.00 47.33 ? 938  HOH A O   1 
HETATM 5122 O  O   . HOH H 7 .   ? 21.343 44.625 16.294  1.00 50.00 ? 939  HOH A O   1 
HETATM 5123 O  O   . HOH H 7 .   ? 36.790 57.180 6.954   1.00 31.51 ? 940  HOH A O   1 
HETATM 5124 O  O   . HOH H 7 .   ? 36.503 42.405 -25.281 1.00 51.59 ? 941  HOH A O   1 
HETATM 5125 O  O   . HOH H 7 .   ? 73.632 50.929 16.812  1.00 46.88 ? 942  HOH A O   1 
HETATM 5126 O  O   . HOH H 7 .   ? 59.701 55.697 -20.253 1.00 41.63 ? 943  HOH A O   1 
HETATM 5127 O  O   . HOH H 7 .   ? 48.617 43.463 -17.254 1.00 44.81 ? 944  HOH A O   1 
HETATM 5128 O  O   . HOH H 7 .   ? 68.566 48.492 8.204   1.00 48.08 ? 945  HOH A O   1 
HETATM 5129 O  O   . HOH H 7 .   ? 36.300 56.798 4.183   1.00 30.46 ? 946  HOH A O   1 
HETATM 5130 O  O   . HOH H 7 .   ? 47.204 52.482 26.183  1.00 31.53 ? 947  HOH A O   1 
HETATM 5131 O  O   . HOH H 7 .   ? 40.034 34.799 24.483  1.00 31.97 ? 948  HOH A O   1 
HETATM 5132 O  O   . HOH H 7 .   ? 52.360 51.625 21.708  1.00 32.76 ? 949  HOH A O   1 
HETATM 5133 O  O   . HOH H 7 .   ? 43.437 84.515 -27.844 1.00 37.78 ? 950  HOH A O   1 
HETATM 5134 O  O   . HOH H 7 .   ? 38.542 35.795 22.516  1.00 25.21 ? 951  HOH A O   1 
HETATM 5135 O  O   . HOH H 7 .   ? 44.305 77.619 -27.405 1.00 37.60 ? 952  HOH A O   1 
HETATM 5136 O  O   . HOH H 7 .   ? 44.291 81.724 -11.743 1.00 43.97 ? 953  HOH A O   1 
HETATM 5137 O  O   . HOH H 7 .   ? 45.952 35.238 28.623  1.00 37.49 ? 954  HOH A O   1 
HETATM 5138 O  O   . HOH H 7 .   ? 43.928 33.127 18.235  1.00 34.57 ? 955  HOH A O   1 
HETATM 5139 O  O   . HOH H 7 .   ? 37.092 25.688 16.912  1.00 41.03 ? 956  HOH A O   1 
HETATM 5140 O  O   . HOH H 7 .   ? 50.043 52.771 22.262  1.00 40.20 ? 957  HOH A O   1 
HETATM 5141 O  O   . HOH H 7 .   ? 54.033 47.527 23.141  1.00 36.41 ? 958  HOH A O   1 
HETATM 5142 O  O   . HOH H 7 .   ? 60.890 49.221 -15.588 1.00 38.88 ? 959  HOH A O   1 
HETATM 5143 O  O   . HOH H 7 .   ? 66.393 60.954 -17.828 1.00 50.80 ? 960  HOH A O   1 
HETATM 5144 O  O   . HOH H 7 .   ? 53.316 71.811 -27.175 1.00 41.14 ? 961  HOH A O   1 
HETATM 5145 O  O   . HOH H 7 .   ? 71.318 56.065 -1.480  1.00 48.73 ? 962  HOH A O   1 
HETATM 5146 O  O   . HOH H 7 .   ? 35.386 58.278 -3.219  1.00 31.69 ? 963  HOH A O   1 
HETATM 5147 O  O   . HOH H 7 .   ? 49.199 79.783 1.607   1.00 30.33 ? 964  HOH A O   1 
HETATM 5148 O  O   . HOH H 7 .   ? 49.209 54.514 20.812  1.00 35.08 ? 965  HOH A O   1 
HETATM 5149 O  O   . HOH H 7 .   ? 34.512 60.109 -1.574  1.00 41.81 ? 966  HOH A O   1 
HETATM 5150 O  O   . HOH H 7 .   ? 52.964 44.731 -17.378 1.00 41.88 ? 967  HOH A O   1 
HETATM 5151 O  O   . HOH H 7 .   ? 35.078 25.622 20.674  1.00 45.34 ? 968  HOH A O   1 
HETATM 5152 O  O   . HOH H 7 .   ? 25.892 37.057 3.819   1.00 41.35 ? 969  HOH A O   1 
HETATM 5153 O  O   . HOH H 7 .   ? 56.928 54.122 23.138  1.00 38.73 ? 970  HOH A O   1 
HETATM 5154 O  O   . HOH H 7 .   ? 23.248 29.769 28.013  1.00 54.29 ? 971  HOH A O   1 
HETATM 5155 O  O   . HOH H 7 .   ? 56.429 57.218 23.776  1.00 44.12 ? 972  HOH A O   1 
HETATM 5156 O  O   . HOH H 7 .   ? 54.439 59.576 24.436  1.00 40.68 ? 973  HOH A O   1 
HETATM 5157 O  O   . HOH H 7 .   ? 71.397 55.250 11.162  1.00 45.89 ? 974  HOH A O   1 
HETATM 5158 O  O   . HOH H 7 .   ? 67.891 67.097 10.492  1.00 55.03 ? 975  HOH A O   1 
HETATM 5159 O  O   . HOH H 7 .   ? 44.753 74.857 -26.771 1.00 38.57 ? 976  HOH A O   1 
HETATM 5160 O  O   . HOH H 7 .   ? 66.597 75.129 0.362   1.00 44.59 ? 977  HOH A O   1 
HETATM 5161 O  O   . HOH H 7 .   ? 43.805 59.614 18.000  1.00 30.03 ? 978  HOH A O   1 
HETATM 5162 O  O   . HOH H 7 .   ? 44.996 43.387 -15.668 1.00 37.46 ? 979  HOH A O   1 
HETATM 5163 O  O   . HOH H 7 .   ? 52.155 59.517 22.953  1.00 38.37 ? 980  HOH A O   1 
HETATM 5164 O  O   . HOH H 7 .   ? 63.849 63.721 21.626  1.00 42.47 ? 981  HOH A O   1 
HETATM 5165 O  O   . HOH H 7 .   ? 17.884 30.594 28.292  1.00 43.60 ? 982  HOH A O   1 
HETATM 5166 O  O   . HOH H 7 .   ? 27.784 59.256 30.153  1.00 48.99 ? 983  HOH A O   1 
HETATM 5167 O  O   . HOH H 7 .   ? 33.427 87.296 -24.101 1.00 41.29 ? 984  HOH A O   1 
HETATM 5168 O  O   . HOH H 7 .   ? 66.305 69.045 13.208  1.00 43.12 ? 985  HOH A O   1 
HETATM 5169 O  O   . HOH H 7 .   ? 39.295 77.408 -33.132 1.00 42.25 ? 986  HOH A O   1 
HETATM 5170 O  O   . HOH H 7 .   ? 39.601 55.439 27.315  1.00 44.44 ? 987  HOH A O   1 
HETATM 5171 O  O   . HOH H 7 .   ? 34.339 39.583 0.484   1.00 39.78 ? 988  HOH A O   1 
HETATM 5172 O  O   . HOH H 7 .   ? 26.620 58.622 27.835  1.00 43.26 ? 989  HOH A O   1 
HETATM 5173 O  O   . HOH H 7 .   ? 62.895 79.567 9.324   1.00 43.77 ? 990  HOH A O   1 
HETATM 5174 O  O   . HOH H 7 .   ? 39.305 41.424 -24.483 1.00 46.57 ? 991  HOH A O   1 
HETATM 5175 O  O   . HOH H 7 .   ? 31.255 31.409 3.603   1.00 46.61 ? 992  HOH A O   1 
HETATM 5176 O  O   . HOH H 7 .   ? 28.568 31.804 3.436   1.00 50.54 ? 993  HOH A O   1 
HETATM 5177 O  O   . HOH H 7 .   ? 46.141 77.723 -11.547 1.00 34.27 ? 994  HOH A O   1 
HETATM 5178 O  O   . HOH H 7 .   ? 24.542 86.591 -26.841 1.00 47.46 ? 995  HOH A O   1 
HETATM 5179 O  O   . HOH H 7 .   ? 69.400 52.165 15.244  1.00 44.74 ? 996  HOH A O   1 
HETATM 5180 O  O   . HOH H 7 .   ? 36.508 89.655 -30.275 1.00 44.64 ? 997  HOH A O   1 
HETATM 5181 O  O   . HOH H 7 .   ? 72.944 52.231 7.193   1.00 51.55 ? 998  HOH A O   1 
HETATM 5182 O  O   . HOH H 7 .   ? 67.879 63.754 -17.405 1.00 49.47 ? 999  HOH A O   1 
HETATM 5183 O  O   . HOH H 7 .   ? 70.672 54.381 14.555  1.00 45.45 ? 1000 HOH A O   1 
HETATM 5184 O  O   . HOH H 7 .   ? 49.253 53.697 24.473  1.00 46.05 ? 1001 HOH A O   1 
HETATM 5185 O  O   . HOH H 7 .   ? 68.735 49.672 20.199  1.00 46.40 ? 1002 HOH A O   1 
HETATM 5186 O  O   . HOH H 7 .   ? 70.551 53.197 4.011   1.00 41.77 ? 1003 HOH A O   1 
HETATM 5187 O  O   . HOH H 7 .   ? 51.372 33.165 -6.013  1.00 44.67 ? 1004 HOH A O   1 
HETATM 5188 O  O   . HOH H 7 .   ? 21.631 37.851 13.690  1.00 45.56 ? 1005 HOH A O   1 
HETATM 5189 O  O   . HOH H 7 .   ? 33.810 57.965 -5.106  1.00 47.32 ? 1006 HOH A O   1 
HETATM 5190 O  O   . HOH H 7 .   ? 22.917 26.508 16.836  1.00 48.38 ? 1007 HOH A O   1 
HETATM 5191 O  O   . HOH H 7 .   ? 48.129 31.979 19.294  1.00 50.57 ? 1008 HOH A O   1 
HETATM 5192 O  O   . HOH H 7 .   ? 71.242 51.780 0.733   1.00 56.10 ? 1009 HOH A O   1 
HETATM 5193 O  O   . HOH H 7 .   ? 68.690 48.271 0.507   1.00 43.13 ? 1010 HOH A O   1 
HETATM 5194 O  O   . HOH H 7 .   ? 73.625 49.038 14.797  1.00 42.56 ? 1011 HOH A O   1 
HETATM 5195 O  O   . HOH H 7 .   ? 64.966 77.108 8.965   1.00 45.40 ? 1012 HOH A O   1 
HETATM 5196 O  O   . HOH H 7 .   ? 39.641 44.806 -27.445 1.00 47.27 ? 1013 HOH A O   1 
HETATM 5197 O  O   . HOH H 7 .   ? 21.512 38.018 17.117  1.00 46.77 ? 1014 HOH A O   1 
HETATM 5198 O  O   . HOH H 7 .   ? 49.353 60.374 24.220  1.00 39.57 ? 1015 HOH A O   1 
HETATM 5199 O  O   . HOH H 7 .   ? 45.623 41.725 -17.649 1.00 42.34 ? 1016 HOH A O   1 
HETATM 5200 O  O   . HOH H 7 .   ? 32.974 59.034 -7.387  1.00 37.35 ? 1017 HOH A O   1 
HETATM 5201 O  O   . HOH H 7 .   ? 32.707 55.517 -5.454  1.00 41.04 ? 1018 HOH A O   1 
HETATM 5202 O  O   . HOH H 7 .   ? 30.900 56.274 -8.219  1.00 34.86 ? 1019 HOH A O   1 
HETATM 5203 O  O   . HOH H 7 .   ? 45.703 57.172 20.133  1.00 37.91 ? 1020 HOH A O   1 
HETATM 5204 O  O   . HOH H 7 .   ? 50.784 45.939 28.024  1.00 44.47 ? 1021 HOH A O   1 
HETATM 5205 O  O   . HOH H 7 .   ? 64.659 57.473 24.137  1.00 45.37 ? 1022 HOH A O   1 
HETATM 5206 O  O   . HOH H 7 .   ? 45.653 60.434 23.778  1.00 36.67 ? 1023 HOH A O   1 
HETATM 5207 O  O   . HOH H 7 .   ? 71.153 52.567 -7.149  1.00 50.14 ? 1024 HOH A O   1 
HETATM 5208 O  O   . HOH H 7 .   ? 59.257 68.637 -29.155 1.00 43.22 ? 1025 HOH A O   1 
HETATM 5209 O  O   . HOH H 7 .   ? 50.830 56.770 22.627  1.00 45.06 ? 1026 HOH A O   1 
HETATM 5210 O  O   . HOH H 7 .   ? 32.174 45.790 4.056   1.00 44.47 ? 1027 HOH A O   1 
HETATM 5211 O  O   . HOH H 7 .   ? 58.637 66.028 -28.734 1.00 54.40 ? 1028 HOH A O   1 
HETATM 5212 O  O   . HOH H 7 .   ? 69.901 55.663 -10.634 1.00 45.13 ? 1029 HOH A O   1 
HETATM 5213 O  O   . HOH H 7 .   ? 26.295 40.906 3.658   1.00 46.48 ? 1030 HOH A O   1 
HETATM 5214 O  O   . HOH H 7 .   ? 41.215 47.238 29.053  1.00 45.21 ? 1031 HOH A O   1 
HETATM 5215 O  O   . HOH H 7 .   ? 56.748 51.896 -18.149 1.00 44.23 ? 1032 HOH A O   1 
HETATM 5216 O  O   . HOH H 7 .   ? 34.521 45.629 3.200   1.00 32.11 ? 1033 HOH A O   1 
HETATM 5217 O  O   . HOH H 7 .   ? 47.497 30.858 3.413   1.00 41.74 ? 1034 HOH A O   1 
HETATM 5218 O  O   . HOH H 7 .   ? 45.280 81.136 -29.801 1.00 43.60 ? 1035 HOH A O   1 
HETATM 5219 O  O   . HOH H 7 .   ? 35.603 33.844 -2.640  1.00 43.43 ? 1036 HOH A O   1 
HETATM 5220 O  O   . HOH H 7 .   ? 33.793 40.484 -2.067  1.00 49.09 ? 1037 HOH A O   1 
HETATM 5221 O  O   . HOH H 7 .   ? 45.379 78.822 -23.918 1.00 47.32 ? 1038 HOH A O   1 
HETATM 5222 O  O   . HOH H 7 .   ? 46.636 57.117 22.344  1.00 44.77 ? 1039 HOH A O   1 
HETATM 5223 O  O   . HOH H 7 .   ? 54.061 69.709 -28.126 1.00 47.74 ? 1040 HOH A O   1 
HETATM 5224 O  O   . HOH H 7 .   ? 54.294 79.862 -13.034 1.00 53.39 ? 1041 HOH A O   1 
HETATM 5225 O  O   . HOH H 7 .   ? 69.070 77.425 5.470   1.00 42.52 ? 1042 HOH A O   1 
HETATM 5226 O  O   . HOH H 7 .   ? 60.567 34.488 13.493  1.00 42.98 ? 1043 HOH A O   1 
HETATM 5227 O  O   . HOH H 7 .   ? 59.641 64.741 24.032  1.00 38.70 ? 1044 HOH A O   1 
HETATM 5228 O  O   . HOH H 7 .   ? 35.255 45.440 29.449  1.00 63.01 ? 1045 HOH A O   1 
HETATM 5229 O  O   . HOH H 7 .   ? 27.059 38.705 30.327  1.00 53.74 ? 1046 HOH A O   1 
HETATM 5230 O  O   . HOH H 7 .   ? 44.880 81.156 -14.315 1.00 50.75 ? 1047 HOH A O   1 
HETATM 5231 O  O   . HOH H 7 .   ? 30.679 34.928 0.896   1.00 48.87 ? 1048 HOH A O   1 
HETATM 5232 O  O   . HOH H 7 .   ? 33.930 49.307 2.891   1.00 40.82 ? 1049 HOH A O   1 
HETATM 5233 O  O   . HOH H 7 .   ? 34.513 47.682 0.255   1.00 36.27 ? 1050 HOH A O   1 
HETATM 5234 O  O   . HOH H 7 .   ? 73.545 60.418 -4.766  1.00 41.98 ? 1051 HOH A O   1 
HETATM 5235 O  O   . HOH H 7 .   ? 36.047 76.074 -23.643 0.70 23.24 ? 1052 HOH A O   1 
HETATM 5236 O  O   . HOH H 7 .   ? 49.909 77.783 -23.013 1.00 38.45 ? 1053 HOH A O   1 
HETATM 5237 O  O   . HOH H 7 .   ? 52.178 41.087 -9.630  1.00 46.48 ? 1054 HOH A O   1 
HETATM 5238 O  O   . HOH H 7 .   ? 55.230 39.216 -5.013  1.00 42.77 ? 1055 HOH A O   1 
HETATM 5239 O  O   . HOH H 7 .   ? 29.704 61.507 31.759  1.00 52.08 ? 1056 HOH A O   1 
HETATM 5240 O  O   . HOH H 7 .   ? 63.259 63.788 11.461  1.00 50.31 ? 1057 HOH A O   1 
HETATM 5241 O  O   . HOH H 7 .   ? 58.185 36.593 2.884   1.00 44.79 ? 1058 HOH A O   1 
HETATM 5242 O  O   . HOH H 7 .   ? 43.146 31.451 3.084   1.00 43.59 ? 1059 HOH A O   1 
HETATM 5243 O  O   . HOH H 7 .   ? 42.808 28.076 4.188   1.00 52.97 ? 1060 HOH A O   1 
HETATM 5244 O  O   . HOH H 7 .   ? 47.685 25.361 4.877   1.00 62.36 ? 1061 HOH A O   1 
HETATM 5245 O  O   . HOH H 7 .   ? 26.952 49.450 26.182  1.00 49.58 ? 1062 HOH A O   1 
HETATM 5246 O  O   . HOH H 7 .   ? 39.512 83.487 -18.613 1.00 42.24 ? 1063 HOH A O   1 
HETATM 5247 O  O   . HOH H 7 .   ? 42.624 83.772 -15.580 1.00 46.55 ? 1064 HOH A O   1 
HETATM 5248 O  O   . HOH H 7 .   ? 70.226 74.056 -14.631 1.00 42.21 ? 1065 HOH A O   1 
HETATM 5249 O  O   . HOH H 7 .   ? 73.873 59.245 -1.149  1.00 48.24 ? 1066 HOH A O   1 
HETATM 5250 O  O   . HOH H 7 .   ? 44.203 82.635 -22.306 1.00 45.65 ? 1067 HOH A O   1 
HETATM 5251 O  O   . HOH H 7 .   ? 54.935 82.061 12.380  1.00 56.93 ? 1068 HOH A O   1 
HETATM 5252 O  O   . HOH H 7 .   ? 63.372 35.698 11.439  1.00 44.05 ? 1069 HOH A O   1 
HETATM 5253 O  O   . HOH H 7 .   ? 24.950 82.627 -27.244 1.00 49.34 ? 1070 HOH A O   1 
HETATM 5254 O  O   . HOH H 7 .   ? 30.641 42.149 2.025   1.00 49.42 ? 1071 HOH A O   1 
HETATM 5255 O  O   . HOH H 7 .   ? 24.575 35.337 8.167   1.00 46.94 ? 1072 HOH A O   1 
HETATM 5256 O  O   . HOH H 7 .   ? 39.335 86.093 -22.923 1.00 41.67 ? 1073 HOH A O   1 
HETATM 5257 O  O   . HOH H 7 .   ? 33.962 77.376 -28.376 1.00 36.06 ? 1074 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASN A 2   ? 0.5439 0.5583 0.7214 -0.0897 -0.1517 0.0439  -1   ASN A N   
2    C  CA  A ASN A 2   ? 0.5380 0.5631 0.7359 -0.0950 -0.1503 0.0551  -1   ASN A CA  
3    C  CA  B ASN A 2   ? 0.5331 0.5579 0.7310 -0.0951 -0.1504 0.0551  -1   ASN A CA  
4    C  C   . ASN A 2   ? 0.5171 0.5534 0.7144 -0.0926 -0.1376 0.0618  -1   ASN A C   
5    O  O   . ASN A 2   ? 0.5099 0.5586 0.7217 -0.0953 -0.1343 0.0712  -1   ASN A O   
6    C  CB  A ASN A 2   ? 0.5511 0.5838 0.7627 -0.0986 -0.1573 0.0587  -1   ASN A CB  
7    C  CB  B ASN A 2   ? 0.5419 0.5739 0.7535 -0.0988 -0.1575 0.0586  -1   ASN A CB  
8    C  CG  A ASN A 2   ? 0.5569 0.5981 0.7612 -0.0944 -0.1533 0.0578  -1   ASN A CG  
9    C  CG  B ASN A 2   ? 0.5463 0.5831 0.7806 -0.1059 -0.1619 0.0678  -1   ASN A CG  
10   O  OD1 A ASN A 2   ? 0.6057 0.6517 0.8180 -0.0963 -0.1595 0.0590  -1   ASN A OD1 
11   O  OD1 B ASN A 2   ? 0.5622 0.5943 0.8066 -0.1104 -0.1731 0.0668  -1   ASN A OD1 
12   N  ND2 A ASN A 2   ? 0.5883 0.6312 0.7784 -0.0889 -0.1436 0.0558  -1   ASN A ND2 
13   N  ND2 B ASN A 2   ? 0.5335 0.5798 0.7761 -0.1069 -0.1532 0.0769  -1   ASN A ND2 
14   N  N   . ALA A 3   ? 0.4839 0.5165 0.6646 -0.0872 -0.1303 0.0570  0    ALA A N   
15   C  CA  . ALA A 3   ? 0.4561 0.4981 0.6353 -0.0846 -0.1189 0.0623  0    ALA A CA  
16   C  C   . ALA A 3   ? 0.4325 0.4761 0.6227 -0.0882 -0.1167 0.0695  0    ALA A C   
17   O  O   . ALA A 3   ? 0.4535 0.4875 0.6474 -0.0914 -0.1230 0.0681  0    ALA A O   
18   C  CB  . ALA A 3   ? 0.4470 0.4835 0.6065 -0.0784 -0.1124 0.0554  0    ALA A CB  
19   N  N   . MET A 4   ? 0.3797 0.4357 0.5753 -0.0875 -0.1081 0.0774  1    MET A N   
20   C  CA  . MET A 4   ? 0.3585 0.4175 0.5617 -0.0896 -0.1040 0.0846  1    MET A CA  
21   C  C   . MET A 4   ? 0.3347 0.3818 0.5255 -0.0874 -0.1024 0.0790  1    MET A C   
22   O  O   . MET A 4   ? 0.3365 0.3794 0.5112 -0.0822 -0.0982 0.0722  1    MET A O   
23   C  CB  . MET A 4   ? 0.3364 0.4103 0.5422 -0.0871 -0.0937 0.0919  1    MET A CB  
24   C  CG  . MET A 4   ? 0.3739 0.4528 0.5877 -0.0891 -0.0890 0.1004  1    MET A CG  
25   S  SD  . MET A 4   ? 0.3675 0.4596 0.5751 -0.0834 -0.0757 0.1048  1    MET A SD  
26   C  CE  . MET A 4   ? 0.3451 0.4250 0.5317 -0.0783 -0.0718 0.0956  1    MET A CE  
27   N  N   . LEU A 5   ? 0.3240 0.3660 0.5229 -0.0913 -0.1058 0.0823  2    LEU A N   
28   C  CA  . LEU A 5   ? 0.3075 0.3390 0.4967 -0.0894 -0.1044 0.0781  2    LEU A CA  
29   C  C   . LEU A 5   ? 0.2990 0.3387 0.4871 -0.0874 -0.0943 0.0845  2    LEU A C   
30   O  O   . LEU A 5   ? 0.3082 0.3562 0.5093 -0.0907 -0.0926 0.0942  2    LEU A O   
31   C  CB  . LEU A 5   ? 0.3187 0.3402 0.5180 -0.0946 -0.1134 0.0789  2    LEU A CB  
32   C  CG  . LEU A 5   ? 0.3179 0.3287 0.5099 -0.0932 -0.1126 0.0757  2    LEU A CG  
33   C  CD1 . LEU A 5   ? 0.3200 0.3201 0.4932 -0.0878 -0.1128 0.0638  2    LEU A CD1 
34   C  CD2 . LEU A 5   ? 0.3505 0.3522 0.5552 -0.0987 -0.1216 0.0780  2    LEU A CD2 
35   N  N   . PHE A 6   ? 0.2881 0.3258 0.4606 -0.0819 -0.0878 0.0793  3    PHE A N   
36   C  CA  . PHE A 6   ? 0.2758 0.3207 0.4459 -0.0795 -0.0788 0.0844  3    PHE A CA  
37   C  C   . PHE A 6   ? 0.3031 0.3417 0.4762 -0.0816 -0.0798 0.0872  3    PHE A C   
38   O  O   . PHE A 6   ? 0.2867 0.3333 0.4687 -0.0835 -0.0763 0.0963  3    PHE A O   
39   C  CB  . PHE A 6   ? 0.2746 0.3190 0.4280 -0.0732 -0.0721 0.0780  3    PHE A CB  
40   C  CG  . PHE A 6   ? 0.2498 0.3004 0.3998 -0.0705 -0.0636 0.0824  3    PHE A CG  
41   C  CD1 . PHE A 6   ? 0.2709 0.3137 0.4135 -0.0690 -0.0623 0.0798  3    PHE A CD1 
42   C  CD2 . PHE A 6   ? 0.2631 0.3275 0.4179 -0.0694 -0.0574 0.0891  3    PHE A CD2 
43   C  CE1 . PHE A 6   ? 0.2685 0.3170 0.4085 -0.0667 -0.0553 0.0840  3    PHE A CE1 
44   C  CE2 . PHE A 6   ? 0.2635 0.3338 0.4151 -0.0668 -0.0501 0.0932  3    PHE A CE2 
45   C  CZ  . PHE A 6   ? 0.2511 0.3134 0.3949 -0.0654 -0.0491 0.0905  3    PHE A CZ  
46   N  N   . CYS A 7   ? 0.3243 0.3491 0.4899 -0.0809 -0.0844 0.0795  4    CYS A N   
47   C  CA  A CYS A 7   ? 0.3346 0.3522 0.5020 -0.0823 -0.0856 0.0813  4    CYS A CA  
48   C  CA  B CYS A 7   ? 0.3450 0.3618 0.5121 -0.0823 -0.0861 0.0807  4    CYS A CA  
49   C  C   . CYS A 7   ? 0.3631 0.3758 0.5457 -0.0885 -0.0946 0.0851  4    CYS A C   
50   O  O   . CYS A 7   ? 0.3701 0.3701 0.5516 -0.0896 -0.1026 0.0785  4    CYS A O   
51   C  CB  A CYS A 7   ? 0.3327 0.3385 0.4851 -0.0781 -0.0856 0.0716  4    CYS A CB  
52   C  CB  B CYS A 7   ? 0.3471 0.3507 0.5003 -0.0787 -0.0881 0.0701  4    CYS A CB  
53   S  SG  A CYS A 7   ? 0.3250 0.3233 0.4784 -0.0786 -0.0854 0.0742  4    CYS A SG  
54   S  SG  B CYS A 7   ? 0.3728 0.3793 0.5084 -0.0719 -0.0797 0.0639  4    CYS A SG  
55   N  N   . ASP A 8   ? 0.3733 0.3966 0.5704 -0.0924 -0.0932 0.0961  5    ASP A N   
56   C  CA  . ASP A 8   ? 0.3925 0.4133 0.6067 -0.0990 -0.1015 0.1015  5    ASP A CA  
57   C  C   . ASP A 8   ? 0.4068 0.4284 0.6302 -0.1018 -0.1001 0.1107  5    ASP A C   
58   O  O   . ASP A 8   ? 0.4042 0.4276 0.6194 -0.0984 -0.0931 0.1119  5    ASP A O   
59   C  CB  . ASP A 8   ? 0.4017 0.4339 0.6278 -0.1020 -0.1028 0.1069  5    ASP A CB  
60   C  CG  . ASP A 8   ? 0.4170 0.4669 0.6486 -0.1013 -0.0933 0.1173  5    ASP A CG  
61   O  OD1 . ASP A 8   ? 0.4262 0.4803 0.6524 -0.0986 -0.0857 0.1209  5    ASP A OD1 
62   O  OD2 . ASP A 8   ? 0.4520 0.5124 0.6939 -0.1035 -0.0938 0.1221  5    ASP A OD2 
63   N  N   . ASP A 9   ? 0.4345 0.4544 0.6752 -0.1082 -0.1073 0.1172  6    ASP A N   
64   C  CA  . ASP A 9   ? 0.4610 0.4813 0.7118 -0.1115 -0.1067 0.1268  6    ASP A CA  
65   C  C   . ASP A 9   ? 0.4468 0.4836 0.6995 -0.1101 -0.0961 0.1375  6    ASP A C   
66   O  O   . ASP A 9   ? 0.4588 0.4956 0.7091 -0.1090 -0.0919 0.1418  6    ASP A O   
67   C  CB  . ASP A 9   ? 0.4795 0.4975 0.7511 -0.1191 -0.1160 0.1337  6    ASP A CB  
68   C  CG  . ASP A 9   ? 0.5461 0.5452 0.8181 -0.1210 -0.1275 0.1249  6    ASP A CG  
69   O  OD1 . ASP A 9   ? 0.5836 0.5715 0.8394 -0.1161 -0.1280 0.1136  6    ASP A OD1 
70   O  OD2 . ASP A 9   ? 0.6031 0.5988 0.8924 -0.1274 -0.1364 0.1295  6    ASP A OD2 
71   N  N   . SER A 10  ? 0.4590 0.5097 0.7160 -0.1100 -0.0921 0.1416  7    SER A N   
72   C  CA  . SER A 10  ? 0.4724 0.5402 0.7302 -0.1079 -0.0818 0.1509  7    SER A CA  
73   C  C   . SER A 10  ? 0.4750 0.5429 0.7144 -0.1010 -0.0732 0.1466  7    SER A C   
74   O  O   . SER A 10  ? 0.4632 0.5388 0.7031 -0.0999 -0.0669 0.1545  7    SER A O   
75   C  CB  . SER A 10  ? 0.4782 0.5589 0.7409 -0.1076 -0.0797 0.1527  7    SER A CB  
76   O  OG  . SER A 10  ? 0.5136 0.6067 0.7667 -0.1018 -0.0692 0.1537  7    SER A OG  
77   N  N   . LYS A 11  ? 0.4791 0.5383 0.7026 -0.0965 -0.0734 0.1343  8    LYS A N   
78   C  CA  . LYS A 11  ? 0.4928 0.5514 0.6992 -0.0901 -0.0661 0.1295  8    LYS A CA  
79   C  C   . LYS A 11  ? 0.5207 0.5704 0.7249 -0.0904 -0.0671 0.1304  8    LYS A C   
80   O  O   . LYS A 11  ? 0.5235 0.5791 0.7229 -0.0877 -0.0603 0.1349  8    LYS A O   
81   C  CB  . LYS A 11  ? 0.4870 0.5373 0.6780 -0.0857 -0.0668 0.1164  8    LYS A CB  
82   C  CG  . LYS A 11  ? 0.5050 0.5622 0.6949 -0.0843 -0.0657 0.1137  8    LYS A CG  
83   C  CD  . LYS A 11  ? 0.5108 0.5841 0.7005 -0.0814 -0.0568 0.1199  8    LYS A CD  
84   C  CE  . LYS A 11  ? 0.5313 0.6127 0.7272 -0.0821 -0.0578 0.1202  8    LYS A CE  
85   N  NZ  . LYS A 11  ? 0.5496 0.6461 0.7605 -0.0848 -0.0549 0.1323  8    LYS A NZ  
86   N  N   . LYS A 12  ? 0.5402 0.5757 0.7478 -0.0935 -0.0759 0.1258  9    LYS A N   
87   C  CA  . LYS A 12  ? 0.5518 0.5767 0.7580 -0.0938 -0.0783 0.1256  9    LYS A CA  
88   C  C   . LYS A 12  ? 0.5427 0.5767 0.7585 -0.0960 -0.0743 0.1388  9    LYS A C   
89   O  O   . LYS A 12  ? 0.5559 0.5872 0.7652 -0.0936 -0.0713 0.1396  9    LYS A O   
90   C  CB  . LYS A 12  ? 0.5667 0.5760 0.7786 -0.0974 -0.0892 0.1200  9    LYS A CB  
91   C  CG  . LYS A 12  ? 0.5893 0.5891 0.7896 -0.0943 -0.0930 0.1063  9    LYS A CG  
92   C  CD  . LYS A 12  ? 0.5929 0.5865 0.7752 -0.0880 -0.0888 0.0974  9    LYS A CD  
93   C  CE  . LYS A 12  ? 0.5851 0.5664 0.7578 -0.0857 -0.0943 0.0845  9    LYS A CE  
94   N  NZ  . LYS A 12  ? 0.5707 0.5444 0.7288 -0.0803 -0.0914 0.0768  9    LYS A NZ  
95   N  N   A TYR A 13  ? 0.5395 0.5847 0.7704 -0.1004 -0.0742 0.1491  10   TYR A N   
96   N  N   B TYR A 13  ? 0.5384 0.5837 0.7689 -0.1002 -0.0740 0.1491  10   TYR A N   
97   C  CA  A TYR A 13  ? 0.5275 0.5840 0.7697 -0.1030 -0.0703 0.1636  10   TYR A CA  
98   C  CA  B TYR A 13  ? 0.5291 0.5840 0.7700 -0.1027 -0.0704 0.1629  10   TYR A CA  
99   C  C   A TYR A 13  ? 0.5052 0.5789 0.7413 -0.0985 -0.0590 0.1698  10   TYR A C   
100  C  C   B TYR A 13  ? 0.5053 0.5766 0.7394 -0.0981 -0.0592 0.1687  10   TYR A C   
101  O  O   A TYR A 13  ? 0.4968 0.5800 0.7402 -0.0998 -0.0550 0.1816  10   TYR A O   
102  O  O   B TYR A 13  ? 0.5011 0.5781 0.7381 -0.0982 -0.0554 0.1780  10   TYR A O   
103  C  CB  A TYR A 13  ? 0.5359 0.5979 0.7991 -0.1101 -0.0754 0.1729  10   TYR A CB  
104  C  CB  B TYR A 13  ? 0.5400 0.5987 0.8022 -0.1101 -0.0763 0.1723  10   TYR A CB  
105  C  CG  A TYR A 13  ? 0.5468 0.6286 0.8179 -0.1103 -0.0673 0.1862  10   TYR A CG  
106  C  CG  B TYR A 13  ? 0.5709 0.6129 0.8417 -0.1150 -0.0874 0.1695  10   TYR A CG  
107  C  CD1 A TYR A 13  ? 0.5789 0.6662 0.8586 -0.1127 -0.0649 0.1987  10   TYR A CD1 
108  C  CD1 B TYR A 13  ? 0.5953 0.6362 0.8818 -0.1205 -0.0911 0.1804  10   TYR A CD1 
109  C  CD2 A TYR A 13  ? 0.5516 0.6467 0.8200 -0.1074 -0.0615 0.1860  10   TYR A CD2 
110  C  CD2 B TYR A 13  ? 0.5938 0.6209 0.8564 -0.1137 -0.0941 0.1559  10   TYR A CD2 
111  C  CE1 A TYR A 13  ? 0.5864 0.6928 0.8718 -0.1120 -0.0567 0.2107  10   TYR A CE1 
112  C  CE1 B TYR A 13  ? 0.6179 0.6426 0.9122 -0.1246 -0.1017 0.1775  10   TYR A CE1 
113  C  CE2 A TYR A 13  ? 0.5463 0.6596 0.8203 -0.1066 -0.0535 0.1973  10   TYR A CE2 
114  C  CE2 B TYR A 13  ? 0.6144 0.6258 0.8839 -0.1174 -0.1044 0.1526  10   TYR A CE2 
115  C  CZ  A TYR A 13  ? 0.5728 0.6923 0.8552 -0.1088 -0.0510 0.2097  10   TYR A CZ  
116  C  CZ  B TYR A 13  ? 0.6277 0.6377 0.9133 -0.1229 -0.1084 0.1631  10   TYR A CZ  
117  O  OH  A TYR A 13  ? 0.5565 0.6954 0.8442 -0.1075 -0.0426 0.2213  10   TYR A OH  
118  O  OH  B TYR A 13  ? 0.6453 0.6389 0.9381 -0.1264 -0.1192 0.1595  10   TYR A OH  
119  N  N   A LEU A 14  ? 0.4655 0.5436 0.6888 -0.0932 -0.0539 0.1624  11   LEU A N   
120  N  N   B LEU A 14  ? 0.4671 0.5456 0.6919 -0.0937 -0.0541 0.1632  11   LEU A N   
121  C  CA  . LEU A 14  ? 0.4405 0.5332 0.6564 -0.0881 -0.0438 0.1666  11   LEU A CA  
122  C  C   . LEU A 14  ? 0.4204 0.5097 0.6248 -0.0843 -0.0399 0.1661  11   LEU A C   
123  O  O   . LEU A 14  ? 0.4017 0.5025 0.6032 -0.0813 -0.0326 0.1730  11   LEU A O   
124  C  CB  . LEU A 14  ? 0.4255 0.5211 0.6296 -0.0831 -0.0403 0.1571  11   LEU A CB  
125  C  CG  . LEU A 14  ? 0.3961 0.4992 0.6097 -0.0852 -0.0418 0.1582  11   LEU A CG  
126  C  CD1 . LEU A 14  ? 0.3648 0.4687 0.5654 -0.0799 -0.0389 0.1482  11   LEU A CD1 
127  C  CD2 . LEU A 14  ? 0.4067 0.5274 0.6326 -0.0866 -0.0368 0.1714  11   LEU A CD2 
128  N  N   . LYS A 15  ? 0.4076 0.4811 0.6057 -0.0842 -0.0450 0.1578  12   LYS A N   
129  C  CA  . LYS A 15  ? 0.4123 0.4799 0.6002 -0.0810 -0.0431 0.1559  12   LYS A CA  
130  C  C   . LYS A 15  ? 0.3963 0.4686 0.5941 -0.0840 -0.0424 0.1688  12   LYS A C   
131  O  O   . LYS A 15  ? 0.3819 0.4576 0.5724 -0.0806 -0.0376 0.1718  12   LYS A O   
132  C  CB  . LYS A 15  ? 0.4296 0.4792 0.6128 -0.0814 -0.0503 0.1452  12   LYS A CB  
133  C  CG  . LYS A 15  ? 0.4662 0.5080 0.6384 -0.0778 -0.0491 0.1411  12   LYS A CG  
134  C  CD  . LYS A 15  ? 0.5155 0.5414 0.6809 -0.0768 -0.0549 0.1287  12   LYS A CD  
135  C  CE  . LYS A 15  ? 0.5488 0.5639 0.7123 -0.0763 -0.0578 0.1279  12   LYS A CE  
136  N  NZ  . LYS A 15  ? 0.6100 0.6181 0.7887 -0.0822 -0.0653 0.1338  12   LYS A NZ  
137  N  N   . GLU A 16  ? 0.3774 0.4508 0.5926 -0.0904 -0.0472 0.1770  13   GLU A N   
138  C  CA  . GLU A 16  ? 0.3765 0.4546 0.6034 -0.0939 -0.0471 0.1906  13   GLU A CA  
139  C  C   . GLU A 16  ? 0.3426 0.4396 0.5688 -0.0913 -0.0376 0.2013  13   GLU A C   
140  O  O   . GLU A 16  ? 0.3303 0.4328 0.5637 -0.0932 -0.0360 0.2131  13   GLU A O   
141  C  CB  . GLU A 16  ? 0.4004 0.4755 0.6473 -0.1017 -0.0549 0.1969  13   GLU A CB  
142  C  CG  . GLU A 16  ? 0.4667 0.5219 0.7155 -0.1046 -0.0651 0.1882  13   GLU A CG  
143  C  CD  . GLU A 16  ? 0.5642 0.6157 0.8336 -0.1125 -0.0739 0.1941  13   GLU A CD  
144  O  OE1 . GLU A 16  ? 0.5887 0.6529 0.8733 -0.1167 -0.0723 0.2070  13   GLU A OE1 
145  O  OE2 . GLU A 16  ? 0.6551 0.6907 0.9256 -0.1144 -0.0827 0.1853  13   GLU A OE2 
146  N  N   . GLN A 17  ? 0.3113 0.4187 0.5293 -0.0867 -0.0313 0.1977  14   GLN A N   
147  C  CA  . GLN A 17  ? 0.3006 0.4248 0.5132 -0.0821 -0.0217 0.2051  14   GLN A CA  
148  C  C   . GLN A 17  ? 0.2936 0.4150 0.4928 -0.0775 -0.0184 0.2041  14   GLN A C   
149  O  O   . GLN A 17  ? 0.2901 0.4242 0.4873 -0.0748 -0.0119 0.2129  14   GLN A O   
150  C  CB  . GLN A 17  ? 0.2934 0.4270 0.4977 -0.0771 -0.0162 0.1992  14   GLN A CB  
151  C  CG  . GLN A 17  ? 0.2899 0.4314 0.5077 -0.0807 -0.0175 0.2026  14   GLN A CG  
152  C  CD  . GLN A 17  ? 0.3093 0.4691 0.5391 -0.0820 -0.0122 0.2175  14   GLN A CD  
153  O  OE1 . GLN A 17  ? 0.3174 0.4910 0.5398 -0.0764 -0.0038 0.2203  14   GLN A OE1 
154  N  NE2 . GLN A 17  ? 0.3595 0.5201 0.6085 -0.0894 -0.0171 0.2274  14   GLN A NE2 
155  N  N   . ASN A 18  ? 0.3014 0.4068 0.4923 -0.0767 -0.0231 0.1940  15   ASN A N   
156  C  CA  A ASN A 18  ? 0.3089 0.4098 0.4879 -0.0727 -0.0212 0.1924  15   ASN A CA  
157  C  CA  B ASN A 18  ? 0.2926 0.3932 0.4712 -0.0726 -0.0213 0.1917  15   ASN A CA  
158  C  C   . ASN A 18  ? 0.2893 0.4023 0.4543 -0.0656 -0.0125 0.1919  15   ASN A C   
159  O  O   . ASN A 18  ? 0.2916 0.4114 0.4534 -0.0634 -0.0085 0.1995  15   ASN A O   
160  C  CB  A ASN A 18  ? 0.3424 0.4425 0.5322 -0.0768 -0.0236 0.2044  15   ASN A CB  
161  C  CB  B ASN A 18  ? 0.3074 0.4048 0.4954 -0.0765 -0.0243 0.2020  15   ASN A CB  
162  C  CG  A ASN A 18  ? 0.3875 0.4721 0.5886 -0.0829 -0.0332 0.2027  15   ASN A CG  
163  C  CG  B ASN A 18  ? 0.2906 0.3784 0.4672 -0.0731 -0.0250 0.1974  15   ASN A CG  
164  O  OD1 A ASN A 18  ? 0.4850 0.5568 0.6814 -0.0826 -0.0380 0.1905  15   ASN A OD1 
165  O  OD1 B ASN A 18  ? 0.2461 0.3259 0.4099 -0.0691 -0.0254 0.1851  15   ASN A OD1 
166  N  ND2 A ASN A 18  ? 0.4968 0.5822 0.7129 -0.0883 -0.0362 0.2148  15   ASN A ND2 
167  N  ND2 B ASN A 18  ? 0.3107 0.3996 0.4926 -0.0747 -0.0254 0.2078  15   ASN A ND2 
168  N  N   . ILE A 19  ? 0.2601 0.3747 0.4162 -0.0618 -0.0100 0.1825  16   ILE A N   
169  C  CA  . ILE A 19  ? 0.2518 0.3774 0.3951 -0.0548 -0.0024 0.1808  16   ILE A CA  
170  C  C   . ILE A 19  ? 0.2610 0.3819 0.3914 -0.0506 -0.0012 0.1779  16   ILE A C   
171  O  O   . ILE A 19  ? 0.2711 0.3779 0.3963 -0.0507 -0.0057 0.1695  16   ILE A O   
172  C  CB  . ILE A 19  ? 0.2563 0.3803 0.3916 -0.0515 -0.0015 0.1692  16   ILE A CB  
173  C  CG1 . ILE A 19  ? 0.2693 0.3992 0.4167 -0.0551 -0.0025 0.1718  16   ILE A CG1 
174  C  CG2 . ILE A 19  ? 0.2495 0.3831 0.3706 -0.0438 0.0057  0.1663  16   ILE A CG2 
175  C  CD1 . ILE A 19  ? 0.2944 0.4430 0.4482 -0.0541 0.0039  0.1832  16   ILE A CD1 
176  N  N   . ASN A 20  ? 0.2631 0.3962 0.3886 -0.0467 0.0048  0.1852  17   ASN A N   
177  C  CA  . ASN A 20  ? 0.2720 0.4035 0.3838 -0.0416 0.0068  0.1825  17   ASN A CA  
178  C  C   . ASN A 20  ? 0.2582 0.3993 0.3575 -0.0346 0.0130  0.1775  17   ASN A C   
179  O  O   . ASN A 20  ? 0.2573 0.4132 0.3577 -0.0323 0.0186  0.1845  17   ASN A O   
180  C  CB  . ASN A 20  ? 0.2882 0.4259 0.4039 -0.0425 0.0083  0.1954  17   ASN A CB  
181  C  CG  . ASN A 20  ? 0.3400 0.4758 0.4417 -0.0373 0.0097  0.1929  17   ASN A CG  
182  O  OD1 . ASN A 20  ? 0.2997 0.4429 0.3888 -0.0309 0.0146  0.1892  17   ASN A OD1 
183  N  ND2 . ASN A 20  ? 0.4430 0.5688 0.5475 -0.0400 0.0051  0.1951  17   ASN A ND2 
184  N  N   . LEU A 21  ? 0.2520 0.3846 0.3395 -0.0309 0.0119  0.1650  18   LEU A N   
185  C  CA  . LEU A 21  ? 0.2529 0.3925 0.3291 -0.0245 0.0167  0.1585  18   LEU A CA  
186  C  C   . LEU A 21  ? 0.2642 0.4154 0.3311 -0.0186 0.0222  0.1636  18   LEU A C   
187  O  O   . LEU A 21  ? 0.2698 0.4335 0.3332 -0.0142 0.0277  0.1651  18   LEU A O   
188  C  CB  . LEU A 21  ? 0.2537 0.3809 0.3199 -0.0222 0.0137  0.1448  18   LEU A CB  
189  C  CG  . LEU A 21  ? 0.2233 0.3399 0.2953 -0.0263 0.0091  0.1378  18   LEU A CG  
190  C  CD1 . LEU A 21  ? 0.2285 0.3336 0.2901 -0.0237 0.0066  0.1258  18   LEU A CD1 
191  C  CD2 . LEU A 21  ? 0.2419 0.3658 0.3176 -0.0259 0.0114  0.1367  18   LEU A CD2 
192  N  N   . LYS A 22  ? 0.2731 0.4206 0.3357 -0.0181 0.0209  0.1663  19   LYS A N   
193  C  CA  . LYS A 22  ? 0.2826 0.4415 0.3361 -0.0125 0.0259  0.1719  19   LYS A CA  
194  C  C   . LYS A 22  ? 0.2896 0.4650 0.3508 -0.0128 0.0311  0.1847  19   LYS A C   
195  O  O   . LYS A 22  ? 0.2983 0.4865 0.3520 -0.0069 0.0370  0.1863  19   LYS A O   
196  C  CB  . LYS A 22  ? 0.3086 0.4613 0.3589 -0.0130 0.0230  0.1750  19   LYS A CB  
197  C  CG  . LYS A 22  ? 0.3688 0.5339 0.4106 -0.0077 0.0278  0.1826  19   LYS A CG  
198  C  CD  . LYS A 22  ? 0.4432 0.6009 0.4779 -0.0065 0.0247  0.1821  19   LYS A CD  
199  C  CE  . LYS A 22  ? 0.4893 0.6604 0.5157 -0.0013 0.0294  0.1911  19   LYS A CE  
200  N  NZ  . LYS A 22  ? 0.5399 0.7212 0.5779 -0.0049 0.0321  0.2067  19   LYS A NZ  
201  N  N   . ASN A 23  ? 0.2864 0.4612 0.3629 -0.0197 0.0289  0.1938  20   ASN A N   
202  C  CA  . ASN A 23  ? 0.2981 0.4887 0.3847 -0.0211 0.0335  0.2076  20   ASN A CA  
203  C  C   . ASN A 23  ? 0.2871 0.4875 0.3752 -0.0188 0.0376  0.2050  20   ASN A C   
204  O  O   . ASN A 23  ? 0.3011 0.5178 0.3883 -0.0149 0.0441  0.2122  20   ASN A O   
205  C  CB  . ASN A 23  ? 0.3026 0.4880 0.4071 -0.0299 0.0287  0.2165  20   ASN A CB  
206  C  CG  . ASN A 23  ? 0.3480 0.5278 0.4529 -0.0319 0.0259  0.2229  20   ASN A CG  
207  O  OD1 . ASN A 23  ? 0.4366 0.6174 0.5283 -0.0266 0.0278  0.2216  20   ASN A OD1 
208  N  ND2 . ASN A 23  ? 0.4178 0.5912 0.5383 -0.0394 0.0208  0.2300  20   ASN A ND2 
209  N  N   . GLU A 24  ? 0.2555 0.4464 0.3458 -0.0208 0.0339  0.1949  21   GLU A N   
210  C  CA  . GLU A 24  ? 0.2557 0.4550 0.3475 -0.0186 0.0373  0.1921  21   GLU A CA  
211  C  C   . GLU A 24  ? 0.2610 0.4689 0.3377 -0.0095 0.0431  0.1867  21   GLU A C   
212  O  O   . GLU A 24  ? 0.2897 0.5124 0.3678 -0.0060 0.0488  0.1915  21   GLU A O   
213  C  CB  . GLU A 24  ? 0.2528 0.4400 0.3487 -0.0221 0.0322  0.1821  21   GLU A CB  
214  C  CG  . GLU A 24  ? 0.2733 0.4536 0.3857 -0.0308 0.0264  0.1869  21   GLU A CG  
215  C  CD  . GLU A 24  ? 0.3206 0.5150 0.4484 -0.0342 0.0290  0.1996  21   GLU A CD  
216  O  OE1 . GLU A 24  ? 0.3118 0.5198 0.4394 -0.0304 0.0346  0.2015  21   GLU A OE1 
217  O  OE2 . GLU A 24  ? 0.3499 0.5416 0.4904 -0.0407 0.0254  0.2081  21   GLU A OE2 
218  N  N   . PHE A 25  ? 0.2675 0.4666 0.3298 -0.0053 0.0416  0.1771  22   PHE A N   
219  C  CA  . PHE A 25  ? 0.2646 0.4706 0.3120 0.0036  0.0462  0.1711  22   PHE A CA  
220  C  C   . PHE A 25  ? 0.3112 0.5323 0.3535 0.0084  0.0521  0.1811  22   PHE A C   
221  O  O   . PHE A 25  ? 0.3381 0.5708 0.3731 0.0152  0.0575  0.1802  22   PHE A O   
222  C  CB  . PHE A 25  ? 0.2646 0.4567 0.2991 0.0063  0.0423  0.1585  22   PHE A CB  
223  C  CG  . PHE A 25  ? 0.2351 0.4171 0.2698 0.0053  0.0391  0.1470  22   PHE A CG  
224  C  CD1 . PHE A 25  ? 0.2577 0.4437 0.2850 0.0112  0.0418  0.1396  22   PHE A CD1 
225  C  CD2 . PHE A 25  ? 0.2380 0.4067 0.2803 -0.0013 0.0333  0.1438  22   PHE A CD2 
226  C  CE1 . PHE A 25  ? 0.2396 0.4162 0.2672 0.0103  0.0388  0.1295  22   PHE A CE1 
227  C  CE2 . PHE A 25  ? 0.2260 0.3863 0.2682 -0.0020 0.0306  0.1339  22   PHE A CE2 
228  C  CZ  . PHE A 25  ? 0.2232 0.3874 0.2580 0.0037  0.0333  0.1270  22   PHE A CZ  
229  N  N   . ASP A 26  ? 0.3219 0.5429 0.3687 0.0047  0.0509  0.1908  23   ASP A N   
230  C  CA  A ASP A 26  ? 0.3394 0.5747 0.3823 0.0085  0.0563  0.2018  23   ASP A CA  
231  C  CA  B ASP A 26  ? 0.3317 0.5671 0.3742 0.0087  0.0563  0.2016  23   ASP A CA  
232  C  C   . ASP A 26  ? 0.3409 0.5938 0.3938 0.0085  0.0623  0.2126  23   ASP A C   
233  O  O   . ASP A 26  ? 0.3712 0.6396 0.4167 0.0154  0.0690  0.2173  23   ASP A O   
234  C  CB  A ASP A 26  ? 0.3445 0.5746 0.3923 0.0035  0.0529  0.2106  23   ASP A CB  
235  C  CB  B ASP A 26  ? 0.3307 0.5607 0.3768 0.0042  0.0531  0.2099  23   ASP A CB  
236  C  CG  A ASP A 26  ? 0.3884 0.6065 0.4230 0.0061  0.0490  0.2024  23   ASP A CG  
237  C  CG  B ASP A 26  ? 0.3404 0.5855 0.3813 0.0085  0.0586  0.2218  23   ASP A CG  
238  O  OD1 A ASP A 26  ? 0.5068 0.7211 0.5283 0.0118  0.0489  0.1902  23   ASP A OD1 
239  O  OD1 B ASP A 26  ? 0.3288 0.5789 0.3534 0.0166  0.0616  0.2174  23   ASP A OD1 
240  O  OD2 A ASP A 26  ? 0.4506 0.6628 0.4885 0.0023  0.0457  0.2081  23   ASP A OD2 
241  O  OD2 B ASP A 26  ? 0.3221 0.5737 0.3752 0.0037  0.0596  0.2357  23   ASP A OD2 
242  N  N   . LYS A 27  ? 0.3228 0.5738 0.3927 0.0011  0.0599  0.2167  24   LYS A N   
243  C  CA  A LYS A 27  ? 0.3243 0.5922 0.4071 -0.0003 0.0650  0.2293  24   LYS A CA  
244  C  CA  B LYS A 27  ? 0.3201 0.5874 0.4040 -0.0009 0.0646  0.2293  24   LYS A CA  
245  C  C   . LYS A 27  ? 0.3112 0.5867 0.3962 0.0027  0.0682  0.2244  24   LYS A C   
246  O  O   . LYS A 27  ? 0.3252 0.6179 0.4173 0.0043  0.0741  0.2338  24   LYS A O   
247  C  CB  A LYS A 27  ? 0.3274 0.5915 0.4297 -0.0105 0.0607  0.2398  24   LYS A CB  
248  C  CB  B LYS A 27  ? 0.3169 0.5773 0.4204 -0.0115 0.0591  0.2366  24   LYS A CB  
249  C  CG  A LYS A 27  ? 0.3570 0.6083 0.4706 -0.0174 0.0541  0.2334  24   LYS A CG  
250  C  CG  B LYS A 27  ? 0.3495 0.6080 0.4589 -0.0161 0.0570  0.2478  24   LYS A CG  
251  C  CD  A LYS A 27  ? 0.3723 0.6161 0.5019 -0.0268 0.0483  0.2422  24   LYS A CD  
252  C  CD  B LYS A 27  ? 0.4076 0.6679 0.5005 -0.0097 0.0596  0.2474  24   LYS A CD  
253  C  CE  A LYS A 27  ? 0.3464 0.5785 0.4877 -0.0335 0.0417  0.2364  24   LYS A CE  
254  C  CE  B LYS A 27  ? 0.4137 0.6816 0.5133 -0.0124 0.0611  0.2636  24   LYS A CE  
255  N  NZ  A LYS A 27  ? 0.3363 0.5618 0.4938 -0.0423 0.0359  0.2450  24   LYS A NZ  
256  N  NZ  B LYS A 27  ? 0.4514 0.7143 0.5360 -0.0082 0.0604  0.2613  24   LYS A NZ  
257  N  N   . ASP A 28  ? 0.3025 0.5656 0.3819 0.0035  0.0645  0.2103  25   ASP A N   
258  C  CA  . ASP A 28  ? 0.2918 0.5597 0.3749 0.0053  0.0662  0.2054  25   ASP A CA  
259  C  C   . ASP A 28  ? 0.3117 0.5791 0.3773 0.0146  0.0686  0.1930  25   ASP A C   
260  O  O   . ASP A 28  ? 0.2761 0.5288 0.3338 0.0150  0.0640  0.1807  25   ASP A O   
261  C  CB  . ASP A 28  ? 0.2865 0.5405 0.3811 -0.0027 0.0591  0.2007  25   ASP A CB  
262  C  CG  . ASP A 28  ? 0.2869 0.5444 0.3862 -0.0015 0.0600  0.1955  25   ASP A CG  
263  O  OD1 . ASP A 28  ? 0.3148 0.5862 0.4106 0.0051  0.0662  0.1964  25   ASP A OD1 
264  O  OD2 . ASP A 28  ? 0.3089 0.5553 0.4161 -0.0074 0.0541  0.1910  25   ASP A OD2 
265  N  N   . ASP A 29  ? 0.3263 0.6098 0.3859 0.0223  0.0758  0.1961  26   ASP A N   
266  C  CA  . ASP A 29  ? 0.3338 0.6171 0.3766 0.0316  0.0778  0.1845  26   ASP A CA  
267  C  C   . ASP A 29  ? 0.3242 0.6031 0.3694 0.0325  0.0764  0.1747  26   ASP A C   
268  O  O   . ASP A 29  ? 0.3519 0.6282 0.3845 0.0395  0.0770  0.1640  26   ASP A O   
269  C  CB  . ASP A 29  ? 0.3666 0.6682 0.3997 0.0409  0.0859  0.1900  26   ASP A CB  
270  C  CG  . ASP A 29  ? 0.4124 0.7328 0.4553 0.0430  0.0925  0.1985  26   ASP A CG  
271  O  OD1 . ASP A 29  ? 0.5002 0.8209 0.5580 0.0377  0.0912  0.2005  26   ASP A OD1 
272  O  OD2 . ASP A 29  ? 0.5270 0.8633 0.5623 0.0507  0.0994  0.2038  26   ASP A OD2 
273  N  N   . LYS A 30  ? 0.2911 0.5684 0.3522 0.0253  0.0739  0.1780  27   LYS A N   
274  C  CA  A LYS A 30  ? 0.2916 0.5635 0.3553 0.0255  0.0717  0.1689  27   LYS A CA  
275  C  CA  B LYS A 30  ? 0.2847 0.5566 0.3485 0.0255  0.0717  0.1689  27   LYS A CA  
276  C  C   . LYS A 30  ? 0.2682 0.5204 0.3349 0.0184  0.0636  0.1614  27   LYS A C   
277  O  O   . LYS A 30  ? 0.2604 0.5073 0.3319 0.0165  0.0609  0.1556  27   LYS A O   
278  C  CB  A LYS A 30  ? 0.2979 0.5838 0.3763 0.0243  0.0752  0.1767  27   LYS A CB  
279  C  CB  B LYS A 30  ? 0.2856 0.5716 0.3641 0.0241  0.0752  0.1770  27   LYS A CB  
280  C  CG  A LYS A 30  ? 0.3408 0.6471 0.4149 0.0334  0.0840  0.1816  27   LYS A CG  
281  C  CG  B LYS A 30  ? 0.3009 0.6076 0.3760 0.0322  0.0840  0.1841  27   LYS A CG  
282  C  CD  A LYS A 30  ? 0.3951 0.6990 0.4506 0.0436  0.0858  0.1691  27   LYS A CD  
283  C  CD  B LYS A 30  ? 0.3117 0.6330 0.3994 0.0330  0.0880  0.1896  27   LYS A CD  
284  C  CE  A LYS A 30  ? 0.4319 0.7519 0.4855 0.0525  0.0926  0.1692  27   LYS A CE  
285  C  CE  B LYS A 30  ? 0.3107 0.6512 0.3909 0.0432  0.0969  0.1934  27   LYS A CE  
286  N  NZ  A LYS A 30  ? 0.4376 0.7510 0.4752 0.0612  0.0922  0.1547  27   LYS A NZ  
287  N  NZ  B LYS A 30  ? 0.3510 0.7102 0.4471 0.0422  0.1021  0.2055  27   LYS A NZ  
288  N  N   . ARG A 31  ? 0.2580 0.4997 0.3211 0.0149  0.0598  0.1613  28   ARG A N   
289  C  CA  . ARG A 31  ? 0.2527 0.4770 0.3196 0.0081  0.0524  0.1553  28   ARG A CA  
290  C  C   . ARG A 31  ? 0.2310 0.4447 0.2899 0.0109  0.0498  0.1415  28   ARG A C   
291  O  O   . ARG A 31  ? 0.2273 0.4328 0.2933 0.0062  0.0455  0.1377  28   ARG A O   
292  C  CB  . ARG A 31  ? 0.2481 0.4628 0.3121 0.0046  0.0489  0.1568  28   ARG A CB  
293  C  CG  . ARG A 31  ? 0.2719 0.4695 0.3408 -0.0022 0.0415  0.1510  28   ARG A CG  
294  C  CD  . ARG A 31  ? 0.2755 0.4653 0.3472 -0.0072 0.0378  0.1550  28   ARG A CD  
295  N  NE  . ARG A 31  ? 0.2589 0.4326 0.3345 -0.0128 0.0309  0.1483  28   ARG A NE  
296  C  CZ  . ARG A 31  ? 0.2287 0.3978 0.3175 -0.0199 0.0267  0.1520  28   ARG A CZ  
297  N  NH1 . ARG A 31  ? 0.2440 0.4233 0.3462 -0.0236 0.0281  0.1631  28   ARG A NH1 
298  N  NH2 . ARG A 31  ? 0.2125 0.3667 0.3017 -0.0236 0.0207  0.1449  28   ARG A NH2 
299  N  N   . VAL A 32  ? 0.2331 0.4464 0.2774 0.0184  0.0518  0.1341  29   VAL A N   
300  C  CA  . VAL A 32  ? 0.2362 0.4389 0.2735 0.0209  0.0489  0.1213  29   VAL A CA  
301  C  C   . VAL A 32  ? 0.2255 0.4343 0.2687 0.0226  0.0507  0.1197  29   VAL A C   
302  O  O   . VAL A 32  ? 0.2198 0.4193 0.2666 0.0195  0.0467  0.1138  29   VAL A O   
303  C  CB  . VAL A 32  ? 0.2276 0.4270 0.2487 0.0281  0.0496  0.1133  29   VAL A CB  
304  C  CG1 . VAL A 32  ? 0.2368 0.4254 0.2519 0.0305  0.0465  0.1005  29   VAL A CG1 
305  C  CG2 . VAL A 32  ? 0.2344 0.4258 0.2508 0.0254  0.0466  0.1142  29   VAL A CG2 
306  N  N   . GLU A 33  ? 0.2387 0.4636 0.2839 0.0271  0.0566  0.1260  30   GLU A N   
307  C  CA  . GLU A 33  ? 0.2497 0.4823 0.3011 0.0295  0.0589  0.1253  30   GLU A CA  
308  C  C   . GLU A 33  ? 0.2363 0.4654 0.3029 0.0210  0.0550  0.1289  30   GLU A C   
309  O  O   . GLU A 33  ? 0.2338 0.4581 0.3032 0.0206  0.0526  0.1231  30   GLU A O   
310  C  CB  . GLU A 33  ? 0.2731 0.5255 0.3251 0.0357  0.0665  0.1330  30   GLU A CB  
311  C  CG  . GLU A 33  ? 0.3457 0.6063 0.4023 0.0398  0.0692  0.1311  30   GLU A CG  
312  C  CD  . GLU A 33  ? 0.4353 0.7161 0.4926 0.0464  0.0771  0.1388  30   GLU A CD  
313  O  OE1 . GLU A 33  ? 0.5269 0.8125 0.5712 0.0540  0.0807  0.1368  30   GLU A OE1 
314  O  OE2 . GLU A 33  ? 0.4950 0.7869 0.5660 0.0441  0.0793  0.1468  30   GLU A OE2 
315  N  N   . LYS A 34  ? 0.2317 0.4619 0.3077 0.0143  0.0537  0.1382  31   LYS A N   
316  C  CA  . LYS A 34  ? 0.2390 0.4660 0.3299 0.0062  0.0494  0.1421  31   LYS A CA  
317  C  C   . LYS A 34  ? 0.2256 0.4344 0.3142 0.0020  0.0425  0.1326  31   LYS A C   
318  O  O   . LYS A 34  ? 0.2246 0.4300 0.3209 -0.0014 0.0392  0.1306  31   LYS A O   
319  C  CB  . LYS A 34  ? 0.2616 0.4925 0.3629 -0.0001 0.0489  0.1538  31   LYS A CB  
320  C  CG  . LYS A 34  ? 0.3100 0.5607 0.4194 0.0016  0.0554  0.1665  31   LYS A CG  
321  C  CD  . LYS A 34  ? 0.3032 0.5532 0.4201 -0.0049 0.0536  0.1767  31   LYS A CD  
322  C  CE  . LYS A 34  ? 0.3946 0.6617 0.5213 -0.0055 0.0587  0.1911  31   LYS A CE  
323  N  NZ  . LYS A 34  ? 0.3704 0.6298 0.5060 -0.0139 0.0537  0.1980  31   LYS A NZ  
324  N  N   . PHE A 35  ? 0.2127 0.4105 0.2904 0.0027  0.0404  0.1269  32   PHE A N   
325  C  CA  . PHE A 35  ? 0.2087 0.3894 0.2848 -0.0019 0.0339  0.1196  32   PHE A CA  
326  C  C   . PHE A 35  ? 0.2093 0.3809 0.2721 0.0030  0.0330  0.1080  32   PHE A C   
327  O  O   . PHE A 35  ? 0.2095 0.3689 0.2662 0.0015  0.0295  0.1027  32   PHE A O   
328  C  CB  . PHE A 35  ? 0.2237 0.3984 0.3023 -0.0071 0.0310  0.1243  32   PHE A CB  
329  C  CG  . PHE A 35  ? 0.2227 0.4054 0.3161 -0.0127 0.0309  0.1361  32   PHE A CG  
330  C  CD1 . PHE A 35  ? 0.2260 0.4106 0.3318 -0.0170 0.0287  0.1385  32   PHE A CD1 
331  C  CD2 . PHE A 35  ? 0.2418 0.4295 0.3368 -0.0137 0.0328  0.1447  32   PHE A CD2 
332  C  CE1 . PHE A 35  ? 0.2185 0.4106 0.3393 -0.0225 0.0281  0.1497  32   PHE A CE1 
333  C  CE2 . PHE A 35  ? 0.2253 0.4208 0.3346 -0.0188 0.0329  0.1563  32   PHE A CE2 
334  C  CZ  . PHE A 35  ? 0.2091 0.4065 0.3316 -0.0234 0.0304  0.1588  32   PHE A CZ  
335  N  N   . SER A 36  ? 0.1948 0.3721 0.2542 0.0086  0.0360  0.1041  33   SER A N   
336  C  CA  . SER A 36  ? 0.2012 0.3699 0.2506 0.0127  0.0346  0.0933  33   SER A CA  
337  C  C   . SER A 36  ? 0.2041 0.3773 0.2573 0.0153  0.0357  0.0908  33   SER A C   
338  O  O   . SER A 36  ? 0.2072 0.3933 0.2680 0.0164  0.0392  0.0973  33   SER A O   
339  C  CB  . SER A 36  ? 0.2102 0.3802 0.2468 0.0195  0.0374  0.0897  33   SER A CB  
340  O  OG  . SER A 36  ? 0.2327 0.4173 0.2678 0.0258  0.0431  0.0933  33   SER A OG  
341  N  N   . LEU A 37  ? 0.2006 0.3638 0.2489 0.0164  0.0328  0.0819  34   LEU A N   
342  C  CA  . LEU A 37  ? 0.2058 0.3710 0.2569 0.0189  0.0330  0.0786  34   LEU A CA  
343  C  C   . LEU A 37  ? 0.2075 0.3649 0.2479 0.0241  0.0322  0.0688  34   LEU A C   
344  O  O   . LEU A 37  ? 0.2125 0.3603 0.2454 0.0237  0.0300  0.0641  34   LEU A O   
345  C  CB  . LEU A 37  ? 0.2031 0.3623 0.2630 0.0125  0.0285  0.0788  34   LEU A CB  
346  C  CG  . LEU A 37  ? 0.2224 0.3882 0.2948 0.0067  0.0279  0.0879  34   LEU A CG  
347  C  CD1 . LEU A 37  ? 0.1915 0.3474 0.2695 0.0002  0.0220  0.0861  34   LEU A CD1 
348  C  CD2 . LEU A 37  ? 0.1994 0.3804 0.2792 0.0101  0.0322  0.0931  34   LEU A CD2 
349  N  N   . LYS A 38  ? 0.2106 0.3720 0.2511 0.0290  0.0337  0.0657  35   LYS A N   
350  C  CA  . LYS A 38  ? 0.2354 0.3892 0.2678 0.0335  0.0324  0.0567  35   LYS A CA  
351  C  C   . LYS A 38  ? 0.2084 0.3583 0.2461 0.0324  0.0299  0.0538  35   LYS A C   
352  O  O   . LYS A 38  ? 0.2359 0.3944 0.2818 0.0325  0.0314  0.0580  35   LYS A O   
353  C  CB  . LYS A 38  ? 0.2554 0.4172 0.2812 0.0422  0.0365  0.0545  35   LYS A CB  
354  C  CG  . LYS A 38  ? 0.3220 0.4882 0.3408 0.0447  0.0391  0.0567  35   LYS A CG  
355  C  CD  . LYS A 38  ? 0.4427 0.6170 0.4535 0.0544  0.0430  0.0535  35   LYS A CD  
356  C  CE  . LYS A 38  ? 0.4904 0.6773 0.5075 0.0585  0.0470  0.0567  35   LYS A CE  
357  N  NZ  . LYS A 38  ? 0.5304 0.7290 0.5405 0.0676  0.0522  0.0568  35   LYS A NZ  
358  N  N   . HIS A 39  ? 0.2021 0.3399 0.2350 0.0320  0.0263  0.0467  36   HIS A N   
359  C  CA  . HIS A 39  ? 0.1925 0.3261 0.2284 0.0324  0.0241  0.0431  36   HIS A CA  
360  C  C   . HIS A 39  ? 0.1783 0.3048 0.2059 0.0378  0.0231  0.0350  36   HIS A C   
361  O  O   . HIS A 39  ? 0.1878 0.3041 0.2101 0.0360  0.0204  0.0308  36   HIS A O   
362  C  CB  . HIS A 39  ? 0.2041 0.3292 0.2443 0.0255  0.0198  0.0434  36   HIS A CB  
363  C  CG  . HIS A 39  ? 0.1982 0.3169 0.2388 0.0265  0.0172  0.0386  36   HIS A CG  
364  N  ND1 . HIS A 39  ? 0.1982 0.3233 0.2444 0.0292  0.0180  0.0398  36   HIS A ND1 
365  C  CD2 . HIS A 39  ? 0.2171 0.3243 0.2537 0.0253  0.0138  0.0334  36   HIS A CD2 
366  C  CE1 . HIS A 39  ? 0.1913 0.3083 0.2366 0.0294  0.0151  0.0353  36   HIS A CE1 
367  N  NE2 . HIS A 39  ? 0.1902 0.2967 0.2299 0.0270  0.0126  0.0316  36   HIS A NE2 
368  N  N   . GLN A 40  ? 0.1989 0.3310 0.2260 0.0444  0.0252  0.0328  37   GLN A N   
369  C  CA  . GLN A 40  ? 0.2129 0.3389 0.2326 0.0501  0.0242  0.0250  37   GLN A CA  
370  C  C   . GLN A 40  ? 0.2393 0.3620 0.2504 0.0510  0.0242  0.0227  37   GLN A C   
371  O  O   . GLN A 40  ? 0.2480 0.3797 0.2569 0.0533  0.0277  0.0263  37   GLN A O   
372  C  CB  . GLN A 40  ? 0.2162 0.3312 0.2376 0.0482  0.0200  0.0206  37   GLN A CB  
373  C  CG  . GLN A 40  ? 0.2138 0.3339 0.2435 0.0483  0.0203  0.0234  37   GLN A CG  
374  C  CD  . GLN A 40  ? 0.2141 0.3253 0.2465 0.0464  0.0164  0.0205  37   GLN A CD  
375  O  OE1 . GLN A 40  ? 0.2920 0.4071 0.3307 0.0473  0.0164  0.0223  37   GLN A OE1 
376  N  NE2 . GLN A 40  ? 0.1895 0.2898 0.2179 0.0442  0.0133  0.0166  37   GLN A NE2 
377  N  N   . ASN A 41  ? 0.2363 0.3473 0.2429 0.0496  0.0205  0.0173  38   ASN A N   
378  C  CA  . ASN A 41  ? 0.2694 0.3771 0.2681 0.0508  0.0200  0.0146  38   ASN A CA  
379  C  C   . ASN A 41  ? 0.2530 0.3562 0.2525 0.0439  0.0185  0.0178  38   ASN A C   
380  O  O   . ASN A 41  ? 0.2934 0.3905 0.2871 0.0436  0.0166  0.0147  38   ASN A O   
381  C  CB  . ASN A 41  ? 0.2739 0.3721 0.2672 0.0543  0.0166  0.0064  38   ASN A CB  
382  C  CG  . ASN A 41  ? 0.3323 0.4340 0.3235 0.0623  0.0177  0.0021  38   ASN A CG  
383  O  OD1 . ASN A 41  ? 0.4122 0.5237 0.4009 0.0674  0.0213  0.0035  38   ASN A OD1 
384  N  ND2 . ASN A 41  ? 0.4403 0.5341 0.4336 0.0631  0.0145  -0.0027 38   ASN A ND2 
385  N  N   . ILE A 42  ? 0.2095 0.3155 0.2161 0.0384  0.0189  0.0238  39   ILE A N   
386  C  CA  . ILE A 42  ? 0.1938 0.2972 0.2015 0.0323  0.0180  0.0277  39   ILE A CA  
387  C  C   . ILE A 42  ? 0.2040 0.3183 0.2140 0.0321  0.0215  0.0348  39   ILE A C   
388  O  O   . ILE A 42  ? 0.2124 0.3358 0.2282 0.0330  0.0240  0.0391  39   ILE A O   
389  C  CB  . ILE A 42  ? 0.1936 0.2915 0.2076 0.0262  0.0153  0.0291  39   ILE A CB  
390  C  CG1 . ILE A 42  ? 0.2121 0.2988 0.2235 0.0257  0.0119  0.0227  39   ILE A CG1 
391  C  CG2 . ILE A 42  ? 0.2059 0.3023 0.2221 0.0202  0.0145  0.0336  39   ILE A CG2 
392  C  CD1 . ILE A 42  ? 0.2440 0.3247 0.2600 0.0206  0.0092  0.0232  39   ILE A CD1 
393  N  N   . TYR A 43  ? 0.1807 0.2946 0.1865 0.0313  0.0217  0.0364  40   TYR A N   
394  C  CA  . TYR A 43  ? 0.1857 0.3091 0.1936 0.0305  0.0247  0.0439  40   TYR A CA  
395  C  C   . TYR A 43  ? 0.1804 0.2988 0.1933 0.0231  0.0224  0.0481  40   TYR A C   
396  O  O   . TYR A 43  ? 0.1989 0.3077 0.2082 0.0209  0.0194  0.0446  40   TYR A O   
397  C  CB  . TYR A 43  ? 0.2064 0.3339 0.2054 0.0358  0.0269  0.0432  40   TYR A CB  
398  C  CG  . TYR A 43  ? 0.2100 0.3466 0.2100 0.0351  0.0299  0.0512  40   TYR A CG  
399  C  CD1 . TYR A 43  ? 0.2051 0.3544 0.2109 0.0362  0.0340  0.0582  40   TYR A CD1 
400  C  CD2 . TYR A 43  ? 0.2002 0.3341 0.1949 0.0344  0.0291  0.0522  40   TYR A CD2 
401  C  CE1 . TYR A 43  ? 0.2355 0.3943 0.2424 0.0360  0.0372  0.0663  40   TYR A CE1 
402  C  CE2 . TYR A 43  ? 0.2268 0.3698 0.2221 0.0343  0.0321  0.0601  40   TYR A CE2 
403  C  CZ  . TYR A 43  ? 0.2177 0.3733 0.2193 0.0350  0.0363  0.0674  40   TYR A CZ  
404  O  OH  . TYR A 43  ? 0.2235 0.3883 0.2261 0.0348  0.0393  0.0759  40   TYR A OH  
405  N  N   . PHE A 44  ? 0.1759 0.3002 0.1976 0.0193  0.0232  0.0549  41   PHE A N   
406  C  CA  . PHE A 44  ? 0.1693 0.2891 0.1967 0.0124  0.0205  0.0589  41   PHE A CA  
407  C  C   . PHE A 44  ? 0.1791 0.3069 0.2091 0.0113  0.0229  0.0669  41   PHE A C   
408  O  O   . PHE A 44  ? 0.1979 0.3361 0.2344 0.0113  0.0256  0.0732  41   PHE A O   
409  C  CB  . PHE A 44  ? 0.1752 0.2948 0.2114 0.0085  0.0187  0.0603  41   PHE A CB  
410  C  CG  . PHE A 44  ? 0.1792 0.2941 0.2219 0.0016  0.0154  0.0639  41   PHE A CG  
411  C  CD1 . PHE A 44  ? 0.1955 0.2985 0.2353 -0.0013 0.0116  0.0593  41   PHE A CD1 
412  C  CD2 . PHE A 44  ? 0.1986 0.3207 0.2507 -0.0017 0.0158  0.0715  41   PHE A CD2 
413  C  CE1 . PHE A 44  ? 0.2093 0.3076 0.2546 -0.0070 0.0083  0.0618  41   PHE A CE1 
414  C  CE2 . PHE A 44  ? 0.2074 0.3242 0.2659 -0.0080 0.0120  0.0743  41   PHE A CE2 
415  C  CZ  . PHE A 44  ? 0.2163 0.3208 0.2706 -0.0104 0.0082  0.0690  41   PHE A CZ  
416  N  N   . ASP A 45  ? 0.1747 0.2981 0.2000 0.0105  0.0220  0.0670  42   ASP A N   
417  C  CA  . ASP A 45  ? 0.1786 0.3091 0.2055 0.0097  0.0241  0.0750  42   ASP A CA  
418  C  C   . ASP A 45  ? 0.1881 0.3125 0.2217 0.0028  0.0207  0.0789  42   ASP A C   
419  O  O   . ASP A 45  ? 0.1706 0.2847 0.2005 0.0010  0.0175  0.0749  42   ASP A O   
420  C  CB  . ASP A 45  ? 0.1870 0.3177 0.2031 0.0146  0.0255  0.0727  42   ASP A CB  
421  C  CG  . ASP A 45  ? 0.1919 0.3291 0.2091 0.0137  0.0274  0.0810  42   ASP A CG  
422  O  OD1 . ASP A 45  ? 0.1983 0.3402 0.2253 0.0092  0.0278  0.0890  42   ASP A OD1 
423  O  OD2 . ASP A 45  ? 0.2020 0.3390 0.2104 0.0172  0.0280  0.0797  42   ASP A OD2 
424  N  N   . TYR A 46  ? 0.1843 0.3142 0.2287 -0.0013 0.0207  0.0860  43   TYR A N   
425  C  CA  . TYR A 46  ? 0.1789 0.3030 0.2309 -0.0080 0.0169  0.0900  43   TYR A CA  
426  C  C   . TYR A 46  ? 0.1763 0.3075 0.2329 -0.0097 0.0186  0.0997  43   TYR A C   
427  O  O   . TYR A 46  ? 0.1953 0.3235 0.2604 -0.0153 0.0156  0.1046  43   TYR A O   
428  C  CB  . TYR A 46  ? 0.1767 0.2986 0.2377 -0.0123 0.0139  0.0897  43   TYR A CB  
429  C  CG  . TYR A 46  ? 0.1809 0.3150 0.2514 -0.0127 0.0163  0.0964  43   TYR A CG  
430  C  CD1 . TYR A 46  ? 0.1926 0.3300 0.2747 -0.0181 0.0147  0.1047  43   TYR A CD1 
431  C  CD2 . TYR A 46  ? 0.1908 0.3322 0.2596 -0.0080 0.0196  0.0943  43   TYR A CD2 
432  C  CE1 . TYR A 46  ? 0.2077 0.3567 0.2998 -0.0189 0.0167  0.1113  43   TYR A CE1 
433  C  CE2 . TYR A 46  ? 0.2018 0.3549 0.2803 -0.0084 0.0217  0.1007  43   TYR A CE2 
434  C  CZ  . TYR A 46  ? 0.1809 0.3379 0.2708 -0.0139 0.0204  0.1092  43   TYR A CZ  
435  O  OH  . TYR A 46  ? 0.2249 0.3937 0.3261 -0.0150 0.0221  0.1162  43   TYR A OH  
436  N  N   . SER A 47  ? 0.1810 0.3205 0.2311 -0.0046 0.0230  0.1020  44   SER A N   
437  C  CA  . SER A 47  ? 0.1794 0.3278 0.2335 -0.0054 0.0255  0.1120  44   SER A CA  
438  C  C   . SER A 47  ? 0.1894 0.3301 0.2431 -0.0087 0.0225  0.1146  44   SER A C   
439  O  O   . SER A 47  ? 0.1935 0.3402 0.2539 -0.0113 0.0234  0.1242  44   SER A O   
440  C  CB  . SER A 47  ? 0.1868 0.3473 0.2329 0.0019  0.0314  0.1137  44   SER A CB  
441  O  OG  . SER A 47  ? 0.1961 0.3513 0.2294 0.0064  0.0313  0.1071  44   SER A OG  
442  N  N   . LYS A 48  ? 0.1878 0.3162 0.2345 -0.0086 0.0190  0.1065  45   LYS A N   
443  C  CA  . LYS A 48  ? 0.1833 0.3035 0.2304 -0.0118 0.0157  0.1080  45   LYS A CA  
444  C  C   . LYS A 48  ? 0.1904 0.3012 0.2471 -0.0184 0.0105  0.1081  45   LYS A C   
445  O  O   . LYS A 48  ? 0.2046 0.3060 0.2613 -0.0210 0.0068  0.1071  45   LYS A O   
446  C  CB  . LYS A 48  ? 0.1918 0.3041 0.2273 -0.0083 0.0145  0.1000  45   LYS A CB  
447  C  CG  . LYS A 48  ? 0.1810 0.3010 0.2062 -0.0016 0.0186  0.0992  45   LYS A CG  
448  C  CD  . LYS A 48  ? 0.1991 0.3112 0.2147 0.0008  0.0165  0.0932  45   LYS A CD  
449  C  CE  . LYS A 48  ? 0.2126 0.3295 0.2165 0.0079  0.0191  0.0890  45   LYS A CE  
450  N  NZ  . LYS A 48  ? 0.1978 0.3131 0.1975 0.0112  0.0194  0.0803  45   LYS A NZ  
451  N  N   . ASN A 49  ? 0.1874 0.3008 0.2522 -0.0211 0.0099  0.1093  46   ASN A N   
452  C  CA  . ASN A 49  ? 0.1846 0.2903 0.2591 -0.0273 0.0047  0.1101  46   ASN A CA  
453  C  C   . ASN A 49  ? 0.1911 0.3020 0.2773 -0.0318 0.0041  0.1213  46   ASN A C   
454  O  O   . ASN A 49  ? 0.1923 0.3154 0.2804 -0.0302 0.0086  0.1291  46   ASN A O   
455  C  CB  . ASN A 49  ? 0.1674 0.2725 0.2453 -0.0283 0.0034  0.1057  46   ASN A CB  
456  C  CG  . ASN A 49  ? 0.1718 0.2677 0.2403 -0.0258 0.0020  0.0948  46   ASN A CG  
457  O  OD1 . ASN A 49  ? 0.2140 0.3139 0.2760 -0.0212 0.0052  0.0906  46   ASN A OD1 
458  N  ND2 . ASN A 49  ? 0.1589 0.2428 0.2266 -0.0283 -0.0025 0.0903  46   ASN A ND2 
459  N  N   . LEU A 50  ? 0.1919 0.2933 0.2855 -0.0372 -0.0015 0.1218  47   LEU A N   
460  C  CA  . LEU A 50  ? 0.2072 0.3108 0.3128 -0.0422 -0.0035 0.1320  47   LEU A CA  
461  C  C   . LEU A 50  ? 0.2099 0.3215 0.3280 -0.0457 -0.0037 0.1379  47   LEU A C   
462  O  O   . LEU A 50  ? 0.2292 0.3348 0.3574 -0.0511 -0.0092 0.1389  47   LEU A O   
463  C  CB  . LEU A 50  ? 0.2172 0.3066 0.3253 -0.0460 -0.0098 0.1297  47   LEU A CB  
464  C  CG  . LEU A 50  ? 0.2288 0.3115 0.3270 -0.0430 -0.0097 0.1264  47   LEU A CG  
465  C  CD1 . LEU A 50  ? 0.2608 0.3286 0.3610 -0.0461 -0.0162 0.1215  47   LEU A CD1 
466  C  CD2 . LEU A 50  ? 0.2498 0.3407 0.3486 -0.0421 -0.0064 0.1364  47   LEU A CD2 
467  N  N   . ILE A 51  ? 0.2178 0.3430 0.3348 -0.0422 0.0022  0.1414  48   ILE A N   
468  C  CA  . ILE A 51  ? 0.2233 0.3587 0.3516 -0.0443 0.0032  0.1471  48   ILE A CA  
469  C  C   . ILE A 51  ? 0.2365 0.3884 0.3676 -0.0420 0.0098  0.1577  48   ILE A C   
470  O  O   . ILE A 51  ? 0.2339 0.3900 0.3557 -0.0375 0.0141  0.1590  48   ILE A O   
471  C  CB  . ILE A 51  ? 0.2319 0.3679 0.3557 -0.0414 0.0040  0.1389  48   ILE A CB  
472  C  CG1 . ILE A 51  ? 0.2348 0.3769 0.3452 -0.0338 0.0102  0.1347  48   ILE A CG1 
473  C  CG2 . ILE A 51  ? 0.2313 0.3517 0.3528 -0.0439 -0.0025 0.1292  48   ILE A CG2 
474  C  CD1 . ILE A 51  ? 0.2759 0.4205 0.3827 -0.0303 0.0118  0.1281  48   ILE A CD1 
475  N  N   . ASN A 52  ? 0.2496 0.4113 0.3947 -0.0455 0.0101  0.1662  49   ASN A N   
476  C  CA  . ASN A 52  ? 0.2486 0.4282 0.3976 -0.0428 0.0169  0.1758  49   ASN A CA  
477  C  C   . ASN A 52  ? 0.2341 0.4212 0.3930 -0.0441 0.0170  0.1766  49   ASN A C   
478  O  O   . ASN A 52  ? 0.2099 0.3881 0.3703 -0.0464 0.0120  0.1692  49   ASN A O   
479  C  CB  . ASN A 52  ? 0.2561 0.4410 0.4151 -0.0468 0.0172  0.1888  49   ASN A CB  
480  C  CG  . ASN A 52  ? 0.2745 0.4535 0.4508 -0.0555 0.0101  0.1939  49   ASN A CG  
481  O  OD1 . ASN A 52  ? 0.2693 0.4422 0.4508 -0.0585 0.0054  0.1885  49   ASN A OD1 
482  N  ND2 . ASN A 52  ? 0.2438 0.4255 0.4295 -0.0595 0.0095  0.2052  49   ASN A ND2 
483  N  N   . ASP A 53  ? 0.2290 0.4334 0.3954 -0.0427 0.0225  0.1863  50   ASP A N   
484  C  CA  . ASP A 53  ? 0.2412 0.4538 0.4173 -0.0435 0.0229  0.1874  50   ASP A CA  
485  C  C   . ASP A 53  ? 0.2405 0.4450 0.4316 -0.0520 0.0146  0.1887  50   ASP A C   
486  O  O   . ASP A 53  ? 0.2219 0.4234 0.4155 -0.0529 0.0115  0.1829  50   ASP A O   
487  C  CB  . ASP A 53  ? 0.2514 0.4848 0.4367 -0.0418 0.0298  0.2000  50   ASP A CB  
488  C  CG  . ASP A 53  ? 0.3171 0.5614 0.4882 -0.0324 0.0384  0.1987  50   ASP A CG  
489  O  OD1 . ASP A 53  ? 0.3671 0.6051 0.5238 -0.0269 0.0392  0.1875  50   ASP A OD1 
490  O  OD2 . ASP A 53  ? 0.4170 0.6775 0.5926 -0.0304 0.0446  0.2096  50   ASP A OD2 
491  N  N   . TYR A 54  ? 0.2429 0.4443 0.4443 -0.0581 0.0109  0.1966  51   TYR A N   
492  C  CA  . TYR A 54  ? 0.2412 0.4356 0.4582 -0.0663 0.0026  0.1985  51   TYR A CA  
493  C  C   . TYR A 54  ? 0.2396 0.4153 0.4493 -0.0675 -0.0046 0.1853  51   TYR A C   
494  O  O   . TYR A 54  ? 0.2250 0.3971 0.4416 -0.0707 -0.0098 0.1819  51   TYR A O   
495  C  CB  . TYR A 54  ? 0.2506 0.4437 0.4784 -0.0720 0.0000  0.2088  51   TYR A CB  
496  C  CG  . TYR A 54  ? 0.2680 0.4507 0.5099 -0.0801 -0.0095 0.2097  51   TYR A CG  
497  C  CD1 . TYR A 54  ? 0.2931 0.4821 0.5508 -0.0845 -0.0126 0.2137  51   TYR A CD1 
498  C  CD2 . TYR A 54  ? 0.2900 0.4571 0.5307 -0.0835 -0.0156 0.2071  51   TYR A CD2 
499  C  CE1 . TYR A 54  ? 0.3482 0.5276 0.6199 -0.0922 -0.0221 0.2150  51   TYR A CE1 
500  C  CE2 . TYR A 54  ? 0.3636 0.5205 0.6176 -0.0909 -0.0250 0.2079  51   TYR A CE2 
501  C  CZ  . TYR A 54  ? 0.3597 0.5232 0.6298 -0.0954 -0.0282 0.2124  51   TYR A CZ  
502  O  OH  . TYR A 54  ? 0.4144 0.5676 0.6981 -0.1027 -0.0381 0.2131  51   TYR A OH  
503  N  N   . ILE A 55  ? 0.2149 0.3798 0.4098 -0.0644 -0.0045 0.1778  52   ILE A N   
504  C  CA  . ILE A 55  ? 0.2046 0.3526 0.3918 -0.0650 -0.0107 0.1656  52   ILE A CA  
505  C  C   . ILE A 55  ? 0.2159 0.3654 0.3956 -0.0608 -0.0090 0.1570  52   ILE A C   
506  O  O   . ILE A 55  ? 0.2094 0.3508 0.3910 -0.0632 -0.0146 0.1508  52   ILE A O   
507  C  CB  . ILE A 55  ? 0.2176 0.3549 0.3915 -0.0625 -0.0105 0.1603  52   ILE A CB  
508  C  CG1 . ILE A 55  ? 0.2121 0.3451 0.3946 -0.0674 -0.0140 0.1680  52   ILE A CG1 
509  C  CG2 . ILE A 55  ? 0.2099 0.3321 0.3739 -0.0615 -0.0152 0.1471  52   ILE A CG2 
510  C  CD1 . ILE A 55  ? 0.2489 0.3756 0.4192 -0.0642 -0.0121 0.1659  52   ILE A CD1 
511  N  N   . LEU A 56  ? 0.2178 0.3775 0.3890 -0.0543 -0.0015 0.1566  53   LEU A N   
512  C  CA  . LEU A 56  ? 0.2211 0.3814 0.3852 -0.0501 -0.0001 0.1483  53   LEU A CA  
513  C  C   . LEU A 56  ? 0.2255 0.3930 0.4029 -0.0531 -0.0021 0.1519  53   LEU A C   
514  O  O   . LEU A 56  ? 0.2203 0.3825 0.3964 -0.0532 -0.0056 0.1449  53   LEU A O   
515  C  CB  . LEU A 56  ? 0.2312 0.4011 0.3845 -0.0424 0.0079  0.1473  53   LEU A CB  
516  C  CG  . LEU A 56  ? 0.3013 0.4715 0.4462 -0.0372 0.0098  0.1386  53   LEU A CG  
517  C  CD1 . LEU A 56  ? 0.3374 0.4909 0.4726 -0.0375 0.0048  0.1273  53   LEU A CD1 
518  C  CD2 . LEU A 56  ? 0.3337 0.5137 0.4689 -0.0295 0.0174  0.1382  53   LEU A CD2 
519  N  N   . LYS A 57  ? 0.2337 0.4141 0.4248 -0.0557 -0.0001 0.1635  54   LYS A N   
520  C  CA  A LYS A 57  ? 0.2322 0.4206 0.4382 -0.0591 -0.0023 0.1681  54   LYS A CA  
521  C  CA  B LYS A 57  ? 0.2313 0.4194 0.4361 -0.0586 -0.0021 0.1672  54   LYS A CA  
522  C  C   . LYS A 57  ? 0.2305 0.4062 0.4435 -0.0655 -0.0120 0.1643  54   LYS A C   
523  O  O   . LYS A 57  ? 0.2306 0.4064 0.4480 -0.0664 -0.0153 0.1608  54   LYS A O   
524  C  CB  A LYS A 57  ? 0.2421 0.4461 0.4636 -0.0618 0.0009  0.1825  54   LYS A CB  
525  C  CB  B LYS A 57  ? 0.2350 0.4419 0.4532 -0.0592 0.0030  0.1806  54   LYS A CB  
526  C  CG  A LYS A 57  ? 0.2852 0.4963 0.5253 -0.0671 -0.0030 0.1885  54   LYS A CG  
527  C  CG  B LYS A 57  ? 0.2531 0.4746 0.4700 -0.0530 0.0097  0.1809  54   LYS A CG  
528  C  CD  A LYS A 57  ? 0.3337 0.5637 0.5878 -0.0681 0.0025  0.2031  54   LYS A CD  
529  C  CD  B LYS A 57  ? 0.2475 0.4622 0.4454 -0.0458 0.0122  0.1685  54   LYS A CD  
530  C  CE  A LYS A 57  ? 0.3834 0.6294 0.6323 -0.0602 0.0116  0.2038  54   LYS A CE  
531  C  CE  B LYS A 57  ? 0.2529 0.4821 0.4478 -0.0385 0.0197  0.1690  54   LYS A CE  
532  N  NZ  A LYS A 57  ? 0.3976 0.6486 0.6534 -0.0598 0.0099  0.2012  54   LYS A NZ  
533  N  NZ  B LYS A 57  ? 0.2371 0.4624 0.4133 -0.0308 0.0240  0.1602  54   LYS A NZ  
534  N  N   . SER A 58  ? 0.2335 0.3986 0.4482 -0.0699 -0.0167 0.1650  55   SER A N   
535  C  CA  A SER A 58  ? 0.2440 0.3957 0.4649 -0.0758 -0.0265 0.1610  55   SER A CA  
536  C  CA  B SER A 58  ? 0.2362 0.3885 0.4574 -0.0758 -0.0264 0.1612  55   SER A CA  
537  C  C   . SER A 58  ? 0.2450 0.3849 0.4524 -0.0729 -0.0293 0.1477  55   SER A C   
538  O  O   . SER A 58  ? 0.2174 0.3526 0.4290 -0.0754 -0.0354 0.1437  55   SER A O   
539  C  CB  A SER A 58  ? 0.2642 0.4057 0.4878 -0.0801 -0.0308 0.1636  55   SER A CB  
540  C  CB  B SER A 58  ? 0.2509 0.3943 0.4765 -0.0805 -0.0306 0.1650  55   SER A CB  
541  O  OG  A SER A 58  ? 0.3057 0.4334 0.5341 -0.0852 -0.0406 0.1585  55   SER A OG  
542  O  OG  B SER A 58  ? 0.2452 0.4014 0.4826 -0.0825 -0.0267 0.1783  55   SER A OG  
543  N  N   . LEU A 59  ? 0.2120 0.3472 0.4031 -0.0675 -0.0251 0.1411  56   LEU A N   
544  C  CA  . LEU A 59  ? 0.2047 0.3294 0.3830 -0.0644 -0.0271 0.1292  56   LEU A CA  
545  C  C   . LEU A 59  ? 0.2062 0.3388 0.3849 -0.0617 -0.0252 0.1272  56   LEU A C   
546  O  O   . LEU A 59  ? 0.2083 0.3338 0.3847 -0.0623 -0.0300 0.1202  56   LEU A O   
547  C  CB  . LEU A 59  ? 0.1831 0.3023 0.3451 -0.0592 -0.0227 0.1233  56   LEU A CB  
548  C  CG  . LEU A 59  ? 0.1965 0.3063 0.3569 -0.0615 -0.0251 0.1239  56   LEU A CG  
549  C  CD1 . LEU A 59  ? 0.2188 0.3267 0.3640 -0.0557 -0.0196 0.1195  56   LEU A CD1 
550  C  CD2 . LEU A 59  ? 0.2628 0.3580 0.4244 -0.0655 -0.0335 0.1183  56   LEU A CD2 
551  N  N   . LEU A 60  ? 0.2006 0.3473 0.3804 -0.0579 -0.0181 0.1322  57   LEU A N   
552  C  CA  . LEU A 60  ? 0.2084 0.3631 0.3897 -0.0550 -0.0163 0.1307  57   LEU A CA  
553  C  C   . LEU A 60  ? 0.2294 0.3872 0.4260 -0.0604 -0.0223 0.1345  57   LEU A C   
554  O  O   . LEU A 60  ? 0.2141 0.3707 0.4096 -0.0594 -0.0247 0.1295  57   LEU A O   
555  C  CB  . LEU A 60  ? 0.2142 0.3842 0.3947 -0.0496 -0.0076 0.1357  57   LEU A CB  
556  C  CG  . LEU A 60  ? 0.2251 0.3929 0.3891 -0.0430 -0.0019 0.1302  57   LEU A CG  
557  C  CD1 . LEU A 60  ? 0.2407 0.4237 0.4046 -0.0380 0.0064  0.1366  57   LEU A CD1 
558  C  CD2 . LEU A 60  ? 0.2026 0.3643 0.3565 -0.0390 -0.0024 0.1203  57   LEU A CD2 
559  N  N   . GLU A 61  ? 0.2315 0.3930 0.4424 -0.0661 -0.0250 0.1434  58   GLU A N   
560  C  CA  . GLU A 61  ? 0.2605 0.4229 0.4868 -0.0721 -0.0322 0.1465  58   GLU A CA  
561  C  C   . GLU A 61  ? 0.2677 0.4145 0.4890 -0.0743 -0.0406 0.1370  58   GLU A C   
562  O  O   . GLU A 61  ? 0.2586 0.4061 0.4847 -0.0755 -0.0450 0.1350  58   GLU A O   
563  C  CB  . GLU A 61  ? 0.2808 0.4471 0.5233 -0.0784 -0.0348 0.1572  58   GLU A CB  
564  C  CG  . GLU A 61  ? 0.3348 0.5193 0.5867 -0.0772 -0.0275 0.1683  58   GLU A CG  
565  C  CD  . GLU A 61  ? 0.4019 0.5905 0.6696 -0.0835 -0.0294 0.1799  58   GLU A CD  
566  O  OE1 . GLU A 61  ? 0.4283 0.6039 0.6968 -0.0880 -0.0354 0.1789  58   GLU A OE1 
567  O  OE2 . GLU A 61  ? 0.3815 0.5868 0.6606 -0.0835 -0.0244 0.1904  58   GLU A OE2 
568  N  N   . SER A 62  ? 0.2711 0.4040 0.4820 -0.0744 -0.0429 0.1310  59   SER A N   
569  C  CA  A SER A 62  ? 0.2813 0.3991 0.4850 -0.0755 -0.0503 0.1211  59   SER A CA  
570  C  CA  B SER A 62  ? 0.2764 0.3942 0.4804 -0.0755 -0.0504 0.1212  59   SER A CA  
571  C  C   . SER A 62  ? 0.2666 0.3842 0.4593 -0.0704 -0.0484 0.1134  59   SER A C   
572  O  O   . SER A 62  ? 0.2801 0.3932 0.4738 -0.0718 -0.0544 0.1089  59   SER A O   
573  C  CB  A SER A 62  ? 0.2939 0.3983 0.4874 -0.0752 -0.0514 0.1161  59   SER A CB  
574  C  CB  B SER A 62  ? 0.2845 0.3886 0.4787 -0.0756 -0.0520 0.1162  59   SER A CB  
575  O  OG  A SER A 62  ? 0.3311 0.4347 0.5357 -0.0802 -0.0542 0.1234  59   SER A OG  
576  O  OG  B SER A 62  ? 0.2957 0.4001 0.4760 -0.0698 -0.0447 0.1129  59   SER A OG  
577  N  N   . ALA A 63  ? 0.2427 0.3651 0.4254 -0.0646 -0.0405 0.1120  60   ALA A N   
578  C  CA  . ALA A 63  ? 0.2164 0.3389 0.3895 -0.0597 -0.0385 0.1053  60   ALA A CA  
579  C  C   . ALA A 63  ? 0.2228 0.3559 0.4069 -0.0605 -0.0396 0.1092  60   ALA A C   
580  O  O   . ALA A 63  ? 0.2292 0.3586 0.4106 -0.0599 -0.0434 0.1039  60   ALA A O   
581  C  CB  . ALA A 63  ? 0.2087 0.3351 0.3705 -0.0534 -0.0300 0.1037  60   ALA A CB  
582  N  N   . GLU A 64  ? 0.2037 0.3503 0.4002 -0.0616 -0.0363 0.1186  61   GLU A N   
583  C  CA  . GLU A 64  ? 0.2069 0.3653 0.4154 -0.0620 -0.0368 0.1231  61   GLU A CA  
584  C  C   . GLU A 64  ? 0.2220 0.3753 0.4402 -0.0679 -0.0465 0.1227  61   GLU A C   
585  O  O   . GLU A 64  ? 0.2269 0.3843 0.4494 -0.0675 -0.0491 0.1217  61   GLU A O   
586  C  CB  . GLU A 64  ? 0.2092 0.3840 0.4297 -0.0620 -0.0309 0.1340  61   GLU A CB  
587  C  CG  . GLU A 64  ? 0.2034 0.3860 0.4142 -0.0548 -0.0210 0.1343  61   GLU A CG  
588  C  CD  . GLU A 64  ? 0.2936 0.4813 0.4983 -0.0485 -0.0172 0.1300  61   GLU A CD  
589  O  OE1 . GLU A 64  ? 0.3041 0.4928 0.5145 -0.0496 -0.0214 0.1286  61   GLU A OE1 
590  O  OE2 . GLU A 64  ? 0.2839 0.4749 0.4787 -0.0423 -0.0102 0.1281  61   GLU A OE2 
591  N  N   . LYS A 65  ? 0.2300 0.3744 0.4522 -0.0733 -0.0523 0.1234  62   LYS A N   
592  C  CA  A LYS A 65  ? 0.2537 0.3924 0.4858 -0.0792 -0.0625 0.1229  62   LYS A CA  
593  C  CA  B LYS A 65  ? 0.2478 0.3869 0.4803 -0.0792 -0.0623 0.1231  62   LYS A CA  
594  C  C   . LYS A 65  ? 0.2577 0.3824 0.4773 -0.0780 -0.0683 0.1118  62   LYS A C   
595  O  O   . LYS A 65  ? 0.2771 0.3980 0.5023 -0.0814 -0.0766 0.1097  62   LYS A O   
596  C  CB  A LYS A 65  ? 0.2722 0.4063 0.5144 -0.0854 -0.0670 0.1280  62   LYS A CB  
597  C  CB  B LYS A 65  ? 0.2578 0.3930 0.5006 -0.0853 -0.0664 0.1286  62   LYS A CB  
598  C  CG  A LYS A 65  ? 0.3115 0.4604 0.5728 -0.0890 -0.0650 0.1406  62   LYS A CG  
599  C  CG  B LYS A 65  ? 0.2664 0.4167 0.5248 -0.0876 -0.0616 0.1416  62   LYS A CG  
600  C  CD  A LYS A 65  ? 0.3393 0.4847 0.6095 -0.0943 -0.0675 0.1469  62   LYS A CD  
601  C  CD  B LYS A 65  ? 0.2716 0.4378 0.5283 -0.0818 -0.0512 0.1458  62   LYS A CD  
602  C  CE  A LYS A 65  ? 0.3632 0.5259 0.6514 -0.0969 -0.0633 0.1606  62   LYS A CE  
603  C  CE  B LYS A 65  ? 0.2577 0.4375 0.5252 -0.0827 -0.0450 0.1577  62   LYS A CE  
604  N  NZ  A LYS A 65  ? 0.4012 0.5641 0.6931 -0.0990 -0.0606 0.1678  62   LYS A NZ  
605  N  NZ  B LYS A 65  ? 0.2218 0.4159 0.4848 -0.0758 -0.0349 0.1601  62   LYS A NZ  
606  N  N   . SER A 66  ? 0.2381 0.3557 0.4407 -0.0732 -0.0641 0.1048  63   SER A N   
607  C  CA  . SER A 66  ? 0.2347 0.3395 0.4240 -0.0715 -0.0683 0.0947  63   SER A CA  
608  C  C   . SER A 66  ? 0.2344 0.3436 0.4204 -0.0681 -0.0680 0.0917  63   SER A C   
609  O  O   . SER A 66  ? 0.2128 0.3347 0.4064 -0.0667 -0.0642 0.0971  63   SER A O   
610  C  CB  . SER A 66  ? 0.2463 0.3431 0.4196 -0.0674 -0.0633 0.0891  63   SER A CB  
611  O  OG  . SER A 66  ? 0.2127 0.3164 0.3787 -0.0618 -0.0552 0.0887  63   SER A OG  
612  N  N   . SER A 67  ? 0.2352 0.3338 0.4088 -0.0662 -0.0714 0.0831  64   SER A N   
613  C  CA  . SER A 67  ? 0.2372 0.3380 0.4053 -0.0627 -0.0712 0.0796  64   SER A CA  
614  C  C   . SER A 67  ? 0.2173 0.3208 0.3746 -0.0566 -0.0626 0.0777  64   SER A C   
615  O  O   . SER A 67  ? 0.2014 0.3052 0.3526 -0.0532 -0.0621 0.0743  64   SER A O   
616  C  CB  . SER A 67  ? 0.2485 0.3371 0.4078 -0.0632 -0.0786 0.0718  64   SER A CB  
617  O  OG  . SER A 67  ? 0.2955 0.3736 0.4413 -0.0612 -0.0769 0.0658  64   SER A OG  
618  N  N   . LEU A 68  ? 0.2008 0.3060 0.3556 -0.0551 -0.0562 0.0797  65   LEU A N   
619  C  CA  . LEU A 68  ? 0.1746 0.2799 0.3179 -0.0495 -0.0490 0.0766  65   LEU A CA  
620  C  C   . LEU A 68  ? 0.1688 0.2838 0.3138 -0.0454 -0.0452 0.0782  65   LEU A C   
621  O  O   . LEU A 68  ? 0.1870 0.2984 0.3221 -0.0415 -0.0435 0.0731  65   LEU A O   
622  C  CB  . LEU A 68  ? 0.1732 0.2801 0.3151 -0.0487 -0.0432 0.0795  65   LEU A CB  
623  C  CG  . LEU A 68  ? 0.1769 0.2831 0.3069 -0.0430 -0.0364 0.0759  65   LEU A CG  
624  C  CD1 . LEU A 68  ? 0.1693 0.2631 0.2859 -0.0413 -0.0383 0.0676  65   LEU A CD1 
625  C  CD2 . LEU A 68  ? 0.1904 0.2986 0.3199 -0.0426 -0.0316 0.0792  65   LEU A CD2 
626  N  N   . LYS A 69  ? 0.1811 0.3085 0.3391 -0.0463 -0.0437 0.0853  66   LYS A N   
627  C  CA  . LYS A 69  ? 0.1765 0.3139 0.3371 -0.0421 -0.0399 0.0870  66   LYS A CA  
628  C  C   . LYS A 69  ? 0.1694 0.3020 0.3259 -0.0412 -0.0448 0.0821  66   LYS A C   
629  O  O   . LYS A 69  ? 0.1609 0.2933 0.3099 -0.0363 -0.0417 0.0787  66   LYS A O   
630  C  CB  . LYS A 69  ? 0.1921 0.3435 0.3692 -0.0442 -0.0392 0.0957  66   LYS A CB  
631  C  CG  . LYS A 69  ? 0.2097 0.3721 0.3922 -0.0403 -0.0366 0.0979  66   LYS A CG  
632  C  CD  . LYS A 69  ? 0.2404 0.4170 0.4411 -0.0431 -0.0370 0.1069  66   LYS A CD  
633  C  CE  . LYS A 69  ? 0.2738 0.4476 0.4854 -0.0501 -0.0468 0.1086  66   LYS A CE  
634  N  NZ  . LYS A 69  ? 0.2743 0.4626 0.5057 -0.0533 -0.0481 0.1178  66   LYS A NZ  
635  N  N   . ASP A 70  ? 0.1883 0.3163 0.3492 -0.0458 -0.0527 0.0814  67   ASP A N   
636  C  CA  A ASP A 70  ? 0.1867 0.3102 0.3434 -0.0451 -0.0580 0.0771  67   ASP A CA  
637  C  CA  B ASP A 70  ? 0.1889 0.3128 0.3456 -0.0449 -0.0576 0.0772  67   ASP A CA  
638  C  C   . ASP A 70  ? 0.1798 0.2916 0.3198 -0.0422 -0.0572 0.0695  67   ASP A C   
639  O  O   . ASP A 70  ? 0.1744 0.2850 0.3079 -0.0388 -0.0570 0.0665  67   ASP A O   
640  C  CB  A ASP A 70  ? 0.1861 0.3062 0.3498 -0.0507 -0.0672 0.0773  67   ASP A CB  
641  C  CB  B ASP A 70  ? 0.1955 0.3176 0.3606 -0.0503 -0.0667 0.0780  67   ASP A CB  
642  C  CG  A ASP A 70  ? 0.2379 0.3700 0.4197 -0.0539 -0.0693 0.0850  67   ASP A CG  
643  C  CG  B ASP A 70  ? 0.2430 0.3655 0.4074 -0.0491 -0.0714 0.0759  67   ASP A CG  
644  O  OD1 A ASP A 70  ? 0.2638 0.4074 0.4518 -0.0510 -0.0643 0.0893  67   ASP A OD1 
645  O  OD1 B ASP A 70  ? 0.2954 0.4267 0.4633 -0.0456 -0.0681 0.0784  67   ASP A OD1 
646  O  OD2 A ASP A 70  ? 0.3006 0.4304 0.4906 -0.0592 -0.0760 0.0865  67   ASP A OD2 
647  O  OD2 B ASP A 70  ? 0.2920 0.4058 0.4520 -0.0513 -0.0787 0.0716  67   ASP A OD2 
648  N  N   . LYS A 71  ? 0.1747 0.2779 0.3082 -0.0437 -0.0571 0.0668  68   LYS A N   
649  C  CA  . LYS A 71  ? 0.1847 0.2771 0.3031 -0.0413 -0.0566 0.0599  68   LYS A CA  
650  C  C   . LYS A 71  ? 0.1602 0.2543 0.2712 -0.0360 -0.0494 0.0586  68   LYS A C   
651  O  O   . LYS A 71  ? 0.1702 0.2585 0.2713 -0.0333 -0.0494 0.0541  68   LYS A O   
652  C  CB  . LYS A 71  ? 0.2031 0.2864 0.3169 -0.0437 -0.0580 0.0573  68   LYS A CB  
653  C  CG  . LYS A 71  ? 0.2643 0.3419 0.3817 -0.0483 -0.0664 0.0561  68   LYS A CG  
654  C  CD  . LYS A 71  ? 0.3682 0.4396 0.4777 -0.0473 -0.0717 0.0507  68   LYS A CD  
655  C  CE  . LYS A 71  ? 0.4349 0.5011 0.5484 -0.0515 -0.0808 0.0492  68   LYS A CE  
656  N  NZ  . LYS A 71  ? 0.4908 0.5554 0.5994 -0.0501 -0.0856 0.0459  68   LYS A NZ  
657  N  N   . ILE A 72  ? 0.1617 0.2638 0.2774 -0.0342 -0.0435 0.0625  69   ILE A N   
658  C  CA  . ILE A 72  ? 0.1540 0.2581 0.2635 -0.0288 -0.0372 0.0611  69   ILE A CA  
659  C  C   . ILE A 72  ? 0.1704 0.2776 0.2805 -0.0260 -0.0381 0.0605  69   ILE A C   
660  O  O   . ILE A 72  ? 0.1666 0.2692 0.2682 -0.0227 -0.0368 0.0567  69   ILE A O   
661  C  CB  . ILE A 72  ? 0.1592 0.2723 0.2738 -0.0270 -0.0310 0.0654  69   ILE A CB  
662  C  CG1 . ILE A 72  ? 0.1596 0.2685 0.2718 -0.0293 -0.0299 0.0656  69   ILE A CG1 
663  C  CG2 . ILE A 72  ? 0.2038 0.3189 0.3125 -0.0212 -0.0255 0.0634  69   ILE A CG2 
664  C  CD1 . ILE A 72  ? 0.1862 0.3046 0.3038 -0.0281 -0.0244 0.0709  69   ILE A CD1 
665  N  N   . LYS A 73  ? 0.1652 0.2808 0.2864 -0.0274 -0.0407 0.0648  70   LYS A N   
666  C  CA  A LYS A 73  ? 0.1896 0.3088 0.3127 -0.0248 -0.0420 0.0649  70   LYS A CA  
667  C  CA  B LYS A 73  ? 0.1730 0.2924 0.2964 -0.0249 -0.0420 0.0651  70   LYS A CA  
668  C  C   . LYS A 73  ? 0.1745 0.2842 0.2889 -0.0254 -0.0471 0.0603  70   LYS A C   
669  O  O   . LYS A 73  ? 0.1854 0.2930 0.2940 -0.0218 -0.0461 0.0580  70   LYS A O   
670  C  CB  A LYS A 73  ? 0.2020 0.3321 0.3397 -0.0269 -0.0446 0.0707  70   LYS A CB  
671  C  CB  B LYS A 73  ? 0.1753 0.3054 0.3134 -0.0273 -0.0448 0.0709  70   LYS A CB  
672  C  CG  A LYS A 73  ? 0.2404 0.3822 0.3865 -0.0248 -0.0386 0.0758  70   LYS A CG  
673  C  CG  B LYS A 73  ? 0.1630 0.2978 0.3050 -0.0251 -0.0471 0.0717  70   LYS A CG  
674  C  CD  A LYS A 73  ? 0.2798 0.4339 0.4412 -0.0262 -0.0405 0.0820  70   LYS A CD  
675  C  CD  B LYS A 73  ? 0.1856 0.3323 0.3437 -0.0274 -0.0493 0.0780  70   LYS A CD  
676  C  CE  A LYS A 73  ? 0.3155 0.4821 0.4844 -0.0234 -0.0334 0.0872  70   LYS A CE  
677  C  CE  B LYS A 73  ? 0.2111 0.3612 0.3729 -0.0259 -0.0532 0.0784  70   LYS A CE  
678  N  NZ  A LYS A 73  ? 0.2901 0.4576 0.4611 -0.0266 -0.0312 0.0903  70   LYS A NZ  
679  N  NZ  B LYS A 73  ? 0.2413 0.4036 0.4197 -0.0281 -0.0556 0.0847  70   LYS A NZ  
680  N  N   . GLN A 74  ? 0.1724 0.2758 0.2855 -0.0297 -0.0525 0.0587  71   GLN A N   
681  C  CA  . GLN A 74  ? 0.1777 0.2721 0.2816 -0.0301 -0.0576 0.0541  71   GLN A CA  
682  C  C   . GLN A 74  ? 0.1857 0.2723 0.2763 -0.0268 -0.0537 0.0496  71   GLN A C   
683  O  O   . GLN A 74  ? 0.1845 0.2676 0.2683 -0.0247 -0.0550 0.0473  71   GLN A O   
684  C  CB  . GLN A 74  ? 0.1853 0.2739 0.2895 -0.0347 -0.0639 0.0525  71   GLN A CB  
685  C  CG  . GLN A 74  ? 0.2163 0.3113 0.3334 -0.0384 -0.0699 0.0564  71   GLN A CG  
686  C  CD  . GLN A 74  ? 0.2808 0.3698 0.3999 -0.0432 -0.0765 0.0550  71   GLN A CD  
687  O  OE1 . GLN A 74  ? 0.3941 0.4732 0.5030 -0.0434 -0.0781 0.0500  71   GLN A OE1 
688  N  NE2 . GLN A 74  ? 0.3544 0.4497 0.4873 -0.0471 -0.0809 0.0594  71   GLN A NE2 
689  N  N   . MET A 75  ? 0.1668 0.2509 0.2542 -0.0266 -0.0493 0.0487  72   MET A N   
690  C  CA  . MET A 75  ? 0.1776 0.2547 0.2537 -0.0237 -0.0457 0.0448  72   MET A CA  
691  C  C   . MET A 75  ? 0.1779 0.2583 0.2532 -0.0194 -0.0424 0.0452  72   MET A C   
692  O  O   . MET A 75  ? 0.1668 0.2424 0.2348 -0.0175 -0.0431 0.0429  72   MET A O   
693  C  CB  . MET A 75  ? 0.1791 0.2546 0.2534 -0.0238 -0.0412 0.0443  72   MET A CB  
694  C  CG  . MET A 75  ? 0.1632 0.2331 0.2275 -0.0203 -0.0372 0.0408  72   MET A CG  
695  S  SD  . MET A 75  ? 0.2239 0.2914 0.2849 -0.0198 -0.0322 0.0396  72   MET A SD  
696  C  CE  . MET A 75  ? 0.1958 0.2550 0.2519 -0.0231 -0.0361 0.0368  72   MET A CE  
697  N  N   . PHE A 76  ? 0.1757 0.2645 0.2586 -0.0175 -0.0389 0.0485  73   PHE A N   
698  C  CA  . PHE A 76  ? 0.1732 0.2641 0.2549 -0.0128 -0.0355 0.0483  73   PHE A CA  
699  C  C   . PHE A 76  ? 0.1909 0.2831 0.2743 -0.0118 -0.0393 0.0491  73   PHE A C   
700  O  O   . PHE A 76  ? 0.2001 0.2901 0.2795 -0.0084 -0.0378 0.0479  73   PHE A O   
701  C  CB  . PHE A 76  ? 0.1790 0.2789 0.2679 -0.0103 -0.0307 0.0511  73   PHE A CB  
702  C  CG  . PHE A 76  ? 0.1776 0.2753 0.2618 -0.0090 -0.0259 0.0495  73   PHE A CG  
703  C  CD1 . PHE A 76  ? 0.1743 0.2689 0.2527 -0.0048 -0.0225 0.0466  73   PHE A CD1 
704  C  CD2 . PHE A 76  ? 0.1875 0.2863 0.2736 -0.0119 -0.0252 0.0509  73   PHE A CD2 
705  C  CE1 . PHE A 76  ? 0.1754 0.2684 0.2497 -0.0034 -0.0185 0.0450  73   PHE A CE1 
706  C  CE2 . PHE A 76  ? 0.1893 0.2863 0.2708 -0.0105 -0.0210 0.0495  73   PHE A CE2 
707  C  CZ  . PHE A 76  ? 0.1825 0.2764 0.2577 -0.0061 -0.0177 0.0462  73   PHE A CZ  
708  N  N   . ASN A 77  ? 0.1842 0.2799 0.2738 -0.0148 -0.0442 0.0513  74   ASN A N   
709  C  CA  . ASN A 77  ? 0.1733 0.2712 0.2653 -0.0141 -0.0485 0.0525  74   ASN A CA  
710  C  C   . ASN A 77  ? 0.1623 0.2518 0.2445 -0.0149 -0.0526 0.0495  74   ASN A C   
711  O  O   . ASN A 77  ? 0.1814 0.2720 0.2642 -0.0143 -0.0565 0.0504  74   ASN A O   
712  C  CB  . ASN A 77  ? 0.1916 0.2975 0.2953 -0.0170 -0.0524 0.0563  74   ASN A CB  
713  C  CG  . ASN A 77  ? 0.2551 0.3719 0.3696 -0.0148 -0.0483 0.0604  74   ASN A CG  
714  O  OD1 . ASN A 77  ? 0.3292 0.4476 0.4421 -0.0102 -0.0434 0.0600  74   ASN A OD1 
715  N  ND2 . ASN A 77  ? 0.2943 0.4189 0.4201 -0.0179 -0.0505 0.0644  74   ASN A ND2 
716  N  N   . GLY A 78  ? 0.1763 0.2580 0.2499 -0.0163 -0.0521 0.0461  75   GLY A N   
717  C  CA  . GLY A 78  ? 0.1762 0.2503 0.2395 -0.0165 -0.0553 0.0431  75   GLY A CA  
718  C  C   . GLY A 78  ? 0.1758 0.2481 0.2386 -0.0198 -0.0621 0.0422  75   GLY A C   
719  O  O   . GLY A 78  ? 0.1959 0.2639 0.2510 -0.0193 -0.0656 0.0404  75   GLY A O   
720  N  N   . ALA A 79  ? 0.1834 0.2590 0.2546 -0.0231 -0.0643 0.0435  76   ALA A N   
721  C  CA  . ALA A 79  ? 0.1774 0.2499 0.2482 -0.0265 -0.0712 0.0419  76   ALA A CA  
722  C  C   . ALA A 79  ? 0.2013 0.2643 0.2604 -0.0267 -0.0713 0.0370  76   ALA A C   
723  O  O   . ALA A 79  ? 0.1853 0.2452 0.2400 -0.0255 -0.0659 0.0358  76   ALA A O   
724  C  CB  . ALA A 79  ? 0.2044 0.2821 0.2879 -0.0303 -0.0732 0.0448  76   ALA A CB  
725  N  N   . LYS A 80  ? 0.2241 0.2824 0.2783 -0.0281 -0.0777 0.0341  77   LYS A N   
726  C  CA  A LYS A 80  ? 0.2340 0.2837 0.2763 -0.0275 -0.0781 0.0293  77   LYS A CA  
727  C  CA  B LYS A 80  ? 0.2328 0.2825 0.2751 -0.0275 -0.0781 0.0292  77   LYS A CA  
728  C  C   . LYS A 80  ? 0.2313 0.2774 0.2767 -0.0306 -0.0789 0.0276  77   LYS A C   
729  O  O   . LYS A 80  ? 0.2573 0.2985 0.3006 -0.0325 -0.0849 0.0244  77   LYS A O   
730  C  CB  A LYS A 80  ? 0.2394 0.2858 0.2735 -0.0265 -0.0843 0.0265  77   LYS A CB  
731  C  CB  B LYS A 80  ? 0.2423 0.2886 0.2768 -0.0268 -0.0846 0.0264  77   LYS A CB  
732  C  CG  A LYS A 80  ? 0.2926 0.3416 0.3221 -0.0231 -0.0824 0.0284  77   LYS A CG  
733  C  CG  B LYS A 80  ? 0.2711 0.3202 0.3012 -0.0235 -0.0835 0.0283  77   LYS A CG  
734  C  CD  A LYS A 80  ? 0.3621 0.4083 0.3822 -0.0218 -0.0884 0.0260  77   LYS A CD  
735  C  CD  B LYS A 80  ? 0.3095 0.3562 0.3318 -0.0227 -0.0904 0.0259  77   LYS A CD  
736  C  CE  A LYS A 80  ? 0.4198 0.4677 0.4342 -0.0182 -0.0855 0.0283  77   LYS A CE  
737  C  CE  B LYS A 80  ? 0.3486 0.3962 0.3631 -0.0189 -0.0880 0.0275  77   LYS A CE  
738  N  NZ  A LYS A 80  ? 0.4324 0.4878 0.4580 -0.0182 -0.0852 0.0331  77   LYS A NZ  
739  N  NZ  B LYS A 80  ? 0.3612 0.4069 0.3667 -0.0175 -0.0942 0.0255  77   LYS A NZ  
740  N  N   . ILE A 81  ? 0.2120 0.2604 0.2619 -0.0308 -0.0730 0.0297  78   ILE A N   
741  C  CA  . ILE A 81  ? 0.2068 0.2523 0.2603 -0.0335 -0.0730 0.0291  78   ILE A CA  
742  C  C   . ILE A 81  ? 0.2285 0.2652 0.2715 -0.0327 -0.0728 0.0241  78   ILE A C   
743  O  O   . ILE A 81  ? 0.2509 0.2837 0.2963 -0.0352 -0.0749 0.0229  78   ILE A O   
744  C  CB  . ILE A 81  ? 0.2229 0.2745 0.2848 -0.0339 -0.0671 0.0335  78   ILE A CB  
745  C  CG1 . ILE A 81  ? 0.2195 0.2704 0.2748 -0.0304 -0.0600 0.0327  78   ILE A CG1 
746  C  CG2 . ILE A 81  ? 0.2057 0.2670 0.2795 -0.0348 -0.0679 0.0386  78   ILE A CG2 
747  C  CD1 . ILE A 81  ? 0.2239 0.2791 0.2851 -0.0305 -0.0544 0.0357  78   ILE A CD1 
748  N  N   . ASN A 82  ? 0.2120 0.2454 0.2438 -0.0293 -0.0704 0.0215  79   ASN A N   
749  C  CA  . ASN A 82  ? 0.2031 0.2287 0.2244 -0.0281 -0.0709 0.0165  79   ASN A CA  
750  C  C   . ASN A 82  ? 0.2370 0.2595 0.2543 -0.0285 -0.0787 0.0134  79   ASN A C   
751  O  O   . ASN A 82  ? 0.2341 0.2564 0.2436 -0.0260 -0.0795 0.0122  79   ASN A O   
752  C  CB  . ASN A 82  ? 0.2032 0.2276 0.2151 -0.0244 -0.0650 0.0156  79   ASN A CB  
753  C  CG  . ASN A 82  ? 0.2110 0.2285 0.2123 -0.0227 -0.0651 0.0108  79   ASN A CG  
754  O  OD1 . ASN A 82  ? 0.2261 0.2390 0.2254 -0.0238 -0.0702 0.0073  79   ASN A OD1 
755  N  ND2 . ASN A 82  ? 0.2064 0.2233 0.2006 -0.0198 -0.0599 0.0106  79   ASN A ND2 
756  N  N   . SER A 83  ? 0.2419 0.2618 0.2647 -0.0317 -0.0844 0.0122  80   SER A N   
757  C  CA  . SER A 83  ? 0.2666 0.2850 0.2893 -0.0328 -0.0929 0.0101  80   SER A CA  
758  C  C   . SER A 83  ? 0.2837 0.2946 0.2930 -0.0301 -0.0960 0.0037  80   SER A C   
759  O  O   . SER A 83  ? 0.3273 0.3371 0.3320 -0.0293 -0.1019 0.0014  80   SER A O   
760  C  CB  . SER A 83  ? 0.2951 0.3137 0.3305 -0.0375 -0.0984 0.0115  80   SER A CB  
761  O  OG  . SER A 83  ? 0.3240 0.3373 0.3598 -0.0386 -0.0972 0.0098  80   SER A OG  
762  N  N   . THR A 84  ? 0.2459 0.2516 0.2485 -0.0285 -0.0924 0.0006  81   THR A N   
763  C  CA  . THR A 84  ? 0.2524 0.2514 0.2422 -0.0255 -0.0950 -0.0056 81   THR A CA  
764  C  C   . THR A 84  ? 0.2655 0.2664 0.2435 -0.0210 -0.0910 -0.0059 81   THR A C   
765  O  O   . THR A 84  ? 0.3001 0.2978 0.2676 -0.0183 -0.0948 -0.0101 81   THR A O   
766  C  CB  . THR A 84  ? 0.2424 0.2353 0.2296 -0.0250 -0.0926 -0.0089 81   THR A CB  
767  O  OG1 . THR A 84  ? 0.2369 0.2325 0.2230 -0.0235 -0.0837 -0.0062 81   THR A OG1 
768  C  CG2 . THR A 84  ? 0.2548 0.2454 0.2538 -0.0295 -0.0966 -0.0081 81   THR A CG2 
769  N  N   . GLU A 85  ? 0.2569 0.2631 0.2369 -0.0202 -0.0841 -0.0012 82   GLU A N   
770  C  CA  . GLU A 85  ? 0.2587 0.2673 0.2297 -0.0165 -0.0803 -0.0001 82   GLU A CA  
771  C  C   . GLU A 85  ? 0.2599 0.2746 0.2353 -0.0169 -0.0820 0.0042  82   GLU A C   
772  O  O   . GLU A 85  ? 0.2805 0.2975 0.2497 -0.0142 -0.0795 0.0061  82   GLU A O   
773  C  CB  . GLU A 85  ? 0.2561 0.2654 0.2259 -0.0151 -0.0718 0.0017  82   GLU A CB  
774  C  CG  . GLU A 85  ? 0.2663 0.2699 0.2302 -0.0139 -0.0696 -0.0025 82   GLU A CG  
775  C  CD  . GLU A 85  ? 0.2938 0.2985 0.2577 -0.0127 -0.0618 -0.0006 82   GLU A CD  
776  O  OE1 . GLU A 85  ? 0.2810 0.2893 0.2530 -0.0143 -0.0586 0.0033  82   GLU A OE1 
777  O  OE2 . GLU A 85  ? 0.3327 0.3348 0.2885 -0.0100 -0.0587 -0.0031 82   GLU A OE2 
778  N  N   . HIS A 86  ? 0.2760 0.2934 0.2624 -0.0203 -0.0861 0.0062  83   HIS A N   
779  C  CA  . HIS A 86  ? 0.2742 0.2978 0.2670 -0.0210 -0.0882 0.0104  83   HIS A CA  
780  C  C   . HIS A 86  ? 0.2608 0.2891 0.2552 -0.0192 -0.0811 0.0150  83   HIS A C   
781  O  O   . HIS A 86  ? 0.2694 0.3002 0.2596 -0.0168 -0.0810 0.0169  83   HIS A O   
782  C  CB  . HIS A 86  ? 0.2971 0.3199 0.2820 -0.0193 -0.0947 0.0084  83   HIS A CB  
783  C  CG  . HIS A 86  ? 0.3694 0.3864 0.3510 -0.0203 -0.1020 0.0028  83   HIS A CG  
784  N  ND1 . HIS A 86  ? 0.4705 0.4874 0.4631 -0.0244 -0.1080 0.0027  83   HIS A ND1 
785  C  CD2 . HIS A 86  ? 0.4561 0.4671 0.4253 -0.0178 -0.1041 -0.0029 83   HIS A CD2 
786  C  CE1 . HIS A 86  ? 0.5036 0.5138 0.4906 -0.0244 -0.1142 -0.0031 83   HIS A CE1 
787  N  NE2 . HIS A 86  ? 0.5147 0.5211 0.4871 -0.0202 -0.1118 -0.0069 83   HIS A NE2 
788  N  N   . ARG A 87  ? 0.2344 0.2635 0.2344 -0.0201 -0.0755 0.0165  84   ARG A N   
789  C  CA  . ARG A 87  ? 0.2199 0.2525 0.2219 -0.0183 -0.0688 0.0200  84   ARG A CA  
790  C  C   . ARG A 87  ? 0.2015 0.2390 0.2160 -0.0203 -0.0665 0.0234  84   ARG A C   
791  O  O   . ARG A 87  ? 0.2016 0.2388 0.2221 -0.0230 -0.0675 0.0229  84   ARG A O   
792  C  CB  . ARG A 87  ? 0.2285 0.2569 0.2232 -0.0166 -0.0630 0.0182  84   ARG A CB  
793  C  CG  . ARG A 87  ? 0.2681 0.2931 0.2505 -0.0139 -0.0634 0.0158  84   ARG A CG  
794  C  CD  . ARG A 87  ? 0.2554 0.2772 0.2323 -0.0124 -0.0578 0.0143  84   ARG A CD  
795  N  NE  . ARG A 87  ? 0.2838 0.3035 0.2493 -0.0095 -0.0578 0.0127  84   ARG A NE  
796  C  CZ  . ARG A 87  ? 0.3287 0.3458 0.2880 -0.0078 -0.0535 0.0112  84   ARG A CZ  
797  N  NH1 . ARG A 87  ? 0.2945 0.3107 0.2581 -0.0086 -0.0490 0.0112  84   ARG A NH1 
798  N  NH2 . ARG A 87  ? 0.3894 0.4056 0.3379 -0.0049 -0.0537 0.0099  84   ARG A NH2 
799  N  N   . ALA A 88  ? 0.1928 0.2348 0.2107 -0.0185 -0.0629 0.0268  85   ALA A N   
800  C  CA  . ALA A 88  ? 0.1753 0.2220 0.2027 -0.0190 -0.0590 0.0296  85   ALA A CA  
801  C  C   . ALA A 88  ? 0.1790 0.2224 0.2035 -0.0185 -0.0535 0.0281  85   ALA A C   
802  O  O   . ALA A 88  ? 0.1893 0.2272 0.2048 -0.0174 -0.0521 0.0254  85   ALA A O   
803  C  CB  . ALA A 88  ? 0.1728 0.2246 0.2041 -0.0166 -0.0571 0.0331  85   ALA A CB  
804  N  N   . VAL A 89  ? 0.1711 0.2181 0.2031 -0.0190 -0.0502 0.0300  86   VAL A N   
805  C  CA  . VAL A 89  ? 0.1603 0.2049 0.1907 -0.0187 -0.0454 0.0288  86   VAL A CA  
806  C  C   . VAL A 89  ? 0.1647 0.2142 0.2002 -0.0165 -0.0409 0.0313  86   VAL A C   
807  O  O   . VAL A 89  ? 0.1656 0.2207 0.2091 -0.0171 -0.0400 0.0337  86   VAL A O   
808  C  CB  . VAL A 89  ? 0.1572 0.2007 0.1910 -0.0217 -0.0466 0.0282  86   VAL A CB  
809  C  CG1 . VAL A 89  ? 0.1631 0.2052 0.1960 -0.0209 -0.0413 0.0276  86   VAL A CG1 
810  C  CG2 . VAL A 89  ? 0.1888 0.2265 0.2171 -0.0233 -0.0517 0.0249  86   VAL A CG2 
811  N  N   . LEU A 90  ? 0.1596 0.2072 0.1906 -0.0138 -0.0381 0.0309  87   LEU A N   
812  C  CA  . LEU A 90  ? 0.1499 0.2014 0.1851 -0.0111 -0.0354 0.0329  87   LEU A CA  
813  C  C   . LEU A 90  ? 0.1486 0.1970 0.1807 -0.0089 -0.0308 0.0315  87   LEU A C   
814  O  O   . LEU A 90  ? 0.1636 0.2127 0.1967 -0.0062 -0.0292 0.0323  87   LEU A O   
815  C  CB  . LEU A 90  ? 0.1560 0.2091 0.1915 -0.0096 -0.0380 0.0346  87   LEU A CB  
816  C  CG  . LEU A 90  ? 0.1782 0.2370 0.2204 -0.0110 -0.0421 0.0369  87   LEU A CG  
817  C  CD1 . LEU A 90  ? 0.1962 0.2556 0.2372 -0.0093 -0.0450 0.0384  87   LEU A CD1 
818  C  CD2 . LEU A 90  ? 0.1790 0.2450 0.2309 -0.0104 -0.0402 0.0393  87   LEU A CD2 
819  N  N   . HIS A 91  ? 0.1477 0.1929 0.1768 -0.0100 -0.0289 0.0294  88   HIS A N   
820  C  CA  . HIS A 91  ? 0.1437 0.1871 0.1715 -0.0081 -0.0250 0.0282  88   HIS A CA  
821  C  C   . HIS A 91  ? 0.1459 0.1945 0.1797 -0.0058 -0.0227 0.0295  88   HIS A C   
822  O  O   . HIS A 91  ? 0.1550 0.2020 0.1880 -0.0031 -0.0204 0.0286  88   HIS A O   
823  C  CB  . HIS A 91  ? 0.1506 0.1904 0.1750 -0.0095 -0.0235 0.0261  88   HIS A CB  
824  C  CG  . HIS A 91  ? 0.1454 0.1875 0.1732 -0.0119 -0.0247 0.0267  88   HIS A CG  
825  N  ND1 . HIS A 91  ? 0.1539 0.1948 0.1812 -0.0145 -0.0285 0.0266  88   HIS A ND1 
826  C  CD2 . HIS A 91  ? 0.1526 0.1980 0.1844 -0.0121 -0.0228 0.0276  88   HIS A CD2 
827  C  CE1 . HIS A 91  ? 0.1649 0.2082 0.1968 -0.0165 -0.0290 0.0276  88   HIS A CE1 
828  N  NE2 . HIS A 91  ? 0.1749 0.2213 0.2095 -0.0151 -0.0253 0.0287  88   HIS A NE2 
829  N  N   . THR A 92  ? 0.1497 0.2043 0.1895 -0.0065 -0.0234 0.0316  89   THR A N   
830  C  CA  . THR A 92  ? 0.1550 0.2157 0.2004 -0.0037 -0.0211 0.0330  89   THR A CA  
831  C  C   . THR A 92  ? 0.1480 0.2089 0.1945 -0.0005 -0.0213 0.0333  89   THR A C   
832  O  O   . THR A 92  ? 0.1583 0.2203 0.2061 0.0030  -0.0188 0.0326  89   THR A O   
833  C  CB  . THR A 92  ? 0.1591 0.2276 0.2120 -0.0051 -0.0219 0.0361  89   THR A CB  
834  O  OG1 . THR A 92  ? 0.1543 0.2236 0.2094 -0.0074 -0.0262 0.0376  89   THR A OG1 
835  C  CG2 . THR A 92  ? 0.1704 0.2395 0.2238 -0.0075 -0.0208 0.0364  89   THR A CG2 
836  N  N   . ALA A 93  ? 0.1543 0.2139 0.1999 -0.0014 -0.0245 0.0343  90   ALA A N   
837  C  CA  . ALA A 93  ? 0.1425 0.2023 0.1897 0.0015  -0.0251 0.0353  90   ALA A CA  
838  C  C   . ALA A 93  ? 0.1382 0.1920 0.1814 0.0036  -0.0233 0.0334  90   ALA A C   
839  O  O   . ALA A 93  ? 0.1546 0.2086 0.2003 0.0068  -0.0227 0.0337  90   ALA A O   
840  C  CB  . ALA A 93  ? 0.1517 0.2113 0.1981 -0.0001 -0.0293 0.0371  90   ALA A CB  
841  N  N   . LEU A 94  ? 0.1380 0.1864 0.1754 0.0020  -0.0223 0.0314  91   LEU A N   
842  C  CA  . LEU A 94  ? 0.1379 0.1806 0.1722 0.0034  -0.0208 0.0300  91   LEU A CA  
843  C  C   . LEU A 94  ? 0.1455 0.1889 0.1827 0.0066  -0.0184 0.0283  91   LEU A C   
844  O  O   . LEU A 94  ? 0.1654 0.2048 0.2025 0.0086  -0.0181 0.0274  91   LEU A O   
845  C  CB  . LEU A 94  ? 0.1599 0.1981 0.1885 0.0010  -0.0200 0.0282  91   LEU A CB  
846  C  CG  . LEU A 94  ? 0.1346 0.1714 0.1589 -0.0016 -0.0223 0.0291  91   LEU A CG  
847  C  CD1 . LEU A 94  ? 0.1672 0.2004 0.1866 -0.0035 -0.0211 0.0269  91   LEU A CD1 
848  C  CD2 . LEU A 94  ? 0.1575 0.1918 0.1797 -0.0007 -0.0234 0.0309  91   LEU A CD2 
849  N  N   . ARG A 95  ? 0.1387 0.1872 0.1786 0.0072  -0.0169 0.0278  92   ARG A N   
850  C  CA  . ARG A 95  ? 0.1461 0.1959 0.1877 0.0109  -0.0145 0.0258  92   ARG A CA  
851  C  C   . ARG A 95  ? 0.1583 0.2154 0.2056 0.0139  -0.0140 0.0271  92   ARG A C   
852  O  O   . ARG A 95  ? 0.1586 0.2186 0.2073 0.0173  -0.0118 0.0256  92   ARG A O   
853  C  CB  . ARG A 95  ? 0.1391 0.1887 0.1778 0.0098  -0.0125 0.0240  92   ARG A CB  
854  C  CG  . ARG A 95  ? 0.1502 0.2054 0.1904 0.0074  -0.0121 0.0259  92   ARG A CG  
855  C  CD  . ARG A 95  ? 0.1477 0.1988 0.1840 0.0031  -0.0131 0.0258  92   ARG A CD  
856  N  NE  . ARG A 95  ? 0.1311 0.1868 0.1695 0.0009  -0.0129 0.0274  92   ARG A NE  
857  C  CZ  . ARG A 95  ? 0.1454 0.1985 0.1813 -0.0022 -0.0134 0.0271  92   ARG A CZ  
858  N  NH1 . ARG A 95  ? 0.1529 0.2101 0.1917 -0.0041 -0.0133 0.0291  92   ARG A NH1 
859  N  NH2 . ARG A 95  ? 0.1587 0.2051 0.1893 -0.0034 -0.0140 0.0250  92   ARG A NH2 
860  N  N   . ASP A 96  ? 0.1411 0.2015 0.1920 0.0131  -0.0161 0.0300  93   ASP A N   
861  C  CA  . ASP A 96  ? 0.1496 0.2181 0.2070 0.0160  -0.0156 0.0317  93   ASP A CA  
862  C  C   . ASP A 96  ? 0.1609 0.2289 0.2203 0.0215  -0.0145 0.0298  93   ASP A C   
863  O  O   . ASP A 96  ? 0.1697 0.2314 0.2278 0.0228  -0.0159 0.0288  93   ASP A O   
864  C  CB  . ASP A 96  ? 0.1623 0.2337 0.2234 0.0144  -0.0187 0.0350  93   ASP A CB  
865  C  CG  . ASP A 96  ? 0.1391 0.2190 0.2079 0.0177  -0.0183 0.0370  93   ASP A CG  
866  O  OD1 . ASP A 96  ? 0.1617 0.2489 0.2341 0.0173  -0.0165 0.0384  93   ASP A OD1 
867  O  OD2 . ASP A 96  ? 0.1621 0.2416 0.2335 0.0207  -0.0195 0.0374  93   ASP A OD2 
868  N  N   . LEU A 97  ? 0.1570 0.2323 0.2200 0.0249  -0.0120 0.0297  94   LEU A N   
869  C  CA  . LEU A 97  ? 0.1686 0.2454 0.2344 0.0311  -0.0110 0.0279  94   LEU A CA  
870  C  C   . LEU A 97  ? 0.1863 0.2730 0.2595 0.0335  -0.0105 0.0308  94   LEU A C   
871  O  O   . LEU A 97  ? 0.2156 0.3043 0.2915 0.0391  -0.0096 0.0293  94   LEU A O   
872  C  CB  . LEU A 97  ? 0.1716 0.2483 0.2339 0.0345  -0.0079 0.0241  94   LEU A CB  
873  C  CG  . LEU A 97  ? 0.2073 0.2739 0.2633 0.0330  -0.0088 0.0207  94   LEU A CG  
874  C  CD1 . LEU A 97  ? 0.2177 0.2854 0.2698 0.0358  -0.0060 0.0173  94   LEU A CD1 
875  C  CD2 . LEU A 97  ? 0.2232 0.2820 0.2797 0.0353  -0.0112 0.0188  94   LEU A CD2 
876  N  N   . SER A 98  ? 0.1756 0.2683 0.2524 0.0297  -0.0113 0.0348  95   SER A N   
877  C  CA  . SER A 98  ? 0.1772 0.2805 0.2625 0.0316  -0.0110 0.0383  95   SER A CA  
878  C  C   . SER A 98  ? 0.1883 0.2906 0.2776 0.0333  -0.0142 0.0395  95   SER A C   
879  O  O   . SER A 98  ? 0.1953 0.3051 0.2915 0.0374  -0.0135 0.0410  95   SER A O   
880  C  CB  . SER A 98  ? 0.1701 0.2796 0.2590 0.0266  -0.0117 0.0423  95   SER A CB  
881  O  OG  . SER A 98  ? 0.1734 0.2787 0.2618 0.0218  -0.0161 0.0439  95   SER A OG  
882  N  N   . SER A 99  ? 0.1769 0.2710 0.2624 0.0301  -0.0176 0.0394  96   SER A N   
883  C  CA  A SER A 99  ? 0.2027 0.2949 0.2909 0.0309  -0.0210 0.0412  96   SER A CA  
884  C  CA  B SER A 99  ? 0.1910 0.2833 0.2793 0.0309  -0.0211 0.0412  96   SER A CA  
885  C  C   . SER A 99  ? 0.1885 0.2896 0.2842 0.0295  -0.0232 0.0456  96   SER A C   
886  O  O   . SER A 99  ? 0.1910 0.2931 0.2908 0.0314  -0.0258 0.0474  96   SER A O   
887  C  CB  A SER A 99  ? 0.2178 0.3078 0.3081 0.0371  -0.0205 0.0392  96   SER A CB  
888  C  CB  B SER A 99  ? 0.1995 0.2896 0.2899 0.0372  -0.0205 0.0392  96   SER A CB  
889  O  OG  A SER A 99  ? 0.2887 0.3691 0.3726 0.0378  -0.0198 0.0354  96   SER A OG  
890  O  OG  B SER A 99  ? 0.2219 0.3059 0.3122 0.0373  -0.0241 0.0404  96   SER A OG  
891  N  N   . THR A 100 ? 0.1679 0.2747 0.2654 0.0258  -0.0228 0.0474  97   THR A N   
892  C  CA  . THR A 100 ? 0.1656 0.2804 0.2707 0.0236  -0.0255 0.0516  97   THR A CA  
893  C  C   . THR A 100 ? 0.1600 0.2690 0.2619 0.0200  -0.0308 0.0526  97   THR A C   
894  O  O   . THR A 100 ? 0.1867 0.2865 0.2800 0.0179  -0.0317 0.0505  97   THR A O   
895  C  CB  . THR A 100 ? 0.1566 0.2784 0.2653 0.0201  -0.0243 0.0536  97   THR A CB  
896  O  OG1 . THR A 100 ? 0.1762 0.2909 0.2775 0.0153  -0.0251 0.0520  97   THR A OG1 
897  C  CG2 . THR A 100 ? 0.1801 0.3094 0.2923 0.0240  -0.0190 0.0536  97   THR A CG2 
898  N  N   . PRO A 101 ? 0.1751 0.2898 0.2836 0.0195  -0.0345 0.0560  98   PRO A N   
899  C  CA  . PRO A 101 ? 0.1727 0.2820 0.2769 0.0165  -0.0395 0.0567  98   PRO A CA  
900  C  C   . PRO A 101 ? 0.1756 0.2806 0.2735 0.0109  -0.0414 0.0557  98   PRO A C   
901  O  O   . PRO A 101 ? 0.2055 0.3150 0.3069 0.0079  -0.0412 0.0565  98   PRO A O   
902  C  CB  . PRO A 101 ? 0.1778 0.2956 0.2915 0.0168  -0.0431 0.0606  98   PRO A CB  
903  C  CG  . PRO A 101 ? 0.1942 0.3209 0.3170 0.0213  -0.0394 0.0616  98   PRO A CG  
904  C  CD  . PRO A 101 ? 0.1540 0.2802 0.2738 0.0216  -0.0342 0.0592  98   PRO A CD  
905  N  N   . LEU A 102 ? 0.1708 0.2669 0.2595 0.0095  -0.0433 0.0542  99   LEU A N   
906  C  CA  . LEU A 102 ? 0.1630 0.2547 0.2451 0.0049  -0.0452 0.0528  99   LEU A CA  
907  C  C   . LEU A 102 ? 0.1865 0.2720 0.2609 0.0040  -0.0490 0.0527  99   LEU A C   
908  O  O   . LEU A 102 ? 0.1804 0.2599 0.2489 0.0058  -0.0474 0.0519  99   LEU A O   
909  C  CB  . LEU A 102 ? 0.1629 0.2498 0.2395 0.0042  -0.0409 0.0497  99   LEU A CB  
910  C  CG  . LEU A 102 ? 0.1786 0.2607 0.2487 -0.0002 -0.0423 0.0478  99   LEU A CG  
911  C  CD1 . LEU A 102 ? 0.1983 0.2861 0.2746 -0.0037 -0.0453 0.0494  99   LEU A CD1 
912  C  CD2 . LEU A 102 ? 0.2067 0.2842 0.2718 -0.0001 -0.0378 0.0450  99   LEU A CD2 
913  N  N   . ILE A 103 ? 0.2152 0.3029 0.2905 0.0015  -0.0541 0.0540  100  ILE A N   
914  C  CA  . ILE A 103 ? 0.2324 0.3158 0.3002 0.0010  -0.0585 0.0544  100  ILE A CA  
915  C  C   . ILE A 103 ? 0.2544 0.3349 0.3167 -0.0030 -0.0614 0.0521  100  ILE A C   
916  O  O   . ILE A 103 ? 0.3061 0.3911 0.3745 -0.0056 -0.0641 0.0525  100  ILE A O   
917  C  CB  . ILE A 103 ? 0.2299 0.3184 0.3033 0.0022  -0.0631 0.0577  100  ILE A CB  
918  C  CG1 . ILE A 103 ? 0.2604 0.3518 0.3402 0.0066  -0.0606 0.0598  100  ILE A CG1 
919  C  CG2 . ILE A 103 ? 0.2701 0.3540 0.3341 0.0017  -0.0677 0.0580  100  ILE A CG2 
920  C  CD1 . ILE A 103 ? 0.3047 0.4027 0.3924 0.0080  -0.0646 0.0631  100  ILE A CD1 
921  N  N   . VAL A 104 ? 0.2747 0.3481 0.3262 -0.0034 -0.0607 0.0499  101  VAL A N   
922  C  CA  . VAL A 104 ? 0.2874 0.3572 0.3326 -0.0066 -0.0634 0.0471  101  VAL A CA  
923  C  C   . VAL A 104 ? 0.2940 0.3591 0.3282 -0.0058 -0.0660 0.0466  101  VAL A C   
924  O  O   . VAL A 104 ? 0.2926 0.3539 0.3209 -0.0037 -0.0628 0.0470  101  VAL A O   
925  C  CB  . VAL A 104 ? 0.3082 0.3745 0.3512 -0.0078 -0.0589 0.0443  101  VAL A CB  
926  C  CG1 . VAL A 104 ? 0.3448 0.4066 0.3808 -0.0107 -0.0621 0.0411  101  VAL A CG1 
927  C  CG2 . VAL A 104 ? 0.3063 0.3784 0.3600 -0.0082 -0.0563 0.0455  101  VAL A CG2 
928  N  N   . ASP A 105 ? 0.3366 0.4021 0.3684 -0.0074 -0.0721 0.0458  102  ASP A N   
929  C  CA  A ASP A 105 ? 0.3558 0.4177 0.3764 -0.0064 -0.0755 0.0452  102  ASP A CA  
930  C  CA  B ASP A 105 ? 0.3424 0.4038 0.3625 -0.0064 -0.0749 0.0450  102  ASP A CA  
931  C  C   . ASP A 105 ? 0.3332 0.3956 0.3522 -0.0032 -0.0737 0.0488  102  ASP A C   
932  O  O   . ASP A 105 ? 0.3280 0.3865 0.3379 -0.0015 -0.0716 0.0493  102  ASP A O   
933  C  CB  A ASP A 105 ? 0.3808 0.4364 0.3906 -0.0068 -0.0731 0.0415  102  ASP A CB  
934  C  CB  B ASP A 105 ? 0.3565 0.4117 0.3672 -0.0068 -0.0714 0.0415  102  ASP A CB  
935  C  CG  A ASP A 105 ? 0.4178 0.4715 0.4268 -0.0097 -0.0764 0.0375  102  ASP A CG  
936  C  CG  B ASP A 105 ? 0.3903 0.4420 0.3884 -0.0048 -0.0721 0.0413  102  ASP A CG  
937  O  OD1 A ASP A 105 ? 0.4467 0.5029 0.4600 -0.0114 -0.0826 0.0373  102  ASP A OD1 
938  O  OD1 B ASP A 105 ? 0.4247 0.4769 0.4180 -0.0046 -0.0778 0.0409  102  ASP A OD1 
939  O  OD2 A ASP A 105 ? 0.4565 0.5060 0.4613 -0.0103 -0.0729 0.0348  102  ASP A OD2 
940  O  OD2 B ASP A 105 ? 0.4234 0.4721 0.4167 -0.0035 -0.0670 0.0415  102  ASP A OD2 
941  N  N   . GLY A 106 ? 0.2625 0.3301 0.2911 -0.0022 -0.0749 0.0520  103  GLY A N   
942  C  CA  . GLY A 106 ? 0.2182 0.2865 0.2470 0.0009  -0.0743 0.0559  103  GLY A CA  
943  C  C   . GLY A 106 ? 0.2191 0.2852 0.2496 0.0030  -0.0683 0.0571  103  GLY A C   
944  O  O   . GLY A 106 ? 0.2125 0.2793 0.2453 0.0056  -0.0683 0.0605  103  GLY A O   
945  N  N   . GLN A 107 ? 0.2206 0.2840 0.2510 0.0021  -0.0635 0.0544  104  GLN A N   
946  C  CA  A GLN A 107 ? 0.2419 0.3023 0.2735 0.0040  -0.0582 0.0550  104  GLN A CA  
947  C  CA  B GLN A 107 ? 0.2306 0.2911 0.2623 0.0041  -0.0583 0.0551  104  GLN A CA  
948  C  C   . GLN A 107 ? 0.2081 0.2723 0.2503 0.0050  -0.0556 0.0547  104  GLN A C   
949  O  O   . GLN A 107 ? 0.2159 0.2832 0.2620 0.0031  -0.0557 0.0529  104  GLN A O   
950  C  CB  A GLN A 107 ? 0.2828 0.3378 0.3067 0.0028  -0.0546 0.0522  104  GLN A CB  
951  C  CB  B GLN A 107 ? 0.2510 0.3058 0.2746 0.0031  -0.0546 0.0526  104  GLN A CB  
952  C  CG  A GLN A 107 ? 0.3215 0.3730 0.3350 0.0032  -0.0555 0.0534  104  GLN A CG  
953  C  CG  B GLN A 107 ? 0.2815 0.3334 0.2940 0.0026  -0.0566 0.0528  104  GLN A CG  
954  C  CD  A GLN A 107 ? 0.3683 0.4148 0.3758 0.0029  -0.0509 0.0520  104  GLN A CD  
955  C  CD  B GLN A 107 ? 0.3227 0.3733 0.3322 0.0050  -0.0565 0.0571  104  GLN A CD  
956  O  OE1 A GLN A 107 ? 0.4006 0.4458 0.4081 0.0013  -0.0487 0.0485  104  GLN A OE1 
957  O  OE1 B GLN A 107 ? 0.3585 0.4093 0.3744 0.0068  -0.0550 0.0596  104  GLN A OE1 
958  N  NE2 A GLN A 107 ? 0.4419 0.4862 0.4446 0.0043  -0.0498 0.0549  104  GLN A NE2 
959  N  NE2 B GLN A 107 ? 0.3777 0.4268 0.3770 0.0051  -0.0580 0.0578  104  GLN A NE2 
960  N  N   . ASP A 108 ? 0.1965 0.2602 0.2430 0.0080  -0.0535 0.0564  105  ASP A N   
961  C  CA  . ASP A 108 ? 0.1974 0.2638 0.2522 0.0098  -0.0504 0.0555  105  ASP A CA  
962  C  C   . ASP A 108 ? 0.1918 0.2535 0.2427 0.0090  -0.0458 0.0523  105  ASP A C   
963  O  O   . ASP A 108 ? 0.1993 0.2555 0.2467 0.0101  -0.0438 0.0523  105  ASP A O   
964  C  CB  . ASP A 108 ? 0.2085 0.2750 0.2685 0.0137  -0.0502 0.0579  105  ASP A CB  
965  C  CG  . ASP A 108 ? 0.2390 0.3087 0.3072 0.0163  -0.0471 0.0566  105  ASP A CG  
966  O  OD1 . ASP A 108 ? 0.2072 0.2768 0.2752 0.0156  -0.0437 0.0535  105  ASP A OD1 
967  O  OD2 . ASP A 108 ? 0.2940 0.3671 0.3690 0.0195  -0.0483 0.0586  105  ASP A OD2 
968  N  N   . ILE A 109 ? 0.1740 0.2379 0.2258 0.0068  -0.0446 0.0499  106  ILE A N   
969  C  CA  . ILE A 109 ? 0.1760 0.2356 0.2235 0.0057  -0.0409 0.0468  106  ILE A CA  
970  C  C   . ILE A 109 ? 0.1851 0.2433 0.2361 0.0088  -0.0371 0.0459  106  ILE A C   
971  O  O   . ILE A 109 ? 0.1818 0.2342 0.2282 0.0088  -0.0347 0.0442  106  ILE A O   
972  C  CB  . ILE A 109 ? 0.1699 0.2326 0.2188 0.0029  -0.0408 0.0451  106  ILE A CB  
973  C  CG1 . ILE A 109 ? 0.1929 0.2561 0.2385 -0.0001 -0.0453 0.0454  106  ILE A CG1 
974  C  CG2 . ILE A 109 ? 0.1724 0.2308 0.2172 0.0021  -0.0368 0.0420  106  ILE A CG2 
975  C  CD1 . ILE A 109 ? 0.2576 0.3147 0.2932 -0.0009 -0.0462 0.0445  106  ILE A CD1 
976  N  N   . ARG A 110 ? 0.1754 0.2385 0.2342 0.0117  -0.0368 0.0467  107  ARG A N   
977  C  CA  . ARG A 110 ? 0.1876 0.2490 0.2492 0.0152  -0.0337 0.0451  107  ARG A CA  
978  C  C   . ARG A 110 ? 0.1883 0.2428 0.2472 0.0167  -0.0341 0.0459  107  ARG A C   
979  O  O   . ARG A 110 ? 0.2075 0.2567 0.2643 0.0174  -0.0319 0.0438  107  ARG A O   
980  C  CB  . ARG A 110 ? 0.2055 0.2738 0.2757 0.0189  -0.0333 0.0459  107  ARG A CB  
981  C  CG  . ARG A 110 ? 0.2060 0.2824 0.2805 0.0174  -0.0328 0.0463  107  ARG A CG  
982  C  CD  . ARG A 110 ? 0.1969 0.2723 0.2681 0.0156  -0.0298 0.0437  107  ARG A CD  
983  N  NE  . ARG A 110 ? 0.1732 0.2571 0.2499 0.0146  -0.0289 0.0448  107  ARG A NE  
984  C  CZ  . ARG A 110 ? 0.1567 0.2412 0.2315 0.0115  -0.0276 0.0440  107  ARG A CZ  
985  N  NH1 . ARG A 110 ? 0.1592 0.2364 0.2264 0.0093  -0.0270 0.0417  107  ARG A NH1 
986  N  NH2 . ARG A 110 ? 0.1644 0.2570 0.2454 0.0106  -0.0269 0.0459  107  ARG A NH2 
987  N  N   . GLN A 111 ? 0.1891 0.2436 0.2484 0.0170  -0.0373 0.0492  108  GLN A N   
988  C  CA  . GLN A 111 ? 0.2233 0.2716 0.2808 0.0182  -0.0381 0.0512  108  GLN A CA  
989  C  C   . GLN A 111 ? 0.2141 0.2569 0.2637 0.0152  -0.0369 0.0507  108  GLN A C   
990  O  O   . GLN A 111 ? 0.2257 0.2629 0.2748 0.0160  -0.0354 0.0505  108  GLN A O   
991  C  CB  . GLN A 111 ? 0.2463 0.2962 0.3050 0.0190  -0.0419 0.0556  108  GLN A CB  
992  C  CG  . GLN A 111 ? 0.3293 0.3839 0.3965 0.0225  -0.0432 0.0567  108  GLN A CG  
993  C  CD  . GLN A 111 ? 0.4134 0.4677 0.4816 0.0236  -0.0471 0.0614  108  GLN A CD  
994  O  OE1 . GLN A 111 ? 0.4856 0.5345 0.5489 0.0228  -0.0478 0.0638  108  GLN A OE1 
995  N  NE2 . GLN A 111 ? 0.4539 0.5144 0.5283 0.0255  -0.0495 0.0630  108  GLN A NE2 
996  N  N   . GLU A 112 ? 0.2012 0.2455 0.2451 0.0121  -0.0377 0.0505  109  GLU A N   
997  C  CA  A GLU A 112 ? 0.2152 0.2551 0.2513 0.0097  -0.0365 0.0502  109  GLU A CA  
998  C  CA  B GLU A 112 ? 0.2047 0.2446 0.2409 0.0098  -0.0365 0.0503  109  GLU A CA  
999  C  C   . GLU A 112 ? 0.1921 0.2287 0.2280 0.0094  -0.0329 0.0468  109  GLU A C   
1000 O  O   . GLU A 112 ? 0.1962 0.2280 0.2297 0.0091  -0.0314 0.0473  109  GLU A O   
1001 C  CB  A GLU A 112 ? 0.2413 0.2835 0.2715 0.0070  -0.0384 0.0497  109  GLU A CB  
1002 C  CB  B GLU A 112 ? 0.2188 0.2607 0.2488 0.0071  -0.0383 0.0499  109  GLU A CB  
1003 C  CG  A GLU A 112 ? 0.3023 0.3452 0.3282 0.0070  -0.0418 0.0532  109  GLU A CG  
1004 C  CG  B GLU A 112 ? 0.2319 0.2772 0.2614 0.0073  -0.0426 0.0529  109  GLU A CG  
1005 C  CD  A GLU A 112 ? 0.3613 0.3997 0.3803 0.0068  -0.0404 0.0551  109  GLU A CD  
1006 C  CD  B GLU A 112 ? 0.2781 0.3209 0.3037 0.0084  -0.0437 0.0569  109  GLU A CD  
1007 O  OE1 A GLU A 112 ? 0.3776 0.4139 0.3994 0.0085  -0.0400 0.0583  109  GLU A OE1 
1008 O  OE1 B GLU A 112 ? 0.3692 0.4082 0.3965 0.0097  -0.0416 0.0584  109  GLU A OE1 
1009 O  OE2 A GLU A 112 ? 0.4036 0.4409 0.4150 0.0051  -0.0398 0.0538  109  GLU A OE2 
1010 O  OE2 B GLU A 112 ? 0.3330 0.3777 0.3541 0.0079  -0.0470 0.0587  109  GLU A OE2 
1011 N  N   . VAL A 113 ? 0.1829 0.2224 0.2215 0.0094  -0.0316 0.0438  110  VAL A N   
1012 C  CA  . VAL A 113 ? 0.1700 0.2070 0.2080 0.0092  -0.0285 0.0404  110  VAL A CA  
1013 C  C   . VAL A 113 ? 0.1863 0.2194 0.2281 0.0120  -0.0275 0.0400  110  VAL A C   
1014 O  O   . VAL A 113 ? 0.1780 0.2062 0.2178 0.0113  -0.0259 0.0388  110  VAL A O   
1015 C  CB  . VAL A 113 ? 0.1667 0.2085 0.2071 0.0088  -0.0274 0.0381  110  VAL A CB  
1016 C  CG1 . VAL A 113 ? 0.1808 0.2205 0.2215 0.0098  -0.0243 0.0348  110  VAL A CG1 
1017 C  CG2 . VAL A 113 ? 0.1925 0.2359 0.2287 0.0054  -0.0286 0.0380  110  VAL A CG2 
1018 N  N   . THR A 114 ? 0.1851 0.2203 0.2327 0.0151  -0.0285 0.0408  111  THR A N   
1019 C  CA  . THR A 114 ? 0.1908 0.2219 0.2426 0.0183  -0.0282 0.0397  111  THR A CA  
1020 C  C   . THR A 114 ? 0.2004 0.2253 0.2513 0.0176  -0.0293 0.0425  111  THR A C   
1021 O  O   . THR A 114 ? 0.2070 0.2264 0.2587 0.0180  -0.0285 0.0410  111  THR A O   
1022 C  CB  . THR A 114 ? 0.2223 0.2573 0.2805 0.0221  -0.0292 0.0400  111  THR A CB  
1023 O  OG1 . THR A 114 ? 0.2409 0.2819 0.3003 0.0228  -0.0274 0.0375  111  THR A OG1 
1024 C  CG2 . THR A 114 ? 0.2403 0.2699 0.3029 0.0260  -0.0296 0.0385  111  THR A CG2 
1025 N  N   . LYS A 115 ? 0.2067 0.2323 0.2557 0.0164  -0.0312 0.0467  112  LYS A N   
1026 C  CA  A LYS A 115 ? 0.2134 0.2341 0.2618 0.0159  -0.0321 0.0505  112  LYS A CA  
1027 C  CA  B LYS A 115 ? 0.2112 0.2320 0.2596 0.0159  -0.0321 0.0505  112  LYS A CA  
1028 C  C   . LYS A 115 ? 0.2154 0.2329 0.2591 0.0131  -0.0299 0.0499  112  LYS A C   
1029 O  O   . LYS A 115 ? 0.2166 0.2290 0.2624 0.0130  -0.0296 0.0512  112  LYS A O   
1030 C  CB  A LYS A 115 ? 0.2205 0.2438 0.2664 0.0152  -0.0344 0.0553  112  LYS A CB  
1031 C  CB  B LYS A 115 ? 0.2163 0.2395 0.2626 0.0154  -0.0345 0.0554  112  LYS A CB  
1032 C  CG  A LYS A 115 ? 0.2557 0.2752 0.2991 0.0141  -0.0347 0.0602  112  LYS A CG  
1033 C  CG  B LYS A 115 ? 0.2269 0.2520 0.2796 0.0186  -0.0370 0.0572  112  LYS A CG  
1034 C  CD  A LYS A 115 ? 0.3377 0.3606 0.3782 0.0142  -0.0373 0.0648  112  LYS A CD  
1035 C  CD  B LYS A 115 ? 0.2497 0.2779 0.3001 0.0182  -0.0398 0.0619  112  LYS A CD  
1036 C  CE  A LYS A 115 ? 0.4130 0.4342 0.4480 0.0125  -0.0368 0.0694  112  LYS A CE  
1037 C  CE  B LYS A 115 ? 0.2522 0.2838 0.3092 0.0214  -0.0424 0.0631  112  LYS A CE  
1038 N  NZ  A LYS A 115 ? 0.4575 0.4808 0.4915 0.0136  -0.0397 0.0747  112  LYS A NZ  
1039 N  NZ  B LYS A 115 ? 0.2669 0.3023 0.3211 0.0208  -0.0456 0.0673  112  LYS A NZ  
1040 N  N   . GLU A 116 ? 0.1915 0.2117 0.2296 0.0108  -0.0286 0.0480  113  GLU A N   
1041 C  CA  A GLU A 116 ? 0.1871 0.2047 0.2208 0.0084  -0.0264 0.0474  113  GLU A CA  
1042 C  CA  B GLU A 116 ? 0.1936 0.2112 0.2272 0.0084  -0.0264 0.0473  113  GLU A CA  
1043 C  C   . GLU A 116 ? 0.1899 0.2041 0.2269 0.0089  -0.0248 0.0436  113  GLU A C   
1044 O  O   . GLU A 116 ? 0.1992 0.2094 0.2364 0.0079  -0.0238 0.0443  113  GLU A O   
1045 C  CB  A GLU A 116 ? 0.1917 0.2128 0.2188 0.0063  -0.0260 0.0463  113  GLU A CB  
1046 C  CB  B GLU A 116 ? 0.1961 0.2167 0.2227 0.0061  -0.0256 0.0461  113  GLU A CB  
1047 C  CG  A GLU A 116 ? 0.1842 0.2035 0.2065 0.0043  -0.0239 0.0456  113  GLU A CG  
1048 C  CG  B GLU A 116 ? 0.2441 0.2671 0.2659 0.0055  -0.0274 0.0497  113  GLU A CG  
1049 C  CD  A GLU A 116 ? 0.2168 0.2341 0.2369 0.0037  -0.0233 0.0498  113  GLU A CD  
1050 C  CD  B GLU A 116 ? 0.1740 0.1945 0.1950 0.0057  -0.0274 0.0547  113  GLU A CD  
1051 O  OE1 A GLU A 116 ? 0.2249 0.2424 0.2451 0.0045  -0.0247 0.0542  113  GLU A OE1 
1052 O  OE1 B GLU A 116 ? 0.2728 0.2909 0.2920 0.0045  -0.0250 0.0548  113  GLU A OE1 
1053 O  OE2 A GLU A 116 ? 0.1887 0.2046 0.2065 0.0024  -0.0210 0.0488  113  GLU A OE2 
1054 O  OE2 B GLU A 116 ? 0.2439 0.2652 0.2666 0.0070  -0.0297 0.0586  113  GLU A OE2 
1055 N  N   . LYS A 117 ? 0.1878 0.2036 0.2275 0.0107  -0.0245 0.0398  114  LYS A N   
1056 C  CA  . LYS A 117 ? 0.1937 0.2063 0.2362 0.0119  -0.0235 0.0360  114  LYS A CA  
1057 C  C   . LYS A 117 ? 0.1940 0.2011 0.2416 0.0135  -0.0250 0.0373  114  LYS A C   
1058 O  O   . LYS A 117 ? 0.1977 0.2004 0.2465 0.0129  -0.0246 0.0358  114  LYS A O   
1059 C  CB  . LYS A 117 ? 0.2025 0.2187 0.2469 0.0145  -0.0230 0.0322  114  LYS A CB  
1060 C  CG  . LYS A 117 ? 0.2291 0.2500 0.2695 0.0127  -0.0214 0.0306  114  LYS A CG  
1061 C  CD  . LYS A 117 ? 0.2852 0.3110 0.3287 0.0156  -0.0208 0.0283  114  LYS A CD  
1062 C  CE  . LYS A 117 ? 0.3296 0.3610 0.3710 0.0139  -0.0195 0.0275  114  LYS A CE  
1063 N  NZ  . LYS A 117 ? 0.2967 0.3339 0.3410 0.0165  -0.0181 0.0257  114  LYS A NZ  
1064 N  N   . GLN A 118 ? 0.2019 0.2089 0.2532 0.0155  -0.0270 0.0399  115  GLN A N   
1065 C  CA  A GLN A 118 ? 0.2003 0.2015 0.2574 0.0171  -0.0289 0.0414  115  GLN A CA  
1066 C  CA  B GLN A 118 ? 0.2067 0.2079 0.2638 0.0171  -0.0290 0.0416  115  GLN A CA  
1067 C  C   . GLN A 118 ? 0.2129 0.2106 0.2693 0.0139  -0.0287 0.0456  115  GLN A C   
1068 O  O   . GLN A 118 ? 0.2185 0.2107 0.2792 0.0138  -0.0295 0.0453  115  GLN A O   
1069 C  CB  A GLN A 118 ? 0.2171 0.2190 0.2784 0.0198  -0.0313 0.0439  115  GLN A CB  
1070 C  CB  B GLN A 118 ? 0.2199 0.2225 0.2807 0.0195  -0.0313 0.0448  115  GLN A CB  
1071 C  CG  A GLN A 118 ? 0.2465 0.2416 0.3149 0.0220  -0.0338 0.0450  115  GLN A CG  
1072 C  CG  B GLN A 118 ? 0.2587 0.2643 0.3226 0.0235  -0.0318 0.0411  115  GLN A CG  
1073 C  CD  A GLN A 118 ? 0.3339 0.3241 0.4056 0.0242  -0.0342 0.0390  115  GLN A CD  
1074 C  CD  B GLN A 118 ? 0.3045 0.3128 0.3718 0.0257  -0.0340 0.0445  115  GLN A CD  
1075 O  OE1 A GLN A 118 ? 0.3423 0.3353 0.4135 0.0271  -0.0334 0.0340  115  GLN A OE1 
1076 O  OE1 B GLN A 118 ? 0.3349 0.3436 0.4009 0.0240  -0.0352 0.0497  115  GLN A OE1 
1077 N  NE2 A GLN A 118 ? 0.3969 0.3804 0.4720 0.0228  -0.0354 0.0398  115  GLN A NE2 
1078 N  NE2 B GLN A 118 ? 0.3554 0.3659 0.4269 0.0299  -0.0344 0.0416  115  GLN A NE2 
1079 N  N   . ARG A 119 ? 0.1911 0.1922 0.2421 0.0114  -0.0277 0.0493  116  ARG A N   
1080 C  CA  . ARG A 119 ? 0.1916 0.1908 0.2413 0.0087  -0.0267 0.0535  116  ARG A CA  
1081 C  C   . ARG A 119 ? 0.1915 0.1888 0.2405 0.0069  -0.0247 0.0504  116  ARG A C   
1082 O  O   . ARG A 119 ? 0.1896 0.1832 0.2425 0.0057  -0.0247 0.0528  116  ARG A O   
1083 C  CB  . ARG A 119 ? 0.1881 0.1919 0.2308 0.0072  -0.0258 0.0574  116  ARG A CB  
1084 C  CG  . ARG A 119 ? 0.2334 0.2388 0.2768 0.0087  -0.0282 0.0616  116  ARG A CG  
1085 C  CD  . ARG A 119 ? 0.2487 0.2584 0.2842 0.0074  -0.0276 0.0646  116  ARG A CD  
1086 N  NE  . ARG A 119 ? 0.2955 0.3040 0.3294 0.0056  -0.0258 0.0692  116  ARG A NE  
1087 C  CZ  . ARG A 119 ? 0.2803 0.2917 0.3069 0.0041  -0.0236 0.0696  116  ARG A CZ  
1088 N  NH1 . ARG A 119 ? 0.2953 0.3100 0.3151 0.0038  -0.0232 0.0654  116  ARG A NH1 
1089 N  NH2 . ARG A 119 ? 0.3287 0.3397 0.3552 0.0030  -0.0218 0.0748  116  ARG A NH2 
1090 N  N   . VAL A 120 ? 0.1851 0.1851 0.2299 0.0067  -0.0231 0.0457  117  VAL A N   
1091 C  CA  . VAL A 120 ? 0.1781 0.1765 0.2222 0.0052  -0.0214 0.0426  117  VAL A CA  
1092 C  C   . VAL A 120 ? 0.1831 0.1763 0.2340 0.0066  -0.0230 0.0397  117  VAL A C   
1093 O  O   . VAL A 120 ? 0.1918 0.1816 0.2456 0.0051  -0.0229 0.0402  117  VAL A O   
1094 C  CB  . VAL A 120 ? 0.1600 0.1622 0.1985 0.0047  -0.0197 0.0385  117  VAL A CB  
1095 C  CG1 . VAL A 120 ? 0.1820 0.1824 0.2202 0.0035  -0.0183 0.0353  117  VAL A CG1 
1096 C  CG2 . VAL A 120 ? 0.1986 0.2050 0.2305 0.0031  -0.0188 0.0411  117  VAL A CG2 
1097 N  N   . LYS A 121 ? 0.1898 0.1823 0.2432 0.0098  -0.0247 0.0368  118  LYS A N   
1098 C  CA  . LYS A 121 ? 0.2005 0.1879 0.2594 0.0120  -0.0267 0.0331  118  LYS A CA  
1099 C  C   . LYS A 121 ? 0.1974 0.1791 0.2630 0.0111  -0.0289 0.0372  118  LYS A C   
1100 O  O   . LYS A 121 ? 0.2143 0.1911 0.2839 0.0106  -0.0301 0.0355  118  LYS A O   
1101 C  CB  . LYS A 121 ? 0.1916 0.1801 0.2519 0.0162  -0.0279 0.0300  118  LYS A CB  
1102 C  CG  . LYS A 121 ? 0.2156 0.1986 0.2809 0.0193  -0.0303 0.0256  118  LYS A CG  
1103 C  CD  . LYS A 121 ? 0.2739 0.2589 0.3399 0.0241  -0.0309 0.0221  118  LYS A CD  
1104 C  CE  . LYS A 121 ? 0.3633 0.3420 0.4337 0.0279  -0.0337 0.0170  118  LYS A CE  
1105 N  NZ  . LYS A 121 ? 0.4108 0.3930 0.4805 0.0332  -0.0334 0.0127  118  LYS A NZ  
1106 N  N   . GLU A 122 ? 0.1974 0.1796 0.2644 0.0107  -0.0296 0.0430  119  GLU A N   
1107 C  CA  A GLU A 122 ? 0.2097 0.1868 0.2835 0.0097  -0.0316 0.0480  119  GLU A CA  
1108 C  CA  B GLU A 122 ? 0.2097 0.1869 0.2835 0.0097  -0.0316 0.0481  119  GLU A CA  
1109 C  C   . GLU A 122 ? 0.2022 0.1791 0.2764 0.0059  -0.0299 0.0511  119  GLU A C   
1110 O  O   . GLU A 122 ? 0.2024 0.1741 0.2837 0.0048  -0.0317 0.0527  119  GLU A O   
1111 C  CB  A GLU A 122 ? 0.2255 0.2041 0.2999 0.0102  -0.0326 0.0541  119  GLU A CB  
1112 C  CB  B GLU A 122 ? 0.2219 0.2010 0.2958 0.0100  -0.0323 0.0544  119  GLU A CB  
1113 C  CG  A GLU A 122 ? 0.2683 0.2460 0.3454 0.0144  -0.0350 0.0513  119  GLU A CG  
1114 C  CG  B GLU A 122 ? 0.2654 0.2400 0.3464 0.0087  -0.0343 0.0610  119  GLU A CG  
1115 C  CD  A GLU A 122 ? 0.3692 0.3497 0.4459 0.0155  -0.0359 0.0565  119  GLU A CD  
1116 C  CD  B GLU A 122 ? 0.3412 0.3174 0.4224 0.0098  -0.0355 0.0668  119  GLU A CD  
1117 O  OE1 A GLU A 122 ? 0.4311 0.4146 0.5043 0.0130  -0.0347 0.0623  119  GLU A OE1 
1118 O  OE1 B GLU A 122 ? 0.3698 0.3454 0.4526 0.0132  -0.0375 0.0645  119  GLU A OE1 
1119 O  OE2 A GLU A 122 ? 0.3710 0.3513 0.4507 0.0191  -0.0379 0.0544  119  GLU A OE2 
1120 O  OE2 B GLU A 122 ? 0.3923 0.3706 0.4720 0.0076  -0.0343 0.0738  119  GLU A OE2 
1121 N  N   . LEU A 123 ? 0.1977 0.1801 0.2646 0.0039  -0.0266 0.0522  120  LEU A N   
1122 C  CA  . LEU A 123 ? 0.2014 0.1846 0.2683 0.0008  -0.0245 0.0549  120  LEU A CA  
1123 C  C   . LEU A 123 ? 0.1903 0.1700 0.2606 0.0003  -0.0252 0.0498  120  LEU A C   
1124 O  O   . LEU A 123 ? 0.1982 0.1748 0.2749 -0.0016 -0.0260 0.0523  120  LEU A O   
1125 C  CB  . LEU A 123 ? 0.1932 0.1829 0.2506 -0.0004 -0.0210 0.0553  120  LEU A CB  
1126 C  CG  . LEU A 123 ? 0.1991 0.1907 0.2553 -0.0030 -0.0182 0.0569  120  LEU A CG  
1127 C  CD1 . LEU A 123 ? 0.2177 0.2091 0.2787 -0.0046 -0.0178 0.0647  120  LEU A CD1 
1128 C  CD2 . LEU A 123 ? 0.2228 0.2197 0.2693 -0.0033 -0.0153 0.0551  120  LEU A CD2 
1129 N  N   . VAL A 124 ? 0.1980 0.1784 0.2646 0.0021  -0.0251 0.0430  121  VAL A N   
1130 C  CA  . VAL A 124 ? 0.1954 0.1729 0.2640 0.0020  -0.0258 0.0379  121  VAL A CA  
1131 C  C   . VAL A 124 ? 0.2078 0.1782 0.2856 0.0029  -0.0299 0.0373  121  VAL A C   
1132 O  O   . VAL A 124 ? 0.2222 0.1895 0.3049 0.0011  -0.0310 0.0371  121  VAL A O   
1133 C  CB  . VAL A 124 ? 0.1906 0.1706 0.2532 0.0041  -0.0249 0.0314  121  VAL A CB  
1134 C  CG1 . VAL A 124 ? 0.2065 0.1834 0.2709 0.0047  -0.0263 0.0259  121  VAL A CG1 
1135 C  CG2 . VAL A 124 ? 0.1978 0.1840 0.2527 0.0025  -0.0214 0.0325  121  VAL A CG2 
1136 N  N   . GLU A 125 ? 0.2142 0.1819 0.2945 0.0058  -0.0324 0.0367  122  GLU A N   
1137 C  CA  A GLU A 125 ? 0.2269 0.1869 0.3158 0.0073  -0.0369 0.0354  122  GLU A CA  
1138 C  CA  B GLU A 125 ? 0.2306 0.1906 0.3195 0.0073  -0.0369 0.0353  122  GLU A CA  
1139 C  C   . GLU A 125 ? 0.2399 0.1966 0.3370 0.0040  -0.0382 0.0422  122  GLU A C   
1140 O  O   . GLU A 125 ? 0.2445 0.1950 0.3493 0.0033  -0.0416 0.0409  122  GLU A O   
1141 C  CB  A GLU A 125 ? 0.2453 0.2037 0.3352 0.0113  -0.0389 0.0341  122  GLU A CB  
1142 C  CB  B GLU A 125 ? 0.2476 0.2057 0.3376 0.0115  -0.0391 0.0336  122  GLU A CB  
1143 C  CG  A GLU A 125 ? 0.2763 0.2381 0.3597 0.0148  -0.0377 0.0273  122  GLU A CG  
1144 C  CG  B GLU A 125 ? 0.2914 0.2409 0.3914 0.0131  -0.0442 0.0337  122  GLU A CG  
1145 C  CD  A GLU A 125 ? 0.3107 0.2716 0.3955 0.0196  -0.0396 0.0252  122  GLU A CD  
1146 C  CD  B GLU A 125 ? 0.3551 0.2986 0.4580 0.0153  -0.0476 0.0262  122  GLU A CD  
1147 O  OE1 A GLU A 125 ? 0.3686 0.3288 0.4569 0.0200  -0.0408 0.0300  122  GLU A OE1 
1148 O  OE1 B GLU A 125 ? 0.3982 0.3447 0.4945 0.0171  -0.0460 0.0201  122  GLU A OE1 
1149 O  OE2 A GLU A 125 ? 0.3213 0.2830 0.4033 0.0231  -0.0397 0.0187  122  GLU A OE2 
1150 O  OE2 B GLU A 125 ? 0.3685 0.3041 0.4802 0.0152  -0.0521 0.0265  122  GLU A OE2 
1151 N  N   . LYS A 126 ? 0.2221 0.1828 0.3177 0.0020  -0.0358 0.0496  123  LYS A N   
1152 C  CA  A LYS A 126 ? 0.2333 0.1923 0.3365 -0.0011 -0.0364 0.0576  123  LYS A CA  
1153 C  CA  B LYS A 126 ? 0.2293 0.1881 0.3326 -0.0011 -0.0365 0.0575  123  LYS A CA  
1154 C  C   . LYS A 126 ? 0.2274 0.1873 0.3330 -0.0045 -0.0351 0.0582  123  LYS A C   
1155 O  O   . LYS A 126 ? 0.2355 0.1913 0.3509 -0.0067 -0.0375 0.0614  123  LYS A O   
1156 C  CB  A LYS A 126 ? 0.2530 0.2177 0.3516 -0.0019 -0.0335 0.0651  123  LYS A CB  
1157 C  CB  B LYS A 126 ? 0.2408 0.2053 0.3401 -0.0021 -0.0336 0.0653  123  LYS A CB  
1158 C  CG  A LYS A 126 ? 0.3020 0.2664 0.4074 -0.0048 -0.0335 0.0747  123  LYS A CG  
1159 C  CG  B LYS A 126 ? 0.2645 0.2268 0.3661 0.0001  -0.0360 0.0682  123  LYS A CG  
1160 C  CD  A LYS A 126 ? 0.3586 0.3298 0.4570 -0.0051 -0.0302 0.0815  123  LYS A CD  
1161 C  CD  B LYS A 126 ? 0.2775 0.2458 0.3741 -0.0011 -0.0331 0.0760  123  LYS A CD  
1162 C  CE  A LYS A 126 ? 0.4045 0.3774 0.5083 -0.0081 -0.0289 0.0919  123  LYS A CE  
1163 C  CE  B LYS A 126 ? 0.3344 0.3051 0.4339 -0.0049 -0.0308 0.0831  123  LYS A CE  
1164 N  NZ  A LYS A 126 ? 0.4209 0.3991 0.5182 -0.0073 -0.0270 0.0985  123  LYS A NZ  
1165 N  NZ  B LYS A 126 ? 0.3797 0.3452 0.4911 -0.0065 -0.0337 0.0900  123  LYS A NZ  
1166 N  N   . VAL A 127 ? 0.1995 0.1651 0.2969 -0.0050 -0.0314 0.0554  124  VAL A N   
1167 C  CA  . VAL A 127 ? 0.2044 0.1718 0.3036 -0.0078 -0.0297 0.0557  124  VAL A CA  
1168 C  C   . VAL A 127 ? 0.2333 0.1947 0.3381 -0.0074 -0.0336 0.0493  124  VAL A C   
1169 O  O   . VAL A 127 ? 0.2350 0.1936 0.3488 -0.0099 -0.0355 0.0515  124  VAL A O   
1170 C  CB  . VAL A 127 ? 0.2027 0.1773 0.2915 -0.0081 -0.0250 0.0543  124  VAL A CB  
1171 C  CG1 . VAL A 127 ? 0.2454 0.2213 0.3362 -0.0103 -0.0238 0.0530  124  VAL A CG1 
1172 C  CG2 . VAL A 127 ? 0.2194 0.1995 0.3036 -0.0088 -0.0217 0.0611  124  VAL A CG2 
1173 N  N   . VAL A 128 ? 0.2363 0.1957 0.3366 -0.0041 -0.0351 0.0417  125  VAL A N   
1174 C  CA  . VAL A 128 ? 0.2650 0.2193 0.3686 -0.0031 -0.0387 0.0348  125  VAL A CA  
1175 C  C   . VAL A 128 ? 0.2924 0.2384 0.4074 -0.0030 -0.0443 0.0356  125  VAL A C   
1176 O  O   . VAL A 128 ? 0.3208 0.2625 0.4424 -0.0044 -0.0476 0.0334  125  VAL A O   
1177 C  CB  . VAL A 128 ? 0.2728 0.2281 0.3678 0.0010  -0.0385 0.0268  125  VAL A CB  
1178 C  CG1 . VAL A 128 ? 0.3014 0.2510 0.3991 0.0032  -0.0429 0.0192  125  VAL A CG1 
1179 C  CG2 . VAL A 128 ? 0.2544 0.2171 0.3400 0.0003  -0.0337 0.0261  125  VAL A CG2 
1180 N  N   . SER A 129 ? 0.2696 0.2129 0.3873 -0.0016 -0.0459 0.0386  126  SER A N   
1181 C  CA  . SER A 129 ? 0.2891 0.2236 0.4178 -0.0012 -0.0516 0.0393  126  SER A CA  
1182 C  C   . SER A 129 ? 0.3085 0.2419 0.4480 -0.0061 -0.0524 0.0477  126  SER A C   
1183 O  O   . SER A 129 ? 0.3431 0.2687 0.4937 -0.0068 -0.0577 0.0487  126  SER A O   
1184 C  CB  . SER A 129 ? 0.2975 0.2299 0.4262 0.0019  -0.0528 0.0406  126  SER A CB  
1185 O  OG  . SER A 129 ? 0.3026 0.2399 0.4305 -0.0002 -0.0496 0.0494  126  SER A OG  
1186 N  N   . GLY A 130 ? 0.2965 0.2375 0.4330 -0.0093 -0.0473 0.0540  127  GLY A N   
1187 C  CA  . GLY A 130 ? 0.3112 0.2530 0.4574 -0.0136 -0.0470 0.0634  127  GLY A CA  
1188 C  C   . GLY A 130 ? 0.3344 0.2766 0.4837 -0.0141 -0.0464 0.0721  127  GLY A C   
1189 O  O   . GLY A 130 ? 0.3567 0.2991 0.5155 -0.0176 -0.0466 0.0807  127  GLY A O   
1190 N  N   . ARG A 131 ? 0.3165 0.2590 0.4590 -0.0108 -0.0460 0.0709  128  ARG A N   
1191 C  CA  . ARG A 131 ? 0.3317 0.2759 0.4755 -0.0111 -0.0450 0.0795  128  ARG A CA  
1192 C  C   . ARG A 131 ? 0.3443 0.2980 0.4817 -0.0133 -0.0389 0.0868  128  ARG A C   
1193 O  O   . ARG A 131 ? 0.3780 0.3335 0.5199 -0.0152 -0.0381 0.0966  128  ARG A O   
1194 C  CB  . ARG A 131 ? 0.3530 0.2953 0.4915 -0.0068 -0.0464 0.0761  128  ARG A CB  
1195 C  CG  . ARG A 131 ? 0.4135 0.3457 0.5600 -0.0042 -0.0528 0.0707  128  ARG A CG  
1196 C  CD  . ARG A 131 ? 0.5113 0.4421 0.6547 0.0000  -0.0541 0.0696  128  ARG A CD  
1197 N  NE  . ARG A 131 ? 0.5656 0.5035 0.6964 0.0025  -0.0501 0.0649  128  ARG A NE  
1198 C  CZ  . ARG A 131 ? 0.6075 0.5452 0.7329 0.0056  -0.0504 0.0556  128  ARG A CZ  
1199 N  NH1 . ARG A 131 ? 0.6336 0.5643 0.7639 0.0072  -0.0544 0.0488  128  ARG A NH1 
1200 N  NH2 . ARG A 131 ? 0.6041 0.5489 0.7190 0.0073  -0.0466 0.0530  128  ARG A NH2 
1201 N  N   . TRP A 132 ? 0.2978 0.2577 0.4245 -0.0128 -0.0349 0.0823  129  TRP A N   
1202 C  CA  . TRP A 132 ? 0.3045 0.2733 0.4252 -0.0146 -0.0292 0.0876  129  TRP A CA  
1203 C  C   . TRP A 132 ? 0.3122 0.2821 0.4406 -0.0181 -0.0284 0.0904  129  TRP A C   
1204 O  O   . TRP A 132 ? 0.3629 0.3305 0.4929 -0.0184 -0.0297 0.0839  129  TRP A O   
1205 C  CB  . TRP A 132 ? 0.3212 0.2951 0.4284 -0.0126 -0.0259 0.0809  129  TRP A CB  
1206 C  CG  . TRP A 132 ? 0.3032 0.2857 0.4025 -0.0136 -0.0204 0.0851  129  TRP A CG  
1207 C  CD1 . TRP A 132 ? 0.2902 0.2771 0.3914 -0.0160 -0.0173 0.0885  129  TRP A CD1 
1208 C  CD2 . TRP A 132 ? 0.2825 0.2703 0.3706 -0.0118 -0.0177 0.0859  129  TRP A CD2 
1209 N  NE1 . TRP A 132 ? 0.2827 0.2772 0.3738 -0.0154 -0.0126 0.0911  129  TRP A NE1 
1210 C  CE2 . TRP A 132 ? 0.2863 0.2812 0.3692 -0.0130 -0.0131 0.0894  129  TRP A CE2 
1211 C  CE3 . TRP A 132 ? 0.3611 0.3484 0.4431 -0.0093 -0.0190 0.0837  129  TRP A CE3 
1212 C  CZ2 . TRP A 132 ? 0.3149 0.3157 0.3863 -0.0115 -0.0101 0.0903  129  TRP A CZ2 
1213 C  CZ3 . TRP A 132 ? 0.3551 0.3485 0.4266 -0.0083 -0.0162 0.0851  129  TRP A CZ3 
1214 C  CH2 . TRP A 132 ? 0.3295 0.3292 0.3954 -0.0093 -0.0120 0.0879  129  TRP A CH2 
1215 N  N   . ARG A 133 ? 0.2937 0.2676 0.4271 -0.0206 -0.0261 0.1003  130  ARG A N   
1216 C  CA  . ARG A 133 ? 0.2975 0.2742 0.4391 -0.0241 -0.0247 0.1044  130  ARG A CA  
1217 C  C   . ARG A 133 ? 0.2859 0.2732 0.4193 -0.0244 -0.0179 0.1092  130  ARG A C   
1218 O  O   . ARG A 133 ? 0.2986 0.2907 0.4230 -0.0228 -0.0148 0.1127  130  ARG A O   
1219 C  CB  . ARG A 133 ? 0.3273 0.3001 0.4843 -0.0270 -0.0278 0.1131  130  ARG A CB  
1220 C  CG  . ARG A 133 ? 0.3419 0.3029 0.5094 -0.0268 -0.0355 0.1085  130  ARG A CG  
1221 C  CD  . ARG A 133 ? 0.3951 0.3519 0.5646 -0.0268 -0.0385 0.0990  130  ARG A CD  
1222 N  NE  . ARG A 133 ? 0.4088 0.3546 0.5867 -0.0259 -0.0459 0.0937  130  ARG A NE  
1223 C  CZ  . ARG A 133 ? 0.5289 0.4687 0.7206 -0.0285 -0.0510 0.0940  130  ARG A CZ  
1224 N  NH1 . ARG A 133 ? 0.5071 0.4513 0.7067 -0.0325 -0.0493 0.0997  130  ARG A NH1 
1225 N  NH2 . ARG A 133 ? 0.5647 0.4937 0.7625 -0.0268 -0.0580 0.0884  130  ARG A NH2 
1226 N  N   . GLY A 134 ? 0.2709 0.2622 0.4076 -0.0264 -0.0156 0.1095  131  GLY A N   
1227 C  CA  . GLY A 134 ? 0.2652 0.2665 0.3970 -0.0268 -0.0093 0.1154  131  GLY A CA  
1228 C  C   . GLY A 134 ? 0.2688 0.2742 0.4073 -0.0286 -0.0075 0.1277  131  GLY A C   
1229 O  O   . GLY A 134 ? 0.2857 0.2855 0.4345 -0.0300 -0.0115 0.1324  131  GLY A O   
1230 N  N   . PHE A 135 ? 0.2631 0.2784 0.3957 -0.0282 -0.0013 0.1334  132  PHE A N   
1231 C  CA  . PHE A 135 ? 0.2697 0.2907 0.4060 -0.0292 0.0015  0.1458  132  PHE A CA  
1232 C  C   . PHE A 135 ? 0.2757 0.2952 0.4308 -0.0334 -0.0006 0.1538  132  PHE A C   
1233 O  O   . PHE A 135 ? 0.3082 0.3275 0.4710 -0.0349 -0.0014 0.1636  132  PHE A O   
1234 C  CB  . PHE A 135 ? 0.2755 0.3080 0.4008 -0.0272 0.0087  0.1491  132  PHE A CB  
1235 C  CG  . PHE A 135 ? 0.2968 0.3365 0.4226 -0.0273 0.0123  0.1617  132  PHE A CG  
1236 C  CD1 . PHE A 135 ? 0.2936 0.3318 0.4130 -0.0255 0.0111  0.1647  132  PHE A CD1 
1237 C  CD2 . PHE A 135 ? 0.3243 0.3731 0.4570 -0.0289 0.0172  0.1709  132  PHE A CD2 
1238 C  CE1 . PHE A 135 ? 0.3138 0.3591 0.4328 -0.0254 0.0145  0.1769  132  PHE A CE1 
1239 C  CE2 . PHE A 135 ? 0.3671 0.4235 0.4998 -0.0287 0.0209  0.1829  132  PHE A CE2 
1240 C  CZ  . PHE A 135 ? 0.3382 0.3926 0.4636 -0.0269 0.0195  0.1860  132  PHE A CZ  
1241 N  N   . SER A 136 ? 0.2604 0.2783 0.4237 -0.0354 -0.0020 0.1497  133  SER A N   
1242 C  CA  . SER A 136 ? 0.2710 0.2865 0.4540 -0.0398 -0.0052 0.1565  133  SER A CA  
1243 C  C   . SER A 136 ? 0.2769 0.2793 0.4695 -0.0410 -0.0136 0.1513  133  SER A C   
1244 O  O   . SER A 136 ? 0.3147 0.3135 0.5238 -0.0447 -0.0174 0.1555  133  SER A O   
1245 C  CB  . SER A 136 ? 0.2679 0.2889 0.4571 -0.0417 -0.0029 0.1560  133  SER A CB  
1246 O  OG  . SER A 136 ? 0.2612 0.2770 0.4468 -0.0407 -0.0058 0.1438  133  SER A OG  
1247 N  N   . GLY A 137 ? 0.2797 0.2753 0.4626 -0.0379 -0.0165 0.1428  134  GLY A N   
1248 C  CA  . GLY A 137 ? 0.2730 0.2565 0.4630 -0.0379 -0.0242 0.1378  134  GLY A CA  
1249 C  C   . GLY A 137 ? 0.2810 0.2580 0.4714 -0.0373 -0.0284 0.1258  134  GLY A C   
1250 O  O   . GLY A 137 ? 0.3033 0.2702 0.5005 -0.0371 -0.0350 0.1214  134  GLY A O   
1251 N  N   . LYS A 138 ? 0.2608 0.2432 0.4433 -0.0365 -0.0248 0.1204  135  LYS A N   
1252 C  CA  . LYS A 138 ? 0.2548 0.2319 0.4378 -0.0360 -0.0287 0.1097  135  LYS A CA  
1253 C  C   . LYS A 138 ? 0.2642 0.2382 0.4327 -0.0317 -0.0291 0.0995  135  LYS A C   
1254 O  O   . LYS A 138 ? 0.2625 0.2418 0.4187 -0.0295 -0.0246 0.1001  135  LYS A O   
1255 C  CB  . LYS A 138 ? 0.2591 0.2436 0.4426 -0.0375 -0.0249 0.1095  135  LYS A CB  
1256 C  CG  . LYS A 138 ? 0.2881 0.2763 0.4873 -0.0418 -0.0246 0.1195  135  LYS A CG  
1257 C  CD  . LYS A 138 ? 0.2946 0.2888 0.4960 -0.0430 -0.0223 0.1178  135  LYS A CD  
1258 C  CE  . LYS A 138 ? 0.3650 0.3644 0.5831 -0.0474 -0.0215 0.1286  135  LYS A CE  
1259 N  NZ  . LYS A 138 ? 0.3925 0.4003 0.6109 -0.0480 -0.0175 0.1279  135  LYS A NZ  
1260 N  N   . LYS A 139 ? 0.2577 0.2236 0.4280 -0.0305 -0.0346 0.0903  136  LYS A N   
1261 C  CA  A LYS A 139 ? 0.2670 0.2306 0.4246 -0.0265 -0.0350 0.0802  136  LYS A CA  
1262 C  CA  B LYS A 139 ? 0.2526 0.2165 0.4100 -0.0265 -0.0348 0.0804  136  LYS A CA  
1263 C  C   . LYS A 139 ? 0.2350 0.2062 0.3815 -0.0257 -0.0298 0.0766  136  LYS A C   
1264 O  O   . LYS A 139 ? 0.2371 0.2123 0.3875 -0.0278 -0.0282 0.0778  136  LYS A O   
1265 C  CB  A LYS A 139 ? 0.2874 0.2415 0.4499 -0.0253 -0.0419 0.0716  136  LYS A CB  
1266 C  CB  B LYS A 139 ? 0.2610 0.2152 0.4226 -0.0251 -0.0417 0.0716  136  LYS A CB  
1267 C  CG  A LYS A 139 ? 0.3469 0.2981 0.4977 -0.0208 -0.0429 0.0614  136  LYS A CG  
1268 C  CG  B LYS A 139 ? 0.2808 0.2264 0.4516 -0.0248 -0.0473 0.0734  136  LYS A CG  
1269 C  CD  A LYS A 139 ? 0.4124 0.3577 0.5650 -0.0195 -0.0479 0.0521  136  LYS A CD  
1270 C  CD  B LYS A 139 ? 0.3075 0.2438 0.4792 -0.0220 -0.0538 0.0630  136  LYS A CD  
1271 C  CE  A LYS A 139 ? 0.4180 0.3597 0.5611 -0.0146 -0.0496 0.0428  136  LYS A CE  
1272 C  CE  B LYS A 139 ? 0.3478 0.2745 0.5311 -0.0221 -0.0603 0.0646  136  LYS A CE  
1273 N  NZ  A LYS A 139 ? 0.4678 0.4017 0.6159 -0.0125 -0.0544 0.0420  136  LYS A NZ  
1274 N  NZ  B LYS A 139 ? 0.3726 0.2899 0.5582 -0.0194 -0.0672 0.0544  136  LYS A NZ  
1275 N  N   . ILE A 140 ? 0.2130 0.1862 0.3464 -0.0226 -0.0273 0.0724  137  ILE A N   
1276 C  CA  . ILE A 140 ? 0.2049 0.1841 0.3274 -0.0215 -0.0230 0.0685  137  ILE A CA  
1277 C  C   . ILE A 140 ? 0.2087 0.1844 0.3306 -0.0206 -0.0258 0.0596  137  ILE A C   
1278 O  O   . ILE A 140 ? 0.2274 0.1965 0.3501 -0.0188 -0.0303 0.0538  137  ILE A O   
1279 C  CB  . ILE A 140 ? 0.2085 0.1901 0.3186 -0.0187 -0.0205 0.0669  137  ILE A CB  
1280 C  CG1 . ILE A 140 ? 0.1982 0.1837 0.3076 -0.0192 -0.0177 0.0758  137  ILE A CG1 
1281 C  CG2 . ILE A 140 ? 0.1917 0.1786 0.2907 -0.0175 -0.0166 0.0621  137  ILE A CG2 
1282 C  CD1 . ILE A 140 ? 0.2353 0.2282 0.3466 -0.0214 -0.0132 0.0831  137  ILE A CD1 
1283 N  N   . THR A 141 ? 0.2035 0.1839 0.3237 -0.0216 -0.0232 0.0585  138  THR A N   
1284 C  CA  . THR A 141 ? 0.1975 0.1757 0.3162 -0.0207 -0.0255 0.0505  138  THR A CA  
1285 C  C   . THR A 141 ? 0.1880 0.1711 0.2946 -0.0189 -0.0215 0.0464  138  THR A C   
1286 O  O   . THR A 141 ? 0.1963 0.1776 0.2992 -0.0175 -0.0231 0.0396  138  THR A O   
1287 C  CB  . THR A 141 ? 0.2106 0.1892 0.3404 -0.0236 -0.0271 0.0526  138  THR A CB  
1288 O  OG1 . THR A 141 ? 0.1968 0.1834 0.3269 -0.0253 -0.0218 0.0589  138  THR A OG1 
1289 C  CG2 . THR A 141 ? 0.2483 0.2211 0.3919 -0.0258 -0.0320 0.0564  138  THR A CG2 
1290 N  N   . ASP A 142 ? 0.1851 0.1744 0.2853 -0.0188 -0.0164 0.0506  139  ASP A N   
1291 C  CA  . ASP A 142 ? 0.1776 0.1716 0.2676 -0.0175 -0.0127 0.0476  139  ASP A CA  
1292 C  C   . ASP A 142 ? 0.1611 0.1580 0.2417 -0.0160 -0.0097 0.0494  139  ASP A C   
1293 O  O   . ASP A 142 ? 0.1820 0.1807 0.2642 -0.0166 -0.0083 0.0555  139  ASP A O   
1294 C  CB  . ASP A 142 ? 0.1644 0.1642 0.2568 -0.0190 -0.0093 0.0505  139  ASP A CB  
1295 C  CG  . ASP A 142 ? 0.1844 0.1821 0.2848 -0.0203 -0.0124 0.0477  139  ASP A CG  
1296 O  OD1 . ASP A 142 ? 0.2002 0.1976 0.2962 -0.0192 -0.0128 0.0419  139  ASP A OD1 
1297 O  OD2 . ASP A 142 ? 0.2043 0.2006 0.3163 -0.0226 -0.0145 0.0519  139  ASP A OD2 
1298 N  N   . ILE A 143 ? 0.1632 0.1607 0.2342 -0.0141 -0.0089 0.0441  140  ILE A N   
1299 C  CA  . ILE A 143 ? 0.1532 0.1534 0.2148 -0.0127 -0.0066 0.0446  140  ILE A CA  
1300 C  C   . ILE A 143 ? 0.1610 0.1655 0.2156 -0.0122 -0.0034 0.0426  140  ILE A C   
1301 O  O   . ILE A 143 ? 0.1691 0.1729 0.2229 -0.0120 -0.0040 0.0380  140  ILE A O   
1302 C  CB  . ILE A 143 ? 0.1686 0.1654 0.2260 -0.0108 -0.0091 0.0396  140  ILE A CB  
1303 C  CG1 . ILE A 143 ? 0.1664 0.1580 0.2306 -0.0105 -0.0128 0.0399  140  ILE A CG1 
1304 C  CG2 . ILE A 143 ? 0.1954 0.1953 0.2438 -0.0095 -0.0073 0.0401  140  ILE A CG2 
1305 C  CD1 . ILE A 143 ? 0.1834 0.1750 0.2513 -0.0111 -0.0129 0.0465  140  ILE A CD1 
1306 N  N   . VAL A 144 ? 0.1604 0.1694 0.2096 -0.0118 -0.0002 0.0461  141  VAL A N   
1307 C  CA  . VAL A 144 ? 0.1672 0.1799 0.2090 -0.0109 0.0027  0.0440  141  VAL A CA  
1308 C  C   . VAL A 144 ? 0.1637 0.1773 0.1960 -0.0094 0.0031  0.0429  141  VAL A C   
1309 O  O   . VAL A 144 ? 0.1682 0.1839 0.1981 -0.0090 0.0041  0.0473  141  VAL A O   
1310 C  CB  . VAL A 144 ? 0.1608 0.1786 0.2046 -0.0113 0.0063  0.0486  141  VAL A CB  
1311 C  CG1 . VAL A 144 ? 0.1946 0.2155 0.2304 -0.0097 0.0089  0.0455  141  VAL A CG1 
1312 C  CG2 . VAL A 144 ? 0.1689 0.1861 0.2243 -0.0133 0.0054  0.0505  141  VAL A CG2 
1313 N  N   . ASN A 145 ? 0.1548 0.1669 0.1820 -0.0086 0.0020  0.0375  142  ASN A N   
1314 C  CA  . ASN A 145 ? 0.1464 0.1594 0.1651 -0.0074 0.0019  0.0360  142  ASN A CA  
1315 C  C   . ASN A 145 ? 0.1604 0.1766 0.1730 -0.0065 0.0045  0.0355  142  ASN A C   
1316 O  O   . ASN A 145 ? 0.1651 0.1816 0.1787 -0.0066 0.0055  0.0332  142  ASN A O   
1317 C  CB  . ASN A 145 ? 0.1623 0.1727 0.1794 -0.0071 -0.0004 0.0309  142  ASN A CB  
1318 C  CG  . ASN A 145 ? 0.1766 0.1877 0.1870 -0.0064 -0.0013 0.0297  142  ASN A CG  
1319 O  OD1 . ASN A 145 ? 0.1793 0.1902 0.1900 -0.0061 -0.0025 0.0318  142  ASN A OD1 
1320 N  ND2 . ASN A 145 ? 0.1858 0.1976 0.1909 -0.0060 -0.0010 0.0266  142  ASN A ND2 
1321 N  N   . ILE A 146 ? 0.1514 0.1702 0.1578 -0.0054 0.0055  0.0376  143  ILE A N   
1322 C  CA  . ILE A 146 ? 0.1580 0.1796 0.1570 -0.0038 0.0077  0.0366  143  ILE A CA  
1323 C  C   . ILE A 146 ? 0.1752 0.1956 0.1666 -0.0030 0.0055  0.0332  143  ILE A C   
1324 O  O   . ILE A 146 ? 0.1667 0.1876 0.1552 -0.0026 0.0043  0.0351  143  ILE A O   
1325 C  CB  . ILE A 146 ? 0.1583 0.1846 0.1557 -0.0027 0.0109  0.0420  143  ILE A CB  
1326 C  CG1 . ILE A 146 ? 0.1754 0.2030 0.1825 -0.0042 0.0125  0.0464  143  ILE A CG1 
1327 C  CG2 . ILE A 146 ? 0.1938 0.2231 0.1833 -0.0004 0.0131  0.0399  143  ILE A CG2 
1328 C  CD1 . ILE A 146 ? 0.2070 0.2401 0.2140 -0.0034 0.0159  0.0531  143  ILE A CD1 
1329 N  N   . GLY A 147 ? 0.1662 0.1850 0.1549 -0.0028 0.0047  0.0284  144  GLY A N   
1330 C  CA  . GLY A 147 ? 0.1763 0.1937 0.1590 -0.0023 0.0022  0.0250  144  GLY A CA  
1331 C  C   . GLY A 147 ? 0.1594 0.1748 0.1408 -0.0023 0.0016  0.0203  144  GLY A C   
1332 O  O   . GLY A 147 ? 0.1579 0.1728 0.1437 -0.0028 0.0028  0.0196  144  GLY A O   
1333 N  N   . ILE A 148 ? 0.1555 0.1694 0.1316 -0.0019 -0.0008 0.0173  145  ILE A N   
1334 C  CA  . ILE A 148 ? 0.1569 0.1686 0.1323 -0.0020 -0.0016 0.0131  145  ILE A CA  
1335 C  C   . ILE A 148 ? 0.1590 0.1684 0.1342 -0.0033 -0.0053 0.0110  145  ILE A C   
1336 O  O   . ILE A 148 ? 0.1668 0.1768 0.1402 -0.0035 -0.0072 0.0120  145  ILE A O   
1337 C  CB  . ILE A 148 ? 0.1701 0.1822 0.1392 0.0004  -0.0004 0.0110  145  ILE A CB  
1338 C  CG1 . ILE A 148 ? 0.1683 0.1779 0.1382 0.0006  -0.0007 0.0073  145  ILE A CG1 
1339 C  CG2 . ILE A 148 ? 0.1905 0.2029 0.1518 0.0019  -0.0023 0.0102  145  ILE A CG2 
1340 C  CD1 . ILE A 148 ? 0.2000 0.2109 0.1656 0.0035  0.0017  0.0059  145  ILE A CD1 
1341 N  N   . GLY A 149 ? 0.1612 0.1683 0.1383 -0.0042 -0.0063 0.0083  146  GLY A N   
1342 C  CA  . GLY A 149 ? 0.1689 0.1746 0.1469 -0.0056 -0.0096 0.0070  146  GLY A CA  
1343 C  C   . GLY A 149 ? 0.1642 0.1714 0.1467 -0.0069 -0.0102 0.0093  146  GLY A C   
1344 O  O   . GLY A 149 ? 0.1664 0.1743 0.1534 -0.0071 -0.0086 0.0105  146  GLY A O   
1345 N  N   . GLY A 150 ? 0.1599 0.1678 0.1414 -0.0074 -0.0127 0.0098  147  GLY A N   
1346 C  CA  . GLY A 150 ? 0.1708 0.1806 0.1564 -0.0081 -0.0133 0.0120  147  GLY A CA  
1347 C  C   . GLY A 150 ? 0.1601 0.1713 0.1474 -0.0072 -0.0112 0.0147  147  GLY A C   
1348 O  O   . GLY A 150 ? 0.1724 0.1846 0.1641 -0.0073 -0.0112 0.0160  147  GLY A O   
1349 N  N   . SER A 151 ? 0.1635 0.1748 0.1475 -0.0061 -0.0095 0.0157  148  SER A N   
1350 C  CA  . SER A 151 ? 0.1665 0.1788 0.1529 -0.0055 -0.0077 0.0188  148  SER A CA  
1351 C  C   . SER A 151 ? 0.1761 0.1877 0.1666 -0.0057 -0.0053 0.0189  148  SER A C   
1352 O  O   . SER A 151 ? 0.1809 0.1931 0.1740 -0.0054 -0.0038 0.0217  148  SER A O   
1353 C  CB  . SER A 151 ? 0.1745 0.1883 0.1556 -0.0043 -0.0071 0.0209  148  SER A CB  
1354 O  OG  . SER A 151 ? 0.1773 0.1919 0.1558 -0.0042 -0.0099 0.0215  148  SER A OG  
1355 N  N   . ASP A 152 ? 0.1517 0.1620 0.1434 -0.0061 -0.0053 0.0162  149  ASP A N   
1356 C  CA  . ASP A 152 ? 0.1594 0.1691 0.1549 -0.0063 -0.0036 0.0157  149  ASP A CA  
1357 C  C   . ASP A 152 ? 0.1610 0.1696 0.1597 -0.0068 -0.0046 0.0137  149  ASP A C   
1358 O  O   . ASP A 152 ? 0.1624 0.1706 0.1655 -0.0068 -0.0044 0.0140  149  ASP A O   
1359 C  CB  . ASP A 152 ? 0.1638 0.1734 0.1562 -0.0056 -0.0021 0.0144  149  ASP A CB  
1360 C  CG  . ASP A 152 ? 0.1787 0.1876 0.1750 -0.0058 -0.0009 0.0133  149  ASP A CG  
1361 O  OD1 . ASP A 152 ? 0.1784 0.1880 0.1793 -0.0060 0.0003  0.0152  149  ASP A OD1 
1362 O  OD2 . ASP A 152 ? 0.2110 0.2187 0.2064 -0.0059 -0.0015 0.0107  149  ASP A OD2 
1363 N  N   . LEU A 153 ? 0.1530 0.1611 0.1497 -0.0073 -0.0057 0.0117  150  LEU A N   
1364 C  CA  . LEU A 153 ? 0.1617 0.1691 0.1607 -0.0076 -0.0060 0.0101  150  LEU A CA  
1365 C  C   . LEU A 153 ? 0.1487 0.1573 0.1508 -0.0075 -0.0067 0.0105  150  LEU A C   
1366 O  O   . LEU A 153 ? 0.1492 0.1575 0.1537 -0.0070 -0.0064 0.0096  150  LEU A O   
1367 C  CB  . LEU A 153 ? 0.1709 0.1774 0.1675 -0.0082 -0.0071 0.0084  150  LEU A CB  
1368 C  CG  . LEU A 153 ? 0.1757 0.1817 0.1743 -0.0086 -0.0073 0.0073  150  LEU A CG  
1369 C  CD1 . LEU A 153 ? 0.2126 0.2180 0.2132 -0.0079 -0.0059 0.0067  150  LEU A CD1 
1370 C  CD2 . LEU A 153 ? 0.2098 0.2141 0.2063 -0.0093 -0.0086 0.0061  150  LEU A CD2 
1371 N  N   . GLY A 154 ? 0.1480 0.1579 0.1500 -0.0075 -0.0078 0.0117  151  GLY A N   
1372 C  CA  . GLY A 154 ? 0.1496 0.1612 0.1547 -0.0068 -0.0082 0.0120  151  GLY A CA  
1373 C  C   . GLY A 154 ? 0.1453 0.1558 0.1531 -0.0056 -0.0076 0.0121  151  GLY A C   
1374 O  O   . GLY A 154 ? 0.1486 0.1591 0.1584 -0.0047 -0.0076 0.0108  151  GLY A O   
1375 N  N   . PRO A 155 ? 0.1457 0.1553 0.1539 -0.0056 -0.0074 0.0137  152  PRO A N   
1376 C  CA  . PRO A 155 ? 0.1604 0.1684 0.1725 -0.0048 -0.0073 0.0140  152  PRO A CA  
1377 C  C   . PRO A 155 ? 0.1431 0.1495 0.1566 -0.0049 -0.0069 0.0122  152  PRO A C   
1378 O  O   . PRO A 155 ? 0.1654 0.1707 0.1817 -0.0039 -0.0077 0.0108  152  PRO A O   
1379 C  CB  . PRO A 155 ? 0.1704 0.1781 0.1823 -0.0052 -0.0070 0.0169  152  PRO A CB  
1380 C  CG  . PRO A 155 ? 0.1813 0.1910 0.1895 -0.0054 -0.0076 0.0178  152  PRO A CG  
1381 C  CD  . PRO A 155 ? 0.1513 0.1616 0.1569 -0.0060 -0.0076 0.0156  152  PRO A CD  
1382 N  N   . LYS A 156 ? 0.1447 0.1512 0.1562 -0.0058 -0.0058 0.0120  153  LYS A N   
1383 C  CA  . LYS A 156 ? 0.1494 0.1548 0.1627 -0.0060 -0.0055 0.0105  153  LYS A CA  
1384 C  C   . LYS A 156 ? 0.1570 0.1625 0.1700 -0.0052 -0.0064 0.0081  153  LYS A C   
1385 O  O   . LYS A 156 ? 0.1567 0.1611 0.1723 -0.0045 -0.0072 0.0067  153  LYS A O   
1386 C  CB  . LYS A 156 ? 0.1641 0.1699 0.1748 -0.0066 -0.0041 0.0107  153  LYS A CB  
1387 C  CG  . LYS A 156 ? 0.1806 0.1859 0.1938 -0.0067 -0.0038 0.0095  153  LYS A CG  
1388 C  CD  . LYS A 156 ? 0.2438 0.2498 0.2549 -0.0068 -0.0022 0.0096  153  LYS A CD  
1389 C  CE  . LYS A 156 ? 0.3684 0.3740 0.3755 -0.0068 -0.0027 0.0078  153  LYS A CE  
1390 N  NZ  . LYS A 156 ? 0.4431 0.4483 0.4495 -0.0065 -0.0020 0.0066  153  LYS A NZ  
1391 N  N   . MET A 157 ? 0.1435 0.1505 0.1537 -0.0053 -0.0065 0.0078  154  MET A N   
1392 C  CA  . MET A 157 ? 0.1453 0.1533 0.1551 -0.0045 -0.0069 0.0064  154  MET A CA  
1393 C  C   . MET A 157 ? 0.1450 0.1534 0.1565 -0.0026 -0.0076 0.0055  154  MET A C   
1394 O  O   . MET A 157 ? 0.1552 0.1635 0.1669 -0.0012 -0.0082 0.0036  154  MET A O   
1395 C  CB  . MET A 157 ? 0.1456 0.1555 0.1531 -0.0053 -0.0069 0.0072  154  MET A CB  
1396 C  CG  . MET A 157 ? 0.1519 0.1639 0.1592 -0.0046 -0.0069 0.0068  154  MET A CG  
1397 S  SD  . MET A 157 ? 0.1648 0.1803 0.1732 -0.0026 -0.0069 0.0072  154  MET A SD  
1398 C  CE  . MET A 157 ? 0.1923 0.2100 0.2011 -0.0043 -0.0072 0.0097  154  MET A CE  
1399 N  N   . VAL A 158 ? 0.1313 0.1403 0.1438 -0.0021 -0.0079 0.0066  155  VAL A N   
1400 C  CA  . VAL A 158 ? 0.1378 0.1473 0.1520 0.0002  -0.0086 0.0056  155  VAL A CA  
1401 C  C   . VAL A 158 ? 0.1487 0.1546 0.1657 0.0011  -0.0099 0.0040  155  VAL A C   
1402 O  O   . VAL A 158 ? 0.1639 0.1693 0.1813 0.0034  -0.0110 0.0014  155  VAL A O   
1403 C  CB  . VAL A 158 ? 0.1339 0.1449 0.1488 0.0005  -0.0087 0.0074  155  VAL A CB  
1404 C  CG1 . VAL A 158 ? 0.1585 0.1694 0.1757 0.0034  -0.0096 0.0061  155  VAL A CG1 
1405 C  CG2 . VAL A 158 ? 0.1528 0.1677 0.1659 -0.0003 -0.0081 0.0088  155  VAL A CG2 
1406 N  N   . VAL A 159 ? 0.1402 0.1439 0.1593 -0.0006 -0.0099 0.0054  156  VAL A N   
1407 C  CA  . VAL A 159 ? 0.1464 0.1468 0.1696 -0.0004 -0.0114 0.0046  156  VAL A CA  
1408 C  C   . VAL A 159 ? 0.1527 0.1525 0.1753 0.0002  -0.0122 0.0017  156  VAL A C   
1409 O  O   . VAL A 159 ? 0.1676 0.1652 0.1923 0.0019  -0.0144 -0.0009 156  VAL A O   
1410 C  CB  . VAL A 159 ? 0.1331 0.1324 0.1590 -0.0024 -0.0108 0.0075  156  VAL A CB  
1411 C  CG1 . VAL A 159 ? 0.1586 0.1550 0.1902 -0.0029 -0.0125 0.0071  156  VAL A CG1 
1412 C  CG2 . VAL A 159 ? 0.1568 0.1562 0.1838 -0.0023 -0.0108 0.0102  156  VAL A CG2 
1413 N  N   . ARG A 160 ? 0.1493 0.1507 0.1693 -0.0009 -0.0110 0.0019  157  ARG A N   
1414 C  CA  . ARG A 160 ? 0.1527 0.1540 0.1719 -0.0001 -0.0119 -0.0006 157  ARG A CA  
1415 C  C   . ARG A 160 ? 0.1467 0.1494 0.1629 0.0024  -0.0125 -0.0028 157  ARG A C   
1416 O  O   . ARG A 160 ? 0.1529 0.1544 0.1692 0.0042  -0.0144 -0.0056 157  ARG A O   
1417 C  CB  . ARG A 160 ? 0.1615 0.1641 0.1787 -0.0017 -0.0104 0.0003  157  ARG A CB  
1418 C  CG  . ARG A 160 ? 0.1623 0.1649 0.1786 -0.0009 -0.0114 -0.0017 157  ARG A CG  
1419 C  CD  . ARG A 160 ? 0.1778 0.1781 0.1981 -0.0008 -0.0135 -0.0032 157  ARG A CD  
1420 N  NE  . ARG A 160 ? 0.2068 0.2071 0.2260 0.0003  -0.0151 -0.0054 157  ARG A NE  
1421 C  CZ  . ARG A 160 ? 0.1947 0.1944 0.2124 0.0027  -0.0173 -0.0083 157  ARG A CZ  
1422 N  NH1 . ARG A 160 ? 0.1778 0.1770 0.1947 0.0045  -0.0178 -0.0094 157  ARG A NH1 
1423 N  NH2 . ARG A 160 ? 0.2096 0.2093 0.2263 0.0037  -0.0191 -0.0102 157  ARG A NH2 
1424 N  N   . ALA A 161 ? 0.1400 0.1457 0.1536 0.0028  -0.0110 -0.0015 158  ALA A N   
1425 C  CA  . ALA A 161 ? 0.1420 0.1506 0.1525 0.0054  -0.0108 -0.0028 158  ALA A CA  
1426 C  C   . ALA A 161 ? 0.1438 0.1513 0.1552 0.0085  -0.0124 -0.0055 158  ALA A C   
1427 O  O   . ALA A 161 ? 0.1739 0.1830 0.1824 0.0115  -0.0128 -0.0078 158  ALA A O   
1428 C  CB  . ALA A 161 ? 0.1433 0.1560 0.1524 0.0048  -0.0089 -0.0002 158  ALA A CB  
1429 N  N   . LEU A 162 ? 0.1465 0.1513 0.1614 0.0083  -0.0134 -0.0052 159  LEU A N   
1430 C  CA  . LEU A 162 ? 0.1516 0.1541 0.1682 0.0112  -0.0153 -0.0078 159  LEU A CA  
1431 C  C   . LEU A 162 ? 0.1566 0.1537 0.1773 0.0108  -0.0183 -0.0096 159  LEU A C   
1432 O  O   . LEU A 162 ? 0.1713 0.1651 0.1951 0.0125  -0.0205 -0.0112 159  LEU A O   
1433 C  CB  . LEU A 162 ? 0.1580 0.1616 0.1764 0.0116  -0.0146 -0.0057 159  LEU A CB  
1434 C  CG  . LEU A 162 ? 0.1409 0.1500 0.1566 0.0119  -0.0121 -0.0036 159  LEU A CG  
1435 C  CD1 . LEU A 162 ? 0.1596 0.1696 0.1777 0.0121  -0.0119 -0.0015 159  LEU A CD1 
1436 C  CD2 . LEU A 162 ? 0.1695 0.1822 0.1819 0.0155  -0.0116 -0.0059 159  LEU A CD2 
1437 N  N   . GLN A 163 ? 0.1643 0.1605 0.1853 0.0090  -0.0188 -0.0099 160  GLN A N   
1438 C  CA  . GLN A 163 ? 0.1594 0.1512 0.1852 0.0082  -0.0217 -0.0113 160  GLN A CA  
1439 C  C   . GLN A 163 ? 0.1596 0.1479 0.1861 0.0117  -0.0254 -0.0159 160  GLN A C   
1440 O  O   . GLN A 163 ? 0.1772 0.1609 0.2094 0.0112  -0.0283 -0.0165 160  GLN A O   
1441 C  CB  . GLN A 163 ? 0.1706 0.1628 0.1967 0.0061  -0.0217 -0.0109 160  GLN A CB  
1442 C  CG  . GLN A 163 ? 0.1898 0.1784 0.2227 0.0043  -0.0243 -0.0110 160  GLN A CG  
1443 C  CD  . GLN A 163 ? 0.2697 0.2598 0.3031 0.0023  -0.0237 -0.0100 160  GLN A CD  
1444 O  OE1 . GLN A 163 ? 0.3000 0.2921 0.3338 0.0000  -0.0208 -0.0065 160  GLN A OE1 
1445 N  NE2 . GLN A 163 ? 0.2929 0.2818 0.3261 0.0035  -0.0265 -0.0132 160  GLN A NE2 
1446 N  N   . PRO A 164 ? 0.1628 0.1533 0.1837 0.0153  -0.0255 -0.0191 161  PRO A N   
1447 C  CA  . PRO A 164 ? 0.1754 0.1622 0.1964 0.0191  -0.0293 -0.0241 161  PRO A CA  
1448 C  C   . PRO A 164 ? 0.1780 0.1619 0.2025 0.0208  -0.0305 -0.0247 161  PRO A C   
1449 O  O   . PRO A 164 ? 0.1980 0.1769 0.2246 0.0235  -0.0347 -0.0290 161  PRO A O   
1450 C  CB  . PRO A 164 ? 0.1966 0.1881 0.2097 0.0232  -0.0280 -0.0266 161  PRO A CB  
1451 C  CG  . PRO A 164 ? 0.1810 0.1764 0.1916 0.0203  -0.0253 -0.0235 161  PRO A CG  
1452 C  CD  . PRO A 164 ? 0.1730 0.1689 0.1876 0.0162  -0.0227 -0.0185 161  PRO A CD  
1453 N  N   . TYR A 165 ? 0.1734 0.1601 0.1985 0.0194  -0.0273 -0.0205 162  TYR A N   
1454 C  CA  . TYR A 165 ? 0.1738 0.1585 0.2021 0.0209  -0.0280 -0.0200 162  TYR A CA  
1455 C  C   . TYR A 165 ? 0.1925 0.1731 0.2282 0.0171  -0.0292 -0.0165 162  TYR A C   
1456 O  O   . TYR A 165 ? 0.1987 0.1776 0.2376 0.0178  -0.0297 -0.0151 162  TYR A O   
1457 C  CB  . TYR A 165 ? 0.1822 0.1730 0.2071 0.0219  -0.0242 -0.0175 162  TYR A CB  
1458 C  CG  . TYR A 165 ? 0.1670 0.1625 0.1856 0.0259  -0.0228 -0.0204 162  TYR A CG  
1459 C  CD1 . TYR A 165 ? 0.2034 0.1992 0.2207 0.0311  -0.0238 -0.0239 162  TYR A CD1 
1460 C  CD2 . TYR A 165 ? 0.1764 0.1763 0.1906 0.0247  -0.0205 -0.0193 162  TYR A CD2 
1461 C  CE1 . TYR A 165 ? 0.2107 0.2117 0.2219 0.0352  -0.0222 -0.0262 162  TYR A CE1 
1462 C  CE2 . TYR A 165 ? 0.1816 0.1866 0.1900 0.0284  -0.0191 -0.0212 162  TYR A CE2 
1463 C  CZ  . TYR A 165 ? 0.2002 0.2060 0.2070 0.0337  -0.0197 -0.0245 162  TYR A CZ  
1464 O  OH  . TYR A 165 ? 0.2286 0.2406 0.2293 0.0375  -0.0177 -0.0256 162  TYR A OH  
1465 N  N   . HIS A 166 ? 0.1861 0.1656 0.2245 0.0133  -0.0294 -0.0145 163  HIS A N   
1466 C  CA  . HIS A 166 ? 0.2022 0.1788 0.2480 0.0098  -0.0301 -0.0103 163  HIS A CA  
1467 C  C   . HIS A 166 ? 0.2212 0.1912 0.2732 0.0114  -0.0348 -0.0128 163  HIS A C   
1468 O  O   . HIS A 166 ? 0.2258 0.1925 0.2779 0.0136  -0.0384 -0.0177 163  HIS A O   
1469 C  CB  . HIS A 166 ? 0.2029 0.1800 0.2511 0.0061  -0.0295 -0.0080 163  HIS A CB  
1470 C  CG  . HIS A 166 ? 0.2251 0.2078 0.2686 0.0042  -0.0250 -0.0050 163  HIS A CG  
1471 N  ND1 . HIS A 166 ? 0.2965 0.2805 0.3422 0.0009  -0.0236 -0.0019 163  HIS A ND1 
1472 C  CD2 . HIS A 166 ? 0.2401 0.2270 0.2774 0.0050  -0.0221 -0.0045 163  HIS A CD2 
1473 C  CE1 . HIS A 166 ? 0.2710 0.2593 0.3113 0.0003  -0.0201 -0.0005 163  HIS A CE1 
1474 N  NE2 . HIS A 166 ? 0.2344 0.2244 0.2699 0.0024  -0.0193 -0.0017 163  HIS A NE2 
1475 N  N   . CYS A 167 ? 0.2088 0.1764 0.2658 0.0105  -0.0353 -0.0094 164  CYS A N   
1476 C  CA  . CYS A 167 ? 0.2212 0.1820 0.2844 0.0125  -0.0401 -0.0118 164  CYS A CA  
1477 C  C   . CYS A 167 ? 0.2359 0.1935 0.3073 0.0099  -0.0412 -0.0065 164  CYS A C   
1478 O  O   . CYS A 167 ? 0.2902 0.2417 0.3669 0.0118  -0.0453 -0.0082 164  CYS A O   
1479 C  CB  . CYS A 167 ? 0.2291 0.1902 0.2876 0.0178  -0.0405 -0.0161 164  CYS A CB  
1480 S  SG  . CYS A 167 ? 0.2467 0.2135 0.3018 0.0183  -0.0360 -0.0117 164  CYS A SG  
1481 N  N   . THR A 168 ? 0.2281 0.1892 0.3009 0.0059  -0.0379 -0.0002 165  THR A N   
1482 C  CA  . THR A 168 ? 0.2294 0.1887 0.3091 0.0035  -0.0382 0.0059  165  THR A CA  
1483 C  C   . THR A 168 ? 0.2354 0.1920 0.3240 -0.0002 -0.0401 0.0092  165  THR A C   
1484 O  O   . THR A 168 ? 0.2659 0.2211 0.3612 -0.0024 -0.0405 0.0151  165  THR A O   
1485 C  CB  . THR A 168 ? 0.2216 0.1870 0.2967 0.0018  -0.0332 0.0113  165  THR A CB  
1486 O  OG1 . THR A 168 ? 0.2099 0.1798 0.2815 -0.0004 -0.0302 0.0119  165  THR A OG1 
1487 C  CG2 . THR A 168 ? 0.2575 0.2259 0.3256 0.0051  -0.0315 0.0094  165  THR A CG2 
1488 N  N   . ASP A 169 ? 0.2496 0.2063 0.3388 -0.0012 -0.0412 0.0064  166  ASP A N   
1489 C  CA  . ASP A 169 ? 0.2806 0.2363 0.3788 -0.0051 -0.0426 0.0101  166  ASP A CA  
1490 C  C   . ASP A 169 ? 0.2825 0.2446 0.3810 -0.0086 -0.0374 0.0175  166  ASP A C   
1491 O  O   . ASP A 169 ? 0.3146 0.2772 0.4214 -0.0119 -0.0376 0.0222  166  ASP A O   
1492 C  CB  . ASP A 169 ? 0.3066 0.2549 0.4159 -0.0058 -0.0482 0.0107  166  ASP A CB  
1493 C  CG  . ASP A 169 ? 0.3816 0.3234 0.4910 -0.0023 -0.0540 0.0022  166  ASP A CG  
1494 O  OD1 . ASP A 169 ? 0.4531 0.3964 0.5570 -0.0009 -0.0544 -0.0031 166  ASP A OD1 
1495 O  OD2 . ASP A 169 ? 0.4740 0.4094 0.5884 -0.0008 -0.0582 0.0011  166  ASP A OD2 
1496 N  N   . LEU A 170 ? 0.2305 0.1978 0.3198 -0.0076 -0.0328 0.0184  167  LEU A N   
1497 C  CA  . LEU A 170 ? 0.2316 0.2049 0.3190 -0.0100 -0.0279 0.0242  167  LEU A CA  
1498 C  C   . LEU A 170 ? 0.2240 0.2016 0.3048 -0.0098 -0.0253 0.0212  167  LEU A C   
1499 O  O   . LEU A 170 ? 0.2670 0.2444 0.3410 -0.0074 -0.0256 0.0159  167  LEU A O   
1500 C  CB  . LEU A 170 ? 0.2266 0.2027 0.3081 -0.0090 -0.0250 0.0272  167  LEU A CB  
1501 C  CG  . LEU A 170 ? 0.2266 0.1989 0.3139 -0.0089 -0.0272 0.0308  167  LEU A CG  
1502 C  CD1 . LEU A 170 ? 0.2065 0.1815 0.2868 -0.0073 -0.0248 0.0325  167  LEU A CD1 
1503 C  CD2 . LEU A 170 ? 0.2294 0.2021 0.3259 -0.0123 -0.0270 0.0381  167  LEU A CD2 
1504 N  N   . LYS A 171 ? 0.2051 0.1869 0.2877 -0.0122 -0.0225 0.0251  168  LYS A N   
1505 C  CA  . LYS A 171 ? 0.2021 0.1882 0.2782 -0.0120 -0.0195 0.0231  168  LYS A CA  
1506 C  C   . LYS A 171 ? 0.1967 0.1874 0.2657 -0.0118 -0.0151 0.0263  168  LYS A C   
1507 O  O   . LYS A 171 ? 0.2046 0.1972 0.2761 -0.0131 -0.0133 0.0320  168  LYS A O   
1508 C  CB  . LYS A 171 ? 0.2232 0.2113 0.3057 -0.0142 -0.0193 0.0249  168  LYS A CB  
1509 C  CG  . LYS A 171 ? 0.2597 0.2430 0.3491 -0.0143 -0.0245 0.0210  168  LYS A CG  
1510 C  CD  . LYS A 171 ? 0.3268 0.3130 0.4238 -0.0168 -0.0242 0.0236  168  LYS A CD  
1511 C  CE  . LYS A 171 ? 0.4125 0.3942 0.5179 -0.0175 -0.0300 0.0205  168  LYS A CE  
1512 N  NZ  . LYS A 171 ? 0.4513 0.4365 0.5607 -0.0189 -0.0297 0.0207  168  LYS A NZ  
1513 N  N   . VAL A 172 ? 0.1746 0.1670 0.2348 -0.0102 -0.0136 0.0227  169  VAL A N   
1514 C  CA  . VAL A 172 ? 0.1749 0.1707 0.2278 -0.0098 -0.0104 0.0244  169  VAL A CA  
1515 C  C   . VAL A 172 ? 0.1873 0.1867 0.2362 -0.0101 -0.0077 0.0237  169  VAL A C   
1516 O  O   . VAL A 172 ? 0.2237 0.2226 0.2712 -0.0096 -0.0085 0.0197  169  VAL A O   
1517 C  CB  . VAL A 172 ? 0.1867 0.1815 0.2337 -0.0078 -0.0113 0.0211  169  VAL A CB  
1518 C  CG1 . VAL A 172 ? 0.1916 0.1898 0.2319 -0.0076 -0.0087 0.0229  169  VAL A CG1 
1519 C  CG2 . VAL A 172 ? 0.2016 0.1927 0.2528 -0.0068 -0.0141 0.0213  169  VAL A CG2 
1520 N  N   . HIS A 173 ? 0.1586 0.1617 0.2054 -0.0106 -0.0046 0.0274  170  HIS A N   
1521 C  CA  . HIS A 173 ? 0.1578 0.1642 0.2012 -0.0106 -0.0019 0.0271  170  HIS A CA  
1522 C  C   . HIS A 173 ? 0.1717 0.1803 0.2063 -0.0095 0.0001  0.0272  170  HIS A C   
1523 O  O   . HIS A 173 ? 0.1951 0.2040 0.2280 -0.0093 0.0003  0.0298  170  HIS A O   
1524 C  CB  . HIS A 173 ? 0.1716 0.1813 0.2208 -0.0117 0.0002  0.0317  170  HIS A CB  
1525 C  CG  . HIS A 173 ? 0.1879 0.1955 0.2474 -0.0133 -0.0022 0.0332  170  HIS A CG  
1526 N  ND1 . HIS A 173 ? 0.2279 0.2358 0.2928 -0.0141 -0.0031 0.0318  170  HIS A ND1 
1527 C  CD2 . HIS A 173 ? 0.1800 0.1851 0.2460 -0.0143 -0.0043 0.0360  170  HIS A CD2 
1528 C  CE1 . HIS A 173 ? 0.2130 0.2184 0.2874 -0.0156 -0.0059 0.0335  170  HIS A CE1 
1529 N  NE2 . HIS A 173 ? 0.2053 0.2087 0.2805 -0.0158 -0.0068 0.0359  170  HIS A NE2 
1530 N  N   . PHE A 174 ? 0.1629 0.1729 0.1926 -0.0088 0.0014  0.0246  171  PHE A N   
1531 C  CA  . PHE A 174 ? 0.1489 0.1600 0.1703 -0.0078 0.0025  0.0237  171  PHE A CA  
1532 C  C   . PHE A 174 ? 0.1701 0.1846 0.1886 -0.0070 0.0054  0.0246  171  PHE A C   
1533 O  O   . PHE A 174 ? 0.1881 0.2028 0.2077 -0.0068 0.0059  0.0226  171  PHE A O   
1534 C  CB  . PHE A 174 ? 0.1589 0.1679 0.1767 -0.0074 0.0007  0.0194  171  PHE A CB  
1535 C  CG  . PHE A 174 ? 0.1513 0.1582 0.1707 -0.0075 -0.0016 0.0186  171  PHE A CG  
1536 C  CD1 . PHE A 174 ? 0.1768 0.1840 0.1932 -0.0071 -0.0021 0.0197  171  PHE A CD1 
1537 C  CD2 . PHE A 174 ? 0.1722 0.1771 0.1962 -0.0075 -0.0034 0.0169  171  PHE A CD2 
1538 C  CE1 . PHE A 174 ? 0.1947 0.2004 0.2131 -0.0067 -0.0041 0.0191  171  PHE A CE1 
1539 C  CE2 . PHE A 174 ? 0.1915 0.1946 0.2168 -0.0069 -0.0054 0.0161  171  PHE A CE2 
1540 C  CZ  . PHE A 174 ? 0.1779 0.1815 0.2005 -0.0065 -0.0055 0.0173  171  PHE A CZ  
1541 N  N   . VAL A 175 ? 0.1634 0.1803 0.1778 -0.0062 0.0072  0.0273  172  VAL A N   
1542 C  CA  . VAL A 175 ? 0.1541 0.1746 0.1644 -0.0047 0.0102  0.0280  172  VAL A CA  
1543 C  C   . VAL A 175 ? 0.1795 0.1991 0.1807 -0.0033 0.0093  0.0252  172  VAL A C   
1544 O  O   . VAL A 175 ? 0.1735 0.1924 0.1720 -0.0035 0.0079  0.0261  172  VAL A O   
1545 C  CB  . VAL A 175 ? 0.1657 0.1904 0.1781 -0.0044 0.0129  0.0337  172  VAL A CB  
1546 C  CG1 . VAL A 175 ? 0.1602 0.1893 0.1657 -0.0018 0.0162  0.0342  172  VAL A CG1 
1547 C  CG2 . VAL A 175 ? 0.1685 0.1940 0.1918 -0.0062 0.0132  0.0368  172  VAL A CG2 
1548 N  N   . SER A 176 ? 0.1509 0.1704 0.1477 -0.0020 0.0098  0.0217  173  SER A N   
1549 C  CA  . SER A 176 ? 0.1489 0.1665 0.1382 -0.0010 0.0080  0.0185  173  SER A CA  
1550 C  C   . SER A 176 ? 0.1690 0.1880 0.1521 0.0016  0.0096  0.0163  173  SER A C   
1551 O  O   . SER A 176 ? 0.1696 0.1899 0.1458 0.0034  0.0100  0.0166  173  SER A O   
1552 C  CB  . SER A 176 ? 0.1607 0.1745 0.1512 -0.0024 0.0050  0.0151  173  SER A CB  
1553 O  OG  . SER A 176 ? 0.1664 0.1793 0.1604 -0.0025 0.0054  0.0132  173  SER A OG  
1554 N  N   . ASN A 177 ? 0.1661 0.1844 0.1511 0.0021  0.0101  0.0138  174  ASN A N   
1555 C  CA  . ASN A 177 ? 0.1669 0.1859 0.1466 0.0050  0.0113  0.0111  174  ASN A CA  
1556 C  C   . ASN A 177 ? 0.1689 0.1931 0.1455 0.0074  0.0150  0.0142  174  ASN A C   
1557 O  O   . ASN A 177 ? 0.1626 0.1907 0.1445 0.0066  0.0174  0.0190  174  ASN A O   
1558 C  CB  . ASN A 177 ? 0.1617 0.1800 0.1463 0.0051  0.0120  0.0093  174  ASN A CB  
1559 C  CG  . ASN A 177 ? 0.1730 0.1894 0.1528 0.0076  0.0115  0.0050  174  ASN A CG  
1560 O  OD1 . ASN A 177 ? 0.1667 0.1838 0.1393 0.0103  0.0120  0.0034  174  ASN A OD1 
1561 N  ND2 . ASN A 177 ? 0.1639 0.1777 0.1475 0.0071  0.0103  0.0027  174  ASN A ND2 
1562 N  N   . VAL A 178 ? 0.1620 0.1867 0.1302 0.0106  0.0154  0.0116  175  VAL A N   
1563 C  CA  . VAL A 178 ? 0.1815 0.2122 0.1464 0.0138  0.0195  0.0142  175  VAL A CA  
1564 C  C   . VAL A 178 ? 0.1759 0.2103 0.1469 0.0149  0.0231  0.0153  175  VAL A C   
1565 O  O   . VAL A 178 ? 0.1839 0.2246 0.1565 0.0163  0.0272  0.0197  175  VAL A O   
1566 C  CB  . VAL A 178 ? 0.1921 0.2226 0.1457 0.0176  0.0190  0.0108  175  VAL A CB  
1567 C  CG1 . VAL A 178 ? 0.2202 0.2470 0.1708 0.0198  0.0174  0.0045  175  VAL A CG1 
1568 C  CG2 . VAL A 178 ? 0.2067 0.2445 0.1557 0.0211  0.0236  0.0145  175  VAL A CG2 
1569 N  N   . ASP A 179 ? 0.1694 0.2004 0.1443 0.0143  0.0216  0.0118  176  ASP A N   
1570 C  CA  . ASP A 179 ? 0.1651 0.1996 0.1473 0.0148  0.0244  0.0132  176  ASP A CA  
1571 C  C   . ASP A 179 ? 0.1467 0.1852 0.1375 0.0121  0.0262  0.0194  176  ASP A C   
1572 O  O   . ASP A 179 ? 0.1544 0.1896 0.1497 0.0085  0.0235  0.0204  176  ASP A O   
1573 C  CB  . ASP A 179 ? 0.1612 0.1905 0.1476 0.0132  0.0213  0.0094  176  ASP A CB  
1574 C  CG  . ASP A 179 ? 0.1778 0.2102 0.1725 0.0135  0.0233  0.0106  176  ASP A CG  
1575 O  OD1 . ASP A 179 ? 0.1765 0.2154 0.1751 0.0145  0.0272  0.0145  176  ASP A OD1 
1576 O  OD2 . ASP A 179 ? 0.1861 0.2144 0.1838 0.0124  0.0208  0.0077  176  ASP A OD2 
1577 N  N   . ALA A 180 ? 0.1601 0.2059 0.1536 0.0138  0.0307  0.0238  177  ALA A N   
1578 C  CA  . ALA A 180 ? 0.1525 0.2022 0.1543 0.0112  0.0323  0.0304  177  ALA A CA  
1579 C  C   . ALA A 180 ? 0.1519 0.1997 0.1651 0.0077  0.0304  0.0312  177  ALA A C   
1580 O  O   . ALA A 180 ? 0.1720 0.2209 0.1928 0.0049  0.0302  0.0357  177  ALA A O   
1581 C  CB  . ALA A 180 ? 0.1577 0.2164 0.1602 0.0138  0.0378  0.0359  177  ALA A CB  
1582 N  N   . ASP A 181 ? 0.1579 0.2025 0.1721 0.0081  0.0286  0.0264  178  ASP A N   
1583 C  CA  . ASP A 181 ? 0.1605 0.2023 0.1838 0.0049  0.0258  0.0262  178  ASP A CA  
1584 C  C   . ASP A 181 ? 0.1631 0.2000 0.1870 0.0017  0.0223  0.0266  178  ASP A C   
1585 O  O   . ASP A 181 ? 0.1588 0.1953 0.1910 -0.0009 0.0209  0.0288  178  ASP A O   
1586 C  CB  . ASP A 181 ? 0.1635 0.2016 0.1859 0.0058  0.0237  0.0208  178  ASP A CB  
1587 C  CG  . ASP A 181 ? 0.1730 0.2095 0.2044 0.0032  0.0212  0.0208  178  ASP A CG  
1588 O  OD1 . ASP A 181 ? 0.1860 0.2274 0.2251 0.0035  0.0232  0.0234  178  ASP A OD1 
1589 O  OD2 . ASP A 181 ? 0.1755 0.2066 0.2065 0.0012  0.0175  0.0185  178  ASP A OD2 
1590 N  N   . SER A 182 ? 0.1485 0.1818 0.1640 0.0020  0.0207  0.0243  179  SER A N   
1591 C  CA  . SER A 182 ? 0.1606 0.1899 0.1765 -0.0005 0.0177  0.0246  179  SER A CA  
1592 C  C   . SER A 182 ? 0.1686 0.2005 0.1897 -0.0020 0.0186  0.0303  179  SER A C   
1593 O  O   . SER A 182 ? 0.1602 0.1901 0.1885 -0.0044 0.0166  0.0316  179  SER A O   
1594 C  CB  . SER A 182 ? 0.1565 0.1827 0.1630 0.0005  0.0161  0.0215  179  SER A CB  
1595 O  OG  . SER A 182 ? 0.1715 0.1939 0.1792 -0.0017 0.0130  0.0214  179  SER A OG  
1596 N  N   . LEU A 183 ? 0.1698 0.2061 0.1873 -0.0004 0.0218  0.0338  180  LEU A N   
1597 C  CA  . LEU A 183 ? 0.1762 0.2156 0.1991 -0.0017 0.0231  0.0403  180  LEU A CA  
1598 C  C   . LEU A 183 ? 0.1666 0.2086 0.2015 -0.0036 0.0238  0.0437  180  LEU A C   
1599 O  O   . LEU A 183 ? 0.1748 0.2151 0.2173 -0.0062 0.0219  0.0467  180  LEU A O   
1600 C  CB  . LEU A 183 ? 0.1772 0.2224 0.1937 0.0009  0.0271  0.0439  180  LEU A CB  
1601 C  CG  . LEU A 183 ? 0.2054 0.2547 0.2268 -0.0002 0.0290  0.0518  180  LEU A CG  
1602 C  CD1 . LEU A 183 ? 0.2247 0.2694 0.2467 -0.0023 0.0256  0.0528  180  LEU A CD1 
1603 C  CD2 . LEU A 183 ? 0.2443 0.3007 0.2583 0.0032  0.0335  0.0551  180  LEU A CD2 
1604 N  N   . LEU A 184 ? 0.1723 0.2177 0.2094 -0.0023 0.0259  0.0428  181  LEU A N   
1605 C  CA  . LEU A 184 ? 0.1684 0.2171 0.2178 -0.0040 0.0265  0.0464  181  LEU A CA  
1606 C  C   . LEU A 184 ? 0.1544 0.1975 0.2109 -0.0069 0.0218  0.0439  181  LEU A C   
1607 O  O   . LEU A 184 ? 0.1861 0.2300 0.2532 -0.0093 0.0208  0.0476  181  LEU A O   
1608 C  CB  . LEU A 184 ? 0.1820 0.2364 0.2325 -0.0016 0.0300  0.0461  181  LEU A CB  
1609 C  CG  . LEU A 184 ? 0.2051 0.2672 0.2514 0.0014  0.0353  0.0503  181  LEU A CG  
1610 C  CD1 . LEU A 184 ? 0.2638 0.3309 0.3090 0.0048  0.0387  0.0484  181  LEU A CD1 
1611 C  CD2 . LEU A 184 ? 0.2565 0.3246 0.3121 -0.0005 0.0378  0.0590  181  LEU A CD2 
1612 N  N   . GLN A 185 ? 0.1640 0.2014 0.2149 -0.0066 0.0188  0.0378  182  GLN A N   
1613 C  CA  . GLN A 185 ? 0.1708 0.2031 0.2272 -0.0087 0.0143  0.0351  182  GLN A CA  
1614 C  C   . GLN A 185 ? 0.1968 0.2262 0.2575 -0.0109 0.0119  0.0376  182  GLN A C   
1615 O  O   . GLN A 185 ? 0.2085 0.2355 0.2774 -0.0128 0.0088  0.0378  182  GLN A O   
1616 C  CB  . GLN A 185 ? 0.1867 0.2140 0.2362 -0.0079 0.0118  0.0289  182  GLN A CB  
1617 C  CG  . GLN A 185 ? 0.2009 0.2294 0.2475 -0.0060 0.0128  0.0257  182  GLN A CG  
1618 C  CD  . GLN A 185 ? 0.2432 0.2759 0.2985 -0.0062 0.0140  0.0277  182  GLN A CD  
1619 O  OE1 . GLN A 185 ? 0.2617 0.2930 0.3248 -0.0080 0.0111  0.0276  182  GLN A OE1 
1620 N  NE2 . GLN A 185 ? 0.2369 0.2751 0.2915 -0.0041 0.0181  0.0297  182  GLN A NE2 
1621 N  N   . ALA A 186 ? 0.1777 0.2071 0.2328 -0.0104 0.0131  0.0397  183  ALA A N   
1622 C  CA  . ALA A 186 ? 0.1846 0.2115 0.2440 -0.0121 0.0111  0.0428  183  ALA A CA  
1623 C  C   . ALA A 186 ? 0.1801 0.2114 0.2489 -0.0136 0.0129  0.0499  183  ALA A C   
1624 O  O   . ALA A 186 ? 0.1902 0.2192 0.2689 -0.0159 0.0101  0.0520  183  ALA A O   
1625 C  CB  . ALA A 186 ? 0.1886 0.2142 0.2388 -0.0110 0.0114  0.0428  183  ALA A CB  
1626 N  N   . LEU A 187 ? 0.1855 0.2234 0.2517 -0.0122 0.0176  0.0541  184  LEU A N   
1627 C  CA  . LEU A 187 ? 0.1959 0.2393 0.2711 -0.0136 0.0201  0.0622  184  LEU A CA  
1628 C  C   . LEU A 187 ? 0.2010 0.2459 0.2891 -0.0157 0.0190  0.0638  184  LEU A C   
1629 O  O   . LEU A 187 ? 0.2316 0.2777 0.3306 -0.0182 0.0183  0.0698  184  LEU A O   
1630 C  CB  . LEU A 187 ? 0.2110 0.2623 0.2803 -0.0111 0.0258  0.0665  184  LEU A CB  
1631 C  CG  . LEU A 187 ? 0.2180 0.2682 0.2745 -0.0089 0.0266  0.0654  184  LEU A CG  
1632 C  CD1 . LEU A 187 ? 0.2466 0.3055 0.2980 -0.0060 0.0323  0.0700  184  LEU A CD1 
1633 C  CD2 . LEU A 187 ? 0.2458 0.2912 0.3037 -0.0107 0.0234  0.0677  184  LEU A CD2 
1634 N  N   . HIS A 188 ? 0.1892 0.2336 0.2771 -0.0150 0.0182  0.0588  185  HIS A N   
1635 C  CA  . HIS A 188 ? 0.2117 0.2577 0.3124 -0.0171 0.0166  0.0601  185  HIS A CA  
1636 C  C   . HIS A 188 ? 0.2292 0.2684 0.3385 -0.0201 0.0107  0.0591  185  HIS A C   
1637 O  O   . HIS A 188 ? 0.2585 0.2992 0.3805 -0.0224 0.0089  0.0618  185  HIS A O   
1638 C  CB  . HIS A 188 ? 0.2133 0.2595 0.3113 -0.0154 0.0164  0.0544  185  HIS A CB  
1639 C  CG  . HIS A 188 ? 0.2171 0.2707 0.3112 -0.0126 0.0218  0.0556  185  HIS A CG  
1640 N  ND1 . HIS A 188 ? 0.2457 0.2988 0.3343 -0.0103 0.0220  0.0500  185  HIS A ND1 
1641 C  CD2 . HIS A 188 ? 0.2544 0.3158 0.3488 -0.0112 0.0272  0.0614  185  HIS A CD2 
1642 C  CE1 . HIS A 188 ? 0.2490 0.3090 0.3350 -0.0075 0.0271  0.0520  185  HIS A CE1 
1643 N  NE2 . HIS A 188 ? 0.2421 0.3077 0.3312 -0.0079 0.0304  0.0588  185  HIS A NE2 
1644 N  N   . VAL A 189 ? 0.2171 0.2495 0.3207 -0.0200 0.0075  0.0555  186  VAL A N   
1645 C  CA  . VAL A 189 ? 0.2287 0.2540 0.3385 -0.0218 0.0015  0.0529  186  VAL A CA  
1646 C  C   . VAL A 189 ? 0.2251 0.2466 0.3361 -0.0228 -0.0001 0.0559  186  VAL A C   
1647 O  O   . VAL A 189 ? 0.2432 0.2581 0.3582 -0.0237 -0.0053 0.0531  186  VAL A O   
1648 C  CB  . VAL A 189 ? 0.2308 0.2505 0.3338 -0.0204 -0.0019 0.0444  186  VAL A CB  
1649 C  CG1 . VAL A 189 ? 0.2786 0.3014 0.3833 -0.0199 -0.0015 0.0420  186  VAL A CG1 
1650 C  CG2 . VAL A 189 ? 0.2092 0.2269 0.2989 -0.0181 -0.0007 0.0408  186  VAL A CG2 
1651 N  N   . VAL A 190 ? 0.2042 0.2299 0.3119 -0.0223 0.0040  0.0615  187  VAL A N   
1652 C  CA  . VAL A 190 ? 0.1880 0.2104 0.2971 -0.0231 0.0025  0.0650  187  VAL A CA  
1653 C  C   . VAL A 190 ? 0.2117 0.2399 0.3285 -0.0247 0.0055  0.0746  187  VAL A C   
1654 O  O   . VAL A 190 ? 0.2295 0.2655 0.3469 -0.0243 0.0102  0.0786  187  VAL A O   
1655 C  CB  . VAL A 190 ? 0.1880 0.2085 0.2838 -0.0207 0.0034  0.0620  187  VAL A CB  
1656 C  CG1 . VAL A 190 ? 0.1912 0.2064 0.2798 -0.0191 0.0005  0.0532  187  VAL A CG1 
1657 C  CG2 . VAL A 190 ? 0.2279 0.2554 0.3147 -0.0187 0.0091  0.0649  187  VAL A CG2 
1658 N  N   . ASP A 191 ? 0.2140 0.2385 0.3376 -0.0265 0.0028  0.0788  188  ASP A N   
1659 C  CA  . ASP A 191 ? 0.2238 0.2527 0.3567 -0.0286 0.0048  0.0889  188  ASP A CA  
1660 C  C   . ASP A 191 ? 0.2189 0.2485 0.3434 -0.0271 0.0069  0.0926  188  ASP A C   
1661 O  O   . ASP A 191 ? 0.2167 0.2396 0.3367 -0.0263 0.0035  0.0886  188  ASP A O   
1662 C  CB  . ASP A 191 ? 0.2404 0.2625 0.3883 -0.0319 -0.0016 0.0903  188  ASP A CB  
1663 C  CG  . ASP A 191 ? 0.3171 0.3421 0.4780 -0.0349 -0.0011 0.1011  188  ASP A CG  
1664 O  OD1 . ASP A 191 ? 0.3397 0.3708 0.4978 -0.0344 0.0037  0.1087  188  ASP A OD1 
1665 O  OD2 . ASP A 191 ? 0.3933 0.4137 0.5685 -0.0381 -0.0062 0.1023  188  ASP A OD2 
1666 N  N   . PRO A 192 ? 0.2223 0.2603 0.3447 -0.0264 0.0124  0.0999  189  PRO A N   
1667 C  CA  . PRO A 192 ? 0.2091 0.2479 0.3228 -0.0248 0.0142  0.1034  189  PRO A CA  
1668 C  C   . PRO A 192 ? 0.2248 0.2569 0.3455 -0.0266 0.0097  0.1066  189  PRO A C   
1669 O  O   . PRO A 192 ? 0.2246 0.2540 0.3369 -0.0249 0.0089  0.1056  189  PRO A O   
1670 C  CB  . PRO A 192 ? 0.2415 0.2911 0.3551 -0.0241 0.0206  0.1123  189  PRO A CB  
1671 C  CG  . PRO A 192 ? 0.2739 0.3283 0.3977 -0.0257 0.0221  0.1138  189  PRO A CG  
1672 C  CD  . PRO A 192 ? 0.2328 0.2801 0.3608 -0.0269 0.0172  0.1056  189  PRO A CD  
1673 N  N   . GLU A 193 ? 0.2151 0.2445 0.3513 -0.0300 0.0064  0.1106  190  GLU A N   
1674 C  CA  . GLU A 193 ? 0.2117 0.2344 0.3551 -0.0316 0.0019  0.1141  190  GLU A CA  
1675 C  C   . GLU A 193 ? 0.2092 0.2215 0.3497 -0.0305 -0.0040 0.1048  190  GLU A C   
1676 O  O   . GLU A 193 ? 0.2047 0.2116 0.3476 -0.0306 -0.0073 0.1067  190  GLU A O   
1677 C  CB  . GLU A 193 ? 0.2121 0.2348 0.3742 -0.0357 -0.0002 0.1216  190  GLU A CB  
1678 C  CG  . GLU A 193 ? 0.2307 0.2644 0.3964 -0.0366 0.0059  0.1327  190  GLU A CG  
1679 C  CD  . GLU A 193 ? 0.3013 0.3356 0.4865 -0.0411 0.0040  0.1425  190  GLU A CD  
1680 O  OE1 . GLU A 193 ? 0.3124 0.3376 0.5085 -0.0435 -0.0025 0.1426  190  GLU A OE1 
1681 O  OE2 . GLU A 193 ? 0.4031 0.4478 0.5930 -0.0420 0.0094  0.1510  190  GLU A OE2 
1682 N  N   . THR A 194 ? 0.1843 0.1945 0.3191 -0.0291 -0.0051 0.0954  191  THR A N   
1683 C  CA  . THR A 194 ? 0.1975 0.1988 0.3297 -0.0278 -0.0104 0.0865  191  THR A CA  
1684 C  C   . THR A 194 ? 0.1818 0.1836 0.2990 -0.0245 -0.0087 0.0787  191  THR A C   
1685 O  O   . THR A 194 ? 0.1926 0.1889 0.3072 -0.0233 -0.0122 0.0707  191  THR A O   
1686 C  CB  . THR A 194 ? 0.2056 0.2020 0.3486 -0.0297 -0.0152 0.0826  191  THR A CB  
1687 O  OG1 . THR A 194 ? 0.2352 0.2372 0.3773 -0.0301 -0.0123 0.0809  191  THR A OG1 
1688 C  CG2 . THR A 194 ? 0.2110 0.2050 0.3709 -0.0333 -0.0184 0.0902  191  THR A CG2 
1689 N  N   . THR A 195 ? 0.1828 0.1913 0.2901 -0.0231 -0.0035 0.0811  192  THR A N   
1690 C  CA  . THR A 195 ? 0.1714 0.1809 0.2653 -0.0204 -0.0019 0.0743  192  THR A CA  
1691 C  C   . THR A 195 ? 0.1701 0.1807 0.2550 -0.0185 -0.0007 0.0763  192  THR A C   
1692 O  O   . THR A 195 ? 0.1864 0.2015 0.2709 -0.0187 0.0021  0.0836  192  THR A O   
1693 C  CB  . THR A 195 ? 0.1862 0.2026 0.2756 -0.0199 0.0027  0.0741  192  THR A CB  
1694 O  OG1 . THR A 195 ? 0.1970 0.2125 0.2952 -0.0216 0.0011  0.0723  192  THR A OG1 
1695 C  CG2 . THR A 195 ? 0.1801 0.1971 0.2565 -0.0173 0.0040  0.0674  192  THR A CG2 
1696 N  N   . LEU A 196 ? 0.1812 0.1881 0.2589 -0.0167 -0.0027 0.0699  193  LEU A N   
1697 C  CA  . LEU A 196 ? 0.1814 0.1898 0.2494 -0.0147 -0.0018 0.0702  193  LEU A CA  
1698 C  C   . LEU A 196 ? 0.1718 0.1834 0.2287 -0.0130 0.0007  0.0651  193  LEU A C   
1699 O  O   . LEU A 196 ? 0.1769 0.1862 0.2324 -0.0127 -0.0006 0.0586  193  LEU A O   
1700 C  CB  . LEU A 196 ? 0.1868 0.1890 0.2558 -0.0137 -0.0060 0.0671  193  LEU A CB  
1701 C  CG  . LEU A 196 ? 0.1944 0.1981 0.2545 -0.0117 -0.0057 0.0673  193  LEU A CG  
1702 C  CD1 . LEU A 196 ? 0.2146 0.2224 0.2738 -0.0120 -0.0036 0.0759  193  LEU A CD1 
1703 C  CD2 . LEU A 196 ? 0.2257 0.2236 0.2880 -0.0105 -0.0099 0.0640  193  LEU A CD2 
1704 N  N   . LEU A 197 ? 0.1725 0.1894 0.2217 -0.0119 0.0039  0.0682  194  LEU A N   
1705 C  CA  . LEU A 197 ? 0.1884 0.2083 0.2272 -0.0102 0.0061  0.0641  194  LEU A CA  
1706 C  C   . LEU A 197 ? 0.1823 0.2011 0.2129 -0.0086 0.0044  0.0619  194  LEU A C   
1707 O  O   . LEU A 197 ? 0.1918 0.2110 0.2221 -0.0083 0.0037  0.0664  194  LEU A O   
1708 C  CB  . LEU A 197 ? 0.2106 0.2373 0.2458 -0.0095 0.0106  0.0686  194  LEU A CB  
1709 C  CG  . LEU A 197 ? 0.2289 0.2574 0.2733 -0.0111 0.0122  0.0706  194  LEU A CG  
1710 C  CD1 . LEU A 197 ? 0.2873 0.3200 0.3366 -0.0119 0.0144  0.0791  194  LEU A CD1 
1711 C  CD2 . LEU A 197 ? 0.2370 0.2684 0.2781 -0.0102 0.0146  0.0670  194  LEU A CD2 
1712 N  N   . ILE A 198 ? 0.1680 0.1856 0.1928 -0.0078 0.0035  0.0554  195  ILE A N   
1713 C  CA  . ILE A 198 ? 0.1614 0.1781 0.1791 -0.0065 0.0016  0.0525  195  ILE A CA  
1714 C  C   . ILE A 198 ? 0.1748 0.1948 0.1830 -0.0052 0.0034  0.0504  195  ILE A C   
1715 O  O   . ILE A 198 ? 0.1844 0.2045 0.1913 -0.0052 0.0045  0.0465  195  ILE A O   
1716 C  CB  . ILE A 198 ? 0.1623 0.1751 0.1817 -0.0066 -0.0011 0.0468  195  ILE A CB  
1717 C  CG1 . ILE A 198 ? 0.1761 0.1851 0.2044 -0.0073 -0.0033 0.0476  195  ILE A CG1 
1718 C  CG2 . ILE A 198 ? 0.1816 0.1948 0.1946 -0.0055 -0.0028 0.0446  195  ILE A CG2 
1719 C  CD1 . ILE A 198 ? 0.1985 0.2042 0.2289 -0.0070 -0.0054 0.0416  195  ILE A CD1 
1720 N  N   . ILE A 199 ? 0.1705 0.1930 0.1719 -0.0039 0.0035  0.0527  196  ILE A N   
1721 C  CA  . ILE A 199 ? 0.1756 0.2003 0.1670 -0.0023 0.0043  0.0496  196  ILE A CA  
1722 C  C   . ILE A 199 ? 0.1949 0.2171 0.1831 -0.0022 0.0007  0.0450  196  ILE A C   
1723 O  O   . ILE A 199 ? 0.1929 0.2153 0.1797 -0.0018 -0.0013 0.0471  196  ILE A O   
1724 C  CB  . ILE A 199 ? 0.1865 0.2158 0.1709 -0.0005 0.0063  0.0539  196  ILE A CB  
1725 C  CG1 . ILE A 199 ? 0.1917 0.2246 0.1803 -0.0006 0.0100  0.0597  196  ILE A CG1 
1726 C  CG2 . ILE A 199 ? 0.2128 0.2433 0.1867 0.0015  0.0064  0.0491  196  ILE A CG2 
1727 C  CD1 . ILE A 199 ? 0.2179 0.2560 0.1990 0.0016  0.0122  0.0647  196  ILE A CD1 
1728 N  N   . ALA A 200 ? 0.1695 0.1897 0.1572 -0.0027 -0.0001 0.0395  197  ALA A N   
1729 C  CA  . ALA A 200 ? 0.1581 0.1764 0.1446 -0.0030 -0.0032 0.0357  197  ALA A CA  
1730 C  C   . ALA A 200 ? 0.1725 0.1918 0.1506 -0.0020 -0.0040 0.0328  197  ALA A C   
1731 O  O   . ALA A 200 ? 0.1800 0.1987 0.1561 -0.0018 -0.0030 0.0295  197  ALA A O   
1732 C  CB  . ALA A 200 ? 0.1650 0.1807 0.1572 -0.0041 -0.0036 0.0322  197  ALA A CB  
1733 N  N   . SER A 201 ? 0.1797 0.2001 0.1529 -0.0012 -0.0061 0.0338  198  SER A N   
1734 C  CA  . SER A 201 ? 0.1902 0.2108 0.1553 -0.0001 -0.0077 0.0304  198  SER A CA  
1735 C  C   . SER A 201 ? 0.1857 0.2068 0.1481 0.0001  -0.0116 0.0307  198  SER A C   
1736 O  O   . SER A 201 ? 0.2075 0.2306 0.1672 0.0011  -0.0118 0.0345  198  SER A O   
1737 C  CB  . SER A 201 ? 0.1929 0.2160 0.1511 0.0021  -0.0051 0.0316  198  SER A CB  
1738 O  OG  . SER A 201 ? 0.2062 0.2290 0.1559 0.0036  -0.0069 0.0276  198  SER A OG  
1739 N  N   . LYS A 202 ? 0.1928 0.2123 0.1562 -0.0010 -0.0146 0.0270  199  LYS A N   
1740 C  CA  . LYS A 202 ? 0.1931 0.2132 0.1550 -0.0012 -0.0188 0.0269  199  LYS A CA  
1741 C  C   . LYS A 202 ? 0.2125 0.2340 0.1651 0.0008  -0.0201 0.0271  199  LYS A C   
1742 O  O   . LYS A 202 ? 0.2237 0.2470 0.1746 0.0015  -0.0219 0.0302  199  LYS A O   
1743 C  CB  . LYS A 202 ? 0.2091 0.2275 0.1737 -0.0028 -0.0216 0.0229  199  LYS A CB  
1744 C  CG  . LYS A 202 ? 0.2102 0.2298 0.1751 -0.0034 -0.0262 0.0230  199  LYS A CG  
1745 C  CD  . LYS A 202 ? 0.1992 0.2177 0.1680 -0.0053 -0.0288 0.0198  199  LYS A CD  
1746 C  CE  . LYS A 202 ? 0.2033 0.2236 0.1735 -0.0061 -0.0337 0.0202  199  LYS A CE  
1747 N  NZ  . LYS A 202 ? 0.1973 0.2169 0.1729 -0.0084 -0.0362 0.0178  199  LYS A NZ  
1748 N  N   . SER A 203 ? 0.2166 0.2372 0.1628 0.0020  -0.0195 0.0239  200  SER A N   
1749 C  CA  . SER A 203 ? 0.2236 0.2454 0.1592 0.0046  -0.0210 0.0231  200  SER A CA  
1750 C  C   . SER A 203 ? 0.2390 0.2642 0.1700 0.0070  -0.0170 0.0275  200  SER A C   
1751 O  O   . SER A 203 ? 0.2541 0.2816 0.1765 0.0094  -0.0181 0.0285  200  SER A O   
1752 C  CB  . SER A 203 ? 0.2409 0.2601 0.1711 0.0056  -0.0220 0.0172  200  SER A CB  
1753 O  OG  . SER A 203 ? 0.2419 0.2609 0.1729 0.0063  -0.0175 0.0166  200  SER A OG  
1754 N  N   . PHE A 204 ? 0.2368 0.2628 0.1730 0.0065  -0.0124 0.0302  201  PHE A N   
1755 C  CA  . PHE A 204 ? 0.2463 0.2758 0.1800 0.0083  -0.0080 0.0345  201  PHE A CA  
1756 C  C   . PHE A 204 ? 0.2695 0.3007 0.1927 0.0116  -0.0066 0.0319  201  PHE A C   
1757 O  O   . PHE A 204 ? 0.3066 0.3421 0.2246 0.0141  -0.0037 0.0358  201  PHE A O   
1758 C  CB  . PHE A 204 ? 0.2515 0.2839 0.1856 0.0087  -0.0080 0.0413  201  PHE A CB  
1759 C  CG  . PHE A 204 ? 0.2564 0.2903 0.1982 0.0076  -0.0038 0.0471  201  PHE A CG  
1760 C  CD1 . PHE A 204 ? 0.2351 0.2660 0.1874 0.0050  -0.0039 0.0468  201  PHE A CD1 
1761 C  CD2 . PHE A 204 ? 0.2730 0.3113 0.2119 0.0094  0.0001  0.0525  201  PHE A CD2 
1762 C  CE1 . PHE A 204 ? 0.2573 0.2888 0.2178 0.0038  -0.0008 0.0514  201  PHE A CE1 
1763 C  CE2 . PHE A 204 ? 0.2866 0.3259 0.2346 0.0079  0.0034  0.0580  201  PHE A CE2 
1764 C  CZ  . PHE A 204 ? 0.2430 0.2784 0.2017 0.0050  0.0026  0.0568  201  PHE A CZ  
1765 N  N   . SER A 205 ? 0.2643 0.2924 0.1846 0.0120  -0.0086 0.0253  202  SER A N   
1766 C  CA  . SER A 205 ? 0.2830 0.3123 0.1935 0.0157  -0.0073 0.0220  202  SER A CA  
1767 C  C   . SER A 205 ? 0.2790 0.3052 0.1913 0.0157  -0.0063 0.0168  202  SER A C   
1768 O  O   . SER A 205 ? 0.3326 0.3584 0.2370 0.0189  -0.0066 0.0123  202  SER A O   
1769 C  CB  . SER A 205 ? 0.3381 0.3666 0.2384 0.0180  -0.0120 0.0186  202  SER A CB  
1770 O  OG  . SER A 205 ? 0.3386 0.3624 0.2421 0.0155  -0.0174 0.0142  202  SER A OG  
1771 N  N   . THR A 206 ? 0.2475 0.2721 0.1700 0.0127  -0.0050 0.0175  203  THR A N   
1772 C  CA  . THR A 206 ? 0.2088 0.2304 0.1341 0.0123  -0.0045 0.0130  203  THR A CA  
1773 C  C   . THR A 206 ? 0.2263 0.2515 0.1508 0.0148  0.0010  0.0146  203  THR A C   
1774 O  O   . THR A 206 ? 0.2476 0.2765 0.1769 0.0140  0.0047  0.0202  203  THR A O   
1775 C  CB  . THR A 206 ? 0.2079 0.2268 0.1439 0.0084  -0.0051 0.0135  203  THR A CB  
1776 O  OG1 . THR A 206 ? 0.2218 0.2383 0.1589 0.0065  -0.0099 0.0124  203  THR A OG1 
1777 C  CG2 . THR A 206 ? 0.2173 0.2332 0.1565 0.0080  -0.0047 0.0094  203  THR A CG2 
1778 N  N   . GLU A 207 ? 0.2507 0.2750 0.1692 0.0178  0.0013  0.0098  204  GLU A N   
1779 C  CA  A GLU A 207 ? 0.2547 0.2834 0.1713 0.0210  0.0066  0.0109  204  GLU A CA  
1780 C  CA  B GLU A 207 ? 0.2507 0.2799 0.1674 0.0209  0.0068  0.0116  204  GLU A CA  
1781 C  C   . GLU A 207 ? 0.2403 0.2711 0.1678 0.0186  0.0106  0.0151  204  GLU A C   
1782 O  O   . GLU A 207 ? 0.2356 0.2720 0.1649 0.0195  0.0151  0.0204  204  GLU A O   
1783 C  CB  A GLU A 207 ? 0.2750 0.3006 0.1866 0.0239  0.0055  0.0038  204  GLU A CB  
1784 C  CB  B GLU A 207 ? 0.2725 0.3004 0.1811 0.0251  0.0064  0.0054  204  GLU A CB  
1785 C  CG  A GLU A 207 ? 0.3243 0.3553 0.2328 0.0283  0.0112  0.0045  204  GLU A CG  
1786 C  CG  B GLU A 207 ? 0.3124 0.3400 0.2088 0.0285  0.0033  0.0024  204  GLU A CG  
1787 C  CD  A GLU A 207 ? 0.3738 0.4017 0.2795 0.0313  0.0107  -0.0022 204  GLU A CD  
1788 C  CD  B GLU A 207 ? 0.3690 0.4041 0.2581 0.0322  0.0076  0.0071  204  GLU A CD  
1789 O  OE1 A GLU A 207 ? 0.4069 0.4284 0.3165 0.0291  0.0069  -0.0064 204  GLU A OE1 
1790 O  OE1 B GLU A 207 ? 0.4113 0.4519 0.3028 0.0338  0.0134  0.0108  204  GLU A OE1 
1791 O  OE2 A GLU A 207 ? 0.4400 0.4723 0.3399 0.0362  0.0144  -0.0029 204  GLU A OE2 
1792 O  OE2 B GLU A 207 ? 0.4531 0.4892 0.3342 0.0337  0.0051  0.0075  204  GLU A OE2 
1793 N  N   . GLU A 208 ? 0.2199 0.2463 0.1550 0.0155  0.0087  0.0129  205  GLU A N   
1794 C  CA  . GLU A 208 ? 0.2062 0.2340 0.1513 0.0135  0.0119  0.0159  205  GLU A CA  
1795 C  C   . GLU A 208 ? 0.2004 0.2311 0.1515 0.0112  0.0133  0.0225  205  GLU A C   
1796 O  O   . GLU A 208 ? 0.1981 0.2327 0.1546 0.0111  0.0170  0.0267  205  GLU A O   
1797 C  CB  . GLU A 208 ? 0.1965 0.2192 0.1478 0.0108  0.0093  0.0123  205  GLU A CB  
1798 C  CG  . GLU A 208 ? 0.2082 0.2275 0.1554 0.0127  0.0077  0.0063  205  GLU A CG  
1799 C  CD  . GLU A 208 ? 0.2399 0.2542 0.1823 0.0123  0.0024  0.0019  205  GLU A CD  
1800 O  OE1 . GLU A 208 ? 0.2299 0.2448 0.1672 0.0125  0.0005  0.0028  205  GLU A OE1 
1801 O  OE2 . GLU A 208 ? 0.1984 0.2084 0.1421 0.0118  0.0001  -0.0023 205  GLU A OE2 
1802 N  N   . THR A 209 ? 0.2060 0.2345 0.1569 0.0094  0.0101  0.0232  206  THR A N   
1803 C  CA  . THR A 209 ? 0.1919 0.2217 0.1488 0.0073  0.0105  0.0289  206  THR A CA  
1804 C  C   . THR A 209 ? 0.2055 0.2411 0.1583 0.0094  0.0137  0.0344  206  THR A C   
1805 O  O   . THR A 209 ? 0.2121 0.2503 0.1715 0.0082  0.0160  0.0400  206  THR A O   
1806 C  CB  . THR A 209 ? 0.1996 0.2260 0.1570 0.0054  0.0062  0.0277  206  THR A CB  
1807 O  OG1 . THR A 209 ? 0.1934 0.2155 0.1547 0.0036  0.0040  0.0233  206  THR A OG1 
1808 C  CG2 . THR A 209 ? 0.2096 0.2368 0.1736 0.0035  0.0063  0.0334  206  THR A CG2 
1809 N  N   . LEU A 210 ? 0.2168 0.2544 0.1588 0.0128  0.0137  0.0330  207  LEU A N   
1810 C  CA  . LEU A 210 ? 0.2500 0.2939 0.1869 0.0155  0.0172  0.0382  207  LEU A CA  
1811 C  C   . LEU A 210 ? 0.2299 0.2786 0.1717 0.0163  0.0225  0.0414  207  LEU A C   
1812 O  O   . LEU A 210 ? 0.2269 0.2802 0.1739 0.0156  0.0257  0.0487  207  LEU A O   
1813 C  CB  . LEU A 210 ? 0.2927 0.3372 0.2160 0.0195  0.0157  0.0341  207  LEU A CB  
1814 C  CG  . LEU A 210 ? 0.3993 0.4406 0.3161 0.0194  0.0103  0.0319  207  LEU A CG  
1815 C  CD1 . LEU A 210 ? 0.4434 0.4832 0.3480 0.0232  0.0077  0.0250  207  LEU A CD1 
1816 C  CD2 . LEU A 210 ? 0.4910 0.5364 0.4059 0.0198  0.0110  0.0387  207  LEU A CD2 
1817 N  N   . LEU A 211 ? 0.2221 0.2699 0.1630 0.0178  0.0235  0.0364  208  LEU A N   
1818 C  CA  . LEU A 211 ? 0.2170 0.2703 0.1622 0.0192  0.0287  0.0392  208  LEU A CA  
1819 C  C   . LEU A 211 ? 0.1865 0.2397 0.1457 0.0149  0.0294  0.0437  208  LEU A C   
1820 O  O   . LEU A 211 ? 0.1986 0.2575 0.1636 0.0148  0.0335  0.0501  208  LEU A O   
1821 C  CB  . LEU A 211 ? 0.2302 0.2824 0.1726 0.0217  0.0292  0.0328  208  LEU A CB  
1822 C  CG  . LEU A 211 ? 0.3304 0.3861 0.2616 0.0273  0.0313  0.0299  208  LEU A CG  
1823 C  CD1 . LEU A 211 ? 0.3743 0.4268 0.2937 0.0291  0.0272  0.0262  208  LEU A CD1 
1824 C  CD2 . LEU A 211 ? 0.3500 0.4044 0.2818 0.0294  0.0321  0.0244  208  LEU A CD2 
1825 N  N   . ASN A 212 ? 0.1856 0.2323 0.1503 0.0117  0.0256  0.0404  209  ASN A N   
1826 C  CA  . ASN A 212 ? 0.1733 0.2190 0.1504 0.0080  0.0255  0.0436  209  ASN A CA  
1827 C  C   . ASN A 212 ? 0.1861 0.2337 0.1678 0.0062  0.0259  0.0509  209  ASN A C   
1828 O  O   . ASN A 212 ? 0.1726 0.2230 0.1634 0.0046  0.0280  0.0562  209  ASN A O   
1829 C  CB  . ASN A 212 ? 0.1638 0.2025 0.1445 0.0054  0.0212  0.0386  209  ASN A CB  
1830 C  CG  . ASN A 212 ? 0.1802 0.2170 0.1617 0.0060  0.0211  0.0332  209  ASN A CG  
1831 O  OD1 . ASN A 212 ? 0.1918 0.2325 0.1761 0.0072  0.0244  0.0345  209  ASN A OD1 
1832 N  ND2 . ASN A 212 ? 0.1616 0.1930 0.1410 0.0052  0.0175  0.0278  209  ASN A ND2 
1833 N  N   . SER A 213 ? 0.1953 0.2416 0.1706 0.0067  0.0237  0.0514  210  SER A N   
1834 C  CA  A SER A 213 ? 0.1994 0.2470 0.1788 0.0052  0.0235  0.0583  210  SER A CA  
1835 C  CA  B SER A 213 ? 0.1966 0.2440 0.1758 0.0052  0.0234  0.0582  210  SER A CA  
1836 C  C   . SER A 213 ? 0.1906 0.2459 0.1692 0.0070  0.0283  0.0656  210  SER A C   
1837 O  O   . SER A 213 ? 0.2030 0.2603 0.1906 0.0049  0.0296  0.0726  210  SER A O   
1838 C  CB  A SER A 213 ? 0.2025 0.2474 0.1746 0.0057  0.0200  0.0570  210  SER A CB  
1839 C  CB  B SER A 213 ? 0.1957 0.2400 0.1683 0.0055  0.0196  0.0566  210  SER A CB  
1840 O  OG  A SER A 213 ? 0.1999 0.2387 0.1745 0.0038  0.0159  0.0517  210  SER A OG  
1841 O  OG  B SER A 213 ? 0.2131 0.2594 0.1732 0.0088  0.0196  0.0538  210  SER A OG  
1842 N  N   . ILE A 214 ? 0.1964 0.2563 0.1648 0.0109  0.0310  0.0643  211  ILE A N   
1843 C  CA  . ILE A 214 ? 0.2077 0.2762 0.1744 0.0133  0.0363  0.0711  211  ILE A CA  
1844 C  C   . ILE A 214 ? 0.2003 0.2723 0.1786 0.0118  0.0398  0.0745  211  ILE A C   
1845 O  O   . ILE A 214 ? 0.2048 0.2823 0.1903 0.0107  0.0428  0.0830  211  ILE A O   
1846 C  CB  . ILE A 214 ? 0.2233 0.2956 0.1757 0.0186  0.0382  0.0675  211  ILE A CB  
1847 C  CG1 . ILE A 214 ? 0.2599 0.3298 0.2013 0.0199  0.0345  0.0661  211  ILE A CG1 
1848 C  CG2 . ILE A 214 ? 0.2708 0.3531 0.2216 0.0217  0.0445  0.0739  211  ILE A CG2 
1849 C  CD1 . ILE A 214 ? 0.3363 0.4069 0.2633 0.0248  0.0341  0.0595  211  ILE A CD1 
1850 N  N   . SER A 215 ? 0.1983 0.2676 0.1793 0.0116  0.0392  0.0682  212  SER A N   
1851 C  CA  . SER A 215 ? 0.1883 0.2606 0.1811 0.0099  0.0418  0.0711  212  SER A CA  
1852 C  C   . SER A 215 ? 0.1924 0.2618 0.1990 0.0050  0.0396  0.0758  212  SER A C   
1853 O  O   . SER A 215 ? 0.2020 0.2764 0.2186 0.0036  0.0423  0.0824  212  SER A O   
1854 C  CB  . SER A 215 ? 0.1971 0.2666 0.1895 0.0108  0.0411  0.0634  212  SER A CB  
1855 O  OG  . SER A 215 ? 0.2014 0.2749 0.1831 0.0157  0.0439  0.0602  212  SER A OG  
1856 N  N   . ALA A 216 ? 0.1873 0.2489 0.1945 0.0027  0.0346  0.0726  213  ALA A N   
1857 C  CA  . ALA A 216 ? 0.1756 0.2335 0.1948 -0.0013 0.0319  0.0760  213  ALA A CA  
1858 C  C   . ALA A 216 ? 0.2009 0.2627 0.2232 -0.0019 0.0335  0.0852  213  ALA A C   
1859 O  O   . ALA A 216 ? 0.1997 0.2621 0.2340 -0.0047 0.0335  0.0909  213  ALA A O   
1860 C  CB  . ALA A 216 ? 0.1919 0.2411 0.2095 -0.0027 0.0265  0.0699  213  ALA A CB  
1861 N  N   . ARG A 217 ? 0.2118 0.2761 0.2236 0.0006  0.0345  0.0870  214  ARG A N   
1862 C  CA  A ARG A 217 ? 0.2092 0.2774 0.2231 0.0002  0.0360  0.0962  214  ARG A CA  
1863 C  CA  B ARG A 217 ? 0.2204 0.2889 0.2338 0.0003  0.0361  0.0963  214  ARG A CA  
1864 C  C   . ARG A 217 ? 0.2318 0.3094 0.2509 0.0008  0.0417  0.1038  214  ARG A C   
1865 O  O   . ARG A 217 ? 0.2230 0.3031 0.2524 -0.0016 0.0426  0.1125  214  ARG A O   
1866 C  CB  A ARG A 217 ? 0.2298 0.2990 0.2300 0.0032  0.0355  0.0958  214  ARG A CB  
1867 C  CB  B ARG A 217 ? 0.2375 0.3076 0.2367 0.0036  0.0361  0.0962  214  ARG A CB  
1868 C  CG  A ARG A 217 ? 0.2500 0.3232 0.2511 0.0031  0.0368  0.1058  214  ARG A CG  
1869 C  CG  B ARG A 217 ? 0.2648 0.3398 0.2646 0.0037  0.0378  0.1066  214  ARG A CG  
1870 C  CD  A ARG A 217 ? 0.2628 0.3367 0.2493 0.0064  0.0357  0.1044  214  ARG A CD  
1871 C  CD  B ARG A 217 ? 0.3081 0.3856 0.2922 0.0077  0.0379  0.1061  214  ARG A CD  
1872 N  NE  A ARG A 217 ? 0.2951 0.3754 0.2699 0.0108  0.0396  0.1021  214  ARG A NE  
1873 N  NE  B ARG A 217 ? 0.3536 0.4310 0.3380 0.0070  0.0362  0.1130  214  ARG A NE  
1874 C  CZ  A ARG A 217 ? 0.3392 0.4198 0.2994 0.0145  0.0386  0.0975  214  ARG A CZ  
1875 C  CZ  B ARG A 217 ? 0.4094 0.4942 0.3908 0.0087  0.0396  0.1221  214  ARG A CZ  
1876 N  NH1 A ARG A 217 ? 0.3850 0.4608 0.3403 0.0142  0.0339  0.0954  214  ARG A NH1 
1877 N  NH1 B ARG A 217 ? 0.4057 0.4892 0.3876 0.0079  0.0373  0.1279  214  ARG A NH1 
1878 N  NH2 A ARG A 217 ? 0.3912 0.4775 0.3417 0.0187  0.0423  0.0954  214  ARG A NH2 
1879 N  NH2 B ARG A 217 ? 0.4439 0.5377 0.4217 0.0114  0.0454  0.1258  214  ARG A NH2 
1880 N  N   . GLU A 218 ? 0.2262 0.3089 0.2392 0.0040  0.0454  0.1007  215  GLU A N   
1881 C  CA  . GLU A 218 ? 0.2285 0.3211 0.2469 0.0050  0.0513  0.1076  215  GLU A CA  
1882 C  C   . GLU A 218 ? 0.2215 0.3132 0.2574 0.0006  0.0506  0.1107  215  GLU A C   
1883 O  O   . GLU A 218 ? 0.2366 0.3345 0.2823 -0.0009 0.0534  0.1199  215  GLU A O   
1884 C  CB  . GLU A 218 ? 0.2476 0.3448 0.2559 0.0097  0.0548  0.1021  215  GLU A CB  
1885 C  CG  . GLU A 218 ? 0.2976 0.3981 0.2898 0.0144  0.0564  0.1015  215  GLU A CG  
1886 C  CD  . GLU A 218 ? 0.4497 0.5539 0.4307 0.0197  0.0594  0.0951  215  GLU A CD  
1887 O  OE1 . GLU A 218 ? 0.5352 0.6378 0.5207 0.0196  0.0594  0.0899  215  GLU A OE1 
1888 O  OE2 . GLU A 218 ? 0.4933 0.6010 0.4604 0.0243  0.0609  0.0945  215  GLU A OE2 
1889 N  N   . TRP A 219 ? 0.1957 0.2796 0.2361 -0.0016 0.0463  0.1032  216  TRP A N   
1890 C  CA  . TRP A 219 ? 0.1948 0.2764 0.2512 -0.0057 0.0442  0.1049  216  TRP A CA  
1891 C  C   . TRP A 219 ? 0.2040 0.2826 0.2707 -0.0095 0.0415  0.1118  216  TRP A C   
1892 O  O   . TRP A 219 ? 0.2127 0.2946 0.2930 -0.0123 0.0424  0.1190  216  TRP A O   
1893 C  CB  . TRP A 219 ? 0.1943 0.2675 0.2503 -0.0066 0.0397  0.0948  216  TRP A CB  
1894 C  CG  . TRP A 219 ? 0.1906 0.2585 0.2600 -0.0106 0.0357  0.0940  216  TRP A CG  
1895 C  CD1 . TRP A 219 ? 0.2030 0.2736 0.2833 -0.0121 0.0363  0.0947  216  TRP A CD1 
1896 C  CD2 . TRP A 219 ? 0.1949 0.2538 0.2685 -0.0133 0.0299  0.0917  216  TRP A CD2 
1897 N  NE1 . TRP A 219 ? 0.2178 0.2811 0.3081 -0.0156 0.0309  0.0927  216  TRP A NE1 
1898 C  CE2 . TRP A 219 ? 0.2100 0.2660 0.2962 -0.0162 0.0270  0.0905  216  TRP A CE2 
1899 C  CE3 . TRP A 219 ? 0.2169 0.2698 0.2844 -0.0132 0.0267  0.0898  216  TRP A CE3 
1900 C  CZ2 . TRP A 219 ? 0.2117 0.2590 0.3037 -0.0186 0.0211  0.0872  216  TRP A CZ2 
1901 C  CZ3 . TRP A 219 ? 0.2058 0.2505 0.2800 -0.0156 0.0212  0.0870  216  TRP A CZ3 
1902 C  CH2 . TRP A 219 ? 0.2121 0.2538 0.2977 -0.0181 0.0185  0.0853  216  TRP A CH2 
1903 N  N   . LEU A 220 ? 0.1983 0.2707 0.2585 -0.0094 0.0380  0.1099  217  LEU A N   
1904 C  CA  . LEU A 220 ? 0.2087 0.2771 0.2780 -0.0126 0.0348  0.1158  217  LEU A CA  
1905 C  C   . LEU A 220 ? 0.2168 0.2937 0.2903 -0.0127 0.0391  0.1275  217  LEU A C   
1906 O  O   . LEU A 220 ? 0.2200 0.2969 0.3077 -0.0162 0.0381  0.1350  217  LEU A O   
1907 C  CB  . LEU A 220 ? 0.2101 0.2714 0.2706 -0.0118 0.0307  0.1114  217  LEU A CB  
1908 C  CG  . LEU A 220 ? 0.2364 0.2920 0.3064 -0.0147 0.0266  0.1161  217  LEU A CG  
1909 C  CD1 . LEU A 220 ? 0.2649 0.3119 0.3445 -0.0174 0.0214  0.1107  217  LEU A CD1 
1910 C  CD2 . LEU A 220 ? 0.2942 0.3474 0.3539 -0.0128 0.0249  0.1160  217  LEU A CD2 
1911 N  N   . LEU A 221 ? 0.2235 0.3076 0.2847 -0.0089 0.0436  0.1298  218  LEU A N   
1912 C  CA  . LEU A 221 ? 0.2510 0.3442 0.3137 -0.0082 0.0483  0.1415  218  LEU A CA  
1913 C  C   . LEU A 221 ? 0.2304 0.3332 0.3028 -0.0087 0.0534  0.1479  218  LEU A C   
1914 O  O   . LEU A 221 ? 0.2420 0.3513 0.3228 -0.0102 0.0563  0.1592  218  LEU A O   
1915 C  CB  . LEU A 221 ? 0.2616 0.3592 0.3064 -0.0034 0.0510  0.1412  218  LEU A CB  
1916 C  CG  . LEU A 221 ? 0.3181 0.4071 0.3556 -0.0034 0.0455  0.1370  218  LEU A CG  
1917 C  CD1 . LEU A 221 ? 0.3364 0.4302 0.3568 0.0012  0.0478  0.1376  218  LEU A CD1 
1918 C  CD2 . LEU A 221 ? 0.3887 0.4720 0.4386 -0.0076 0.0414  0.1434  218  LEU A CD2 
1919 N  N   . ASP A 222 ? 0.2389 0.3430 0.3109 -0.0076 0.0548  0.1412  219  ASP A N   
1920 C  CA  . ASP A 222 ? 0.2481 0.3606 0.3322 -0.0086 0.0589  0.1469  219  ASP A CA  
1921 C  C   . ASP A 222 ? 0.2405 0.3494 0.3441 -0.0145 0.0552  0.1529  219  ASP A C   
1922 O  O   . ASP A 222 ? 0.2658 0.3828 0.3818 -0.0163 0.0585  0.1630  219  ASP A O   
1923 C  CB  . ASP A 222 ? 0.2697 0.3823 0.3516 -0.0068 0.0595  0.1379  219  ASP A CB  
1924 C  CG  . ASP A 222 ? 0.3155 0.4352 0.4127 -0.0087 0.0623  0.1430  219  ASP A CG  
1925 O  OD1 . ASP A 222 ? 0.3921 0.5237 0.4890 -0.0062 0.0689  0.1502  219  ASP A OD1 
1926 O  OD2 . ASP A 222 ? 0.3694 0.4831 0.4786 -0.0126 0.0578  0.1400  219  ASP A OD2 
1927 N  N   . HIS A 223 ? 0.2327 0.3298 0.3398 -0.0173 0.0483  0.1467  220  HIS A N   
1928 C  CA  . HIS A 223 ? 0.2233 0.3153 0.3481 -0.0225 0.0437  0.1510  220  HIS A CA  
1929 C  C   . HIS A 223 ? 0.2286 0.3211 0.3588 -0.0244 0.0434  0.1615  220  HIS A C   
1930 O  O   . HIS A 223 ? 0.2388 0.3357 0.3841 -0.0276 0.0443  0.1714  220  HIS A O   
1931 C  CB  . HIS A 223 ? 0.2320 0.3114 0.3577 -0.0242 0.0366  0.1408  220  HIS A CB  
1932 C  CG  . HIS A 223 ? 0.2714 0.3447 0.4144 -0.0290 0.0311  0.1440  220  HIS A CG  
1933 N  ND1 . HIS A 223 ? 0.3192 0.3946 0.4773 -0.0320 0.0304  0.1462  220  HIS A ND1 
1934 C  CD2 . HIS A 223 ? 0.2894 0.3547 0.4379 -0.0313 0.0261  0.1462  220  HIS A CD2 
1935 C  CE1 . HIS A 223 ? 0.3287 0.3972 0.5007 -0.0361 0.0248  0.1492  220  HIS A CE1 
1936 N  NE2 . HIS A 223 ? 0.3352 0.3973 0.5016 -0.0356 0.0221  0.1491  220  HIS A NE2 
1937 N  N   . TYR A 224 ? 0.2224 0.3099 0.3415 -0.0227 0.0414  0.1592  221  TYR A N   
1938 C  CA  . TYR A 224 ? 0.2405 0.3267 0.3646 -0.0245 0.0400  0.1684  221  TYR A CA  
1939 C  C   . TYR A 224 ? 0.2521 0.3498 0.3720 -0.0225 0.0464  0.1796  221  TYR A C   
1940 O  O   . TYR A 224 ? 0.2649 0.3639 0.3941 -0.0249 0.0461  0.1902  221  TYR A O   
1941 C  CB  . TYR A 224 ? 0.2366 0.3132 0.3507 -0.0232 0.0352  0.1617  221  TYR A CB  
1942 C  CG  . TYR A 224 ? 0.2275 0.2918 0.3489 -0.0258 0.0279  0.1543  221  TYR A CG  
1943 C  CD1 . TYR A 224 ? 0.2274 0.2866 0.3647 -0.0298 0.0236  0.1599  221  TYR A CD1 
1944 C  CD2 . TYR A 224 ? 0.2205 0.2783 0.3327 -0.0241 0.0250  0.1422  221  TYR A CD2 
1945 C  CE1 . TYR A 224 ? 0.2333 0.2808 0.3764 -0.0315 0.0166  0.1529  221  TYR A CE1 
1946 C  CE2 . TYR A 224 ? 0.2018 0.2487 0.3198 -0.0259 0.0184  0.1354  221  TYR A CE2 
1947 C  CZ  . TYR A 224 ? 0.2021 0.2438 0.3351 -0.0294 0.0142  0.1409  221  TYR A CZ  
1948 O  OH  . TYR A 224 ? 0.2442 0.2750 0.3824 -0.0305 0.0076  0.1344  221  TYR A OH  
1949 N  N   . GLU A 225 ? 0.2479 0.3539 0.3532 -0.0177 0.0521  0.1776  222  GLU A N   
1950 C  CA  . GLU A 225 ? 0.2664 0.3842 0.3656 -0.0149 0.0586  0.1878  222  GLU A CA  
1951 C  C   . GLU A 225 ? 0.2786 0.3938 0.3727 -0.0146 0.0566  0.1935  222  GLU A C   
1952 O  O   . GLU A 225 ? 0.3066 0.4301 0.4033 -0.0145 0.0604  0.2058  222  GLU A O   
1953 C  CB  . GLU A 225 ? 0.2819 0.4098 0.3974 -0.0174 0.0631  0.1992  222  GLU A CB  
1954 C  CG  . GLU A 225 ? 0.2851 0.4160 0.4063 -0.0176 0.0648  0.1939  222  GLU A CG  
1955 C  CD  . GLU A 225 ? 0.2896 0.4313 0.4280 -0.0201 0.0692  0.2058  222  GLU A CD  
1956 O  OE1 . GLU A 225 ? 0.3260 0.4713 0.4734 -0.0226 0.0702  0.2177  222  GLU A OE1 
1957 O  OE2 . GLU A 225 ? 0.3324 0.4786 0.4762 -0.0200 0.0714  0.2029  222  GLU A OE2 
1958 N  N   . ASP A 226 ? 0.2896 0.3938 0.3771 -0.0145 0.0507  0.1849  223  ASP A N   
1959 C  CA  . ASP A 226 ? 0.3004 0.4004 0.3845 -0.0145 0.0476  0.1892  223  ASP A CA  
1960 C  C   . ASP A 226 ? 0.3160 0.4081 0.3856 -0.0119 0.0436  0.1770  223  ASP A C   
1961 O  O   . ASP A 226 ? 0.2879 0.3707 0.3612 -0.0136 0.0388  0.1679  223  ASP A O   
1962 C  CB  . ASP A 226 ? 0.3014 0.3936 0.4040 -0.0198 0.0423  0.1945  223  ASP A CB  
1963 C  CG  . ASP A 226 ? 0.3374 0.4272 0.4388 -0.0198 0.0400  0.2019  223  ASP A CG  
1964 O  OD1 . ASP A 226 ? 0.3264 0.4164 0.4117 -0.0161 0.0401  0.1984  223  ASP A OD1 
1965 O  OD2 . ASP A 226 ? 0.3550 0.4423 0.4721 -0.0237 0.0377  0.2108  223  ASP A OD2 
1966 N  N   . GLU A 227 ? 0.3395 0.4360 0.3929 -0.0077 0.0457  0.1771  224  GLU A N   
1967 C  CA  . GLU A 227 ? 0.3620 0.4521 0.4013 -0.0051 0.0419  0.1665  224  GLU A CA  
1968 C  C   . GLU A 227 ? 0.3443 0.4233 0.3893 -0.0076 0.0350  0.1637  224  GLU A C   
1969 O  O   . GLU A 227 ? 0.3528 0.4249 0.3914 -0.0067 0.0312  0.1531  224  GLU A O   
1970 C  CB  . GLU A 227 ? 0.3980 0.4956 0.4205 -0.0003 0.0451  0.1696  224  GLU A CB  
1971 C  CG  . GLU A 227 ? 0.5020 0.6035 0.5101 0.0040  0.0480  0.1605  224  GLU A CG  
1972 C  CD  . GLU A 227 ? 0.6162 0.7299 0.6133 0.0086  0.0545  0.1662  224  GLU A CD  
1973 O  OE1 . GLU A 227 ? 0.6883 0.8055 0.6766 0.0109  0.0548  0.1717  224  GLU A OE1 
1974 O  OE2 . GLU A 227 ? 0.6967 0.8166 0.6933 0.0103  0.0593  0.1647  224  GLU A OE2 
1975 N  N   . LYS A 228 ? 0.3413 0.4184 0.3990 -0.0106 0.0332  0.1729  225  LYS A N   
1976 C  CA  A LYS A 228 ? 0.3371 0.4035 0.4012 -0.0126 0.0266  0.1706  225  LYS A CA  
1977 C  CA  B LYS A 228 ? 0.3313 0.3978 0.3957 -0.0127 0.0266  0.1708  225  LYS A CA  
1978 C  C   . LYS A 228 ? 0.3108 0.3684 0.3822 -0.0147 0.0225  0.1604  225  LYS A C   
1979 O  O   . LYS A 228 ? 0.3128 0.3618 0.3848 -0.0150 0.0173  0.1547  225  LYS A O   
1980 C  CB  A LYS A 228 ? 0.3585 0.4243 0.4355 -0.0153 0.0253  0.1828  225  LYS A CB  
1981 C  CB  B LYS A 228 ? 0.3467 0.4125 0.4250 -0.0157 0.0254  0.1830  225  LYS A CB  
1982 C  CG  A LYS A 228 ? 0.4019 0.4748 0.4701 -0.0128 0.0280  0.1922  225  LYS A CG  
1983 C  CG  B LYS A 228 ? 0.3651 0.4389 0.4369 -0.0137 0.0287  0.1942  225  LYS A CG  
1984 C  CD  A LYS A 228 ? 0.4573 0.5315 0.5396 -0.0158 0.0279  0.2061  225  LYS A CD  
1985 C  CD  B LYS A 228 ? 0.3887 0.4624 0.4771 -0.0173 0.0280  0.2072  225  LYS A CD  
1986 C  CE  A LYS A 228 ? 0.4821 0.5623 0.5554 -0.0132 0.0297  0.2157  225  LYS A CE  
1987 C  CE  B LYS A 228 ? 0.3788 0.4397 0.4798 -0.0203 0.0206  0.2040  225  LYS A CE  
1988 N  NZ  A LYS A 228 ? 0.5116 0.5979 0.5641 -0.0082 0.0327  0.2100  225  LYS A NZ  
1989 N  NZ  B LYS A 228 ? 0.3601 0.4186 0.4811 -0.0250 0.0194  0.2105  225  LYS A NZ  
1990 N  N   . ALA A 229 ? 0.2813 0.3412 0.3578 -0.0160 0.0249  0.1579  226  ALA A N   
1991 C  CA  . ALA A 229 ? 0.2716 0.3238 0.3535 -0.0176 0.0212  0.1482  226  ALA A CA  
1992 C  C   . ALA A 229 ? 0.2531 0.3014 0.3225 -0.0150 0.0193  0.1364  226  ALA A C   
1993 O  O   . ALA A 229 ? 0.2643 0.3050 0.3373 -0.0160 0.0152  0.1287  226  ALA A O   
1994 C  CB  . ALA A 229 ? 0.2758 0.3326 0.3656 -0.0192 0.0244  0.1487  226  ALA A CB  
1995 N  N   . VAL A 230 ? 0.2591 0.3127 0.3135 -0.0116 0.0223  0.1347  227  VAL A N   
1996 C  CA  . VAL A 230 ? 0.2714 0.3210 0.3145 -0.0094 0.0200  0.1242  227  VAL A CA  
1997 C  C   . VAL A 230 ? 0.2622 0.3033 0.3077 -0.0100 0.0142  0.1207  227  VAL A C   
1998 O  O   . VAL A 230 ? 0.2614 0.2974 0.3045 -0.0097 0.0114  0.1116  227  VAL A O   
1999 C  CB  . VAL A 230 ? 0.2834 0.3395 0.3104 -0.0055 0.0230  0.1239  227  VAL A CB  
2000 C  CG1 . VAL A 230 ? 0.2947 0.3460 0.3112 -0.0037 0.0196  0.1138  227  VAL A CG1 
2001 C  CG2 . VAL A 230 ? 0.3167 0.3804 0.3398 -0.0040 0.0285  0.1241  227  VAL A CG2 
2002 N  N   . ALA A 231 ? 0.2642 0.3042 0.3146 -0.0107 0.0125  0.1281  228  ALA A N   
2003 C  CA  . ALA A 231 ? 0.2841 0.3167 0.3366 -0.0107 0.0073  0.1255  228  ALA A CA  
2004 C  C   . ALA A 231 ? 0.2844 0.3091 0.3470 -0.0126 0.0036  0.1194  228  ALA A C   
2005 O  O   . ALA A 231 ? 0.3130 0.3322 0.3736 -0.0117 0.0000  0.1125  228  ALA A O   
2006 C  CB  . ALA A 231 ? 0.2983 0.3310 0.3562 -0.0113 0.0062  0.1359  228  ALA A CB  
2007 N  N   . ASN A 232 ? 0.2554 0.2796 0.3289 -0.0152 0.0042  0.1216  229  ASN A N   
2008 C  CA  . ASN A 232 ? 0.2465 0.2629 0.3296 -0.0168 0.0001  0.1159  229  ASN A CA  
2009 C  C   . ASN A 232 ? 0.2390 0.2553 0.3178 -0.0164 0.0009  0.1066  229  ASN A C   
2010 O  O   . ASN A 232 ? 0.2630 0.2732 0.3469 -0.0170 -0.0025 0.1005  229  ASN A O   
2011 C  CB  . ASN A 232 ? 0.2655 0.2805 0.3641 -0.0201 -0.0008 0.1225  229  ASN A CB  
2012 C  CG  . ASN A 232 ? 0.2771 0.2913 0.3826 -0.0211 -0.0020 0.1323  229  ASN A CG  
2013 O  OD1 . ASN A 232 ? 0.2989 0.3199 0.4001 -0.0205 0.0016  0.1403  229  ASN A OD1 
2014 N  ND2 . ASN A 232 ? 0.3255 0.3311 0.4418 -0.0223 -0.0074 0.1318  229  ASN A ND2 
2015 N  N   . HIS A 233 ? 0.2212 0.2441 0.2902 -0.0150 0.0052  0.1053  230  HIS A N   
2016 C  CA  . HIS A 233 ? 0.2027 0.2258 0.2694 -0.0149 0.0062  0.0980  230  HIS A CA  
2017 C  C   . HIS A 233 ? 0.1994 0.2238 0.2524 -0.0123 0.0071  0.0907  230  HIS A C   
2018 O  O   . HIS A 233 ? 0.1845 0.2090 0.2354 -0.0121 0.0078  0.0847  230  HIS A O   
2019 C  CB  . HIS A 233 ? 0.2003 0.2294 0.2720 -0.0162 0.0102  0.1028  230  HIS A CB  
2020 C  CG  . HIS A 233 ? 0.1997 0.2264 0.2869 -0.0194 0.0082  0.1077  230  HIS A CG  
2021 N  ND1 . HIS A 233 ? 0.2055 0.2261 0.3009 -0.0210 0.0045  0.1022  230  HIS A ND1 
2022 C  CD2 . HIS A 233 ? 0.2278 0.2567 0.3240 -0.0213 0.0090  0.1177  230  HIS A CD2 
2023 C  CE1 . HIS A 233 ? 0.2084 0.2273 0.3176 -0.0238 0.0027  0.1083  230  HIS A CE1 
2024 N  NE2 . HIS A 233 ? 0.2338 0.2576 0.3444 -0.0242 0.0054  0.1180  230  HIS A NE2 
2025 N  N   . PHE A 234 ? 0.1975 0.2227 0.2420 -0.0105 0.0066  0.0914  231  PHE A N   
2026 C  CA  . PHE A 234 ? 0.1922 0.2183 0.2248 -0.0083 0.0066  0.0848  231  PHE A CA  
2027 C  C   . PHE A 234 ? 0.1873 0.2096 0.2172 -0.0074 0.0029  0.0826  231  PHE A C   
2028 O  O   . PHE A 234 ? 0.2030 0.2252 0.2347 -0.0072 0.0017  0.0883  231  PHE A O   
2029 C  CB  . PHE A 234 ? 0.2247 0.2578 0.2466 -0.0062 0.0104  0.0876  231  PHE A CB  
2030 C  CG  . PHE A 234 ? 0.2362 0.2738 0.2567 -0.0059 0.0144  0.0866  231  PHE A CG  
2031 C  CD1 . PHE A 234 ? 0.2486 0.2858 0.2622 -0.0047 0.0147  0.0789  231  PHE A CD1 
2032 C  CD2 . PHE A 234 ? 0.2645 0.3072 0.2904 -0.0066 0.0180  0.0939  231  PHE A CD2 
2033 C  CE1 . PHE A 234 ? 0.2864 0.3274 0.2989 -0.0040 0.0181  0.0778  231  PHE A CE1 
2034 C  CE2 . PHE A 234 ? 0.2894 0.3367 0.3143 -0.0059 0.0218  0.0930  231  PHE A CE2 
2035 C  CZ  . PHE A 234 ? 0.2950 0.3413 0.3129 -0.0045 0.0218  0.0846  231  PHE A CZ  
2036 N  N   . VAL A 235 ? 0.1770 0.1969 0.2025 -0.0066 0.0012  0.0748  232  VAL A N   
2037 C  CA  . VAL A 235 ? 0.1841 0.2026 0.2044 -0.0052 -0.0016 0.0721  232  VAL A CA  
2038 C  C   . VAL A 235 ? 0.1905 0.2114 0.2007 -0.0040 -0.0008 0.0668  232  VAL A C   
2039 O  O   . VAL A 235 ? 0.1854 0.2075 0.1939 -0.0043 0.0014  0.0639  232  VAL A O   
2040 C  CB  . VAL A 235 ? 0.1755 0.1884 0.2026 -0.0055 -0.0052 0.0684  232  VAL A CB  
2041 C  CG1 . VAL A 235 ? 0.1933 0.2029 0.2305 -0.0064 -0.0068 0.0736  232  VAL A CG1 
2042 C  CG2 . VAL A 235 ? 0.1957 0.2063 0.2246 -0.0060 -0.0053 0.0616  232  VAL A CG2 
2043 N  N   . ALA A 236 ? 0.1914 0.2126 0.1955 -0.0028 -0.0029 0.0653  233  ALA A N   
2044 C  CA  . ALA A 236 ? 0.1752 0.1981 0.1701 -0.0018 -0.0031 0.0603  233  ALA A CA  
2045 C  C   . ALA A 236 ? 0.1960 0.2166 0.1914 -0.0017 -0.0066 0.0559  233  ALA A C   
2046 O  O   . ALA A 236 ? 0.1992 0.2184 0.1988 -0.0015 -0.0088 0.0581  233  ALA A O   
2047 C  CB  . ALA A 236 ? 0.2139 0.2411 0.1996 -0.0001 -0.0023 0.0636  233  ALA A CB  
2048 N  N   . ILE A 237 ? 0.2003 0.2207 0.1915 -0.0017 -0.0070 0.0503  234  ILE A N   
2049 C  CA  . ILE A 237 ? 0.1871 0.2065 0.1781 -0.0017 -0.0100 0.0464  234  ILE A CA  
2050 C  C   . ILE A 237 ? 0.1935 0.2148 0.1757 -0.0010 -0.0111 0.0441  234  ILE A C   
2051 O  O   . ILE A 237 ? 0.1913 0.2128 0.1695 -0.0011 -0.0097 0.0411  234  ILE A O   
2052 C  CB  . ILE A 237 ? 0.1952 0.2123 0.1909 -0.0026 -0.0100 0.0418  234  ILE A CB  
2053 C  CG1 . ILE A 237 ? 0.2033 0.2180 0.2072 -0.0031 -0.0092 0.0433  234  ILE A CG1 
2054 C  CG2 . ILE A 237 ? 0.2115 0.2286 0.2086 -0.0025 -0.0128 0.0391  234  ILE A CG2 
2055 C  CD1 . ILE A 237 ? 0.1960 0.2088 0.2032 -0.0037 -0.0085 0.0392  234  ILE A CD1 
2056 N  N   . SER A 238 ? 0.2133 0.2359 0.1925 -0.0003 -0.0141 0.0450  235  SER A N   
2057 C  CA  . SER A 238 ? 0.2105 0.2345 0.1813 0.0003  -0.0158 0.0425  235  SER A CA  
2058 C  C   . SER A 238 ? 0.2499 0.2748 0.2207 0.0004  -0.0200 0.0423  235  SER A C   
2059 O  O   . SER A 238 ? 0.2476 0.2727 0.2242 0.0005  -0.0210 0.0452  235  SER A O   
2060 C  CB  . SER A 238 ? 0.2223 0.2487 0.1858 0.0020  -0.0139 0.0455  235  SER A CB  
2061 O  OG  . SER A 238 ? 0.2377 0.2649 0.1916 0.0032  -0.0153 0.0421  235  SER A OG  
2062 N  N   . SER A 239 ? 0.2594 0.2847 0.2243 0.0005  -0.0226 0.0388  236  SER A N   
2063 C  CA  . SER A 239 ? 0.2794 0.3063 0.2428 0.0008  -0.0272 0.0390  236  SER A CA  
2064 C  C   . SER A 239 ? 0.2903 0.3192 0.2446 0.0028  -0.0282 0.0414  236  SER A C   
2065 O  O   . SER A 239 ? 0.3314 0.3618 0.2839 0.0034  -0.0322 0.0426  236  SER A O   
2066 C  CB  . SER A 239 ? 0.2905 0.3166 0.2538 -0.0005 -0.0303 0.0340  236  SER A CB  
2067 O  OG  . SER A 239 ? 0.3386 0.3637 0.2932 0.0003  -0.0310 0.0307  236  SER A OG  
2068 N  N   . LYS A 240 ? 0.3063 0.3355 0.2549 0.0041  -0.0247 0.0426  237  LYS A N   
2069 C  CA  . LYS A 240 ? 0.3300 0.3617 0.2683 0.0066  -0.0249 0.0445  237  LYS A CA  
2070 C  C   . LYS A 240 ? 0.3352 0.3691 0.2741 0.0076  -0.0214 0.0514  237  LYS A C   
2071 O  O   . LYS A 240 ? 0.3325 0.3680 0.2676 0.0088  -0.0174 0.0532  237  LYS A O   
2072 C  CB  . LYS A 240 ? 0.3464 0.3776 0.2757 0.0080  -0.0240 0.0397  237  LYS A CB  
2073 C  CG  . LYS A 240 ? 0.3736 0.4021 0.3024 0.0069  -0.0282 0.0331  237  LYS A CG  
2074 C  CD  . LYS A 240 ? 0.4234 0.4526 0.3491 0.0072  -0.0342 0.0323  237  LYS A CD  
2075 C  CE  . LYS A 240 ? 0.4655 0.4918 0.3891 0.0064  -0.0386 0.0256  237  LYS A CE  
2076 N  NZ  . LYS A 240 ? 0.5402 0.5671 0.4637 0.0058  -0.0451 0.0250  237  LYS A NZ  
2077 N  N   . LEU A 241 ? 0.3671 0.4016 0.3108 0.0073  -0.0231 0.0560  238  LEU A N   
2078 C  CA  . LEU A 241 ? 0.3716 0.4074 0.3187 0.0077  -0.0201 0.0630  238  LEU A CA  
2079 C  C   . LEU A 241 ? 0.3802 0.4200 0.3176 0.0102  -0.0182 0.0674  238  LEU A C   
2080 O  O   . LEU A 241 ? 0.3603 0.4017 0.2999 0.0103  -0.0143 0.0728  238  LEU A O   
2081 C  CB  . LEU A 241 ? 0.4047 0.4396 0.3601 0.0070  -0.0227 0.0666  238  LEU A CB  
2082 C  CG  . LEU A 241 ? 0.4316 0.4631 0.3983 0.0051  -0.0222 0.0643  238  LEU A CG  
2083 C  CD1 . LEU A 241 ? 0.4952 0.5254 0.4623 0.0040  -0.0239 0.0574  238  LEU A CD1 
2084 C  CD2 . LEU A 241 ? 0.4978 0.5282 0.4731 0.0051  -0.0242 0.0680  238  LEU A CD2 
2085 N  N   . ASP A 242 ? 0.4038 0.4455 0.3306 0.0122  -0.0211 0.0655  239  ASP A N   
2086 C  CA  . ASP A 242 ? 0.4302 0.4763 0.3462 0.0152  -0.0192 0.0691  239  ASP A CA  
2087 C  C   . ASP A 242 ? 0.4160 0.4634 0.3289 0.0161  -0.0140 0.0680  239  ASP A C   
2088 O  O   . ASP A 242 ? 0.4154 0.4670 0.3244 0.0179  -0.0100 0.0735  239  ASP A O   
2089 C  CB  . ASP A 242 ? 0.4540 0.5014 0.3581 0.0177  -0.0240 0.0656  239  ASP A CB  
2090 C  CG  . ASP A 242 ? 0.5412 0.5892 0.4466 0.0177  -0.0289 0.0690  239  ASP A CG  
2091 O  OD1 . ASP A 242 ? 0.6324 0.6803 0.5466 0.0164  -0.0281 0.0749  239  ASP A OD1 
2092 O  OD2 . ASP A 242 ? 0.6269 0.6754 0.5245 0.0191  -0.0339 0.0655  239  ASP A OD2 
2093 N  N   . LYS A 243 ? 0.4014 0.4457 0.3163 0.0149  -0.0138 0.0611  240  LYS A N   
2094 C  CA  . LYS A 243 ? 0.3994 0.4448 0.3121 0.0158  -0.0090 0.0595  240  LYS A CA  
2095 C  C   . LYS A 243 ? 0.3745 0.4203 0.2980 0.0138  -0.0043 0.0646  240  LYS A C   
2096 O  O   . LYS A 243 ? 0.3673 0.4163 0.2896 0.0149  0.0005  0.0669  240  LYS A O   
2097 C  CB  . LYS A 243 ? 0.3922 0.4336 0.3043 0.0151  -0.0108 0.0507  240  LYS A CB  
2098 C  CG  . LYS A 243 ? 0.4431 0.4840 0.3442 0.0173  -0.0154 0.0451  240  LYS A CG  
2099 C  CD  . LYS A 243 ? 0.4938 0.5306 0.3944 0.0168  -0.0169 0.0368  240  LYS A CD  
2100 C  CE  . LYS A 243 ? 0.5857 0.6229 0.4730 0.0205  -0.0193 0.0317  240  LYS A CE  
2101 N  NZ  . LYS A 243 ? 0.6328 0.6741 0.5131 0.0240  -0.0136 0.0335  240  LYS A NZ  
2102 N  N   . VAL A 244 ? 0.3578 0.4005 0.2920 0.0110  -0.0057 0.0663  241  VAL A N   
2103 C  CA  . VAL A 244 ? 0.3463 0.3886 0.2910 0.0091  -0.0023 0.0709  241  VAL A CA  
2104 C  C   . VAL A 244 ? 0.3756 0.4224 0.3201 0.0101  0.0005  0.0799  241  VAL A C   
2105 O  O   . VAL A 244 ? 0.3370 0.3862 0.2854 0.0097  0.0049  0.0840  241  VAL A O   
2106 C  CB  . VAL A 244 ? 0.3193 0.3569 0.2748 0.0065  -0.0051 0.0700  241  VAL A CB  
2107 C  CG1 . VAL A 244 ? 0.3388 0.3753 0.3055 0.0046  -0.0025 0.0746  241  VAL A CG1 
2108 C  CG2 . VAL A 244 ? 0.2981 0.3323 0.2544 0.0054  -0.0073 0.0618  241  VAL A CG2 
2109 N  N   . LYS A 245 ? 0.4087 0.4568 0.3490 0.0113  -0.0022 0.0837  242  LYS A N   
2110 C  CA  A LYS A 245 ? 0.4354 0.4879 0.3749 0.0124  0.0000  0.0930  242  LYS A CA  
2111 C  CA  B LYS A 245 ? 0.4306 0.4831 0.3704 0.0123  0.0001  0.0931  242  LYS A CA  
2112 C  C   . LYS A 245 ? 0.4510 0.5096 0.3811 0.0151  0.0047  0.0946  242  LYS A C   
2113 O  O   . LYS A 245 ? 0.4328 0.4955 0.3661 0.0152  0.0092  0.1016  242  LYS A O   
2114 C  CB  A LYS A 245 ? 0.4518 0.5050 0.3861 0.0138  -0.0042 0.0957  242  LYS A CB  
2115 C  CB  B LYS A 245 ? 0.4412 0.4942 0.3774 0.0134  -0.0040 0.0965  242  LYS A CB  
2116 C  CG  A LYS A 245 ? 0.4807 0.5291 0.4242 0.0118  -0.0086 0.0951  242  LYS A CG  
2117 C  CG  B LYS A 245 ? 0.4667 0.5238 0.4033 0.0143  -0.0019 0.1073  242  LYS A CG  
2118 C  CD  A LYS A 245 ? 0.5406 0.5907 0.4797 0.0134  -0.0123 0.0998  242  LYS A CD  
2119 C  CD  B LYS A 245 ? 0.4826 0.5406 0.4295 0.0123  0.0028  0.1130  242  LYS A CD  
2120 C  CE  A LYS A 245 ? 0.5756 0.6275 0.5022 0.0157  -0.0159 0.0943  242  LYS A CE  
2121 C  CE  B LYS A 245 ? 0.4918 0.5503 0.4468 0.0112  0.0029  0.1233  242  LYS A CE  
2122 N  NZ  A LYS A 245 ? 0.6040 0.6609 0.5169 0.0189  -0.0132 0.0947  242  LYS A NZ  
2123 N  NZ  B LYS A 245 ? 0.4975 0.5566 0.4630 0.0090  0.0071  0.1282  242  LYS A NZ  
2124 N  N   . GLU A 246 ? 0.4710 0.5302 0.3898 0.0176  0.0035  0.0877  243  GLU A N   
2125 C  CA  A GLU A 246 ? 0.4879 0.5527 0.3965 0.0210  0.0076  0.0879  243  GLU A CA  
2126 C  CA  B GLU A 246 ? 0.4854 0.5502 0.3940 0.0210  0.0077  0.0878  243  GLU A CA  
2127 C  C   . GLU A 246 ? 0.4843 0.5507 0.4003 0.0199  0.0131  0.0890  243  GLU A C   
2128 O  O   . GLU A 246 ? 0.4935 0.5662 0.4059 0.0221  0.0180  0.0938  243  GLU A O   
2129 C  CB  A GLU A 246 ? 0.5036 0.5673 0.3994 0.0238  0.0041  0.0790  243  GLU A CB  
2130 C  CB  B GLU A 246 ? 0.4997 0.5633 0.3961 0.0238  0.0047  0.0787  243  GLU A CB  
2131 C  CG  A GLU A 246 ? 0.5383 0.6024 0.4261 0.0255  -0.0010 0.0800  243  GLU A CG  
2132 C  CG  B GLU A 246 ? 0.5208 0.5904 0.4049 0.0284  0.0087  0.0783  243  GLU A CG  
2133 C  CD  A GLU A 246 ? 0.5749 0.6365 0.4520 0.0275  -0.0062 0.0710  243  GLU A CD  
2134 C  CD  B GLU A 246 ? 0.5584 0.6264 0.4291 0.0316  0.0044  0.0699  243  GLU A CD  
2135 O  OE1 A GLU A 246 ? 0.5784 0.6354 0.4583 0.0260  -0.0078 0.0632  243  GLU A OE1 
2136 O  OE1 B GLU A 246 ? 0.5768 0.6394 0.4489 0.0298  -0.0015 0.0650  243  GLU A OE1 
2137 O  OE2 A GLU A 246 ? 0.6002 0.6644 0.4666 0.0304  -0.0090 0.0720  243  GLU A OE2 
2138 O  OE2 B GLU A 246 ? 0.5819 0.6543 0.4410 0.0362  0.0069  0.0683  243  GLU A OE2 
2139 N  N   . PHE A 247 ? 0.4563 0.5173 0.3829 0.0165  0.0124  0.0848  244  PHE A N   
2140 C  CA  . PHE A 247 ? 0.4379 0.4999 0.3734 0.0150  0.0168  0.0861  244  PHE A CA  
2141 C  C   . PHE A 247 ? 0.4408 0.5047 0.3879 0.0126  0.0194  0.0956  244  PHE A C   
2142 O  O   . PHE A 247 ? 0.4566 0.5233 0.4102 0.0118  0.0236  0.0985  244  PHE A O   
2143 C  CB  . PHE A 247 ? 0.4345 0.4897 0.3767 0.0123  0.0143  0.0779  244  PHE A CB  
2144 C  CG  . PHE A 247 ? 0.4287 0.4841 0.3799 0.0106  0.0179  0.0778  244  PHE A CG  
2145 C  CD1 . PHE A 247 ? 0.4800 0.5374 0.4268 0.0125  0.0206  0.0732  244  PHE A CD1 
2146 C  CD2 . PHE A 247 ? 0.4554 0.5086 0.4200 0.0073  0.0181  0.0820  244  PHE A CD2 
2147 C  CE1 . PHE A 247 ? 0.4327 0.4904 0.3885 0.0109  0.0235  0.0732  244  PHE A CE1 
2148 C  CE2 . PHE A 247 ? 0.4858 0.5391 0.4594 0.0056  0.0207  0.0819  244  PHE A CE2 
2149 C  CZ  . PHE A 247 ? 0.4557 0.5116 0.4249 0.0074  0.0235  0.0777  244  PHE A CZ  
2150 N  N   . GLY A 248 ? 0.4266 0.4891 0.3770 0.0115  0.0168  0.1009  245  GLY A N   
2151 C  CA  . GLY A 248 ? 0.4240 0.4875 0.3862 0.0091  0.0185  0.1101  245  GLY A CA  
2152 C  C   . GLY A 248 ? 0.4069 0.4631 0.3821 0.0055  0.0148  0.1099  245  GLY A C   
2153 O  O   . GLY A 248 ? 0.4240 0.4799 0.4105 0.0033  0.0157  0.1167  245  GLY A O   
2154 N  N   . ILE A 249 ? 0.3707 0.4212 0.3449 0.0051  0.0105  0.1019  246  ILE A N   
2155 C  CA  . ILE A 249 ? 0.3367 0.3806 0.3218 0.0025  0.0069  0.1006  246  ILE A CA  
2156 C  C   . ILE A 249 ? 0.3407 0.3831 0.3231 0.0034  0.0028  0.1020  246  ILE A C   
2157 O  O   . ILE A 249 ? 0.3427 0.3862 0.3151 0.0054  0.0010  0.0981  246  ILE A O   
2158 C  CB  . ILE A 249 ? 0.3107 0.3503 0.2974 0.0015  0.0056  0.0911  246  ILE A CB  
2159 C  CG1 . ILE A 249 ? 0.2988 0.3396 0.2902 0.0004  0.0094  0.0907  246  ILE A CG1 
2160 C  CG2 . ILE A 249 ? 0.2956 0.3287 0.2913 -0.0002 0.0016  0.0886  246  ILE A CG2 
2161 C  CD1 . ILE A 249 ? 0.2836 0.3213 0.2737 0.0001  0.0085  0.0812  246  ILE A CD1 
2162 N  N   . ASP A 250 ? 0.3379 0.3774 0.3299 0.0020  0.0011  0.1073  247  ASP A N   
2163 C  CA  . ASP A 250 ? 0.3511 0.3894 0.3413 0.0031  -0.0029 0.1092  247  ASP A CA  
2164 C  C   . ASP A 250 ? 0.3359 0.3691 0.3288 0.0028  -0.0070 0.1019  247  ASP A C   
2165 O  O   . ASP A 250 ? 0.3191 0.3488 0.3166 0.0015  -0.0070 0.0957  247  ASP A O   
2166 C  CB  . ASP A 250 ? 0.3661 0.4041 0.3638 0.0024  -0.0032 0.1189  247  ASP A CB  
2167 C  CG  . ASP A 250 ? 0.4007 0.4323 0.4132 0.0000  -0.0050 0.1192  247  ASP A CG  
2168 O  OD1 . ASP A 250 ? 0.3993 0.4261 0.4155 -0.0006 -0.0070 0.1114  247  ASP A OD1 
2169 O  OD2 . ASP A 250 ? 0.4774 0.5086 0.4978 -0.0010 -0.0048 0.1276  247  ASP A OD2 
2170 N  N   . LEU A 251 ? 0.3447 0.3779 0.3346 0.0042  -0.0105 0.1027  248  LEU A N   
2171 C  CA  A LEU A 251 ? 0.3392 0.3691 0.3306 0.0043  -0.0144 0.0961  248  LEU A CA  
2172 C  CA  B LEU A 251 ? 0.3325 0.3624 0.3238 0.0043  -0.0144 0.0963  248  LEU A CA  
2173 C  C   . LEU A 251 ? 0.3039 0.3282 0.3076 0.0029  -0.0156 0.0945  248  LEU A C   
2174 O  O   . LEU A 251 ? 0.2755 0.2974 0.2812 0.0027  -0.0170 0.0876  248  LEU A O   
2175 C  CB  A LEU A 251 ? 0.3726 0.4042 0.3593 0.0061  -0.0181 0.0981  248  LEU A CB  
2176 C  CB  B LEU A 251 ? 0.3580 0.3897 0.3448 0.0062  -0.0181 0.0988  248  LEU A CB  
2177 C  CG  A LEU A 251 ? 0.4103 0.4432 0.3893 0.0069  -0.0205 0.0909  248  LEU A CG  
2178 C  CG  B LEU A 251 ? 0.3829 0.4198 0.3559 0.0081  -0.0182 0.0989  248  LEU A CG  
2179 C  CD1 A LEU A 251 ? 0.4351 0.4705 0.4049 0.0071  -0.0176 0.0873  248  LEU A CD1 
2180 C  CD1 B LEU A 251 ? 0.4291 0.4679 0.3987 0.0098  -0.0221 0.1031  248  LEU A CD1 
2181 C  CD2 A LEU A 251 ? 0.4477 0.4831 0.4215 0.0087  -0.0244 0.0936  248  LEU A CD2 
2182 C  CD2 B LEU A 251 ? 0.4192 0.4563 0.3856 0.0081  -0.0189 0.0901  248  LEU A CD2 
2183 N  N   . GLU A 252 ? 0.2950 0.3172 0.3071 0.0021  -0.0152 0.1006  249  GLU A N   
2184 C  CA  A GLU A 252 ? 0.3034 0.3196 0.3271 0.0012  -0.0170 0.0986  249  GLU A CA  
2185 C  CA  B GLU A 252 ? 0.2966 0.3129 0.3204 0.0012  -0.0169 0.0991  249  GLU A CA  
2186 C  C   . GLU A 252 ? 0.2918 0.3060 0.3182 -0.0003 -0.0150 0.0927  249  GLU A C   
2187 O  O   . GLU A 252 ? 0.2904 0.3001 0.3239 -0.0005 -0.0167 0.0884  249  GLU A O   
2188 C  CB  A GLU A 252 ? 0.3234 0.3369 0.3564 0.0006  -0.0179 0.1066  249  GLU A CB  
2189 C  CB  B GLU A 252 ? 0.3121 0.3264 0.3445 0.0003  -0.0171 0.1077  249  GLU A CB  
2190 C  CG  A GLU A 252 ? 0.4056 0.4183 0.4399 0.0024  -0.0215 0.1105  249  GLU A CG  
2191 C  CG  B GLU A 252 ? 0.3509 0.3664 0.3822 0.0019  -0.0195 0.1146  249  GLU A CG  
2192 C  CD  A GLU A 252 ? 0.4846 0.4928 0.5242 0.0036  -0.0251 0.1043  249  GLU A CD  
2193 C  CD  B GLU A 252 ? 0.3977 0.4199 0.4162 0.0033  -0.0184 0.1174  249  GLU A CD  
2194 O  OE1 A GLU A 252 ? 0.5445 0.5476 0.5928 0.0030  -0.0257 0.1012  249  GLU A OE1 
2195 O  OE1 B GLU A 252 ? 0.3694 0.3961 0.3823 0.0030  -0.0147 0.1205  249  GLU A OE1 
2196 O  OE2 A GLU A 252 ? 0.5271 0.5374 0.5625 0.0054  -0.0273 0.1025  249  GLU A OE2 
2197 O  OE2 B GLU A 252 ? 0.4569 0.4802 0.4711 0.0051  -0.0215 0.1164  249  GLU A OE2 
2198 N  N   . HIS A 253 ? 0.2705 0.2886 0.2910 -0.0009 -0.0115 0.0925  250  HIS A N   
2199 C  CA  . HIS A 253 ? 0.2543 0.2712 0.2765 -0.0022 -0.0096 0.0871  250  HIS A CA  
2200 C  C   . HIS A 253 ? 0.2415 0.2602 0.2548 -0.0014 -0.0093 0.0798  250  HIS A C   
2201 O  O   . HIS A 253 ? 0.2163 0.2352 0.2287 -0.0022 -0.0073 0.0758  250  HIS A O   
2202 C  CB  . HIS A 253 ? 0.2668 0.2870 0.2896 -0.0034 -0.0056 0.0922  250  HIS A CB  
2203 C  CG  . HIS A 253 ? 0.2903 0.3084 0.3238 -0.0049 -0.0058 0.0993  250  HIS A CG  
2204 N  ND1 . HIS A 253 ? 0.3503 0.3692 0.3855 -0.0045 -0.0067 0.1072  250  HIS A ND1 
2205 C  CD2 . HIS A 253 ? 0.3311 0.3468 0.3743 -0.0070 -0.0051 0.1004  250  HIS A CD2 
2206 C  CE1 . HIS A 253 ? 0.3974 0.4137 0.4439 -0.0064 -0.0070 0.1126  250  HIS A CE1 
2207 N  NE2 . HIS A 253 ? 0.3668 0.3809 0.4185 -0.0080 -0.0062 0.1083  250  HIS A NE2 
2208 N  N   . CYS A 254 ? 0.2326 0.2526 0.2403 0.0000  -0.0117 0.0781  251  CYS A N   
2209 C  CA  A CYS A 254 ? 0.2362 0.2577 0.2363 0.0005  -0.0121 0.0718  251  CYS A CA  
2210 C  CA  B CYS A 254 ? 0.2428 0.2644 0.2427 0.0006  -0.0122 0.0718  251  CYS A CA  
2211 C  C   . CYS A 254 ? 0.2532 0.2721 0.2575 0.0007  -0.0152 0.0671  251  CYS A C   
2212 O  O   . CYS A 254 ? 0.2718 0.2896 0.2806 0.0015  -0.0176 0.0693  251  CYS A O   
2213 C  CB  A CYS A 254 ? 0.2539 0.2797 0.2436 0.0019  -0.0125 0.0736  251  CYS A CB  
2214 C  CB  B CYS A 254 ? 0.2583 0.2836 0.2488 0.0021  -0.0135 0.0736  251  CYS A CB  
2215 S  SG  A CYS A 254 ? 0.3100 0.3372 0.2901 0.0024  -0.0132 0.0660  251  CYS A SG  
2216 S  SG  B CYS A 254 ? 0.3160 0.3459 0.2976 0.0029  -0.0100 0.0771  251  CYS A SG  
2217 N  N   . TYR A 255 ? 0.2147 0.2331 0.2179 0.0002  -0.0148 0.0609  252  TYR A N   
2218 C  CA  . TYR A 255 ? 0.2143 0.2312 0.2216 0.0004  -0.0168 0.0562  252  TYR A CA  
2219 C  C   . TYR A 255 ? 0.2541 0.2735 0.2548 0.0004  -0.0179 0.0525  252  TYR A C   
2220 O  O   . TYR A 255 ? 0.2871 0.3077 0.2817 -0.0001 -0.0166 0.0508  252  TYR A O   
2221 C  CB  . TYR A 255 ? 0.2209 0.2346 0.2340 -0.0003 -0.0155 0.0530  252  TYR A CB  
2222 C  CG  . TYR A 255 ? 0.2037 0.2144 0.2242 -0.0003 -0.0156 0.0568  252  TYR A CG  
2223 C  CD1 . TYR A 255 ? 0.2108 0.2187 0.2381 0.0009  -0.0179 0.0565  252  TYR A CD1 
2224 C  CD2 . TYR A 255 ? 0.1844 0.1950 0.2059 -0.0014 -0.0135 0.0611  252  TYR A CD2 
2225 C  CE1 . TYR A 255 ? 0.2113 0.2156 0.2458 0.0009  -0.0187 0.0599  252  TYR A CE1 
2226 C  CE2 . TYR A 255 ? 0.2001 0.2078 0.2294 -0.0017 -0.0141 0.0652  252  TYR A CE2 
2227 C  CZ  . TYR A 255 ? 0.2044 0.2085 0.2401 -0.0006 -0.0170 0.0647  252  TYR A CZ  
2228 O  OH  . TYR A 255 ? 0.2319 0.2322 0.2758 -0.0010 -0.0181 0.0686  252  TYR A OH  
2229 N  N   . LYS A 256 ? 0.2756 0.2960 0.2781 0.0011  -0.0206 0.0512  253  LYS A N   
2230 C  CA  A LYS A 256 ? 0.2776 0.3006 0.2746 0.0009  -0.0227 0.0489  253  LYS A CA  
2231 C  CA  B LYS A 256 ? 0.2754 0.2984 0.2722 0.0009  -0.0227 0.0490  253  LYS A CA  
2232 C  C   . LYS A 256 ? 0.2668 0.2898 0.2651 0.0000  -0.0227 0.0439  253  LYS A C   
2233 O  O   . LYS A 256 ? 0.2621 0.2842 0.2669 0.0002  -0.0222 0.0423  253  LYS A O   
2234 C  CB  A LYS A 256 ? 0.2940 0.3190 0.2934 0.0021  -0.0260 0.0511  253  LYS A CB  
2235 C  CB  B LYS A 256 ? 0.2884 0.3135 0.2865 0.0021  -0.0261 0.0516  253  LYS A CB  
2236 C  CG  A LYS A 256 ? 0.3437 0.3697 0.3391 0.0030  -0.0270 0.0562  253  LYS A CG  
2237 C  CG  B LYS A 256 ? 0.3173 0.3454 0.3102 0.0019  -0.0292 0.0499  253  LYS A CG  
2238 C  CD  A LYS A 256 ? 0.3852 0.4131 0.3840 0.0042  -0.0306 0.0585  253  LYS A CD  
2239 C  CD  B LYS A 256 ? 0.3287 0.3576 0.3114 0.0020  -0.0293 0.0504  253  LYS A CD  
2240 C  CE  A LYS A 256 ? 0.4149 0.4422 0.4146 0.0055  -0.0309 0.0648  253  LYS A CE  
2241 C  CE  B LYS A 256 ? 0.3396 0.3711 0.3173 0.0024  -0.0338 0.0501  253  LYS A CE  
2242 N  NZ  A LYS A 256 ? 0.4466 0.4706 0.4558 0.0061  -0.0301 0.0667  253  LYS A NZ  
2243 N  NZ  B LYS A 256 ? 0.3233 0.3554 0.2995 0.0012  -0.0365 0.0453  253  LYS A NZ  
2244 N  N   . MET A 257 ? 0.2538 0.2781 0.2461 -0.0007 -0.0236 0.0414  254  MET A N   
2245 C  CA  A MET A 257 ? 0.2391 0.2643 0.2331 -0.0017 -0.0250 0.0376  254  MET A CA  
2246 C  CA  B MET A 257 ? 0.2506 0.2757 0.2444 -0.0018 -0.0250 0.0376  254  MET A CA  
2247 C  C   . MET A 257 ? 0.2491 0.2764 0.2382 -0.0019 -0.0287 0.0373  254  MET A C   
2248 O  O   . MET A 257 ? 0.2661 0.2940 0.2500 -0.0010 -0.0298 0.0397  254  MET A O   
2249 C  CB  A MET A 257 ? 0.2420 0.2653 0.2345 -0.0028 -0.0227 0.0341  254  MET A CB  
2250 C  CB  B MET A 257 ? 0.2585 0.2818 0.2509 -0.0028 -0.0227 0.0341  254  MET A CB  
2251 C  CG  A MET A 257 ? 0.2352 0.2577 0.2195 -0.0030 -0.0224 0.0329  254  MET A CG  
2252 C  CG  B MET A 257 ? 0.2870 0.3091 0.2724 -0.0027 -0.0210 0.0340  254  MET A CG  
2253 S  SD  A MET A 257 ? 0.1909 0.2110 0.1750 -0.0037 -0.0187 0.0300  254  MET A SD  
2254 S  SD  B MET A 257 ? 0.3325 0.3528 0.3164 -0.0039 -0.0196 0.0292  254  MET A SD  
2255 C  CE  A MET A 257 ? 0.1723 0.1923 0.1594 -0.0053 -0.0207 0.0259  254  MET A CE  
2256 C  CE  B MET A 257 ? 0.1808 0.2025 0.1641 -0.0049 -0.0240 0.0272  254  MET A CE  
2257 N  N   . TRP A 258 ? 0.2136 0.2422 0.2050 -0.0031 -0.0308 0.0348  255  TRP A N   
2258 C  CA  . TRP A 258 ? 0.2143 0.2448 0.2033 -0.0035 -0.0351 0.0346  255  TRP A CA  
2259 C  C   . TRP A 258 ? 0.1976 0.2269 0.1834 -0.0051 -0.0367 0.0306  255  TRP A C   
2260 O  O   . TRP A 258 ? 0.1952 0.2229 0.1825 -0.0061 -0.0344 0.0283  255  TRP A O   
2261 C  CB  . TRP A 258 ? 0.2246 0.2586 0.2221 -0.0036 -0.0371 0.0360  255  TRP A CB  
2262 C  CG  . TRP A 258 ? 0.2390 0.2735 0.2401 -0.0016 -0.0359 0.0396  255  TRP A CG  
2263 C  CD1 . TRP A 258 ? 0.2785 0.3140 0.2776 -0.0003 -0.0380 0.0428  255  TRP A CD1 
2264 C  CD2 . TRP A 258 ? 0.2035 0.2371 0.2105 -0.0006 -0.0328 0.0401  255  TRP A CD2 
2265 N  NE1 . TRP A 258 ? 0.3085 0.3436 0.3127 0.0013  -0.0364 0.0457  255  TRP A NE1 
2266 C  CE2 . TRP A 258 ? 0.2372 0.2709 0.2461 0.0012  -0.0334 0.0438  255  TRP A CE2 
2267 C  CE3 . TRP A 258 ? 0.2040 0.2366 0.2148 -0.0008 -0.0299 0.0378  255  TRP A CE3 
2268 C  CZ2 . TRP A 258 ? 0.2442 0.2763 0.2590 0.0028  -0.0314 0.0447  255  TRP A CZ2 
2269 C  CZ3 . TRP A 258 ? 0.2408 0.2722 0.2564 0.0008  -0.0279 0.0385  255  TRP A CZ3 
2270 C  CH2 . TRP A 258 ? 0.2130 0.2439 0.2308 0.0026  -0.0288 0.0418  255  TRP A CH2 
2271 N  N   . ASP A 259 ? 0.2072 0.2372 0.1891 -0.0054 -0.0411 0.0298  256  ASP A N   
2272 C  CA  A ASP A 259 ? 0.2146 0.2426 0.1933 -0.0068 -0.0434 0.0257  256  ASP A CA  
2273 C  CA  B ASP A 259 ? 0.2137 0.2419 0.1924 -0.0068 -0.0439 0.0258  256  ASP A CA  
2274 C  C   . ASP A 259 ? 0.1991 0.2279 0.1859 -0.0091 -0.0438 0.0244  256  ASP A C   
2275 O  O   . ASP A 259 ? 0.1996 0.2256 0.1849 -0.0103 -0.0439 0.0213  256  ASP A O   
2276 C  CB  A ASP A 259 ? 0.2287 0.2568 0.2010 -0.0064 -0.0489 0.0245  256  ASP A CB  
2277 C  CB  B ASP A 259 ? 0.2204 0.2499 0.1961 -0.0069 -0.0499 0.0253  256  ASP A CB  
2278 C  CG  A ASP A 259 ? 0.2664 0.2981 0.2449 -0.0075 -0.0537 0.0261  256  ASP A CG  
2279 C  CG  B ASP A 259 ? 0.2688 0.2977 0.2340 -0.0044 -0.0507 0.0259  256  ASP A CG  
2280 O  OD1 A ASP A 259 ? 0.2814 0.3162 0.2690 -0.0081 -0.0527 0.0286  256  ASP A OD1 
2281 O  OD1 B ASP A 259 ? 0.3106 0.3384 0.2712 -0.0028 -0.0464 0.0269  256  ASP A OD1 
2282 O  OD2 A ASP A 259 ? 0.3045 0.3361 0.2779 -0.0072 -0.0589 0.0249  256  ASP A OD2 
2283 O  OD2 B ASP A 259 ? 0.3307 0.3608 0.2928 -0.0041 -0.0559 0.0258  256  ASP A OD2 
2284 N  N   . TRP A 260 ? 0.1952 0.2277 0.1905 -0.0094 -0.0435 0.0270  257  TRP A N   
2285 C  CA  . TRP A 260 ? 0.1809 0.2155 0.1843 -0.0112 -0.0434 0.0268  257  TRP A CA  
2286 C  C   . TRP A 260 ? 0.1769 0.2105 0.1828 -0.0110 -0.0383 0.0263  257  TRP A C   
2287 O  O   . TRP A 260 ? 0.1685 0.2044 0.1807 -0.0121 -0.0375 0.0266  257  TRP A O   
2288 C  CB  . TRP A 260 ? 0.1879 0.2279 0.1992 -0.0112 -0.0455 0.0298  257  TRP A CB  
2289 C  CG  . TRP A 260 ? 0.1836 0.2255 0.1961 -0.0087 -0.0439 0.0326  257  TRP A CG  
2290 C  CD1 . TRP A 260 ? 0.2046 0.2479 0.2155 -0.0077 -0.0472 0.0346  257  TRP A CD1 
2291 C  CD2 . TRP A 260 ? 0.1723 0.2146 0.1884 -0.0069 -0.0396 0.0339  257  TRP A CD2 
2292 N  NE1 . TRP A 260 ? 0.2132 0.2576 0.2265 -0.0054 -0.0449 0.0373  257  TRP A NE1 
2293 C  CE2 . TRP A 260 ? 0.1832 0.2268 0.1999 -0.0048 -0.0404 0.0367  257  TRP A CE2 
2294 C  CE3 . TRP A 260 ? 0.1708 0.2123 0.1893 -0.0065 -0.0354 0.0328  257  TRP A CE3 
2295 C  CZ2 . TRP A 260 ? 0.1962 0.2399 0.2166 -0.0025 -0.0375 0.0382  257  TRP A CZ2 
2296 C  CZ3 . TRP A 260 ? 0.1873 0.2291 0.2088 -0.0042 -0.0327 0.0340  257  TRP A CZ3 
2297 C  CH2 . TRP A 260 ? 0.1833 0.2259 0.2059 -0.0023 -0.0338 0.0365  257  TRP A CH2 
2298 N  N   . VAL A 261 ? 0.1585 0.1890 0.1593 -0.0096 -0.0351 0.0258  258  VAL A N   
2299 C  CA  . VAL A 261 ? 0.1649 0.1936 0.1667 -0.0094 -0.0309 0.0247  258  VAL A CA  
2300 C  C   . VAL A 261 ? 0.1667 0.1916 0.1629 -0.0102 -0.0307 0.0217  258  VAL A C   
2301 O  O   . VAL A 261 ? 0.1833 0.2058 0.1729 -0.0092 -0.0301 0.0211  258  VAL A O   
2302 C  CB  . VAL A 261 ? 0.1525 0.1800 0.1534 -0.0074 -0.0277 0.0261  258  VAL A CB  
2303 C  CG1 . VAL A 261 ? 0.1788 0.2046 0.1813 -0.0073 -0.0241 0.0247  258  VAL A CG1 
2304 C  CG2 . VAL A 261 ? 0.1831 0.2137 0.1893 -0.0060 -0.0282 0.0289  258  VAL A CG2 
2305 N  N   . GLY A 262 ? 0.1638 0.1882 0.1626 -0.0120 -0.0314 0.0201  259  GLY A N   
2306 C  CA  . GLY A 262 ? 0.1784 0.1987 0.1726 -0.0125 -0.0311 0.0171  259  GLY A CA  
2307 C  C   . GLY A 262 ? 0.1793 0.1978 0.1718 -0.0113 -0.0267 0.0167  259  GLY A C   
2308 O  O   . GLY A 262 ? 0.1643 0.1846 0.1613 -0.0108 -0.0242 0.0181  259  GLY A O   
2309 N  N   . GLY A 263 ? 0.1987 0.2141 0.1850 -0.0105 -0.0258 0.0147  260  GLY A N   
2310 C  CA  . GLY A 263 ? 0.1893 0.2035 0.1749 -0.0094 -0.0218 0.0146  260  GLY A CA  
2311 C  C   . GLY A 263 ? 0.1629 0.1770 0.1537 -0.0103 -0.0200 0.0142  260  GLY A C   
2312 O  O   . GLY A 263 ? 0.1685 0.1832 0.1622 -0.0096 -0.0174 0.0152  260  GLY A O   
2313 N  N   . ARG A 264 ? 0.1564 0.1698 0.1487 -0.0118 -0.0217 0.0128  261  ARG A N   
2314 C  CA  . ARG A 264 ? 0.1576 0.1713 0.1542 -0.0125 -0.0202 0.0127  261  ARG A CA  
2315 C  C   . ARG A 264 ? 0.1612 0.1791 0.1638 -0.0127 -0.0197 0.0150  261  ARG A C   
2316 O  O   . ARG A 264 ? 0.1699 0.1888 0.1755 -0.0128 -0.0182 0.0153  261  ARG A O   
2317 C  CB  . ARG A 264 ? 0.1723 0.1836 0.1689 -0.0141 -0.0224 0.0110  261  ARG A CB  
2318 C  CG  . ARG A 264 ? 0.1821 0.1945 0.1811 -0.0159 -0.0264 0.0116  261  ARG A CG  
2319 C  CD  . ARG A 264 ? 0.1597 0.1688 0.1592 -0.0176 -0.0290 0.0099  261  ARG A CD  
2320 N  NE  . ARG A 264 ? 0.1722 0.1809 0.1731 -0.0193 -0.0339 0.0097  261  ARG A NE  
2321 C  CZ  . ARG A 264 ? 0.1791 0.1852 0.1749 -0.0187 -0.0370 0.0073  261  ARG A CZ  
2322 N  NH1 . ARG A 264 ? 0.1816 0.1873 0.1797 -0.0205 -0.0420 0.0071  261  ARG A NH1 
2323 N  NH2 . ARG A 264 ? 0.1919 0.1960 0.1802 -0.0162 -0.0353 0.0052  261  ARG A NH2 
2324 N  N   . TYR A 265 ? 0.1569 0.1772 0.1606 -0.0121 -0.0207 0.0167  262  TYR A N   
2325 C  CA  . TYR A 265 ? 0.1562 0.1807 0.1651 -0.0114 -0.0201 0.0188  262  TYR A CA  
2326 C  C   . TYR A 265 ? 0.1562 0.1808 0.1645 -0.0094 -0.0190 0.0198  262  TYR A C   
2327 O  O   . TYR A 265 ? 0.1567 0.1845 0.1686 -0.0086 -0.0196 0.0215  262  TYR A O   
2328 C  CB  . TYR A 265 ? 0.1541 0.1820 0.1666 -0.0129 -0.0231 0.0203  262  TYR A CB  
2329 C  CG  . TYR A 265 ? 0.1406 0.1682 0.1551 -0.0152 -0.0247 0.0200  262  TYR A CG  
2330 C  CD1 . TYR A 265 ? 0.1624 0.1925 0.1811 -0.0156 -0.0229 0.0211  262  TYR A CD1 
2331 C  CD2 . TYR A 265 ? 0.1552 0.1798 0.1672 -0.0169 -0.0282 0.0186  262  TYR A CD2 
2332 C  CE1 . TYR A 265 ? 0.1639 0.1938 0.1851 -0.0178 -0.0243 0.0215  262  TYR A CE1 
2333 C  CE2 . TYR A 265 ? 0.1643 0.1879 0.1789 -0.0192 -0.0302 0.0184  262  TYR A CE2 
2334 C  CZ  . TYR A 265 ? 0.1619 0.1882 0.1814 -0.0198 -0.0281 0.0201  262  TYR A CZ  
2335 O  OH  . TYR A 265 ? 0.1728 0.1983 0.1958 -0.0222 -0.0299 0.0208  262  TYR A OH  
2336 N  N   . SER A 266 ? 0.1447 0.1660 0.1491 -0.0087 -0.0177 0.0190  263  SER A N   
2337 C  CA  . SER A 266 ? 0.1570 0.1780 0.1610 -0.0072 -0.0171 0.0206  263  SER A CA  
2338 C  C   . SER A 266 ? 0.1489 0.1689 0.1556 -0.0058 -0.0149 0.0207  263  SER A C   
2339 O  O   . SER A 266 ? 0.1587 0.1782 0.1662 -0.0047 -0.0149 0.0224  263  SER A O   
2340 C  CB  . SER A 266 ? 0.1554 0.1743 0.1536 -0.0073 -0.0174 0.0207  263  SER A CB  
2341 O  OG  . SER A 266 ? 0.1584 0.1748 0.1544 -0.0073 -0.0151 0.0193  263  SER A OG  
2342 N  N   . LEU A 267 ? 0.1436 0.1629 0.1517 -0.0057 -0.0134 0.0190  264  LEU A N   
2343 C  CA  . LEU A 267 ? 0.1360 0.1537 0.1464 -0.0042 -0.0119 0.0185  264  LEU A CA  
2344 C  C   . LEU A 267 ? 0.1413 0.1606 0.1557 -0.0023 -0.0125 0.0195  264  LEU A C   
2345 O  O   . LEU A 267 ? 0.1512 0.1683 0.1676 -0.0010 -0.0122 0.0196  264  LEU A O   
2346 C  CB  . LEU A 267 ? 0.1546 0.1717 0.1654 -0.0043 -0.0107 0.0163  264  LEU A CB  
2347 C  CG  . LEU A 267 ? 0.1412 0.1614 0.1539 -0.0037 -0.0106 0.0157  264  LEU A CG  
2348 C  CD1 . LEU A 267 ? 0.1511 0.1723 0.1670 -0.0010 -0.0101 0.0151  264  LEU A CD1 
2349 C  CD2 . LEU A 267 ? 0.1785 0.1980 0.1897 -0.0046 -0.0097 0.0141  264  LEU A CD2 
2350 N  N   . TRP A 268 ? 0.1495 0.1726 0.1655 -0.0021 -0.0135 0.0204  265  TRP A N   
2351 C  CA  . TRP A 268 ? 0.1362 0.1617 0.1563 0.0001  -0.0140 0.0213  265  TRP A CA  
2352 C  C   . TRP A 268 ? 0.1463 0.1706 0.1669 0.0006  -0.0154 0.0236  265  TRP A C   
2353 O  O   . TRP A 268 ? 0.1631 0.1881 0.1872 0.0028  -0.0160 0.0243  265  TRP A O   
2354 C  CB  . TRP A 268 ? 0.1351 0.1658 0.1575 0.0000  -0.0146 0.0220  265  TRP A CB  
2355 C  CG  . TRP A 268 ? 0.1381 0.1702 0.1597 -0.0014 -0.0137 0.0210  265  TRP A CG  
2356 C  CD1 . TRP A 268 ? 0.1430 0.1751 0.1628 -0.0041 -0.0147 0.0213  265  TRP A CD1 
2357 C  CD2 . TRP A 268 ? 0.1430 0.1764 0.1655 0.0000  -0.0118 0.0195  265  TRP A CD2 
2358 N  NE1 . TRP A 268 ? 0.1475 0.1806 0.1675 -0.0047 -0.0135 0.0204  265  TRP A NE1 
2359 C  CE2 . TRP A 268 ? 0.1391 0.1734 0.1605 -0.0022 -0.0115 0.0195  265  TRP A CE2 
2360 C  CE3 . TRP A 268 ? 0.1514 0.1851 0.1753 0.0032  -0.0105 0.0180  265  TRP A CE3 
2361 C  CZ2 . TRP A 268 ? 0.1348 0.1710 0.1564 -0.0014 -0.0098 0.0187  265  TRP A CZ2 
2362 C  CZ3 . TRP A 268 ? 0.1502 0.1856 0.1736 0.0041  -0.0088 0.0166  265  TRP A CZ3 
2363 C  CH2 . TRP A 268 ? 0.1378 0.1747 0.1599 0.0018  -0.0084 0.0173  265  TRP A CH2 
2364 N  N   . SER A 269 ? 0.1406 0.1634 0.1573 -0.0011 -0.0161 0.0249  266  SER A N   
2365 C  CA  . SER A 269 ? 0.1443 0.1665 0.1602 -0.0008 -0.0174 0.0277  266  SER A CA  
2366 C  C   . SER A 269 ? 0.1608 0.1791 0.1770 -0.0003 -0.0163 0.0287  266  SER A C   
2367 O  O   . SER A 269 ? 0.1540 0.1701 0.1720 0.0000  -0.0150 0.0269  266  SER A O   
2368 C  CB  . SER A 269 ? 0.1533 0.1763 0.1640 -0.0025 -0.0187 0.0284  266  SER A CB  
2369 O  OG  . SER A 269 ? 0.1552 0.1756 0.1613 -0.0035 -0.0172 0.0275  266  SER A OG  
2370 N  N   . SER A 270 ? 0.1604 0.1781 0.1751 -0.0004 -0.0170 0.0319  267  SER A N   
2371 C  CA  . SER A 270 ? 0.1653 0.1799 0.1807 -0.0005 -0.0158 0.0339  267  SER A CA  
2372 C  C   . SER A 270 ? 0.1677 0.1810 0.1804 -0.0018 -0.0137 0.0323  267  SER A C   
2373 O  O   . SER A 270 ? 0.1654 0.1765 0.1804 -0.0021 -0.0126 0.0333  267  SER A O   
2374 C  CB  . SER A 270 ? 0.1769 0.1921 0.1903 -0.0004 -0.0167 0.0383  267  SER A CB  
2375 O  OG  . SER A 270 ? 0.1925 0.2083 0.2100 0.0012  -0.0187 0.0399  267  SER A OG  
2376 N  N   . ILE A 271 ? 0.1565 0.1714 0.1647 -0.0028 -0.0135 0.0300  268  ILE A N   
2377 C  CA  . ILE A 271 ? 0.1557 0.1694 0.1616 -0.0038 -0.0116 0.0281  268  ILE A CA  
2378 C  C   . ILE A 271 ? 0.1627 0.1745 0.1732 -0.0036 -0.0108 0.0260  268  ILE A C   
2379 O  O   . ILE A 271 ? 0.1849 0.1952 0.1958 -0.0041 -0.0093 0.0255  268  ILE A O   
2380 C  CB  . ILE A 271 ? 0.1540 0.1689 0.1554 -0.0046 -0.0121 0.0256  268  ILE A CB  
2381 C  CG1 . ILE A 271 ? 0.1772 0.1934 0.1730 -0.0046 -0.0132 0.0271  268  ILE A CG1 
2382 C  CG2 . ILE A 271 ? 0.1711 0.1846 0.1714 -0.0053 -0.0103 0.0230  268  ILE A CG2 
2383 C  CD1 . ILE A 271 ? 0.1918 0.2076 0.1834 -0.0043 -0.0112 0.0286  268  ILE A CD1 
2384 N  N   . GLY A 272 ? 0.1639 0.1759 0.1779 -0.0025 -0.0117 0.0247  269  GLY A N   
2385 C  CA  . GLY A 272 ? 0.1755 0.1857 0.1932 -0.0017 -0.0114 0.0223  269  GLY A CA  
2386 C  C   . GLY A 272 ? 0.1738 0.1807 0.1961 -0.0010 -0.0118 0.0237  269  GLY A C   
2387 O  O   . GLY A 272 ? 0.1835 0.1883 0.2090 0.0001  -0.0123 0.0214  269  GLY A O   
2388 N  N   . MET A 273 ? 0.1533 0.1596 0.1761 -0.0016 -0.0119 0.0274  270  MET A N   
2389 C  CA  . MET A 273 ? 0.1795 0.1825 0.2078 -0.0012 -0.0127 0.0294  270  MET A CA  
2390 C  C   . MET A 273 ? 0.1654 0.1660 0.1964 -0.0020 -0.0122 0.0275  270  MET A C   
2391 O  O   . MET A 273 ? 0.1658 0.1630 0.2020 -0.0012 -0.0138 0.0265  270  MET A O   
2392 C  CB  . MET A 273 ? 0.2283 0.2319 0.2566 -0.0019 -0.0126 0.0346  270  MET A CB  
2393 C  CG  . MET A 273 ? 0.2743 0.2791 0.2999 -0.0034 -0.0107 0.0372  270  MET A CG  
2394 S  SD  . MET A 273 ? 0.2088 0.2135 0.2375 -0.0039 -0.0105 0.0447  270  MET A SD  
2395 C  CE  . MET A 273 ? 0.2425 0.2487 0.2685 -0.0024 -0.0125 0.0465  270  MET A CE  
2396 N  N   . SER A 274 ? 0.1566 0.1587 0.1844 -0.0034 -0.0103 0.0270  271  SER A N   
2397 C  CA  . SER A 274 ? 0.1614 0.1617 0.1920 -0.0042 -0.0100 0.0252  271  SER A CA  
2398 C  C   . SER A 274 ? 0.1529 0.1516 0.1848 -0.0028 -0.0114 0.0205  271  SER A C   
2399 O  O   . SER A 274 ? 0.1634 0.1594 0.1994 -0.0028 -0.0125 0.0189  271  SER A O   
2400 C  CB  . SER A 274 ? 0.1684 0.1710 0.1952 -0.0055 -0.0076 0.0256  271  SER A CB  
2401 O  OG  . SER A 274 ? 0.1790 0.1837 0.2000 -0.0052 -0.0071 0.0232  271  SER A OG  
2402 N  N   . ILE A 275 ? 0.1594 0.1600 0.1877 -0.0015 -0.0115 0.0183  272  ILE A N   
2403 C  CA  . ILE A 275 ? 0.1512 0.1512 0.1802 0.0004  -0.0125 0.0143  272  ILE A CA  
2404 C  C   . ILE A 275 ? 0.1543 0.1509 0.1882 0.0024  -0.0148 0.0138  272  ILE A C   
2405 O  O   . ILE A 275 ? 0.1660 0.1597 0.2025 0.0034  -0.0164 0.0108  272  ILE A O   
2406 C  CB  . ILE A 275 ? 0.1538 0.1575 0.1791 0.0015  -0.0119 0.0132  272  ILE A CB  
2407 C  CG1 . ILE A 275 ? 0.1591 0.1653 0.1800 -0.0003 -0.0104 0.0133  272  ILE A CG1 
2408 C  CG2 . ILE A 275 ? 0.1593 0.1630 0.1852 0.0042  -0.0127 0.0096  272  ILE A CG2 
2409 C  CD1 . ILE A 275 ? 0.1508 0.1607 0.1691 -0.0002 -0.0101 0.0136  272  ILE A CD1 
2410 N  N   . ALA A 276 ? 0.1517 0.1483 0.1871 0.0030  -0.0155 0.0164  273  ALA A N   
2411 C  CA  . ALA A 276 ? 0.1596 0.1525 0.2002 0.0049  -0.0179 0.0161  273  ALA A CA  
2412 C  C   . ALA A 276 ? 0.1590 0.1473 0.2052 0.0036  -0.0195 0.0169  273  ALA A C   
2413 O  O   . ALA A 276 ? 0.1794 0.1633 0.2300 0.0053  -0.0221 0.0146  273  ALA A O   
2414 C  CB  . ALA A 276 ? 0.1744 0.1684 0.2159 0.0056  -0.0183 0.0196  273  ALA A CB  
2415 N  N   . PHE A 277 ? 0.1593 0.1485 0.2056 0.0007  -0.0179 0.0205  274  PHE A N   
2416 C  CA  . PHE A 277 ? 0.1578 0.1435 0.2105 -0.0010 -0.0192 0.0223  274  PHE A CA  
2417 C  C   . PHE A 277 ? 0.1764 0.1600 0.2304 -0.0007 -0.0205 0.0176  274  PHE A C   
2418 O  O   . PHE A 277 ? 0.2109 0.1905 0.2718 -0.0016 -0.0229 0.0178  274  PHE A O   
2419 C  CB  . PHE A 277 ? 0.1562 0.1446 0.2086 -0.0038 -0.0166 0.0275  274  PHE A CB  
2420 C  CG  . PHE A 277 ? 0.1532 0.1421 0.2074 -0.0044 -0.0163 0.0334  274  PHE A CG  
2421 C  CD1 . PHE A 277 ? 0.1870 0.1718 0.2489 -0.0045 -0.0189 0.0358  274  PHE A CD1 
2422 C  CD2 . PHE A 277 ? 0.1808 0.1741 0.2290 -0.0049 -0.0138 0.0363  274  PHE A CD2 
2423 C  CE1 . PHE A 277 ? 0.2018 0.1871 0.2654 -0.0051 -0.0186 0.0420  274  PHE A CE1 
2424 C  CE2 . PHE A 277 ? 0.1989 0.1930 0.2481 -0.0053 -0.0136 0.0422  274  PHE A CE2 
2425 C  CZ  . PHE A 277 ? 0.1850 0.1753 0.2419 -0.0055 -0.0158 0.0451  274  PHE A CZ  
2426 N  N   . ALA A 278 ? 0.1713 0.1574 0.2195 0.0002  -0.0193 0.0139  275  ALA A N   
2427 C  CA  . ALA A 278 ? 0.1895 0.1741 0.2380 0.0009  -0.0207 0.0093  275  ALA A CA  
2428 C  C   . ALA A 278 ? 0.1863 0.1683 0.2346 0.0045  -0.0233 0.0045  275  ALA A C   
2429 O  O   . ALA A 278 ? 0.1939 0.1716 0.2461 0.0053  -0.0265 0.0016  275  ALA A O   
2430 C  CB  . ALA A 278 ? 0.1758 0.1643 0.2183 0.0002  -0.0181 0.0081  275  ALA A CB  
2431 N  N   . ILE A 279 ? 0.1762 0.1611 0.2202 0.0066  -0.0221 0.0038  276  ILE A N   
2432 C  CA  . ILE A 279 ? 0.1780 0.1623 0.2202 0.0108  -0.0236 -0.0010 276  ILE A CA  
2433 C  C   . ILE A 279 ? 0.1839 0.1658 0.2294 0.0134  -0.0255 -0.0012 276  ILE A C   
2434 O  O   . ILE A 279 ? 0.1779 0.1593 0.2222 0.0175  -0.0268 -0.0055 276  ILE A O   
2435 C  CB  . ILE A 279 ? 0.1720 0.1622 0.2075 0.0121  -0.0209 -0.0024 276  ILE A CB  
2436 C  CG1 . ILE A 279 ? 0.1761 0.1704 0.2101 0.0116  -0.0187 0.0011  276  ILE A CG1 
2437 C  CG2 . ILE A 279 ? 0.2075 0.1996 0.2398 0.0100  -0.0194 -0.0028 276  ILE A CG2 
2438 C  CD1 . ILE A 279 ? 0.2176 0.2180 0.2462 0.0123  -0.0161 0.0006  276  ILE A CD1 
2439 N  N   . GLY A 280 ? 0.1905 0.1709 0.2401 0.0116  -0.0257 0.0034  277  GLY A N   
2440 C  CA  . GLY A 280 ? 0.1882 0.1665 0.2413 0.0139  -0.0274 0.0042  277  GLY A CA  
2441 C  C   . GLY A 280 ? 0.1789 0.1627 0.2282 0.0153  -0.0251 0.0056  277  GLY A C   
2442 O  O   . GLY A 280 ? 0.1782 0.1671 0.2223 0.0156  -0.0227 0.0044  277  GLY A O   
2443 N  N   . TYR A 281 ? 0.1858 0.1686 0.2383 0.0161  -0.0261 0.0084  278  TYR A N   
2444 C  CA  . TYR A 281 ? 0.1965 0.1848 0.2466 0.0173  -0.0244 0.0102  278  TYR A CA  
2445 C  C   . TYR A 281 ? 0.1761 0.1674 0.2240 0.0216  -0.0240 0.0058  278  TYR A C   
2446 O  O   . TYR A 281 ? 0.1894 0.1872 0.2339 0.0218  -0.0216 0.0066  278  TYR A O   
2447 C  CB  . TYR A 281 ? 0.1910 0.1778 0.2452 0.0170  -0.0257 0.0149  278  TYR A CB  
2448 C  CG  . TYR A 281 ? 0.1883 0.1812 0.2390 0.0159  -0.0236 0.0183  278  TYR A CG  
2449 C  CD1 . TYR A 281 ? 0.1893 0.1844 0.2367 0.0121  -0.0219 0.0218  278  TYR A CD1 
2450 C  CD2 . TYR A 281 ? 0.1844 0.1815 0.2348 0.0189  -0.0234 0.0174  278  TYR A CD2 
2451 C  CE1 . TYR A 281 ? 0.1891 0.1894 0.2329 0.0113  -0.0206 0.0241  278  TYR A CE1 
2452 C  CE2 . TYR A 281 ? 0.1924 0.1953 0.2400 0.0177  -0.0220 0.0202  278  TYR A CE2 
2453 C  CZ  . TYR A 281 ? 0.1968 0.2009 0.2410 0.0138  -0.0209 0.0233  278  TYR A CZ  
2454 O  OH  . TYR A 281 ? 0.2219 0.2313 0.2631 0.0126  -0.0201 0.0255  278  TYR A OH  
2455 N  N   . ASP A 282 ? 0.1973 0.1847 0.2472 0.0253  -0.0262 0.0013  279  ASP A N   
2456 C  CA  . ASP A 282 ? 0.1995 0.1909 0.2466 0.0301  -0.0253 -0.0028 279  ASP A CA  
2457 C  C   . ASP A 282 ? 0.1757 0.1731 0.2168 0.0291  -0.0222 -0.0039 279  ASP A C   
2458 O  O   . ASP A 282 ? 0.1969 0.2012 0.2357 0.0308  -0.0198 -0.0035 279  ASP A O   
2459 C  CB  . ASP A 282 ? 0.2218 0.2076 0.2708 0.0347  -0.0285 -0.0085 279  ASP A CB  
2460 C  CG  . ASP A 282 ? 0.3243 0.3050 0.3795 0.0372  -0.0316 -0.0083 279  ASP A CG  
2461 O  OD1 . ASP A 282 ? 0.3861 0.3686 0.4439 0.0365  -0.0312 -0.0039 279  ASP A OD1 
2462 O  OD2 . ASP A 282 ? 0.4368 0.4111 0.4941 0.0405  -0.0351 -0.0132 279  ASP A OD2 
2463 N  N   . ASN A 283 ? 0.1910 0.1860 0.2303 0.0264  -0.0223 -0.0048 280  ASN A N   
2464 C  CA  . ASN A 283 ? 0.1701 0.1700 0.2042 0.0253  -0.0198 -0.0054 280  ASN A CA  
2465 C  C   . ASN A 283 ? 0.1676 0.1726 0.2002 0.0217  -0.0172 -0.0007 280  ASN A C   
2466 O  O   . ASN A 283 ? 0.1695 0.1800 0.1987 0.0218  -0.0149 -0.0005 280  ASN A O   
2467 C  CB  . ASN A 283 ? 0.1708 0.1667 0.2039 0.0236  -0.0209 -0.0075 280  ASN A CB  
2468 C  CG  . ASN A 283 ? 0.1919 0.1846 0.2243 0.0278  -0.0234 -0.0134 280  ASN A CG  
2469 O  OD1 . ASN A 283 ? 0.2172 0.2133 0.2469 0.0324  -0.0227 -0.0161 280  ASN A OD1 
2470 N  ND2 . ASN A 283 ? 0.1819 0.1688 0.2164 0.0264  -0.0262 -0.0152 280  ASN A ND2 
2471 N  N   . PHE A 284 ? 0.1810 0.1839 0.2160 0.0186  -0.0177 0.0032  281  PHE A N   
2472 C  CA  . PHE A 284 ? 0.1664 0.1737 0.1996 0.0156  -0.0159 0.0072  281  PHE A CA  
2473 C  C   . PHE A 284 ? 0.1606 0.1737 0.1944 0.0181  -0.0151 0.0079  281  PHE A C   
2474 O  O   . PHE A 284 ? 0.1578 0.1761 0.1894 0.0169  -0.0134 0.0092  281  PHE A O   
2475 C  CB  . PHE A 284 ? 0.1670 0.1713 0.2022 0.0127  -0.0167 0.0110  281  PHE A CB  
2476 C  CG  . PHE A 284 ? 0.1537 0.1620 0.1861 0.0100  -0.0153 0.0144  281  PHE A CG  
2477 C  CD1 . PHE A 284 ? 0.1675 0.1770 0.1962 0.0073  -0.0139 0.0145  281  PHE A CD1 
2478 C  CD2 . PHE A 284 ? 0.1810 0.1915 0.2145 0.0103  -0.0159 0.0173  281  PHE A CD2 
2479 C  CE1 . PHE A 284 ? 0.1608 0.1733 0.1867 0.0051  -0.0132 0.0169  281  PHE A CE1 
2480 C  CE2 . PHE A 284 ? 0.1760 0.1900 0.2066 0.0079  -0.0153 0.0199  281  PHE A CE2 
2481 C  CZ  . PHE A 284 ? 0.1636 0.1782 0.1904 0.0054  -0.0141 0.0195  281  PHE A CZ  
2482 N  N   . GLU A 285 ? 0.1809 0.1929 0.2180 0.0217  -0.0164 0.0069  282  GLU A N   
2483 C  CA  . GLU A 285 ? 0.1837 0.2019 0.2222 0.0246  -0.0156 0.0076  282  GLU A CA  
2484 C  C   . GLU A 285 ? 0.1669 0.1906 0.2025 0.0267  -0.0133 0.0052  282  GLU A C   
2485 O  O   . GLU A 285 ? 0.1853 0.2160 0.2212 0.0269  -0.0116 0.0073  282  GLU A O   
2486 C  CB  . GLU A 285 ? 0.1987 0.2146 0.2414 0.0286  -0.0175 0.0067  282  GLU A CB  
2487 C  CG  . GLU A 285 ? 0.2439 0.2555 0.2895 0.0261  -0.0194 0.0105  282  GLU A CG  
2488 C  CD  . GLU A 285 ? 0.3923 0.4036 0.4425 0.0288  -0.0211 0.0120  282  GLU A CD  
2489 O  OE1 . GLU A 285 ? 0.3786 0.3947 0.4295 0.0279  -0.0208 0.0156  282  GLU A OE1 
2490 O  OE2 . GLU A 285 ? 0.4142 0.4199 0.4676 0.0316  -0.0233 0.0098  282  GLU A OE2 
2491 N  N   . LYS A 286 ? 0.1616 0.1826 0.1947 0.0284  -0.0134 0.0013  283  LYS A N   
2492 C  CA  . LYS A 286 ? 0.1676 0.1943 0.1974 0.0306  -0.0112 -0.0005 283  LYS A CA  
2493 C  C   . LYS A 286 ? 0.1583 0.1889 0.1857 0.0262  -0.0092 0.0025  283  LYS A C   
2494 O  O   . LYS A 286 ? 0.1518 0.1894 0.1785 0.0271  -0.0070 0.0038  283  LYS A O   
2495 C  CB  . LYS A 286 ? 0.1668 0.1893 0.1938 0.0336  -0.0122 -0.0056 283  LYS A CB  
2496 C  CG  . LYS A 286 ? 0.1996 0.2184 0.2287 0.0389  -0.0145 -0.0096 283  LYS A CG  
2497 C  CD  . LYS A 286 ? 0.2553 0.2696 0.2813 0.0415  -0.0163 -0.0151 283  LYS A CD  
2498 C  CE  . LYS A 286 ? 0.3828 0.3911 0.4114 0.0462  -0.0196 -0.0195 283  LYS A CE  
2499 N  NZ  . LYS A 286 ? 0.4549 0.4685 0.4835 0.0518  -0.0182 -0.0206 283  LYS A NZ  
2500 N  N   . LEU A 287 ? 0.1560 0.1820 0.1823 0.0219  -0.0100 0.0035  284  LEU A N   
2501 C  CA  . LEU A 287 ? 0.1411 0.1696 0.1655 0.0177  -0.0088 0.0062  284  LEU A CA  
2502 C  C   . LEU A 287 ? 0.1428 0.1770 0.1695 0.0164  -0.0081 0.0100  284  LEU A C   
2503 O  O   . LEU A 287 ? 0.1583 0.1981 0.1846 0.0156  -0.0066 0.0116  284  LEU A O   
2504 C  CB  . LEU A 287 ? 0.1549 0.1774 0.1785 0.0140  -0.0099 0.0067  284  LEU A CB  
2505 C  CG  . LEU A 287 ? 0.1400 0.1639 0.1617 0.0100  -0.0091 0.0091  284  LEU A CG  
2506 C  CD1 . LEU A 287 ? 0.1671 0.1923 0.1859 0.0095  -0.0080 0.0078  284  LEU A CD1 
2507 C  CD2 . LEU A 287 ? 0.1630 0.1819 0.1845 0.0072  -0.0101 0.0101  284  LEU A CD2 
2508 N  N   . LEU A 288 ? 0.1484 0.1813 0.1779 0.0167  -0.0095 0.0114  285  LEU A N   
2509 C  CA  . LEU A 288 ? 0.1491 0.1871 0.1812 0.0157  -0.0096 0.0147  285  LEU A CA  
2510 C  C   . LEU A 288 ? 0.1502 0.1958 0.1848 0.0191  -0.0080 0.0150  285  LEU A C   
2511 O  O   . LEU A 288 ? 0.1502 0.2020 0.1867 0.0175  -0.0073 0.0178  285  LEU A O   
2512 C  CB  . LEU A 288 ? 0.1676 0.2026 0.2019 0.0152  -0.0117 0.0164  285  LEU A CB  
2513 C  CG  . LEU A 288 ? 0.1889 0.2199 0.2207 0.0110  -0.0129 0.0183  285  LEU A CG  
2514 C  CD1 . LEU A 288 ? 0.2102 0.2359 0.2384 0.0093  -0.0123 0.0163  285  LEU A CD1 
2515 C  CD2 . LEU A 288 ? 0.2746 0.3037 0.3084 0.0114  -0.0147 0.0204  285  LEU A CD2 
2516 N  N   . ALA A 289 ? 0.1498 0.1955 0.1850 0.0239  -0.0075 0.0122  286  ALA A N   
2517 C  CA  . ALA A 289 ? 0.1453 0.1989 0.1825 0.0277  -0.0055 0.0124  286  ALA A CA  
2518 C  C   . ALA A 289 ? 0.1577 0.2168 0.1927 0.0270  -0.0030 0.0132  286  ALA A C   
2519 O  O   . ALA A 289 ? 0.1579 0.2255 0.1957 0.0278  -0.0011 0.0160  286  ALA A O   
2520 C  CB  . ALA A 289 ? 0.1659 0.2175 0.2027 0.0336  -0.0056 0.0082  286  ALA A CB  
2521 N  N   . GLY A 290 ? 0.1570 0.2117 0.1874 0.0253  -0.0030 0.0114  287  GLY A N   
2522 C  CA  . GLY A 290 ? 0.1728 0.2324 0.2012 0.0244  -0.0008 0.0127  287  GLY A CA  
2523 C  C   . GLY A 290 ? 0.1476 0.2107 0.1789 0.0195  -0.0008 0.0173  287  GLY A C   
2524 O  O   . GLY A 290 ? 0.1529 0.2234 0.1862 0.0192  0.0010  0.0204  287  GLY A O   
2525 N  N   . ALA A 291 ? 0.1492 0.2070 0.1807 0.0156  -0.0032 0.0180  288  ALA A N   
2526 C  CA  . ALA A 291 ? 0.1395 0.1998 0.1737 0.0113  -0.0041 0.0217  288  ALA A CA  
2527 C  C   . ALA A 291 ? 0.1284 0.1962 0.1685 0.0123  -0.0039 0.0248  288  ALA A C   
2528 O  O   . ALA A 291 ? 0.1409 0.2144 0.1843 0.0103  -0.0035 0.0281  288  ALA A O   
2529 C  CB  . ALA A 291 ? 0.1577 0.2110 0.1902 0.0079  -0.0067 0.0213  288  ALA A CB  
2530 N  N   . TYR A 292 ? 0.1399 0.2078 0.1818 0.0156  -0.0044 0.0239  289  TYR A N   
2531 C  CA  . TYR A 292 ? 0.1356 0.2113 0.1838 0.0172  -0.0042 0.0267  289  TYR A CA  
2532 C  C   . TYR A 292 ? 0.1362 0.2211 0.1868 0.0194  -0.0010 0.0285  289  TYR A C   
2533 O  O   . TYR A 292 ? 0.1455 0.2381 0.2019 0.0181  -0.0006 0.0327  289  TYR A O   
2534 C  CB  . TYR A 292 ? 0.1550 0.2293 0.2048 0.0214  -0.0049 0.0250  289  TYR A CB  
2535 C  CG  . TYR A 292 ? 0.1370 0.2202 0.1937 0.0236  -0.0044 0.0281  289  TYR A CG  
2536 C  CD1 . TYR A 292 ? 0.1552 0.2407 0.2162 0.0201  -0.0068 0.0316  289  TYR A CD1 
2537 C  CD2 . TYR A 292 ? 0.1766 0.2666 0.2354 0.0290  -0.0016 0.0274  289  TYR A CD2 
2538 C  CE1 . TYR A 292 ? 0.1633 0.2578 0.2316 0.0217  -0.0065 0.0348  289  TYR A CE1 
2539 C  CE2 . TYR A 292 ? 0.1737 0.2729 0.2396 0.0310  -0.0009 0.0306  289  TYR A CE2 
2540 C  CZ  . TYR A 292 ? 0.1879 0.2893 0.2588 0.0270  -0.0034 0.0345  289  TYR A CZ  
2541 O  OH  . TYR A 292 ? 0.1975 0.3089 0.2764 0.0290  -0.0027 0.0379  289  TYR A OH  
2542 N  N   . SER A 293 ? 0.1478 0.2324 0.1941 0.0228  0.0014  0.0258  290  SER A N   
2543 C  CA  . SER A 293 ? 0.1608 0.2552 0.2087 0.0257  0.0049  0.0279  290  SER A CA  
2544 C  C   . SER A 293 ? 0.1457 0.2447 0.1965 0.0209  0.0054  0.0326  290  SER A C   
2545 O  O   . SER A 293 ? 0.1533 0.2623 0.2096 0.0214  0.0074  0.0370  290  SER A O   
2546 C  CB  . SER A 293 ? 0.1615 0.2546 0.2032 0.0302  0.0069  0.0239  290  SER A CB  
2547 O  OG  . SER A 293 ? 0.1743 0.2625 0.2109 0.0274  0.0067  0.0229  290  SER A OG  
2548 N  N   . VAL A 294 ? 0.1467 0.2385 0.1941 0.0163  0.0034  0.0320  291  VAL A N   
2549 C  CA  . VAL A 294 ? 0.1358 0.2297 0.1857 0.0114  0.0030  0.0360  291  VAL A CA  
2550 C  C   . VAL A 294 ? 0.1369 0.2329 0.1935 0.0076  0.0003  0.0394  291  VAL A C   
2551 O  O   . VAL A 294 ? 0.1514 0.2539 0.2139 0.0050  0.0004  0.0441  291  VAL A O   
2552 C  CB  . VAL A 294 ? 0.1386 0.2240 0.1828 0.0086  0.0017  0.0336  291  VAL A CB  
2553 C  CG1 . VAL A 294 ? 0.1386 0.2239 0.1857 0.0030  0.0001  0.0372  291  VAL A CG1 
2554 C  CG2 . VAL A 294 ? 0.1576 0.2435 0.1963 0.0120  0.0045  0.0316  291  VAL A CG2 
2555 N  N   . ASP A 295 ? 0.1329 0.2239 0.1892 0.0072  -0.0024 0.0375  292  ASP A N   
2556 C  CA  . ASP A 295 ? 0.1425 0.2359 0.2048 0.0043  -0.0054 0.0403  292  ASP A CA  
2557 C  C   . ASP A 295 ? 0.1418 0.2468 0.2124 0.0064  -0.0036 0.0445  292  ASP A C   
2558 O  O   . ASP A 295 ? 0.1517 0.2617 0.2292 0.0029  -0.0052 0.0487  292  ASP A O   
2559 C  CB  . ASP A 295 ? 0.1410 0.2283 0.2011 0.0051  -0.0080 0.0377  292  ASP A CB  
2560 C  CG  . ASP A 295 ? 0.1581 0.2352 0.2114 0.0026  -0.0100 0.0346  292  ASP A CG  
2561 O  OD1 . ASP A 295 ? 0.1539 0.2282 0.2050 -0.0006 -0.0104 0.0346  292  ASP A OD1 
2562 O  OD2 . ASP A 295 ? 0.1549 0.2270 0.2056 0.0039  -0.0112 0.0326  292  ASP A OD2 
2563 N  N   . LYS A 296 ? 0.1463 0.2554 0.2167 0.0121  -0.0007 0.0432  293  LYS A N   
2564 C  CA  . LYS A 296 ? 0.1607 0.2817 0.2388 0.0149  0.0017  0.0470  293  LYS A CA  
2565 C  C   . LYS A 296 ? 0.1619 0.2913 0.2436 0.0137  0.0046  0.0516  293  LYS A C   
2566 O  O   . LYS A 296 ? 0.1554 0.2934 0.2459 0.0117  0.0044  0.0569  293  LYS A O   
2567 C  CB  . LYS A 296 ? 0.1567 0.2791 0.2323 0.0220  0.0043  0.0437  293  LYS A CB  
2568 C  CG  . LYS A 296 ? 0.1834 0.3185 0.2666 0.0263  0.0073  0.0470  293  LYS A CG  
2569 C  CD  . LYS A 296 ? 0.2290 0.3636 0.3091 0.0336  0.0090  0.0426  293  LYS A CD  
2570 C  CE  . LYS A 296 ? 0.3442 0.4924 0.4308 0.0391  0.0128  0.0455  293  LYS A CE  
2571 N  NZ  . LYS A 296 ? 0.3899 0.5437 0.4863 0.0373  0.0108  0.0497  293  LYS A NZ  
2572 N  N   . HIS A 297 ? 0.1533 0.2800 0.2285 0.0142  0.0067  0.0500  294  HIS A N   
2573 C  CA  . HIS A 297 ? 0.1430 0.2762 0.2205 0.0125  0.0092  0.0545  294  HIS A CA  
2574 C  C   . HIS A 297 ? 0.1443 0.2774 0.2285 0.0056  0.0058  0.0590  294  HIS A C   
2575 O  O   . HIS A 297 ? 0.1507 0.2934 0.2437 0.0038  0.0067  0.0651  294  HIS A O   
2576 C  CB  . HIS A 297 ? 0.1637 0.2914 0.2320 0.0137  0.0108  0.0514  294  HIS A CB  
2577 C  CG  . HIS A 297 ? 0.1613 0.2932 0.2312 0.0109  0.0124  0.0561  294  HIS A CG  
2578 N  ND1 . HIS A 297 ? 0.2180 0.3609 0.2895 0.0143  0.0170  0.0600  294  HIS A ND1 
2579 C  CD2 . HIS A 297 ? 0.1651 0.2915 0.2348 0.0054  0.0100  0.0575  294  HIS A CD2 
2580 C  CE1 . HIS A 297 ? 0.1882 0.3322 0.2608 0.0106  0.0172  0.0641  294  HIS A CE1 
2581 N  NE2 . HIS A 297 ? 0.1719 0.3058 0.2439 0.0051  0.0129  0.0627  294  HIS A NE2 
2582 N  N   . PHE A 298 ? 0.1411 0.2636 0.2218 0.0016  0.0016  0.0560  295  PHE A N   
2583 C  CA  . PHE A 298 ? 0.1535 0.2736 0.2389 -0.0048 -0.0023 0.0589  295  PHE A CA  
2584 C  C   . PHE A 298 ? 0.1603 0.2866 0.2554 -0.0066 -0.0049 0.0626  295  PHE A C   
2585 O  O   . PHE A 298 ? 0.1723 0.3035 0.2758 -0.0107 -0.0065 0.0677  295  PHE A O   
2586 C  CB  . PHE A 298 ? 0.1456 0.2524 0.2232 -0.0073 -0.0060 0.0537  295  PHE A CB  
2587 C  CG  . PHE A 298 ? 0.1658 0.2686 0.2469 -0.0131 -0.0108 0.0551  295  PHE A CG  
2588 C  CD1 . PHE A 298 ? 0.1472 0.2521 0.2328 -0.0167 -0.0112 0.0591  295  PHE A CD1 
2589 C  CD2 . PHE A 298 ? 0.1535 0.2500 0.2330 -0.0148 -0.0152 0.0524  295  PHE A CD2 
2590 C  CE1 . PHE A 298 ? 0.1598 0.2599 0.2487 -0.0219 -0.0163 0.0598  295  PHE A CE1 
2591 C  CE2 . PHE A 298 ? 0.1445 0.2367 0.2263 -0.0198 -0.0200 0.0529  295  PHE A CE2 
2592 C  CZ  . PHE A 298 ? 0.1607 0.2544 0.2473 -0.0232 -0.0207 0.0564  295  PHE A CZ  
2593 N  N   . LYS A 299 ? 0.1607 0.2861 0.2552 -0.0040 -0.0059 0.0600  296  LYS A N   
2594 C  CA  . LYS A 299 ? 0.1793 0.3103 0.2828 -0.0054 -0.0088 0.0631  296  LYS A CA  
2595 C  C   . LYS A 299 ? 0.1634 0.3085 0.2772 -0.0038 -0.0057 0.0691  296  LYS A C   
2596 O  O   . LYS A 299 ? 0.1746 0.3259 0.2989 -0.0070 -0.0084 0.0737  296  LYS A O   
2597 C  CB  . LYS A 299 ? 0.1709 0.2977 0.2709 -0.0022 -0.0103 0.0591  296  LYS A CB  
2598 C  CG  . LYS A 299 ? 0.2297 0.3605 0.3374 -0.0034 -0.0141 0.0615  296  LYS A CG  
2599 C  CD  . LYS A 299 ? 0.2717 0.3970 0.3740 0.0003  -0.0151 0.0573  296  LYS A CD  
2600 C  CE  . LYS A 299 ? 0.3380 0.4666 0.4467 -0.0001 -0.0190 0.0592  296  LYS A CE  
2601 N  NZ  . LYS A 299 ? 0.3782 0.5198 0.4976 0.0026  -0.0167 0.0636  296  LYS A NZ  
2602 N  N   . GLU A 300 ? 0.1684 0.3195 0.2801 0.0015  0.0000  0.0693  297  GLU A N   
2603 C  CA  . GLU A 300 ? 0.1685 0.3342 0.2892 0.0047  0.0038  0.0744  297  GLU A CA  
2604 C  C   . GLU A 300 ? 0.1664 0.3409 0.2912 0.0038  0.0076  0.0802  297  GLU A C   
2605 O  O   . GLU A 300 ? 0.1869 0.3748 0.3217 0.0050  0.0102  0.0862  297  GLU A O   
2606 C  CB  . GLU A 300 ? 0.1675 0.3352 0.2834 0.0125  0.0075  0.0706  297  GLU A CB  
2607 C  CG  . GLU A 300 ? 0.1891 0.3506 0.3034 0.0140  0.0042  0.0664  297  GLU A CG  
2608 C  CD  . GLU A 300 ? 0.2500 0.4138 0.3611 0.0220  0.0076  0.0629  297  GLU A CD  
2609 O  OE1 . GLU A 300 ? 0.2984 0.4670 0.4062 0.0268  0.0124  0.0622  297  GLU A OE1 
2610 O  OE2 . GLU A 300 ? 0.3304 0.4905 0.4418 0.0236  0.0049  0.0604  297  GLU A OE2 
2611 N  N   . THR A 301 ? 0.1721 0.3403 0.2907 0.0014  0.0078  0.0793  298  THR A N   
2612 C  CA  . THR A 301 ? 0.1584 0.3349 0.2788 0.0018  0.0123  0.0845  298  THR A CA  
2613 C  C   . THR A 301 ? 0.1590 0.3376 0.2889 -0.0053 0.0094  0.0911  298  THR A C   
2614 O  O   . THR A 301 ? 0.1761 0.3445 0.3054 -0.0108 0.0040  0.0893  298  THR A O   
2615 C  CB  . THR A 301 ? 0.1817 0.3511 0.2896 0.0044  0.0146  0.0800  298  THR A CB  
2616 O  OG1 . THR A 301 ? 0.1850 0.3514 0.2845 0.0109  0.0165  0.0735  298  THR A OG1 
2617 C  CG2 . THR A 301 ? 0.1929 0.3721 0.3019 0.0058  0.0197  0.0857  298  THR A CG2 
2618 N  N   . GLU A 302 ? 0.1556 0.3484 0.2955 -0.0051 0.0130  0.0991  299  GLU A N   
2619 C  CA  . GLU A 302 ? 0.1855 0.3812 0.3356 -0.0119 0.0106  0.1064  299  GLU A CA  
2620 C  C   . GLU A 302 ? 0.1730 0.3578 0.3160 -0.0154 0.0089  0.1047  299  GLU A C   
2621 O  O   . GLU A 302 ? 0.1770 0.3581 0.3089 -0.0116 0.0121  0.1010  299  GLU A O   
2622 C  CB  . GLU A 302 ? 0.1888 0.4020 0.3491 -0.0105 0.0161  0.1159  299  GLU A CB  
2623 C  CG  . GLU A 302 ? 0.2347 0.4527 0.3868 -0.0055 0.0228  0.1169  299  GLU A CG  
2624 C  CD  . GLU A 302 ? 0.3679 0.6047 0.5293 -0.0026 0.0289  0.1259  299  GLU A CD  
2625 O  OE1 . GLU A 302 ? 0.4264 0.6712 0.6026 -0.0073 0.0272  0.1336  299  GLU A OE1 
2626 O  OE2 . GLU A 302 ? 0.4219 0.6653 0.5756 0.0045  0.0353  0.1251  299  GLU A OE2 
2627 N  N   . PHE A 303 ? 0.1734 0.3529 0.3231 -0.0225 0.0033  0.1071  300  PHE A N   
2628 C  CA  . PHE A 303 ? 0.1632 0.3304 0.3060 -0.0257 0.0006  0.1043  300  PHE A CA  
2629 C  C   . PHE A 303 ? 0.1781 0.3487 0.3165 -0.0238 0.0056  0.1075  300  PHE A C   
2630 O  O   . PHE A 303 ? 0.1830 0.3438 0.3106 -0.0229 0.0055  0.1025  300  PHE A O   
2631 C  CB  . PHE A 303 ? 0.1644 0.3262 0.3161 -0.0333 -0.0063 0.1069  300  PHE A CB  
2632 C  CG  . PHE A 303 ? 0.1900 0.3455 0.3434 -0.0354 -0.0124 0.1024  300  PHE A CG  
2633 C  CD1 . PHE A 303 ? 0.1821 0.3324 0.3260 -0.0313 -0.0123 0.0949  300  PHE A CD1 
2634 C  CD2 . PHE A 303 ? 0.2078 0.3614 0.3719 -0.0418 -0.0190 0.1054  300  PHE A CD2 
2635 C  CE1 . PHE A 303 ? 0.1750 0.3197 0.3202 -0.0334 -0.0182 0.0913  300  PHE A CE1 
2636 C  CE2 . PHE A 303 ? 0.2076 0.3557 0.3727 -0.0435 -0.0250 0.1012  300  PHE A CE2 
2637 C  CZ  . PHE A 303 ? 0.1913 0.3350 0.3464 -0.0392 -0.0244 0.0943  300  PHE A CZ  
2638 N  N   . SER A 304 ? 0.1822 0.3669 0.3286 -0.0228 0.0101  0.1159  301  SER A N   
2639 C  CA  . SER A 304 ? 0.1954 0.3844 0.3377 -0.0209 0.0150  0.1198  301  SER A CA  
2640 C  C   . SER A 304 ? 0.1939 0.3816 0.3213 -0.0133 0.0198  0.1134  301  SER A C   
2641 O  O   . SER A 304 ? 0.2217 0.4097 0.3427 -0.0116 0.0228  0.1147  301  SER A O   
2642 C  CB  . SER A 304 ? 0.2006 0.4070 0.3548 -0.0208 0.0195  0.1308  301  SER A CB  
2643 O  OG  . SER A 304 ? 0.2264 0.4438 0.3808 -0.0147 0.0242  0.1305  301  SER A OG  
2644 N  N   . LYS A 305 ? 0.1822 0.3677 0.3041 -0.0090 0.0200  0.1065  302  LYS A N   
2645 C  CA  A LYS A 305 ? 0.1872 0.3710 0.2962 -0.0018 0.0237  0.1000  302  LYS A CA  
2646 C  CA  B LYS A 305 ? 0.1839 0.3676 0.2928 -0.0018 0.0237  0.1000  302  LYS A CA  
2647 C  C   . LYS A 305 ? 0.1737 0.3428 0.2739 -0.0016 0.0196  0.0902  302  LYS A C   
2648 O  O   . LYS A 305 ? 0.1819 0.3486 0.2731 0.0040  0.0216  0.0840  302  LYS A O   
2649 C  CB  A LYS A 305 ? 0.1960 0.3932 0.3071 0.0047  0.0289  0.1016  302  LYS A CB  
2650 C  CB  B LYS A 305 ? 0.1894 0.3866 0.3005 0.0046  0.0290  0.1017  302  LYS A CB  
2651 C  CG  A LYS A 305 ? 0.2318 0.4458 0.3527 0.0048  0.0337  0.1123  302  LYS A CG  
2652 C  CG  B LYS A 305 ? 0.2071 0.4201 0.3253 0.0056  0.0342  0.1116  302  LYS A CG  
2653 C  CD  A LYS A 305 ? 0.2600 0.4766 0.3756 0.0056  0.0371  0.1162  302  LYS A CD  
2654 C  CD  B LYS A 305 ? 0.2283 0.4548 0.3474 0.0131  0.0398  0.1125  302  LYS A CD  
2655 C  CE  A LYS A 305 ? 0.2990 0.5332 0.4261 0.0052  0.0417  0.1281  302  LYS A CE  
2656 C  CE  B LYS A 305 ? 0.2523 0.4953 0.3774 0.0146  0.0457  0.1226  302  LYS A CE  
2657 N  NZ  A LYS A 305 ? 0.3274 0.5637 0.4541 0.0028  0.0433  0.1347  302  LYS A NZ  
2658 N  NZ  B LYS A 305 ? 0.2991 0.5391 0.4185 0.0127  0.0465  0.1252  302  LYS A NZ  
2659 N  N   . ASN A 306 ? 0.1640 0.3235 0.2671 -0.0077 0.0139  0.0890  303  ASN A N   
2660 C  CA  . ASN A 306 ? 0.1513 0.2984 0.2483 -0.0082 0.0098  0.0810  303  ASN A CA  
2661 C  C   . ASN A 306 ? 0.1516 0.2867 0.2400 -0.0101 0.0078  0.0770  303  ASN A C   
2662 O  O   . ASN A 306 ? 0.1674 0.2983 0.2593 -0.0152 0.0048  0.0794  303  ASN A O   
2663 C  CB  . ASN A 306 ? 0.1585 0.3046 0.2649 -0.0132 0.0048  0.0828  303  ASN A CB  
2664 C  CG  . ASN A 306 ? 0.1642 0.3001 0.2654 -0.0133 0.0009  0.0758  303  ASN A CG  
2665 O  OD1 . ASN A 306 ? 0.1727 0.2975 0.2647 -0.0134 -0.0006 0.0702  303  ASN A OD1 
2666 N  ND2 . ASN A 306 ? 0.1711 0.3106 0.2786 -0.0135 -0.0012 0.0764  303  ASN A ND2 
2667 N  N   . ILE A 307 ? 0.1463 0.2758 0.2241 -0.0058 0.0093  0.0706  304  ILE A N   
2668 C  CA  . ILE A 307 ? 0.1557 0.2759 0.2255 -0.0067 0.0084  0.0673  304  ILE A CA  
2669 C  C   . ILE A 307 ? 0.1428 0.2521 0.2131 -0.0120 0.0031  0.0650  304  ILE A C   
2670 O  O   . ILE A 307 ? 0.1496 0.2553 0.2207 -0.0154 0.0016  0.0671  304  ILE A O   
2671 C  CB  . ILE A 307 ? 0.1489 0.2657 0.2081 -0.0010 0.0107  0.0610  304  ILE A CB  
2672 C  CG1 . ILE A 307 ? 0.1523 0.2799 0.2100 0.0045  0.0159  0.0634  304  ILE A CG1 
2673 C  CG2 . ILE A 307 ? 0.1565 0.2632 0.2087 -0.0025 0.0090  0.0575  304  ILE A CG2 
2674 C  CD1 . ILE A 307 ? 0.1711 0.2963 0.2196 0.0107  0.0176  0.0569  304  ILE A CD1 
2675 N  N   . PRO A 308 ? 0.1492 0.2532 0.2191 -0.0127 0.0001  0.0610  305  PRO A N   
2676 C  CA  . PRO A 308 ? 0.1612 0.2555 0.2310 -0.0173 -0.0049 0.0587  305  PRO A CA  
2677 C  C   . PRO A 308 ? 0.1541 0.2498 0.2329 -0.0226 -0.0081 0.0639  305  PRO A C   
2678 O  O   . PRO A 308 ? 0.1500 0.2379 0.2280 -0.0259 -0.0114 0.0629  305  PRO A O   
2679 C  CB  . PRO A 308 ? 0.1608 0.2516 0.2289 -0.0164 -0.0070 0.0545  305  PRO A CB  
2680 C  CG  . PRO A 308 ? 0.1619 0.2569 0.2262 -0.0108 -0.0030 0.0526  305  PRO A CG  
2681 C  CD  . PRO A 308 ? 0.1487 0.2544 0.2170 -0.0088 0.0010  0.0577  305  PRO A CD  
2682 N  N   . VAL A 309 ? 0.1514 0.2571 0.2395 -0.0233 -0.0073 0.0695  306  VAL A N   
2683 C  CA  . VAL A 309 ? 0.1590 0.2668 0.2573 -0.0286 -0.0106 0.0753  306  VAL A CA  
2684 C  C   . VAL A 309 ? 0.1530 0.2607 0.2518 -0.0302 -0.0092 0.0792  306  VAL A C   
2685 O  O   . VAL A 309 ? 0.1640 0.2657 0.2661 -0.0346 -0.0133 0.0803  306  VAL A O   
2686 C  CB  . VAL A 309 ? 0.1652 0.2849 0.2744 -0.0290 -0.0097 0.0812  306  VAL A CB  
2687 C  CG1 . VAL A 309 ? 0.1845 0.3065 0.3058 -0.0350 -0.0134 0.0879  306  VAL A CG1 
2688 C  CG2 . VAL A 309 ? 0.1636 0.2817 0.2726 -0.0281 -0.0123 0.0772  306  VAL A CG2 
2689 N  N   . ILE A 310 ? 0.1468 0.2614 0.2425 -0.0263 -0.0037 0.0815  307  ILE A N   
2690 C  CA  . ILE A 310 ? 0.1628 0.2779 0.2581 -0.0272 -0.0022 0.0855  307  ILE A CA  
2691 C  C   . ILE A 310 ? 0.1626 0.2644 0.2495 -0.0281 -0.0050 0.0795  307  ILE A C   
2692 O  O   . ILE A 310 ? 0.1625 0.2600 0.2522 -0.0316 -0.0074 0.0820  307  ILE A O   
2693 C  CB  . ILE A 310 ? 0.1707 0.2956 0.2621 -0.0220 0.0042  0.0880  307  ILE A CB  
2694 C  CG1 . ILE A 310 ? 0.2200 0.3593 0.3206 -0.0209 0.0074  0.0946  307  ILE A CG1 
2695 C  CG2 . ILE A 310 ? 0.1906 0.3155 0.2800 -0.0225 0.0058  0.0918  307  ILE A CG2 
2696 C  CD1 . ILE A 310 ? 0.2649 0.4098 0.3777 -0.0259 0.0060  0.1032  307  ILE A CD1 
2697 N  N   . MET A 311 ? 0.1546 0.2501 0.2320 -0.0249 -0.0046 0.0720  308  MET A N   
2698 C  CA  . MET A 311 ? 0.1529 0.2368 0.2231 -0.0256 -0.0070 0.0666  308  MET A CA  
2699 C  C   . MET A 311 ? 0.1503 0.2266 0.2253 -0.0307 -0.0128 0.0663  308  MET A C   
2700 O  O   . MET A 311 ? 0.1661 0.2355 0.2405 -0.0329 -0.0151 0.0661  308  MET A O   
2701 C  CB  . MET A 311 ? 0.1679 0.2467 0.2292 -0.0220 -0.0064 0.0591  308  MET A CB  
2702 C  CG  . MET A 311 ? 0.1770 0.2602 0.2320 -0.0167 -0.0017 0.0577  308  MET A CG  
2703 S  SD  . MET A 311 ? 0.1849 0.2642 0.2326 -0.0127 -0.0012 0.0503  308  MET A SD  
2704 C  CE  . MET A 311 ? 0.2049 0.2716 0.2457 -0.0139 -0.0038 0.0446  308  MET A CE  
2705 N  N   . ALA A 312 ? 0.1428 0.2198 0.2224 -0.0323 -0.0155 0.0657  309  ALA A N   
2706 C  CA  . ALA A 312 ? 0.1532 0.2227 0.2365 -0.0367 -0.0216 0.0643  309  ALA A CA  
2707 C  C   . ALA A 312 ? 0.1712 0.2424 0.2645 -0.0412 -0.0240 0.0710  309  ALA A C   
2708 O  O   . ALA A 312 ? 0.1732 0.2357 0.2673 -0.0441 -0.0285 0.0695  309  ALA A O   
2709 C  CB  . ALA A 312 ? 0.1523 0.2234 0.2385 -0.0372 -0.0242 0.0629  309  ALA A CB  
2710 N  N   . LEU A 313 ? 0.1660 0.2484 0.2677 -0.0417 -0.0215 0.0783  310  LEU A N   
2711 C  CA  . LEU A 313 ? 0.1681 0.2530 0.2807 -0.0463 -0.0237 0.0857  310  LEU A CA  
2712 C  C   . LEU A 313 ? 0.1685 0.2490 0.2779 -0.0464 -0.0228 0.0871  310  LEU A C   
2713 O  O   . LEU A 313 ? 0.1769 0.2515 0.2918 -0.0505 -0.0273 0.0890  310  LEU A O   
2714 C  CB  . LEU A 313 ? 0.1626 0.2619 0.2848 -0.0464 -0.0201 0.0943  310  LEU A CB  
2715 C  CG  . LEU A 313 ? 0.1713 0.2756 0.3000 -0.0473 -0.0220 0.0945  310  LEU A CG  
2716 C  CD1 . LEU A 313 ? 0.1897 0.3098 0.3261 -0.0456 -0.0168 0.1023  310  LEU A CD1 
2717 C  CD2 . LEU A 313 ? 0.2002 0.2990 0.3388 -0.0534 -0.0297 0.0959  310  LEU A CD2 
2718 N  N   . LEU A 314 ? 0.1717 0.2546 0.2723 -0.0420 -0.0175 0.0858  311  LEU A N   
2719 C  CA  . LEU A 314 ? 0.1741 0.2528 0.2711 -0.0418 -0.0168 0.0869  311  LEU A CA  
2720 C  C   . LEU A 314 ? 0.1821 0.2470 0.2748 -0.0433 -0.0217 0.0804  311  LEU A C   
2721 O  O   . LEU A 314 ? 0.1826 0.2418 0.2789 -0.0462 -0.0249 0.0824  311  LEU A O   
2722 C  CB  . LEU A 314 ? 0.1710 0.2543 0.2585 -0.0363 -0.0108 0.0855  311  LEU A CB  
2723 C  CG  . LEU A 314 ? 0.1880 0.2852 0.2782 -0.0338 -0.0054 0.0920  311  LEU A CG  
2724 C  CD1 . LEU A 314 ? 0.2171 0.3170 0.2959 -0.0275 -0.0004 0.0879  311  LEU A CD1 
2725 C  CD2 . LEU A 314 ? 0.2497 0.3532 0.3481 -0.0365 -0.0045 0.1021  311  LEU A CD2 
2726 N  N   . ALA A 315 ? 0.1673 0.2264 0.2521 -0.0410 -0.0224 0.0723  312  ALA A N   
2727 C  CA  . ALA A 315 ? 0.1777 0.2248 0.2571 -0.0414 -0.0261 0.0658  312  ALA A CA  
2728 C  C   . ALA A 315 ? 0.1792 0.2201 0.2662 -0.0461 -0.0326 0.0664  312  ALA A C   
2729 O  O   . ALA A 315 ? 0.1967 0.2297 0.2840 -0.0476 -0.0357 0.0655  312  ALA A O   
2730 C  CB  . ALA A 315 ? 0.1847 0.2284 0.2549 -0.0381 -0.0252 0.0581  312  ALA A CB  
2731 N  N   . SER A 316 ? 0.1726 0.2169 0.2661 -0.0483 -0.0351 0.0678  313  SER A N   
2732 C  CA  . SER A 316 ? 0.1791 0.2173 0.2799 -0.0527 -0.0420 0.0678  313  SER A CA  
2733 C  C   . SER A 316 ? 0.1964 0.2362 0.3083 -0.0568 -0.0439 0.0757  313  SER A C   
2734 O  O   . SER A 316 ? 0.2019 0.2331 0.3179 -0.0599 -0.0498 0.0748  313  SER A O   
2735 C  CB  . SER A 316 ? 0.1741 0.2162 0.2792 -0.0539 -0.0443 0.0675  313  SER A CB  
2736 O  OG  . SER A 316 ? 0.2005 0.2397 0.2956 -0.0505 -0.0435 0.0602  313  SER A OG  
2737 N  N   . TYR A 317 ? 0.1976 0.2482 0.3139 -0.0565 -0.0391 0.0832  314  TYR A N   
2738 C  CA  . TYR A 317 ? 0.1923 0.2451 0.3185 -0.0600 -0.0400 0.0917  314  TYR A CA  
2739 C  C   . TYR A 317 ? 0.1996 0.2425 0.3209 -0.0596 -0.0414 0.0894  314  TYR A C   
2740 O  O   . TYR A 317 ? 0.1994 0.2356 0.3280 -0.0634 -0.0467 0.0915  314  TYR A O   
2741 C  CB  . TYR A 317 ? 0.1931 0.2602 0.3225 -0.0585 -0.0333 0.1001  314  TYR A CB  
2742 C  CG  . TYR A 317 ? 0.2071 0.2775 0.3448 -0.0613 -0.0329 0.1096  314  TYR A CG  
2743 C  CD1 . TYR A 317 ? 0.2260 0.2949 0.3775 -0.0671 -0.0383 0.1154  314  TYR A CD1 
2744 C  CD2 . TYR A 317 ? 0.2097 0.2845 0.3416 -0.0581 -0.0274 0.1126  314  TYR A CD2 
2745 C  CE1 . TYR A 317 ? 0.2303 0.3027 0.3904 -0.0699 -0.0380 0.1248  314  TYR A CE1 
2746 C  CE2 . TYR A 317 ? 0.2301 0.3086 0.3697 -0.0606 -0.0269 0.1221  314  TYR A CE2 
2747 C  CZ  . TYR A 317 ? 0.2132 0.2903 0.3671 -0.0666 -0.0323 0.1282  314  TYR A CZ  
2748 O  OH  . TYR A 317 ? 0.2391 0.3195 0.4012 -0.0693 -0.0320 0.1383  314  TYR A OH  
2749 N  N   . TYR A 318 ? 0.1940 0.2358 0.3035 -0.0549 -0.0370 0.0850  315  TYR A N   
2750 C  CA  . TYR A 318 ? 0.1948 0.2281 0.3001 -0.0543 -0.0381 0.0830  315  TYR A CA  
2751 C  C   . TYR A 318 ? 0.2040 0.2241 0.3085 -0.0557 -0.0447 0.0762  315  TYR A C   
2752 O  O   . TYR A 318 ? 0.2329 0.2458 0.3417 -0.0579 -0.0487 0.0776  315  TYR A O   
2753 C  CB  . TYR A 318 ? 0.1916 0.2262 0.2848 -0.0490 -0.0327 0.0790  315  TYR A CB  
2754 C  CG  . TYR A 318 ? 0.1834 0.2294 0.2757 -0.0468 -0.0265 0.0852  315  TYR A CG  
2755 C  CD1 . TYR A 318 ? 0.2098 0.2610 0.3094 -0.0488 -0.0257 0.0944  315  TYR A CD1 
2756 C  CD2 . TYR A 318 ? 0.1751 0.2267 0.2591 -0.0423 -0.0215 0.0820  315  TYR A CD2 
2757 C  CE1 . TYR A 318 ? 0.2051 0.2670 0.3027 -0.0462 -0.0200 0.0999  315  TYR A CE1 
2758 C  CE2 . TYR A 318 ? 0.2083 0.2701 0.2904 -0.0395 -0.0161 0.0870  315  TYR A CE2 
2759 C  CZ  . TYR A 318 ? 0.1961 0.2634 0.2846 -0.0413 -0.0151 0.0960  315  TYR A CZ  
2760 O  OH  . TYR A 318 ? 0.1951 0.2731 0.2809 -0.0381 -0.0096 0.1010  315  TYR A OH  
2761 N  N   . SER A 319 ? 0.2026 0.2197 0.3015 -0.0542 -0.0459 0.0688  316  SER A N   
2762 C  CA  . SER A 319 ? 0.2110 0.2159 0.3067 -0.0544 -0.0514 0.0614  316  SER A CA  
2763 C  C   . SER A 319 ? 0.2328 0.2328 0.3390 -0.0592 -0.0589 0.0631  316  SER A C   
2764 O  O   . SER A 319 ? 0.2710 0.2602 0.3765 -0.0597 -0.0641 0.0586  316  SER A O   
2765 C  CB  . SER A 319 ? 0.2095 0.2121 0.2944 -0.0508 -0.0501 0.0529  316  SER A CB  
2766 O  OG  . SER A 319 ? 0.2182 0.2263 0.3053 -0.0516 -0.0505 0.0531  316  SER A OG  
2767 N  N   . CYS A 320 ? 0.2124 0.2205 0.3287 -0.0626 -0.0594 0.0700  317  CYS A N   
2768 C  CA  . CYS A 320 ? 0.2445 0.2498 0.3739 -0.0679 -0.0663 0.0740  317  CYS A CA  
2769 C  C   . CYS A 320 ? 0.2597 0.2635 0.3972 -0.0706 -0.0673 0.0811  317  CYS A C   
2770 O  O   . CYS A 320 ? 0.3275 0.3205 0.4685 -0.0726 -0.0736 0.0791  317  CYS A O   
2771 C  CB  . CYS A 320 ? 0.2355 0.2519 0.3739 -0.0705 -0.0657 0.0798  317  CYS A CB  
2772 S  SG  . CYS A 320 ? 0.2943 0.3092 0.4512 -0.0777 -0.0740 0.0866  317  CYS A SG  
2773 N  N   . THR A 321 ? 0.2485 0.2628 0.3888 -0.0705 -0.0614 0.0894  318  THR A N   
2774 C  CA  A THR A 321 ? 0.2546 0.2705 0.4054 -0.0739 -0.0623 0.0988  318  THR A CA  
2775 C  CA  B THR A 321 ? 0.2500 0.2656 0.4011 -0.0740 -0.0625 0.0988  318  THR A CA  
2776 C  C   . THR A 321 ? 0.2487 0.2573 0.3941 -0.0719 -0.0618 0.0977  318  THR A C   
2777 O  O   . THR A 321 ? 0.2545 0.2575 0.4082 -0.0751 -0.0660 0.1021  318  THR A O   
2778 C  CB  A THR A 321 ? 0.2570 0.2889 0.4133 -0.0742 -0.0559 0.1086  318  THR A CB  
2779 C  CB  B THR A 321 ? 0.2496 0.2809 0.4078 -0.0750 -0.0566 0.1100  318  THR A CB  
2780 O  OG1 A THR A 321 ? 0.3039 0.3414 0.4665 -0.0763 -0.0575 0.1092  318  THR A OG1 
2781 O  OG1 B THR A 321 ? 0.2418 0.2804 0.3886 -0.0697 -0.0485 0.1090  318  THR A OG1 
2782 C  CG2 A THR A 321 ? 0.2455 0.2809 0.4138 -0.0781 -0.0566 0.1197  318  THR A CG2 
2783 C  CG2 B THR A 321 ? 0.2463 0.2851 0.4132 -0.0777 -0.0579 0.1126  318  THR A CG2 
2784 N  N   . TYR A 322 ? 0.2425 0.2509 0.3742 -0.0666 -0.0567 0.0917  319  TYR A N   
2785 C  CA  . TYR A 322 ? 0.2501 0.2522 0.3758 -0.0642 -0.0559 0.0899  319  TYR A CA  
2786 C  C   . TYR A 322 ? 0.2529 0.2413 0.3720 -0.0624 -0.0607 0.0792  319  TYR A C   
2787 O  O   . TYR A 322 ? 0.2712 0.2527 0.3865 -0.0606 -0.0613 0.0770  319  TYR A O   
2788 C  CB  . TYR A 322 ? 0.2477 0.2582 0.3636 -0.0596 -0.0480 0.0907  319  TYR A CB  
2789 C  CG  . TYR A 322 ? 0.2668 0.2898 0.3883 -0.0605 -0.0434 0.1014  319  TYR A CG  
2790 C  CD1 . TYR A 322 ? 0.3401 0.3640 0.4632 -0.0605 -0.0421 0.1078  319  TYR A CD1 
2791 C  CD2 . TYR A 322 ? 0.2649 0.2991 0.3899 -0.0610 -0.0402 0.1053  319  TYR A CD2 
2792 C  CE1 . TYR A 322 ? 0.3799 0.4159 0.5080 -0.0612 -0.0378 0.1184  319  TYR A CE1 
2793 C  CE2 . TYR A 322 ? 0.3033 0.3498 0.4334 -0.0615 -0.0358 0.1153  319  TYR A CE2 
2794 C  CZ  . TYR A 322 ? 0.3125 0.3601 0.4437 -0.0615 -0.0343 0.1219  319  TYR A CZ  
2795 O  OH  . TYR A 322 ? 0.3431 0.4034 0.4787 -0.0615 -0.0296 0.1321  319  TYR A OH  
2796 N  N   . ASN A 323 ? 0.2580 0.2430 0.3758 -0.0628 -0.0640 0.0729  320  ASN A N   
2797 C  CA  . ASN A 323 ? 0.2745 0.2478 0.3851 -0.0606 -0.0681 0.0625  320  ASN A CA  
2798 C  C   . ASN A 323 ? 0.2608 0.2333 0.3584 -0.0551 -0.0630 0.0566  320  ASN A C   
2799 O  O   . ASN A 323 ? 0.2749 0.2381 0.3667 -0.0527 -0.0653 0.0495  320  ASN A O   
2800 C  CB  . ASN A 323 ? 0.2942 0.2558 0.4116 -0.0630 -0.0757 0.0618  320  ASN A CB  
2801 C  CG  . ASN A 323 ? 0.3436 0.3052 0.4746 -0.0687 -0.0816 0.0671  320  ASN A CG  
2802 O  OD1 . ASN A 323 ? 0.3619 0.3260 0.4944 -0.0700 -0.0835 0.0652  320  ASN A OD1 
2803 N  ND2 . ASN A 323 ? 0.3742 0.3328 0.5159 -0.0722 -0.0850 0.0740  320  ASN A ND2 
2804 N  N   . SER A 324 ? 0.2522 0.2346 0.3455 -0.0531 -0.0562 0.0594  321  SER A N   
2805 C  CA  . SER A 324 ? 0.2202 0.2027 0.3018 -0.0482 -0.0515 0.0539  321  SER A CA  
2806 C  C   . SER A 324 ? 0.2257 0.2044 0.3000 -0.0461 -0.0525 0.0452  321  SER A C   
2807 O  O   . SER A 324 ? 0.2269 0.2068 0.3035 -0.0478 -0.0547 0.0443  321  SER A O   
2808 C  CB  . SER A 324 ? 0.2203 0.2140 0.2992 -0.0465 -0.0448 0.0584  321  SER A CB  
2809 O  OG  . SER A 324 ? 0.2304 0.2323 0.3128 -0.0480 -0.0434 0.0615  321  SER A OG  
2810 N  N   . GLN A 325 ? 0.2064 0.1806 0.2721 -0.0423 -0.0509 0.0390  322  GLN A N   
2811 C  CA  . GLN A 325 ? 0.2012 0.1714 0.2593 -0.0397 -0.0515 0.0309  322  GLN A CA  
2812 C  C   . GLN A 325 ? 0.2019 0.1770 0.2512 -0.0359 -0.0455 0.0282  322  GLN A C   
2813 O  O   . GLN A 325 ? 0.2121 0.1844 0.2546 -0.0334 -0.0452 0.0221  322  GLN A O   
2814 C  CB  . GLN A 325 ? 0.2216 0.1806 0.2779 -0.0385 -0.0562 0.0251  322  GLN A CB  
2815 C  CG  . GLN A 325 ? 0.2619 0.2147 0.3265 -0.0420 -0.0629 0.0266  322  GLN A CG  
2816 C  CD  . GLN A 325 ? 0.2984 0.2401 0.3610 -0.0400 -0.0671 0.0206  322  GLN A CD  
2817 O  OE1 . GLN A 325 ? 0.3756 0.3157 0.4301 -0.0357 -0.0641 0.0157  322  GLN A OE1 
2818 N  NE2 . GLN A 325 ? 0.3425 0.2782 0.4133 -0.0429 -0.0728 0.0228  322  GLN A NE2 
2819 N  N   . SER A 326 ? 0.1917 0.1742 0.2413 -0.0355 -0.0410 0.0330  323  SER A N   
2820 C  CA  . SER A 326 ? 0.1921 0.1794 0.2346 -0.0322 -0.0359 0.0309  323  SER A CA  
2821 C  C   . SER A 326 ? 0.1908 0.1874 0.2350 -0.0324 -0.0320 0.0364  323  SER A C   
2822 O  O   . SER A 326 ? 0.1861 0.1860 0.2367 -0.0347 -0.0325 0.0427  323  SER A O   
2823 C  CB  . SER A 326 ? 0.2144 0.1976 0.2518 -0.0292 -0.0345 0.0275  323  SER A CB  
2824 O  OG  . SER A 326 ? 0.2158 0.2015 0.2554 -0.0292 -0.0330 0.0322  323  SER A OG  
2825 N  N   . GLN A 327 ? 0.1836 0.1846 0.2224 -0.0298 -0.0282 0.0343  324  GLN A N   
2826 C  CA  . GLN A 327 ? 0.1850 0.1946 0.2234 -0.0286 -0.0241 0.0382  324  GLN A CA  
2827 C  C   . GLN A 327 ? 0.1867 0.1964 0.2181 -0.0250 -0.0210 0.0344  324  GLN A C   
2828 O  O   . GLN A 327 ? 0.1788 0.1844 0.2059 -0.0236 -0.0212 0.0291  324  GLN A O   
2829 C  CB  . GLN A 327 ? 0.2117 0.2271 0.2516 -0.0290 -0.0230 0.0390  324  GLN A CB  
2830 C  CG  . GLN A 327 ? 0.2185 0.2364 0.2664 -0.0325 -0.0255 0.0437  324  GLN A CG  
2831 C  CD  . GLN A 327 ? 0.2374 0.2607 0.2861 -0.0324 -0.0246 0.0435  324  GLN A CD  
2832 O  OE1 . GLN A 327 ? 0.2127 0.2444 0.2634 -0.0316 -0.0215 0.0474  324  GLN A OE1 
2833 N  NE2 . GLN A 327 ? 0.2098 0.2283 0.2563 -0.0326 -0.0272 0.0386  324  GLN A NE2 
2834 N  N   . ALA A 328 ? 0.1682 0.1827 0.1982 -0.0234 -0.0182 0.0373  325  ALA A N   
2835 C  CA  . ALA A 328 ? 0.1578 0.1726 0.1818 -0.0201 -0.0158 0.0340  325  ALA A CA  
2836 C  C   . ALA A 328 ? 0.1774 0.1991 0.1991 -0.0180 -0.0127 0.0342  325  ALA A C   
2837 O  O   . ALA A 328 ? 0.1869 0.2151 0.2111 -0.0182 -0.0113 0.0387  325  ALA A O   
2838 C  CB  . ALA A 328 ? 0.1749 0.1895 0.1984 -0.0193 -0.0157 0.0364  325  ALA A CB  
2839 N  N   . LEU A 329 ? 0.1542 0.1746 0.1714 -0.0158 -0.0116 0.0294  326  LEU A N   
2840 C  CA  . LEU A 329 ? 0.1608 0.1861 0.1756 -0.0134 -0.0092 0.0283  326  LEU A CA  
2841 C  C   . LEU A 329 ? 0.1642 0.1883 0.1744 -0.0105 -0.0083 0.0253  326  LEU A C   
2842 O  O   . LEU A 329 ? 0.1590 0.1780 0.1678 -0.0104 -0.0093 0.0218  326  LEU A O   
2843 C  CB  . LEU A 329 ? 0.1781 0.2017 0.1930 -0.0138 -0.0097 0.0254  326  LEU A CB  
2844 C  CG  . LEU A 329 ? 0.1722 0.1993 0.1848 -0.0113 -0.0077 0.0237  326  LEU A CG  
2845 C  CD1 . LEU A 329 ? 0.2062 0.2409 0.2204 -0.0102 -0.0058 0.0274  326  LEU A CD1 
2846 C  CD2 . LEU A 329 ? 0.2177 0.2424 0.2307 -0.0121 -0.0086 0.0214  326  LEU A CD2 
2847 N  N   . LEU A 330 ? 0.1592 0.1885 0.1673 -0.0082 -0.0066 0.0268  327  LEU A N   
2848 C  CA  . LEU A 330 ? 0.1450 0.1739 0.1490 -0.0055 -0.0063 0.0246  327  LEU A CA  
2849 C  C   . LEU A 330 ? 0.1673 0.1995 0.1681 -0.0022 -0.0049 0.0220  327  LEU A C   
2850 O  O   . LEU A 330 ? 0.1593 0.1972 0.1582 0.0000  -0.0034 0.0240  327  LEU A O   
2851 C  CB  . LEU A 330 ? 0.1541 0.1854 0.1576 -0.0052 -0.0063 0.0286  327  LEU A CB  
2852 C  CG  . LEU A 330 ? 0.1564 0.1848 0.1641 -0.0084 -0.0079 0.0321  327  LEU A CG  
2853 C  CD1 . LEU A 330 ? 0.1692 0.2010 0.1762 -0.0077 -0.0075 0.0368  327  LEU A CD1 
2854 C  CD2 . LEU A 330 ? 0.1886 0.2092 0.1966 -0.0094 -0.0100 0.0282  327  LEU A CD2 
2855 N  N   . PRO A 331 ? 0.1486 0.1773 0.1488 -0.0017 -0.0055 0.0178  328  PRO A N   
2856 C  CA  . PRO A 331 ? 0.1618 0.1925 0.1596 0.0014  -0.0047 0.0150  328  PRO A CA  
2857 C  C   . PRO A 331 ? 0.1591 0.1890 0.1532 0.0041  -0.0056 0.0124  328  PRO A C   
2858 O  O   . PRO A 331 ? 0.1694 0.1949 0.1639 0.0034  -0.0071 0.0102  328  PRO A O   
2859 C  CB  . PRO A 331 ? 0.1703 0.1970 0.1698 0.0003  -0.0054 0.0122  328  PRO A CB  
2860 C  CG  . PRO A 331 ? 0.1882 0.2118 0.1905 -0.0031 -0.0061 0.0136  328  PRO A CG  
2861 C  CD  . PRO A 331 ? 0.1481 0.1713 0.1503 -0.0040 -0.0067 0.0157  328  PRO A CD  
2862 N  N   . TYR A 332 ? 0.1532 0.1881 0.1440 0.0073  -0.0046 0.0128  329  TYR A N   
2863 C  CA  . TYR A 332 ? 0.1578 0.1925 0.1442 0.0104  -0.0058 0.0101  329  TYR A CA  
2864 C  C   . TYR A 332 ? 0.1678 0.2001 0.1530 0.0129  -0.0071 0.0048  329  TYR A C   
2865 O  O   . TYR A 332 ? 0.1778 0.2126 0.1588 0.0169  -0.0073 0.0025  329  TYR A O   
2866 C  CB  . TYR A 332 ? 0.1761 0.2174 0.1584 0.0131  -0.0043 0.0133  329  TYR A CB  
2867 C  CG  . TYR A 332 ? 0.1590 0.2004 0.1419 0.0111  -0.0047 0.0174  329  TYR A CG  
2868 C  CD1 . TYR A 332 ? 0.1572 0.1976 0.1449 0.0071  -0.0042 0.0214  329  TYR A CD1 
2869 C  CD2 . TYR A 332 ? 0.1640 0.2061 0.1424 0.0134  -0.0058 0.0171  329  TYR A CD2 
2870 C  CE1 . TYR A 332 ? 0.1673 0.2070 0.1560 0.0054  -0.0050 0.0250  329  TYR A CE1 
2871 C  CE2 . TYR A 332 ? 0.1839 0.2260 0.1630 0.0118  -0.0064 0.0210  329  TYR A CE2 
2872 C  CZ  . TYR A 332 ? 0.1680 0.2085 0.1524 0.0078  -0.0059 0.0250  329  TYR A CZ  
2873 O  OH  . TYR A 332 ? 0.1878 0.2275 0.1736 0.0062  -0.0068 0.0289  329  TYR A OH  
2874 N  N   . ASP A 333 ? 0.1597 0.1870 0.1486 0.0106  -0.0081 0.0028  330  ASP A N   
2875 C  CA  . ASP A 333 ? 0.1582 0.1822 0.1474 0.0123  -0.0099 -0.0017 330  ASP A CA  
2876 C  C   . ASP A 333 ? 0.1558 0.1746 0.1494 0.0091  -0.0109 -0.0024 330  ASP A C   
2877 O  O   . ASP A 333 ? 0.1595 0.1777 0.1557 0.0064  -0.0097 -0.0002 330  ASP A O   
2878 C  CB  . ASP A 333 ? 0.1709 0.1973 0.1601 0.0143  -0.0087 -0.0024 330  ASP A CB  
2879 C  CG  . ASP A 333 ? 0.1875 0.2106 0.1765 0.0168  -0.0109 -0.0072 330  ASP A CG  
2880 O  OD1 . ASP A 333 ? 0.1832 0.2015 0.1762 0.0148  -0.0123 -0.0084 330  ASP A OD1 
2881 O  OD2 . ASP A 333 ? 0.1920 0.2172 0.1771 0.0211  -0.0114 -0.0097 330  ASP A OD2 
2882 N  N   . GLU A 334 ? 0.1538 0.1693 0.1482 0.0096  -0.0132 -0.0053 331  GLU A N   
2883 C  CA  . GLU A 334 ? 0.1529 0.1643 0.1519 0.0070  -0.0142 -0.0059 331  GLU A CA  
2884 C  C   . GLU A 334 ? 0.1523 0.1623 0.1544 0.0057  -0.0132 -0.0056 331  GLU A C   
2885 O  O   . GLU A 334 ? 0.1599 0.1680 0.1650 0.0032  -0.0127 -0.0044 331  GLU A O   
2886 C  CB  . GLU A 334 ? 0.1702 0.1789 0.1704 0.0083  -0.0172 -0.0094 331  GLU A CB  
2887 C  CG  . GLU A 334 ? 0.1924 0.2015 0.1910 0.0090  -0.0188 -0.0098 331  GLU A CG  
2888 C  CD  . GLU A 334 ? 0.1901 0.1980 0.1920 0.0061  -0.0181 -0.0077 331  GLU A CD  
2889 O  OE1 . GLU A 334 ? 0.1979 0.2034 0.2048 0.0044  -0.0187 -0.0082 331  GLU A OE1 
2890 O  OE2 . GLU A 334 ? 0.2040 0.2135 0.2042 0.0055  -0.0170 -0.0052 331  GLU A OE2 
2891 N  N   . ARG A 335 ? 0.1508 0.1619 0.1520 0.0077  -0.0131 -0.0066 332  ARG A N   
2892 C  CA  . ARG A 335 ? 0.1528 0.1625 0.1569 0.0067  -0.0126 -0.0061 332  ARG A CA  
2893 C  C   . ARG A 335 ? 0.1636 0.1750 0.1679 0.0044  -0.0103 -0.0028 332  ARG A C   
2894 O  O   . ARG A 335 ? 0.1646 0.1746 0.1714 0.0029  -0.0100 -0.0019 332  ARG A O   
2895 C  CB  . ARG A 335 ? 0.1466 0.1569 0.1499 0.0098  -0.0132 -0.0082 332  ARG A CB  
2896 C  CG  . ARG A 335 ? 0.1683 0.1754 0.1719 0.0120  -0.0163 -0.0123 332  ARG A CG  
2897 C  CD  . ARG A 335 ? 0.1708 0.1789 0.1722 0.0162  -0.0170 -0.0150 332  ARG A CD  
2898 N  NE  . ARG A 335 ? 0.1814 0.1946 0.1773 0.0190  -0.0155 -0.0148 332  ARG A NE  
2899 C  CZ  . ARG A 335 ? 0.1780 0.1935 0.1709 0.0232  -0.0154 -0.0170 332  ARG A CZ  
2900 N  NH1 . ARG A 335 ? 0.1863 0.1991 0.1815 0.0251  -0.0168 -0.0195 332  ARG A NH1 
2901 N  NH2 . ARG A 335 ? 0.1837 0.2046 0.1713 0.0259  -0.0137 -0.0164 332  ARG A NH2 
2902 N  N   . LEU A 336 ? 0.1527 0.1670 0.1547 0.0041  -0.0092 -0.0009 333  LEU A N   
2903 C  CA  . LEU A 336 ? 0.1401 0.1559 0.1427 0.0018  -0.0078 0.0021  333  LEU A CA  
2904 C  C   . LEU A 336 ? 0.1474 0.1607 0.1507 -0.0006 -0.0080 0.0029  333  LEU A C   
2905 O  O   . LEU A 336 ? 0.1557 0.1696 0.1591 -0.0023 -0.0074 0.0050  333  LEU A O   
2906 C  CB  . LEU A 336 ? 0.1463 0.1670 0.1472 0.0028  -0.0066 0.0043  333  LEU A CB  
2907 C  CG  . LEU A 336 ? 0.1601 0.1841 0.1605 0.0055  -0.0060 0.0038  333  LEU A CG  
2908 C  CD1 . LEU A 336 ? 0.1696 0.1996 0.1685 0.0068  -0.0043 0.0065  333  LEU A CD1 
2909 C  CD2 . LEU A 336 ? 0.1733 0.1969 0.1764 0.0042  -0.0057 0.0048  333  LEU A CD2 
2910 N  N   . CYS A 337 ? 0.1618 0.1721 0.1665 -0.0009 -0.0088 0.0013  334  CYS A N   
2911 C  CA  A CYS A 337 ? 0.1560 0.1644 0.1616 -0.0025 -0.0087 0.0018  334  CYS A CA  
2912 C  CA  B CYS A 337 ? 0.1869 0.1953 0.1925 -0.0025 -0.0087 0.0018  334  CYS A CA  
2913 C  C   . CYS A 337 ? 0.1704 0.1778 0.1764 -0.0044 -0.0079 0.0030  334  CYS A C   
2914 O  O   . CYS A 337 ? 0.1988 0.2050 0.2046 -0.0053 -0.0078 0.0034  334  CYS A O   
2915 C  CB  A CYS A 337 ? 0.1848 0.1912 0.1926 -0.0023 -0.0097 0.0001  334  CYS A CB  
2916 C  CB  B CYS A 337 ? 0.2105 0.2169 0.2182 -0.0022 -0.0097 0.0000  334  CYS A CB  
2917 S  SG  A CYS A 337 ? 0.1401 0.1450 0.1512 -0.0023 -0.0099 -0.0007 334  CYS A SG  
2918 S  SG  B CYS A 337 ? 0.3367 0.3413 0.3480 -0.0034 -0.0092 0.0001  334  CYS A SG  
2919 N  N   . TYR A 338 ? 0.1512 0.1590 0.1575 -0.0045 -0.0074 0.0034  335  TYR A N   
2920 C  CA  . TYR A 338 ? 0.1480 0.1553 0.1538 -0.0059 -0.0070 0.0045  335  TYR A CA  
2921 C  C   . TYR A 338 ? 0.1463 0.1556 0.1513 -0.0066 -0.0072 0.0060  335  TYR A C   
2922 O  O   . TYR A 338 ? 0.1519 0.1608 0.1563 -0.0077 -0.0074 0.0068  335  TYR A O   
2923 C  CB  . TYR A 338 ? 0.1440 0.1506 0.1509 -0.0060 -0.0065 0.0046  335  TYR A CB  
2924 C  CG  . TYR A 338 ? 0.1691 0.1743 0.1780 -0.0059 -0.0062 0.0040  335  TYR A CG  
2925 C  CD1 . TYR A 338 ? 0.2370 0.2414 0.2454 -0.0064 -0.0054 0.0040  335  TYR A CD1 
2926 C  CD2 . TYR A 338 ? 0.1829 0.1876 0.1944 -0.0052 -0.0067 0.0034  335  TYR A CD2 
2927 C  CE1 . TYR A 338 ? 0.2914 0.2955 0.3026 -0.0062 -0.0048 0.0041  335  TYR A CE1 
2928 C  CE2 . TYR A 338 ? 0.2227 0.2265 0.2374 -0.0054 -0.0066 0.0034  335  TYR A CE2 
2929 C  CZ  . TYR A 338 ? 0.3025 0.3065 0.3172 -0.0060 -0.0054 0.0040  335  TYR A CZ  
2930 O  OH  . TYR A 338 ? 0.3575 0.3616 0.3763 -0.0062 -0.0050 0.0045  335  TYR A OH  
2931 N  N   . PHE A 339 ? 0.1482 0.1601 0.1532 -0.0058 -0.0071 0.0067  336  PHE A N   
2932 C  CA  . PHE A 339 ? 0.1473 0.1623 0.1528 -0.0063 -0.0071 0.0088  336  PHE A CA  
2933 C  C   . PHE A 339 ? 0.1532 0.1674 0.1590 -0.0084 -0.0080 0.0102  336  PHE A C   
2934 O  O   . PHE A 339 ? 0.1622 0.1770 0.1689 -0.0097 -0.0087 0.0114  336  PHE A O   
2935 C  CB  . PHE A 339 ? 0.1685 0.1873 0.1739 -0.0044 -0.0064 0.0093  336  PHE A CB  
2936 C  CG  . PHE A 339 ? 0.1805 0.2038 0.1873 -0.0044 -0.0059 0.0118  336  PHE A CG  
2937 C  CD1 . PHE A 339 ? 0.1907 0.2154 0.1986 -0.0037 -0.0058 0.0118  336  PHE A CD1 
2938 C  CD2 . PHE A 339 ? 0.2106 0.2371 0.2181 -0.0050 -0.0056 0.0145  336  PHE A CD2 
2939 C  CE1 . PHE A 339 ? 0.2082 0.2378 0.2182 -0.0036 -0.0053 0.0143  336  PHE A CE1 
2940 C  CE2 . PHE A 339 ? 0.2233 0.2550 0.2332 -0.0051 -0.0049 0.0173  336  PHE A CE2 
2941 C  CZ  . PHE A 339 ? 0.2133 0.2466 0.2245 -0.0044 -0.0048 0.0171  336  PHE A CZ  
2942 N  N   . VAL A 340 ? 0.1544 0.1671 0.1599 -0.0088 -0.0083 0.0102  337  VAL A N   
2943 C  CA  . VAL A 340 ? 0.1629 0.1734 0.1691 -0.0107 -0.0097 0.0112  337  VAL A CA  
2944 C  C   . VAL A 340 ? 0.1550 0.1623 0.1602 -0.0115 -0.0105 0.0095  337  VAL A C   
2945 O  O   . VAL A 340 ? 0.1619 0.1687 0.1677 -0.0130 -0.0120 0.0102  337  VAL A O   
2946 C  CB  . VAL A 340 ? 0.1628 0.1715 0.1689 -0.0107 -0.0101 0.0112  337  VAL A CB  
2947 C  CG1 . VAL A 340 ? 0.1978 0.2030 0.2049 -0.0125 -0.0119 0.0115  337  VAL A CG1 
2948 C  CG2 . VAL A 340 ? 0.1867 0.1993 0.1932 -0.0099 -0.0094 0.0136  337  VAL A CG2 
2949 N  N   . ASP A 341 ? 0.1605 0.1659 0.1641 -0.0104 -0.0096 0.0074  338  ASP A N   
2950 C  CA  A ASP A 341 ? 0.1632 0.1664 0.1650 -0.0106 -0.0100 0.0061  338  ASP A CA  
2951 C  CA  B ASP A 341 ? 0.1622 0.1654 0.1640 -0.0106 -0.0100 0.0060  338  ASP A CA  
2952 C  C   . ASP A 341 ? 0.1593 0.1640 0.1608 -0.0112 -0.0106 0.0070  338  ASP A C   
2953 O  O   . ASP A 341 ? 0.1619 0.1651 0.1620 -0.0119 -0.0121 0.0064  338  ASP A O   
2954 C  CB  A ASP A 341 ? 0.1878 0.1905 0.1890 -0.0093 -0.0084 0.0048  338  ASP A CB  
2955 C  CB  B ASP A 341 ? 0.1819 0.1844 0.1830 -0.0093 -0.0084 0.0047  338  ASP A CB  
2956 C  CG  A ASP A 341 ? 0.2454 0.2462 0.2469 -0.0086 -0.0081 0.0036  338  ASP A CG  
2957 C  CG  B ASP A 341 ? 0.2115 0.2130 0.2136 -0.0085 -0.0079 0.0039  338  ASP A CG  
2958 O  OD1 A ASP A 341 ? 0.2547 0.2539 0.2563 -0.0091 -0.0093 0.0036  338  ASP A OD1 
2959 O  OD1 B ASP A 341 ? 0.2396 0.2393 0.2410 -0.0080 -0.0076 0.0026  338  ASP A OD1 
2960 O  OD2 A ASP A 341 ? 0.2507 0.2518 0.2531 -0.0077 -0.0068 0.0030  338  ASP A OD2 
2961 O  OD2 B ASP A 341 ? 0.2332 0.2360 0.2366 -0.0082 -0.0079 0.0044  338  ASP A OD2 
2962 N  N   . TYR A 342 ? 0.1345 0.1421 0.1373 -0.0106 -0.0097 0.0080  339  TYR A N   
2963 C  CA  . TYR A 342 ? 0.1371 0.1467 0.1402 -0.0108 -0.0102 0.0091  339  TYR A CA  
2964 C  C   . TYR A 342 ? 0.1469 0.1578 0.1516 -0.0125 -0.0120 0.0106  339  TYR A C   
2965 O  O   . TYR A 342 ? 0.1565 0.1670 0.1606 -0.0133 -0.0137 0.0107  339  TYR A O   
2966 C  CB  . TYR A 342 ? 0.1397 0.1519 0.1444 -0.0094 -0.0090 0.0097  339  TYR A CB  
2967 C  CG  . TYR A 342 ? 0.1491 0.1634 0.1546 -0.0095 -0.0096 0.0110  339  TYR A CG  
2968 C  CD1 . TYR A 342 ? 0.1614 0.1744 0.1654 -0.0092 -0.0098 0.0109  339  TYR A CD1 
2969 C  CD2 . TYR A 342 ? 0.1603 0.1783 0.1683 -0.0097 -0.0101 0.0127  339  TYR A CD2 
2970 C  CE1 . TYR A 342 ? 0.1567 0.1718 0.1616 -0.0092 -0.0107 0.0123  339  TYR A CE1 
2971 C  CE2 . TYR A 342 ? 0.1598 0.1802 0.1693 -0.0097 -0.0109 0.0140  339  TYR A CE2 
2972 C  CZ  . TYR A 342 ? 0.1515 0.1700 0.1592 -0.0095 -0.0114 0.0137  339  TYR A CZ  
2973 O  OH  . TYR A 342 ? 0.1758 0.1965 0.1847 -0.0093 -0.0124 0.0151  339  TYR A OH  
2974 N  N   . LEU A 343 ? 0.1530 0.1658 0.1601 -0.0129 -0.0119 0.0120  340  LEU A N   
2975 C  CA  . LEU A 343 ? 0.1663 0.1810 0.1764 -0.0148 -0.0136 0.0144  340  LEU A CA  
2976 C  C   . LEU A 343 ? 0.1765 0.1869 0.1862 -0.0165 -0.0161 0.0134  340  LEU A C   
2977 O  O   . LEU A 343 ? 0.1902 0.2007 0.2021 -0.0184 -0.0187 0.0145  340  LEU A O   
2978 C  CB  . LEU A 343 ? 0.1834 0.2025 0.1964 -0.0146 -0.0124 0.0170  340  LEU A CB  
2979 C  CG  . LEU A 343 ? 0.1929 0.2167 0.2066 -0.0126 -0.0105 0.0178  340  LEU A CG  
2980 C  CD1 . LEU A 343 ? 0.2439 0.2726 0.2597 -0.0121 -0.0091 0.0205  340  LEU A CD1 
2981 C  CD2 . LEU A 343 ? 0.2071 0.2334 0.2227 -0.0129 -0.0113 0.0187  340  LEU A CD2 
2982 N  N   . GLN A 344 ? 0.1662 0.1727 0.1735 -0.0159 -0.0159 0.0113  341  GLN A N   
2983 C  CA  A GLN A 344 ? 0.1972 0.1990 0.2034 -0.0168 -0.0183 0.0096  341  GLN A CA  
2984 C  CA  B GLN A 344 ? 0.1885 0.1900 0.1945 -0.0167 -0.0184 0.0094  341  GLN A CA  
2985 C  C   . GLN A 344 ? 0.1928 0.1932 0.1965 -0.0169 -0.0201 0.0079  341  GLN A C   
2986 O  O   . GLN A 344 ? 0.2034 0.2017 0.2079 -0.0183 -0.0234 0.0075  341  GLN A O   
2987 C  CB  A GLN A 344 ? 0.2009 0.1997 0.2049 -0.0154 -0.0172 0.0075  341  GLN A CB  
2988 C  CB  B GLN A 344 ? 0.1930 0.1911 0.1964 -0.0152 -0.0172 0.0070  341  GLN A CB  
2989 C  CG  A GLN A 344 ? 0.2237 0.2176 0.2270 -0.0157 -0.0195 0.0056  341  GLN A CG  
2990 C  CG  B GLN A 344 ? 0.1871 0.1849 0.1928 -0.0154 -0.0170 0.0082  341  GLN A CG  
2991 C  CD  A GLN A 344 ? 0.2346 0.2265 0.2361 -0.0138 -0.0179 0.0037  341  GLN A CD  
2992 C  CD  B GLN A 344 ? 0.1908 0.1857 0.1946 -0.0137 -0.0160 0.0059  341  GLN A CD  
2993 O  OE1 A GLN A 344 ? 0.2448 0.2371 0.2435 -0.0121 -0.0160 0.0021  341  GLN A OE1 
2994 O  OE1 B GLN A 344 ? 0.1979 0.1935 0.1997 -0.0121 -0.0139 0.0045  341  GLN A OE1 
2995 N  NE2 A GLN A 344 ? 0.2320 0.2223 0.2358 -0.0142 -0.0185 0.0045  341  GLN A NE2 
2996 N  NE2 B GLN A 344 ? 0.1755 0.1672 0.1807 -0.0141 -0.0175 0.0059  341  GLN A NE2 
2997 N  N   . GLN A 345 ? 0.1825 0.1841 0.1832 -0.0153 -0.0183 0.0070  342  GLN A N   
2998 C  CA  . GLN A 345 ? 0.1792 0.1805 0.1773 -0.0151 -0.0199 0.0062  342  GLN A CA  
2999 C  C   . GLN A 345 ? 0.1843 0.1885 0.1858 -0.0168 -0.0220 0.0084  342  GLN A C   
3000 O  O   . GLN A 345 ? 0.1912 0.1937 0.1923 -0.0179 -0.0254 0.0076  342  GLN A O   
3001 C  CB  . GLN A 345 ? 0.1804 0.1829 0.1755 -0.0132 -0.0172 0.0059  342  GLN A CB  
3002 C  CG  . GLN A 345 ? 0.1786 0.1816 0.1707 -0.0129 -0.0186 0.0057  342  GLN A CG  
3003 C  CD  . GLN A 345 ? 0.2281 0.2317 0.2167 -0.0110 -0.0161 0.0058  342  GLN A CD  
3004 O  OE1 . GLN A 345 ? 0.2267 0.2308 0.2162 -0.0101 -0.0134 0.0061  342  GLN A OE1 
3005 N  NE2 . GLN A 345 ? 0.2405 0.2445 0.2257 -0.0104 -0.0175 0.0057  342  GLN A NE2 
3006 N  N   . ALA A 346 ? 0.1589 0.1676 0.1638 -0.0168 -0.0201 0.0109  343  ALA A N   
3007 C  CA  . ALA A 346 ? 0.1675 0.1800 0.1762 -0.0180 -0.0218 0.0133  343  ALA A CA  
3008 C  C   . ALA A 346 ? 0.1733 0.1852 0.1860 -0.0206 -0.0251 0.0145  343  ALA A C   
3009 O  O   . ALA A 346 ? 0.1874 0.2000 0.2020 -0.0220 -0.0283 0.0150  343  ALA A O   
3010 C  CB  . ALA A 346 ? 0.1621 0.1798 0.1742 -0.0171 -0.0192 0.0158  343  ALA A CB  
3011 N  N   . ASP A 347 ? 0.1656 0.1764 0.1803 -0.0213 -0.0246 0.0151  344  ASP A N   
3012 C  CA  . ASP A 347 ? 0.1612 0.1716 0.1811 -0.0241 -0.0277 0.0171  344  ASP A CA  
3013 C  C   . ASP A 347 ? 0.1766 0.1803 0.1941 -0.0249 -0.0317 0.0139  344  ASP A C   
3014 O  O   . ASP A 347 ? 0.1820 0.1851 0.2020 -0.0268 -0.0357 0.0140  344  ASP A O   
3015 C  CB  . ASP A 347 ? 0.1597 0.1713 0.1821 -0.0242 -0.0255 0.0194  344  ASP A CB  
3016 C  CG  . ASP A 347 ? 0.2070 0.2193 0.2358 -0.0271 -0.0279 0.0228  344  ASP A CG  
3017 O  OD1 . ASP A 347 ? 0.2152 0.2258 0.2470 -0.0293 -0.0319 0.0229  344  ASP A OD1 
3018 O  OD2 . ASP A 347 ? 0.2127 0.2274 0.2437 -0.0271 -0.0258 0.0257  344  ASP A OD2 
3019 N  N   . MET A 348 ? 0.1724 0.1713 0.1855 -0.0235 -0.0310 0.0108  345  MET A N   
3020 C  CA  . MET A 348 ? 0.1758 0.1680 0.1868 -0.0238 -0.0350 0.0074  345  MET A CA  
3021 C  C   . MET A 348 ? 0.1956 0.1862 0.2020 -0.0229 -0.0374 0.0043  345  MET A C   
3022 O  O   . MET A 348 ? 0.1938 0.1802 0.2001 -0.0239 -0.0422 0.0022  345  MET A O   
3023 C  CB  . MET A 348 ? 0.1779 0.1662 0.1852 -0.0217 -0.0331 0.0047  345  MET A CB  
3024 C  CG  . MET A 348 ? 0.1720 0.1613 0.1838 -0.0227 -0.0316 0.0077  345  MET A CG  
3025 S  SD  . MET A 348 ? 0.2080 0.1931 0.2166 -0.0203 -0.0297 0.0051  345  MET A SD  
3026 C  CE  . MET A 348 ? 0.2323 0.2101 0.2399 -0.0203 -0.0342 0.0014  345  MET A CE  
3027 N  N   . GLU A 349 ? 0.1810 0.1743 0.1829 -0.0208 -0.0345 0.0039  346  GLU A N   
3028 C  CA  . GLU A 349 ? 0.1864 0.1789 0.1833 -0.0198 -0.0368 0.0015  346  GLU A CA  
3029 C  C   . GLU A 349 ? 0.1970 0.1921 0.1985 -0.0221 -0.0404 0.0037  346  GLU A C   
3030 O  O   . GLU A 349 ? 0.2136 0.2065 0.2124 -0.0222 -0.0446 0.0014  346  GLU A O   
3031 C  CB  . GLU A 349 ? 0.2032 0.1981 0.1949 -0.0172 -0.0328 0.0014  346  GLU A CB  
3032 C  CG  . GLU A 349 ? 0.2192 0.2126 0.2041 -0.0154 -0.0347 -0.0013 346  GLU A CG  
3033 C  CD  . GLU A 349 ? 0.2763 0.2726 0.2570 -0.0132 -0.0309 -0.0004 346  GLU A CD  
3034 O  OE1 . GLU A 349 ? 0.2578 0.2571 0.2415 -0.0132 -0.0272 0.0022  346  GLU A OE1 
3035 O  OE2 . GLU A 349 ? 0.3192 0.3151 0.2940 -0.0116 -0.0322 -0.0019 346  GLU A OE2 
3036 N  N   . SER A 350 ? 0.1738 0.1740 0.1820 -0.0238 -0.0391 0.0079  347  SER A N   
3037 C  CA  . SER A 350 ? 0.1686 0.1720 0.1824 -0.0261 -0.0425 0.0103  347  SER A CA  
3038 C  C   . SER A 350 ? 0.1744 0.1746 0.1934 -0.0291 -0.0477 0.0103  347  SER A C   
3039 O  O   . SER A 350 ? 0.1841 0.1833 0.2044 -0.0304 -0.0528 0.0094  347  SER A O   
3040 C  CB  . SER A 350 ? 0.1691 0.1799 0.1891 -0.0266 -0.0392 0.0150  347  SER A CB  
3041 O  OG  . SER A 350 ? 0.1774 0.1908 0.1934 -0.0239 -0.0351 0.0150  347  SER A OG  
3042 N  N   . ASN A 351 ? 0.1827 0.1818 0.2058 -0.0303 -0.0467 0.0119  348  ASN A N   
3043 C  CA  . ASN A 351 ? 0.1789 0.1763 0.2097 -0.0338 -0.0514 0.0137  348  ASN A CA  
3044 C  C   . ASN A 351 ? 0.1858 0.1744 0.2144 -0.0339 -0.0551 0.0098  348  ASN A C   
3045 O  O   . ASN A 351 ? 0.1929 0.1789 0.2286 -0.0370 -0.0597 0.0112  348  ASN A O   
3046 C  CB  . ASN A 351 ? 0.1813 0.1847 0.2202 -0.0356 -0.0485 0.0197  348  ASN A CB  
3047 C  CG  . ASN A 351 ? 0.2025 0.2146 0.2456 -0.0359 -0.0467 0.0236  348  ASN A CG  
3048 O  OD1 . ASN A 351 ? 0.2054 0.2181 0.2472 -0.0357 -0.0492 0.0222  348  ASN A OD1 
3049 N  ND2 . ASN A 351 ? 0.1668 0.1856 0.2151 -0.0361 -0.0428 0.0285  348  ASN A ND2 
3050 N  N   . GLY A 352 ? 0.1843 0.1684 0.2038 -0.0306 -0.0536 0.0049  349  GLY A N   
3051 C  CA  . GLY A 352 ? 0.1886 0.1644 0.2047 -0.0297 -0.0575 0.0000  349  GLY A CA  
3052 C  C   . GLY A 352 ? 0.2040 0.1759 0.2170 -0.0296 -0.0635 -0.0041 349  GLY A C   
3053 O  O   . GLY A 352 ? 0.2162 0.1862 0.2201 -0.0263 -0.0631 -0.0085 349  GLY A O   
3054 N  N   . LYS A 353 ? 0.2097 0.1811 0.2306 -0.0333 -0.0691 -0.0022 350  LYS A N   
3055 C  CA  . LYS A 353 ? 0.2203 0.1891 0.2404 -0.0340 -0.0758 -0.0051 350  LYS A CA  
3056 C  C   . LYS A 353 ? 0.2179 0.1806 0.2460 -0.0374 -0.0830 -0.0054 350  LYS A C   
3057 O  O   . LYS A 353 ? 0.2522 0.2168 0.2902 -0.0407 -0.0824 -0.0002 350  LYS A O   
3058 C  CB  . LYS A 353 ? 0.2141 0.1908 0.2384 -0.0357 -0.0755 -0.0009 350  LYS A CB  
3059 C  CG  . LYS A 353 ? 0.2111 0.1941 0.2300 -0.0330 -0.0688 0.0005  350  LYS A CG  
3060 C  CD  . LYS A 353 ? 0.2052 0.1855 0.2119 -0.0289 -0.0686 -0.0048 350  LYS A CD  
3061 C  CE  . LYS A 353 ? 0.2075 0.1927 0.2091 -0.0261 -0.0612 -0.0033 350  LYS A CE  
3062 N  NZ  . LYS A 353 ? 0.2037 0.1965 0.2096 -0.0271 -0.0592 0.0014  350  LYS A NZ  
3063 N  N   . SER A 354 ? 0.2272 0.1827 0.2509 -0.0363 -0.0896 -0.0115 351  SER A N   
3064 C  CA  . SER A 354 ? 0.2519 0.1998 0.2828 -0.0392 -0.0974 -0.0129 351  SER A CA  
3065 C  C   . SER A 354 ? 0.2642 0.2122 0.3014 -0.0426 -0.1052 -0.0124 351  SER A C   
3066 O  O   . SER A 354 ? 0.2720 0.2141 0.3174 -0.0458 -0.1124 -0.0128 351  SER A O   
3067 C  CB  . SER A 354 ? 0.2692 0.2073 0.2909 -0.0352 -0.1001 -0.0210 351  SER A CB  
3068 O  OG  . SER A 354 ? 0.3122 0.2489 0.3329 -0.0335 -0.0948 -0.0203 351  SER A OG  
3069 N  N   . VAL A 355 ? 0.2525 0.2064 0.2859 -0.0417 -0.1045 -0.0122 352  VAL A N   
3070 C  CA  . VAL A 355 ? 0.2580 0.2131 0.2975 -0.0448 -0.1116 -0.0115 352  VAL A CA  
3071 C  C   . VAL A 355 ? 0.2538 0.2201 0.3010 -0.0472 -0.1077 -0.0039 352  VAL A C   
3072 O  O   . VAL A 355 ? 0.2447 0.2174 0.2883 -0.0451 -0.0996 -0.0012 352  VAL A O   
3073 C  CB  . VAL A 355 ? 0.2621 0.2134 0.2902 -0.0413 -0.1166 -0.0187 352  VAL A CB  
3074 C  CG1 . VAL A 355 ? 0.2998 0.2400 0.3196 -0.0381 -0.1208 -0.0270 352  VAL A CG1 
3075 C  CG2 . VAL A 355 ? 0.2780 0.2358 0.2954 -0.0373 -0.1098 -0.0187 352  VAL A CG2 
3076 N  N   . ASN A 356 ? 0.2607 0.2292 0.3194 -0.0517 -0.1137 -0.0006 353  ASN A N   
3077 C  CA  . ASN A 356 ? 0.2448 0.2244 0.3118 -0.0538 -0.1110 0.0064  353  ASN A CA  
3078 C  C   . ASN A 356 ? 0.2534 0.2362 0.3131 -0.0514 -0.1122 0.0039  353  ASN A C   
3079 O  O   . ASN A 356 ? 0.2551 0.2321 0.3026 -0.0478 -0.1146 -0.0029 353  ASN A O   
3080 C  CB  . ASN A 356 ? 0.2356 0.2178 0.3195 -0.0597 -0.1161 0.0123  353  ASN A CB  
3081 C  CG  . ASN A 356 ? 0.2703 0.2458 0.3577 -0.0621 -0.1272 0.0083  353  ASN A CG  
3082 O  OD1 . ASN A 356 ? 0.2827 0.2545 0.3603 -0.0593 -0.1313 0.0020  353  ASN A OD1 
3083 N  ND2 . ASN A 356 ? 0.2884 0.2632 0.3911 -0.0676 -0.1326 0.0128  353  ASN A ND2 
3084 N  N   . ILE A 357 ? 0.2558 0.2484 0.3228 -0.0529 -0.1101 0.0098  354  ILE A N   
3085 C  CA  . ILE A 357 ? 0.2712 0.2680 0.3325 -0.0506 -0.1108 0.0086  354  ILE A CA  
3086 C  C   . ILE A 357 ? 0.2738 0.2644 0.3320 -0.0510 -0.1208 0.0031  354  ILE A C   
3087 O  O   . ILE A 357 ? 0.2849 0.2746 0.3318 -0.0474 -0.1214 -0.0010 354  ILE A O   
3088 C  CB  . ILE A 357 ? 0.2702 0.2784 0.3424 -0.0527 -0.1081 0.0161  354  ILE A CB  
3089 C  CG1 . ILE A 357 ? 0.3044 0.3188 0.3771 -0.0511 -0.0979 0.0206  354  ILE A CG1 
3090 C  CG2 . ILE A 357 ? 0.2932 0.3053 0.3616 -0.0509 -0.1105 0.0152  354  ILE A CG2 
3091 C  CD1 . ILE A 357 ? 0.3217 0.3347 0.3809 -0.0463 -0.0921 0.0172  354  ILE A CD1 
3092 N  N   . ALA A 358 ? 0.2658 0.2521 0.3340 -0.0552 -0.1286 0.0030  355  ALA A N   
3093 C  CA  . ALA A 358 ? 0.2918 0.2715 0.3583 -0.0559 -0.1394 -0.0026 355  ALA A CA  
3094 C  C   . ALA A 358 ? 0.3033 0.2715 0.3560 -0.0521 -0.1421 -0.0116 355  ALA A C   
3095 O  O   . ALA A 358 ? 0.3396 0.3012 0.3888 -0.0517 -0.1514 -0.0176 355  ALA A O   
3096 C  CB  . ALA A 358 ? 0.3112 0.2908 0.3952 -0.0621 -0.1472 0.0012  355  ALA A CB  
3097 N  N   . GLY A 359 ? 0.2999 0.2655 0.3452 -0.0491 -0.1348 -0.0129 356  GLY A N   
3098 C  CA  . GLY A 359 ? 0.3112 0.2667 0.3439 -0.0451 -0.1367 -0.0212 356  GLY A CA  
3099 C  C   . GLY A 359 ? 0.3207 0.2669 0.3600 -0.0476 -0.1422 -0.0235 356  GLY A C   
3100 O  O   . GLY A 359 ? 0.3666 0.3037 0.3962 -0.0441 -0.1449 -0.0310 356  GLY A O   
3101 N  N   . GLU A 360 ? 0.3089 0.2576 0.3646 -0.0533 -0.1436 -0.0169 357  GLU A N   
3102 C  CA  . GLU A 360 ? 0.3106 0.2508 0.3744 -0.0561 -0.1490 -0.0179 357  GLU A CA  
3103 C  C   . GLU A 360 ? 0.3052 0.2442 0.3670 -0.0546 -0.1411 -0.0163 357  GLU A C   
3104 O  O   . GLU A 360 ? 0.3015 0.2491 0.3653 -0.0548 -0.1322 -0.0100 357  GLU A O   
3105 C  CB  . GLU A 360 ? 0.3153 0.2596 0.3986 -0.0632 -0.1537 -0.0103 357  GLU A CB  
3106 C  CG  . GLU A 360 ? 0.3446 0.2912 0.4322 -0.0653 -0.1621 -0.0110 357  GLU A CG  
3107 C  CD  . GLU A 360 ? 0.3791 0.3338 0.4862 -0.0719 -0.1643 -0.0017 357  GLU A CD  
3108 O  OE1 . GLU A 360 ? 0.3639 0.3268 0.4797 -0.0740 -0.1568 0.0066  357  GLU A OE1 
3109 O  OE2 . GLU A 360 ? 0.4767 0.4297 0.5913 -0.0750 -0.1743 -0.0028 357  GLU A OE2 
3110 N  N   . THR A 361 ? 0.2972 0.2255 0.3559 -0.0532 -0.1446 -0.0218 358  THR A N   
3111 C  CA  . THR A 361 ? 0.3113 0.2377 0.3695 -0.0520 -0.1383 -0.0203 358  THR A CA  
3112 C  C   . THR A 361 ? 0.2984 0.2296 0.3735 -0.0580 -0.1370 -0.0106 358  THR A C   
3113 O  O   . THR A 361 ? 0.3289 0.2566 0.4168 -0.0629 -0.1451 -0.0085 358  THR A O   
3114 C  CB  . THR A 361 ? 0.3204 0.2336 0.3726 -0.0492 -0.1437 -0.0286 358  THR A CB  
3115 O  OG1 . THR A 361 ? 0.3913 0.3016 0.4270 -0.0430 -0.1438 -0.0372 358  THR A OG1 
3116 C  CG2 . THR A 361 ? 0.3340 0.2456 0.3870 -0.0482 -0.1372 -0.0264 358  THR A CG2 
3117 N  N   . VAL A 362 ? 0.2875 0.2265 0.3634 -0.0577 -0.1275 -0.0046 359  VAL A N   
3118 C  CA  . VAL A 362 ? 0.2908 0.2364 0.3816 -0.0627 -0.1251 0.0052  359  VAL A CA  
3119 C  C   . VAL A 362 ? 0.3007 0.2388 0.3968 -0.0641 -0.1266 0.0062  359  VAL A C   
3120 O  O   . VAL A 362 ? 0.3060 0.2372 0.3926 -0.0601 -0.1249 0.0006  359  VAL A O   
3121 C  CB  . VAL A 362 ? 0.2881 0.2460 0.3780 -0.0618 -0.1146 0.0116  359  VAL A CB  
3122 C  CG1 . VAL A 362 ? 0.3168 0.2821 0.4035 -0.0608 -0.1140 0.0114  359  VAL A CG1 
3123 C  CG2 . VAL A 362 ? 0.2809 0.2379 0.3593 -0.0569 -0.1065 0.0091  359  VAL A CG2 
3124 N  N   . ASN A 363 ? 0.3098 0.2495 0.4217 -0.0698 -0.1298 0.0136  360  ASN A N   
3125 C  CA  A ASN A 363 ? 0.3127 0.2452 0.4308 -0.0714 -0.1316 0.0154  360  ASN A CA  
3126 C  CA  B ASN A 363 ? 0.3196 0.2521 0.4381 -0.0716 -0.1319 0.0154  360  ASN A CA  
3127 C  C   . ASN A 363 ? 0.3199 0.2600 0.4419 -0.0721 -0.1230 0.0237  360  ASN A C   
3128 O  O   . ASN A 363 ? 0.3644 0.3009 0.4947 -0.0746 -0.1243 0.0279  360  ASN A O   
3129 C  CB  A ASN A 363 ? 0.3320 0.2587 0.4655 -0.0773 -0.1421 0.0179  360  ASN A CB  
3130 C  CB  B ASN A 363 ? 0.3388 0.2664 0.4730 -0.0776 -0.1423 0.0183  360  ASN A CB  
3131 C  CG  A ASN A 363 ? 0.3673 0.3052 0.5157 -0.0829 -0.1422 0.0277  360  ASN A CG  
3132 C  CG  B ASN A 363 ? 0.3855 0.3010 0.5152 -0.0764 -0.1529 0.0081  360  ASN A CG  
3133 O  OD1 A ASN A 363 ? 0.3968 0.3468 0.5451 -0.0825 -0.1339 0.0336  360  ASN A OD1 
3134 O  OD1 B ASN A 363 ? 0.4564 0.3644 0.5717 -0.0709 -0.1528 -0.0011 360  ASN A OD1 
3135 N  ND2 A ASN A 363 ? 0.3838 0.3175 0.5456 -0.0881 -0.1521 0.0293  360  ASN A ND2 
3136 N  ND2 B ASN A 363 ? 0.4484 0.3620 0.5905 -0.0815 -0.1621 0.0099  360  ASN A ND2 
3137 N  N   . TYR A 364 ? 0.2701 0.2202 0.3852 -0.0693 -0.1140 0.0256  361  TYR A N   
3138 C  CA  . TYR A 364 ? 0.2515 0.2093 0.3676 -0.0688 -0.1053 0.0324  361  TYR A CA  
3139 C  C   . TYR A 364 ? 0.2495 0.2080 0.3500 -0.0628 -0.0982 0.0269  361  TYR A C   
3140 O  O   . TYR A 364 ? 0.2495 0.2070 0.3403 -0.0597 -0.0983 0.0205  361  TYR A O   
3141 C  CB  . TYR A 364 ? 0.2411 0.2125 0.3663 -0.0717 -0.1012 0.0415  361  TYR A CB  
3142 C  CG  . TYR A 364 ? 0.2357 0.2126 0.3580 -0.0709 -0.1016 0.0393  361  TYR A CG  
3143 C  CD1 . TYR A 364 ? 0.2457 0.2286 0.3571 -0.0665 -0.0945 0.0370  361  TYR A CD1 
3144 C  CD2 . TYR A 364 ? 0.2494 0.2261 0.3806 -0.0746 -0.1092 0.0398  361  TYR A CD2 
3145 C  CE1 . TYR A 364 ? 0.2337 0.2213 0.3427 -0.0657 -0.0951 0.0354  361  TYR A CE1 
3146 C  CE2 . TYR A 364 ? 0.2500 0.2315 0.3785 -0.0738 -0.1099 0.0379  361  TYR A CE2 
3147 C  CZ  . TYR A 364 ? 0.2464 0.2339 0.3641 -0.0693 -0.1026 0.0361  361  TYR A CZ  
3148 O  OH  . TYR A 364 ? 0.2563 0.2486 0.3714 -0.0683 -0.1034 0.0344  361  TYR A OH  
3149 N  N   . GLN A 365 ? 0.2255 0.1863 0.3243 -0.0614 -0.0920 0.0300  362  GLN A N   
3150 C  CA  . GLN A 365 ? 0.2228 0.1848 0.3086 -0.0562 -0.0850 0.0259  362  GLN A CA  
3151 C  C   . GLN A 365 ? 0.2170 0.1898 0.2998 -0.0550 -0.0792 0.0281  362  GLN A C   
3152 O  O   . GLN A 365 ? 0.2219 0.2034 0.3133 -0.0577 -0.0776 0.0352  362  GLN A O   
3153 C  CB  . GLN A 365 ? 0.2246 0.1869 0.3114 -0.0556 -0.0805 0.0298  362  GLN A CB  
3154 C  CG  . GLN A 365 ? 0.2378 0.2004 0.3126 -0.0505 -0.0742 0.0256  362  GLN A CG  
3155 C  CD  . GLN A 365 ? 0.2401 0.2029 0.3161 -0.0499 -0.0705 0.0294  362  GLN A CD  
3156 O  OE1 . GLN A 365 ? 0.2558 0.2102 0.3303 -0.0487 -0.0728 0.0263  362  GLN A OE1 
3157 N  NE2 . GLN A 365 ? 0.2261 0.1985 0.3055 -0.0508 -0.0652 0.0364  362  GLN A NE2 
3158 N  N   . THR A 366 ? 0.2037 0.1760 0.2747 -0.0507 -0.0761 0.0222  363  THR A N   
3159 C  CA  . THR A 366 ? 0.2068 0.1881 0.2741 -0.0490 -0.0707 0.0236  363  THR A CA  
3160 C  C   . THR A 366 ? 0.1976 0.1816 0.2578 -0.0454 -0.0631 0.0236  363  THR A C   
3161 O  O   . THR A 366 ? 0.2051 0.1904 0.2688 -0.0460 -0.0605 0.0276  363  THR A O   
3162 C  CB  . THR A 366 ? 0.2025 0.1818 0.2631 -0.0473 -0.0738 0.0178  363  THR A CB  
3163 O  OG1 . THR A 366 ? 0.2097 0.1808 0.2600 -0.0438 -0.0747 0.0105  363  THR A OG1 
3164 C  CG2 . THR A 366 ? 0.2307 0.2086 0.3001 -0.0513 -0.0818 0.0188  363  THR A CG2 
3165 N  N   . GLY A 367 ? 0.1904 0.1758 0.2412 -0.0418 -0.0595 0.0197  364  GLY A N   
3166 C  CA  . GLY A 367 ? 0.1771 0.1660 0.2228 -0.0389 -0.0527 0.0203  364  GLY A CA  
3167 C  C   . GLY A 367 ? 0.1917 0.1750 0.2347 -0.0375 -0.0518 0.0185  364  GLY A C   
3168 O  O   . GLY A 367 ? 0.2003 0.1755 0.2404 -0.0368 -0.0556 0.0137  364  GLY A O   
3169 N  N   . VAL A 368 ? 0.1956 0.1832 0.2392 -0.0367 -0.0469 0.0220  365  VAL A N   
3170 C  CA  . VAL A 368 ? 0.1978 0.1810 0.2394 -0.0354 -0.0458 0.0211  365  VAL A CA  
3171 C  C   . VAL A 368 ? 0.1933 0.1778 0.2268 -0.0315 -0.0408 0.0180  365  VAL A C   
3172 O  O   . VAL A 368 ? 0.1911 0.1799 0.2209 -0.0301 -0.0380 0.0171  365  VAL A O   
3173 C  CB  . VAL A 368 ? 0.1952 0.1816 0.2442 -0.0376 -0.0450 0.0277  365  VAL A CB  
3174 C  CG1 . VAL A 368 ? 0.1990 0.1843 0.2578 -0.0420 -0.0504 0.0315  365  VAL A CG1 
3175 C  CG2 . VAL A 368 ? 0.2142 0.2099 0.2628 -0.0365 -0.0393 0.0319  365  VAL A CG2 
3176 N  N   . VAL A 369 ? 0.1884 0.1692 0.2197 -0.0299 -0.0398 0.0166  366  VAL A N   
3177 C  CA  . VAL A 369 ? 0.1757 0.1574 0.2004 -0.0266 -0.0355 0.0139  366  VAL A CA  
3178 C  C   . VAL A 369 ? 0.1760 0.1651 0.2014 -0.0261 -0.0310 0.0178  366  VAL A C   
3179 O  O   . VAL A 369 ? 0.2016 0.1935 0.2315 -0.0274 -0.0306 0.0225  366  VAL A O   
3180 C  CB  . VAL A 369 ? 0.1884 0.1643 0.2117 -0.0249 -0.0360 0.0116  366  VAL A CB  
3181 C  CG1 . VAL A 369 ? 0.2026 0.1804 0.2205 -0.0216 -0.0315 0.0095  366  VAL A CG1 
3182 C  CG2 . VAL A 369 ? 0.1895 0.1576 0.2110 -0.0244 -0.0405 0.0065  366  VAL A CG2 
3183 N  N   . LEU A 370 ? 0.1817 0.1740 0.2025 -0.0240 -0.0278 0.0161  367  LEU A N   
3184 C  CA  . LEU A 370 ? 0.1652 0.1636 0.1856 -0.0227 -0.0238 0.0185  367  LEU A CA  
3185 C  C   . LEU A 370 ? 0.1884 0.1848 0.2045 -0.0201 -0.0216 0.0156  367  LEU A C   
3186 O  O   . LEU A 370 ? 0.2006 0.1939 0.2129 -0.0187 -0.0215 0.0117  367  LEU A O   
3187 C  CB  . LEU A 370 ? 0.1723 0.1755 0.1914 -0.0221 -0.0220 0.0185  367  LEU A CB  
3188 C  CG  . LEU A 370 ? 0.1906 0.2002 0.2097 -0.0206 -0.0184 0.0207  367  LEU A CG  
3189 C  CD1 . LEU A 370 ? 0.2132 0.2275 0.2369 -0.0218 -0.0179 0.0259  367  LEU A CD1 
3190 C  CD2 . LEU A 370 ? 0.2344 0.2474 0.2523 -0.0196 -0.0172 0.0200  367  LEU A CD2 
3191 N  N   . TRP A 371 ? 0.1688 0.1675 0.1856 -0.0194 -0.0199 0.0178  368  TRP A N   
3192 C  CA  . TRP A 371 ? 0.1693 0.1667 0.1830 -0.0171 -0.0183 0.0156  368  TRP A CA  
3193 C  C   . TRP A 371 ? 0.1715 0.1739 0.1850 -0.0161 -0.0160 0.0181  368  TRP A C   
3194 O  O   . TRP A 371 ? 0.1812 0.1883 0.1967 -0.0169 -0.0154 0.0218  368  TRP A O   
3195 C  CB  . TRP A 371 ? 0.1757 0.1674 0.1902 -0.0172 -0.0204 0.0145  368  TRP A CB  
3196 C  CG  . TRP A 371 ? 0.1757 0.1675 0.1943 -0.0188 -0.0218 0.0188  368  TRP A CG  
3197 C  CD1 . TRP A 371 ? 0.1736 0.1647 0.1966 -0.0216 -0.0244 0.0219  368  TRP A CD1 
3198 C  CD2 . TRP A 371 ? 0.1718 0.1650 0.1906 -0.0179 -0.0209 0.0212  368  TRP A CD2 
3199 N  NE1 . TRP A 371 ? 0.1854 0.1777 0.2118 -0.0225 -0.0247 0.0265  368  TRP A NE1 
3200 C  CE2 . TRP A 371 ? 0.1759 0.1694 0.1993 -0.0201 -0.0226 0.0260  368  TRP A CE2 
3201 C  CE3 . TRP A 371 ? 0.1792 0.1733 0.1952 -0.0155 -0.0191 0.0197  368  TRP A CE3 
3202 C  CZ2 . TRP A 371 ? 0.2001 0.1951 0.2246 -0.0198 -0.0223 0.0298  368  TRP A CZ2 
3203 C  CZ3 . TRP A 371 ? 0.1925 0.1880 0.2094 -0.0151 -0.0191 0.0230  368  TRP A CZ3 
3204 C  CH2 . TRP A 371 ? 0.2115 0.2075 0.2322 -0.0171 -0.0205 0.0280  368  TRP A CH2 
3205 N  N   . GLY A 372 ? 0.1644 0.1661 0.1757 -0.0141 -0.0148 0.0163  369  GLY A N   
3206 C  CA  . GLY A 372 ? 0.1694 0.1753 0.1797 -0.0127 -0.0133 0.0183  369  GLY A CA  
3207 C  C   . GLY A 372 ? 0.2035 0.2088 0.2113 -0.0104 -0.0123 0.0151  369  GLY A C   
3208 O  O   . GLY A 372 ? 0.2574 0.2590 0.2651 -0.0101 -0.0129 0.0127  369  GLY A O   
3209 N  N   . GLY A 373 ? 0.1874 0.1967 0.1934 -0.0088 -0.0110 0.0154  370  GLY A N   
3210 C  CA  . GLY A 373 ? 0.1966 0.2055 0.2010 -0.0068 -0.0107 0.0126  370  GLY A CA  
3211 C  C   . GLY A 373 ? 0.1762 0.1892 0.1782 -0.0047 -0.0100 0.0129  370  GLY A C   
3212 O  O   . GLY A 373 ? 0.1788 0.1957 0.1802 -0.0045 -0.0093 0.0160  370  GLY A O   
3213 N  N   . VAL A 374 ? 0.1630 0.1754 0.1640 -0.0031 -0.0101 0.0097  371  VAL A N   
3214 C  CA  . VAL A 374 ? 0.1466 0.1622 0.1450 -0.0006 -0.0099 0.0088  371  VAL A CA  
3215 C  C   . VAL A 374 ? 0.1528 0.1702 0.1490 0.0009  -0.0107 0.0102  371  VAL A C   
3216 O  O   . VAL A 374 ? 0.1580 0.1730 0.1550 0.0005  -0.0119 0.0101  371  VAL A O   
3217 C  CB  . VAL A 374 ? 0.1464 0.1599 0.1455 0.0003  -0.0106 0.0050  371  VAL A CB  
3218 C  CG1 . VAL A 374 ? 0.1849 0.2001 0.1813 0.0033  -0.0115 0.0028  371  VAL A CG1 
3219 C  CG2 . VAL A 374 ? 0.1846 0.1974 0.1852 -0.0007 -0.0096 0.0044  371  VAL A CG2 
3220 N  N   . GLY A 375 ? 0.1528 0.1748 0.1460 0.0029  -0.0098 0.0114  372  GLY A N   
3221 C  CA  . GLY A 375 ? 0.1585 0.1832 0.1480 0.0052  -0.0104 0.0125  372  GLY A CA  
3222 C  C   . GLY A 375 ? 0.1533 0.1779 0.1397 0.0083  -0.0117 0.0081  372  GLY A C   
3223 O  O   . GLY A 375 ? 0.1590 0.1834 0.1455 0.0092  -0.0115 0.0054  372  GLY A O   
3224 N  N   . THR A 376 ? 0.1557 0.1803 0.1396 0.0100  -0.0136 0.0073  373  THR A N   
3225 C  CA  . THR A 376 ? 0.1736 0.1994 0.1567 0.0097  -0.0140 0.0110  373  THR A CA  
3226 C  C   . THR A 376 ? 0.1694 0.1906 0.1569 0.0070  -0.0152 0.0115  373  THR A C   
3227 O  O   . THR A 376 ? 0.1697 0.1910 0.1574 0.0065  -0.0157 0.0150  373  THR A O   
3228 C  CB  . THR A 376 ? 0.1831 0.2114 0.1607 0.0132  -0.0156 0.0102  373  THR A CB  
3229 O  OG1 . THR A 376 ? 0.1752 0.1997 0.1539 0.0137  -0.0187 0.0058  373  THR A OG1 
3230 C  CG2 . THR A 376 ? 0.1753 0.2088 0.1471 0.0169  -0.0143 0.0094  373  THR A CG2 
3231 N  N   . ASN A 377 ? 0.1790 0.1962 0.1702 0.0057  -0.0158 0.0084  374  ASN A N   
3232 C  CA  . ASN A 377 ? 0.1739 0.1874 0.1690 0.0040  -0.0169 0.0083  374  ASN A CA  
3233 C  C   . ASN A 377 ? 0.1659 0.1784 0.1629 0.0020  -0.0161 0.0122  374  ASN A C   
3234 O  O   . ASN A 377 ? 0.1745 0.1852 0.1729 0.0019  -0.0175 0.0133  374  ASN A O   
3235 C  CB  . ASN A 377 ? 0.1663 0.1767 0.1651 0.0027  -0.0166 0.0054  374  ASN A CB  
3236 C  CG  . ASN A 377 ? 0.1907 0.2012 0.1896 0.0041  -0.0178 0.0017  374  ASN A CG  
3237 O  OD1 . ASN A 377 ? 0.1975 0.2099 0.1933 0.0056  -0.0176 0.0006  374  ASN A OD1 
3238 N  ND2 . ASN A 377 ? 0.1723 0.1807 0.1750 0.0038  -0.0193 -0.0002 374  ASN A ND2 
3239 N  N   . GLY A 378 ? 0.1607 0.1742 0.1580 0.0005  -0.0144 0.0144  375  GLY A N   
3240 C  CA  . GLY A 378 ? 0.1644 0.1763 0.1644 -0.0017 -0.0145 0.0178  375  GLY A CA  
3241 C  C   . GLY A 378 ? 0.1627 0.1761 0.1619 -0.0012 -0.0153 0.0219  375  GLY A C   
3242 O  O   . GLY A 378 ? 0.1800 0.1906 0.1821 -0.0027 -0.0163 0.0243  375  GLY A O   
3243 N  N   . GLN A 379 ? 0.1700 0.1879 0.1651 0.0011  -0.0150 0.0229  376  GLN A N   
3244 C  CA  . GLN A 379 ? 0.1836 0.2041 0.1769 0.0021  -0.0157 0.0274  376  GLN A CA  
3245 C  C   . GLN A 379 ? 0.1976 0.2142 0.1926 0.0022  -0.0181 0.0269  376  GLN A C   
3246 O  O   . GLN A 379 ? 0.2086 0.2259 0.2037 0.0023  -0.0190 0.0314  376  GLN A O   
3247 C  CB  . GLN A 379 ? 0.1901 0.2162 0.1773 0.0054  -0.0151 0.0275  376  GLN A CB  
3248 C  CG  . GLN A 379 ? 0.1719 0.2029 0.1571 0.0062  -0.0125 0.0280  376  GLN A CG  
3249 C  CD  . GLN A 379 ? 0.1667 0.2029 0.1451 0.0104  -0.0120 0.0265  376  GLN A CD  
3250 O  OE1 . GLN A 379 ? 0.1995 0.2393 0.1763 0.0115  -0.0099 0.0260  376  GLN A OE1 
3251 N  NE2 . GLN A 379 ? 0.1762 0.2129 0.1504 0.0129  -0.0140 0.0256  376  GLN A NE2 
3252 N  N   . HIS A 380 ? 0.1860 0.1992 0.1825 0.0025  -0.0192 0.0220  377  HIS A N   
3253 C  CA  . HIS A 380 ? 0.1974 0.2075 0.1962 0.0030  -0.0214 0.0210  377  HIS A CA  
3254 C  C   . HIS A 380 ? 0.2315 0.2367 0.2353 0.0011  -0.0216 0.0209  377  HIS A C   
3255 O  O   . HIS A 380 ? 0.2361 0.2386 0.2425 0.0016  -0.0232 0.0198  377  HIS A O   
3256 C  CB  . HIS A 380 ? 0.1886 0.1988 0.1866 0.0048  -0.0225 0.0161  377  HIS A CB  
3257 C  CG  . HIS A 380 ? 0.1627 0.1772 0.1552 0.0072  -0.0231 0.0157  377  HIS A CG  
3258 N  ND1 . HIS A 380 ? 0.1796 0.1957 0.1692 0.0095  -0.0254 0.0164  377  HIS A ND1 
3259 C  CD2 . HIS A 380 ? 0.1718 0.1892 0.1604 0.0082  -0.0216 0.0146  377  HIS A CD2 
3260 C  CE1 . HIS A 380 ? 0.1754 0.1953 0.1593 0.0119  -0.0255 0.0154  377  HIS A CE1 
3261 N  NE2 . HIS A 380 ? 0.1748 0.1956 0.1581 0.0113  -0.0231 0.0143  377  HIS A NE2 
3262 N  N   . ALA A 381 ? 0.2372 0.2413 0.2424 -0.0010 -0.0202 0.0219  378  ALA A N   
3263 C  CA  . ALA A 381 ? 0.2443 0.2435 0.2533 -0.0024 -0.0205 0.0202  378  ALA A CA  
3264 C  C   A ALA A 381 ? 0.2215 0.2196 0.2321 -0.0046 -0.0206 0.0241  378  ALA A C   
3265 C  C   B ALA A 381 ? 0.2363 0.2324 0.2478 -0.0046 -0.0207 0.0219  378  ALA A C   
3266 O  O   A ALA A 381 ? 0.1878 0.1854 0.1999 -0.0051 -0.0219 0.0283  378  ALA A O   
3267 O  O   B ALA A 381 ? 0.2655 0.2571 0.2799 -0.0047 -0.0219 0.0207  378  ALA A O   
3268 C  CB  . ALA A 381 ? 0.2212 0.2203 0.2300 -0.0023 -0.0191 0.0159  378  ALA A CB  
3269 N  N   A PHE A 382 ? 0.1892 0.1870 0.2003 -0.0062 -0.0194 0.0230  379  PHE A N   
3270 N  N   B PHE A 382 ? 0.2122 0.2105 0.2231 -0.0061 -0.0194 0.0234  379  PHE A N   
3271 C  CA  . PHE A 382 ? 0.1979 0.1937 0.2118 -0.0085 -0.0202 0.0260  379  PHE A CA  
3272 C  C   . PHE A 382 ? 0.1816 0.1820 0.1955 -0.0095 -0.0197 0.0318  379  PHE A C   
3273 O  O   . PHE A 382 ? 0.1797 0.1787 0.1974 -0.0118 -0.0209 0.0355  379  PHE A O   
3274 C  CB  . PHE A 382 ? 0.2001 0.1943 0.2144 -0.0097 -0.0196 0.0230  379  PHE A CB  
3275 C  CG  . PHE A 382 ? 0.1863 0.1852 0.1978 -0.0093 -0.0173 0.0220  379  PHE A CG  
3276 C  CD1 . PHE A 382 ? 0.1935 0.1970 0.2048 -0.0102 -0.0163 0.0256  379  PHE A CD1 
3277 C  CD2 . PHE A 382 ? 0.1727 0.1717 0.1823 -0.0079 -0.0163 0.0177  379  PHE A CD2 
3278 C  CE1 . PHE A 382 ? 0.2200 0.2277 0.2290 -0.0094 -0.0144 0.0244  379  PHE A CE1 
3279 C  CE2 . PHE A 382 ? 0.2171 0.2200 0.2244 -0.0073 -0.0146 0.0168  379  PHE A CE2 
3280 C  CZ  . PHE A 382 ? 0.2002 0.2073 0.2071 -0.0079 -0.0136 0.0199  379  PHE A CZ  
3281 N  N   . HIS A 383 ? 0.1849 0.1911 0.1949 -0.0076 -0.0181 0.0329  380  HIS A N   
3282 C  CA  . HIS A 383 ? 0.1682 0.1797 0.1782 -0.0081 -0.0173 0.0393  380  HIS A CA  
3283 C  C   . HIS A 383 ? 0.1828 0.1922 0.1957 -0.0089 -0.0193 0.0440  380  HIS A C   
3284 O  O   . HIS A 383 ? 0.1842 0.1965 0.1996 -0.0105 -0.0191 0.0502  380  HIS A O   
3285 C  CB  . HIS A 383 ? 0.1661 0.1844 0.1705 -0.0053 -0.0153 0.0395  380  HIS A CB  
3286 C  CG  . HIS A 383 ? 0.1634 0.1848 0.1657 -0.0046 -0.0132 0.0366  380  HIS A CG  
3287 N  ND1 . HIS A 383 ? 0.1723 0.2007 0.1709 -0.0026 -0.0111 0.0383  380  HIS A ND1 
3288 C  CD2 . HIS A 383 ? 0.1833 0.2020 0.1864 -0.0052 -0.0130 0.0319  380  HIS A CD2 
3289 C  CE1 . HIS A 383 ? 0.1779 0.2072 0.1756 -0.0021 -0.0098 0.0347  380  HIS A CE1 
3290 N  NE2 . HIS A 383 ? 0.1824 0.2059 0.1828 -0.0038 -0.0110 0.0309  380  HIS A NE2 
3291 N  N   . GLN A 384 ? 0.1737 0.1785 0.1870 -0.0078 -0.0213 0.0417  381  GLN A N   
3292 C  CA  . GLN A 384 ? 0.1802 0.1818 0.1972 -0.0087 -0.0236 0.0463  381  GLN A CA  
3293 C  C   . GLN A 384 ? 0.1810 0.1791 0.2040 -0.0121 -0.0249 0.0493  381  GLN A C   
3294 O  O   . GLN A 384 ? 0.2010 0.2000 0.2272 -0.0135 -0.0258 0.0559  381  GLN A O   
3295 C  CB  . GLN A 384 ? 0.1905 0.1865 0.2084 -0.0072 -0.0257 0.0424  381  GLN A CB  
3296 C  CG  . GLN A 384 ? 0.1899 0.1805 0.2128 -0.0080 -0.0287 0.0456  381  GLN A CG  
3297 C  CD  . GLN A 384 ? 0.1995 0.1935 0.2220 -0.0077 -0.0293 0.0526  381  GLN A CD  
3298 O  OE1 . GLN A 384 ? 0.2109 0.2104 0.2283 -0.0055 -0.0281 0.0533  381  GLN A OE1 
3299 N  NE2 . GLN A 384 ? 0.1933 0.1839 0.2213 -0.0099 -0.0313 0.0579  381  GLN A NE2 
3300 N  N   . LEU A 385 ? 0.1769 0.1710 0.2016 -0.0133 -0.0253 0.0448  382  LEU A N   
3301 C  CA  . LEU A 385 ? 0.1791 0.1691 0.2094 -0.0164 -0.0273 0.0466  382  LEU A CA  
3302 C  C   . LEU A 385 ? 0.1906 0.1868 0.2225 -0.0186 -0.0258 0.0519  382  LEU A C   
3303 O  O   . LEU A 385 ? 0.1894 0.1847 0.2273 -0.0215 -0.0276 0.0573  382  LEU A O   
3304 C  CB  . LEU A 385 ? 0.1894 0.1733 0.2199 -0.0165 -0.0285 0.0398  382  LEU A CB  
3305 C  CG  . LEU A 385 ? 0.2145 0.1927 0.2506 -0.0194 -0.0316 0.0404  382  LEU A CG  
3306 C  CD1 . LEU A 385 ? 0.2328 0.2033 0.2687 -0.0181 -0.0337 0.0340  382  LEU A CD1 
3307 C  CD2 . LEU A 385 ? 0.2263 0.2084 0.2629 -0.0216 -0.0305 0.0413  382  LEU A CD2 
3308 N  N   . LEU A 386 ? 0.1748 0.1776 0.2022 -0.0173 -0.0225 0.0507  383  LEU A N   
3309 C  CA  . LEU A 386 ? 0.1721 0.1821 0.2010 -0.0187 -0.0205 0.0561  383  LEU A CA  
3310 C  C   . LEU A 386 ? 0.1856 0.2006 0.2159 -0.0188 -0.0200 0.0640  383  LEU A C   
3311 O  O   . LEU A 386 ? 0.2026 0.2214 0.2378 -0.0213 -0.0196 0.0702  383  LEU A O   
3312 C  CB  . LEU A 386 ? 0.1628 0.1789 0.1861 -0.0164 -0.0172 0.0528  383  LEU A CB  
3313 C  CG  . LEU A 386 ? 0.1670 0.1796 0.1891 -0.0163 -0.0173 0.0459  383  LEU A CG  
3314 C  CD1 . LEU A 386 ? 0.1945 0.2134 0.2115 -0.0138 -0.0141 0.0437  383  LEU A CD1 
3315 C  CD2 . LEU A 386 ? 0.2021 0.2115 0.2296 -0.0197 -0.0191 0.0463  383  LEU A CD2 
3316 N  N   . HIS A 387 ? 0.1848 0.1998 0.2114 -0.0164 -0.0201 0.0645  384  HIS A N   
3317 C  CA  . HIS A 387 ? 0.1980 0.2182 0.2249 -0.0160 -0.0195 0.0725  384  HIS A CA  
3318 C  C   . HIS A 387 ? 0.1906 0.2051 0.2244 -0.0186 -0.0229 0.0773  384  HIS A C   
3319 O  O   . HIS A 387 ? 0.2098 0.2284 0.2476 -0.0203 -0.0227 0.0859  384  HIS A O   
3320 C  CB  . HIS A 387 ? 0.2071 0.2309 0.2262 -0.0118 -0.0182 0.0710  384  HIS A CB  
3321 C  CG  . HIS A 387 ? 0.1801 0.2104 0.1925 -0.0090 -0.0150 0.0676  384  HIS A CG  
3322 N  ND1 . HIS A 387 ? 0.2250 0.2636 0.2370 -0.0089 -0.0120 0.0718  384  HIS A ND1 
3323 C  CD2 . HIS A 387 ? 0.2113 0.2410 0.2180 -0.0062 -0.0146 0.0604  384  HIS A CD2 
3324 C  CE1 . HIS A 387 ? 0.2320 0.2744 0.2376 -0.0058 -0.0098 0.0669  384  HIS A CE1 
3325 N  NE2 . HIS A 387 ? 0.2144 0.2514 0.2168 -0.0042 -0.0116 0.0602  384  HIS A NE2 
3326 N  N   . GLN A 388 ? 0.1897 0.1953 0.2249 -0.0185 -0.0261 0.0727  385  GLN A N   
3327 C  CA  . GLN A 388 ? 0.1982 0.1974 0.2395 -0.0201 -0.0297 0.0766  385  GLN A CA  
3328 C  C   . GLN A 388 ? 0.1991 0.1884 0.2462 -0.0223 -0.0335 0.0728  385  GLN A C   
3329 O  O   . GLN A 388 ? 0.2233 0.2064 0.2758 -0.0234 -0.0370 0.0754  385  GLN A O   
3330 C  CB  . GLN A 388 ? 0.2085 0.2062 0.2459 -0.0169 -0.0306 0.0756  385  GLN A CB  
3331 C  CG  . GLN A 388 ? 0.2138 0.2201 0.2461 -0.0147 -0.0283 0.0813  385  GLN A CG  
3332 C  CD  . GLN A 388 ? 0.2150 0.2186 0.2454 -0.0121 -0.0304 0.0815  385  GLN A CD  
3333 O  OE1 . GLN A 388 ? 0.2224 0.2217 0.2506 -0.0101 -0.0316 0.0746  385  GLN A OE1 
3334 N  NE2 . GLN A 388 ? 0.2147 0.2216 0.2460 -0.0122 -0.0308 0.0899  385  GLN A NE2 
3335 N  N   . GLY A 389 ? 0.1914 0.1788 0.2375 -0.0227 -0.0331 0.0663  386  GLY A N   
3336 C  CA  . GLY A 389 ? 0.1950 0.1737 0.2465 -0.0249 -0.0368 0.0632  386  GLY A CA  
3337 C  C   . GLY A 389 ? 0.2055 0.1845 0.2649 -0.0291 -0.0388 0.0698  386  GLY A C   
3338 O  O   . GLY A 389 ? 0.2186 0.2055 0.2794 -0.0303 -0.0366 0.0773  386  GLY A O   
3339 N  N   . ASN A 390 ? 0.2186 0.1894 0.2832 -0.0312 -0.0429 0.0670  387  ASN A N   
3340 C  CA  . ASN A 390 ? 0.2221 0.1922 0.2958 -0.0357 -0.0458 0.0729  387  ASN A CA  
3341 C  C   . ASN A 390 ? 0.2363 0.2044 0.3111 -0.0374 -0.0471 0.0682  387  ASN A C   
3342 O  O   . ASN A 390 ? 0.2532 0.2158 0.3360 -0.0409 -0.0518 0.0697  387  ASN A O   
3343 C  CB  . ASN A 390 ? 0.2315 0.1933 0.3126 -0.0372 -0.0507 0.0766  387  ASN A CB  
3344 C  CG  . ASN A 390 ? 0.2315 0.1818 0.3119 -0.0352 -0.0547 0.0686  387  ASN A CG  
3345 O  OD1 . ASN A 390 ? 0.2314 0.1787 0.3072 -0.0335 -0.0546 0.0602  387  ASN A OD1 
3346 N  ND2 . ASN A 390 ? 0.2483 0.1919 0.3341 -0.0355 -0.0585 0.0717  387  ASN A ND2 
3347 N  N   . ILE A 391 ? 0.2218 0.1949 0.2894 -0.0353 -0.0433 0.0634  388  ILE A N   
3348 C  CA  . ILE A 391 ? 0.2218 0.1955 0.2888 -0.0364 -0.0435 0.0591  388  ILE A CA  
3349 C  C   . ILE A 391 ? 0.2313 0.2161 0.2988 -0.0375 -0.0395 0.0646  388  ILE A C   
3350 O  O   . ILE A 391 ? 0.2160 0.2079 0.2780 -0.0350 -0.0350 0.0658  388  ILE A O   
3351 C  CB  . ILE A 391 ? 0.2339 0.2058 0.2925 -0.0329 -0.0417 0.0501  388  ILE A CB  
3352 C  CG1 . ILE A 391 ? 0.3079 0.2717 0.3635 -0.0301 -0.0435 0.0445  388  ILE A CG1 
3353 C  CG2 . ILE A 391 ? 0.2761 0.2464 0.3350 -0.0344 -0.0434 0.0460  388  ILE A CG2 
3354 C  CD1 . ILE A 391 ? 0.3067 0.2603 0.3676 -0.0315 -0.0493 0.0425  388  ILE A CD1 
3355 N  N   . PHE A 392 ? 0.2170 0.2035 0.2908 -0.0409 -0.0413 0.0672  389  PHE A N   
3356 C  CA  . PHE A 392 ? 0.2153 0.2127 0.2899 -0.0417 -0.0375 0.0718  389  PHE A CA  
3357 C  C   . PHE A 392 ? 0.2077 0.2068 0.2753 -0.0394 -0.0352 0.0647  389  PHE A C   
3358 O  O   . PHE A 392 ? 0.1987 0.1920 0.2662 -0.0401 -0.0382 0.0591  389  PHE A O   
3359 C  CB  . PHE A 392 ? 0.2138 0.2128 0.2993 -0.0465 -0.0405 0.0777  389  PHE A CB  
3360 C  CG  . PHE A 392 ? 0.2301 0.2415 0.3178 -0.0470 -0.0363 0.0838  389  PHE A CG  
3361 C  CD1 . PHE A 392 ? 0.2635 0.2830 0.3550 -0.0477 -0.0335 0.0934  389  PHE A CD1 
3362 C  CD2 . PHE A 392 ? 0.2176 0.2329 0.3036 -0.0467 -0.0349 0.0805  389  PHE A CD2 
3363 C  CE1 . PHE A 392 ? 0.2580 0.2899 0.3512 -0.0475 -0.0291 0.0988  389  PHE A CE1 
3364 C  CE2 . PHE A 392 ? 0.2138 0.2411 0.3018 -0.0466 -0.0307 0.0859  389  PHE A CE2 
3365 C  CZ  . PHE A 392 ? 0.2358 0.2714 0.3272 -0.0469 -0.0277 0.0950  389  PHE A CZ  
3366 N  N   . ILE A 393 ? 0.1828 0.1896 0.2440 -0.0363 -0.0301 0.0647  390  ILE A N   
3367 C  CA  . ILE A 393 ? 0.1908 0.1994 0.2450 -0.0337 -0.0275 0.0583  390  ILE A CA  
3368 C  C   . ILE A 393 ? 0.1848 0.2045 0.2379 -0.0325 -0.0230 0.0622  390  ILE A C   
3369 O  O   . ILE A 393 ? 0.1956 0.2203 0.2447 -0.0299 -0.0197 0.0643  390  ILE A O   
3370 C  CB  . ILE A 393 ? 0.1896 0.1940 0.2358 -0.0300 -0.0264 0.0522  390  ILE A CB  
3371 C  CG1 . ILE A 393 ? 0.2194 0.2137 0.2669 -0.0306 -0.0305 0.0489  390  ILE A CG1 
3372 C  CG2 . ILE A 393 ? 0.2032 0.2094 0.2432 -0.0276 -0.0240 0.0462  390  ILE A CG2 
3373 C  CD1 . ILE A 393 ? 0.2429 0.2339 0.2843 -0.0271 -0.0294 0.0446  390  ILE A CD1 
3374 N  N   . PRO A 394 ? 0.1753 0.1990 0.2311 -0.0336 -0.0227 0.0623  391  PRO A N   
3375 C  CA  . PRO A 394 ? 0.1760 0.2097 0.2294 -0.0314 -0.0181 0.0642  391  PRO A CA  
3376 C  C   . PRO A 394 ? 0.1735 0.2072 0.2174 -0.0270 -0.0152 0.0580  391  PRO A C   
3377 O  O   . PRO A 394 ? 0.1769 0.2034 0.2171 -0.0264 -0.0169 0.0517  391  PRO A O   
3378 C  CB  . PRO A 394 ? 0.1835 0.2192 0.2417 -0.0335 -0.0193 0.0641  391  PRO A CB  
3379 C  CG  . PRO A 394 ? 0.1843 0.2124 0.2495 -0.0378 -0.0249 0.0647  391  PRO A CG  
3380 C  CD  . PRO A 394 ? 0.1831 0.2021 0.2438 -0.0367 -0.0268 0.0603  391  PRO A CD  
3381 N  N   . VAL A 395 ? 0.1759 0.2172 0.2161 -0.0240 -0.0113 0.0600  392  VAL A N   
3382 C  CA  . VAL A 395 ? 0.1622 0.2033 0.1941 -0.0199 -0.0091 0.0545  392  VAL A CA  
3383 C  C   . VAL A 395 ? 0.1675 0.2163 0.1972 -0.0173 -0.0059 0.0541  392  VAL A C   
3384 O  O   . VAL A 395 ? 0.1773 0.2346 0.2092 -0.0167 -0.0034 0.0597  392  VAL A O   
3385 C  CB  . VAL A 395 ? 0.1720 0.2137 0.1998 -0.0177 -0.0081 0.0559  392  VAL A CB  
3386 C  CG1 . VAL A 395 ? 0.1965 0.2394 0.2161 -0.0133 -0.0060 0.0507  392  VAL A CG1 
3387 C  CG2 . VAL A 395 ? 0.1864 0.2196 0.2161 -0.0198 -0.0116 0.0555  392  VAL A CG2 
3388 N  N   . ASP A 396 ? 0.1565 0.2025 0.1822 -0.0156 -0.0057 0.0479  393  ASP A N   
3389 C  CA  . ASP A 396 ? 0.1633 0.2153 0.1860 -0.0122 -0.0028 0.0464  393  ASP A CA  
3390 C  C   . ASP A 396 ? 0.1639 0.2139 0.1792 -0.0084 -0.0019 0.0417  393  ASP A C   
3391 O  O   . ASP A 396 ? 0.1719 0.2145 0.1850 -0.0088 -0.0038 0.0371  393  ASP A O   
3392 C  CB  . ASP A 396 ? 0.1782 0.2282 0.2021 -0.0128 -0.0037 0.0428  393  ASP A CB  
3393 C  CG  . ASP A 396 ? 0.1943 0.2485 0.2253 -0.0155 -0.0042 0.0469  393  ASP A CG  
3394 O  OD1 . ASP A 396 ? 0.1896 0.2488 0.2257 -0.0172 -0.0038 0.0531  393  ASP A OD1 
3395 O  OD2 . ASP A 396 ? 0.1934 0.2455 0.2251 -0.0161 -0.0054 0.0440  393  ASP A OD2 
3396 N  N   . PHE A 397 ? 0.1598 0.2163 0.1714 -0.0047 0.0007  0.0425  394  PHE A N   
3397 C  CA  . PHE A 397 ? 0.1495 0.2044 0.1543 -0.0008 0.0011  0.0374  394  PHE A CA  
3398 C  C   . PHE A 397 ? 0.1554 0.2129 0.1589 0.0019  0.0024  0.0342  394  PHE A C   
3399 O  O   . PHE A 397 ? 0.1703 0.2348 0.1760 0.0028  0.0045  0.0373  394  PHE A O   
3400 C  CB  . PHE A 397 ? 0.1730 0.2337 0.1734 0.0024  0.0028  0.0401  394  PHE A CB  
3401 C  CG  . PHE A 397 ? 0.1535 0.2121 0.1544 0.0006  0.0015  0.0435  394  PHE A CG  
3402 C  CD1 . PHE A 397 ? 0.1659 0.2194 0.1627 0.0018  -0.0002 0.0399  394  PHE A CD1 
3403 C  CD2 . PHE A 397 ? 0.1732 0.2350 0.1794 -0.0023 0.0019  0.0506  394  PHE A CD2 
3404 C  CE1 . PHE A 397 ? 0.1925 0.2438 0.1897 0.0005  -0.0016 0.0429  394  PHE A CE1 
3405 C  CE2 . PHE A 397 ? 0.1895 0.2486 0.1965 -0.0039 0.0003  0.0538  394  PHE A CE2 
3406 C  CZ  . PHE A 397 ? 0.1906 0.2445 0.1928 -0.0023 -0.0013 0.0499  394  PHE A CZ  
3407 N  N   . ILE A 398 ? 0.1585 0.2107 0.1590 0.0033  0.0012  0.0283  395  ILE A N   
3408 C  CA  . ILE A 398 ? 0.1644 0.2181 0.1631 0.0065  0.0020  0.0247  395  ILE A CA  
3409 C  C   . ILE A 398 ? 0.1761 0.2298 0.1687 0.0108  0.0019  0.0210  395  ILE A C   
3410 O  O   . ILE A 398 ? 0.1862 0.2342 0.1768 0.0104  -0.0001 0.0181  395  ILE A O   
3411 C  CB  . ILE A 398 ? 0.1644 0.2120 0.1650 0.0048  0.0004  0.0210  395  ILE A CB  
3412 C  CG1 . ILE A 398 ? 0.1999 0.2458 0.2056 0.0004  -0.0005 0.0237  395  ILE A CG1 
3413 C  CG2 . ILE A 398 ? 0.1747 0.2243 0.1745 0.0081  0.0012  0.0182  395  ILE A CG2 
3414 C  CD1 . ILE A 398 ? 0.2031 0.2554 0.2128 -0.0004 0.0008  0.0281  395  ILE A CD1 
3415 N  N   . ALA A 399 ? 0.1742 0.2344 0.1637 0.0151  0.0040  0.0211  396  ALA A N   
3416 C  CA  . ALA A 399 ? 0.1748 0.2353 0.1579 0.0199  0.0035  0.0171  396  ALA A CA  
3417 C  C   . ALA A 399 ? 0.1747 0.2355 0.1567 0.0235  0.0037  0.0127  396  ALA A C   
3418 O  O   . ALA A 399 ? 0.1661 0.2309 0.1514 0.0237  0.0055  0.0145  396  ALA A O   
3419 C  CB  . ALA A 399 ? 0.2033 0.2721 0.1824 0.0228  0.0059  0.0212  396  ALA A CB  
3420 N  N   . ILE A 400 ? 0.1769 0.2331 0.1549 0.0263  0.0014  0.0071  397  ILE A N   
3421 C  CA  . ILE A 400 ? 0.1817 0.2364 0.1586 0.0300  0.0006  0.0020  397  ILE A CA  
3422 C  C   . ILE A 400 ? 0.1865 0.2443 0.1561 0.0361  0.0003  -0.0014 397  ILE A C   
3423 O  O   . ILE A 400 ? 0.2049 0.2594 0.1708 0.0366  -0.0020 -0.0037 397  ILE A O   
3424 C  CB  . ILE A 400 ? 0.1849 0.2304 0.1646 0.0278  -0.0029 -0.0024 397  ILE A CB  
3425 C  CG1 . ILE A 400 ? 0.1886 0.2306 0.1739 0.0220  -0.0029 0.0006  397  ILE A CG1 
3426 C  CG2 . ILE A 400 ? 0.1940 0.2375 0.1738 0.0313  -0.0039 -0.0070 397  ILE A CG2 
3427 C  CD1 . ILE A 400 ? 0.1909 0.2361 0.1807 0.0203  -0.0009 0.0040  397  ILE A CD1 
3428 N  N   . ALA A 401 ? 0.2077 0.2720 0.1748 0.0410  0.0027  -0.0016 398  ALA A N   
3429 C  CA  . ALA A 401 ? 0.2182 0.2869 0.1772 0.0473  0.0030  -0.0042 398  ALA A CA  
3430 C  C   . ALA A 401 ? 0.2158 0.2770 0.1709 0.0504  -0.0015 -0.0122 398  ALA A C   
3431 O  O   . ALA A 401 ? 0.2248 0.2856 0.1736 0.0530  -0.0033 -0.0145 398  ALA A O   
3432 C  CB  . ALA A 401 ? 0.2263 0.3043 0.1838 0.0524  0.0069  -0.0028 398  ALA A CB  
3433 N  N   . THR A 402 ? 0.2221 0.2767 0.1816 0.0497  -0.0038 -0.0161 399  THR A N   
3434 C  CA  A THR A 402 ? 0.2279 0.2749 0.1854 0.0522  -0.0085 -0.0234 399  THR A CA  
3435 C  CA  B THR A 402 ? 0.2274 0.2746 0.1849 0.0525  -0.0084 -0.0236 399  THR A CA  
3436 C  C   . THR A 402 ? 0.2286 0.2670 0.1933 0.0467  -0.0113 -0.0241 399  THR A C   
3437 O  O   . THR A 402 ? 0.2370 0.2750 0.2076 0.0431  -0.0097 -0.0209 399  THR A O   
3438 C  CB  A THR A 402 ? 0.2494 0.2970 0.2042 0.0585  -0.0090 -0.0285 399  THR A CB  
3439 C  CB  B THR A 402 ? 0.2415 0.2895 0.1976 0.0585  -0.0085 -0.0282 399  THR A CB  
3440 O  OG1 A THR A 402 ? 0.2745 0.3221 0.2360 0.0569  -0.0074 -0.0267 399  THR A OG1 
3441 O  OG1 B THR A 402 ? 0.2491 0.3067 0.1985 0.0645  -0.0050 -0.0274 399  THR A OG1 
3442 C  CG2 A THR A 402 ? 0.2554 0.3128 0.2018 0.0651  -0.0058 -0.0280 399  THR A CG2 
3443 C  CG2 B THR A 402 ? 0.2527 0.2921 0.2073 0.0612  -0.0141 -0.0360 399  THR A CG2 
3444 N  N   . SER A 403 ? 0.2153 0.2473 0.1796 0.0459  -0.0155 -0.0278 400  SER A N   
3445 C  CA  . SER A 403 ? 0.2104 0.2347 0.1816 0.0408  -0.0182 -0.0282 400  SER A CA  
3446 C  C   . SER A 403 ? 0.2442 0.2620 0.2178 0.0430  -0.0221 -0.0338 400  SER A C   
3447 O  O   . SER A 403 ? 0.2750 0.2944 0.2471 0.0474  -0.0216 -0.0362 400  SER A O   
3448 C  CB  . SER A 403 ? 0.2207 0.2429 0.1914 0.0379  -0.0202 -0.0276 400  SER A CB  
3449 O  OG  . SER A 403 ? 0.2136 0.2294 0.1912 0.0333  -0.0224 -0.0275 400  SER A OG  
3450 N  N   . HIS A 404 ? 0.2367 0.2475 0.2156 0.0395  -0.0256 -0.0352 401  HIS A N   
3451 C  CA  . HIS A 404 ? 0.2365 0.2405 0.2201 0.0402  -0.0294 -0.0392 401  HIS A CA  
3452 C  C   . HIS A 404 ? 0.2614 0.2598 0.2445 0.0419  -0.0352 -0.0449 401  HIS A C   
3453 O  O   . HIS A 404 ? 0.3128 0.3043 0.3024 0.0400  -0.0390 -0.0469 401  HIS A O   
3454 C  CB  . HIS A 404 ? 0.2371 0.2377 0.2292 0.0345  -0.0288 -0.0354 401  HIS A CB  
3455 C  CG  . HIS A 404 ? 0.2247 0.2234 0.2204 0.0295  -0.0294 -0.0329 401  HIS A CG  
3456 N  ND1 . HIS A 404 ? 0.2950 0.2877 0.2965 0.0275  -0.0335 -0.0348 401  HIS A ND1 
3457 C  CD2 . HIS A 404 ? 0.2234 0.2257 0.2183 0.0263  -0.0266 -0.0287 401  HIS A CD2 
3458 C  CE1 . HIS A 404 ? 0.3459 0.3390 0.3498 0.0234  -0.0328 -0.0317 401  HIS A CE1 
3459 N  NE2 . HIS A 404 ? 0.2302 0.2287 0.2299 0.0228  -0.0287 -0.0283 401  HIS A NE2 
3460 N  N   . HIS A 405 ? 0.2274 0.2286 0.2035 0.0446  -0.0360 -0.0467 402  HIS A N   
3461 C  CA  . HIS A 405 ? 0.2411 0.2377 0.2162 0.0459  -0.0417 -0.0517 402  HIS A CA  
3462 C  C   . HIS A 405 ? 0.2398 0.2409 0.2039 0.0523  -0.0419 -0.0551 402  HIS A C   
3463 O  O   . HIS A 405 ? 0.2388 0.2471 0.1973 0.0550  -0.0372 -0.0527 402  HIS A O   
3464 C  CB  . HIS A 405 ? 0.2251 0.2209 0.2043 0.0406  -0.0423 -0.0484 402  HIS A CB  
3465 C  CG  . HIS A 405 ? 0.2192 0.2218 0.1936 0.0396  -0.0378 -0.0435 402  HIS A CG  
3466 N  ND1 . HIS A 405 ? 0.2324 0.2392 0.1980 0.0437  -0.0381 -0.0449 402  HIS A ND1 
3467 C  CD2 . HIS A 405 ? 0.2197 0.2258 0.1965 0.0357  -0.0331 -0.0373 402  HIS A CD2 
3468 C  CE1 . HIS A 405 ? 0.2032 0.2158 0.1669 0.0417  -0.0336 -0.0391 402  HIS A CE1 
3469 N  NE2 . HIS A 405 ? 0.2206 0.2325 0.1911 0.0369  -0.0307 -0.0347 402  HIS A NE2 
3470 N  N   . ASN A 406 ? 0.2430 0.2404 0.2045 0.0546  -0.0476 -0.0605 403  ASN A N   
3471 C  CA  . ASN A 406 ? 0.2532 0.2541 0.2034 0.0613  -0.0489 -0.0648 403  ASN A CA  
3472 C  C   . ASN A 406 ? 0.2515 0.2554 0.1973 0.0606  -0.0498 -0.0632 403  ASN A C   
3473 O  O   . ASN A 406 ? 0.2708 0.2759 0.2076 0.0660  -0.0528 -0.0677 403  ASN A O   
3474 C  CB  . ASN A 406 ? 0.2626 0.2572 0.2108 0.0667  -0.0554 -0.0737 403  ASN A CB  
3475 C  CG  . ASN A 406 ? 0.2911 0.2843 0.2413 0.0693  -0.0540 -0.0755 403  ASN A CG  
3476 O  OD1 . ASN A 406 ? 0.3094 0.3095 0.2548 0.0724  -0.0484 -0.0731 403  ASN A OD1 
3477 N  ND2 . ASN A 406 ? 0.3351 0.3196 0.2938 0.0676  -0.0587 -0.0787 403  ASN A ND2 
3478 N  N   . TYR A 407 ? 0.2387 0.2438 0.1900 0.0544  -0.0473 -0.0569 404  TYR A N   
3479 C  CA  . TYR A 407 ? 0.2411 0.2499 0.1884 0.0535  -0.0471 -0.0540 404  TYR A CA  
3480 C  C   . TYR A 407 ? 0.2372 0.2550 0.1771 0.0557  -0.0409 -0.0491 404  TYR A C   
3481 O  O   . TYR A 407 ? 0.2375 0.2589 0.1801 0.0517  -0.0365 -0.0424 404  TYR A O   
3482 C  CB  . TYR A 407 ? 0.2268 0.2329 0.1836 0.0463  -0.0472 -0.0497 404  TYR A CB  
3483 C  CG  . TYR A 407 ? 0.2416 0.2403 0.2057 0.0443  -0.0535 -0.0538 404  TYR A CG  
3484 C  CD1 . TYR A 407 ? 0.2856 0.2832 0.2488 0.0443  -0.0581 -0.0556 404  TYR A CD1 
3485 C  CD2 . TYR A 407 ? 0.3182 0.3114 0.2908 0.0419  -0.0549 -0.0551 404  TYR A CD2 
3486 C  CE1 . TYR A 407 ? 0.3333 0.3248 0.3044 0.0420  -0.0639 -0.0586 404  TYR A CE1 
3487 C  CE2 . TYR A 407 ? 0.3810 0.3676 0.3615 0.0396  -0.0610 -0.0583 404  TYR A CE2 
3488 C  CZ  . TYR A 407 ? 0.3664 0.3527 0.3463 0.0395  -0.0652 -0.0597 404  TYR A CZ  
3489 O  OH  . TYR A 407 ? 0.4511 0.4318 0.4398 0.0370  -0.0712 -0.0622 404  TYR A OH  
3490 N  N   . ASP A 408 ? 0.2479 0.2695 0.1783 0.0626  -0.0408 -0.0526 405  ASP A N   
3491 C  CA  . ASP A 408 ? 0.2471 0.2780 0.1710 0.0654  -0.0347 -0.0479 405  ASP A CA  
3492 C  C   . ASP A 408 ? 0.2265 0.2626 0.1473 0.0635  -0.0327 -0.0418 405  ASP A C   
3493 O  O   . ASP A 408 ? 0.2373 0.2799 0.1582 0.0620  -0.0271 -0.0351 405  ASP A O   
3494 C  CB  . ASP A 408 ? 0.2783 0.3125 0.1919 0.0740  -0.0353 -0.0534 405  ASP A CB  
3495 C  CG  . ASP A 408 ? 0.3387 0.3691 0.2553 0.0765  -0.0361 -0.0584 405  ASP A CG  
3496 O  OD1 . ASP A 408 ? 0.3462 0.3734 0.2722 0.0717  -0.0347 -0.0560 405  ASP A OD1 
3497 O  OD2 . ASP A 408 ? 0.4016 0.4327 0.3101 0.0840  -0.0381 -0.0648 405  ASP A OD2 
3498 N  N   . ASN A 409 ? 0.2411 0.2744 0.1597 0.0636  -0.0375 -0.0442 406  ASN A N   
3499 C  CA  . ASN A 409 ? 0.2252 0.2627 0.1418 0.0616  -0.0361 -0.0383 406  ASN A CA  
3500 C  C   . ASN A 409 ? 0.2201 0.2564 0.1463 0.0542  -0.0331 -0.0317 406  ASN A C   
3501 O  O   . ASN A 409 ? 0.2302 0.2719 0.1555 0.0527  -0.0291 -0.0250 406  ASN A O   
3502 C  CB  . ASN A 409 ? 0.2350 0.2695 0.1481 0.0630  -0.0422 -0.0420 406  ASN A CB  
3503 C  CG  . ASN A 409 ? 0.2967 0.3224 0.2190 0.0588  -0.0475 -0.0458 406  ASN A CG  
3504 O  OD1 . ASN A 409 ? 0.2962 0.3167 0.2252 0.0572  -0.0485 -0.0489 406  ASN A OD1 
3505 N  ND2 . ASN A 409 ? 0.3546 0.3790 0.2784 0.0566  -0.0508 -0.0445 406  ASN A ND2 
3506 N  N   . HIS A 410 ? 0.2268 0.2564 0.1624 0.0499  -0.0348 -0.0335 407  HIS A N   
3507 C  CA  . HIS A 410 ? 0.1960 0.2244 0.1401 0.0435  -0.0320 -0.0280 407  HIS A CA  
3508 C  C   . HIS A 410 ? 0.2081 0.2414 0.1527 0.0428  -0.0262 -0.0232 407  HIS A C   
3509 O  O   . HIS A 410 ? 0.2134 0.2493 0.1608 0.0393  -0.0228 -0.0170 407  HIS A O   
3510 C  CB  . HIS A 410 ? 0.1885 0.2093 0.1417 0.0398  -0.0349 -0.0311 407  HIS A CB  
3511 C  CG  . HIS A 410 ? 0.2063 0.2226 0.1627 0.0384  -0.0402 -0.0338 407  HIS A CG  
3512 N  ND1 . HIS A 410 ? 0.2017 0.2158 0.1657 0.0333  -0.0402 -0.0306 407  HIS A ND1 
3513 C  CD2 . HIS A 410 ? 0.2145 0.2281 0.1680 0.0415  -0.0459 -0.0394 407  HIS A CD2 
3514 C  CE1 . HIS A 410 ? 0.1863 0.1971 0.1525 0.0333  -0.0455 -0.0339 407  HIS A CE1 
3515 N  NE2 . HIS A 410 ? 0.1983 0.2086 0.1583 0.0380  -0.0493 -0.0392 407  HIS A NE2 
3516 N  N   . GLN A 411 ? 0.1995 0.2335 0.1428 0.0458  -0.0251 -0.0261 408  GLN A N   
3517 C  CA  . GLN A 411 ? 0.1931 0.2317 0.1381 0.0451  -0.0199 -0.0219 408  GLN A CA  
3518 C  C   . GLN A 411 ? 0.2043 0.2519 0.1433 0.0472  -0.0160 -0.0164 408  GLN A C   
3519 O  O   . GLN A 411 ? 0.2073 0.2585 0.1500 0.0440  -0.0122 -0.0101 408  GLN A O   
3520 C  CB  . GLN A 411 ? 0.2013 0.2390 0.1460 0.0486  -0.0201 -0.0264 408  GLN A CB  
3521 C  CG  . GLN A 411 ? 0.2129 0.2561 0.1599 0.0482  -0.0149 -0.0221 408  GLN A CG  
3522 C  CD  . GLN A 411 ? 0.2198 0.2601 0.1757 0.0417  -0.0134 -0.0181 408  GLN A CD  
3523 O  OE1 . GLN A 411 ? 0.2147 0.2488 0.1755 0.0375  -0.0159 -0.0188 408  GLN A OE1 
3524 N  NE2 . GLN A 411 ? 0.2280 0.2734 0.1861 0.0411  -0.0093 -0.0140 408  GLN A NE2 
3525 N  N   . GLN A 412 ? 0.2279 0.2790 0.1579 0.0527  -0.0172 -0.0186 409  GLN A N   
3526 C  CA  . GLN A 412 ? 0.2457 0.3059 0.1698 0.0551  -0.0135 -0.0129 409  GLN A CA  
3527 C  C   . GLN A 412 ? 0.2362 0.2965 0.1638 0.0500  -0.0129 -0.0064 409  GLN A C   
3528 O  O   . GLN A 412 ? 0.2331 0.2992 0.1623 0.0482  -0.0087 0.0007  409  GLN A O   
3529 C  CB  . GLN A 412 ? 0.2731 0.3368 0.1860 0.0622  -0.0153 -0.0168 409  GLN A CB  
3530 C  CG  . GLN A 412 ? 0.3362 0.4109 0.2430 0.0653  -0.0103 -0.0103 409  GLN A CG  
3531 C  CD  . GLN A 412 ? 0.4119 0.4913 0.3066 0.0732  -0.0114 -0.0140 409  GLN A CD  
3532 O  OE1 . GLN A 412 ? 0.4338 0.5104 0.3239 0.0744  -0.0156 -0.0167 409  GLN A OE1 
3533 N  NE2 . GLN A 412 ? 0.4727 0.5601 0.3621 0.0788  -0.0074 -0.0137 409  GLN A NE2 
3534 N  N   . ALA A 413 ? 0.2341 0.2878 0.1642 0.0474  -0.0171 -0.0087 410  ALA A N   
3535 C  CA  . ALA A 413 ? 0.2187 0.2716 0.1526 0.0429  -0.0170 -0.0033 410  ALA A CA  
3536 C  C   . ALA A 413 ? 0.1975 0.2487 0.1403 0.0372  -0.0142 0.0011  410  ALA A C   
3537 O  O   . ALA A 413 ? 0.2098 0.2637 0.1550 0.0343  -0.0120 0.0076  410  ALA A O   
3538 C  CB  . ALA A 413 ? 0.2168 0.2632 0.1521 0.0416  -0.0222 -0.0069 410  ALA A CB  
3539 N  N   . LEU A 414 ? 0.1941 0.2407 0.1422 0.0353  -0.0146 -0.0024 411  LEU A N   
3540 C  CA  . LEU A 414 ? 0.1969 0.2418 0.1528 0.0303  -0.0123 0.0009  411  LEU A CA  
3541 C  C   . LEU A 414 ? 0.1855 0.2376 0.1411 0.0304  -0.0078 0.0068  411  LEU A C   
3542 O  O   . LEU A 414 ? 0.1881 0.2409 0.1480 0.0265  -0.0063 0.0123  411  LEU A O   
3543 C  CB  . LEU A 414 ? 0.1841 0.2238 0.1440 0.0296  -0.0135 -0.0040 411  LEU A CB  
3544 C  CG  . LEU A 414 ? 0.1875 0.2254 0.1545 0.0251  -0.0115 -0.0015 411  LEU A CG  
3545 C  CD1 . LEU A 414 ? 0.1894 0.2233 0.1616 0.0202  -0.0122 0.0011  411  LEU A CD1 
3546 C  CD2 . LEU A 414 ? 0.1949 0.2289 0.1645 0.0256  -0.0126 -0.0063 411  LEU A CD2 
3547 N  N   . LEU A 415 ? 0.1948 0.2525 0.1457 0.0350  -0.0060 0.0057  412  LEU A N   
3548 C  CA  . LEU A 415 ? 0.1928 0.2589 0.1439 0.0356  -0.0015 0.0116  412  LEU A CA  
3549 C  C   . LEU A 415 ? 0.1968 0.2686 0.1451 0.0357  0.0001  0.0182  412  LEU A C   
3550 O  O   . LEU A 415 ? 0.1951 0.2704 0.1483 0.0324  0.0028  0.0249  412  LEU A O   
3551 C  CB  . LEU A 415 ? 0.2079 0.2788 0.1545 0.0412  0.0002  0.0085  412  LEU A CB  
3552 C  CG  . LEU A 415 ? 0.2003 0.2661 0.1508 0.0409  -0.0009 0.0033  412  LEU A CG  
3553 C  CD1 . LEU A 415 ? 0.2185 0.2876 0.1629 0.0478  -0.0006 -0.0017 412  LEU A CD1 
3554 C  CD2 . LEU A 415 ? 0.2268 0.2937 0.1853 0.0363  0.0017  0.0079  412  LEU A CD2 
3555 N  N   . ALA A 416 ? 0.2022 0.2745 0.1433 0.0392  -0.0019 0.0163  413  ALA A N   
3556 C  CA  . ALA A 416 ? 0.2109 0.2888 0.1492 0.0395  -0.0006 0.0230  413  ALA A CA  
3557 C  C   . ALA A 416 ? 0.2075 0.2814 0.1533 0.0333  -0.0012 0.0280  413  ALA A C   
3558 O  O   . ALA A 416 ? 0.2226 0.3011 0.1708 0.0313  0.0011  0.0356  413  ALA A O   
3559 C  CB  . ALA A 416 ? 0.2066 0.2845 0.1355 0.0442  -0.0036 0.0195  413  ALA A CB  
3560 N  N   . ASN A 417 ? 0.1977 0.2627 0.1476 0.0302  -0.0045 0.0237  414  ASN A N   
3561 C  CA  . ASN A 417 ? 0.1984 0.2584 0.1554 0.0246  -0.0055 0.0272  414  ASN A CA  
3562 C  C   . ASN A 417 ? 0.1806 0.2417 0.1447 0.0208  -0.0028 0.0313  414  ASN A C   
3563 O  O   . ASN A 417 ? 0.1957 0.2573 0.1643 0.0174  -0.0022 0.0374  414  ASN A O   
3564 C  CB  . ASN A 417 ? 0.1957 0.2469 0.1556 0.0227  -0.0092 0.0215  414  ASN A CB  
3565 C  CG  . ASN A 417 ? 0.2611 0.3106 0.2174 0.0244  -0.0124 0.0202  414  ASN A CG  
3566 O  OD1 . ASN A 417 ? 0.2383 0.2866 0.1969 0.0222  -0.0132 0.0242  414  ASN A OD1 
3567 N  ND2 . ASN A 417 ? 0.3010 0.3505 0.2512 0.0286  -0.0146 0.0146  414  ASN A ND2 
3568 N  N   . CYS A 418 ? 0.1889 0.2498 0.1547 0.0210  -0.0018 0.0280  415  CYS A N   
3569 C  CA  . CYS A 418 ? 0.1869 0.2492 0.1592 0.0176  0.0004  0.0317  415  CYS A CA  
3570 C  C   . CYS A 418 ? 0.1895 0.2605 0.1625 0.0177  0.0034  0.0396  415  CYS A C   
3571 O  O   . CYS A 418 ? 0.2011 0.2718 0.1803 0.0135  0.0037  0.0450  415  CYS A O   
3572 C  CB  . CYS A 418 ? 0.1847 0.2473 0.1573 0.0191  0.0013  0.0273  415  CYS A CB  
3573 S  SG  . CYS A 418 ? 0.2075 0.2715 0.1882 0.0150  0.0032  0.0310  415  CYS A SG  
3574 N  N   . PHE A 419 ? 0.2003 0.2787 0.1668 0.0227  0.0056  0.0401  416  PHE A N   
3575 C  CA  . PHE A 419 ? 0.2025 0.2910 0.1698 0.0234  0.0093  0.0483  416  PHE A CA  
3576 C  C   . PHE A 419 ? 0.2055 0.2943 0.1731 0.0215  0.0085  0.0544  416  PHE A C   
3577 O  O   . PHE A 419 ? 0.2017 0.2950 0.1748 0.0186  0.0103  0.0625  416  PHE A O   
3578 C  CB  . PHE A 419 ? 0.2069 0.3040 0.1666 0.0300  0.0121  0.0470  416  PHE A CB  
3579 C  CG  . PHE A 419 ? 0.1992 0.2956 0.1587 0.0323  0.0125  0.0408  416  PHE A CG  
3580 C  CD1 . PHE A 419 ? 0.2052 0.2971 0.1719 0.0284  0.0120  0.0395  416  PHE A CD1 
3581 C  CD2 . PHE A 419 ? 0.2247 0.3248 0.1755 0.0391  0.0133  0.0359  416  PHE A CD2 
3582 C  CE1 . PHE A 419 ? 0.2044 0.2960 0.1707 0.0310  0.0124  0.0341  416  PHE A CE1 
3583 C  CE2 . PHE A 419 ? 0.2422 0.3413 0.1930 0.0417  0.0134  0.0302  416  PHE A CE2 
3584 C  CZ  . PHE A 419 ? 0.2235 0.3183 0.1823 0.0374  0.0130  0.0296  416  PHE A CZ  
3585 N  N   . ALA A 420 ? 0.2055 0.2895 0.1681 0.0229  0.0056  0.0512  417  ALA A N   
3586 C  CA  . ALA A 420 ? 0.2154 0.2988 0.1789 0.0210  0.0044  0.0568  417  ALA A CA  
3587 C  C   . ALA A 420 ? 0.2086 0.2859 0.1817 0.0148  0.0028  0.0602  417  ALA A C   
3588 O  O   . ALA A 420 ? 0.2238 0.3029 0.2004 0.0125  0.0029  0.0677  417  ALA A O   
3589 C  CB  . ALA A 420 ? 0.2197 0.2986 0.1764 0.0237  0.0009  0.0519  417  ALA A CB  
3590 N  N   . GLN A 421 ? 0.1986 0.2683 0.1759 0.0121  0.0010  0.0547  418  GLN A N   
3591 C  CA  . GLN A 421 ? 0.1930 0.2563 0.1783 0.0069  -0.0009 0.0564  418  GLN A CA  
3592 C  C   . GLN A 421 ? 0.1905 0.2579 0.1828 0.0036  0.0010  0.0631  418  GLN A C   
3593 O  O   . GLN A 421 ? 0.1934 0.2586 0.1917 -0.0001 -0.0003 0.0682  418  GLN A O   
3594 C  CB  . GLN A 421 ? 0.2002 0.2549 0.1873 0.0053  -0.0031 0.0489  418  GLN A CB  
3595 C  CG  . GLN A 421 ? 0.2058 0.2554 0.1885 0.0074  -0.0058 0.0435  418  GLN A CG  
3596 C  CD  . GLN A 421 ? 0.1867 0.2312 0.1725 0.0051  -0.0083 0.0458  418  GLN A CD  
3597 O  OE1 . GLN A 421 ? 0.2056 0.2464 0.1978 0.0013  -0.0089 0.0482  418  GLN A OE1 
3598 N  NE2 . GLN A 421 ? 0.1978 0.2416 0.1794 0.0075  -0.0101 0.0448  418  GLN A NE2 
3599 N  N   . SER A 422 ? 0.1939 0.2671 0.1863 0.0049  0.0037  0.0626  419  SER A N   
3600 C  CA  . SER A 422 ? 0.1865 0.2651 0.1862 0.0020  0.0056  0.0694  419  SER A CA  
3601 C  C   . SER A 422 ? 0.1972 0.2839 0.1973 0.0025  0.0077  0.0784  419  SER A C   
3602 O  O   . SER A 422 ? 0.2002 0.2879 0.2084 -0.0016 0.0074  0.0854  419  SER A O   
3603 C  CB  . SER A 422 ? 0.1841 0.2674 0.1843 0.0035  0.0080  0.0672  419  SER A CB  
3604 O  OG  . SER A 422 ? 0.1922 0.2831 0.1850 0.0091  0.0109  0.0660  419  SER A OG  
3605 N  N   . GLN A 423 ? 0.2107 0.3028 0.2021 0.0076  0.0094  0.0783  420  GLN A N   
3606 C  CA  . GLN A 423 ? 0.2223 0.3230 0.2127 0.0088  0.0117  0.0873  420  GLN A CA  
3607 C  C   . GLN A 423 ? 0.2199 0.3144 0.2146 0.0050  0.0085  0.0916  420  GLN A C   
3608 O  O   . GLN A 423 ? 0.2279 0.3263 0.2291 0.0020  0.0092  0.1008  420  GLN A O   
3609 C  CB  . GLN A 423 ? 0.2329 0.3400 0.2119 0.0155  0.0137  0.0853  420  GLN A CB  
3610 C  CG  . GLN A 423 ? 0.2511 0.3692 0.2284 0.0173  0.0170  0.0954  420  GLN A CG  
3611 C  CD  . GLN A 423 ? 0.2561 0.3799 0.2206 0.0245  0.0183  0.0930  420  GLN A CD  
3612 O  OE1 . GLN A 423 ? 0.2648 0.3822 0.2228 0.0264  0.0151  0.0869  420  GLN A OE1 
3613 N  NE2 . GLN A 423 ? 0.2715 0.4079 0.2324 0.0286  0.0230  0.0980  420  GLN A NE2 
3614 N  N   . ALA A 424 ? 0.2030 0.2877 0.1953 0.0047  0.0048  0.0853  421  ALA A N   
3615 C  CA  . ALA A 424 ? 0.2173 0.2955 0.2134 0.0017  0.0015  0.0885  421  ALA A CA  
3616 C  C   . ALA A 424 ? 0.2021 0.2748 0.2095 -0.0044 -0.0005 0.0916  421  ALA A C   
3617 O  O   . ALA A 424 ? 0.2144 0.2857 0.2275 -0.0073 -0.0020 0.0986  421  ALA A O   
3618 C  CB  . ALA A 424 ? 0.2369 0.3064 0.2282 0.0031  -0.0019 0.0805  421  ALA A CB  
3619 N  N   . LEU A 425 ? 0.1942 0.2635 0.2051 -0.0063 -0.0008 0.0866  422  LEU A N   
3620 C  CA  . LEU A 425 ? 0.1880 0.2530 0.2090 -0.0116 -0.0028 0.0892  422  LEU A CA  
3621 C  C   . LEU A 425 ? 0.1947 0.2683 0.2224 -0.0137 -0.0007 0.0998  422  LEU A C   
3622 O  O   . LEU A 425 ? 0.2063 0.2766 0.2425 -0.0180 -0.0032 0.1054  422  LEU A O   
3623 C  CB  . LEU A 425 ? 0.1752 0.2375 0.1976 -0.0125 -0.0029 0.0827  422  LEU A CB  
3624 C  CG  . LEU A 425 ? 0.1776 0.2298 0.1970 -0.0122 -0.0057 0.0735  422  LEU A CG  
3625 C  CD1 . LEU A 425 ? 0.1817 0.2332 0.2009 -0.0121 -0.0050 0.0677  422  LEU A CD1 
3626 C  CD2 . LEU A 425 ? 0.1912 0.2336 0.2161 -0.0157 -0.0098 0.0734  422  LEU A CD2 
3627 N  N   . MET A 426 ? 0.1950 0.2796 0.2192 -0.0106 0.0036  0.1026  423  MET A N   
3628 C  CA  . MET A 426 ? 0.1964 0.2914 0.2271 -0.0121 0.0065  0.1133  423  MET A CA  
3629 C  C   . MET A 426 ? 0.2304 0.3282 0.2615 -0.0122 0.0065  0.1219  423  MET A C   
3630 O  O   . MET A 426 ? 0.2453 0.3445 0.2865 -0.0166 0.0056  0.1308  423  MET A O   
3631 C  CB  . MET A 426 ? 0.2093 0.3162 0.2354 -0.0078 0.0116  0.1134  423  MET A CB  
3632 C  CG  . MET A 426 ? 0.2482 0.3681 0.2784 -0.0076 0.0155  0.1248  423  MET A CG  
3633 S  SD  . MET A 426 ? 0.3081 0.4398 0.3384 -0.0046 0.0206  0.1246  423  MET A SD  
3634 C  CE  . MET A 426 ? 0.2316 0.3684 0.2460 0.0040  0.0238  0.1187  423  MET A CE  
3635 N  N   . PHE A 427 ? 0.2202 0.3191 0.2411 -0.0077 0.0072  0.1201  424  PHE A N   
3636 C  CA  . PHE A 427 ? 0.2401 0.3434 0.2604 -0.0071 0.0077  0.1292  424  PHE A CA  
3637 C  C   . PHE A 427 ? 0.2425 0.3355 0.2657 -0.0098 0.0029  0.1299  424  PHE A C   
3638 O  O   . PHE A 427 ? 0.2550 0.3499 0.2835 -0.0120 0.0024  0.1396  424  PHE A O   
3639 C  CB  . PHE A 427 ? 0.2532 0.3652 0.2606 -0.0002 0.0112  0.1281  424  PHE A CB  
3640 C  CG  . PHE A 427 ? 0.3069 0.4322 0.3127 0.0027  0.0167  0.1317  424  PHE A CG  
3641 C  CD1 . PHE A 427 ? 0.4178 0.5530 0.4313 0.0005  0.0197  0.1437  424  PHE A CD1 
3642 C  CD2 . PHE A 427 ? 0.3267 0.4553 0.3240 0.0077  0.0190  0.1237  424  PHE A CD2 
3643 C  CE1 . PHE A 427 ? 0.4383 0.5869 0.4508 0.0036  0.0252  0.1474  424  PHE A CE1 
3644 C  CE2 . PHE A 427 ? 0.3501 0.4908 0.3459 0.0110  0.0239  0.1267  424  PHE A CE2 
3645 C  CZ  . PHE A 427 ? 0.4056 0.5570 0.4089 0.0091  0.0274  0.1387  424  PHE A CZ  
3646 N  N   . GLY A 428 ? 0.2357 0.3184 0.2550 -0.0091 -0.0003 0.1200  425  GLY A N   
3647 C  CA  . GLY A 428 ? 0.2420 0.3156 0.2624 -0.0102 -0.0045 0.1198  425  GLY A CA  
3648 C  C   . GLY A 428 ? 0.2466 0.3257 0.2604 -0.0068 -0.0036 0.1253  425  GLY A C   
3649 O  O   . GLY A 428 ? 0.2708 0.3592 0.2757 -0.0021 0.0000  0.1255  425  GLY A O   
3650 N  N   . GLN A 429 ? 0.2448 0.3174 0.2624 -0.0086 -0.0072 0.1288  426  GLN A N   
3651 C  CA  A GLN A 429 ? 0.2530 0.3291 0.2653 -0.0058 -0.0074 0.1345  426  GLN A CA  
3652 C  CA  B GLN A 429 ? 0.2511 0.3279 0.2637 -0.0059 -0.0071 0.1351  426  GLN A CA  
3653 C  C   . GLN A 429 ? 0.2629 0.3340 0.2854 -0.0101 -0.0106 0.1432  426  GLN A C   
3654 O  O   . GLN A 429 ? 0.2643 0.3238 0.2929 -0.0130 -0.0149 0.1391  426  GLN A O   
3655 C  CB  A GLN A 429 ? 0.2752 0.3455 0.2786 -0.0019 -0.0099 0.1253  426  GLN A CB  
3656 C  CB  B GLN A 429 ? 0.2599 0.3336 0.2617 -0.0011 -0.0087 0.1269  426  GLN A CB  
3657 C  CG  A GLN A 429 ? 0.3054 0.3811 0.2975 0.0032  -0.0073 0.1174  426  GLN A CG  
3658 C  CG  B GLN A 429 ? 0.2501 0.3109 0.2548 -0.0025 -0.0136 0.1195  426  GLN A CG  
3659 C  CD  A GLN A 429 ? 0.3782 0.4513 0.3612 0.0075  -0.0098 0.1117  426  GLN A CD  
3660 C  CD  B GLN A 429 ? 0.2717 0.3312 0.2665 0.0022  -0.0150 0.1120  426  GLN A CD  
3661 O  OE1 A GLN A 429 ? 0.3899 0.4545 0.3758 0.0063  -0.0138 0.1094  426  GLN A OE1 
3662 O  OE1 B GLN A 429 ? 0.3064 0.3738 0.2920 0.0065  -0.0132 0.1135  426  GLN A OE1 
3663 N  NE2 A GLN A 429 ? 0.3850 0.4656 0.3571 0.0128  -0.0076 0.1092  426  GLN A NE2 
3664 N  NE2 B GLN A 429 ? 0.2960 0.3457 0.2927 0.0016  -0.0184 0.1040  426  GLN A NE2 
3665 N  N   . SER A 430 ? 0.2706 0.3503 0.2950 -0.0104 -0.0085 0.1552  427  SER A N   
3666 C  CA  . SER A 430 ? 0.2802 0.3556 0.3154 -0.0148 -0.0115 0.1644  427  SER A CA  
3667 C  C   . SER A 430 ? 0.2939 0.3632 0.3262 -0.0131 -0.0152 0.1649  427  SER A C   
3668 O  O   . SER A 430 ? 0.3088 0.3801 0.3297 -0.0081 -0.0147 0.1601  427  SER A O   
3669 C  CB  . SER A 430 ? 0.3096 0.3975 0.3487 -0.0159 -0.0075 0.1781  427  SER A CB  
3670 O  OG  . SER A 430 ? 0.3156 0.4125 0.3440 -0.0107 -0.0049 0.1825  427  SER A OG  
3671 N  N   . TYR A 431 ? 0.3086 0.3702 0.3517 -0.0172 -0.0193 0.1708  428  TYR A N   
3672 C  CA  . TYR A 431 ? 0.3254 0.3816 0.3676 -0.0160 -0.0230 0.1734  428  TYR A CA  
3673 C  C   . TYR A 431 ? 0.3274 0.3949 0.3598 -0.0114 -0.0200 0.1805  428  TYR A C   
3674 O  O   . TYR A 431 ? 0.3249 0.3909 0.3486 -0.0073 -0.0215 0.1765  428  TYR A O   
3675 C  CB  . TYR A 431 ? 0.3374 0.3858 0.3937 -0.0212 -0.0273 0.1815  428  TYR A CB  
3676 C  CG  . TYR A 431 ? 0.3467 0.3883 0.4033 -0.0199 -0.0315 0.1839  428  TYR A CG  
3677 C  CD1 . TYR A 431 ? 0.3479 0.3761 0.4076 -0.0202 -0.0366 0.1753  428  TYR A CD1 
3678 C  CD2 . TYR A 431 ? 0.3996 0.4485 0.4538 -0.0183 -0.0306 0.1952  428  TYR A CD2 
3679 C  CE1 . TYR A 431 ? 0.3878 0.4099 0.4483 -0.0187 -0.0406 0.1774  428  TYR A CE1 
3680 C  CE2 . TYR A 431 ? 0.4087 0.4511 0.4636 -0.0171 -0.0349 0.1976  428  TYR A CE2 
3681 C  CZ  . TYR A 431 ? 0.4162 0.4452 0.4745 -0.0173 -0.0399 0.1884  428  TYR A CZ  
3682 O  OH  . TYR A 431 ? 0.4643 0.4874 0.5238 -0.0158 -0.0441 0.1910  428  TYR A OH  
3683 N  N   . ASP A 432 ? 0.3568 0.4361 0.3901 -0.0119 -0.0157 0.1912  429  ASP A N   
3684 C  CA  . ASP A 432 ? 0.3756 0.4663 0.3990 -0.0073 -0.0127 0.1985  429  ASP A CA  
3685 C  C   . ASP A 432 ? 0.3690 0.4650 0.3766 -0.0007 -0.0103 0.1888  429  ASP A C   
3686 O  O   . ASP A 432 ? 0.3622 0.4601 0.3600 0.0038  -0.0113 0.1885  429  ASP A O   
3687 C  CB  . ASP A 432 ? 0.3946 0.4983 0.4226 -0.0089 -0.0078 0.2120  429  ASP A CB  
3688 C  CG  . ASP A 432 ? 0.4609 0.5614 0.5032 -0.0144 -0.0105 0.2248  429  ASP A CG  
3689 O  OD1 . ASP A 432 ? 0.5218 0.6100 0.5700 -0.0166 -0.0163 0.2240  429  ASP A OD1 
3690 O  OD2 . ASP A 432 ? 0.5270 0.6380 0.5751 -0.0165 -0.0067 0.2363  429  ASP A OD2 
3691 N  N   . MET A 433 ? 0.3513 0.4487 0.3565 -0.0002 -0.0078 0.1804  430  MET A N   
3692 C  CA  . MET A 433 ? 0.3527 0.4539 0.3442 0.0056  -0.0060 0.1704  430  MET A CA  
3693 C  C   . MET A 433 ? 0.3521 0.4426 0.3397 0.0072  -0.0111 0.1610  430  MET A C   
3694 O  O   . MET A 433 ? 0.3441 0.4378 0.3205 0.0124  -0.0116 0.1581  430  MET A O   
3695 C  CB  . MET A 433 ? 0.3701 0.4724 0.3623 0.0050  -0.0033 0.1628  430  MET A CB  
3696 C  CG  . MET A 433 ? 0.4229 0.5275 0.4019 0.0108  -0.0021 0.1515  430  MET A CG  
3697 S  SD  . MET A 433 ? 0.5184 0.6250 0.4982 0.0105  0.0012  0.1434  430  MET A SD  
3698 C  CE  . MET A 433 ? 0.5814 0.6903 0.5450 0.0181  0.0015  0.1319  430  MET A CE  
3699 N  N   . VAL A 434 ? 0.3419 0.4202 0.3389 0.0030  -0.0149 0.1559  431  VAL A N   
3700 C  CA  . VAL A 434 ? 0.3402 0.4086 0.3350 0.0044  -0.0195 0.1470  431  VAL A CA  
3701 C  C   . VAL A 434 ? 0.3627 0.4305 0.3552 0.0063  -0.0225 0.1528  431  VAL A C   
3702 O  O   . VAL A 434 ? 0.3753 0.4427 0.3592 0.0106  -0.0244 0.1473  431  VAL A O   
3703 C  CB  . VAL A 434 ? 0.3284 0.3844 0.3341 -0.0003 -0.0227 0.1416  431  VAL A CB  
3704 C  CG1 . VAL A 434 ? 0.3763 0.4229 0.3818 0.0011  -0.0276 0.1359  431  VAL A CG1 
3705 C  CG2 . VAL A 434 ? 0.3336 0.3895 0.3389 -0.0010 -0.0204 0.1331  431  VAL A CG2 
3706 N  N   . TYR A 435 ? 0.3378 0.4053 0.3386 0.0032  -0.0233 0.1641  432  TYR A N   
3707 C  CA  . TYR A 435 ? 0.3694 0.4361 0.3694 0.0046  -0.0264 0.1710  432  TYR A CA  
3708 C  C   . TYR A 435 ? 0.3799 0.4578 0.3657 0.0106  -0.0242 0.1734  432  TYR A C   
3709 O  O   . TYR A 435 ? 0.3795 0.4554 0.3589 0.0141  -0.0274 0.1705  432  TYR A O   
3710 C  CB  . TYR A 435 ? 0.3598 0.4260 0.3712 0.0001  -0.0268 0.1840  432  TYR A CB  
3711 C  CG  . TYR A 435 ? 0.4057 0.4713 0.4174 0.0012  -0.0299 0.1928  432  TYR A CG  
3712 C  CD1 . TYR A 435 ? 0.4172 0.4708 0.4354 0.0000  -0.0356 0.1904  432  TYR A CD1 
3713 C  CD2 . TYR A 435 ? 0.4401 0.5175 0.4458 0.0036  -0.0270 0.2039  432  TYR A CD2 
3714 C  CE1 . TYR A 435 ? 0.4549 0.5077 0.4739 0.0011  -0.0387 0.1989  432  TYR A CE1 
3715 C  CE2 . TYR A 435 ? 0.4695 0.5466 0.4755 0.0046  -0.0299 0.2129  432  TYR A CE2 
3716 C  CZ  . TYR A 435 ? 0.4816 0.5460 0.4945 0.0033  -0.0359 0.2103  432  TYR A CZ  
3717 O  OH  . TYR A 435 ? 0.5293 0.5932 0.5428 0.0044  -0.0390 0.2194  432  TYR A OH  
3718 N  N   . ASN A 436 ? 0.3905 0.4802 0.3711 0.0121  -0.0189 0.1781  433  ASN A N   
3719 C  CA  . ASN A 436 ? 0.4266 0.5274 0.3928 0.0184  -0.0167 0.1803  433  ASN A CA  
3720 C  C   . ASN A 436 ? 0.4322 0.5314 0.3871 0.0232  -0.0181 0.1667  433  ASN A C   
3721 O  O   . ASN A 436 ? 0.4446 0.5470 0.3891 0.0281  -0.0199 0.1659  433  ASN A O   
3722 C  CB  . ASN A 436 ? 0.4420 0.5562 0.4056 0.0192  -0.0103 0.1882  433  ASN A CB  
3723 C  CG  . ASN A 436 ? 0.4805 0.5990 0.4534 0.0156  -0.0090 0.2040  433  ASN A CG  
3724 O  OD1 . ASN A 436 ? 0.5593 0.6759 0.5333 0.0156  -0.0120 0.2112  433  ASN A OD1 
3725 N  ND2 . ASN A 436 ? 0.5841 0.7086 0.5643 0.0124  -0.0047 0.2099  433  ASN A ND2 
3726 N  N   . GLU A 437 ? 0.4213 0.5150 0.3789 0.0217  -0.0180 0.1561  434  GLU A N   
3727 C  CA  A GLU A 437 ? 0.4345 0.5254 0.3834 0.0255  -0.0199 0.1432  434  GLU A CA  
3728 C  CA  B GLU A 437 ? 0.4287 0.5194 0.3777 0.0254  -0.0199 0.1431  434  GLU A CA  
3729 C  C   . GLU A 437 ? 0.4333 0.5151 0.3838 0.0257  -0.0258 0.1391  434  GLU A C   
3730 O  O   . GLU A 437 ? 0.4592 0.5417 0.4004 0.0301  -0.0282 0.1330  434  GLU A O   
3731 C  CB  A GLU A 437 ? 0.4238 0.5111 0.3761 0.0235  -0.0182 0.1338  434  GLU A CB  
3732 C  CB  B GLU A 437 ? 0.4162 0.5024 0.3695 0.0231  -0.0185 0.1338  434  GLU A CB  
3733 C  CG  A GLU A 437 ? 0.4686 0.5663 0.4174 0.0247  -0.0122 0.1363  434  GLU A CG  
3734 C  CG  B GLU A 437 ? 0.4222 0.5064 0.3673 0.0268  -0.0201 0.1210  434  GLU A CG  
3735 C  CD  A GLU A 437 ? 0.5057 0.6010 0.4545 0.0245  -0.0109 0.1257  434  GLU A CD  
3736 C  CD  B GLU A 437 ? 0.4371 0.5167 0.3872 0.0242  -0.0187 0.1128  434  GLU A CD  
3737 O  OE1 A GLU A 437 ? 0.5022 0.5878 0.4542 0.0229  -0.0141 0.1169  434  GLU A OE1 
3738 O  OE1 B GLU A 437 ? 0.4519 0.5275 0.4126 0.0191  -0.0179 0.1157  434  GLU A OE1 
3739 O  OE2 A GLU A 437 ? 0.5637 0.6673 0.5091 0.0261  -0.0063 0.1265  434  GLU A OE2 
3740 O  OE2 B GLU A 437 ? 0.4638 0.5435 0.4074 0.0271  -0.0189 0.1034  434  GLU A OE2 
3741 N  N   . LEU A 438 ? 0.4257 0.4989 0.3879 0.0212  -0.0285 0.1427  435  LEU A N   
3742 C  CA  . LEU A 438 ? 0.4067 0.4713 0.3715 0.0215  -0.0340 0.1391  435  LEU A CA  
3743 C  C   . LEU A 438 ? 0.4286 0.4980 0.3865 0.0253  -0.0361 0.1459  435  LEU A C   
3744 O  O   . LEU A 438 ? 0.4365 0.5038 0.3894 0.0284  -0.0399 0.1403  435  LEU A O   
3745 C  CB  . LEU A 438 ? 0.3890 0.4433 0.3679 0.0164  -0.0364 0.1412  435  LEU A CB  
3746 C  CG  . LEU A 438 ? 0.3532 0.4003 0.3390 0.0130  -0.0358 0.1327  435  LEU A CG  
3747 C  CD1 . LEU A 438 ? 0.3343 0.3717 0.3333 0.0084  -0.0384 0.1356  435  LEU A CD1 
3748 C  CD2 . LEU A 438 ? 0.3644 0.4082 0.3456 0.0156  -0.0376 0.1202  435  LEU A CD2 
3749 N  N   . LEU A 439 ? 0.4472 0.5236 0.4051 0.0248  -0.0337 0.1582  436  LEU A N   
3750 C  CA  . LEU A 439 ? 0.4733 0.5560 0.4231 0.0288  -0.0351 0.1659  436  LEU A CA  
3751 C  C   . LEU A 439 ? 0.5089 0.5994 0.4431 0.0352  -0.0345 0.1596  436  LEU A C   
3752 O  O   . LEU A 439 ? 0.5304 0.6213 0.4576 0.0390  -0.0384 0.1586  436  LEU A O   
3753 C  CB  . LEU A 439 ? 0.4634 0.5543 0.4154 0.0274  -0.0315 0.1807  436  LEU A CB  
3754 C  CG  . LEU A 439 ? 0.4667 0.5504 0.4342 0.0214  -0.0329 0.1892  436  LEU A CG  
3755 C  CD1 . LEU A 439 ? 0.4859 0.5790 0.4553 0.0201  -0.0291 0.2040  436  LEU A CD1 
3756 C  CD2 . LEU A 439 ? 0.4766 0.5508 0.4491 0.0212  -0.0392 0.1895  436  LEU A CD2 
3757 N  N   . LYS A 440 ? 0.5219 0.6187 0.4505 0.0365  -0.0300 0.1557  437  LYS A N   
3758 C  CA  A LYS A 440 ? 0.5457 0.6495 0.4591 0.0428  -0.0294 0.1489  437  LYS A CA  
3759 C  CA  B LYS A 440 ? 0.5426 0.6465 0.4561 0.0429  -0.0295 0.1491  437  LYS A CA  
3760 C  C   . LYS A 440 ? 0.5480 0.6441 0.4593 0.0444  -0.0345 0.1358  437  LYS A C   
3761 O  O   . LYS A 440 ? 0.5703 0.6700 0.4700 0.0498  -0.0369 0.1311  437  LYS A O   
3762 C  CB  A LYS A 440 ? 0.5530 0.6638 0.4632 0.0435  -0.0235 0.1468  437  LYS A CB  
3763 C  CB  B LYS A 440 ? 0.5474 0.6594 0.4564 0.0440  -0.0234 0.1481  437  LYS A CB  
3764 C  CG  A LYS A 440 ? 0.5844 0.7046 0.4782 0.0508  -0.0220 0.1423  437  LYS A CG  
3765 C  CG  B LYS A 440 ? 0.5640 0.6892 0.4667 0.0467  -0.0187 0.1603  437  LYS A CG  
3766 C  CD  A LYS A 440 ? 0.6170 0.7438 0.5092 0.0512  -0.0160 0.1410  437  LYS A CD  
3767 C  CD  B LYS A 440 ? 0.5791 0.7112 0.4839 0.0455  -0.0122 0.1624  437  LYS A CD  
3768 C  CE  A LYS A 440 ? 0.6340 0.7686 0.5104 0.0588  -0.0149 0.1341  437  LYS A CE  
3769 C  CE  B LYS A 440 ? 0.5828 0.7169 0.5000 0.0400  -0.0093 0.1759  437  LYS A CE  
3770 N  NZ  A LYS A 440 ? 0.6395 0.7779 0.5164 0.0588  -0.0099 0.1303  437  LYS A NZ  
3771 N  NZ  B LYS A 440 ? 0.5866 0.7336 0.5015 0.0413  -0.0024 0.1828  437  LYS A NZ  
3772 N  N   . SER A 441 ? 0.5435 0.6292 0.4662 0.0399  -0.0363 0.1300  438  SER A N   
3773 C  CA  . SER A 441 ? 0.5478 0.6261 0.4709 0.0407  -0.0410 0.1185  438  SER A CA  
3774 C  C   . SER A 441 ? 0.5528 0.6272 0.4772 0.0418  -0.0468 0.1201  438  SER A C   
3775 O  O   . SER A 441 ? 0.5726 0.6424 0.4969 0.0430  -0.0509 0.1114  438  SER A O   
3776 C  CB  . SER A 441 ? 0.5313 0.6006 0.4663 0.0357  -0.0407 0.1125  438  SER A CB  
3777 O  OG  . SER A 441 ? 0.5476 0.6106 0.4938 0.0316  -0.0420 0.1187  438  SER A OG  
3778 N  N   . GLY A 442 ? 0.5471 0.6230 0.4742 0.0410  -0.0470 0.1313  439  GLY A N   
3779 C  CA  . GLY A 442 ? 0.5494 0.6224 0.4771 0.0425  -0.0525 0.1342  439  GLY A CA  
3780 C  C   . GLY A 442 ? 0.5366 0.6008 0.4785 0.0380  -0.0545 0.1388  439  GLY A C   
3781 O  O   . GLY A 442 ? 0.5467 0.6078 0.4906 0.0391  -0.0591 0.1414  439  GLY A O   
3782 N  N   . LEU A 443 ? 0.5150 0.5745 0.4669 0.0331  -0.0516 0.1396  440  LEU A N   
3783 C  CA  . LEU A 443 ? 0.5041 0.5548 0.4693 0.0292  -0.0539 0.1440  440  LEU A CA  
3784 C  C   . LEU A 443 ? 0.5074 0.5620 0.4733 0.0289  -0.0536 0.1580  440  LEU A C   
3785 O  O   . LEU A 443 ? 0.5210 0.5848 0.4806 0.0297  -0.0496 0.1650  440  LEU A O   
3786 C  CB  . LEU A 443 ? 0.4849 0.5293 0.4603 0.0241  -0.0513 0.1411  440  LEU A CB  
3787 C  CG  . LEU A 443 ? 0.4953 0.5341 0.4729 0.0236  -0.0517 0.1281  440  LEU A CG  
3788 C  CD1 . LEU A 443 ? 0.4563 0.4890 0.4439 0.0187  -0.0496 0.1270  440  LEU A CD1 
3789 C  CD2 . LEU A 443 ? 0.5188 0.5514 0.4995 0.0253  -0.0568 0.1222  440  LEU A CD2 
3790 N  N   . ASN A 444 ? 0.5012 0.5492 0.4750 0.0279  -0.0579 0.1625  441  ASN A N   
3791 C  CA  . ASN A 444 ? 0.5120 0.5622 0.4891 0.0267  -0.0579 0.1766  441  ASN A CA  
3792 C  C   . ASN A 444 ? 0.5010 0.5471 0.4897 0.0210  -0.0553 0.1812  441  ASN A C   
3793 O  O   . ASN A 444 ? 0.4619 0.5033 0.4552 0.0185  -0.0538 0.1729  441  ASN A O   
3794 C  CB  . ASN A 444 ? 0.5244 0.5695 0.5056 0.0281  -0.0637 0.1808  441  ASN A CB  
3795 C  CG  . ASN A 444 ? 0.5517 0.5836 0.5467 0.0251  -0.0673 0.1760  441  ASN A CG  
3796 O  OD1 . ASN A 444 ? 0.5138 0.5397 0.5180 0.0208  -0.0658 0.1746  441  ASN A OD1 
3797 N  ND2 . ASN A 444 ? 0.5304 0.5581 0.5267 0.0277  -0.0724 0.1734  441  ASN A ND2 
3798 N  N   . GLU A 445 ? 0.5064 0.5547 0.4998 0.0191  -0.0549 0.1945  442  GLU A N   
3799 C  CA  . GLU A 445 ? 0.5164 0.5618 0.5210 0.0135  -0.0528 0.2005  442  GLU A CA  
3800 C  C   . GLU A 445 ? 0.5031 0.5344 0.5213 0.0097  -0.0564 0.1947  442  GLU A C   
3801 O  O   . GLU A 445 ? 0.4717 0.5000 0.4962 0.0059  -0.0544 0.1920  442  GLU A O   
3802 C  CB  . GLU A 445 ? 0.5458 0.5969 0.5535 0.0122  -0.0520 0.2172  442  GLU A CB  
3803 C  CG  . GLU A 445 ? 0.5927 0.6596 0.5878 0.0152  -0.0464 0.2234  442  GLU A CG  
3804 C  CD  . GLU A 445 ? 0.6749 0.7493 0.6719 0.0144  -0.0450 0.2408  442  GLU A CD  
3805 O  OE1 . GLU A 445 ? 0.7405 0.8089 0.7452 0.0131  -0.0493 0.2484  442  GLU A OE1 
3806 O  OE2 . GLU A 445 ? 0.7104 0.7974 0.7010 0.0155  -0.0394 0.2470  442  GLU A OE2 
3807 N  N   . THR A 446 ? 0.4988 0.5217 0.5210 0.0110  -0.0616 0.1922  443  THR A N   
3808 C  CA  . THR A 446 ? 0.4966 0.5062 0.5311 0.0082  -0.0651 0.1864  443  THR A CA  
3809 C  C   . THR A 446 ? 0.4630 0.4700 0.4954 0.0083  -0.0634 0.1721  443  THR A C   
3810 O  O   . THR A 446 ? 0.4617 0.4622 0.5019 0.0048  -0.0629 0.1681  443  THR A O   
3811 C  CB  . THR A 446 ? 0.5067 0.5089 0.5453 0.0105  -0.0708 0.1864  443  THR A CB  
3812 O  OG1 . THR A 446 ? 0.5543 0.5594 0.5944 0.0105  -0.0724 0.2002  443  THR A OG1 
3813 C  CG2 . THR A 446 ? 0.5333 0.5217 0.5850 0.0079  -0.0742 0.1808  443  THR A CG2 
3814 N  N   . GLN A 447 ? 0.4452 0.4574 0.4671 0.0125  -0.0627 0.1648  444  GLN A N   
3815 C  CA  . GLN A 447 ? 0.4177 0.4287 0.4368 0.0129  -0.0610 0.1521  444  GLN A CA  
3816 C  C   . GLN A 447 ? 0.3939 0.4093 0.4113 0.0102  -0.0560 0.1513  444  GLN A C   
3817 O  O   . GLN A 447 ? 0.3584 0.3688 0.3798 0.0082  -0.0550 0.1432  444  GLN A O   
3818 C  CB  . GLN A 447 ? 0.4338 0.4506 0.4418 0.0177  -0.0615 0.1458  444  GLN A CB  
3819 C  CG  . GLN A 447 ? 0.4934 0.5062 0.5031 0.0207  -0.0667 0.1443  444  GLN A CG  
3820 C  CD  . GLN A 447 ? 0.5293 0.5494 0.5272 0.0252  -0.0674 0.1398  444  GLN A CD  
3821 O  OE1 . GLN A 447 ? 0.5209 0.5502 0.5089 0.0271  -0.0653 0.1441  444  GLN A OE1 
3822 N  NE2 . GLN A 447 ? 0.5755 0.5919 0.5749 0.0271  -0.0702 0.1305  444  GLN A NE2 
3823 N  N   . ALA A 448 ? 0.3771 0.4025 0.3884 0.0106  -0.0526 0.1593  445  ALA A N   
3824 C  CA  . ALA A 448 ? 0.3780 0.4088 0.3878 0.0085  -0.0477 0.1591  445  ALA A CA  
3825 C  C   . ALA A 448 ? 0.3840 0.4082 0.4067 0.0029  -0.0478 0.1629  445  ALA A C   
3826 O  O   . ALA A 448 ? 0.3523 0.3751 0.3774 0.0006  -0.0456 0.1571  445  ALA A O   
3827 C  CB  . ALA A 448 ? 0.3849 0.4286 0.3854 0.0106  -0.0438 0.1671  445  ALA A CB  
3828 N  N   . LYS A 449 ? 0.4129 0.4324 0.4442 0.0008  -0.0509 0.1720  446  LYS A N   
3829 C  CA  A LYS A 449 ? 0.4211 0.4331 0.4656 -0.0045 -0.0522 0.1756  446  LYS A CA  
3830 C  CA  B LYS A 449 ? 0.4168 0.4288 0.4612 -0.0045 -0.0522 0.1756  446  LYS A CA  
3831 C  C   . LYS A 449 ? 0.4124 0.4126 0.4629 -0.0057 -0.0549 0.1641  446  LYS A C   
3832 O  O   . LYS A 449 ? 0.4236 0.4197 0.4810 -0.0095 -0.0545 0.1623  446  LYS A O   
3833 C  CB  A LYS A 449 ? 0.4424 0.4509 0.4955 -0.0063 -0.0557 0.1878  446  LYS A CB  
3834 C  CB  B LYS A 449 ? 0.4333 0.4423 0.4861 -0.0063 -0.0555 0.1881  446  LYS A CB  
3835 C  CG  A LYS A 449 ? 0.4630 0.4617 0.5307 -0.0118 -0.0584 0.1904  446  LYS A CG  
3836 C  CG  B LYS A 449 ? 0.4410 0.4621 0.4906 -0.0066 -0.0520 0.2015  446  LYS A CG  
3837 C  CD  A LYS A 449 ? 0.5188 0.5204 0.5946 -0.0154 -0.0587 0.2059  446  LYS A CD  
3838 C  CD  B LYS A 449 ? 0.4785 0.4970 0.5365 -0.0084 -0.0553 0.2147  446  LYS A CD  
3839 C  CE  A LYS A 449 ? 0.5178 0.5130 0.6063 -0.0212 -0.0598 0.2067  446  LYS A CE  
3840 C  CE  B LYS A 449 ? 0.4914 0.5238 0.5413 -0.0062 -0.0517 0.2265  446  LYS A CE  
3841 N  NZ  A LYS A 449 ? 0.5468 0.5277 0.6412 -0.0218 -0.0643 0.1952  446  LYS A NZ  
3842 N  NZ  B LYS A 449 ? 0.5156 0.5467 0.5639 -0.0034 -0.0556 0.2329  446  LYS A NZ  
3843 N  N   . GLU A 450 ? 0.4174 0.4128 0.4654 -0.0023 -0.0577 0.1567  447  GLU A N   
3844 C  CA  A GLU A 450 ? 0.4144 0.3995 0.4675 -0.0026 -0.0600 0.1458  447  GLU A CA  
3845 C  CA  B GLU A 450 ? 0.4075 0.3924 0.4607 -0.0027 -0.0600 0.1459  447  GLU A CA  
3846 C  C   . GLU A 450 ? 0.3901 0.3776 0.4383 -0.0027 -0.0564 0.1359  447  GLU A C   
3847 O  O   . GLU A 450 ? 0.3904 0.3705 0.4440 -0.0046 -0.0571 0.1291  447  GLU A O   
3848 C  CB  A GLU A 450 ? 0.4324 0.4141 0.4834 0.0016  -0.0632 0.1408  447  GLU A CB  
3849 C  CB  B GLU A 450 ? 0.4202 0.4008 0.4724 0.0013  -0.0635 0.1409  447  GLU A CB  
3850 C  CG  A GLU A 450 ? 0.4869 0.4562 0.5480 0.0012  -0.0678 0.1375  447  GLU A CG  
3851 C  CG  B GLU A 450 ? 0.4371 0.4073 0.4953 0.0014  -0.0659 0.1307  447  GLU A CG  
3852 C  CD  A GLU A 450 ? 0.5238 0.4911 0.5845 0.0052  -0.0714 0.1372  447  GLU A CD  
3853 C  CD  B GLU A 450 ? 0.4777 0.4372 0.5478 -0.0017 -0.0694 0.1337  447  GLU A CD  
3854 O  OE1 A GLU A 450 ? 0.5671 0.5323 0.6323 0.0051  -0.0746 0.1462  447  GLU A OE1 
3855 O  OE1 B GLU A 450 ? 0.5141 0.4721 0.5892 -0.0029 -0.0719 0.1438  447  GLU A OE1 
3856 O  OE2 A GLU A 450 ? 0.5320 0.5003 0.5884 0.0083  -0.0712 0.1283  447  GLU A OE2 
3857 O  OE2 B GLU A 450 ? 0.5116 0.4640 0.5860 -0.0028 -0.0699 0.1259  447  GLU A OE2 
3858 N  N   . LEU A 451 ? 0.3356 0.3332 0.3734 -0.0004 -0.0528 0.1349  448  LEU A N   
3859 C  CA  . LEU A 451 ? 0.3122 0.3124 0.3447 0.0000  -0.0495 0.1254  448  LEU A CA  
3860 C  C   . LEU A 451 ? 0.2953 0.3011 0.3275 -0.0028 -0.0454 0.1279  448  LEU A C   
3861 O  O   . LEU A 451 ? 0.2870 0.2911 0.3195 -0.0041 -0.0437 0.1205  448  LEU A O   
3862 C  CB  . LEU A 451 ? 0.3124 0.3190 0.3343 0.0044  -0.0486 0.1208  448  LEU A CB  
3863 C  CG  . LEU A 451 ? 0.3170 0.3267 0.3328 0.0055  -0.0457 0.1113  448  LEU A CG  
3864 C  CD1 . LEU A 451 ? 0.2963 0.2966 0.3188 0.0040  -0.0470 0.1024  448  LEU A CD1 
3865 C  CD2 . LEU A 451 ? 0.3345 0.3499 0.3405 0.0100  -0.0460 0.1073  448  LEU A CD2 
3866 N  N   . ALA A 452 ? 0.2946 0.3073 0.3264 -0.0038 -0.0437 0.1386  449  ALA A N   
3867 C  CA  . ALA A 452 ? 0.2828 0.3035 0.3126 -0.0054 -0.0392 0.1415  449  ALA A CA  
3868 C  C   . ALA A 452 ? 0.2795 0.2947 0.3176 -0.0097 -0.0391 0.1381  449  ALA A C   
3869 O  O   . ALA A 452 ? 0.2770 0.2967 0.3115 -0.0098 -0.0357 0.1338  449  ALA A O   
3870 C  CB  . ALA A 452 ? 0.3004 0.3297 0.3306 -0.0060 -0.0375 0.1553  449  ALA A CB  
3871 N  N   . ALA A 453 ? 0.2844 0.2898 0.3333 -0.0130 -0.0429 0.1400  450  ALA A N   
3872 C  CA  . ALA A 453 ? 0.2919 0.2923 0.3485 -0.0171 -0.0433 0.1374  450  ALA A CA  
3873 C  C   . ALA A 453 ? 0.2801 0.2774 0.3324 -0.0158 -0.0425 0.1248  450  ALA A C   
3874 O  O   . ALA A 453 ? 0.2920 0.2900 0.3462 -0.0180 -0.0408 0.1220  450  ALA A O   
3875 C  CB  . ALA A 453 ? 0.3107 0.2998 0.3792 -0.0203 -0.0486 0.1403  450  ALA A CB  
3876 N  N   . HIS A 454 ? 0.2608 0.2555 0.3078 -0.0120 -0.0435 0.1177  451  HIS A N   
3877 C  CA  . HIS A 454 ? 0.2461 0.2379 0.2896 -0.0106 -0.0427 0.1059  451  HIS A CA  
3878 C  C   . HIS A 454 ? 0.2480 0.2488 0.2831 -0.0092 -0.0382 0.1029  451  HIS A C   
3879 O  O   . HIS A 454 ? 0.2352 0.2345 0.2688 -0.0092 -0.0371 0.0951  451  HIS A O   
3880 C  CB  . HIS A 454 ? 0.2457 0.2330 0.2870 -0.0072 -0.0451 0.1003  451  HIS A CB  
3881 C  CG  . HIS A 454 ? 0.2498 0.2272 0.2994 -0.0080 -0.0496 0.1013  451  HIS A CG  
3882 N  ND1 . HIS A 454 ? 0.2344 0.2029 0.2896 -0.0092 -0.0515 0.0949  451  HIS A ND1 
3883 C  CD2 . HIS A 454 ? 0.2618 0.2367 0.3156 -0.0079 -0.0526 0.1086  451  HIS A CD2 
3884 C  CE1 . HIS A 454 ? 0.2590 0.2196 0.3211 -0.0093 -0.0557 0.0975  451  HIS A CE1 
3885 N  NE2 . HIS A 454 ? 0.2942 0.2583 0.3561 -0.0088 -0.0566 0.1061  451  HIS A NE2 
3886 N  N   . LYS A 455 ? 0.2401 0.2504 0.2696 -0.0077 -0.0358 0.1092  452  LYS A N   
3887 C  CA  . LYS A 455 ? 0.2536 0.2727 0.2747 -0.0057 -0.0317 0.1067  452  LYS A CA  
3888 C  C   . LYS A 455 ? 0.2471 0.2724 0.2705 -0.0083 -0.0284 0.1121  452  LYS A C   
3889 O  O   . LYS A 455 ? 0.2529 0.2851 0.2702 -0.0066 -0.0249 0.1094  452  LYS A O   
3890 C  CB  . LYS A 455 ? 0.2755 0.3019 0.2876 -0.0015 -0.0309 0.1091  452  LYS A CB  
3891 C  CG  . LYS A 455 ? 0.2869 0.3085 0.2963 0.0015  -0.0342 0.1032  452  LYS A CG  
3892 C  CD  . LYS A 455 ? 0.3008 0.3294 0.3005 0.0059  -0.0339 0.1038  452  LYS A CD  
3893 C  CE  . LYS A 455 ? 0.3145 0.3500 0.3056 0.0082  -0.0307 0.0989  452  LYS A CE  
3894 N  NZ  . LYS A 455 ? 0.3765 0.4186 0.3572 0.0131  -0.0311 0.0991  452  LYS A NZ  
3895 N  N   . VAL A 456 ? 0.2531 0.2759 0.2859 -0.0123 -0.0298 0.1196  453  VAL A N   
3896 C  CA  . VAL A 456 ? 0.2626 0.2918 0.2991 -0.0151 -0.0269 0.1254  453  VAL A CA  
3897 C  C   . VAL A 456 ? 0.2383 0.2660 0.2747 -0.0160 -0.0255 0.1170  453  VAL A C   
3898 O  O   . VAL A 456 ? 0.2414 0.2598 0.2812 -0.0173 -0.0282 0.1098  453  VAL A O   
3899 C  CB  . VAL A 456 ? 0.2545 0.2802 0.3027 -0.0197 -0.0294 0.1346  453  VAL A CB  
3900 C  CG1 . VAL A 456 ? 0.2780 0.3089 0.3323 -0.0234 -0.0271 0.1392  453  VAL A CG1 
3901 C  CG2 . VAL A 456 ? 0.2870 0.3174 0.3343 -0.0185 -0.0295 0.1449  453  VAL A CG2 
3902 N  N   . ILE A 457 ? 0.2437 0.2808 0.2763 -0.0153 -0.0213 0.1182  454  ILE A N   
3903 C  CA  . ILE A 457 ? 0.2353 0.2720 0.2681 -0.0161 -0.0198 0.1114  454  ILE A CA  
3904 C  C   . ILE A 457 ? 0.2538 0.2960 0.2943 -0.0198 -0.0182 0.1191  454  ILE A C   
3905 O  O   . ILE A 457 ? 0.2473 0.3001 0.2859 -0.0188 -0.0146 0.1263  454  ILE A O   
3906 C  CB  . ILE A 457 ? 0.2269 0.2703 0.2491 -0.0117 -0.0163 0.1056  454  ILE A CB  
3907 C  CG1 . ILE A 457 ? 0.2908 0.3315 0.3052 -0.0077 -0.0178 0.0998  454  ILE A CG1 
3908 C  CG2 . ILE A 457 ? 0.2217 0.2640 0.2446 -0.0127 -0.0151 0.0985  454  ILE A CG2 
3909 C  CD1 . ILE A 457 ? 0.3070 0.3385 0.3225 -0.0080 -0.0204 0.0913  454  ILE A CD1 
3910 N  N   . PRO A 458 ? 0.2555 0.2907 0.3048 -0.0241 -0.0210 0.1178  455  PRO A N   
3911 C  CA  . PRO A 458 ? 0.2689 0.3089 0.3275 -0.0281 -0.0204 0.1269  455  PRO A CA  
3912 C  C   . PRO A 458 ? 0.2478 0.2994 0.3046 -0.0274 -0.0155 0.1291  455  PRO A C   
3913 O  O   . PRO A 458 ? 0.2457 0.3057 0.3077 -0.0290 -0.0134 0.1391  455  PRO A O   
3914 C  CB  . PRO A 458 ? 0.2823 0.3119 0.3497 -0.0323 -0.0248 0.1231  455  PRO A CB  
3915 C  CG  . PRO A 458 ? 0.2994 0.3215 0.3612 -0.0302 -0.0263 0.1123  455  PRO A CG  
3916 C  CD  . PRO A 458 ? 0.2811 0.3040 0.3338 -0.0256 -0.0252 0.1101  455  PRO A CD  
3917 N  N   . GLY A 459 ? 0.2332 0.2853 0.2833 -0.0249 -0.0137 0.1201  456  GLY A N   
3918 C  CA  . GLY A 459 ? 0.2268 0.2897 0.2746 -0.0235 -0.0091 0.1212  456  GLY A CA  
3919 C  C   . GLY A 459 ? 0.2256 0.2901 0.2844 -0.0282 -0.0096 0.1253  456  GLY A C   
3920 O  O   . GLY A 459 ? 0.2287 0.2843 0.2958 -0.0325 -0.0141 0.1246  456  GLY A O   
3921 N  N   . ASN A 460 ? 0.2129 0.2889 0.2714 -0.0271 -0.0052 0.1288  457  ASN A N   
3922 C  CA  . ASN A 460 ? 0.2147 0.2939 0.2829 -0.0309 -0.0051 0.1320  457  ASN A CA  
3923 C  C   . ASN A 460 ? 0.2287 0.2990 0.2978 -0.0324 -0.0082 0.1222  457  ASN A C   
3924 O  O   . ASN A 460 ? 0.2207 0.2882 0.2995 -0.0369 -0.0110 0.1234  457  ASN A O   
3925 C  CB  . ASN A 460 ? 0.2314 0.3106 0.3126 -0.0363 -0.0077 0.1427  457  ASN A CB  
3926 C  CG  . ASN A 460 ? 0.2355 0.3254 0.3257 -0.0388 -0.0051 0.1500  457  ASN A CG  
3927 O  OD1 . ASN A 460 ? 0.2712 0.3732 0.3566 -0.0351 0.0004  0.1520  457  ASN A OD1 
3928 N  ND2 . ASN A 460 ? 0.2383 0.3236 0.3419 -0.0449 -0.0095 0.1535  457  ASN A ND2 
3929 N  N   . ARG A 461 ? 0.2165 0.2828 0.2754 -0.0285 -0.0076 0.1124  458  ARG A N   
3930 C  CA  . ARG A 461 ? 0.2033 0.2619 0.2614 -0.0292 -0.0099 0.1030  458  ARG A CA  
3931 C  C   . ARG A 461 ? 0.1964 0.2623 0.2500 -0.0264 -0.0062 0.0995  458  ARG A C   
3932 O  O   . ARG A 461 ? 0.2083 0.2811 0.2541 -0.0219 -0.0023 0.0990  458  ARG A O   
3933 C  CB  . ARG A 461 ? 0.2082 0.2562 0.2598 -0.0274 -0.0125 0.0949  458  ARG A CB  
3934 C  CG  . ARG A 461 ? 0.2265 0.2665 0.2832 -0.0300 -0.0167 0.0979  458  ARG A CG  
3935 C  CD  . ARG A 461 ? 0.2174 0.2476 0.2695 -0.0285 -0.0193 0.0904  458  ARG A CD  
3936 N  NE  . ARG A 461 ? 0.2314 0.2544 0.2903 -0.0312 -0.0235 0.0943  458  ARG A NE  
3937 C  CZ  . ARG A 461 ? 0.2327 0.2452 0.2916 -0.0312 -0.0272 0.0889  458  ARG A CZ  
3938 N  NH1 . ARG A 461 ? 0.2461 0.2545 0.2984 -0.0285 -0.0270 0.0799  458  ARG A NH1 
3939 N  NH2 . ARG A 461 ? 0.2549 0.2609 0.3209 -0.0337 -0.0313 0.0928  458  ARG A NH2 
3940 N  N   . PRO A 462 ? 0.1936 0.2573 0.2519 -0.0288 -0.0076 0.0965  459  PRO A N   
3941 C  CA  . PRO A 462 ? 0.1947 0.2664 0.2515 -0.0268 -0.0042 0.0953  459  PRO A CA  
3942 C  C   . PRO A 462 ? 0.1972 0.2660 0.2443 -0.0227 -0.0031 0.0857  459  PRO A C   
3943 O  O   . PRO A 462 ? 0.1988 0.2579 0.2423 -0.0227 -0.0058 0.0791  459  PRO A O   
3944 C  CB  . PRO A 462 ? 0.1946 0.2641 0.2609 -0.0314 -0.0073 0.0961  459  PRO A CB  
3945 C  CG  . PRO A 462 ? 0.2134 0.2703 0.2812 -0.0340 -0.0125 0.0918  459  PRO A CG  
3946 C  CD  . PRO A 462 ? 0.1994 0.2547 0.2660 -0.0336 -0.0127 0.0960  459  PRO A CD  
3947 N  N   . SER A 463 ? 0.1886 0.2658 0.2320 -0.0192 0.0007  0.0851  460  SER A N   
3948 C  CA  . SER A 463 ? 0.1767 0.2511 0.2129 -0.0159 0.0014  0.0763  460  SER A CA  
3949 C  C   . SER A 463 ? 0.1761 0.2594 0.2127 -0.0137 0.0046  0.0768  460  SER A C   
3950 O  O   . SER A 463 ? 0.1721 0.2656 0.2123 -0.0132 0.0076  0.0837  460  SER A O   
3951 C  CB  . SER A 463 ? 0.1769 0.2499 0.2035 -0.0116 0.0024  0.0725  460  SER A CB  
3952 O  OG  . SER A 463 ? 0.1885 0.2711 0.2112 -0.0080 0.0061  0.0767  460  SER A OG  
3953 N  N   . THR A 464 ? 0.1733 0.2531 0.2066 -0.0122 0.0042  0.0697  461  THR A N   
3954 C  CA  . THR A 464 ? 0.1615 0.2479 0.1933 -0.0088 0.0071  0.0680  461  THR A CA  
3955 C  C   . THR A 464 ? 0.1619 0.2455 0.1840 -0.0041 0.0079  0.0610  461  THR A C   
3956 O  O   . THR A 464 ? 0.1717 0.2462 0.1907 -0.0049 0.0053  0.0559  461  THR A O   
3957 C  CB  . THR A 464 ? 0.1716 0.2549 0.2085 -0.0115 0.0050  0.0656  461  THR A CB  
3958 O  OG1 . THR A 464 ? 0.1876 0.2738 0.2343 -0.0161 0.0036  0.0722  461  THR A OG1 
3959 C  CG2 . THR A 464 ? 0.1897 0.2788 0.2249 -0.0078 0.0075  0.0629  461  THR A CG2 
3960 N  N   . THR A 465 ? 0.1662 0.2573 0.1842 0.0008  0.0112  0.0604  462  THR A N   
3961 C  CA  . THR A 465 ? 0.1631 0.2512 0.1729 0.0053  0.0114  0.0531  462  THR A CA  
3962 C  C   . THR A 465 ? 0.1831 0.2743 0.1938 0.0076  0.0126  0.0502  462  THR A C   
3963 O  O   . THR A 465 ? 0.1844 0.2851 0.1974 0.0096  0.0157  0.0541  462  THR A O   
3964 C  CB  . THR A 465 ? 0.1778 0.2704 0.1801 0.0099  0.0133  0.0535  462  THR A CB  
3965 O  OG1 . THR A 465 ? 0.1801 0.2687 0.1819 0.0076  0.0116  0.0559  462  THR A OG1 
3966 C  CG2 . THR A 465 ? 0.1977 0.2862 0.1920 0.0147  0.0126  0.0451  462  THR A CG2 
3967 N  N   . ILE A 466 ? 0.1734 0.2569 0.1821 0.0077  0.0105  0.0436  463  ILE A N   
3968 C  CA  . ILE A 466 ? 0.1654 0.2501 0.1743 0.0102  0.0111  0.0401  463  ILE A CA  
3969 C  C   . ILE A 466 ? 0.1866 0.2687 0.1878 0.0152  0.0110  0.0338  463  ILE A C   
3970 O  O   . ILE A 466 ? 0.1845 0.2584 0.1827 0.0144  0.0085  0.0295  463  ILE A O   
3971 C  CB  . ILE A 466 ? 0.1727 0.2507 0.1860 0.0064  0.0084  0.0379  463  ILE A CB  
3972 C  CG1 . ILE A 466 ? 0.2059 0.2846 0.2264 0.0011  0.0072  0.0433  463  ILE A CG1 
3973 C  CG2 . ILE A 466 ? 0.1960 0.2756 0.2099 0.0091  0.0090  0.0351  463  ILE A CG2 
3974 C  CD1 . ILE A 466 ? 0.2195 0.2926 0.2440 -0.0023 0.0044  0.0415  463  ILE A CD1 
3975 N  N   . LEU A 467 ? 0.1738 0.2630 0.1720 0.0205  0.0137  0.0334  464  LEU A N   
3976 C  CA  . LEU A 467 ? 0.1795 0.2670 0.1702 0.0259  0.0133  0.0273  464  LEU A CA  
3977 C  C   . LEU A 467 ? 0.1924 0.2789 0.1838 0.0288  0.0131  0.0228  464  LEU A C   
3978 O  O   . LEU A 467 ? 0.1967 0.2906 0.1910 0.0309  0.0156  0.0251  464  LEU A O   
3979 C  CB  . LEU A 467 ? 0.1863 0.2829 0.1716 0.0309  0.0164  0.0297  464  LEU A CB  
3980 C  CG  . LEU A 467 ? 0.1890 0.2842 0.1658 0.0372  0.0157  0.0231  464  LEU A CG  
3981 C  CD1 . LEU A 467 ? 0.2242 0.3101 0.1966 0.0362  0.0119  0.0184  464  LEU A CD1 
3982 C  CD2 . LEU A 467 ? 0.2275 0.3341 0.1988 0.0427  0.0196  0.0265  464  LEU A CD2 
3983 N  N   . LEU A 468 ? 0.1732 0.2506 0.1626 0.0289  0.0100  0.0166  465  LEU A N   
3984 C  CA  . LEU A 468 ? 0.1826 0.2575 0.1724 0.0318  0.0091  0.0119  465  LEU A CA  
3985 C  C   . LEU A 468 ? 0.1842 0.2593 0.1670 0.0383  0.0088  0.0066  465  LEU A C   
3986 O  O   . LEU A 468 ? 0.2152 0.2882 0.1928 0.0391  0.0077  0.0050  465  LEU A O   
3987 C  CB  . LEU A 468 ? 0.1646 0.2296 0.1570 0.0280  0.0058  0.0090  465  LEU A CB  
3988 C  CG  . LEU A 468 ? 0.1765 0.2406 0.1754 0.0233  0.0056  0.0122  465  LEU A CG  
3989 C  CD1 . LEU A 468 ? 0.2135 0.2812 0.2153 0.0191  0.0067  0.0181  465  LEU A CD1 
3990 C  CD2 . LEU A 468 ? 0.1795 0.2340 0.1797 0.0202  0.0026  0.0091  465  LEU A CD2 
3991 N  N   . ASP A 469 ? 0.1876 0.2645 0.1701 0.0430  0.0093  0.0034  466  ASP A N   
3992 C  CA  . ASP A 469 ? 0.1988 0.2742 0.1745 0.0493  0.0080  -0.0028 466  ASP A CA  
3993 C  C   . ASP A 469 ? 0.2018 0.2658 0.1764 0.0479  0.0033  -0.0086 466  ASP A C   
3994 O  O   . ASP A 469 ? 0.2117 0.2735 0.1804 0.0508  0.0014  -0.0125 466  ASP A O   
3995 C  CB  . ASP A 469 ? 0.2393 0.3188 0.2150 0.0553  0.0094  -0.0054 466  ASP A CB  
3996 C  CG  . ASP A 469 ? 0.2610 0.3355 0.2433 0.0533  0.0077  -0.0065 466  ASP A CG  
3997 O  OD1 . ASP A 469 ? 0.2756 0.3463 0.2636 0.0473  0.0068  -0.0036 466  ASP A OD1 
3998 O  OD2 . ASP A 469 ? 0.3651 0.4401 0.3462 0.0591  0.0075  -0.0107 466  ASP A OD2 
3999 N  N   . GLU A 470 ? 0.2036 0.2613 0.1841 0.0434  0.0014  -0.0084 467  GLU A N   
4000 C  CA  . GLU A 470 ? 0.1964 0.2440 0.1778 0.0413  -0.0027 -0.0126 467  GLU A CA  
4001 C  C   . GLU A 470 ? 0.1990 0.2430 0.1868 0.0350  -0.0030 -0.0092 467  GLU A C   
4002 O  O   . GLU A 470 ? 0.1968 0.2455 0.1880 0.0334  -0.0006 -0.0050 467  GLU A O   
4003 C  CB  . GLU A 470 ? 0.2037 0.2469 0.1846 0.0460  -0.0053 -0.0188 467  GLU A CB  
4004 C  CG  . GLU A 470 ? 0.2317 0.2763 0.2172 0.0470  -0.0043 -0.0180 467  GLU A CG  
4005 C  CD  . GLU A 470 ? 0.3251 0.3647 0.3104 0.0519  -0.0072 -0.0242 467  GLU A CD  
4006 O  OE1 . GLU A 470 ? 0.3975 0.4348 0.3778 0.0560  -0.0094 -0.0293 467  GLU A OE1 
4007 O  OE2 . GLU A 470 ? 0.3157 0.3542 0.3057 0.0521  -0.0073 -0.0238 467  GLU A OE2 
4008 N  N   . LEU A 471 ? 0.1901 0.2264 0.1796 0.0320  -0.0059 -0.0112 468  LEU A N   
4009 C  CA  . LEU A 471 ? 0.1732 0.2057 0.1681 0.0267  -0.0063 -0.0086 468  LEU A CA  
4010 C  C   . LEU A 471 ? 0.1802 0.2072 0.1785 0.0274  -0.0085 -0.0113 468  LEU A C   
4011 O  O   . LEU A 471 ? 0.2131 0.2339 0.2124 0.0268  -0.0113 -0.0142 468  LEU A O   
4012 C  CB  . LEU A 471 ? 0.1655 0.1942 0.1604 0.0226  -0.0073 -0.0076 468  LEU A CB  
4013 C  CG  . LEU A 471 ? 0.1703 0.1964 0.1695 0.0175  -0.0072 -0.0047 468  LEU A CG  
4014 C  CD1 . LEU A 471 ? 0.1840 0.2155 0.1844 0.0158  -0.0047 -0.0002 468  LEU A CD1 
4015 C  CD2 . LEU A 471 ? 0.1911 0.2134 0.1903 0.0146  -0.0083 -0.0048 468  LEU A CD2 
4016 N  N   . SER A 472 ? 0.1826 0.2125 0.1830 0.0291  -0.0074 -0.0104 469  SER A N   
4017 C  CA  . SER A 472 ? 0.1749 0.2004 0.1789 0.0303  -0.0093 -0.0123 469  SER A CA  
4018 C  C   . SER A 472 ? 0.1714 0.1968 0.1798 0.0261  -0.0086 -0.0081 469  SER A C   
4019 O  O   . SER A 472 ? 0.1650 0.1943 0.1734 0.0230  -0.0066 -0.0042 469  SER A O   
4020 C  CB  . SER A 472 ? 0.1817 0.2113 0.1846 0.0360  -0.0085 -0.0143 469  SER A CB  
4021 O  OG  . SER A 472 ? 0.1933 0.2311 0.1968 0.0360  -0.0050 -0.0101 469  SER A OG  
4022 N  N   . PRO A 473 ? 0.1665 0.1872 0.1787 0.0259  -0.0104 -0.0087 470  PRO A N   
4023 C  CA  . PRO A 473 ? 0.1690 0.1904 0.1847 0.0227  -0.0098 -0.0046 470  PRO A CA  
4024 C  C   . PRO A 473 ? 0.1546 0.1840 0.1704 0.0234  -0.0072 -0.0016 470  PRO A C   
4025 O  O   . PRO A 473 ? 0.1527 0.1844 0.1692 0.0197  -0.0062 0.0020  470  PRO A O   
4026 C  CB  . PRO A 473 ? 0.1792 0.1954 0.1986 0.0241  -0.0122 -0.0060 470  PRO A CB  
4027 C  CG  . PRO A 473 ? 0.1658 0.1763 0.1847 0.0254  -0.0147 -0.0102 470  PRO A CG  
4028 C  CD  . PRO A 473 ? 0.1736 0.1879 0.1874 0.0284  -0.0136 -0.0128 470  PRO A CD  
4029 N  N   . TYR A 474 ? 0.1624 0.1960 0.1778 0.0282  -0.0064 -0.0032 471  TYR A N   
4030 C  CA  . TYR A 474 ? 0.1625 0.2044 0.1794 0.0291  -0.0038 0.0001  471  TYR A CA  
4031 C  C   . TYR A 474 ? 0.1593 0.2064 0.1742 0.0267  -0.0017 0.0030  471  TYR A C   
4032 O  O   . TYR A 474 ? 0.1528 0.2039 0.1704 0.0236  -0.0008 0.0072  471  TYR A O   
4033 C  CB  . TYR A 474 ? 0.1741 0.2198 0.1906 0.0355  -0.0031 -0.0026 471  TYR A CB  
4034 C  CG  . TYR A 474 ? 0.1697 0.2248 0.1889 0.0374  -0.0004 0.0007  471  TYR A CG  
4035 C  CD1 . TYR A 474 ? 0.1658 0.2220 0.1898 0.0385  -0.0009 0.0019  471  TYR A CD1 
4036 C  CD2 . TYR A 474 ? 0.1948 0.2582 0.2125 0.0378  0.0026  0.0033  471  TYR A CD2 
4037 C  CE1 . TYR A 474 ? 0.1759 0.2412 0.2033 0.0404  0.0014  0.0050  471  TYR A CE1 
4038 C  CE2 . TYR A 474 ? 0.1729 0.2456 0.1942 0.0394  0.0051  0.0068  471  TYR A CE2 
4039 C  CZ  . TYR A 474 ? 0.1709 0.2448 0.1972 0.0407  0.0045  0.0076  471  TYR A CZ  
4040 O  OH  . TYR A 474 ? 0.1809 0.2646 0.2115 0.0427  0.0069  0.0110  471  TYR A OH  
4041 N  N   . SER A 475 ? 0.1589 0.2061 0.1694 0.0281  -0.0012 0.0011  472  SER A N   
4042 C  CA  . SER A 475 ? 0.1629 0.2153 0.1720 0.0260  0.0009  0.0044  472  SER A CA  
4043 C  C   . SER A 475 ? 0.1539 0.2025 0.1641 0.0202  -0.0001 0.0068  472  SER A C   
4044 O  O   . SER A 475 ? 0.1590 0.2117 0.1707 0.0175  0.0010  0.0107  472  SER A O   
4045 C  CB  . SER A 475 ? 0.1595 0.2131 0.1632 0.0292  0.0015  0.0020  472  SER A CB  
4046 O  OG  . SER A 475 ? 0.2059 0.2519 0.2072 0.0278  -0.0009 -0.0012 472  SER A OG  
4047 N  N   . LEU A 476 ? 0.1496 0.1906 0.1595 0.0182  -0.0023 0.0046  473  LEU A N   
4048 C  CA  . LEU A 476 ? 0.1443 0.1817 0.1551 0.0133  -0.0032 0.0065  473  LEU A CA  
4049 C  C   . LEU A 476 ? 0.1372 0.1766 0.1515 0.0110  -0.0032 0.0096  473  LEU A C   
4050 O  O   . LEU A 476 ? 0.1451 0.1855 0.1602 0.0075  -0.0032 0.0123  473  LEU A O   
4051 C  CB  . LEU A 476 ? 0.1661 0.1961 0.1765 0.0122  -0.0052 0.0038  473  LEU A CB  
4052 C  CG  . LEU A 476 ? 0.1344 0.1611 0.1452 0.0078  -0.0057 0.0055  473  LEU A CG  
4053 C  CD1 . LEU A 476 ? 0.1405 0.1683 0.1495 0.0058  -0.0050 0.0068  473  LEU A CD1 
4054 C  CD2 . LEU A 476 ? 0.1596 0.1802 0.1709 0.0071  -0.0072 0.0035  473  LEU A CD2 
4055 N  N   . GLY A 477 ? 0.1479 0.1877 0.1646 0.0128  -0.0037 0.0093  474  GLY A N   
4056 C  CA  . GLY A 477 ? 0.1456 0.1877 0.1657 0.0109  -0.0041 0.0124  474  GLY A CA  
4057 C  C   . GLY A 477 ? 0.1402 0.1898 0.1625 0.0102  -0.0027 0.0157  474  GLY A C   
4058 O  O   . GLY A 477 ? 0.1342 0.1847 0.1585 0.0067  -0.0035 0.0185  474  GLY A O   
4059 N  N   . ALA A 478 ? 0.1336 0.1888 0.1557 0.0136  -0.0006 0.0157  475  ALA A N   
4060 C  CA  . ALA A 478 ? 0.1358 0.1992 0.1605 0.0132  0.0012  0.0198  475  ALA A CA  
4061 C  C   . ALA A 478 ? 0.1327 0.1950 0.1566 0.0091  0.0009  0.0217  475  ALA A C   
4062 O  O   . ALA A 478 ? 0.1505 0.2155 0.1781 0.0059  0.0004  0.0253  475  ALA A O   
4063 C  CB  . ALA A 478 ? 0.1564 0.2259 0.1796 0.0183  0.0038  0.0190  475  ALA A CB  
4064 N  N   . LEU A 479 ? 0.1386 0.1962 0.1580 0.0091  0.0008  0.0193  476  LEU A N   
4065 C  CA  . LEU A 479 ? 0.1411 0.1969 0.1595 0.0057  0.0004  0.0209  476  LEU A CA  
4066 C  C   . LEU A 479 ? 0.1472 0.1987 0.1675 0.0012  -0.0019 0.0218  476  LEU A C   
4067 O  O   . LEU A 479 ? 0.1545 0.2074 0.1773 -0.0019 -0.0025 0.0249  476  LEU A O   
4068 C  CB  . LEU A 479 ? 0.1397 0.1910 0.1531 0.0070  0.0003  0.0177  476  LEU A CB  
4069 C  CG  . LEU A 479 ? 0.1593 0.2082 0.1715 0.0041  -0.0002 0.0189  476  LEU A CG  
4070 C  CD1 . LEU A 479 ? 0.1933 0.2488 0.2073 0.0035  0.0013  0.0233  476  LEU A CD1 
4071 C  CD2 . LEU A 479 ? 0.1895 0.2336 0.1973 0.0056  -0.0008 0.0151  476  LEU A CD2 
4072 N  N   . ILE A 480 ? 0.1397 0.1857 0.1589 0.0009  -0.0034 0.0193  477  ILE A N   
4073 C  CA  . ILE A 480 ? 0.1381 0.1801 0.1579 -0.0027 -0.0055 0.0198  477  ILE A CA  
4074 C  C   . ILE A 480 ? 0.1437 0.1905 0.1681 -0.0042 -0.0064 0.0231  477  ILE A C   
4075 O  O   . ILE A 480 ? 0.1416 0.1873 0.1674 -0.0075 -0.0082 0.0246  477  ILE A O   
4076 C  CB  . ILE A 480 ? 0.1532 0.1900 0.1711 -0.0023 -0.0065 0.0173  477  ILE A CB  
4077 C  CG1 . ILE A 480 ? 0.1493 0.1816 0.1638 -0.0012 -0.0060 0.0144  477  ILE A CG1 
4078 C  CG2 . ILE A 480 ? 0.1600 0.1935 0.1774 -0.0053 -0.0085 0.0177  477  ILE A CG2 
4079 C  CD1 . ILE A 480 ? 0.1520 0.1802 0.1660 -0.0001 -0.0067 0.0125  477  ILE A CD1 
4080 N  N   . ALA A 481 ? 0.1368 0.1885 0.1640 -0.0019 -0.0056 0.0240  478  ALA A N   
4081 C  CA  . ALA A 481 ? 0.1482 0.2049 0.1807 -0.0033 -0.0067 0.0273  478  ALA A CA  
4082 C  C   . ALA A 481 ? 0.1380 0.2000 0.1745 -0.0053 -0.0062 0.0311  478  ALA A C   
4083 O  O   . ALA A 481 ? 0.1505 0.2138 0.1912 -0.0085 -0.0085 0.0336  478  ALA A O   
4084 C  CB  . ALA A 481 ? 0.1643 0.2258 0.1993 0.0004  -0.0055 0.0275  478  ALA A CB  
4085 N  N   . LEU A 482 ? 0.1480 0.2130 0.1834 -0.0038 -0.0037 0.0318  479  LEU A N   
4086 C  CA  . LEU A 482 ? 0.1303 0.2003 0.1698 -0.0060 -0.0032 0.0363  479  LEU A CA  
4087 C  C   . LEU A 482 ? 0.1343 0.1984 0.1742 -0.0106 -0.0063 0.0365  479  LEU A C   
4088 O  O   . LEU A 482 ? 0.1566 0.2233 0.2023 -0.0137 -0.0081 0.0401  479  LEU A O   
4089 C  CB  . LEU A 482 ? 0.1317 0.2045 0.1682 -0.0036 -0.0002 0.0368  479  LEU A CB  
4090 C  CG  . LEU A 482 ? 0.1475 0.2275 0.1836 0.0014  0.0031  0.0370  479  LEU A CG  
4091 C  CD1 . LEU A 482 ? 0.1976 0.2786 0.2285 0.0040  0.0055  0.0363  479  LEU A CD1 
4092 C  CD2 . LEU A 482 ? 0.1659 0.2562 0.2094 0.0014  0.0046  0.0424  479  LEU A CD2 
4093 N  N   . TYR A 483 ? 0.1307 0.1869 0.1650 -0.0109 -0.0072 0.0327  480  TYR A N   
4094 C  CA  . TYR A 483 ? 0.1510 0.2011 0.1849 -0.0145 -0.0102 0.0322  480  TYR A CA  
4095 C  C   . TYR A 483 ? 0.1427 0.1902 0.1780 -0.0165 -0.0135 0.0314  480  TYR A C   
4096 O  O   . TYR A 483 ? 0.1592 0.2047 0.1972 -0.0198 -0.0165 0.0325  480  TYR A O   
4097 C  CB  . TYR A 483 ? 0.1486 0.1920 0.1764 -0.0137 -0.0098 0.0285  480  TYR A CB  
4098 C  CG  . TYR A 483 ? 0.1466 0.1917 0.1737 -0.0129 -0.0079 0.0300  480  TYR A CG  
4099 C  CD1 . TYR A 483 ? 0.1738 0.2177 0.2031 -0.0157 -0.0092 0.0324  480  TYR A CD1 
4100 C  CD2 . TYR A 483 ? 0.1725 0.2200 0.1964 -0.0094 -0.0052 0.0288  480  TYR A CD2 
4101 C  CE1 . TYR A 483 ? 0.1706 0.2163 0.1993 -0.0150 -0.0076 0.0343  480  TYR A CE1 
4102 C  CE2 . TYR A 483 ? 0.1650 0.2147 0.1877 -0.0085 -0.0036 0.0304  480  TYR A CE2 
4103 C  CZ  . TYR A 483 ? 0.1760 0.2251 0.2011 -0.0113 -0.0047 0.0334  480  TYR A CZ  
4104 O  OH  . TYR A 483 ? 0.1774 0.2287 0.2009 -0.0102 -0.0031 0.0354  480  TYR A OH  
4105 N  N   . GLU A 484 ? 0.1448 0.1922 0.1784 -0.0146 -0.0133 0.0295  481  GLU A N   
4106 C  CA  . GLU A 484 ? 0.1472 0.1932 0.1820 -0.0162 -0.0165 0.0294  481  GLU A CA  
4107 C  C   . GLU A 484 ? 0.1445 0.1961 0.1868 -0.0186 -0.0184 0.0334  481  GLU A C   
4108 O  O   . GLU A 484 ? 0.1499 0.1991 0.1940 -0.0215 -0.0223 0.0335  481  GLU A O   
4109 C  CB  . GLU A 484 ? 0.1453 0.1918 0.1784 -0.0136 -0.0159 0.0280  481  GLU A CB  
4110 C  CG  . GLU A 484 ? 0.1494 0.1898 0.1761 -0.0121 -0.0149 0.0244  481  GLU A CG  
4111 C  CD  . GLU A 484 ? 0.1538 0.1940 0.1793 -0.0098 -0.0147 0.0236  481  GLU A CD  
4112 O  OE1 . GLU A 484 ? 0.1599 0.2050 0.1892 -0.0083 -0.0144 0.0253  481  GLU A OE1 
4113 O  OE2 . GLU A 484 ? 0.1450 0.1801 0.1661 -0.0094 -0.0148 0.0214  481  GLU A OE2 
4114 N  N   . HIS A 485 ? 0.1445 0.2038 0.1915 -0.0172 -0.0159 0.0366  482  HIS A N   
4115 C  CA  . HIS A 485 ? 0.1369 0.2027 0.1924 -0.0195 -0.0174 0.0412  482  HIS A CA  
4116 C  C   . HIS A 485 ? 0.1447 0.2104 0.2042 -0.0230 -0.0187 0.0441  482  HIS A C   
4117 O  O   . HIS A 485 ? 0.1461 0.2132 0.2121 -0.0264 -0.0222 0.0467  482  HIS A O   
4118 C  CB  . HIS A 485 ? 0.1382 0.2135 0.1980 -0.0165 -0.0141 0.0441  482  HIS A CB  
4119 C  CG  . HIS A 485 ? 0.1420 0.2171 0.1997 -0.0136 -0.0140 0.0417  482  HIS A CG  
4120 N  ND1 . HIS A 485 ? 0.1805 0.2515 0.2375 -0.0151 -0.0177 0.0401  482  HIS A ND1 
4121 C  CD2 . HIS A 485 ? 0.1462 0.2248 0.2027 -0.0092 -0.0108 0.0408  482  HIS A CD2 
4122 C  CE1 . HIS A 485 ? 0.1814 0.2533 0.2370 -0.0119 -0.0168 0.0388  482  HIS A CE1 
4123 N  NE2 . HIS A 485 ? 0.1563 0.2327 0.2122 -0.0083 -0.0128 0.0392  482  HIS A NE2 
4124 N  N   . LYS A 486 ? 0.1373 0.2009 0.1932 -0.0223 -0.0164 0.0437  483  LYS A N   
4125 C  CA  . LYS A 486 ? 0.1424 0.2041 0.2015 -0.0257 -0.0182 0.0461  483  LYS A CA  
4126 C  C   . LYS A 486 ? 0.1326 0.1863 0.1915 -0.0290 -0.0235 0.0436  483  LYS A C   
4127 O  O   . LYS A 486 ? 0.1517 0.2054 0.2172 -0.0326 -0.0270 0.0463  483  LYS A O   
4128 C  CB  . LYS A 486 ? 0.1492 0.2078 0.2026 -0.0241 -0.0155 0.0448  483  LYS A CB  
4129 C  CG  . LYS A 486 ? 0.1393 0.1944 0.1954 -0.0274 -0.0176 0.0469  483  LYS A CG  
4130 C  CD  . LYS A 486 ? 0.1637 0.2139 0.2136 -0.0259 -0.0160 0.0446  483  LYS A CD  
4131 C  CE  . LYS A 486 ? 0.1658 0.2126 0.2190 -0.0290 -0.0183 0.0472  483  LYS A CE  
4132 N  NZ  . LYS A 486 ? 0.1994 0.2412 0.2460 -0.0271 -0.0169 0.0444  483  LYS A NZ  
4133 N  N   . ILE A 487 ? 0.1349 0.1817 0.1861 -0.0275 -0.0242 0.0383  484  ILE A N   
4134 C  CA  . ILE A 487 ? 0.1454 0.1843 0.1940 -0.0295 -0.0288 0.0348  484  ILE A CA  
4135 C  C   . ILE A 487 ? 0.1493 0.1903 0.2033 -0.0317 -0.0330 0.0361  484  ILE A C   
4136 O  O   . ILE A 487 ? 0.1685 0.2058 0.2254 -0.0347 -0.0378 0.0359  484  ILE A O   
4137 C  CB  . ILE A 487 ? 0.1552 0.1883 0.1944 -0.0268 -0.0276 0.0296  484  ILE A CB  
4138 C  CG1 . ILE A 487 ? 0.1615 0.1919 0.1967 -0.0254 -0.0247 0.0283  484  ILE A CG1 
4139 C  CG2 . ILE A 487 ? 0.1743 0.2009 0.2101 -0.0279 -0.0321 0.0260  484  ILE A CG2 
4140 C  CD1 . ILE A 487 ? 0.1725 0.1999 0.2003 -0.0223 -0.0223 0.0244  484  ILE A CD1 
4141 N  N   . PHE A 488 ? 0.1644 0.2111 0.2197 -0.0300 -0.0316 0.0372  485  PHE A N   
4142 C  CA  . PHE A 488 ? 0.1647 0.2147 0.2257 -0.0317 -0.0354 0.0389  485  PHE A CA  
4143 C  C   . PHE A 488 ? 0.1537 0.2082 0.2254 -0.0355 -0.0378 0.0440  485  PHE A C   
4144 O  O   . PHE A 488 ? 0.1569 0.2089 0.2328 -0.0387 -0.0434 0.0440  485  PHE A O   
4145 C  CB  . PHE A 488 ? 0.1517 0.2083 0.2135 -0.0288 -0.0326 0.0401  485  PHE A CB  
4146 C  CG  . PHE A 488 ? 0.1788 0.2405 0.2476 -0.0302 -0.0360 0.0426  485  PHE A CG  
4147 C  CD1 . PHE A 488 ? 0.1882 0.2456 0.2569 -0.0325 -0.0420 0.0408  485  PHE A CD1 
4148 C  CD2 . PHE A 488 ? 0.2505 0.3216 0.3256 -0.0286 -0.0332 0.0464  485  PHE A CD2 
4149 C  CE1 . PHE A 488 ? 0.1945 0.2572 0.2700 -0.0337 -0.0454 0.0432  485  PHE A CE1 
4150 C  CE2 . PHE A 488 ? 0.2604 0.3370 0.3428 -0.0296 -0.0364 0.0490  485  PHE A CE2 
4151 C  CZ  . PHE A 488 ? 0.1920 0.2643 0.2748 -0.0324 -0.0424 0.0475  485  PHE A CZ  
4152 N  N   . VAL A 489 ? 0.1514 0.2128 0.2278 -0.0350 -0.0336 0.0485  486  VAL A N   
4153 C  CA  . VAL A 489 ? 0.1475 0.2145 0.2350 -0.0385 -0.0351 0.0546  486  VAL A CA  
4154 C  C   . VAL A 489 ? 0.1588 0.2179 0.2478 -0.0423 -0.0398 0.0539  486  VAL A C   
4155 O  O   . VAL A 489 ? 0.1602 0.2192 0.2574 -0.0462 -0.0448 0.0562  486  VAL A O   
4156 C  CB  . VAL A 489 ? 0.1456 0.2214 0.2364 -0.0368 -0.0293 0.0595  486  VAL A CB  
4157 C  CG1 . VAL A 489 ? 0.1545 0.2361 0.2573 -0.0409 -0.0307 0.0668  486  VAL A CG1 
4158 C  CG2 . VAL A 489 ? 0.1574 0.2415 0.2479 -0.0327 -0.0249 0.0603  486  VAL A CG2 
4159 N  N   . GLN A 490 ? 0.1498 0.2017 0.2309 -0.0411 -0.0384 0.0504  487  GLN A N   
4160 C  CA  . GLN A 490 ? 0.1722 0.2160 0.2544 -0.0442 -0.0429 0.0493  487  GLN A CA  
4161 C  C   . GLN A 490 ? 0.1761 0.2134 0.2578 -0.0460 -0.0496 0.0452  487  GLN A C   
4162 O  O   . GLN A 490 ? 0.1901 0.2238 0.2783 -0.0497 -0.0551 0.0463  487  GLN A O   
4163 C  CB  . GLN A 490 ? 0.1686 0.2059 0.2422 -0.0420 -0.0403 0.0457  487  GLN A CB  
4164 C  CG  . GLN A 490 ? 0.1652 0.2081 0.2399 -0.0407 -0.0349 0.0500  487  GLN A CG  
4165 C  CD  . GLN A 490 ? 0.1797 0.2152 0.2476 -0.0396 -0.0341 0.0468  487  GLN A CD  
4166 O  OE1 . GLN A 490 ? 0.2317 0.2638 0.3037 -0.0421 -0.0363 0.0491  487  GLN A OE1 
4167 N  NE2 . GLN A 490 ? 0.1514 0.1839 0.2102 -0.0361 -0.0316 0.0418  487  GLN A NE2 
4168 N  N   . GLY A 491 ? 0.1728 0.2078 0.2465 -0.0433 -0.0496 0.0403  488  GLY A N   
4169 C  CA  . GLY A 491 ? 0.1698 0.1991 0.2415 -0.0444 -0.0559 0.0362  488  GLY A CA  
4170 C  C   . GLY A 491 ? 0.1756 0.2096 0.2577 -0.0477 -0.0606 0.0398  488  GLY A C   
4171 O  O   . GLY A 491 ? 0.1910 0.2199 0.2760 -0.0504 -0.0674 0.0382  488  GLY A O   
4172 N  N   . VAL A 492 ? 0.1889 0.2330 0.2771 -0.0473 -0.0573 0.0448  489  VAL A N   
4173 C  CA  . VAL A 492 ? 0.1891 0.2397 0.2891 -0.0505 -0.0612 0.0494  489  VAL A CA  
4174 C  C   . VAL A 492 ? 0.1854 0.2353 0.2959 -0.0552 -0.0648 0.0535  489  VAL A C   
4175 O  O   . VAL A 492 ? 0.1980 0.2456 0.3155 -0.0588 -0.0720 0.0537  489  VAL A O   
4176 C  CB  . VAL A 492 ? 0.1916 0.2539 0.2964 -0.0486 -0.0561 0.0541  489  VAL A CB  
4177 C  CG1 . VAL A 492 ? 0.2150 0.2857 0.3347 -0.0523 -0.0599 0.0602  489  VAL A CG1 
4178 C  CG2 . VAL A 492 ? 0.1931 0.2554 0.2892 -0.0445 -0.0544 0.0501  489  VAL A CG2 
4179 N  N   . LEU A 493 ? 0.1836 0.2355 0.2958 -0.0552 -0.0603 0.0570  490  LEU A N   
4180 C  CA  . LEU A 493 ? 0.1810 0.2330 0.3043 -0.0598 -0.0634 0.0622  490  LEU A CA  
4181 C  C   . LEU A 493 ? 0.1808 0.2202 0.3022 -0.0621 -0.0705 0.0574  490  LEU A C   
4182 O  O   . LEU A 493 ? 0.2118 0.2501 0.3445 -0.0668 -0.0765 0.0607  490  LEU A O   
4183 C  CB  . LEU A 493 ? 0.2054 0.2624 0.3301 -0.0589 -0.0569 0.0673  490  LEU A CB  
4184 C  CG  . LEU A 493 ? 0.2284 0.2985 0.3559 -0.0564 -0.0499 0.0725  490  LEU A CG  
4185 C  CD1 . LEU A 493 ? 0.2609 0.3338 0.3861 -0.0546 -0.0438 0.0758  490  LEU A CD1 
4186 C  CD2 . LEU A 493 ? 0.2906 0.3707 0.4326 -0.0596 -0.0520 0.0794  490  LEU A CD2 
4187 N  N   . TRP A 494 ? 0.1830 0.2134 0.2916 -0.0591 -0.0704 0.0500  491  TRP A N   
4188 C  CA  . TRP A 494 ? 0.1879 0.2063 0.2928 -0.0601 -0.0770 0.0441  491  TRP A CA  
4189 C  C   . TRP A 494 ? 0.2102 0.2245 0.3131 -0.0605 -0.0840 0.0391  491  TRP A C   
4190 O  O   . TRP A 494 ? 0.2305 0.2351 0.3304 -0.0611 -0.0901 0.0339  491  TRP A O   
4191 C  CB  . TRP A 494 ? 0.1948 0.2060 0.2866 -0.0561 -0.0735 0.0382  491  TRP A CB  
4192 C  CG  . TRP A 494 ? 0.1884 0.1998 0.2817 -0.0562 -0.0691 0.0418  491  TRP A CG  
4193 C  CD1 . TRP A 494 ? 0.2242 0.2370 0.3286 -0.0600 -0.0706 0.0480  491  TRP A CD1 
4194 C  CD2 . TRP A 494 ? 0.2017 0.2123 0.2857 -0.0523 -0.0628 0.0398  491  TRP A CD2 
4195 N  NE1 . TRP A 494 ? 0.2108 0.2234 0.3123 -0.0585 -0.0656 0.0497  491  TRP A NE1 
4196 C  CE2 . TRP A 494 ? 0.1962 0.2075 0.2854 -0.0538 -0.0609 0.0446  491  TRP A CE2 
4197 C  CE3 . TRP A 494 ? 0.1715 0.1811 0.2437 -0.0479 -0.0586 0.0347  491  TRP A CE3 
4198 C  CZ2 . TRP A 494 ? 0.2034 0.2147 0.2860 -0.0508 -0.0552 0.0442  491  TRP A CZ2 
4199 C  CZ3 . TRP A 494 ? 0.1768 0.1863 0.2436 -0.0453 -0.0533 0.0344  491  TRP A CZ3 
4200 C  CH2 . TRP A 494 ? 0.1985 0.2084 0.2701 -0.0467 -0.0519 0.0387  491  TRP A CH2 
4201 N  N   . ASP A 495 ? 0.2126 0.2345 0.3167 -0.0598 -0.0831 0.0405  492  ASP A N   
4202 C  CA  . ASP A 495 ? 0.2261 0.2457 0.3282 -0.0599 -0.0894 0.0366  492  ASP A CA  
4203 C  C   . ASP A 495 ? 0.2160 0.2265 0.3028 -0.0560 -0.0903 0.0280  492  ASP A C   
4204 O  O   . ASP A 495 ? 0.2200 0.2239 0.3039 -0.0564 -0.0975 0.0230  492  ASP A O   
4205 C  CB  . ASP A 495 ? 0.2327 0.2498 0.3469 -0.0651 -0.0985 0.0382  492  ASP A CB  
4206 C  CG  . ASP A 495 ? 0.2818 0.3003 0.3975 -0.0657 -0.1048 0.0363  492  ASP A CG  
4207 O  OD1 . ASP A 495 ? 0.3407 0.3669 0.4541 -0.0634 -0.1008 0.0377  492  ASP A OD1 
4208 O  OD2 . ASP A 495 ? 0.3558 0.3673 0.4753 -0.0686 -0.1139 0.0335  492  ASP A OD2 
4209 N  N   . ILE A 496 ? 0.2034 0.2137 0.2802 -0.0520 -0.0832 0.0261  493  ILE A N   
4210 C  CA  . ILE A 496 ? 0.2107 0.2143 0.2733 -0.0479 -0.0827 0.0190  493  ILE A CA  
4211 C  C   . ILE A 496 ? 0.2072 0.2163 0.2633 -0.0446 -0.0782 0.0190  493  ILE A C   
4212 O  O   . ILE A 496 ? 0.2019 0.2196 0.2637 -0.0448 -0.0743 0.0240  493  ILE A O   
4213 C  CB  . ILE A 496 ? 0.1949 0.1927 0.2512 -0.0460 -0.0789 0.0165  493  ILE A CB  
4214 C  CG1 . ILE A 496 ? 0.1997 0.2041 0.2573 -0.0449 -0.0705 0.0211  493  ILE A CG1 
4215 C  CG2 . ILE A 496 ? 0.2232 0.2135 0.2852 -0.0491 -0.0848 0.0156  493  ILE A CG2 
4216 C  CD1 . ILE A 496 ? 0.2027 0.2021 0.2540 -0.0428 -0.0667 0.0187  493  ILE A CD1 
4217 N  N   . ASN A 497 ? 0.2167 0.2210 0.2608 -0.0412 -0.0783 0.0133  494  ASN A N   
4218 C  CA  . ASN A 497 ? 0.2089 0.2174 0.2460 -0.0378 -0.0737 0.0133  494  ASN A CA  
4219 C  C   . ASN A 497 ? 0.2083 0.2160 0.2392 -0.0349 -0.0665 0.0126  494  ASN A C   
4220 O  O   . ASN A 497 ? 0.2200 0.2214 0.2422 -0.0328 -0.0661 0.0081  494  ASN A O   
4221 C  CB  . ASN A 497 ? 0.2035 0.2083 0.2314 -0.0356 -0.0779 0.0085  494  ASN A CB  
4222 C  CG  . ASN A 497 ? 0.2016 0.2108 0.2231 -0.0323 -0.0735 0.0093  494  ASN A CG  
4223 O  OD1 . ASN A 497 ? 0.2124 0.2275 0.2378 -0.0319 -0.0681 0.0133  494  ASN A OD1 
4224 N  ND2 . ASN A 497 ? 0.2074 0.2137 0.2192 -0.0298 -0.0761 0.0054  494  ASN A ND2 
4225 N  N   . SER A 498 ? 0.1895 0.2037 0.2246 -0.0346 -0.0608 0.0170  495  SER A N   
4226 C  CA  . SER A 498 ? 0.1921 0.2060 0.2225 -0.0322 -0.0544 0.0167  495  SER A CA  
4227 C  C   . SER A 498 ? 0.1787 0.1915 0.1993 -0.0286 -0.0517 0.0139  495  SER A C   
4228 O  O   . SER A 498 ? 0.1951 0.2068 0.2113 -0.0265 -0.0469 0.0130  495  SER A O   
4229 C  CB  . SER A 498 ? 0.1793 0.2004 0.2162 -0.0324 -0.0495 0.0216  495  SER A CB  
4230 O  OG  . SER A 498 ? 0.1867 0.2094 0.2326 -0.0356 -0.0509 0.0250  495  SER A OG  
4231 N  N   . TYR A 499 ? 0.1796 0.1932 0.1973 -0.0279 -0.0546 0.0130  496  TYR A N   
4232 C  CA  . TYR A 499 ? 0.1721 0.1869 0.1828 -0.0247 -0.0514 0.0125  496  TYR A CA  
4233 C  C   . TYR A 499 ? 0.1798 0.1896 0.1800 -0.0224 -0.0532 0.0082  496  TYR A C   
4234 O  O   . TYR A 499 ? 0.1895 0.2004 0.1841 -0.0199 -0.0502 0.0083  496  TYR A O   
4235 C  CB  . TYR A 499 ? 0.1695 0.1910 0.1853 -0.0247 -0.0516 0.0162  496  TYR A CB  
4236 C  CG  . TYR A 499 ? 0.1521 0.1789 0.1767 -0.0258 -0.0482 0.0201  496  TYR A CG  
4237 C  CD1 . TYR A 499 ? 0.1506 0.1780 0.1738 -0.0240 -0.0425 0.0206  496  TYR A CD1 
4238 C  CD2 . TYR A 499 ? 0.1756 0.2068 0.2099 -0.0285 -0.0508 0.0233  496  TYR A CD2 
4239 C  CE1 . TYR A 499 ? 0.1695 0.2017 0.1994 -0.0244 -0.0393 0.0238  496  TYR A CE1 
4240 C  CE2 . TYR A 499 ? 0.1817 0.2182 0.2233 -0.0291 -0.0472 0.0270  496  TYR A CE2 
4241 C  CZ  . TYR A 499 ? 0.1743 0.2113 0.2132 -0.0269 -0.0414 0.0271  496  TYR A CZ  
4242 O  OH  . TYR A 499 ? 0.1910 0.2336 0.2362 -0.0269 -0.0379 0.0306  496  TYR A OH  
4243 N  N   . ASP A 500 ? 0.1918 0.1964 0.1896 -0.0232 -0.0579 0.0046  497  ASP A N   
4244 C  CA  . ASP A 500 ? 0.1996 0.1992 0.1866 -0.0204 -0.0592 -0.0001 497  ASP A CA  
4245 C  C   . ASP A 500 ? 0.1913 0.1866 0.1753 -0.0193 -0.0559 -0.0026 497  ASP A C   
4246 O  O   . ASP A 500 ? 0.1940 0.1902 0.1842 -0.0208 -0.0531 -0.0005 497  ASP A O   
4247 C  CB  . ASP A 500 ? 0.2089 0.2052 0.1940 -0.0211 -0.0670 -0.0034 497  ASP A CB  
4248 C  CG  . ASP A 500 ? 0.2172 0.2092 0.2088 -0.0242 -0.0717 -0.0048 497  ASP A CG  
4249 O  OD1 . ASP A 500 ? 0.2231 0.2142 0.2193 -0.0253 -0.0686 -0.0036 497  ASP A OD1 
4250 O  OD2 . ASP A 500 ? 0.2367 0.2266 0.2295 -0.0256 -0.0788 -0.0067 497  ASP A OD2 
4251 N  N   . GLN A 501 ? 0.2110 0.2027 0.1854 -0.0162 -0.0558 -0.0066 498  GLN A N   
4252 C  CA  . GLN A 501 ? 0.2163 0.2042 0.1875 -0.0146 -0.0528 -0.0092 498  GLN A CA  
4253 C  C   . GLN A 501 ? 0.2260 0.2095 0.1872 -0.0113 -0.0552 -0.0145 498  GLN A C   
4254 O  O   . GLN A 501 ? 0.2369 0.2211 0.1907 -0.0079 -0.0510 -0.0155 498  GLN A O   
4255 C  CB  . GLN A 501 ? 0.2068 0.1982 0.1782 -0.0133 -0.0455 -0.0063 498  GLN A CB  
4256 C  CG  . GLN A 501 ? 0.2065 0.2016 0.1724 -0.0109 -0.0425 -0.0048 498  GLN A CG  
4257 C  CD  . GLN A 501 ? 0.1805 0.1802 0.1505 -0.0123 -0.0432 -0.0009 498  GLN A CD  
4258 O  OE1 . GLN A 501 ? 0.2192 0.2215 0.1975 -0.0146 -0.0424 0.0021  498  GLN A OE1 
4259 N  NE2 . GLN A 501 ? 0.2109 0.2120 0.1751 -0.0106 -0.0447 -0.0009 498  GLN A NE2 
4260 N  N   . TRP A 502 ? 0.2350 0.2141 0.1956 -0.0120 -0.0619 -0.0180 499  TRP A N   
4261 C  CA  . TRP A 502 ? 0.2458 0.2209 0.1958 -0.0083 -0.0648 -0.0237 499  TRP A CA  
4262 C  C   . TRP A 502 ? 0.2508 0.2218 0.1962 -0.0053 -0.0621 -0.0274 499  TRP A C   
4263 O  O   . TRP A 502 ? 0.2928 0.2624 0.2277 -0.0009 -0.0618 -0.0315 499  TRP A O   
4264 C  CB  . TRP A 502 ? 0.2709 0.2418 0.2212 -0.0096 -0.0737 -0.0271 499  TRP A CB  
4265 C  CG  . TRP A 502 ? 0.2601 0.2355 0.2131 -0.0116 -0.0765 -0.0239 499  TRP A CG  
4266 C  CD1 . TRP A 502 ? 0.2954 0.2726 0.2594 -0.0161 -0.0799 -0.0205 499  TRP A CD1 
4267 C  CD2 . TRP A 502 ? 0.2565 0.2360 0.2019 -0.0090 -0.0754 -0.0230 499  TRP A CD2 
4268 N  NE1 . TRP A 502 ? 0.2906 0.2727 0.2544 -0.0163 -0.0814 -0.0180 499  TRP A NE1 
4269 C  CE2 . TRP A 502 ? 0.2699 0.2533 0.2222 -0.0121 -0.0788 -0.0195 499  TRP A CE2 
4270 C  CE3 . TRP A 502 ? 0.2879 0.2685 0.2213 -0.0042 -0.0721 -0.0247 499  TRP A CE3 
4271 C  CZ2 . TRP A 502 ? 0.3232 0.3108 0.2706 -0.0105 -0.0792 -0.0177 499  TRP A CZ2 
4272 C  CZ3 . TRP A 502 ? 0.3508 0.3359 0.2794 -0.0029 -0.0723 -0.0226 499  TRP A CZ3 
4273 C  CH2 . TRP A 502 ? 0.3723 0.3606 0.3079 -0.0060 -0.0760 -0.0191 499  TRP A CH2 
4274 N  N   A GLY A 503 ? 0.2579 0.2279 0.2103 -0.0071 -0.0592 -0.0258 500  GLY A N   
4275 N  N   B GLY A 503 ? 0.2594 0.2280 0.2124 -0.0076 -0.0614 -0.0266 500  GLY A N   
4276 C  CA  A GLY A 503 ? 0.2425 0.2101 0.1915 -0.0041 -0.0554 -0.0283 500  GLY A CA  
4277 C  CA  B GLY A 503 ? 0.2586 0.2218 0.2089 -0.0053 -0.0612 -0.0309 500  GLY A CA  
4278 C  C   A GLY A 503 ? 0.2472 0.2202 0.1922 -0.0015 -0.0479 -0.0258 500  GLY A C   
4279 C  C   B GLY A 503 ? 0.2513 0.2173 0.1941 -0.0010 -0.0546 -0.0313 500  GLY A C   
4280 O  O   A GLY A 503 ? 0.2687 0.2411 0.2072 0.0024  -0.0450 -0.0285 500  GLY A O   
4281 O  O   B GLY A 503 ? 0.2478 0.2103 0.1858 0.0024  -0.0541 -0.0355 500  GLY A O   
4282 N  N   A VAL A 504 ? 0.2256 0.2040 0.1750 -0.0036 -0.0448 -0.0206 501  VAL A N   
4283 N  N   B VAL A 504 ? 0.2546 0.2272 0.1969 -0.0009 -0.0497 -0.0269 501  VAL A N   
4284 C  CA  A VAL A 504 ? 0.2149 0.1984 0.1615 -0.0017 -0.0385 -0.0177 501  VAL A CA  
4285 C  CA  B VAL A 504 ? 0.2573 0.2334 0.1942 0.0025  -0.0433 -0.0262 501  VAL A CA  
4286 C  C   A VAL A 504 ? 0.2368 0.2224 0.1739 0.0015  -0.0386 -0.0185 501  VAL A C   
4287 C  C   B VAL A 504 ? 0.2683 0.2455 0.1938 0.0070  -0.0433 -0.0289 501  VAL A C   
4288 O  O   A VAL A 504 ? 0.2632 0.2511 0.1942 0.0049  -0.0345 -0.0186 501  VAL A O   
4289 O  O   B VAL A 504 ? 0.2718 0.2517 0.1924 0.0105  -0.0382 -0.0289 501  VAL A O   
4290 C  CB  A VAL A 504 ? 0.1976 0.1854 0.1523 -0.0047 -0.0356 -0.0122 501  VAL A CB  
4291 C  CB  B VAL A 504 ? 0.2358 0.2180 0.1778 0.0006  -0.0381 -0.0200 501  VAL A CB  
4292 C  CG1 A VAL A 504 ? 0.1999 0.1926 0.1521 -0.0030 -0.0303 -0.0089 501  VAL A CG1 
4293 C  CG1 B VAL A 504 ? 0.2231 0.2048 0.1755 -0.0032 -0.0376 -0.0175 501  VAL A CG1 
4294 C  CG2 A VAL A 504 ? 0.2052 0.1916 0.1672 -0.0067 -0.0342 -0.0114 501  VAL A CG2 
4295 C  CG2 B VAL A 504 ? 0.2485 0.2346 0.1896 -0.0003 -0.0393 -0.0171 501  VAL A CG2 
4296 N  N   A GLU A 505 ? 0.2482 0.2336 0.1843 0.0004  -0.0435 -0.0188 502  GLU A N   
4297 N  N   B GLU A 505 ? 0.2824 0.2583 0.2036 0.0072  -0.0488 -0.0311 502  GLU A N   
4298 C  CA  A GLU A 505 ? 0.2560 0.2431 0.1822 0.0037  -0.0445 -0.0200 502  GLU A CA  
4299 C  CA  B GLU A 505 ? 0.3013 0.2790 0.2105 0.0119  -0.0486 -0.0333 502  GLU A CA  
4300 C  C   A GLU A 505 ? 0.2755 0.2595 0.1919 0.0083  -0.0450 -0.0257 502  GLU A C   
4301 C  C   B GLU A 505 ? 0.3069 0.2810 0.2077 0.0171  -0.0485 -0.0395 502  GLU A C   
4302 O  O   A GLU A 505 ? 0.2915 0.2789 0.1995 0.0121  -0.0417 -0.0253 502  GLU A O   
4303 O  O   B GLU A 505 ? 0.3165 0.2945 0.2088 0.0216  -0.0443 -0.0397 502  GLU A O   
4304 C  CB  A GLU A 505 ? 0.2581 0.2452 0.1850 0.0018  -0.0506 -0.0198 502  GLU A CB  
4305 C  CB  B GLU A 505 ? 0.3213 0.2980 0.2275 0.0111  -0.0553 -0.0347 502  GLU A CB  
4306 C  CG  A GLU A 505 ? 0.2584 0.2494 0.1941 -0.0018 -0.0500 -0.0145 502  GLU A CG  
4307 C  CG  B GLU A 505 ? 0.3506 0.3328 0.2484 0.0138  -0.0537 -0.0324 502  GLU A CG  
4308 C  CD  A GLU A 505 ? 0.2986 0.2952 0.2338 -0.0008 -0.0443 -0.0095 502  GLU A CD  
4309 C  CD  B GLU A 505 ? 0.3675 0.3491 0.2645 0.0122  -0.0605 -0.0328 502  GLU A CD  
4310 O  OE1 A GLU A 505 ? 0.3423 0.3409 0.2691 0.0026  -0.0417 -0.0092 502  GLU A OE1 
4311 O  OE1 B GLU A 505 ? 0.3491 0.3252 0.2490 0.0104  -0.0672 -0.0367 502  GLU A OE1 
4312 O  OE2 A GLU A 505 ? 0.2689 0.2680 0.2122 -0.0034 -0.0427 -0.0056 502  GLU A OE2 
4313 O  OE2 B GLU A 505 ? 0.4472 0.4339 0.3412 0.0126  -0.0596 -0.0289 502  GLU A OE2 
4314 N  N   A LEU A 506 ? 0.2877 0.2654 0.2048 0.0083  -0.0492 -0.0307 503  LEU A N   
4315 N  N   B LEU A 506 ? 0.3036 0.2707 0.2069 0.0166  -0.0533 -0.0444 503  LEU A N   
4316 C  CA  A LEU A 506 ? 0.3103 0.2846 0.2185 0.0131  -0.0496 -0.0366 503  LEU A CA  
4317 C  CA  B LEU A 506 ? 0.3132 0.2758 0.2086 0.0218  -0.0544 -0.0512 503  LEU A CA  
4318 C  C   A LEU A 506 ? 0.3088 0.2865 0.2159 0.0158  -0.0419 -0.0350 503  LEU A C   
4319 C  C   B LEU A 506 ? 0.2940 0.2606 0.1878 0.0251  -0.0463 -0.0498 503  LEU A C   
4320 O  O   A LEU A 506 ? 0.2974 0.2773 0.1955 0.0206  -0.0392 -0.0368 503  LEU A O   
4321 O  O   B LEU A 506 ? 0.3000 0.2691 0.1839 0.0308  -0.0437 -0.0524 503  LEU A O   
4322 C  CB  A LEU A 506 ? 0.3314 0.2977 0.2428 0.0122  -0.0553 -0.0419 503  LEU A CB  
4323 C  CB  B LEU A 506 ? 0.3180 0.2717 0.2190 0.0199  -0.0608 -0.0557 503  LEU A CB  
4324 C  CG  A LEU A 506 ? 0.3785 0.3405 0.2799 0.0180  -0.0566 -0.0490 503  LEU A CG  
4325 C  CG  B LEU A 506 ? 0.3306 0.2792 0.2255 0.0252  -0.0614 -0.0626 503  LEU A CG  
4326 C  CD1 A LEU A 506 ? 0.4013 0.3649 0.2903 0.0223  -0.0587 -0.0520 503  LEU A CD1 
4327 C  CD1 B LEU A 506 ? 0.3809 0.3296 0.2616 0.0311  -0.0638 -0.0680 503  LEU A CD1 
4328 C  CD2 A LEU A 506 ? 0.4243 0.3774 0.3292 0.0171  -0.0633 -0.0545 503  LEU A CD2 
4329 C  CD2 B LEU A 506 ? 0.3472 0.2864 0.2495 0.0228  -0.0681 -0.0664 503  LEU A CD2 
4330 N  N   A GLY A 507 ? 0.2977 0.2763 0.2142 0.0127  -0.0385 -0.0315 504  GLY A N   
4331 N  N   B GLY A 507 ? 0.2758 0.2442 0.1796 0.0217  -0.0423 -0.0452 504  GLY A N   
4332 C  CA  A GLY A 507 ? 0.3025 0.2843 0.2195 0.0148  -0.0318 -0.0298 504  GLY A CA  
4333 C  CA  B GLY A 507 ? 0.2754 0.2480 0.1796 0.0241  -0.0350 -0.0433 504  GLY A CA  
4334 C  C   A GLY A 507 ? 0.2946 0.2833 0.2060 0.0175  -0.0265 -0.0263 504  GLY A C   
4335 C  C   B GLY A 507 ? 0.2686 0.2493 0.1664 0.0270  -0.0293 -0.0396 504  GLY A C   
4336 O  O   A GLY A 507 ? 0.2865 0.2777 0.1937 0.0213  -0.0222 -0.0269 504  GLY A O   
4337 O  O   B GLY A 507 ? 0.2758 0.2599 0.1693 0.0313  -0.0244 -0.0401 504  GLY A O   
4338 N  N   A LYS A 508 ? 0.3032 0.2951 0.2150 0.0156  -0.0270 -0.0224 505  LYS A N   
4339 N  N   B LYS A 508 ? 0.2604 0.2445 0.1579 0.0247  -0.0299 -0.0356 505  LYS A N   
4340 C  CA  A LYS A 508 ? 0.3093 0.3076 0.2166 0.0176  -0.0226 -0.0180 505  LYS A CA  
4341 C  CA  B LYS A 508 ? 0.2633 0.2549 0.1553 0.0271  -0.0247 -0.0314 505  LYS A CA  
4342 C  C   A LYS A 508 ? 0.3362 0.3362 0.2310 0.0229  -0.0227 -0.0208 505  LYS A C   
4343 C  C   B LYS A 508 ? 0.2781 0.2704 0.1566 0.0334  -0.0254 -0.0360 505  LYS A C   
4344 O  O   A LYS A 508 ? 0.3501 0.3561 0.2407 0.0253  -0.0179 -0.0169 505  LYS A O   
4345 O  O   B LYS A 508 ? 0.2969 0.2953 0.1701 0.0374  -0.0197 -0.0339 505  LYS A O   
4346 C  CB  A LYS A 508 ? 0.3205 0.3210 0.2315 0.0143  -0.0242 -0.0136 505  LYS A CB  
4347 C  CB  B LYS A 508 ? 0.2504 0.2451 0.1451 0.0235  -0.0257 -0.0262 505  LYS A CB  
4348 C  CG  A LYS A 508 ? 0.3221 0.3229 0.2444 0.0101  -0.0225 -0.0100 505  LYS A CG  
4349 C  CG  B LYS A 508 ? 0.2449 0.2397 0.1520 0.0179  -0.0247 -0.0215 505  LYS A CG  
4350 C  CD  A LYS A 508 ? 0.3439 0.3474 0.2701 0.0075  -0.0232 -0.0053 505  LYS A CD  
4351 C  CD  B LYS A 508 ? 0.2812 0.2794 0.1905 0.0153  -0.0254 -0.0166 505  LYS A CD  
4352 C  CE  A LYS A 508 ? 0.3345 0.3405 0.2689 0.0056  -0.0187 -0.0009 505  LYS A CE  
4353 C  CE  B LYS A 508 ? 0.2889 0.2879 0.2095 0.0107  -0.0237 -0.0122 505  LYS A CE  
4354 N  NZ  A LYS A 508 ? 0.2343 0.2427 0.1724 0.0037  -0.0192 0.0033  505  LYS A NZ  
4355 N  NZ  B LYS A 508 ? 0.3194 0.3199 0.2425 0.0082  -0.0264 -0.0092 505  LYS A NZ  
4356 N  N   A LYS A 509 ? 0.3440 0.3387 0.2329 0.0249  -0.0281 -0.0274 506  LYS A N   
4357 N  N   B LYS A 509 ? 0.2959 0.2825 0.1688 0.0344  -0.0325 -0.0419 506  LYS A N   
4358 C  CA  A LYS A 509 ? 0.3661 0.3615 0.2420 0.0305  -0.0291 -0.0314 506  LYS A CA  
4359 C  CA  B LYS A 509 ? 0.3067 0.2929 0.1657 0.0407  -0.0345 -0.0474 506  LYS A CA  
4360 C  C   A LYS A 509 ? 0.3639 0.3566 0.2350 0.0351  -0.0282 -0.0373 506  LYS A C   
4361 C  C   B LYS A 509 ? 0.3055 0.2912 0.1598 0.0464  -0.0313 -0.0519 506  LYS A C   
4362 O  O   A LYS A 509 ? 0.3872 0.3808 0.2465 0.0408  -0.0285 -0.0411 506  LYS A O   
4363 O  O   B LYS A 509 ? 0.3130 0.3040 0.1567 0.0525  -0.0274 -0.0527 506  LYS A O   
4364 C  CB  A LYS A 509 ? 0.3758 0.3674 0.2471 0.0299  -0.0371 -0.0348 506  LYS A CB  
4365 C  CB  B LYS A 509 ? 0.3257 0.3041 0.1819 0.0399  -0.0442 -0.0536 506  LYS A CB  
4366 C  CG  A LYS A 509 ? 0.4046 0.3998 0.2799 0.0261  -0.0379 -0.0288 506  LYS A CG  
4367 C  CG  B LYS A 509 ? 0.3915 0.3684 0.2331 0.0462  -0.0480 -0.0602 506  LYS A CG  
4368 C  CD  A LYS A 509 ? 0.4940 0.4861 0.3651 0.0256  -0.0459 -0.0319 506  LYS A CD  
4369 C  CD  B LYS A 509 ? 0.4494 0.4187 0.2915 0.0437  -0.0582 -0.0650 506  LYS A CD  
4370 C  CE  A LYS A 509 ? 0.5360 0.5335 0.4062 0.0245  -0.0456 -0.0260 506  LYS A CE  
4371 C  CE  B LYS A 509 ? 0.4519 0.4234 0.3034 0.0369  -0.0597 -0.0585 506  LYS A CE  
4372 N  NZ  A LYS A 509 ? 0.5552 0.5526 0.4380 0.0186  -0.0472 -0.0219 506  LYS A NZ  
4373 N  NZ  B LYS A 509 ? 0.4893 0.4537 0.3517 0.0313  -0.0664 -0.0600 506  LYS A NZ  
4374 N  N   A LEU A 510 ? 0.3454 0.3349 0.2249 0.0332  -0.0271 -0.0381 507  LEU A N   
4375 N  N   B LEU A 510 ? 0.3057 0.2851 0.1673 0.0448  -0.0332 -0.0552 507  LEU A N   
4376 C  CA  A LEU A 510 ? 0.3626 0.3486 0.2385 0.0376  -0.0270 -0.0442 507  LEU A CA  
4377 C  CA  B LEU A 510 ? 0.2976 0.2759 0.1557 0.0502  -0.0308 -0.0600 507  LEU A CA  
4378 C  C   A LEU A 510 ? 0.3823 0.3753 0.2555 0.0418  -0.0190 -0.0417 507  LEU A C   
4379 C  C   B LEU A 510 ? 0.2952 0.2819 0.1571 0.0511  -0.0216 -0.0539 507  LEU A C   
4380 O  O   A LEU A 510 ? 0.3764 0.3759 0.2546 0.0398  -0.0135 -0.0347 507  LEU A O   
4381 O  O   B LEU A 510 ? 0.3227 0.3119 0.1802 0.0566  -0.0177 -0.0563 507  LEU A O   
4382 C  CB  A LEU A 510 ? 0.3372 0.3172 0.2236 0.0341  -0.0289 -0.0456 507  LEU A CB  
4383 C  CB  B LEU A 510 ? 0.2980 0.2679 0.1638 0.0480  -0.0349 -0.0638 507  LEU A CB  
4384 C  CG  A LEU A 510 ? 0.3426 0.3151 0.2343 0.0296  -0.0366 -0.0479 507  LEU A CG  
4385 C  CG  B LEU A 510 ? 0.3045 0.2645 0.1731 0.0452  -0.0441 -0.0689 507  LEU A CG  
4386 C  CD1 A LEU A 510 ? 0.3133 0.2823 0.2159 0.0263  -0.0364 -0.0472 507  LEU A CD1 
4387 C  CD1 B LEU A 510 ? 0.2045 0.1624 0.0818 0.0449  -0.0409 -0.0688 507  LEU A CD1 
4388 C  CD2 A LEU A 510 ? 0.3508 0.3168 0.2343 0.0328  -0.0436 -0.0557 507  LEU A CD2 
4389 C  CD2 B LEU A 510 ? 0.3261 0.2808 0.1821 0.0507  -0.0505 -0.0775 507  LEU A CD2 
4390 N  N   A GLY A 511 ? 0.3955 0.3872 0.2622 0.0475  -0.0185 -0.0473 508  GLY A N   
4391 N  N   B GLY A 511 ? 0.2924 0.2835 0.1627 0.0458  -0.0184 -0.0463 508  GLY A N   
4392 C  CA  A GLY A 511 ? 0.4174 0.4157 0.2840 0.0513  -0.0108 -0.0450 508  GLY A CA  
4393 C  CA  B GLY A 511 ? 0.2911 0.2903 0.1666 0.0457  -0.0102 -0.0397 508  GLY A CA  
4394 C  C   A GLY A 511 ? 0.4234 0.4315 0.2831 0.0545  -0.0050 -0.0399 508  GLY A C   
4395 C  C   B GLY A 511 ? 0.3225 0.3302 0.1886 0.0504  -0.0053 -0.0368 508  GLY A C   
4396 O  O   A GLY A 511 ? 0.4287 0.4434 0.2886 0.0577  0.0016  -0.0374 508  GLY A O   
4397 O  O   B GLY A 511 ? 0.3009 0.3146 0.1657 0.0543  0.0008  -0.0353 508  GLY A O   
4398 N  N   A LYS A 512 ? 0.4367 0.4463 0.2910 0.0535  -0.0073 -0.0378 509  LYS A N   
4399 N  N   B LYS A 512 ? 0.3430 0.3514 0.2020 0.0504  -0.0082 -0.0361 509  LYS A N   
4400 C  CA  A LYS A 512 ? 0.4404 0.4582 0.2843 0.0583  -0.0032 -0.0349 509  LYS A CA  
4401 C  CA  B LYS A 512 ? 0.3697 0.3857 0.2177 0.0556  -0.0044 -0.0341 509  LYS A CA  
4402 C  C   A LYS A 512 ? 0.4454 0.4622 0.2785 0.0660  -0.0033 -0.0425 509  LYS A C   
4403 C  C   B LYS A 512 ? 0.3755 0.3914 0.2123 0.0636  -0.0039 -0.0411 509  LYS A C   
4404 O  O   A LYS A 512 ? 0.4322 0.4566 0.2599 0.0715  0.0031  -0.0410 509  LYS A O   
4405 O  O   B LYS A 512 ? 0.3824 0.4065 0.2132 0.0687  0.0024  -0.0387 509  LYS A O   
4406 C  CB  A LYS A 512 ? 0.4488 0.4666 0.2867 0.0569  -0.0074 -0.0334 509  LYS A CB  
4407 C  CB  B LYS A 512 ? 0.3797 0.3957 0.2216 0.0544  -0.0086 -0.0328 509  LYS A CB  
4408 C  CG  A LYS A 512 ? 0.4513 0.4706 0.2999 0.0498  -0.0071 -0.0257 509  LYS A CG  
4409 C  CG  B LYS A 512 ? 0.4327 0.4583 0.2686 0.0570  -0.0032 -0.0262 509  LYS A CG  
4410 C  CD  A LYS A 512 ? 0.5055 0.5241 0.3484 0.0487  -0.0122 -0.0248 509  LYS A CD  
4411 C  CD  B LYS A 512 ? 0.4782 0.5053 0.2981 0.0636  -0.0052 -0.0306 509  LYS A CD  
4412 C  CE  A LYS A 512 ? 0.4821 0.4995 0.3368 0.0416  -0.0138 -0.0196 509  LYS A CE  
4413 C  CE  B LYS A 512 ? 0.5038 0.5254 0.3195 0.0615  -0.0135 -0.0335 509  LYS A CE  
4414 N  NZ  A LYS A 512 ? 0.5279 0.5451 0.3786 0.0402  -0.0187 -0.0182 509  LYS A NZ  
4415 N  NZ  B LYS A 512 ? 0.5226 0.5424 0.3227 0.0681  -0.0176 -0.0408 509  LYS A NZ  
4416 N  N   A ASN A 513 ? 0.4455 0.4527 0.2760 0.0665  -0.0107 -0.0508 510  ASN A N   
4417 N  N   B ASN A 513 ? 0.3932 0.4000 0.2273 0.0647  -0.0105 -0.0497 510  ASN A N   
4418 C  CA  A ASN A 513 ? 0.4611 0.4655 0.2819 0.0738  -0.0119 -0.0592 510  ASN A CA  
4419 C  CA  B ASN A 513 ? 0.4234 0.4283 0.2461 0.0727  -0.0115 -0.0579 510  ASN A CA  
4420 C  C   . ASN A 513 ? 0.4355 0.4428 0.2623 0.0762  -0.0058 -0.0588 510  ASN A C   
4421 O  O   . ASN A 513 ? 0.4222 0.4342 0.2405 0.0836  -0.0017 -0.0614 510  ASN A O   
4422 C  CB  A ASN A 513 ? 0.4783 0.4706 0.2979 0.0729  -0.0219 -0.0680 510  ASN A CB  
4423 C  CB  B ASN A 513 ? 0.4363 0.4293 0.2576 0.0717  -0.0214 -0.0665 510  ASN A CB  
4424 C  CG  A ASN A 513 ? 0.5360 0.5257 0.3476 0.0722  -0.0287 -0.0698 510  ASN A CG  
4425 C  CG  B ASN A 513 ? 0.4655 0.4550 0.2737 0.0800  -0.0244 -0.0760 510  ASN A CG  
4426 O  OD1 A ASN A 513 ? 0.5565 0.5534 0.3606 0.0739  -0.0262 -0.0658 510  ASN A OD1 
4427 O  OD1 B ASN A 513 ? 0.5014 0.4906 0.2973 0.0836  -0.0282 -0.0795 510  ASN A OD1 
4428 N  ND2 A ASN A 513 ? 0.6046 0.5840 0.4185 0.0695  -0.0378 -0.0758 510  ASN A ND2 
4429 N  ND2 B ASN A 513 ? 0.5250 0.5113 0.3354 0.0833  -0.0232 -0.0806 510  ASN A ND2 
4430 N  N   . ILE A 514 ? 0.4193 0.4239 0.2600 0.0705  -0.0052 -0.0560 511  ILE A N   
4431 C  CA  . ILE A 514 ? 0.4075 0.4149 0.2541 0.0726  0.0001  -0.0556 511  ILE A CA  
4432 C  C   . ILE A 514 ? 0.3801 0.4001 0.2273 0.0747  0.0095  -0.0478 511  ILE A C   
4433 O  O   . ILE A 514 ? 0.3795 0.4046 0.2247 0.0804  0.0145  -0.0489 511  ILE A O   
4434 C  CB  . ILE A 514 ? 0.3992 0.4001 0.2603 0.0661  -0.0023 -0.0547 511  ILE A CB  
4435 C  CG1 . ILE A 514 ? 0.4552 0.4442 0.3144 0.0667  -0.0106 -0.0637 511  ILE A CG1 
4436 C  CG2 . ILE A 514 ? 0.3703 0.3767 0.2395 0.0672  0.0045  -0.0515 511  ILE A CG2 
4437 C  CD1 . ILE A 514 ? 0.4590 0.4413 0.3313 0.0603  -0.0138 -0.0626 511  ILE A CD1 
4438 N  N   . LEU A 515 ? 0.3879 0.4131 0.2383 0.0703  0.0116  -0.0400 512  LEU A N   
4439 C  CA  . LEU A 515 ? 0.4126 0.4495 0.2637 0.0720  0.0200  -0.0322 512  LEU A CA  
4440 C  C   . LEU A 515 ? 0.4327 0.4758 0.2695 0.0804  0.0229  -0.0345 512  LEU A C   
4441 O  O   . LEU A 515 ? 0.4259 0.4775 0.2626 0.0848  0.0298  -0.0317 512  LEU A O   
4442 C  CB  . LEU A 515 ? 0.4193 0.4598 0.2752 0.0662  0.0208  -0.0237 512  LEU A CB  
4443 C  CG  . LEU A 515 ? 0.4319 0.4709 0.3031 0.0590  0.0213  -0.0189 512  LEU A CG  
4444 C  CD1 . LEU A 515 ? 0.5098 0.5485 0.3846 0.0531  0.0193  -0.0131 512  LEU A CD1 
4445 C  CD2 . LEU A 515 ? 0.4188 0.4661 0.2982 0.0599  0.0290  -0.0134 512  LEU A CD2 
4446 N  N   . LYS A 516 ? 0.4519 0.4909 0.2763 0.0830  0.0176  -0.0396 513  LYS A N   
4447 C  CA  A LYS A 516 ? 0.4766 0.5213 0.2854 0.0918  0.0199  -0.0425 513  LYS A CA  
4448 C  CA  B LYS A 516 ? 0.4686 0.5132 0.2773 0.0918  0.0198  -0.0426 513  LYS A CA  
4449 C  C   . LYS A 516 ? 0.4807 0.5249 0.2863 0.0988  0.0217  -0.0495 513  LYS A C   
4450 O  O   . LYS A 516 ? 0.4946 0.5484 0.2946 0.1054  0.0286  -0.0478 513  LYS A O   
4451 C  CB  A LYS A 516 ? 0.5039 0.5427 0.3000 0.0934  0.0123  -0.0482 513  LYS A CB  
4452 C  CB  B LYS A 516 ? 0.4878 0.5263 0.2840 0.0933  0.0121  -0.0484 513  LYS A CB  
4453 C  CG  A LYS A 516 ? 0.5200 0.5626 0.3149 0.0893  0.0118  -0.0410 513  LYS A CG  
4454 C  CG  B LYS A 516 ? 0.4903 0.5363 0.2693 0.1014  0.0145  -0.0491 513  LYS A CG  
4455 C  CD  A LYS A 516 ? 0.5816 0.6179 0.3642 0.0909  0.0034  -0.0473 513  LYS A CD  
4456 C  CD  B LYS A 516 ? 0.5182 0.5614 0.2900 0.0991  0.0083  -0.0488 513  LYS A CD  
4457 C  CE  A LYS A 516 ? 0.6163 0.6579 0.3956 0.0885  0.0036  -0.0399 513  LYS A CE  
4458 C  CE  B LYS A 516 ? 0.5359 0.5888 0.2925 0.1056  0.0119  -0.0459 513  LYS A CE  
4459 N  NZ  A LYS A 516 ? 0.6293 0.6690 0.4240 0.0792  0.0029  -0.0332 513  LYS A NZ  
4460 N  NZ  B LYS A 516 ? 0.5419 0.5898 0.2815 0.1123  0.0052  -0.0559 513  LYS A NZ  
4461 N  N   . ALA A 517 ? 0.4603 0.4934 0.2700 0.0974  0.0157  -0.0571 514  ALA A N   
4462 C  CA  . ALA A 517 ? 0.4568 0.4877 0.2660 0.1032  0.0166  -0.0638 514  ALA A CA  
4463 C  C   . ALA A 517 ? 0.4572 0.4969 0.2766 0.1037  0.0251  -0.0578 514  ALA A C   
4464 O  O   . ALA A 517 ? 0.4697 0.5138 0.2851 0.1110  0.0292  -0.0608 514  ALA A O   
4465 C  CB  . ALA A 517 ? 0.4552 0.4720 0.2698 0.1000  0.0080  -0.0713 514  ALA A CB  
4466 N  N   . MET A 518 ? 0.4338 0.4754 0.2672 0.0959  0.0272  -0.0498 515  MET A N   
4467 C  CA  . MET A 518 ? 0.4293 0.4794 0.2736 0.0954  0.0347  -0.0434 515  MET A CA  
4468 C  C   . MET A 518 ? 0.4669 0.5312 0.3061 0.1003  0.0432  -0.0371 515  MET A C   
4469 O  O   . MET A 518 ? 0.4971 0.5694 0.3415 0.1035  0.0497  -0.0343 515  MET A O   
4470 C  CB  . MET A 518 ? 0.4132 0.4621 0.2724 0.0858  0.0344  -0.0363 515  MET A CB  
4471 C  CG  . MET A 518 ? 0.3613 0.3986 0.2286 0.0810  0.0279  -0.0409 515  MET A CG  
4472 S  SD  . MET A 518 ? 0.3772 0.4126 0.2596 0.0704  0.0267  -0.0334 515  MET A SD  
4473 C  CE  . MET A 518 ? 0.4456 0.4867 0.3415 0.0698  0.0325  -0.0292 515  MET A CE  
4474 N  N   . ASN A 519 ? 0.4974 0.5651 0.3270 0.1010  0.0432  -0.0343 516  ASN A N   
4475 C  CA  . ASN A 519 ? 0.5153 0.5971 0.3405 0.1051  0.0514  -0.0267 516  ASN A CA  
4476 C  C   . ASN A 519 ? 0.5617 0.6482 0.3698 0.1157  0.0534  -0.0323 516  ASN A C   
4477 O  O   . ASN A 519 ? 0.5733 0.6728 0.3775 0.1205  0.0612  -0.0264 516  ASN A O   
4478 C  CB  . ASN A 519 ? 0.5256 0.6104 0.3535 0.0988  0.0515  -0.0178 516  ASN A CB  
4479 C  CG  . ASN A 519 ? 0.4817 0.5661 0.3283 0.0898  0.0527  -0.0104 516  ASN A CG  
4480 O  OD1 . ASN A 519 ? 0.5014 0.5928 0.3576 0.0900  0.0585  -0.0059 516  ASN A OD1 
4481 N  ND2 . ASN A 519 ? 0.5397 0.6158 0.3916 0.0825  0.0467  -0.0101 516  ASN A ND2 
4482 N  N   . ASP A 520 ? 0.5720 0.6482 0.3704 0.1196  0.0465  -0.0437 517  ASP A N   
4483 C  CA  . ASP A 520 ? 0.6096 0.6887 0.3905 0.1304  0.0474  -0.0507 517  ASP A CA  
4484 C  C   . ASP A 520 ? 0.6127 0.6790 0.3888 0.1341  0.0399  -0.0639 517  ASP A C   
4485 O  O   . ASP A 520 ? 0.6133 0.6683 0.3843 0.1319  0.0309  -0.0701 517  ASP A O   
4486 C  CB  . ASP A 520 ? 0.6188 0.7001 0.3858 0.1317  0.0454  -0.0493 517  ASP A CB  
4487 C  CG  . ASP A 520 ? 0.6558 0.7409 0.4032 0.1433  0.0462  -0.0564 517  ASP A CG  
4488 O  OD1 . ASP A 520 ? 0.7357 0.8218 0.4700 0.1454  0.0436  -0.0567 517  ASP A OD1 
4489 O  OD2 . ASP A 520 ? 0.6854 0.7725 0.4308 0.1505  0.0493  -0.0617 517  ASP A OD2 
4490 N  N   . ASP A 521 ? 0.6364 0.7047 0.4150 0.1398  0.0434  -0.0676 518  ASP A N   
4491 C  CA  . ASP A 521 ? 0.6623 0.7185 0.4377 0.1438  0.0368  -0.0798 518  ASP A CA  
4492 C  C   . ASP A 521 ? 0.6934 0.7468 0.4488 0.1537  0.0331  -0.0901 518  ASP A C   
4493 O  O   . ASP A 521 ? 0.7119 0.7547 0.4639 0.1577  0.0269  -0.1008 518  ASP A O   
4494 C  CB  . ASP A 521 ? 0.6629 0.7222 0.4488 0.1466  0.0418  -0.0801 518  ASP A CB  
4495 C  CG  . ASP A 521 ? 0.7101 0.7843 0.4895 0.1565  0.0516  -0.0781 518  ASP A CG  
4496 O  OD1 . ASP A 521 ? 0.7433 0.8243 0.5077 0.1627  0.0540  -0.0783 518  ASP A OD1 
4497 O  OD2 . ASP A 521 ? 0.7542 0.8336 0.5437 0.1581  0.0570  -0.0760 518  ASP A OD2 
4498 N  N   . SER A 522 ? 0.7016 0.7642 0.4442 0.1577  0.0364  -0.0867 519  SER A N   
4499 C  CA  . SER A 522 ? 0.7260 0.7860 0.4484 0.1665  0.0322  -0.0959 519  SER A CA  
4500 C  C   . SER A 522 ? 0.7244 0.7753 0.4418 0.1608  0.0228  -0.0977 519  SER A C   
4501 O  O   . SER A 522 ? 0.7319 0.7790 0.4327 0.1668  0.0175  -0.1056 519  SER A O   
4502 C  CB  . SER A 522 ? 0.7363 0.8131 0.4462 0.1754  0.0418  -0.0912 519  SER A CB  
4503 O  OG  . SER A 522 ? 0.7332 0.8170 0.4401 0.1711  0.0436  -0.0819 519  SER A OG  
4504 N  N   . SER A 523 ? 0.6950 0.7423 0.4263 0.1494  0.0207  -0.0907 520  SER A N   
4505 C  CA  . SER A 523 ? 0.6941 0.7345 0.4222 0.1437  0.0128  -0.0908 520  SER A CA  
4506 C  C   . SER A 523 ? 0.7106 0.7347 0.4369 0.1431  0.0011  -0.1025 520  SER A C   
4507 O  O   . SER A 523 ? 0.7213 0.7381 0.4541 0.1439  -0.0009 -0.1084 520  SER A O   
4508 C  CB  . SER A 523 ? 0.6765 0.7180 0.4207 0.1322  0.0140  -0.0801 520  SER A CB  
4509 O  OG  . SER A 523 ? 0.6394 0.6747 0.4003 0.1262  0.0132  -0.0799 520  SER A OG  
4510 N  N   . ASP A 524 ? 0.7151 0.7334 0.4340 0.1409  -0.0068 -0.1052 521  ASP A N   
4511 C  CA  . ASP A 524 ? 0.7151 0.7176 0.4354 0.1379  -0.0188 -0.1145 521  ASP A CA  
4512 C  C   . ASP A 524 ? 0.6780 0.6737 0.4184 0.1276  -0.0206 -0.1107 521  ASP A C   
4513 O  O   . ASP A 524 ? 0.6812 0.6657 0.4272 0.1266  -0.0268 -0.1177 521  ASP A O   
4514 C  CB  . ASP A 524 ? 0.7282 0.7279 0.4403 0.1354  -0.0261 -0.1151 521  ASP A CB  
4515 C  CG  . ASP A 524 ? 0.7701 0.7732 0.4605 0.1459  -0.0274 -0.1216 521  ASP A CG  
4516 O  OD1 . ASP A 524 ? 0.8003 0.8091 0.4810 0.1556  -0.0218 -0.1252 521  ASP A OD1 
4517 O  OD2 . ASP A 524 ? 0.8190 0.8190 0.5023 0.1443  -0.0343 -0.1230 521  ASP A OD2 
4518 N  N   . GLU A 525 ? 0.6480 0.6507 0.3989 0.1203  -0.0154 -0.0995 522  GLU A N   
4519 C  CA  . GLU A 525 ? 0.6082 0.6067 0.3777 0.1109  -0.0158 -0.0946 522  GLU A CA  
4520 C  C   . GLU A 525 ? 0.5903 0.5859 0.3680 0.1128  -0.0134 -0.0977 522  GLU A C   
4521 O  O   . GLU A 525 ? 0.5760 0.5617 0.3641 0.1077  -0.0189 -0.1002 522  GLU A O   
4522 C  CB  . GLU A 525 ? 0.5942 0.6031 0.3719 0.1052  -0.0083 -0.0820 522  GLU A CB  
4523 C  CG  . GLU A 525 ? 0.6088 0.6188 0.3840 0.1004  -0.0117 -0.0774 522  GLU A CG  
4524 C  CD  . GLU A 525 ? 0.6668 0.6837 0.4247 0.1071  -0.0105 -0.0777 522  GLU A CD  
4525 O  OE1 . GLU A 525 ? 0.6559 0.6799 0.4037 0.1156  -0.0049 -0.0793 522  GLU A OE1 
4526 O  OE2 . GLU A 525 ? 0.6945 0.7100 0.4493 0.1038  -0.0153 -0.0760 522  GLU A OE2 
4527 N  N   . TYR A 526 ? 0.5675 0.5722 0.3413 0.1197  -0.0052 -0.0967 523  TYR A N   
4528 C  CA  . TYR A 526 ? 0.5578 0.5610 0.3391 0.1222  -0.0025 -0.0993 523  TYR A CA  
4529 C  C   . TYR A 526 ? 0.5656 0.5566 0.3408 0.1276  -0.0103 -0.1119 523  TYR A C   
4530 O  O   . TYR A 526 ? 0.5508 0.5335 0.3359 0.1254  -0.0136 -0.1151 523  TYR A O   
4531 C  CB  . TYR A 526 ? 0.5579 0.5749 0.3361 0.1290  0.0083  -0.0952 523  TYR A CB  
4532 C  CG  . TYR A 526 ? 0.5820 0.5990 0.3696 0.1312  0.0119  -0.0965 523  TYR A CG  
4533 C  CD1 . TYR A 526 ? 0.5623 0.5839 0.3658 0.1248  0.0170  -0.0879 523  TYR A CD1 
4534 C  CD2 . TYR A 526 ? 0.6281 0.6405 0.4086 0.1400  0.0100  -0.1066 523  TYR A CD2 
4535 C  CE1 . TYR A 526 ? 0.5838 0.6058 0.3963 0.1268  0.0200  -0.0889 523  TYR A CE1 
4536 C  CE2 . TYR A 526 ? 0.6469 0.6595 0.4365 0.1422  0.0132  -0.1077 523  TYR A CE2 
4537 C  CZ  . TYR A 526 ? 0.6102 0.6280 0.4156 0.1356  0.0183  -0.0986 523  TYR A CZ  
4538 O  OH  . TYR A 526 ? 0.6334 0.6515 0.4483 0.1376  0.0211  -0.0995 523  TYR A OH  
4539 N  N   . GLN A 527 ? 0.5757 0.5658 0.3342 0.1351  -0.0136 -0.1191 524  GLN A N   
4540 C  CA  A GLN A 527 ? 0.5952 0.5734 0.3467 0.1409  -0.0217 -0.1318 524  GLN A CA  
4541 C  CA  B GLN A 527 ? 0.5899 0.5682 0.3412 0.1410  -0.0218 -0.1318 524  GLN A CA  
4542 C  C   . GLN A 527 ? 0.5757 0.5388 0.3358 0.1331  -0.0328 -0.1355 524  GLN A C   
4543 O  O   . GLN A 527 ? 0.6030 0.5555 0.3666 0.1348  -0.0384 -0.1431 524  GLN A O   
4544 C  CB  A GLN A 527 ? 0.6200 0.6002 0.3507 0.1504  -0.0237 -0.1389 524  GLN A CB  
4545 C  CB  B GLN A 527 ? 0.6099 0.5903 0.3407 0.1499  -0.0238 -0.1384 524  GLN A CB  
4546 C  CG  A GLN A 527 ? 0.6545 0.6409 0.3748 0.1625  -0.0178 -0.1442 524  GLN A CG  
4547 C  CG  B GLN A 527 ? 0.6257 0.5922 0.3477 0.1549  -0.0347 -0.1520 524  GLN A CG  
4548 C  CD  A GLN A 527 ? 0.6651 0.6656 0.3932 0.1633  -0.0052 -0.1348 524  GLN A CD  
4549 C  CD  B GLN A 527 ? 0.6384 0.6089 0.3393 0.1648  -0.0355 -0.1582 524  GLN A CD  
4550 O  OE1 A GLN A 527 ? 0.6851 0.6852 0.4186 0.1673  -0.0022 -0.1376 524  GLN A OE1 
4551 O  OE1 B GLN A 527 ? 0.6287 0.5949 0.3218 0.1632  -0.0428 -0.1608 524  GLN A OE1 
4552 N  NE2 A GLN A 527 ? 0.6392 0.6522 0.3684 0.1597  0.0020  -0.1236 524  GLN A NE2 
4553 N  NE2 B GLN A 527 ? 0.6467 0.6265 0.3382 0.1751  -0.0275 -0.1599 524  GLN A NE2 
4554 N  N   . ASN A 528 ? 0.5666 0.5293 0.3310 0.1248  -0.0358 -0.1297 525  ASN A N   
4555 C  CA  . ASN A 528 ? 0.5559 0.5060 0.3287 0.1169  -0.0462 -0.1320 525  ASN A CA  
4556 C  C   . ASN A 528 ? 0.5278 0.4747 0.3194 0.1083  -0.0453 -0.1261 525  ASN A C   
4557 O  O   . ASN A 528 ? 0.5141 0.4516 0.3143 0.1014  -0.0530 -0.1268 525  ASN A O   
4558 C  CB  . ASN A 528 ? 0.5732 0.5252 0.3422 0.1121  -0.0495 -0.1281 525  ASN A CB  
4559 C  CG  . ASN A 528 ? 0.6303 0.5826 0.3801 0.1201  -0.0534 -0.1355 525  ASN A CG  
4560 O  OD1 . ASN A 528 ? 0.7024 0.6503 0.4421 0.1287  -0.0559 -0.1452 525  ASN A OD1 
4561 N  ND2 . ASN A 528 ? 0.7180 0.6758 0.4624 0.1177  -0.0537 -0.1307 525  ASN A ND2 
4562 N  N   . LEU A 529 ? 0.5061 0.4618 0.3044 0.1083  -0.0358 -0.1196 526  LEU A N   
4563 C  CA  . LEU A 529 ? 0.4600 0.4133 0.2754 0.1008  -0.0348 -0.1141 526  LEU A CA  
4564 C  C   . LEU A 529 ? 0.4532 0.3938 0.2742 0.1014  -0.0416 -0.1216 526  LEU A C   
4565 O  O   . LEU A 529 ? 0.4713 0.4078 0.2845 0.1096  -0.0436 -0.1302 526  LEU A O   
4566 C  CB  . LEU A 529 ? 0.4413 0.4060 0.2626 0.1018  -0.0239 -0.1069 526  LEU A CB  
4567 C  CG  . LEU A 529 ? 0.4362 0.4142 0.2562 0.1001  -0.0159 -0.0975 526  LEU A CG  
4568 C  CD1 . LEU A 529 ? 0.4631 0.4517 0.2888 0.1024  -0.0059 -0.0918 526  LEU A CD1 
4569 C  CD2 . LEU A 529 ? 0.4268 0.4039 0.2549 0.0904  -0.0182 -0.0906 526  LEU A CD2 
4570 N  N   . ASP A 530 ? 0.4233 0.3582 0.2584 0.0929  -0.0450 -0.1176 527  ASP A N   
4571 C  CA  . ASP A 530 ? 0.4039 0.3289 0.2474 0.0927  -0.0491 -0.1218 527  ASP A CA  
4572 C  C   . ASP A 530 ? 0.3960 0.3286 0.2433 0.0967  -0.0402 -0.1190 527  ASP A C   
4573 O  O   . ASP A 530 ? 0.3872 0.3316 0.2352 0.0962  -0.0317 -0.1119 527  ASP A O   
4574 C  CB  . ASP A 530 ? 0.3793 0.2983 0.2371 0.0828  -0.0536 -0.1168 527  ASP A CB  
4575 C  CG  . ASP A 530 ? 0.3659 0.2945 0.2329 0.0771  -0.0458 -0.1064 527  ASP A CG  
4576 O  OD1 . ASP A 530 ? 0.3558 0.2918 0.2207 0.0740  -0.0427 -0.1008 527  ASP A OD1 
4577 O  OD2 . ASP A 530 ? 0.3604 0.2896 0.2362 0.0767  -0.0424 -0.1040 527  ASP A OD2 
4578 N  N   . ASP A 531 ? 0.3926 0.3184 0.2422 0.1010  -0.0424 -0.1249 528  ASP A N   
4579 C  CA  . ASP A 531 ? 0.3880 0.3215 0.2405 0.1060  -0.0341 -0.1230 528  ASP A CA  
4580 C  C   . ASP A 531 ? 0.3719 0.3106 0.2390 0.0989  -0.0290 -0.1134 528  ASP A C   
4581 O  O   . ASP A 531 ? 0.3613 0.3094 0.2304 0.1019  -0.0212 -0.1098 528  ASP A O   
4582 C  CB  . ASP A 531 ? 0.3978 0.3227 0.2488 0.1132  -0.0378 -0.1322 528  ASP A CB  
4583 C  CG  . ASP A 531 ? 0.4357 0.3703 0.2840 0.1216  -0.0292 -0.1326 528  ASP A CG  
4584 O  OD1 . ASP A 531 ? 0.4694 0.4155 0.3087 0.1260  -0.0222 -0.1306 528  ASP A OD1 
4585 O  OD2 . ASP A 531 ? 0.4614 0.3921 0.3171 0.1238  -0.0294 -0.1346 528  ASP A OD2 
4586 N  N   . SER A 532 ? 0.3540 0.2871 0.2308 0.0900  -0.0335 -0.1092 529  SER A N   
4587 C  CA  . SER A 532 ? 0.3382 0.2763 0.2276 0.0836  -0.0290 -0.1004 529  SER A CA  
4588 C  C   . SER A 532 ? 0.3353 0.2863 0.2223 0.0821  -0.0214 -0.0932 529  SER A C   
4589 O  O   . SER A 532 ? 0.3301 0.2903 0.2214 0.0830  -0.0139 -0.0882 529  SER A O   
4590 C  CB  . SER A 532 ? 0.3149 0.2450 0.2138 0.0750  -0.0353 -0.0977 529  SER A CB  
4591 O  OG  . SER A 532 ? 0.3084 0.2450 0.2175 0.0687  -0.0306 -0.0886 529  SER A OG  
4592 N  N   . THR A 533 ? 0.3224 0.2743 0.2027 0.0799  -0.0234 -0.0926 530  THR A N   
4593 C  CA  . THR A 533 ? 0.3077 0.2711 0.1855 0.0788  -0.0166 -0.0858 530  THR A CA  
4594 C  C   . THR A 533 ? 0.3383 0.3114 0.2087 0.0870  -0.0092 -0.0865 530  THR A C   
4595 O  O   . THR A 533 ? 0.3321 0.3157 0.2063 0.0864  -0.0017 -0.0796 530  THR A O   
4596 C  CB  . THR A 533 ? 0.3149 0.2771 0.1853 0.0763  -0.0207 -0.0859 530  THR A CB  
4597 O  OG1 . THR A 533 ? 0.3192 0.2727 0.1967 0.0692  -0.0278 -0.0856 530  THR A OG1 
4598 C  CG2 . THR A 533 ? 0.3379 0.3113 0.2069 0.0743  -0.0143 -0.0781 530  THR A CG2 
4599 N  N   . ARG A 534 ? 0.3487 0.3185 0.2083 0.0951  -0.0113 -0.0948 531  ARG A N   
4600 C  CA  . ARG A 534 ? 0.3704 0.3502 0.2225 0.1036  -0.0040 -0.0956 531  ARG A CA  
4601 C  C   . ARG A 534 ? 0.3682 0.3541 0.2300 0.1051  0.0025  -0.0921 531  ARG A C   
4602 O  O   . ARG A 534 ? 0.3524 0.3505 0.2145 0.1072  0.0107  -0.0865 531  ARG A O   
4603 C  CB  . ARG A 534 ? 0.3827 0.3565 0.2219 0.1126  -0.0081 -0.1065 531  ARG A CB  
4604 C  CG  . ARG A 534 ? 0.4267 0.4116 0.2559 0.1228  -0.0003 -0.1078 531  ARG A CG  
4605 C  CD  . ARG A 534 ? 0.4679 0.4467 0.2834 0.1326  -0.0047 -0.1195 531  ARG A CD  
4606 N  NE  . ARG A 534 ? 0.4905 0.4643 0.2949 0.1319  -0.0111 -0.1231 531  ARG A NE  
4607 C  CZ  . ARG A 534 ? 0.5141 0.4741 0.3184 0.1287  -0.0216 -0.1294 531  ARG A CZ  
4608 N  NH1 . ARG A 534 ? 0.5032 0.4519 0.3171 0.1262  -0.0274 -0.1331 531  ARG A NH1 
4609 N  NH2 . ARG A 534 ? 0.5224 0.4799 0.3168 0.1281  -0.0267 -0.1318 531  ARG A NH2 
4610 N  N   . GLN A 535 ? 0.3635 0.3412 0.2341 0.1037  -0.0013 -0.0948 532  GLN A N   
4611 C  CA  . GLN A 535 ? 0.3697 0.3529 0.2496 0.1054  0.0043  -0.0919 532  GLN A CA  
4612 C  C   . GLN A 535 ? 0.3503 0.3404 0.2420 0.0975  0.0086  -0.0815 532  GLN A C   
4613 O  O   . GLN A 535 ? 0.3737 0.3734 0.2713 0.0992  0.0155  -0.0770 532  GLN A O   
4614 C  CB  . GLN A 535 ? 0.3788 0.3511 0.2639 0.1071  -0.0011 -0.0979 532  GLN A CB  
4615 C  CG  . GLN A 535 ? 0.4010 0.3664 0.2751 0.1158  -0.0053 -0.1086 532  GLN A CG  
4616 C  CD  . GLN A 535 ? 0.4717 0.4477 0.3356 0.1255  0.0018  -0.1107 532  GLN A CD  
4617 O  OE1 . GLN A 535 ? 0.4633 0.4505 0.3322 0.1279  0.0097  -0.1059 532  GLN A OE1 
4618 N  NE2 . GLN A 535 ? 0.5118 0.4849 0.3614 0.1314  -0.0013 -0.1180 532  GLN A NE2 
4619 N  N   . LEU A 536 ? 0.3292 0.3151 0.2247 0.0891  0.0048  -0.0778 533  LEU A N   
4620 C  CA  . LEU A 536 ? 0.3074 0.3002 0.2125 0.0821  0.0087  -0.0685 533  LEU A CA  
4621 C  C   . LEU A 536 ? 0.3278 0.3332 0.2287 0.0841  0.0161  -0.0631 533  LEU A C   
4622 O  O   . LEU A 536 ? 0.3299 0.3442 0.2386 0.0829  0.0221  -0.0568 533  LEU A O   
4623 C  CB  . LEU A 536 ? 0.2854 0.2713 0.1941 0.0737  0.0031  -0.0662 533  LEU A CB  
4624 C  CG  . LEU A 536 ? 0.2788 0.2544 0.1956 0.0699  -0.0030 -0.0683 533  LEU A CG  
4625 C  CD1 . LEU A 536 ? 0.2887 0.2569 0.2060 0.0634  -0.0094 -0.0679 533  LEU A CD1 
4626 C  CD2 . LEU A 536 ? 0.2770 0.2568 0.2060 0.0668  0.0007  -0.0626 533  LEU A CD2 
4627 N  N   . ILE A 537 ? 0.3457 0.3522 0.2345 0.0872  0.0156  -0.0655 534  ILE A N   
4628 C  CA  . ILE A 537 ? 0.3699 0.3887 0.2538 0.0896  0.0226  -0.0601 534  ILE A CA  
4629 C  C   . ILE A 537 ? 0.3926 0.4206 0.2770 0.0969  0.0297  -0.0599 534  ILE A C   
4630 O  O   . ILE A 537 ? 0.3851 0.4245 0.2745 0.0964  0.0367  -0.0524 534  ILE A O   
4631 C  CB  . ILE A 537 ? 0.4017 0.4191 0.2710 0.0928  0.0201  -0.0639 534  ILE A CB  
4632 C  CG1 . ILE A 537 ? 0.3987 0.4105 0.2695 0.0850  0.0147  -0.0615 534  ILE A CG1 
4633 C  CG2 . ILE A 537 ? 0.4073 0.4377 0.2685 0.0987  0.0277  -0.0603 534  ILE A CG2 
4634 C  CD1 . ILE A 537 ? 0.4604 0.4680 0.3168 0.0882  0.0098  -0.0672 534  ILE A CD1 
4635 N  N   . ALA A 538 ? 0.4096 0.4330 0.2893 0.1039  0.0278  -0.0681 535  ALA A N   
4636 C  CA  . ALA A 538 ? 0.4238 0.4562 0.3037 0.1115  0.0345  -0.0684 535  ALA A CA  
4637 C  C   . ALA A 538 ? 0.4317 0.4695 0.3273 0.1076  0.0385  -0.0617 535  ALA A C   
4638 O  O   . ALA A 538 ? 0.4490 0.4989 0.3482 0.1103  0.0460  -0.0564 535  ALA A O   
4639 C  CB  . ALA A 538 ? 0.4203 0.4447 0.2934 0.1195  0.0307  -0.0792 535  ALA A CB  
4640 N  N   . LYS A 539 ? 0.4458 0.4746 0.3507 0.1011  0.0333  -0.0617 536  LYS A N   
4641 C  CA  . LYS A 539 ? 0.4567 0.4895 0.3765 0.0970  0.0360  -0.0558 536  LYS A CA  
4642 C  C   . LYS A 539 ? 0.4771 0.5194 0.4039 0.0911  0.0407  -0.0459 536  LYS A C   
4643 O  O   . LYS A 539 ? 0.4820 0.5322 0.4193 0.0906  0.0453  -0.0408 536  LYS A O   
4644 C  CB  . LYS A 539 ? 0.4431 0.4638 0.3696 0.0920  0.0289  -0.0586 536  LYS A CB  
4645 C  CG  . LYS A 539 ? 0.5064 0.5214 0.4310 0.0988  0.0266  -0.0663 536  LYS A CG  
4646 C  CD  . LYS A 539 ? 0.5136 0.5160 0.4424 0.0953  0.0192  -0.0700 536  LYS A CD  
4647 C  CE  . LYS A 539 ? 0.5483 0.5452 0.4751 0.1030  0.0171  -0.0778 536  LYS A CE  
4648 N  NZ  . LYS A 539 ? 0.5810 0.5879 0.5115 0.1096  0.0238  -0.0769 536  LYS A NZ  
4649 N  N   . VAL A 540 ? 0.4873 0.5290 0.4092 0.0869  0.0394  -0.0432 537  VAL A N   
4650 C  CA  . VAL A 540 ? 0.4954 0.5458 0.4233 0.0817  0.0437  -0.0338 537  VAL A CA  
4651 C  C   . VAL A 540 ? 0.5609 0.6239 0.4834 0.0866  0.0510  -0.0295 537  VAL A C   
4652 O  O   . VAL A 540 ? 0.5564 0.6268 0.4838 0.0826  0.0546  -0.0214 537  VAL A O   
4653 C  CB  . VAL A 540 ? 0.4763 0.5205 0.4041 0.0740  0.0390  -0.0315 537  VAL A CB  
4654 C  CG1 . VAL A 540 ? 0.4022 0.4341 0.3336 0.0698  0.0317  -0.0359 537  VAL A CG1 
4655 C  CG2 . VAL A 540 ? 0.4968 0.5410 0.4119 0.0756  0.0382  -0.0327 537  VAL A CG2 
4656 N  N   . LYS A 541 ? 0.6061 0.6712 0.5186 0.0952  0.0529  -0.0350 538  LYS A N   
4657 C  CA  A LYS A 541 ? 0.6389 0.7173 0.5464 0.1015  0.0607  -0.0315 538  LYS A CA  
4658 C  CA  B LYS A 541 ? 0.6376 0.7161 0.5451 0.1015  0.0607  -0.0314 538  LYS A CA  
4659 C  C   . LYS A 541 ? 0.6514 0.7383 0.5690 0.1049  0.0662  -0.0291 538  LYS A C   
4660 O  O   . LYS A 541 ? 0.6736 0.7732 0.5975 0.1049  0.0730  -0.0210 538  LYS A O   
4661 C  CB  A LYS A 541 ? 0.6525 0.7289 0.5431 0.1100  0.0597  -0.0394 538  LYS A CB  
4662 C  CB  B LYS A 541 ? 0.6522 0.7291 0.5426 0.1101  0.0599  -0.0392 538  LYS A CB  
4663 C  CG  A LYS A 541 ? 0.6598 0.7304 0.5393 0.1079  0.0551  -0.0412 538  LYS A CG  
4664 C  CG  B LYS A 541 ? 0.6598 0.7385 0.5388 0.1097  0.0598  -0.0371 538  LYS A CG  
4665 C  CD  A LYS A 541 ? 0.6609 0.7434 0.5346 0.1093  0.0611  -0.0339 538  LYS A CD  
4666 C  CD  B LYS A 541 ? 0.6664 0.7545 0.5317 0.1197  0.0651  -0.0389 538  LYS A CD  
4667 C  CE  A LYS A 541 ? 0.6541 0.7311 0.5186 0.1060  0.0562  -0.0343 538  LYS A CE  
4668 C  CE  B LYS A 541 ? 0.6798 0.7601 0.5337 0.1278  0.0610  -0.0510 538  LYS A CE  
4669 N  NZ  A LYS A 541 ? 0.6183 0.6815 0.4741 0.1072  0.0476  -0.0449 538  LYS A NZ  
4670 N  NZ  B LYS A 541 ? 0.6930 0.7829 0.5327 0.1384  0.0665  -0.0530 538  LYS A NZ  
4671 N  N   . ASN A 542 ? 0.6723 0.7522 0.5922 0.1077  0.0629  -0.0360 539  ASN A N   
4672 C  CA  . ASN A 542 ? 0.6934 0.7803 0.6228 0.1116  0.0674  -0.0349 539  ASN A CA  
4673 C  C   . ASN A 542 ? 0.6800 0.7617 0.6243 0.1041  0.0639  -0.0324 539  ASN A C   
4674 O  O   . ASN A 542 ? 0.6877 0.7640 0.6365 0.1059  0.0611  -0.0371 539  ASN A O   
4675 C  CB  . ASN A 542 ? 0.7142 0.7977 0.6354 0.1213  0.0666  -0.0446 539  ASN A CB  
4676 C  CG  . ASN A 542 ? 0.7620 0.8462 0.6652 0.1286  0.0673  -0.0499 539  ASN A CG  
4677 O  OD1 . ASN A 542 ? 0.8148 0.9118 0.7131 0.1335  0.0745  -0.0458 539  ASN A OD1 
4678 N  ND2 . ASN A 542 ? 0.7891 0.8597 0.6825 0.1296  0.0596  -0.0589 539  ASN A ND2 
4679 C  C1  . 6PG B .   ? 0.2300 0.2358 0.2079 -0.0105 -0.0257 0.0062  601  6PG A C1  
4680 C  C2  . 6PG B .   ? 0.2128 0.2162 0.1827 -0.0085 -0.0263 0.0034  601  6PG A C2  
4681 C  C3  . 6PG B .   ? 0.1984 0.2020 0.1651 -0.0063 -0.0218 0.0034  601  6PG A C3  
4682 C  C4  . 6PG B .   ? 0.1801 0.1869 0.1451 -0.0050 -0.0193 0.0067  601  6PG A C4  
4683 C  C5  . 6PG B .   ? 0.1708 0.1781 0.1319 -0.0027 -0.0154 0.0068  601  6PG A C5  
4684 C  C6  . 6PG B .   ? 0.1834 0.1941 0.1440 -0.0017 -0.0128 0.0109  601  6PG A C6  
4685 O  O1A . 6PG B .   ? 0.2672 0.2758 0.2474 -0.0110 -0.0268 0.0084  601  6PG A O1A 
4686 O  O1  . 6PG B .   ? 0.2719 0.2769 0.2537 -0.0115 -0.0246 0.0059  601  6PG A O1  
4687 O  O2  . 6PG B .   ? 0.2728 0.2771 0.2381 -0.0077 -0.0292 0.0035  601  6PG A O2  
4688 O  O3  . 6PG B .   ? 0.2004 0.2036 0.1721 -0.0071 -0.0189 0.0038  601  6PG A O3  
4689 O  O4  . 6PG B .   ? 0.1887 0.1974 0.1603 -0.0063 -0.0178 0.0097  601  6PG A O4  
4690 O  O5  . 6PG B .   ? 0.2121 0.2178 0.1656 -0.0007 -0.0169 0.0034  601  6PG A O5  
4691 O  O6  . 6PG B .   ? 0.1963 0.2080 0.1519 -0.0009 -0.0154 0.0117  601  6PG A O6  
4692 P  P   . 6PG B .   ? 0.1906 0.2056 0.1462 -0.0002 -0.0137 0.0167  601  6PG A P   
4693 O  O1P . 6PG B .   ? 0.1821 0.1974 0.1462 -0.0022 -0.0134 0.0191  601  6PG A O1P 
4694 O  O2P . 6PG B .   ? 0.1981 0.2150 0.1513 0.0016  -0.0093 0.0184  601  6PG A O2P 
4695 O  O3P . 6PG B .   ? 0.2093 0.2251 0.1585 0.0008  -0.0173 0.0163  601  6PG A O3P 
4696 O  O1  . MES C .   ? 0.2085 0.3109 0.3018 -0.0032 -0.0574 0.0571  602  MES A O1  
4697 C  C2  . MES C .   ? 0.1836 0.2946 0.2873 -0.0005 -0.0571 0.0603  602  MES A C2  
4698 C  C3  . MES C .   ? 0.2117 0.3311 0.3251 -0.0003 -0.0529 0.0619  602  MES A C3  
4699 N  N4  . MES C .   ? 0.3074 0.4269 0.4221 -0.0056 -0.0551 0.0619  602  MES A N4  
4700 C  C5  . MES C .   ? 0.2811 0.3908 0.3849 -0.0087 -0.0568 0.0584  602  MES A C5  
4701 C  C6  . MES C .   ? 0.2457 0.3483 0.3401 -0.0079 -0.0603 0.0566  602  MES A C6  
4702 C  C7  . MES C .   ? 0.3365 0.4651 0.4625 -0.0078 -0.0544 0.0651  602  MES A C7  
4703 C  C8  . MES C .   ? 0.3606 0.5006 0.4986 -0.0048 -0.0530 0.0692  602  MES A C8  
4704 S  S   . MES C .   ? 0.3650 0.5157 0.5146 -0.0064 -0.0495 0.0731  602  MES A S   
4705 O  O1S . MES C .   ? 0.3961 0.5478 0.5511 -0.0127 -0.0546 0.0749  602  MES A O1S 
4706 O  O2S . MES C .   ? 0.2248 0.3859 0.3845 -0.0027 -0.0484 0.0765  602  MES A O2S 
4707 O  O3S . MES C .   ? 0.3097 0.4581 0.4539 -0.0051 -0.0431 0.0712  602  MES A O3S 
4708 O  O1  . MES D .   ? 0.4819 0.4477 0.5423 0.0064  -0.0411 -0.0162 603  MES A O1  
4709 C  C2  . MES D .   ? 0.4627 0.4252 0.5202 0.0105  -0.0451 -0.0228 603  MES A C2  
4710 C  C3  . MES D .   ? 0.3939 0.3618 0.4411 0.0129  -0.0419 -0.0248 603  MES A C3  
4711 N  N4  . MES D .   ? 0.4043 0.3752 0.4509 0.0104  -0.0406 -0.0234 603  MES A N4  
4712 C  C5  . MES D .   ? 0.4666 0.4379 0.5202 0.0057  -0.0398 -0.0186 603  MES A C5  
4713 C  C6  . MES D .   ? 0.4759 0.4450 0.5366 0.0036  -0.0395 -0.0143 603  MES A C6  
4714 C  C7  . MES D .   ? 0.3349 0.3098 0.3724 0.0129  -0.0390 -0.0260 603  MES A C7  
4715 C  C8  . MES D .   ? 0.2986 0.2754 0.3352 0.0116  -0.0394 -0.0263 603  MES A C8  
4716 S  S   . MES D .   ? 0.2714 0.2542 0.2978 0.0137  -0.0355 -0.0263 603  MES A S   
4717 O  O1S . MES D .   ? 0.3207 0.3031 0.3417 0.0186  -0.0368 -0.0307 603  MES A O1S 
4718 O  O2S . MES D .   ? 0.3134 0.2971 0.3378 0.0138  -0.0371 -0.0279 603  MES A O2S 
4719 O  O3S . MES D .   ? 0.2306 0.2173 0.2554 0.0119  -0.0305 -0.0217 603  MES A O3S 
4720 P  P   . PO4 E .   ? 0.5049 0.6143 0.4807 0.0532  0.0210  0.0155  604  PO4 A P   
4721 O  O1  . PO4 E .   ? 0.4836 0.5876 0.4508 0.0553  0.0186  0.0109  604  PO4 A O1  
4722 O  O2  . PO4 E .   ? 0.4525 0.5569 0.4298 0.0558  0.0191  0.0095  604  PO4 A O2  
4723 O  O3  . PO4 E .   ? 0.4809 0.5886 0.4647 0.0453  0.0206  0.0212  604  PO4 A O3  
4724 O  O4  . PO4 E .   ? 0.4575 0.5811 0.4323 0.0578  0.0262  0.0206  604  PO4 A O4  
4725 C  C1  . IPA F .   ? 0.2040 0.2775 0.2129 0.0363  0.0074  0.0074  605  IPA A C1  
4726 C  C2  . IPA F .   ? 0.2731 0.3576 0.2856 0.0370  0.0107  0.0127  605  IPA A C2  
4727 C  C3  . IPA F .   ? 0.2869 0.3745 0.3066 0.0328  0.0108  0.0177  605  IPA A C3  
4728 O  O2  . IPA F .   ? 0.2809 0.3702 0.2904 0.0438  0.0126  0.0101  605  IPA A O2  
4729 CA CA  . CA  G .   ? 0.1973 0.3739 0.4395 -0.0680 -0.0505 0.1290  606  CA  A CA  
4730 O  O   . HOH H .   ? 0.3921 0.4025 0.3762 0.0467  -0.0238 -0.0383 541  HOH A O   
4731 O  O   . HOH H .   ? 0.5195 0.6193 0.6865 -0.0617 -0.0891 0.0709  542  HOH A O   
4732 O  O   . HOH H .   ? 0.2611 0.2761 0.2714 0.0456  -0.0164 -0.0250 543  HOH A O   
4733 O  O   . HOH H .   ? 0.4557 0.4947 0.4724 0.0497  -0.0069 -0.0141 544  HOH A O   
4734 O  O   . HOH H .   ? 0.5658 0.5679 0.5720 -0.0051 -0.0117 0.0062  545  HOH A O   
4735 O  O   . HOH H .   ? 0.4222 0.4518 0.4612 0.0418  -0.0130 -0.0021 546  HOH A O   
4736 O  O   . HOH H .   ? 0.5588 0.6101 0.4635 0.0591  -0.0354 -0.0188 547  HOH A O   
4737 O  O   . HOH H .   ? 0.4204 0.3876 0.4742 0.0015  -0.0608 0.1057  548  HOH A O   
4738 O  O   . HOH H .   ? 0.4447 0.5006 0.6238 -0.0396 0.0179  0.1851  549  HOH A O   
4739 O  O   . HOH H .   ? 0.5597 0.5979 0.5009 0.0782  -0.0189 -0.0513 550  HOH A O   
4740 O  O   . HOH H .   ? 0.3482 0.4847 0.4743 0.0374  -0.0214 0.0551  551  HOH A O   
4741 O  O   . HOH H .   ? 0.4925 0.5616 0.3924 0.0796  0.0509  -0.0178 552  HOH A O   
4742 O  O   . HOH H .   ? 0.3771 0.5898 0.6096 -0.0452 -0.0248 0.1310  553  HOH A O   
4743 O  O   . HOH H .   ? 0.4175 0.5713 0.5575 0.0298  -0.0234 0.0632  554  HOH A O   
4744 O  O   . HOH H .   ? 0.1998 0.2270 0.1833 0.0356  -0.0121 -0.0203 555  HOH A O   
4745 O  O   . HOH H .   ? 0.2223 0.2593 0.2633 -0.0220 -0.0166 0.0982  556  HOH A O   
4746 O  O   . HOH H .   ? 0.2189 0.2575 0.2814 -0.0379 -0.0513 0.0340  557  HOH A O   
4747 O  O   . HOH H .   ? 0.2411 0.3233 0.3092 0.0041  -0.0243 0.0415  558  HOH A O   
4748 O  O   . HOH H .   ? 0.2902 0.2885 0.3106 0.0415  -0.0237 -0.0264 559  HOH A O   
4749 O  O   . HOH H .   ? 0.2948 0.2874 0.4071 -0.0640 -0.0746 0.0524  560  HOH A O   
4750 O  O   . HOH H .   ? 0.4890 0.4993 0.3757 0.0331  -0.0078 -0.0196 561  HOH A O   
4751 O  O   . HOH H .   ? 0.3388 0.5231 0.5420 -0.0449 -0.0252 0.1182  562  HOH A O   
4752 O  O   . HOH H .   ? 0.5731 0.6640 0.5861 0.0583  0.0121  0.0013  563  HOH A O   
4753 O  O   . HOH H .   ? 0.2908 0.4719 0.3916 -0.0066 0.0268  0.1111  564  HOH A O   
4754 O  O   . HOH H .   ? 0.3582 0.3640 0.3628 -0.0041 -0.0106 0.0051  565  HOH A O   
4755 O  O   . HOH H .   ? 0.4419 0.4563 0.3612 0.0097  -0.0201 0.0062  566  HOH A O   
4756 O  O   . HOH H .   ? 0.4533 0.4553 0.4011 -0.0027 -0.0318 -0.0014 567  HOH A O   
4757 O  O   . HOH H .   ? 0.4246 0.5857 0.5013 0.0271  0.0231  0.0597  568  HOH A O   
4758 O  O   . HOH H .   ? 0.3734 0.3679 0.4071 -0.0025 -0.0158 0.0001  569  HOH A O   
4759 O  O   . HOH H .   ? 0.3512 0.3625 0.3685 -0.0064 0.0036  0.0151  570  HOH A O   
4760 O  O   . HOH H .   ? 0.2556 0.4671 0.4337 -0.0268 0.0105  0.1320  571  HOH A O   
4761 O  O   . HOH H .   ? 0.3288 0.3655 0.3848 0.0243  -0.0226 0.0295  572  HOH A O   
4762 O  O   . HOH H .   ? 0.2707 0.4673 0.5117 -0.0602 -0.0338 0.1376  573  HOH A O   
4763 O  O   . HOH H .   ? 0.3967 0.5483 0.6249 -0.0707 -0.0637 0.1145  574  HOH A O   
4764 O  O   . HOH H .   ? 0.5679 0.6290 0.6497 -0.0404 -0.0916 0.0369  575  HOH A O   
4765 O  O   . HOH H .   ? 0.4087 0.3608 0.5799 -0.0280 -0.0478 0.0577  576  HOH A O   
4766 O  O   . HOH H .   ? 0.3805 0.5025 0.4392 0.0436  0.0130  0.0297  577  HOH A O   
4767 O  O   . HOH H .   ? 0.5387 0.7366 0.7004 -0.0102 0.0029  0.1015  578  HOH A O   
4768 O  O   . HOH H .   ? 0.5502 0.4749 0.6343 -0.0562 -0.1123 0.0046  579  HOH A O   
4769 O  O   . HOH H .   ? 0.5278 0.5404 0.4842 -0.0060 -0.0403 0.0092  580  HOH A O   
4770 O  O   . HOH H .   ? 0.2060 0.2259 0.2736 -0.0412 -0.0333 0.0529  581  HOH A O   
4771 O  O   . HOH H .   ? 0.5656 0.6667 0.6379 -0.0031 0.0548  0.1076  582  HOH A O   
4772 O  O   . HOH H .   ? 0.4584 0.4122 0.5909 -0.0779 -0.1376 0.0224  583  HOH A O   
4773 O  O   . HOH H .   ? 0.6166 0.5697 0.7420 -0.0765 -0.1473 0.0137  584  HOH A O   
4774 O  O   . HOH H .   ? 0.2881 0.3029 0.2796 0.0359  -0.0177 -0.0262 585  HOH A O   
4775 O  O   . HOH H .   ? 0.2604 0.2752 0.3746 -0.0622 -0.0629 0.0619  586  HOH A O   
4776 O  O   . HOH H .   ? 0.2394 0.2877 0.2625 -0.0136 -0.0104 0.0902  587  HOH A O   
4777 O  O   . HOH H .   ? 0.2569 0.2869 0.3127 -0.0388 -0.0624 0.0273  588  HOH A O   
4778 O  O   . HOH H .   ? 0.2022 0.2798 0.2663 -0.0041 -0.0301 0.0417  589  HOH A O   
4779 O  O   . HOH H .   ? 0.2701 0.3711 0.3152 0.0456  0.0093  0.0186  590  HOH A O   
4780 O  O   . HOH H .   ? 0.2055 0.1634 0.2609 -0.0247 -0.0444 0.0489  591  HOH A O   
4781 O  O   . HOH H .   ? 0.2493 0.4184 0.4630 -0.0566 -0.0425 0.1160  592  HOH A O   
4782 O  O   . HOH H .   ? 0.1776 0.1873 0.1824 0.0198  -0.0153 -0.0145 593  HOH A O   
4783 O  O   . HOH H .   ? 0.1696 0.2025 0.1841 -0.0144 -0.0332 0.0235  594  HOH A O   
4784 O  O   . HOH H .   ? 0.1584 0.1676 0.1666 -0.0016 -0.0080 0.0023  595  HOH A O   
4785 O  O   . HOH H .   ? 0.2875 0.2550 0.4632 -0.0329 -0.0371 0.0774  596  HOH A O   
4786 O  O   . HOH H .   ? 0.2064 0.2440 0.2499 0.0278  -0.0127 0.0132  597  HOH A O   
4787 O  O   . HOH H .   ? 0.1659 0.2247 0.2124 -0.0137 -0.0305 0.0344  598  HOH A O   
4788 O  O   . HOH H .   ? 0.1915 0.2571 0.2593 0.0247  -0.0219 0.0353  599  HOH A O   
4789 O  O   . HOH H .   ? 0.2019 0.2282 0.2033 -0.0173 -0.0499 0.0183  600  HOH A O   
4790 O  O   . HOH H .   ? 0.2523 0.2462 0.2602 -0.0115 -0.0149 0.0088  607  HOH A O   
4791 O  O   . HOH H .   ? 0.2306 0.2769 0.2768 0.0219  -0.0134 0.0209  608  HOH A O   
4792 O  O   . HOH H .   ? 0.1829 0.1983 0.2306 -0.0356 -0.0379 0.0306  609  HOH A O   
4793 O  O   . HOH H .   ? 0.1760 0.2148 0.1722 0.0059  0.0245  0.0299  610  HOH A O   
4794 O  O   . HOH H .   ? 0.2104 0.2321 0.2516 -0.0252 -0.0189 0.0680  611  HOH A O   
4795 O  O   . HOH H .   ? 0.1775 0.2396 0.2310 -0.0207 -0.0521 0.0372  612  HOH A O   
4796 O  O   . HOH H .   ? 0.1711 0.2256 0.2172 -0.0187 -0.0245 0.0336  613  HOH A O   
4797 O  O   . HOH H .   ? 0.1706 0.2310 0.2252 0.0103  -0.0268 0.0384  614  HOH A O   
4798 O  O   . HOH H .   ? 0.2040 0.1989 0.2334 -0.0310 -0.0403 0.0164  615  HOH A O   
4799 O  O   . HOH H .   ? 0.2144 0.3411 0.2753 0.0329  0.0137  0.0380  616  HOH A O   
4800 O  O   . HOH H .   ? 0.1927 0.2191 0.2005 -0.0177 -0.0411 0.0191  617  HOH A O   
4801 O  O   . HOH H .   ? 0.1735 0.2862 0.2048 -0.0033 0.0162  0.0853  618  HOH A O   
4802 O  O   . HOH H .   ? 0.2216 0.2563 0.1948 0.0288  -0.0103 -0.0103 619  HOH A O   
4803 O  O   . HOH H .   ? 0.2216 0.2044 0.2633 -0.0112 -0.0404 0.0806  620  HOH A O   
4804 O  O   . HOH H .   ? 0.1582 0.1973 0.2116 0.0009  0.0182  0.0212  621  HOH A O   
4805 O  O   . HOH H .   ? 0.1887 0.2121 0.1624 0.0027  0.0095  0.0240  622  HOH A O   
4806 O  O   . HOH H .   ? 0.2808 0.2884 0.2050 0.0151  -0.0081 -0.0069 623  HOH A O   
4807 O  O   . HOH H .   ? 0.2532 0.2499 0.2474 -0.0106 -0.0131 0.0020  624  HOH A O   
4808 O  O   . HOH H .   ? 0.1698 0.2456 0.2269 0.0077  -0.0138 0.0343  625  HOH A O   
4809 O  O   . HOH H .   ? 0.1784 0.1959 0.1439 0.0001  -0.0029 0.0216  626  HOH A O   
4810 O  O   . HOH H .   ? 0.2222 0.2105 0.2741 -0.0287 -0.0332 0.0619  627  HOH A O   
4811 O  O   . HOH H .   ? 0.2394 0.2171 0.2209 -0.0206 -0.0701 -0.0141 628  HOH A O   
4812 O  O   . HOH H .   ? 0.2038 0.2247 0.2014 -0.0017 -0.0104 0.0205  629  HOH A O   
4813 O  O   . HOH H .   ? 0.2179 0.2287 0.2506 0.0063  -0.0183 0.0298  630  HOH A O   
4814 O  O   . HOH H .   ? 0.1753 0.1878 0.1789 -0.0059 0.0021  0.0226  631  HOH A O   
4815 O  O   . HOH H .   ? 0.2037 0.2871 0.1913 0.0128  0.0096  0.0506  632  HOH A O   
4816 O  O   . HOH H .   ? 0.1867 0.1924 0.1723 -0.0049 -0.0037 0.0068  633  HOH A O   
4817 O  O   . HOH H .   ? 0.2130 0.2519 0.2586 -0.0263 -0.0137 0.0752  634  HOH A O   
4818 O  O   . HOH H .   ? 0.2110 0.2155 0.2770 -0.0417 -0.0379 0.0501  635  HOH A O   
4819 O  O   . HOH H .   ? 0.1818 0.2320 0.1699 0.0225  0.0351  0.0169  636  HOH A O   
4820 O  O   . HOH H .   ? 0.2626 0.2163 0.2634 -0.0286 -0.0916 -0.0221 637  HOH A O   
4821 O  O   . HOH H .   ? 0.1907 0.2134 0.2152 -0.0022 0.0124  0.0170  638  HOH A O   
4822 O  O   . HOH H .   ? 0.2133 0.2403 0.2273 0.0388  -0.0100 -0.0133 639  HOH A O   
4823 O  O   . HOH H .   ? 0.2040 0.2574 0.2611 0.0175  -0.0256 0.0371  640  HOH A O   
4824 O  O   . HOH H .   ? 0.2292 0.2550 0.2572 0.0053  -0.0226 0.0354  641  HOH A O   
4825 O  O   . HOH H .   ? 0.1971 0.2781 0.2414 0.0383  0.0020  0.0160  642  HOH A O   
4826 O  O   . HOH H .   ? 0.1882 0.2523 0.2489 -0.0282 -0.0108 0.0629  643  HOH A O   
4827 O  O   . HOH H .   ? 0.2095 0.2253 0.2775 -0.0429 -0.0396 0.0459  644  HOH A O   
4828 O  O   . HOH H .   ? 0.1846 0.2826 0.1982 0.0014  0.0131  0.0732  645  HOH A O   
4829 O  O   . HOH H .   ? 0.2088 0.2352 0.2540 -0.0310 -0.0258 0.0366  646  HOH A O   
4830 O  O   . HOH H .   ? 0.2843 0.2431 0.1856 0.0575  -0.0218 -0.0718 647  HOH A O   
4831 O  O   . HOH H .   ? 0.2706 0.2402 0.3378 0.0157  -0.0327 0.0119  648  HOH A O   
4832 O  O   . HOH H .   ? 0.2090 0.2256 0.2076 -0.0177 -0.0391 0.0132  649  HOH A O   
4833 O  O   . HOH H .   ? 0.3858 0.5354 0.4457 0.0323  0.0239  0.0504  650  HOH A O   
4834 O  O   . HOH H .   ? 0.1888 0.1967 0.2041 -0.0051 -0.0069 0.0292  651  HOH A O   
4835 O  O   . HOH H .   ? 0.2286 0.2474 0.2114 -0.0129 -0.0448 0.0141  652  HOH A O   
4836 O  O   . HOH H .   ? 0.2061 0.2131 0.2563 -0.0373 -0.0393 0.0320  653  HOH A O   
4837 O  O   . HOH H .   ? 0.2045 0.2161 0.2084 -0.0059 -0.0079 0.0078  654  HOH A O   
4838 O  O   . HOH H .   ? 0.2558 0.2415 0.2870 -0.0394 -0.0872 0.0013  655  HOH A O   
4839 O  O   . HOH H .   ? 0.1893 0.2748 0.2184 -0.0117 0.0052  0.0913  656  HOH A O   
4840 O  O   . HOH H .   ? 0.2168 0.2068 0.3010 -0.0530 -0.0625 0.0414  657  HOH A O   
4841 O  O   . HOH H .   ? 0.2670 0.2855 0.2655 0.0485  -0.0160 -0.0296 658  HOH A O   
4842 O  O   . HOH H .   ? 0.3640 0.3980 0.3410 -0.0022 -0.0456 0.0363  659  HOH A O   
4843 O  O   . HOH H .   ? 0.2001 0.2052 0.2362 -0.0307 -0.0314 0.0265  660  HOH A O   
4844 O  O   . HOH H .   ? 0.2307 0.2414 0.2130 -0.0132 -0.0355 0.0090  661  HOH A O   
4845 O  O   . HOH H .   ? 0.2747 0.2957 0.4181 -0.0742 -0.0914 0.0586  662  HOH A O   
4846 O  O   . HOH H .   ? 0.3860 0.4777 0.3656 0.0221  0.0550  0.0694  663  HOH A O   
4847 O  O   . HOH H .   ? 0.2032 0.2892 0.2870 0.0168  -0.0428 0.0542  664  HOH A O   
4848 O  O   . HOH H .   ? 0.2071 0.2538 0.1803 0.0251  -0.0039 0.0027  665  HOH A O   
4849 O  O   . HOH H .   ? 0.2093 0.1728 0.3377 -0.0173 -0.0326 0.0686  666  HOH A O   
4850 O  O   . HOH H .   ? 0.2293 0.2457 0.2566 0.0046  -0.0200 0.0355  667  HOH A O   
4851 O  O   . HOH H .   ? 0.2704 0.3107 0.2731 -0.0127 -0.0610 0.0283  668  HOH A O   
4852 O  O   . HOH H .   ? 0.1745 0.2136 0.2122 -0.0236 -0.0296 0.0284  669  HOH A O   
4853 O  O   . HOH H .   ? 0.2185 0.2294 0.2237 -0.0054 0.0033  0.0144  670  HOH A O   
4854 O  O   . HOH H .   ? 0.2052 0.2340 0.2352 0.0056  -0.0194 0.0291  671  HOH A O   
4855 O  O   . HOH H .   ? 0.2267 0.2403 0.2848 -0.0332 -0.0260 0.0744  672  HOH A O   
4856 O  O   . HOH H .   ? 0.2736 0.2696 0.2047 0.0117  -0.0157 -0.0150 673  HOH A O   
4857 O  O   . HOH H .   ? 0.3325 0.2884 0.2411 0.0851  -0.0128 -0.0889 674  HOH A O   
4858 O  O   . HOH H .   ? 0.2372 0.2851 0.2974 -0.0324 -0.0167 0.0614  675  HOH A O   
4859 O  O   . HOH H .   ? 0.3190 0.5191 0.4076 0.0059  0.0384  0.1144  676  HOH A O   
4860 O  O   . HOH H .   ? 0.3224 0.3108 0.2354 0.0248  -0.0168 -0.0311 677  HOH A O   
4861 O  O   . HOH H .   ? 0.2052 0.2214 0.1897 0.0239  -0.0188 -0.0188 678  HOH A O   
4862 O  O   . HOH H .   ? 0.2502 0.2296 0.2555 -0.0312 -0.0887 -0.0097 679  HOH A O   
4863 O  O   . HOH H .   ? 0.3044 0.2363 0.3621 -0.0487 -0.1125 -0.0092 680  HOH A O   
4864 O  O   . HOH H .   ? 0.2234 0.2327 0.2500 0.0025  -0.0151 0.0267  681  HOH A O   
4865 O  O   . HOH H .   ? 0.2412 0.2494 0.2769 -0.0092 -0.0006 0.0189  682  HOH A O   
4866 O  O   . HOH H .   ? 0.1843 0.2738 0.2553 0.0090  -0.0164 0.0403  683  HOH A O   
4867 O  O   . HOH H .   ? 0.2421 0.2439 0.2275 -0.0071 -0.0091 0.0036  684  HOH A O   
4868 O  O   . HOH H .   ? 0.2162 0.2532 0.3187 -0.0544 -0.0536 0.0570  685  HOH A O   
4869 O  O   . HOH H .   ? 0.2441 0.2482 0.4058 -0.0344 -0.0101 0.1246  686  HOH A O   
4870 O  O   . HOH H .   ? 0.3864 0.4093 0.3725 0.0080  -0.0216 0.0317  687  HOH A O   
4871 O  O   . HOH H .   ? 0.2826 0.2327 0.3705 -0.0442 -0.0602 0.0594  688  HOH A O   
4872 O  O   . HOH H .   ? 0.2778 0.2707 0.3335 0.0030  -0.0246 0.0667  689  HOH A O   
4873 O  O   . HOH H .   ? 0.2734 0.5059 0.2963 0.0317  0.0611  0.1408  690  HOH A O   
4874 O  O   . HOH H .   ? 0.3407 0.3383 0.3284 -0.0070 -0.0095 0.0003  691  HOH A O   
4875 O  O   . HOH H .   ? 0.4619 0.6143 0.4020 0.0397  0.0263  0.1055  692  HOH A O   
4876 O  O   . HOH H .   ? 0.2354 0.2553 0.2657 -0.0070 0.0092  0.0254  693  HOH A O   
4877 O  O   . HOH H .   ? 0.2435 0.4239 0.3240 0.0192  0.0310  0.0800  694  HOH A O   
4878 O  O   . HOH H .   ? 0.2047 0.3212 0.3103 0.0064  -0.0338 0.0562  695  HOH A O   
4879 O  O   . HOH H .   ? 0.3747 0.4480 0.5591 -0.0788 -0.0968 0.0767  696  HOH A O   
4880 O  O   . HOH H .   ? 0.2396 0.3031 0.2914 -0.0253 -0.0062 0.0734  697  HOH A O   
4881 O  O   . HOH H .   ? 0.2285 0.2077 0.2760 0.0254  -0.0296 -0.0087 698  HOH A O   
4882 O  O   . HOH H .   ? 0.2886 0.2981 0.4270 -0.0734 -0.0879 0.0587  699  HOH A O   
4883 O  O   . HOH H .   ? 0.2476 0.3989 0.3768 -0.0168 -0.0081 0.0819  700  HOH A O   
4884 O  O   . HOH H .   ? 0.2375 0.2530 0.2478 -0.0035 0.0080  0.0148  701  HOH A O   
4885 O  O   . HOH H .   ? 0.2872 0.3108 0.2321 0.0569  -0.0303 -0.0448 702  HOH A O   
4886 O  O   . HOH H .   ? 0.2843 0.2977 0.1949 0.0181  -0.0095 -0.0029 703  HOH A O   
4887 O  O   . HOH H .   ? 0.2886 0.3181 0.3213 -0.0234 -0.0171 0.0324  704  HOH A O   
4888 O  O   . HOH H .   ? 0.1710 0.1887 0.1757 -0.0084 -0.0132 0.0157  705  HOH A O   
4889 O  O   . HOH H .   ? 0.2679 0.3832 0.3308 -0.0239 0.0084  0.1546  706  HOH A O   
4890 O  O   . HOH H .   ? 0.2423 0.3235 0.2933 -0.0051 -0.0833 0.0546  707  HOH A O   
4891 O  O   . HOH H .   ? 0.2961 0.2661 0.4180 -0.0686 -0.0890 0.0490  708  HOH A O   
4892 O  O   . HOH H .   ? 0.2409 0.2333 0.1982 -0.0112 -0.0604 -0.0101 709  HOH A O   
4893 O  O   . HOH H .   ? 0.3736 0.4018 0.4184 0.0223  -0.0169 0.0184  710  HOH A O   
4894 O  O   . HOH H .   ? 0.3448 0.3506 0.4008 0.0161  -0.0341 0.0598  711  HOH A O   
4895 O  O   . HOH H .   ? 0.2316 0.2660 0.2673 -0.0233 -0.0131 0.0451  712  HOH A O   
4896 O  O   . HOH H .   ? 0.3576 0.5567 0.5437 -0.0374 0.0013  0.1342  713  HOH A O   
4897 O  O   . HOH H .   ? 0.3355 0.3423 0.4589 -0.0262 -0.0082 0.0683  714  HOH A O   
4898 O  O   . HOH H .   ? 0.1947 0.2520 0.2398 -0.0216 -0.0086 0.0500  715  HOH A O   
4899 O  O   . HOH H .   ? 0.2853 0.2871 0.3896 -0.0210 -0.0130 0.0399  716  HOH A O   
4900 O  O   . HOH H .   ? 0.2211 0.2314 0.1987 -0.0140 -0.0470 0.0069  717  HOH A O   
4901 O  O   . HOH H .   ? 0.3219 0.3014 0.3802 -0.0371 -0.0421 0.0431  718  HOH A O   
4902 O  O   . HOH H .   ? 0.2929 0.3067 0.3534 -0.0128 0.0007  0.0285  719  HOH A O   
4903 O  O   . HOH H .   ? 0.3438 0.4190 0.2943 0.0245  0.0436  0.0546  720  HOH A O   
4904 O  O   . HOH H .   ? 0.2317 0.3808 0.3808 -0.0263 -0.0275 0.0825  721  HOH A O   
4905 O  O   . HOH H .   ? 0.2154 0.3537 0.3997 -0.0560 -0.0459 0.1004  722  HOH A O   
4906 O  O   . HOH H .   ? 0.2627 0.3115 0.3147 0.0181  -0.0202 0.0305  723  HOH A O   
4907 O  O   . HOH H .   ? 0.3602 0.3752 0.4035 -0.0098 0.0040  0.0246  724  HOH A O   
4908 O  O   . HOH H .   ? 0.3113 0.3605 0.3099 0.0475  -0.0018 -0.0134 725  HOH A O   
4909 O  O   . HOH H .   ? 0.2153 0.4065 0.3926 -0.0301 -0.0047 0.1159  726  HOH A O   
4910 O  O   . HOH H .   ? 0.2507 0.3373 0.3966 -0.0619 -0.0221 0.1428  727  HOH A O   
4911 O  O   . HOH H .   ? 0.2138 0.2652 0.2601 -0.0250 -0.0098 0.0594  728  HOH A O   
4912 O  O   . HOH H .   ? 0.3338 0.5496 0.3358 0.0284  0.0541  0.1504  729  HOH A O   
4913 O  O   . HOH H .   ? 0.2356 0.2424 0.2389 -0.0030 -0.0131 0.0094  730  HOH A O   
4914 O  O   . HOH H .   ? 0.3840 0.3979 0.5356 -0.0790 -0.1087 0.0527  731  HOH A O   
4915 O  O   . HOH H .   ? 0.2733 0.3394 0.3395 -0.0310 -0.0917 0.0371  732  HOH A O   
4916 O  O   . HOH H .   ? 0.2729 0.3613 0.2997 0.0061  0.0510  0.0867  733  HOH A O   
4917 O  O   . HOH H .   ? 0.4129 0.4683 0.3298 0.0689  -0.0175 -0.0323 734  HOH A O   
4918 O  O   . HOH H .   ? 0.2064 0.2819 0.2565 -0.0197 -0.0019 0.0640  735  HOH A O   
4919 O  O   . HOH H .   ? 0.1752 0.2015 0.1893 -0.0119 -0.0153 0.0181  736  HOH A O   
4920 O  O   . HOH H .   ? 0.3839 0.4360 0.5107 -0.0616 -0.0828 0.0534  737  HOH A O   
4921 O  O   . HOH H .   ? 0.2818 0.2547 0.3061 0.0274  -0.0428 -0.0388 738  HOH A O   
4922 O  O   . HOH H .   ? 0.3701 0.3789 0.2804 0.0243  -0.0048 -0.0137 739  HOH A O   
4923 O  O   . HOH H .   ? 0.3322 0.3603 0.2710 0.0087  0.0002  0.0285  740  HOH A O   
4924 O  O   . HOH H .   ? 0.3380 0.3243 0.4621 -0.0732 -0.1216 0.0294  741  HOH A O   
4925 O  O   . HOH H .   ? 0.2912 0.2591 0.4052 -0.0642 -0.0800 0.0517  742  HOH A O   
4926 O  O   . HOH H .   ? 0.3060 0.3616 0.3707 0.0312  -0.0190 0.0280  743  HOH A O   
4927 O  O   . HOH H .   ? 0.3425 0.3312 0.3980 -0.0071 -0.0179 0.0113  744  HOH A O   
4928 O  O   . HOH H .   ? 0.2920 0.3465 0.3269 0.0103  -0.0536 0.0615  745  HOH A O   
4929 O  O   . HOH H .   ? 0.2734 0.5227 0.3029 0.0392  0.0677  0.1370  746  HOH A O   
4930 O  O   . HOH H .   ? 0.1738 0.1861 0.1723 -0.0083 -0.0110 0.0137  747  HOH A O   
4931 O  O   . HOH H .   ? 0.2683 0.3035 0.2998 -0.0209 -0.0122 0.0378  748  HOH A O   
4932 O  O   . HOH H .   ? 0.3455 0.3137 0.4335 -0.0470 -0.0541 0.0646  749  HOH A O   
4933 O  O   . HOH H .   ? 0.3133 0.3478 0.2613 0.0565  -0.0199 -0.0362 750  HOH A O   
4934 O  O   . HOH H .   ? 0.3371 0.4055 0.4946 -0.0694 -0.0818 0.0703  751  HOH A O   
4935 O  O   . HOH H .   ? 0.5126 0.5202 0.4456 0.0604  -0.0599 -0.0629 752  HOH A O   
4936 O  O   . HOH H .   ? 0.3213 0.5136 0.3204 0.0484  0.0500  0.0802  753  HOH A O   
4937 O  O   . HOH H .   ? 0.3436 0.3422 0.3729 -0.0400 -0.1129 -0.0006 754  HOH A O   
4938 O  O   . HOH H .   ? 0.2744 0.3031 0.2993 0.0081  -0.0336 0.0551  755  HOH A O   
4939 O  O   . HOH H .   ? 0.2498 0.4057 0.3999 -0.0264 -0.0186 0.0888  756  HOH A O   
4940 O  O   . HOH H .   ? 0.2959 0.2923 0.3494 -0.0205 -0.0377 0.1071  757  HOH A O   
4941 O  O   . HOH H .   ? 0.2871 0.2636 0.2302 0.0047  -0.0325 -0.0252 758  HOH A O   
4942 O  O   . HOH H .   ? 0.4907 0.4984 0.5163 -0.0076 -0.0006 0.0129  759  HOH A O   
4943 O  O   . HOH H .   ? 0.3065 0.3192 0.2761 -0.0090 -0.0358 0.0106  760  HOH A O   
4944 O  O   . HOH H .   ? 0.3419 0.4136 0.3851 0.0487  -0.0005 0.0072  761  HOH A O   
4945 O  O   . HOH H .   ? 0.3226 0.4467 0.4054 0.0415  0.0034  0.0361  762  HOH A O   
4946 O  O   . HOH H .   ? 0.3102 0.3500 0.3573 0.0396  -0.0123 0.0070  763  HOH A O   
4947 O  O   . HOH H .   ? 0.3636 0.4178 0.2721 0.0594  -0.0277 -0.0189 764  HOH A O   
4948 O  O   . HOH H .   ? 0.2993 0.3167 0.3291 -0.0060 0.0074  0.0178  765  HOH A O   
4949 O  O   . HOH H .   ? 0.3364 0.3378 0.3557 -0.0009 -0.0152 -0.0052 766  HOH A O   
4950 O  O   . HOH H .   ? 0.2755 0.3151 0.3613 -0.0116 0.0124  0.0381  767  HOH A O   
4951 O  O   . HOH H .   ? 0.3055 0.3069 0.3299 -0.0056 -0.0078 0.0074  768  HOH A O   
4952 O  O   . HOH H .   ? 0.4827 0.5204 0.4216 0.0107  0.0071  0.0421  769  HOH A O   
4953 O  O   . HOH H .   ? 0.4364 0.4276 0.5215 -0.0435 -0.0415 0.0879  770  HOH A O   
4954 O  O   . HOH H .   ? 0.3491 0.3487 0.4535 -0.0658 -0.1271 0.0202  771  HOH A O   
4955 O  O   . HOH H .   ? 0.2696 0.4902 0.4753 -0.0574 0.0204  0.2203  772  HOH A O   
4956 O  O   . HOH H .   ? 0.4589 0.5591 0.4437 0.0129  0.0529  0.1172  773  HOH A O   
4957 O  O   . HOH H .   ? 0.3415 0.4989 0.3817 0.0497  0.0321  0.0423  774  HOH A O   
4958 O  O   . HOH H .   ? 0.1779 0.1906 0.1797 -0.0128 -0.0156 0.0117  775  HOH A O   
4959 O  O   . HOH H .   ? 0.3219 0.3517 0.4003 -0.0388 -0.0254 0.1156  776  HOH A O   
4960 O  O   . HOH H .   ? 0.3935 0.4664 0.3132 0.0654  -0.0055 -0.0152 777  HOH A O   
4961 O  O   . HOH H .   ? 0.4367 0.5605 0.3726 0.0373  0.0140  0.0848  778  HOH A O   
4962 O  O   . HOH H .   ? 0.3646 0.3201 0.5652 -0.0366 -0.0455 0.0907  779  HOH A O   
4963 O  O   . HOH H .   ? 0.2690 0.4129 0.4006 -0.0153 -0.0212 0.0736  780  HOH A O   
4964 O  O   . HOH H .   ? 0.3676 0.4377 0.2985 0.0649  -0.0032 -0.0185 781  HOH A O   
4965 O  O   . HOH H .   ? 0.2922 0.2972 0.2964 -0.0079 -0.0082 0.0054  782  HOH A O   
4966 O  O   . HOH H .   ? 0.2969 0.3017 0.3072 0.0008  -0.0143 -0.0047 783  HOH A O   
4967 O  O   . HOH H .   ? 0.3349 0.3916 0.4489 -0.0210 0.0233  0.0873  784  HOH A O   
4968 O  O   . HOH H .   ? 0.3430 0.3166 0.4570 -0.0181 -0.0318 0.0305  785  HOH A O   
4969 O  O   . HOH H .   ? 0.2935 0.4440 0.3691 0.0305  0.0185  0.0513  786  HOH A O   
4970 O  O   . HOH H .   ? 0.3216 0.4857 0.3861 0.0274  0.0287  0.0633  787  HOH A O   
4971 O  O   . HOH H .   ? 0.3536 0.4075 0.5085 -0.0721 -0.0832 0.0689  788  HOH A O   
4972 O  O   . HOH H .   ? 0.2507 0.3708 0.3506 0.0134  -0.0176 0.0516  789  HOH A O   
4973 O  O   . HOH H .   ? 0.3347 0.4274 0.4970 -0.0674 -0.0223 0.1642  790  HOH A O   
4974 O  O   . HOH H .   ? 0.2477 0.2711 0.2619 0.0005  -0.0217 0.0359  791  HOH A O   
4975 O  O   . HOH H .   ? 0.2732 0.4405 0.4171 -0.0481 0.0148  0.2090  792  HOH A O   
4976 O  O   . HOH H .   ? 0.2788 0.4937 0.3924 -0.0200 0.0401  0.1851  793  HOH A O   
4977 O  O   . HOH H .   ? 0.5659 0.6084 0.3925 0.0705  0.0133  -0.0239 794  HOH A O   
4978 O  O   . HOH H .   ? 0.2728 0.4070 0.4621 -0.0584 -0.0611 0.0936  795  HOH A O   
4979 O  O   . HOH H .   ? 0.3655 0.5896 0.5124 -0.0307 0.0366  0.1953  796  HOH A O   
4980 O  O   . HOH H .   ? 0.1698 0.1850 0.1538 -0.0061 -0.0153 0.0201  797  HOH A O   
4981 O  O   . HOH H .   ? 0.4541 0.5316 0.3752 0.0333  0.0423  0.0494  798  HOH A O   
4982 O  O   . HOH H .   ? 0.4258 0.4619 0.5132 -0.0504 -0.0771 0.0363  799  HOH A O   
4983 O  O   . HOH H .   ? 0.2946 0.3624 0.2932 0.0457  0.0056  -0.0031 800  HOH A O   
4984 O  O   . HOH H .   ? 0.4500 0.5079 0.4805 -0.0056 0.0203  0.1457  801  HOH A O   
4985 O  O   . HOH H .   ? 0.2869 0.5040 0.4273 0.0092  0.0253  0.1020  802  HOH A O   
4986 O  O   . HOH H .   ? 0.3360 0.5690 0.3623 0.0247  0.0599  0.1579  803  HOH A O   
4987 O  O   . HOH H .   ? 0.4070 0.3819 0.4279 -0.0409 -0.1370 -0.0177 804  HOH A O   
4988 O  O   . HOH H .   ? 0.2730 0.4504 0.4495 -0.0326 -0.0168 0.1056  805  HOH A O   
4989 O  O   . HOH H .   ? 0.3858 0.3924 0.3380 -0.0066 -0.0462 0.0021  806  HOH A O   
4990 O  O   . HOH H .   ? 0.3301 0.4179 0.4360 -0.0163 0.0435  0.1216  807  HOH A O   
4991 O  O   . HOH H .   ? 0.3586 0.3096 0.4732 -0.0083 -0.0429 0.0281  808  HOH A O   
4992 O  O   . HOH H .   ? 0.4790 0.5357 0.4830 0.0055  -0.0682 0.0601  809  HOH A O   
4993 O  O   . HOH H .   ? 0.3626 0.3328 0.4075 -0.0308 -0.0412 0.0295  810  HOH A O   
4994 O  O   . HOH H .   ? 0.4349 0.4182 0.5075 0.0008  -0.0269 0.0729  811  HOH A O   
4995 O  O   . HOH H .   ? 0.3690 0.4341 0.4209 -0.0234 -0.0130 0.1516  812  HOH A O   
4996 O  O   . HOH H .   ? 0.4584 0.4177 0.5555 0.0092  -0.0399 0.0539  813  HOH A O   
4997 O  O   . HOH H .   ? 0.4956 0.4072 0.5438 -0.0431 -0.1191 -0.0220 814  HOH A O   
4998 O  O   . HOH H .   ? 0.3480 0.4706 0.4371 0.0180  -0.0047 0.0476  815  HOH A O   
4999 O  O   . HOH H .   ? 0.1935 0.2069 0.1655 -0.0055 -0.0187 0.0156  816  HOH A O   
5000 O  O   . HOH H .   ? 0.4926 0.5302 0.5786 -0.0171 0.0090  0.1630  817  HOH A O   
5001 O  O   . HOH H .   ? 0.5245 0.5761 0.4528 0.0670  -0.0152 -0.0339 818  HOH A O   
5002 O  O   . HOH H .   ? 0.3284 0.4388 0.4153 0.0102  -0.0135 0.0473  819  HOH A O   
5003 O  O   . HOH H .   ? 0.4170 0.5546 0.4190 0.0500  0.0305  0.0339  820  HOH A O   
5004 O  O   . HOH H .   ? 0.3771 0.4965 0.4086 0.0065  0.0655  0.1346  821  HOH A O   
5005 O  O   . HOH H .   ? 0.3187 0.3626 0.3733 0.0277  -0.0173 0.0228  822  HOH A O   
5006 O  O   . HOH H .   ? 0.5475 0.5414 0.7053 -0.0304 -0.0158 0.1470  823  HOH A O   
5007 O  O   . HOH H .   ? 0.3714 0.4234 0.4426 0.0290  -0.0291 0.0397  824  HOH A O   
5008 O  O   . HOH H .   ? 0.2858 0.4732 0.3474 0.0293  0.0393  0.0792  825  HOH A O   
5009 O  O   . HOH H .   ? 0.2120 0.2216 0.2075 -0.0102 -0.0127 0.0104  826  HOH A O   
5010 O  O   . HOH H .   ? 0.3164 0.3846 0.3939 0.0303  -0.0261 0.0392  827  HOH A O   
5011 O  O   . HOH H .   ? 0.4690 0.5076 0.3749 0.0620  -0.0474 -0.0353 828  HOH A O   
5012 O  O   . HOH H .   ? 0.4989 0.6156 0.5034 0.0115  0.0630  0.1339  829  HOH A O   
5013 O  O   . HOH H .   ? 0.3694 0.4899 0.5291 -0.0271 0.0558  0.1818  830  HOH A O   
5014 O  O   . HOH H .   ? 0.4601 0.4570 0.4865 0.0108  -0.0595 0.1223  831  HOH A O   
5015 O  O   . HOH H .   ? 0.5189 0.5698 0.6158 -0.0462 -0.0215 0.1246  832  HOH A O   
5016 O  O   . HOH H .   ? 0.4317 0.3395 0.4922 -0.0546 -0.1688 -0.0354 833  HOH A O   
5017 O  O   . HOH H .   ? 0.6207 0.5927 0.4187 0.0945  -0.0322 -0.0997 834  HOH A O   
5018 O  O   . HOH H .   ? 0.4305 0.3926 0.5049 0.0020  -0.0395 -0.0039 835  HOH A O   
5019 O  O   . HOH H .   ? 0.3877 0.4728 0.5400 -0.0322 0.0354  0.2161  836  HOH A O   
5020 O  O   . HOH H .   ? 0.3695 0.3559 0.4942 -0.0237 -0.0249 0.0423  837  HOH A O   
5021 O  O   . HOH H .   ? 0.4042 0.3219 0.4247 -0.0394 -0.1480 -0.0423 838  HOH A O   
5022 O  O   . HOH H .   ? 0.3624 0.3201 0.4818 -0.0129 -0.0372 0.0449  839  HOH A O   
5023 O  O   . HOH H .   ? 0.3730 0.3464 0.4373 -0.0003 -0.0296 0.0039  840  HOH A O   
5024 O  O   . HOH H .   ? 0.3524 0.3586 0.3516 -0.0058 -0.0008 0.0078  841  HOH A O   
5025 O  O   . HOH H .   ? 0.3782 0.3675 0.4583 -0.0374 -0.0408 0.1013  842  HOH A O   
5026 O  O   . HOH H .   ? 0.3863 0.5713 0.4918 0.0228  0.0229  0.0742  843  HOH A O   
5027 O  O   . HOH H .   ? 0.4239 0.4907 0.4721 -0.0189 -0.0768 0.0398  844  HOH A O   
5028 O  O   . HOH H .   ? 0.3928 0.5634 0.4903 0.0294  0.0188  0.0617  845  HOH A O   
5029 O  O   . HOH H .   ? 0.4080 0.6126 0.5051 0.0252  0.0362  0.0870  846  HOH A O   
5030 O  O   . HOH H .   ? 0.4458 0.4794 0.4781 -0.0325 -0.0998 0.0175  847  HOH A O   
5031 O  O   . HOH H .   ? 0.4401 0.4388 0.4896 0.0048  -0.0264 0.0751  848  HOH A O   
5032 O  O   . HOH H .   ? 0.3444 0.4448 0.5556 -0.0815 -0.0920 0.0930  849  HOH A O   
5033 O  O   . HOH H .   ? 0.3178 0.5381 0.4465 -0.0123 0.0371  0.1483  850  HOH A O   
5034 O  O   . HOH H .   ? 0.3520 0.3796 0.4335 -0.0140 0.0054  0.0344  851  HOH A O   
5035 O  O   . HOH H .   ? 0.4571 0.5605 0.4642 0.0155  0.0605  0.0901  852  HOH A O   
5036 O  O   . HOH H .   ? 0.4116 0.3885 0.5947 -0.0365 -0.0348 0.0762  853  HOH A O   
5037 O  O   . HOH H .   ? 0.3540 0.3248 0.4140 0.0255  -0.0340 -0.0030 854  HOH A O   
5038 O  O   . HOH H .   ? 0.3775 0.4094 0.3556 0.0682  -0.0138 -0.0410 855  HOH A O   
5039 O  O   . HOH H .   ? 0.3938 0.3609 0.4926 -0.0532 -0.0607 0.0645  856  HOH A O   
5040 O  O   . HOH H .   ? 0.4465 0.4392 0.4447 -0.0089 -0.0118 0.0004  857  HOH A O   
5041 O  O   . HOH H .   ? 0.4139 0.4238 0.4562 0.0413  -0.0199 -0.0066 858  HOH A O   
5042 O  O   . HOH H .   ? 0.4773 0.4725 0.5144 -0.0033 -0.0189 -0.0039 859  HOH A O   
5043 O  O   . HOH H .   ? 0.5503 0.5862 0.6182 -0.0438 -0.0884 0.0268  860  HOH A O   
5044 O  O   . HOH H .   ? 0.6275 0.7235 0.5428 0.0382  0.0521  0.0660  861  HOH A O   
5045 O  O   . HOH H .   ? 0.5603 0.4774 0.3710 0.1255  -0.0512 -0.1515 862  HOH A O   
5046 O  O   . HOH H .   ? 0.5115 0.5354 0.4744 0.0770  -0.0221 -0.0551 863  HOH A O   
5047 O  O   . HOH H .   ? 0.3869 0.4788 0.5454 -0.0290 0.0392  0.1446  864  HOH A O   
5048 O  O   . HOH H .   ? 0.4265 0.3893 0.5755 -0.0791 -0.1038 0.0571  865  HOH A O   
5049 O  O   . HOH H .   ? 0.4358 0.4516 0.4181 0.0550  -0.0212 -0.0406 866  HOH A O   
5050 O  O   . HOH H .   ? 0.3400 0.3468 0.3443 -0.0066 -0.0092 0.0070  867  HOH A O   
5051 O  O   . HOH H .   ? 0.5017 0.5236 0.4120 0.0734  -0.0519 -0.0632 868  HOH A O   
5052 O  O   . HOH H .   ? 0.4735 0.5295 0.5850 -0.0509 -0.0227 0.1457  869  HOH A O   
5053 O  O   . HOH H .   ? 0.4134 0.4069 0.4571 -0.0059 -0.0149 0.0070  870  HOH A O   
5054 O  O   . HOH H .   ? 0.3360 0.4625 0.4551 -0.0117 -0.0342 0.0632  871  HOH A O   
5055 O  O   . HOH H .   ? 0.3743 0.5871 0.5118 -0.0152 0.0302  0.1386  872  HOH A O   
5056 O  O   . HOH H .   ? 0.3452 0.5595 0.5726 -0.0696 0.0132  0.2392  873  HOH A O   
5057 O  O   . HOH H .   ? 0.4046 0.3852 0.4160 0.0296  -0.0411 -0.0411 874  HOH A O   
5058 O  O   . HOH H .   ? 0.4344 0.4417 0.4391 0.0016  -0.0153 -0.0017 875  HOH A O   
5059 O  O   . HOH H .   ? 0.4402 0.6663 0.5944 -0.0256 0.0334  0.1688  876  HOH A O   
5060 O  O   . HOH H .   ? 0.3657 0.4456 0.5200 -0.0328 0.0333  0.1957  877  HOH A O   
5061 O  O   . HOH H .   ? 0.4374 0.4737 0.4946 -0.0378 -0.0667 0.0282  878  HOH A O   
5062 O  O   . HOH H .   ? 0.4829 0.4644 0.6346 -0.0292 -0.0314 0.0519  879  HOH A O   
5063 O  O   . HOH H .   ? 0.3795 0.5771 0.5540 -0.0530 0.0202  0.2208  880  HOH A O   
5064 O  O   . HOH H .   ? 0.6093 0.6030 0.6741 0.0151  -0.0341 0.0608  881  HOH A O   
5065 O  O   . HOH H .   ? 0.4021 0.5894 0.4333 0.0363  0.0450  0.0806  882  HOH A O   
5066 O  O   . HOH H .   ? 0.4207 0.6433 0.6055 -0.0403 0.0225  0.1773  883  HOH A O   
5067 O  O   . HOH H .   ? 0.3478 0.4261 0.4868 -0.0600 -0.0206 0.1622  884  HOH A O   
5068 O  O   . HOH H .   ? 0.3868 0.4072 0.4483 -0.0101 0.0028  0.0212  885  HOH A O   
5069 O  O   . HOH H .   ? 0.4992 0.5474 0.6744 -0.0377 0.0117  0.1277  886  HOH A O   
5070 O  O   . HOH H .   ? 0.3920 0.3831 0.5520 -0.0328 -0.0235 0.0714  887  HOH A O   
5071 O  O   . HOH H .   ? 0.3321 0.5838 0.5662 -0.0598 0.0256  0.2356  888  HOH A O   
5072 O  O   . HOH H .   ? 0.4916 0.5250 0.4715 0.0172  -0.0396 0.0909  889  HOH A O   
5073 O  O   . HOH H .   ? 0.4292 0.4577 0.5168 -0.0439 -0.0278 0.1097  890  HOH A O   
5074 O  O   . HOH H .   ? 0.4658 0.5205 0.4825 0.0100  -0.0619 0.0673  891  HOH A O   
5075 O  O   . HOH H .   ? 0.4270 0.4407 0.5351 -0.0653 -0.1307 0.0232  892  HOH A O   
5076 O  O   . HOH H .   ? 0.4265 0.4795 0.4975 -0.0296 -0.0229 0.1775  893  HOH A O   
5077 O  O   . HOH H .   ? 0.5145 0.5120 0.4523 -0.0082 -0.0905 -0.0140 894  HOH A O   
5078 O  O   . HOH H .   ? 0.3887 0.3781 0.4470 0.0309  -0.0283 0.0067  895  HOH A O   
5079 O  O   . HOH H .   ? 0.5224 0.4609 0.6980 -0.0202 -0.0493 0.1030  896  HOH A O   
5080 O  O   . HOH H .   ? 0.4153 0.5554 0.5258 0.0229  -0.0084 0.0545  897  HOH A O   
5081 O  O   . HOH H .   ? 0.4089 0.4074 0.4830 -0.0278 -0.0423 0.1392  898  HOH A O   
5082 O  O   . HOH H .   ? 0.4145 0.5785 0.5952 -0.0633 0.0052  0.2216  899  HOH A O   
5083 O  O   . HOH H .   ? 0.4055 0.4199 0.4497 -0.0088 0.0023  0.0177  900  HOH A O   
5084 O  O   . HOH H .   ? 0.4233 0.7436 0.4965 0.0236  0.0882  0.2261  901  HOH A O   
5085 O  O   . HOH H .   ? 0.5915 0.5596 0.6668 -0.0144 -0.0607 0.1402  902  HOH A O   
5086 O  O   . HOH H .   ? 0.4021 0.5749 0.5511 -0.0502 0.0161  0.2303  903  HOH A O   
5087 O  O   . HOH H .   ? 0.4314 0.4868 0.4794 0.0492  -0.0074 0.0046  904  HOH A O   
5088 O  O   . HOH H .   ? 0.5026 0.5122 0.5531 -0.0462 -0.1247 0.0061  905  HOH A O   
5089 O  O   . HOH H .   ? 0.4716 0.6127 0.6398 -0.0630 -0.0007 0.2252  906  HOH A O   
5090 O  O   . HOH H .   ? 0.3520 0.3847 0.3448 0.0054  -0.0260 0.0830  907  HOH A O   
5091 O  O   . HOH H .   ? 0.4528 0.6467 0.5056 0.0445  0.0437  0.0691  908  HOH A O   
5092 O  O   . HOH H .   ? 0.3418 0.5054 0.5632 -0.0579 -0.0708 0.1024  909  HOH A O   
5093 O  O   . HOH H .   ? 0.4584 0.6810 0.4676 0.0496  0.0603  0.1017  910  HOH A O   
5094 O  O   . HOH H .   ? 0.4984 0.6187 0.5433 -0.0029 0.0576  0.2005  911  HOH A O   
5095 O  O   . HOH H .   ? 0.4818 0.7092 0.5793 0.0156  0.0473  0.1195  912  HOH A O   
5096 O  O   . HOH H .   ? 0.4314 0.4380 0.4461 -0.0060 -0.0004 0.0071  913  HOH A O   
5097 O  O   . HOH H .   ? 0.5062 0.5616 0.3906 0.0899  0.0437  -0.0363 914  HOH A O   
5098 O  O   . HOH H .   ? 0.6164 0.5466 0.7307 0.0103  -0.0557 0.0148  915  HOH A O   
5099 O  O   . HOH H .   ? 0.3759 0.5009 0.4893 0.0425  -0.0158 0.0470  916  HOH A O   
5100 O  O   . HOH H .   ? 0.6987 0.7971 0.4945 0.1413  0.0646  -0.0474 917  HOH A O   
5101 O  O   . HOH H .   ? 0.4831 0.7201 0.6598 -0.0419 0.0355  0.2209  918  HOH A O   
5102 O  O   . HOH H .   ? 0.6336 0.6448 0.4855 0.1443  0.0248  -0.1056 919  HOH A O   
5103 O  O   . HOH H .   ? 0.4452 0.4506 0.5851 -0.0767 -0.1207 0.0396  920  HOH A O   
5104 O  O   . HOH H .   ? 0.4309 0.5753 0.4809 0.0519  0.0247  0.0336  921  HOH A O   
5105 O  O   . HOH H .   ? 0.2664 0.2785 0.2150 -0.0014 -0.0267 0.0103  922  HOH A O   
5106 O  O   . HOH H .   ? 0.2697 0.2808 0.2353 -0.0064 -0.0270 0.0106  923  HOH A O   
5107 O  O   . HOH H .   ? 0.3953 0.3960 0.4007 -0.0087 -0.0108 0.0069  924  HOH A O   
5108 O  O   . HOH H .   ? 0.5146 0.6197 0.5834 -0.0109 0.0465  0.2173  925  HOH A O   
5109 O  O   . HOH H .   ? 0.5662 0.5069 0.4330 0.1331  -0.0182 -0.1331 926  HOH A O   
5110 O  O   . HOH H .   ? 0.5701 0.6747 0.5269 0.0231  0.0559  0.1026  927  HOH A O   
5111 O  O   . HOH H .   ? 0.5316 0.5551 0.5312 0.0046  -0.0232 0.0772  928  HOH A O   
5112 O  O   . HOH H .   ? 0.4909 0.5747 0.5773 -0.0020 0.0424  0.0671  929  HOH A O   
5113 O  O   . HOH H .   ? 0.4867 0.5221 0.4336 0.0069  -0.0338 0.0546  930  HOH A O   
5114 O  O   . HOH H .   ? 0.5054 0.5701 0.4911 0.0638  0.0028  -0.0191 931  HOH A O   
5115 O  O   . HOH H .   ? 0.5690 0.5723 0.8215 -0.1148 -0.1293 0.1058  932  HOH A O   
5116 O  O   . HOH H .   ? 0.5946 0.6516 0.4204 0.1199  0.0417  -0.0595 933  HOH A O   
5117 O  O   . HOH H .   ? 0.4751 0.5199 0.3757 0.0208  0.0005  0.0416  934  HOH A O   
5118 O  O   . HOH H .   ? 0.6758 0.7719 0.8051 -0.0536 -0.0108 0.1889  935  HOH A O   
5119 O  O   . HOH H .   ? 0.3674 0.4157 0.3800 -0.0023 -0.0510 0.0435  936  HOH A O   
5120 O  O   . HOH H .   ? 0.5570 0.5503 0.6543 -0.0146 -0.0156 0.1112  937  HOH A O   
5121 O  O   . HOH H .   ? 0.5811 0.5494 0.6677 -0.0075 -0.0363 0.0061  938  HOH A O   
5122 O  O   . HOH H .   ? 0.5796 0.6571 0.6629 -0.0081 0.0399  0.0816  939  HOH A O   
5123 O  O   . HOH H .   ? 0.4000 0.4024 0.3947 -0.0060 -0.0037 0.0035  940  HOH A O   
5124 O  O   . HOH H .   ? 0.6789 0.6866 0.5945 0.0820  -0.0580 -0.0807 941  HOH A O   
5125 O  O   . HOH H .   ? 0.5164 0.6323 0.6325 -0.0183 -0.0846 0.0623  942  HOH A O   
5126 O  O   . HOH H .   ? 0.4617 0.6532 0.4669 0.0524  0.0497  0.0711  943  HOH A O   
5127 O  O   . HOH H .   ? 0.5621 0.6172 0.5233 0.0695  -0.0043 -0.0319 944  HOH A O   
5128 O  O   . HOH H .   ? 0.5384 0.6499 0.6386 -0.0008 -0.0341 0.0548  945  HOH A O   
5129 O  O   . HOH H .   ? 0.3843 0.3869 0.3861 -0.0068 -0.0044 0.0036  946  HOH A O   
5130 O  O   . HOH H .   ? 0.4220 0.4475 0.3285 0.0122  -0.0280 0.0206  947  HOH A O   
5131 O  O   . HOH H .   ? 0.3874 0.4229 0.4043 -0.0030 0.0040  0.1142  948  HOH A O   
5132 O  O   . HOH H .   ? 0.4226 0.4459 0.3761 -0.0019 -0.0400 0.0231  949  HOH A O   
5133 O  O   . HOH H .   ? 0.4308 0.5132 0.4916 -0.0236 -0.0144 0.2068  950  HOH A O   
5134 O  O   . HOH H .   ? 0.3003 0.3323 0.3253 -0.0057 0.0060  0.1037  951  HOH A O   
5135 O  O   . HOH H .   ? 0.4360 0.5447 0.4480 -0.0035 0.0034  0.1626  952  HOH A O   
5136 O  O   . HOH H .   ? 0.5310 0.5180 0.6215 -0.0439 -0.0441 0.0973  953  HOH A O   
5137 O  O   . HOH H .   ? 0.4689 0.5120 0.4435 0.0080  -0.0099 0.1172  954  HOH A O   
5138 O  O   . HOH H .   ? 0.4212 0.4239 0.4686 -0.0034 -0.0156 0.0837  955  HOH A O   
5139 O  O   . HOH H .   ? 0.4827 0.4583 0.6180 -0.0201 -0.0260 0.1174  956  HOH A O   
5140 O  O   . HOH H .   ? 0.5223 0.5419 0.4633 0.0007  -0.0351 0.0183  957  HOH A O   
5141 O  O   . HOH H .   ? 0.4642 0.4960 0.4231 0.0014  -0.0409 0.0391  958  HOH A O   
5142 O  O   . HOH H .   ? 0.4341 0.5936 0.4495 0.0617  0.0370  0.0354  959  HOH A O   
5143 O  O   . HOH H .   ? 0.5305 0.7750 0.6247 0.0191  0.0556  0.1318  960  HOH A O   
5144 O  O   . HOH H .   ? 0.4522 0.6406 0.4703 0.0091  0.0401  0.1684  961  HOH A O   
5145 O  O   . HOH H .   ? 0.5063 0.6858 0.6593 -0.0117 -0.0058 0.0911  962  HOH A O   
5146 O  O   . HOH H .   ? 0.3979 0.4021 0.4043 -0.0050 -0.0089 0.0029  963  HOH A O   
5147 O  O   . HOH H .   ? 0.3728 0.3194 0.4602 -0.0519 -0.0763 0.0343  964  HOH A O   
5148 O  O   . HOH H .   ? 0.4578 0.4722 0.4029 -0.0013 -0.0340 0.0119  965  HOH A O   
5149 O  O   . HOH H .   ? 0.5272 0.5275 0.5340 -0.0060 -0.0087 0.0025  966  HOH A O   
5150 O  O   . HOH H .   ? 0.5113 0.6011 0.4787 0.0747  0.0121  -0.0152 967  HOH A O   
5151 O  O   . HOH H .   ? 0.5290 0.5286 0.6652 -0.0251 -0.0126 0.1502  968  HOH A O   
5152 O  O   . HOH H .   ? 0.4846 0.4748 0.6118 -0.0243 -0.0259 0.0367  969  HOH A O   
5153 O  O   . HOH H .   ? 0.4962 0.5213 0.4541 -0.0064 -0.0642 0.0170  970  HOH A O   
5154 O  O   . HOH H .   ? 0.5993 0.7192 0.7444 -0.0272 0.0554  0.2256  971  HOH A O   
5155 O  O   . HOH H .   ? 0.5709 0.5860 0.5193 -0.0074 -0.0727 0.0048  972  HOH A O   
5156 O  O   . HOH H .   ? 0.5366 0.5401 0.4689 -0.0042 -0.0740 -0.0073 973  HOH A O   
5157 O  O   . HOH H .   ? 0.4997 0.6160 0.6278 -0.0288 -0.0641 0.0633  974  HOH A O   
5158 O  O   . HOH H .   ? 0.6299 0.6918 0.7691 -0.0640 -0.0943 0.0549  975  HOH A O   
5159 O  O   . HOH H .   ? 0.4513 0.5649 0.4493 0.0032  0.0082  0.1435  976  HOH A O   
5160 O  O   . HOH H .   ? 0.4695 0.5463 0.6786 -0.0880 -0.0748 0.1116  977  HOH A O   
5161 O  O   . HOH H .   ? 0.3992 0.3977 0.3439 0.0006  -0.0251 -0.0058 978  HOH A O   
5162 O  O   . HOH H .   ? 0.4744 0.5042 0.4445 0.0554  -0.0155 -0.0354 979  HOH A O   
5163 O  O   . HOH H .   ? 0.5074 0.5091 0.4413 -0.0032 -0.0613 -0.0067 980  HOH A O   
5164 O  O   . HOH H .   ? 0.5265 0.5400 0.5472 -0.0351 -0.1184 0.0028  981  HOH A O   
5165 O  O   . HOH H .   ? 0.4357 0.5991 0.6218 -0.0304 0.0759  0.2485  982  HOH A O   
5166 O  O   . HOH H .   ? 0.6401 0.7196 0.5016 0.0706  0.0463  0.0060  983  HOH A O   
5167 O  O   . HOH H .   ? 0.5051 0.4955 0.5682 -0.0144 -0.0521 0.1497  984  HOH A O   
5168 O  O   . HOH H .   ? 0.4967 0.5270 0.6146 -0.0647 -0.1123 0.0360  985  HOH A O   
5169 O  O   . HOH H .   ? 0.5106 0.6299 0.4649 0.0227  -0.0030 0.1638  986  HOH A O   
5170 O  O   . HOH H .   ? 0.5912 0.6240 0.4734 0.0287  -0.0028 0.0108  987  HOH A O   
5171 O  O   . HOH H .   ? 0.4897 0.4705 0.5514 -0.0047 -0.0250 0.0058  988  HOH A O   
5172 O  O   . HOH H .   ? 0.5581 0.6367 0.4491 0.0610  0.0491  0.0123  989  HOH A O   
5173 O  O   . HOH H .   ? 0.5102 0.4790 0.6741 -0.0881 -0.1378 0.0412  990  HOH A O   
5174 O  O   . HOH H .   ? 0.6131 0.6271 0.5292 0.0878  -0.0482 -0.0795 991  HOH A O   
5175 O  O   . HOH H .   ? 0.5610 0.5177 0.6921 -0.0176 -0.0433 0.0317  992  HOH A O   
5176 O  O   . HOH H .   ? 0.6042 0.5659 0.7502 -0.0235 -0.0439 0.0360  993  HOH A O   
5177 O  O   . HOH H .   ? 0.4047 0.4182 0.4793 -0.0394 -0.0303 0.0908  994  HOH A O   
5178 O  O   . HOH H .   ? 0.5933 0.5782 0.6316 0.0128  -0.0678 0.1269  995  HOH A O   
5179 O  O   . HOH H .   ? 0.5068 0.5991 0.5942 -0.0194 -0.0704 0.0514  996  HOH A O   
5180 O  O   . HOH H .   ? 0.5321 0.5687 0.5954 -0.0167 -0.0430 0.2202  997  HOH A O   
5181 O  O   . HOH H .   ? 0.5545 0.7031 0.7012 -0.0133 -0.0405 0.0734  998  HOH A O   
5182 O  O   . HOH H .   ? 0.4985 0.7549 0.6262 0.0025  0.0528  0.1562  999  HOH A O   
5183 O  O   . HOH H .   ? 0.5074 0.6068 0.6126 -0.0270 -0.0760 0.0546  1000 HOH A O   
5184 O  O   . HOH H .   ? 0.6032 0.6225 0.5241 0.0059  -0.0370 0.0144  1001 HOH A O   
5185 O  O   . HOH H .   ? 0.5433 0.6221 0.5975 -0.0120 -0.0829 0.0487  1002 HOH A O   
5186 O  O   . HOH H .   ? 0.4368 0.5809 0.5696 -0.0113 -0.0257 0.0709  1003 HOH A O   
5187 O  O   . HOH H .   ? 0.5552 0.5510 0.5911 0.0583  -0.0272 -0.0290 1004 HOH A O   
5188 O  O   . HOH H .   ? 0.5116 0.5644 0.6548 -0.0285 0.0168  0.0984  1005 HOH A O   
5189 O  O   . HOH H .   ? 0.5952 0.6000 0.6028 -0.0030 -0.0108 0.0013  1006 HOH A O   
5190 O  O   . HOH H .   ? 0.5262 0.5529 0.7591 -0.0522 -0.0062 0.1638  1007 HOH A O   
5191 O  O   . HOH H .   ? 0.6247 0.6275 0.6690 0.0029  -0.0243 0.0862  1008 HOH A O   
5192 O  O   . HOH H .   ? 0.6093 0.7756 0.7466 0.0018  -0.0091 0.0750  1009 HOH A O   
5193 O  O   . HOH H .   ? 0.4627 0.6056 0.5704 0.0161  -0.0046 0.0573  1010 HOH A O   
5194 O  O   . HOH H .   ? 0.4567 0.5809 0.5795 -0.0105 -0.0707 0.0654  1011 HOH A O   
5195 O  O   . HOH H .   ? 0.5181 0.5173 0.6897 -0.0883 -0.1278 0.0526  1012 HOH A O   
5196 O  O   . HOH H .   ? 0.6223 0.6647 0.5090 0.0953  -0.0379 -0.0673 1013 HOH A O   
5197 O  O   . HOH H .   ? 0.5239 0.5973 0.6557 -0.0243 0.0317  0.1163  1014 HOH A O   
5198 O  O   . HOH H .   ? 0.5313 0.5285 0.4438 0.0051  -0.0552 -0.0142 1015 HOH A O   
5199 O  O   . HOH H .   ? 0.5395 0.5705 0.4986 0.0697  -0.0183 -0.0468 1016 HOH A O   
5200 O  O   . HOH H .   ? 0.4692 0.4752 0.4749 -0.0010 -0.0133 0.0019  1017 HOH A O   
5201 O  O   . HOH H .   ? 0.5144 0.5189 0.5259 -0.0016 -0.0125 -0.0020 1018 HOH A O   
5202 O  O   . HOH H .   ? 0.4362 0.4415 0.4468 0.0012  -0.0173 -0.0040 1019 HOH A O   
5203 O  O   . HOH H .   ? 0.4988 0.5054 0.4364 0.0017  -0.0274 0.0016  1020 HOH A O   
5204 O  O   . HOH H .   ? 0.5766 0.6153 0.4977 0.0116  -0.0327 0.0527  1021 HOH A O   
5205 O  O   . HOH H .   ? 0.5632 0.5991 0.5616 -0.0208 -0.1071 0.0157  1022 HOH A O   
5206 O  O   . HOH H .   ? 0.4965 0.4945 0.4021 0.0114  -0.0395 -0.0152 1023 HOH A O   
5207 O  O   . HOH H .   ? 0.5209 0.7325 0.6519 0.0219  0.0253  0.0879  1024 HOH A O   
5208 O  O   . HOH H .   ? 0.4517 0.7172 0.4733 0.0306  0.0715  0.1865  1025 HOH A O   
5209 O  O   . HOH H .   ? 0.5894 0.5994 0.5232 -0.0007 -0.0477 0.0032  1026 HOH A O   
5210 O  O   . HOH H .   ? 0.5479 0.5503 0.5914 -0.0095 -0.0064 0.0158  1027 HOH A O   
5211 O  O   . HOH H .   ? 0.6035 0.8592 0.6042 0.0421  0.0702  0.1600  1028 HOH A O   
5212 O  O   . HOH H .   ? 0.4552 0.6801 0.5793 0.0186  0.0363  0.1024  1029 HOH A O   
5213 O  O   . HOH H .   ? 0.5554 0.5560 0.6548 -0.0192 -0.0160 0.0291  1030 HOH A O   
5214 O  O   . HOH H .   ? 0.5872 0.6406 0.4900 0.0212  0.0045  0.0583  1031 HOH A O   
5215 O  O   . HOH H .   ? 0.5156 0.6609 0.5041 0.0565  0.0341  0.0348  1032 HOH A O   
5216 O  O   . HOH H .   ? 0.3948 0.3943 0.4308 -0.0073 -0.0087 0.0118  1033 HOH A O   
5217 O  O   . HOH H .   ? 0.5156 0.4831 0.5874 0.0231  -0.0360 0.0108  1034 HOH A O   
5218 O  O   . HOH H .   ? 0.5009 0.6250 0.5308 -0.0096 0.0046  0.2054  1035 HOH A O   
5219 O  O   . HOH H .   ? 0.5393 0.4920 0.6189 0.0057  -0.0475 -0.0110 1036 HOH A O   
5220 O  O   . HOH H .   ? 0.6099 0.5897 0.6657 -0.0015 -0.0286 -0.0039 1037 HOH A O   
5221 O  O   . HOH H .   ? 0.5560 0.6420 0.5999 -0.0191 -0.0043 0.1576  1038 HOH A O   
5222 O  O   . HOH H .   ? 0.5896 0.5977 0.5136 0.0051  -0.0327 0.0006  1039 HOH A O   
5223 O  O   . HOH H .   ? 0.5359 0.7410 0.5370 0.0221  0.0483  0.1608  1040 HOH A O   
5224 O  O   . HOH H .   ? 0.6096 0.6704 0.7487 -0.0623 -0.0287 0.1454  1041 HOH A O   
5225 O  O   . HOH H .   ? 0.4439 0.4911 0.6807 -0.1043 -0.1197 0.0959  1042 HOH A O   
5226 O  O   . HOH H .   ? 0.5127 0.5451 0.5752 0.0237  -0.0370 0.0520  1043 HOH A O   
5227 O  O   . HOH H .   ? 0.5034 0.4936 0.4734 -0.0215 -0.1149 -0.0177 1044 HOH A O   
5228 O  O   . HOH H .   ? 0.7983 0.8755 0.7204 0.0232  0.0313  0.0826  1045 HOH A O   
5229 O  O   . HOH H .   ? 0.6360 0.7624 0.6435 0.0103  0.0659  0.1583  1046 HOH A O   
5230 O  O   . HOH H .   ? 0.6110 0.6192 0.6980 -0.0420 -0.0354 0.1130  1047 HOH A O   
5231 O  O   . HOH H .   ? 0.5950 0.5601 0.7019 -0.0130 -0.0398 0.0143  1048 HOH A O   
5232 O  O   . HOH H .   ? 0.5074 0.5110 0.5325 -0.0070 -0.0052 0.0085  1049 HOH A O   
5233 O  O   . HOH H .   ? 0.4500 0.4495 0.4786 -0.0049 -0.0107 0.0035  1050 HOH A O   
5234 O  O   . HOH H .   ? 0.3934 0.6128 0.5889 -0.0248 0.0020  0.1260  1051 HOH A O   
5235 O  O   . HOH H .   ? 0.2808 0.3237 0.2786 0.0017  -0.0214 0.0999  1052 HOH A O   
5236 O  O   . HOH H .   ? 0.4274 0.5412 0.4922 -0.0253 0.0060  0.1697  1053 HOH A O   
5237 O  O   . HOH H .   ? 0.5717 0.6161 0.5780 0.0523  -0.0045 -0.0168 1054 HOH A O   
5238 O  O   . HOH H .   ? 0.5170 0.5607 0.5475 0.0472  -0.0069 -0.0053 1055 HOH A O   
5239 O  O   . HOH H .   ? 0.6950 0.7596 0.5240 0.0801  0.0328  -0.0147 1056 HOH A O   
5240 O  O   . HOH H .   ? 0.5962 0.6395 0.6757 -0.0451 -0.0749 0.0350  1057 HOH A O   
5241 O  O   . HOH H .   ? 0.5361 0.5722 0.5934 0.0362  -0.0180 0.0164  1058 HOH A O   
5242 O  O   . HOH H .   ? 0.5396 0.4998 0.6167 0.0124  -0.0372 0.0117  1059 HOH A O   
5243 O  O   . HOH H .   ? 0.6563 0.6002 0.7559 0.0119  -0.0468 0.0191  1060 HOH A O   
5244 O  O   . HOH H .   ? 0.7751 0.7144 0.8798 0.0273  -0.0522 0.0190  1061 HOH A O   
5245 O  O   . HOH H .   ? 0.6109 0.7060 0.5668 0.0283  0.0557  0.0698  1062 HOH A O   
5246 O  O   . HOH H .   ? 0.5115 0.5107 0.5828 -0.0294 -0.0390 0.1243  1063 HOH A O   
5247 O  O   . HOH H .   ? 0.5613 0.5535 0.6537 -0.0412 -0.0431 0.1208  1064 HOH A O   
5248 O  O   . HOH H .   ? 0.3742 0.6122 0.6173 -0.0646 0.0142  0.2196  1065 HOH A O   
5249 O  O   . HOH H .   ? 0.4803 0.6791 0.6736 -0.0283 -0.0147 0.1119  1066 HOH A O   
5250 O  O   . HOH H .   ? 0.5361 0.5883 0.6099 -0.0323 -0.0210 0.1644  1067 HOH A O   
5251 O  O   . HOH H .   ? 0.7254 0.6261 0.8116 -0.0583 -0.1416 -0.0134 1068 HOH A O   
5252 O  O   . HOH H .   ? 0.5166 0.5672 0.5899 0.0284  -0.0351 0.0470  1069 HOH A O   
5253 O  O   . HOH H .   ? 0.6191 0.6242 0.6315 0.0167  -0.0592 0.1101  1070 HOH A O   
5254 O  O   . HOH H .   ? 0.6060 0.5986 0.6732 -0.0114 -0.0172 0.0143  1071 HOH A O   
5255 O  O   . HOH H .   ? 0.5429 0.5486 0.6921 -0.0312 -0.0148 0.0673  1072 HOH A O   
5256 O  O   . HOH H .   ? 0.4974 0.5114 0.5744 -0.0289 -0.0393 0.1631  1073 HOH A O   
5257 O  O   . HOH H .   ? 0.4451 0.5032 0.4216 0.0135  -0.0258 0.1189  1074 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -2  ?   ?   ?   A . n 
A 1 2   ASN 2   -1  -1  ASN ASN A . n 
A 1 3   ALA 3   0   0   ALA ALA A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   LEU 5   2   2   LEU LEU A . n 
A 1 6   PHE 6   3   3   PHE PHE A . n 
A 1 7   CYS 7   4   4   CYS CYS A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  SER 10  7   7   SER SER A . n 
A 1 11  LYS 11  8   8   LYS LYS A . n 
A 1 12  LYS 12  9   9   LYS LYS A . n 
A 1 13  TYR 13  10  10  TYR TYR A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  LYS 15  12  12  LYS LYS A . n 
A 1 16  GLU 16  13  13  GLU GLU A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  ASN 18  15  15  ASN ASN A . n 
A 1 19  ILE 19  16  16  ILE ILE A . n 
A 1 20  ASN 20  17  17  ASN ASN A . n 
A 1 21  LEU 21  18  18  LEU LEU A . n 
A 1 22  LYS 22  19  19  LYS LYS A . n 
A 1 23  ASN 23  20  20  ASN ASN A . n 
A 1 24  GLU 24  21  21  GLU GLU A . n 
A 1 25  PHE 25  22  22  PHE PHE A . n 
A 1 26  ASP 26  23  23  ASP ASP A . n 
A 1 27  LYS 27  24  24  LYS LYS A . n 
A 1 28  ASP 28  25  25  ASP ASP A . n 
A 1 29  ASP 29  26  26  ASP ASP A . n 
A 1 30  LYS 30  27  27  LYS LYS A . n 
A 1 31  ARG 31  28  28  ARG ARG A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  GLU 33  30  30  GLU GLU A . n 
A 1 34  LYS 34  31  31  LYS LYS A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  SER 36  33  33  SER SER A . n 
A 1 37  LEU 37  34  34  LEU LEU A . n 
A 1 38  LYS 38  35  35  LYS LYS A . n 
A 1 39  HIS 39  36  36  HIS HIS A . n 
A 1 40  GLN 40  37  37  GLN GLN A . n 
A 1 41  ASN 41  38  38  ASN ASN A . n 
A 1 42  ILE 42  39  39  ILE ILE A . n 
A 1 43  TYR 43  40  40  TYR TYR A . n 
A 1 44  PHE 44  41  41  PHE PHE A . n 
A 1 45  ASP 45  42  42  ASP ASP A . n 
A 1 46  TYR 46  43  43  TYR TYR A . n 
A 1 47  SER 47  44  44  SER SER A . n 
A 1 48  LYS 48  45  45  LYS LYS A . n 
A 1 49  ASN 49  46  46  ASN ASN A . n 
A 1 50  LEU 50  47  47  LEU LEU A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ASN 52  49  49  ASN ASN A . n 
A 1 53  ASP 53  50  50  ASP ASP A . n 
A 1 54  TYR 54  51  51  TYR TYR A . n 
A 1 55  ILE 55  52  52  ILE ILE A . n 
A 1 56  LEU 56  53  53  LEU LEU A . n 
A 1 57  LYS 57  54  54  LYS LYS A . n 
A 1 58  SER 58  55  55  SER SER A . n 
A 1 59  LEU 59  56  56  LEU LEU A . n 
A 1 60  LEU 60  57  57  LEU LEU A . n 
A 1 61  GLU 61  58  58  GLU GLU A . n 
A 1 62  SER 62  59  59  SER SER A . n 
A 1 63  ALA 63  60  60  ALA ALA A . n 
A 1 64  GLU 64  61  61  GLU GLU A . n 
A 1 65  LYS 65  62  62  LYS LYS A . n 
A 1 66  SER 66  63  63  SER SER A . n 
A 1 67  SER 67  64  64  SER SER A . n 
A 1 68  LEU 68  65  65  LEU LEU A . n 
A 1 69  LYS 69  66  66  LYS LYS A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  LYS 71  68  68  LYS LYS A . n 
A 1 72  ILE 72  69  69  ILE ILE A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  MET 75  72  72  MET MET A . n 
A 1 76  PHE 76  73  73  PHE PHE A . n 
A 1 77  ASN 77  74  74  ASN ASN A . n 
A 1 78  GLY 78  75  75  GLY GLY A . n 
A 1 79  ALA 79  76  76  ALA ALA A . n 
A 1 80  LYS 80  77  77  LYS LYS A . n 
A 1 81  ILE 81  78  78  ILE ILE A . n 
A 1 82  ASN 82  79  79  ASN ASN A . n 
A 1 83  SER 83  80  80  SER SER A . n 
A 1 84  THR 84  81  81  THR THR A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  HIS 86  83  83  HIS HIS A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  ALA 88  85  85  ALA ALA A . n 
A 1 89  VAL 89  86  86  VAL VAL A . n 
A 1 90  LEU 90  87  87  LEU LEU A . n 
A 1 91  HIS 91  88  88  HIS HIS A . n 
A 1 92  THR 92  89  89  THR THR A . n 
A 1 93  ALA 93  90  90  ALA ALA A . n 
A 1 94  LEU 94  91  91  LEU LEU A . n 
A 1 95  ARG 95  92  92  ARG ARG A . n 
A 1 96  ASP 96  93  93  ASP ASP A . n 
A 1 97  LEU 97  94  94  LEU LEU A . n 
A 1 98  SER 98  95  95  SER SER A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 THR 100 97  97  THR THR A . n 
A 1 101 PRO 101 98  98  PRO PRO A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ILE 103 100 100 ILE ILE A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 ASP 105 102 102 ASP ASP A . n 
A 1 106 GLY 106 103 103 GLY GLY A . n 
A 1 107 GLN 107 104 104 GLN GLN A . n 
A 1 108 ASP 108 105 105 ASP ASP A . n 
A 1 109 ILE 109 106 106 ILE ILE A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 GLN 111 108 108 GLN GLN A . n 
A 1 112 GLU 112 109 109 GLU GLU A . n 
A 1 113 VAL 113 110 110 VAL VAL A . n 
A 1 114 THR 114 111 111 THR THR A . n 
A 1 115 LYS 115 112 112 LYS LYS A . n 
A 1 116 GLU 116 113 113 GLU GLU A . n 
A 1 117 LYS 117 114 114 LYS LYS A . n 
A 1 118 GLN 118 115 115 GLN GLN A . n 
A 1 119 ARG 119 116 116 ARG ARG A . n 
A 1 120 VAL 120 117 117 VAL VAL A . n 
A 1 121 LYS 121 118 118 LYS LYS A . n 
A 1 122 GLU 122 119 119 GLU GLU A . n 
A 1 123 LEU 123 120 120 LEU LEU A . n 
A 1 124 VAL 124 121 121 VAL VAL A . n 
A 1 125 GLU 125 122 122 GLU GLU A . n 
A 1 126 LYS 126 123 123 LYS LYS A . n 
A 1 127 VAL 127 124 124 VAL VAL A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 SER 129 126 126 SER SER A . n 
A 1 130 GLY 130 127 127 GLY GLY A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 TRP 132 129 129 TRP TRP A . n 
A 1 133 ARG 133 130 130 ARG ARG A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PHE 135 132 132 PHE PHE A . n 
A 1 136 SER 136 133 133 SER SER A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 LYS 138 135 135 LYS LYS A . n 
A 1 139 LYS 139 136 136 LYS LYS A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 THR 141 138 138 THR THR A . n 
A 1 142 ASP 142 139 139 ASP ASP A . n 
A 1 143 ILE 143 140 140 ILE ILE A . n 
A 1 144 VAL 144 141 141 VAL VAL A . n 
A 1 145 ASN 145 142 142 ASN ASN A . n 
A 1 146 ILE 146 143 143 ILE ILE A . n 
A 1 147 GLY 147 144 144 GLY GLY A . n 
A 1 148 ILE 148 145 145 ILE ILE A . n 
A 1 149 GLY 149 146 146 GLY GLY A . n 
A 1 150 GLY 150 147 147 GLY GLY A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 ASP 152 149 149 ASP ASP A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PRO 155 152 152 PRO PRO A . n 
A 1 156 LYS 156 153 153 LYS LYS A . n 
A 1 157 MET 157 154 154 MET MET A . n 
A 1 158 VAL 158 155 155 VAL VAL A . n 
A 1 159 VAL 159 156 156 VAL VAL A . n 
A 1 160 ARG 160 157 157 ARG ARG A . n 
A 1 161 ALA 161 158 158 ALA ALA A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 GLN 163 160 160 GLN GLN A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 TYR 165 162 162 TYR TYR A . n 
A 1 166 HIS 166 163 163 HIS HIS A . n 
A 1 167 CYS 167 164 164 CYS CYS A . n 
A 1 168 THR 168 165 165 THR THR A . n 
A 1 169 ASP 169 166 166 ASP ASP A . n 
A 1 170 LEU 170 167 167 LEU LEU A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 VAL 172 169 169 VAL VAL A . n 
A 1 173 HIS 173 170 170 HIS HIS A . n 
A 1 174 PHE 174 171 171 PHE PHE A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 SER 176 173 173 SER SER A . n 
A 1 177 ASN 177 174 174 ASN ASN A . n 
A 1 178 VAL 178 175 175 VAL VAL A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ASP 181 178 178 ASP ASP A . n 
A 1 182 SER 182 179 179 SER SER A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 LEU 184 181 181 LEU LEU A . n 
A 1 185 GLN 185 182 182 GLN GLN A . n 
A 1 186 ALA 186 183 183 ALA ALA A . n 
A 1 187 LEU 187 184 184 LEU LEU A . n 
A 1 188 HIS 188 185 185 HIS HIS A . n 
A 1 189 VAL 189 186 186 VAL VAL A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 ASP 191 188 188 ASP ASP A . n 
A 1 192 PRO 192 189 189 PRO PRO A . n 
A 1 193 GLU 193 190 190 GLU GLU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 THR 195 192 192 THR THR A . n 
A 1 196 LEU 196 193 193 LEU LEU A . n 
A 1 197 LEU 197 194 194 LEU LEU A . n 
A 1 198 ILE 198 195 195 ILE ILE A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 ALA 200 197 197 ALA ALA A . n 
A 1 201 SER 201 198 198 SER SER A . n 
A 1 202 LYS 202 199 199 LYS LYS A . n 
A 1 203 SER 203 200 200 SER SER A . n 
A 1 204 PHE 204 201 201 PHE PHE A . n 
A 1 205 SER 205 202 202 SER SER A . n 
A 1 206 THR 206 203 203 THR THR A . n 
A 1 207 GLU 207 204 204 GLU GLU A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 THR 209 206 206 THR THR A . n 
A 1 210 LEU 210 207 207 LEU LEU A . n 
A 1 211 LEU 211 208 208 LEU LEU A . n 
A 1 212 ASN 212 209 209 ASN ASN A . n 
A 1 213 SER 213 210 210 SER SER A . n 
A 1 214 ILE 214 211 211 ILE ILE A . n 
A 1 215 SER 215 212 212 SER SER A . n 
A 1 216 ALA 216 213 213 ALA ALA A . n 
A 1 217 ARG 217 214 214 ARG ARG A . n 
A 1 218 GLU 218 215 215 GLU GLU A . n 
A 1 219 TRP 219 216 216 TRP TRP A . n 
A 1 220 LEU 220 217 217 LEU LEU A . n 
A 1 221 LEU 221 218 218 LEU LEU A . n 
A 1 222 ASP 222 219 219 ASP ASP A . n 
A 1 223 HIS 223 220 220 HIS HIS A . n 
A 1 224 TYR 224 221 221 TYR TYR A . n 
A 1 225 GLU 225 222 222 GLU GLU A . n 
A 1 226 ASP 226 223 223 ASP ASP A . n 
A 1 227 GLU 227 224 224 GLU GLU A . n 
A 1 228 LYS 228 225 225 LYS LYS A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 VAL 230 227 227 VAL VAL A . n 
A 1 231 ALA 231 228 228 ALA ALA A . n 
A 1 232 ASN 232 229 229 ASN ASN A . n 
A 1 233 HIS 233 230 230 HIS HIS A . n 
A 1 234 PHE 234 231 231 PHE PHE A . n 
A 1 235 VAL 235 232 232 VAL VAL A . n 
A 1 236 ALA 236 233 233 ALA ALA A . n 
A 1 237 ILE 237 234 234 ILE ILE A . n 
A 1 238 SER 238 235 235 SER SER A . n 
A 1 239 SER 239 236 236 SER SER A . n 
A 1 240 LYS 240 237 237 LYS LYS A . n 
A 1 241 LEU 241 238 238 LEU LEU A . n 
A 1 242 ASP 242 239 239 ASP ASP A . n 
A 1 243 LYS 243 240 240 LYS LYS A . n 
A 1 244 VAL 244 241 241 VAL VAL A . n 
A 1 245 LYS 245 242 242 LYS LYS A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 PHE 247 244 244 PHE PHE A . n 
A 1 248 GLY 248 245 245 GLY GLY A . n 
A 1 249 ILE 249 246 246 ILE ILE A . n 
A 1 250 ASP 250 247 247 ASP ASP A . n 
A 1 251 LEU 251 248 248 LEU LEU A . n 
A 1 252 GLU 252 249 249 GLU GLU A . n 
A 1 253 HIS 253 250 250 HIS HIS A . n 
A 1 254 CYS 254 251 251 CYS CYS A . n 
A 1 255 TYR 255 252 252 TYR TYR A . n 
A 1 256 LYS 256 253 253 LYS LYS A . n 
A 1 257 MET 257 254 254 MET MET A . n 
A 1 258 TRP 258 255 255 TRP TRP A . n 
A 1 259 ASP 259 256 256 ASP ASP A . n 
A 1 260 TRP 260 257 257 TRP TRP A . n 
A 1 261 VAL 261 258 258 VAL VAL A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 ARG 264 261 261 ARG ARG A . n 
A 1 265 TYR 265 262 262 TYR TYR A . n 
A 1 266 SER 266 263 263 SER SER A . n 
A 1 267 LEU 267 264 264 LEU LEU A . n 
A 1 268 TRP 268 265 265 TRP TRP A . n 
A 1 269 SER 269 266 266 SER SER A . n 
A 1 270 SER 270 267 267 SER SER A . n 
A 1 271 ILE 271 268 268 ILE ILE A . n 
A 1 272 GLY 272 269 269 GLY GLY A . n 
A 1 273 MET 273 270 270 MET MET A . n 
A 1 274 SER 274 271 271 SER SER A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ALA 276 273 273 ALA ALA A . n 
A 1 277 PHE 277 274 274 PHE PHE A . n 
A 1 278 ALA 278 275 275 ALA ALA A . n 
A 1 279 ILE 279 276 276 ILE ILE A . n 
A 1 280 GLY 280 277 277 GLY GLY A . n 
A 1 281 TYR 281 278 278 TYR TYR A . n 
A 1 282 ASP 282 279 279 ASP ASP A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 GLU 285 282 282 GLU GLU A . n 
A 1 286 LYS 286 283 283 LYS LYS A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 LEU 288 285 285 LEU LEU A . n 
A 1 289 ALA 289 286 286 ALA ALA A . n 
A 1 290 GLY 290 287 287 GLY GLY A . n 
A 1 291 ALA 291 288 288 ALA ALA A . n 
A 1 292 TYR 292 289 289 TYR TYR A . n 
A 1 293 SER 293 290 290 SER SER A . n 
A 1 294 VAL 294 291 291 VAL VAL A . n 
A 1 295 ASP 295 292 292 ASP ASP A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 HIS 297 294 294 HIS HIS A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 LYS 299 296 296 LYS LYS A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 THR 301 298 298 THR THR A . n 
A 1 302 GLU 302 299 299 GLU GLU A . n 
A 1 303 PHE 303 300 300 PHE PHE A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LYS 305 302 302 LYS LYS A . n 
A 1 306 ASN 306 303 303 ASN ASN A . n 
A 1 307 ILE 307 304 304 ILE ILE A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 VAL 309 306 306 VAL VAL A . n 
A 1 310 ILE 310 307 307 ILE ILE A . n 
A 1 311 MET 311 308 308 MET MET A . n 
A 1 312 ALA 312 309 309 ALA ALA A . n 
A 1 313 LEU 313 310 310 LEU LEU A . n 
A 1 314 LEU 314 311 311 LEU LEU A . n 
A 1 315 ALA 315 312 312 ALA ALA A . n 
A 1 316 SER 316 313 313 SER SER A . n 
A 1 317 TYR 317 314 314 TYR TYR A . n 
A 1 318 TYR 318 315 315 TYR TYR A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 CYS 320 317 317 CYS CYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 TYR 322 319 319 TYR TYR A . n 
A 1 323 ASN 323 320 320 ASN ASN A . n 
A 1 324 SER 324 321 321 SER SER A . n 
A 1 325 GLN 325 322 322 GLN GLN A . n 
A 1 326 SER 326 323 323 SER SER A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 ALA 328 325 325 ALA ALA A . n 
A 1 329 LEU 329 326 326 LEU LEU A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 PRO 331 328 328 PRO PRO A . n 
A 1 332 TYR 332 329 329 TYR TYR A . n 
A 1 333 ASP 333 330 330 ASP ASP A . n 
A 1 334 GLU 334 331 331 GLU GLU A . n 
A 1 335 ARG 335 332 332 ARG ARG A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 CYS 337 334 334 CYS CYS A . n 
A 1 338 TYR 338 335 335 TYR TYR A . n 
A 1 339 PHE 339 336 336 PHE PHE A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 ASP 341 338 338 ASP ASP A . n 
A 1 342 TYR 342 339 339 TYR TYR A . n 
A 1 343 LEU 343 340 340 LEU LEU A . n 
A 1 344 GLN 344 341 341 GLN GLN A . n 
A 1 345 GLN 345 342 342 GLN GLN A . n 
A 1 346 ALA 346 343 343 ALA ALA A . n 
A 1 347 ASP 347 344 344 ASP ASP A . n 
A 1 348 MET 348 345 345 MET MET A . n 
A 1 349 GLU 349 346 346 GLU GLU A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 GLY 352 349 349 GLY GLY A . n 
A 1 353 LYS 353 350 350 LYS LYS A . n 
A 1 354 SER 354 351 351 SER SER A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 ASN 356 353 353 ASN ASN A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 ALA 358 355 355 ALA ALA A . n 
A 1 359 GLY 359 356 356 GLY GLY A . n 
A 1 360 GLU 360 357 357 GLU GLU A . n 
A 1 361 THR 361 358 358 THR THR A . n 
A 1 362 VAL 362 359 359 VAL VAL A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 TYR 364 361 361 TYR TYR A . n 
A 1 365 GLN 365 362 362 GLN GLN A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 GLY 367 364 364 GLY GLY A . n 
A 1 368 VAL 368 365 365 VAL VAL A . n 
A 1 369 VAL 369 366 366 VAL VAL A . n 
A 1 370 LEU 370 367 367 LEU LEU A . n 
A 1 371 TRP 371 368 368 TRP TRP A . n 
A 1 372 GLY 372 369 369 GLY GLY A . n 
A 1 373 GLY 373 370 370 GLY GLY A . n 
A 1 374 VAL 374 371 371 VAL VAL A . n 
A 1 375 GLY 375 372 372 GLY GLY A . n 
A 1 376 THR 376 373 373 THR THR A . n 
A 1 377 ASN 377 374 374 ASN ASN A . n 
A 1 378 GLY 378 375 375 GLY GLY A . n 
A 1 379 GLN 379 376 376 GLN GLN A . n 
A 1 380 HIS 380 377 377 HIS HIS A . n 
A 1 381 ALA 381 378 378 ALA ALA A . n 
A 1 382 PHE 382 379 379 PHE PHE A . n 
A 1 383 HIS 383 380 380 HIS HIS A . n 
A 1 384 GLN 384 381 381 GLN GLN A . n 
A 1 385 LEU 385 382 382 LEU LEU A . n 
A 1 386 LEU 386 383 383 LEU LEU A . n 
A 1 387 HIS 387 384 384 HIS HIS A . n 
A 1 388 GLN 388 385 385 GLN GLN A . n 
A 1 389 GLY 389 386 386 GLY GLY A . n 
A 1 390 ASN 390 387 387 ASN ASN A . n 
A 1 391 ILE 391 388 388 ILE ILE A . n 
A 1 392 PHE 392 389 389 PHE PHE A . n 
A 1 393 ILE 393 390 390 ILE ILE A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 VAL 395 392 392 VAL VAL A . n 
A 1 396 ASP 396 393 393 ASP ASP A . n 
A 1 397 PHE 397 394 394 PHE PHE A . n 
A 1 398 ILE 398 395 395 ILE ILE A . n 
A 1 399 ALA 399 396 396 ALA ALA A . n 
A 1 400 ILE 400 397 397 ILE ILE A . n 
A 1 401 ALA 401 398 398 ALA ALA A . n 
A 1 402 THR 402 399 399 THR THR A . n 
A 1 403 SER 403 400 400 SER SER A . n 
A 1 404 HIS 404 401 401 HIS HIS A . n 
A 1 405 HIS 405 402 402 HIS HIS A . n 
A 1 406 ASN 406 403 403 ASN ASN A . n 
A 1 407 TYR 407 404 404 TYR TYR A . n 
A 1 408 ASP 408 405 405 ASP ASP A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 HIS 410 407 407 HIS HIS A . n 
A 1 411 GLN 411 408 408 GLN GLN A . n 
A 1 412 GLN 412 409 409 GLN GLN A . n 
A 1 413 ALA 413 410 410 ALA ALA A . n 
A 1 414 LEU 414 411 411 LEU LEU A . n 
A 1 415 LEU 415 412 412 LEU LEU A . n 
A 1 416 ALA 416 413 413 ALA ALA A . n 
A 1 417 ASN 417 414 414 ASN ASN A . n 
A 1 418 CYS 418 415 415 CYS CYS A . n 
A 1 419 PHE 419 416 416 PHE PHE A . n 
A 1 420 ALA 420 417 417 ALA ALA A . n 
A 1 421 GLN 421 418 418 GLN GLN A . n 
A 1 422 SER 422 419 419 SER SER A . n 
A 1 423 GLN 423 420 420 GLN GLN A . n 
A 1 424 ALA 424 421 421 ALA ALA A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 MET 426 423 423 MET MET A . n 
A 1 427 PHE 427 424 424 PHE PHE A . n 
A 1 428 GLY 428 425 425 GLY GLY A . n 
A 1 429 GLN 429 426 426 GLN GLN A . n 
A 1 430 SER 430 427 427 SER SER A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 ASP 432 429 429 ASP ASP A . n 
A 1 433 MET 433 430 430 MET MET A . n 
A 1 434 VAL 434 431 431 VAL VAL A . n 
A 1 435 TYR 435 432 432 TYR TYR A . n 
A 1 436 ASN 436 433 433 ASN ASN A . n 
A 1 437 GLU 437 434 434 GLU GLU A . n 
A 1 438 LEU 438 435 435 LEU LEU A . n 
A 1 439 LEU 439 436 436 LEU LEU A . n 
A 1 440 LYS 440 437 437 LYS LYS A . n 
A 1 441 SER 441 438 438 SER SER A . n 
A 1 442 GLY 442 439 439 GLY GLY A . n 
A 1 443 LEU 443 440 440 LEU LEU A . n 
A 1 444 ASN 444 441 441 ASN ASN A . n 
A 1 445 GLU 445 442 442 GLU GLU A . n 
A 1 446 THR 446 443 443 THR THR A . n 
A 1 447 GLN 447 444 444 GLN GLN A . n 
A 1 448 ALA 448 445 445 ALA ALA A . n 
A 1 449 LYS 449 446 446 LYS LYS A . n 
A 1 450 GLU 450 447 447 GLU GLU A . n 
A 1 451 LEU 451 448 448 LEU LEU A . n 
A 1 452 ALA 452 449 449 ALA ALA A . n 
A 1 453 ALA 453 450 450 ALA ALA A . n 
A 1 454 HIS 454 451 451 HIS HIS A . n 
A 1 455 LYS 455 452 452 LYS LYS A . n 
A 1 456 VAL 456 453 453 VAL VAL A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PRO 458 455 455 PRO PRO A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 ASN 460 457 457 ASN ASN A . n 
A 1 461 ARG 461 458 458 ARG ARG A . n 
A 1 462 PRO 462 459 459 PRO PRO A . n 
A 1 463 SER 463 460 460 SER SER A . n 
A 1 464 THR 464 461 461 THR THR A . n 
A 1 465 THR 465 462 462 THR THR A . n 
A 1 466 ILE 466 463 463 ILE ILE A . n 
A 1 467 LEU 467 464 464 LEU LEU A . n 
A 1 468 LEU 468 465 465 LEU LEU A . n 
A 1 469 ASP 469 466 466 ASP ASP A . n 
A 1 470 GLU 470 467 467 GLU GLU A . n 
A 1 471 LEU 471 468 468 LEU LEU A . n 
A 1 472 SER 472 469 469 SER SER A . n 
A 1 473 PRO 473 470 470 PRO PRO A . n 
A 1 474 TYR 474 471 471 TYR TYR A . n 
A 1 475 SER 475 472 472 SER SER A . n 
A 1 476 LEU 476 473 473 LEU LEU A . n 
A 1 477 GLY 477 474 474 GLY GLY A . n 
A 1 478 ALA 478 475 475 ALA ALA A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 ILE 480 477 477 ILE ILE A . n 
A 1 481 ALA 481 478 478 ALA ALA A . n 
A 1 482 LEU 482 479 479 LEU LEU A . n 
A 1 483 TYR 483 480 480 TYR TYR A . n 
A 1 484 GLU 484 481 481 GLU GLU A . n 
A 1 485 HIS 485 482 482 HIS HIS A . n 
A 1 486 LYS 486 483 483 LYS LYS A . n 
A 1 487 ILE 487 484 484 ILE ILE A . n 
A 1 488 PHE 488 485 485 PHE PHE A . n 
A 1 489 VAL 489 486 486 VAL VAL A . n 
A 1 490 GLN 490 487 487 GLN GLN A . n 
A 1 491 GLY 491 488 488 GLY GLY A . n 
A 1 492 VAL 492 489 489 VAL VAL A . n 
A 1 493 LEU 493 490 490 LEU LEU A . n 
A 1 494 TRP 494 491 491 TRP TRP A . n 
A 1 495 ASP 495 492 492 ASP ASP A . n 
A 1 496 ILE 496 493 493 ILE ILE A . n 
A 1 497 ASN 497 494 494 ASN ASN A . n 
A 1 498 SER 498 495 495 SER SER A . n 
A 1 499 TYR 499 496 496 TYR TYR A . n 
A 1 500 ASP 500 497 497 ASP ASP A . n 
A 1 501 GLN 501 498 498 GLN GLN A . n 
A 1 502 TRP 502 499 499 TRP TRP A . n 
A 1 503 GLY 503 500 500 GLY GLY A . n 
A 1 504 VAL 504 501 501 VAL VAL A . n 
A 1 505 GLU 505 502 502 GLU GLU A . n 
A 1 506 LEU 506 503 503 LEU LEU A . n 
A 1 507 GLY 507 504 504 GLY GLY A . n 
A 1 508 LYS 508 505 505 LYS LYS A . n 
A 1 509 LYS 509 506 506 LYS LYS A . n 
A 1 510 LEU 510 507 507 LEU LEU A . n 
A 1 511 GLY 511 508 508 GLY GLY A . n 
A 1 512 LYS 512 509 509 LYS LYS A . n 
A 1 513 ASN 513 510 510 ASN ASN A . n 
A 1 514 ILE 514 511 511 ILE ILE A . n 
A 1 515 LEU 515 512 512 LEU LEU A . n 
A 1 516 LYS 516 513 513 LYS LYS A . n 
A 1 517 ALA 517 514 514 ALA ALA A . n 
A 1 518 MET 518 515 515 MET MET A . n 
A 1 519 ASN 519 516 516 ASN ASN A . n 
A 1 520 ASP 520 517 517 ASP ASP A . n 
A 1 521 ASP 521 518 518 ASP ASP A . n 
A 1 522 SER 522 519 519 SER SER A . n 
A 1 523 SER 523 520 520 SER SER A . n 
A 1 524 ASP 524 521 521 ASP ASP A . n 
A 1 525 GLU 525 522 522 GLU GLU A . n 
A 1 526 TYR 526 523 523 TYR TYR A . n 
A 1 527 GLN 527 524 524 GLN GLN A . n 
A 1 528 ASN 528 525 525 ASN ASN A . n 
A 1 529 LEU 529 526 526 LEU LEU A . n 
A 1 530 ASP 530 527 527 ASP ASP A . n 
A 1 531 ASP 531 528 528 ASP ASP A . n 
A 1 532 SER 532 529 529 SER SER A . n 
A 1 533 THR 533 530 530 THR THR A . n 
A 1 534 ARG 534 531 531 ARG ARG A . n 
A 1 535 GLN 535 532 532 GLN GLN A . n 
A 1 536 LEU 536 533 533 LEU LEU A . n 
A 1 537 ILE 537 534 534 ILE ILE A . n 
A 1 538 ALA 538 535 535 ALA ALA A . n 
A 1 539 LYS 539 536 536 LYS LYS A . n 
A 1 540 VAL 540 537 537 VAL VAL A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 ASN 542 539 539 ASN ASN A . n 
A 1 543 LYS 543 540 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Center for Structural Genomics of Infectious Diseases' 
_pdbx_SG_project.initial_of_center     CSGID 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 6PG 1   601  601 6PG 6PG A . 
C 3 MES 1   602  602 MES MES A . 
D 3 MES 1   603  603 MES MES A . 
E 4 PO4 1   604  604 PO4 PO4 A . 
F 5 IPA 1   605  605 IPA IPA A . 
G 6 CA  1   606  606 CA  CA  A . 
H 7 HOH 1   541  1   HOH HOH A . 
H 7 HOH 2   542  2   HOH HOH A . 
H 7 HOH 3   543  3   HOH HOH A . 
H 7 HOH 4   544  4   HOH HOH A . 
H 7 HOH 5   545  5   HOH HOH A . 
H 7 HOH 6   546  6   HOH HOH A . 
H 7 HOH 7   547  7   HOH HOH A . 
H 7 HOH 8   548  8   HOH HOH A . 
H 7 HOH 9   549  9   HOH HOH A . 
H 7 HOH 10  550  10  HOH HOH A . 
H 7 HOH 11  551  11  HOH HOH A . 
H 7 HOH 12  552  12  HOH HOH A . 
H 7 HOH 13  553  13  HOH HOH A . 
H 7 HOH 14  554  14  HOH HOH A . 
H 7 HOH 15  555  15  HOH HOH A . 
H 7 HOH 16  556  16  HOH HOH A . 
H 7 HOH 17  557  17  HOH HOH A . 
H 7 HOH 18  558  18  HOH HOH A . 
H 7 HOH 19  559  19  HOH HOH A . 
H 7 HOH 20  560  20  HOH HOH A . 
H 7 HOH 21  561  21  HOH HOH A . 
H 7 HOH 22  562  22  HOH HOH A . 
H 7 HOH 23  563  23  HOH HOH A . 
H 7 HOH 24  564  24  HOH HOH A . 
H 7 HOH 25  565  25  HOH HOH A . 
H 7 HOH 26  566  26  HOH HOH A . 
H 7 HOH 27  567  27  HOH HOH A . 
H 7 HOH 28  568  28  HOH HOH A . 
H 7 HOH 29  569  29  HOH HOH A . 
H 7 HOH 30  570  30  HOH HOH A . 
H 7 HOH 31  571  31  HOH HOH A . 
H 7 HOH 32  572  32  HOH HOH A . 
H 7 HOH 33  573  33  HOH HOH A . 
H 7 HOH 34  574  34  HOH HOH A . 
H 7 HOH 35  575  35  HOH HOH A . 
H 7 HOH 36  576  36  HOH HOH A . 
H 7 HOH 37  577  37  HOH HOH A . 
H 7 HOH 38  578  38  HOH HOH A . 
H 7 HOH 39  579  39  HOH HOH A . 
H 7 HOH 40  580  40  HOH HOH A . 
H 7 HOH 41  581  41  HOH HOH A . 
H 7 HOH 42  582  42  HOH HOH A . 
H 7 HOH 43  583  43  HOH HOH A . 
H 7 HOH 44  584  44  HOH HOH A . 
H 7 HOH 45  585  45  HOH HOH A . 
H 7 HOH 46  586  46  HOH HOH A . 
H 7 HOH 47  587  47  HOH HOH A . 
H 7 HOH 48  588  48  HOH HOH A . 
H 7 HOH 49  589  49  HOH HOH A . 
H 7 HOH 50  590  50  HOH HOH A . 
H 7 HOH 51  591  51  HOH HOH A . 
H 7 HOH 52  592  52  HOH HOH A . 
H 7 HOH 53  593  53  HOH HOH A . 
H 7 HOH 54  594  54  HOH HOH A . 
H 7 HOH 55  595  55  HOH HOH A . 
H 7 HOH 56  596  56  HOH HOH A . 
H 7 HOH 57  597  57  HOH HOH A . 
H 7 HOH 58  598  58  HOH HOH A . 
H 7 HOH 59  599  59  HOH HOH A . 
H 7 HOH 60  600  60  HOH HOH A . 
H 7 HOH 61  607  61  HOH HOH A . 
H 7 HOH 62  608  62  HOH HOH A . 
H 7 HOH 63  609  63  HOH HOH A . 
H 7 HOH 64  610  64  HOH HOH A . 
H 7 HOH 65  611  65  HOH HOH A . 
H 7 HOH 66  612  66  HOH HOH A . 
H 7 HOH 67  613  67  HOH HOH A . 
H 7 HOH 68  614  68  HOH HOH A . 
H 7 HOH 69  615  69  HOH HOH A . 
H 7 HOH 70  616  70  HOH HOH A . 
H 7 HOH 71  617  71  HOH HOH A . 
H 7 HOH 72  618  72  HOH HOH A . 
H 7 HOH 73  619  73  HOH HOH A . 
H 7 HOH 74  620  74  HOH HOH A . 
H 7 HOH 75  621  75  HOH HOH A . 
H 7 HOH 76  622  76  HOH HOH A . 
H 7 HOH 77  623  77  HOH HOH A . 
H 7 HOH 78  624  78  HOH HOH A . 
H 7 HOH 79  625  79  HOH HOH A . 
H 7 HOH 80  626  80  HOH HOH A . 
H 7 HOH 81  627  81  HOH HOH A . 
H 7 HOH 82  628  82  HOH HOH A . 
H 7 HOH 83  629  83  HOH HOH A . 
H 7 HOH 84  630  84  HOH HOH A . 
H 7 HOH 85  631  85  HOH HOH A . 
H 7 HOH 86  632  86  HOH HOH A . 
H 7 HOH 87  633  87  HOH HOH A . 
H 7 HOH 88  634  88  HOH HOH A . 
H 7 HOH 89  635  89  HOH HOH A . 
H 7 HOH 90  636  90  HOH HOH A . 
H 7 HOH 91  637  91  HOH HOH A . 
H 7 HOH 92  638  92  HOH HOH A . 
H 7 HOH 93  639  93  HOH HOH A . 
H 7 HOH 94  640  94  HOH HOH A . 
H 7 HOH 95  641  95  HOH HOH A . 
H 7 HOH 96  642  96  HOH HOH A . 
H 7 HOH 97  643  97  HOH HOH A . 
H 7 HOH 98  644  98  HOH HOH A . 
H 7 HOH 99  645  99  HOH HOH A . 
H 7 HOH 100 646  100 HOH HOH A . 
H 7 HOH 101 647  101 HOH HOH A . 
H 7 HOH 102 648  102 HOH HOH A . 
H 7 HOH 103 649  103 HOH HOH A . 
H 7 HOH 104 650  104 HOH HOH A . 
H 7 HOH 105 651  105 HOH HOH A . 
H 7 HOH 106 652  106 HOH HOH A . 
H 7 HOH 107 653  107 HOH HOH A . 
H 7 HOH 108 654  108 HOH HOH A . 
H 7 HOH 109 655  109 HOH HOH A . 
H 7 HOH 110 656  110 HOH HOH A . 
H 7 HOH 111 657  111 HOH HOH A . 
H 7 HOH 112 658  112 HOH HOH A . 
H 7 HOH 113 659  113 HOH HOH A . 
H 7 HOH 114 660  114 HOH HOH A . 
H 7 HOH 115 661  115 HOH HOH A . 
H 7 HOH 116 662  116 HOH HOH A . 
H 7 HOH 117 663  117 HOH HOH A . 
H 7 HOH 118 664  118 HOH HOH A . 
H 7 HOH 119 665  119 HOH HOH A . 
H 7 HOH 120 666  120 HOH HOH A . 
H 7 HOH 121 667  121 HOH HOH A . 
H 7 HOH 122 668  122 HOH HOH A . 
H 7 HOH 123 669  123 HOH HOH A . 
H 7 HOH 124 670  124 HOH HOH A . 
H 7 HOH 125 671  125 HOH HOH A . 
H 7 HOH 126 672  126 HOH HOH A . 
H 7 HOH 127 673  127 HOH HOH A . 
H 7 HOH 128 674  128 HOH HOH A . 
H 7 HOH 129 675  129 HOH HOH A . 
H 7 HOH 130 676  130 HOH HOH A . 
H 7 HOH 131 677  131 HOH HOH A . 
H 7 HOH 132 678  132 HOH HOH A . 
H 7 HOH 133 679  133 HOH HOH A . 
H 7 HOH 134 680  134 HOH HOH A . 
H 7 HOH 135 681  135 HOH HOH A . 
H 7 HOH 136 682  136 HOH HOH A . 
H 7 HOH 137 683  137 HOH HOH A . 
H 7 HOH 138 684  138 HOH HOH A . 
H 7 HOH 139 685  139 HOH HOH A . 
H 7 HOH 140 686  140 HOH HOH A . 
H 7 HOH 141 687  141 HOH HOH A . 
H 7 HOH 142 688  142 HOH HOH A . 
H 7 HOH 143 689  143 HOH HOH A . 
H 7 HOH 144 690  144 HOH HOH A . 
H 7 HOH 145 691  145 HOH HOH A . 
H 7 HOH 146 692  146 HOH HOH A . 
H 7 HOH 147 693  147 HOH HOH A . 
H 7 HOH 148 694  148 HOH HOH A . 
H 7 HOH 149 695  149 HOH HOH A . 
H 7 HOH 150 696  150 HOH HOH A . 
H 7 HOH 151 697  151 HOH HOH A . 
H 7 HOH 152 698  152 HOH HOH A . 
H 7 HOH 153 699  153 HOH HOH A . 
H 7 HOH 154 700  154 HOH HOH A . 
H 7 HOH 155 701  155 HOH HOH A . 
H 7 HOH 156 702  156 HOH HOH A . 
H 7 HOH 157 703  157 HOH HOH A . 
H 7 HOH 158 704  158 HOH HOH A . 
H 7 HOH 159 705  159 HOH HOH A . 
H 7 HOH 160 706  160 HOH HOH A . 
H 7 HOH 161 707  161 HOH HOH A . 
H 7 HOH 162 708  162 HOH HOH A . 
H 7 HOH 163 709  163 HOH HOH A . 
H 7 HOH 164 710  164 HOH HOH A . 
H 7 HOH 165 711  165 HOH HOH A . 
H 7 HOH 166 712  166 HOH HOH A . 
H 7 HOH 167 713  167 HOH HOH A . 
H 7 HOH 168 714  168 HOH HOH A . 
H 7 HOH 169 715  169 HOH HOH A . 
H 7 HOH 170 716  170 HOH HOH A . 
H 7 HOH 171 717  171 HOH HOH A . 
H 7 HOH 172 718  172 HOH HOH A . 
H 7 HOH 173 719  173 HOH HOH A . 
H 7 HOH 174 720  174 HOH HOH A . 
H 7 HOH 175 721  175 HOH HOH A . 
H 7 HOH 176 722  176 HOH HOH A . 
H 7 HOH 177 723  177 HOH HOH A . 
H 7 HOH 178 724  178 HOH HOH A . 
H 7 HOH 179 725  179 HOH HOH A . 
H 7 HOH 180 726  180 HOH HOH A . 
H 7 HOH 181 727  181 HOH HOH A . 
H 7 HOH 182 728  182 HOH HOH A . 
H 7 HOH 183 729  183 HOH HOH A . 
H 7 HOH 184 730  184 HOH HOH A . 
H 7 HOH 185 731  185 HOH HOH A . 
H 7 HOH 186 732  186 HOH HOH A . 
H 7 HOH 187 733  187 HOH HOH A . 
H 7 HOH 188 734  188 HOH HOH A . 
H 7 HOH 189 735  189 HOH HOH A . 
H 7 HOH 190 736  190 HOH HOH A . 
H 7 HOH 191 737  191 HOH HOH A . 
H 7 HOH 192 738  192 HOH HOH A . 
H 7 HOH 193 739  193 HOH HOH A . 
H 7 HOH 194 740  194 HOH HOH A . 
H 7 HOH 195 741  195 HOH HOH A . 
H 7 HOH 196 742  196 HOH HOH A . 
H 7 HOH 197 743  197 HOH HOH A . 
H 7 HOH 198 744  198 HOH HOH A . 
H 7 HOH 199 745  199 HOH HOH A . 
H 7 HOH 200 746  200 HOH HOH A . 
H 7 HOH 201 747  201 HOH HOH A . 
H 7 HOH 202 748  202 HOH HOH A . 
H 7 HOH 203 749  203 HOH HOH A . 
H 7 HOH 204 750  204 HOH HOH A . 
H 7 HOH 205 751  205 HOH HOH A . 
H 7 HOH 206 752  206 HOH HOH A . 
H 7 HOH 207 753  207 HOH HOH A . 
H 7 HOH 208 754  208 HOH HOH A . 
H 7 HOH 209 755  209 HOH HOH A . 
H 7 HOH 210 756  210 HOH HOH A . 
H 7 HOH 211 757  211 HOH HOH A . 
H 7 HOH 212 758  212 HOH HOH A . 
H 7 HOH 213 759  213 HOH HOH A . 
H 7 HOH 214 760  214 HOH HOH A . 
H 7 HOH 215 761  215 HOH HOH A . 
H 7 HOH 216 762  216 HOH HOH A . 
H 7 HOH 217 763  217 HOH HOH A . 
H 7 HOH 218 764  218 HOH HOH A . 
H 7 HOH 219 765  219 HOH HOH A . 
H 7 HOH 220 766  220 HOH HOH A . 
H 7 HOH 221 767  221 HOH HOH A . 
H 7 HOH 222 768  222 HOH HOH A . 
H 7 HOH 223 769  223 HOH HOH A . 
H 7 HOH 224 770  224 HOH HOH A . 
H 7 HOH 225 771  225 HOH HOH A . 
H 7 HOH 226 772  226 HOH HOH A . 
H 7 HOH 227 773  227 HOH HOH A . 
H 7 HOH 228 774  228 HOH HOH A . 
H 7 HOH 229 775  229 HOH HOH A . 
H 7 HOH 230 776  230 HOH HOH A . 
H 7 HOH 231 777  231 HOH HOH A . 
H 7 HOH 232 778  232 HOH HOH A . 
H 7 HOH 233 779  233 HOH HOH A . 
H 7 HOH 234 780  234 HOH HOH A . 
H 7 HOH 235 781  235 HOH HOH A . 
H 7 HOH 236 782  236 HOH HOH A . 
H 7 HOH 237 783  237 HOH HOH A . 
H 7 HOH 238 784  238 HOH HOH A . 
H 7 HOH 239 785  239 HOH HOH A . 
H 7 HOH 240 786  240 HOH HOH A . 
H 7 HOH 241 787  241 HOH HOH A . 
H 7 HOH 242 788  242 HOH HOH A . 
H 7 HOH 243 789  243 HOH HOH A . 
H 7 HOH 244 790  244 HOH HOH A . 
H 7 HOH 245 791  245 HOH HOH A . 
H 7 HOH 246 792  246 HOH HOH A . 
H 7 HOH 247 793  247 HOH HOH A . 
H 7 HOH 248 794  248 HOH HOH A . 
H 7 HOH 249 795  249 HOH HOH A . 
H 7 HOH 250 796  250 HOH HOH A . 
H 7 HOH 251 797  251 HOH HOH A . 
H 7 HOH 252 798  252 HOH HOH A . 
H 7 HOH 253 799  253 HOH HOH A . 
H 7 HOH 254 800  254 HOH HOH A . 
H 7 HOH 255 801  255 HOH HOH A . 
H 7 HOH 256 802  256 HOH HOH A . 
H 7 HOH 257 803  257 HOH HOH A . 
H 7 HOH 258 804  258 HOH HOH A . 
H 7 HOH 259 805  259 HOH HOH A . 
H 7 HOH 260 806  260 HOH HOH A . 
H 7 HOH 261 807  261 HOH HOH A . 
H 7 HOH 262 808  262 HOH HOH A . 
H 7 HOH 263 809  263 HOH HOH A . 
H 7 HOH 264 810  264 HOH HOH A . 
H 7 HOH 265 811  265 HOH HOH A . 
H 7 HOH 266 812  266 HOH HOH A . 
H 7 HOH 267 813  267 HOH HOH A . 
H 7 HOH 268 814  268 HOH HOH A . 
H 7 HOH 269 815  269 HOH HOH A . 
H 7 HOH 270 816  270 HOH HOH A . 
H 7 HOH 271 817  271 HOH HOH A . 
H 7 HOH 272 818  272 HOH HOH A . 
H 7 HOH 273 819  273 HOH HOH A . 
H 7 HOH 274 820  274 HOH HOH A . 
H 7 HOH 275 821  275 HOH HOH A . 
H 7 HOH 276 822  276 HOH HOH A . 
H 7 HOH 277 823  277 HOH HOH A . 
H 7 HOH 278 824  278 HOH HOH A . 
H 7 HOH 279 825  279 HOH HOH A . 
H 7 HOH 280 826  280 HOH HOH A . 
H 7 HOH 281 827  281 HOH HOH A . 
H 7 HOH 282 828  282 HOH HOH A . 
H 7 HOH 283 829  283 HOH HOH A . 
H 7 HOH 284 830  284 HOH HOH A . 
H 7 HOH 285 831  285 HOH HOH A . 
H 7 HOH 286 832  286 HOH HOH A . 
H 7 HOH 287 833  287 HOH HOH A . 
H 7 HOH 288 834  288 HOH HOH A . 
H 7 HOH 289 835  289 HOH HOH A . 
H 7 HOH 290 836  290 HOH HOH A . 
H 7 HOH 291 837  291 HOH HOH A . 
H 7 HOH 292 838  292 HOH HOH A . 
H 7 HOH 293 839  293 HOH HOH A . 
H 7 HOH 294 840  294 HOH HOH A . 
H 7 HOH 295 841  295 HOH HOH A . 
H 7 HOH 296 842  296 HOH HOH A . 
H 7 HOH 297 843  297 HOH HOH A . 
H 7 HOH 298 844  298 HOH HOH A . 
H 7 HOH 299 845  299 HOH HOH A . 
H 7 HOH 300 846  300 HOH HOH A . 
H 7 HOH 301 847  301 HOH HOH A . 
H 7 HOH 302 848  302 HOH HOH A . 
H 7 HOH 303 849  303 HOH HOH A . 
H 7 HOH 304 850  304 HOH HOH A . 
H 7 HOH 305 851  305 HOH HOH A . 
H 7 HOH 306 852  306 HOH HOH A . 
H 7 HOH 307 853  307 HOH HOH A . 
H 7 HOH 308 854  308 HOH HOH A . 
H 7 HOH 309 855  309 HOH HOH A . 
H 7 HOH 310 856  310 HOH HOH A . 
H 7 HOH 311 857  311 HOH HOH A . 
H 7 HOH 312 858  312 HOH HOH A . 
H 7 HOH 313 859  313 HOH HOH A . 
H 7 HOH 314 860  314 HOH HOH A . 
H 7 HOH 315 861  315 HOH HOH A . 
H 7 HOH 316 862  316 HOH HOH A . 
H 7 HOH 317 863  317 HOH HOH A . 
H 7 HOH 318 864  318 HOH HOH A . 
H 7 HOH 319 865  319 HOH HOH A . 
H 7 HOH 320 866  320 HOH HOH A . 
H 7 HOH 321 867  321 HOH HOH A . 
H 7 HOH 322 868  322 HOH HOH A . 
H 7 HOH 323 869  323 HOH HOH A . 
H 7 HOH 324 870  324 HOH HOH A . 
H 7 HOH 325 871  325 HOH HOH A . 
H 7 HOH 326 872  326 HOH HOH A . 
H 7 HOH 327 873  327 HOH HOH A . 
H 7 HOH 328 874  328 HOH HOH A . 
H 7 HOH 329 875  329 HOH HOH A . 
H 7 HOH 330 876  330 HOH HOH A . 
H 7 HOH 331 877  331 HOH HOH A . 
H 7 HOH 332 878  332 HOH HOH A . 
H 7 HOH 333 879  333 HOH HOH A . 
H 7 HOH 334 880  334 HOH HOH A . 
H 7 HOH 335 881  335 HOH HOH A . 
H 7 HOH 336 882  336 HOH HOH A . 
H 7 HOH 337 883  337 HOH HOH A . 
H 7 HOH 338 884  338 HOH HOH A . 
H 7 HOH 339 885  339 HOH HOH A . 
H 7 HOH 340 886  340 HOH HOH A . 
H 7 HOH 341 887  341 HOH HOH A . 
H 7 HOH 342 888  342 HOH HOH A . 
H 7 HOH 343 889  343 HOH HOH A . 
H 7 HOH 344 890  344 HOH HOH A . 
H 7 HOH 345 891  345 HOH HOH A . 
H 7 HOH 346 892  346 HOH HOH A . 
H 7 HOH 347 893  347 HOH HOH A . 
H 7 HOH 348 894  348 HOH HOH A . 
H 7 HOH 349 895  349 HOH HOH A . 
H 7 HOH 350 896  350 HOH HOH A . 
H 7 HOH 351 897  351 HOH HOH A . 
H 7 HOH 352 898  352 HOH HOH A . 
H 7 HOH 353 899  353 HOH HOH A . 
H 7 HOH 354 900  354 HOH HOH A . 
H 7 HOH 355 901  355 HOH HOH A . 
H 7 HOH 356 902  356 HOH HOH A . 
H 7 HOH 357 903  357 HOH HOH A . 
H 7 HOH 358 904  358 HOH HOH A . 
H 7 HOH 359 905  359 HOH HOH A . 
H 7 HOH 360 906  360 HOH HOH A . 
H 7 HOH 361 907  361 HOH HOH A . 
H 7 HOH 362 908  362 HOH HOH A . 
H 7 HOH 363 909  363 HOH HOH A . 
H 7 HOH 364 910  364 HOH HOH A . 
H 7 HOH 365 911  365 HOH HOH A . 
H 7 HOH 366 912  366 HOH HOH A . 
H 7 HOH 367 913  367 HOH HOH A . 
H 7 HOH 368 914  368 HOH HOH A . 
H 7 HOH 369 915  369 HOH HOH A . 
H 7 HOH 370 916  370 HOH HOH A . 
H 7 HOH 371 917  371 HOH HOH A . 
H 7 HOH 372 918  372 HOH HOH A . 
H 7 HOH 373 919  373 HOH HOH A . 
H 7 HOH 374 920  374 HOH HOH A . 
H 7 HOH 375 921  375 HOH HOH A . 
H 7 HOH 376 922  376 HOH HOH A . 
H 7 HOH 377 923  377 HOH HOH A . 
H 7 HOH 378 924  378 HOH HOH A . 
H 7 HOH 379 925  379 HOH HOH A . 
H 7 HOH 380 926  380 HOH HOH A . 
H 7 HOH 381 927  381 HOH HOH A . 
H 7 HOH 382 928  382 HOH HOH A . 
H 7 HOH 383 929  383 HOH HOH A . 
H 7 HOH 384 930  384 HOH HOH A . 
H 7 HOH 385 931  385 HOH HOH A . 
H 7 HOH 386 932  386 HOH HOH A . 
H 7 HOH 387 933  387 HOH HOH A . 
H 7 HOH 388 934  388 HOH HOH A . 
H 7 HOH 389 935  389 HOH HOH A . 
H 7 HOH 390 936  390 HOH HOH A . 
H 7 HOH 391 937  391 HOH HOH A . 
H 7 HOH 392 938  392 HOH HOH A . 
H 7 HOH 393 939  393 HOH HOH A . 
H 7 HOH 394 940  394 HOH HOH A . 
H 7 HOH 395 941  395 HOH HOH A . 
H 7 HOH 396 942  396 HOH HOH A . 
H 7 HOH 397 943  397 HOH HOH A . 
H 7 HOH 398 944  398 HOH HOH A . 
H 7 HOH 399 945  399 HOH HOH A . 
H 7 HOH 400 946  400 HOH HOH A . 
H 7 HOH 401 947  401 HOH HOH A . 
H 7 HOH 402 948  402 HOH HOH A . 
H 7 HOH 403 949  403 HOH HOH A . 
H 7 HOH 404 950  404 HOH HOH A . 
H 7 HOH 405 951  405 HOH HOH A . 
H 7 HOH 406 952  406 HOH HOH A . 
H 7 HOH 407 953  407 HOH HOH A . 
H 7 HOH 408 954  408 HOH HOH A . 
H 7 HOH 409 955  409 HOH HOH A . 
H 7 HOH 410 956  410 HOH HOH A . 
H 7 HOH 411 957  411 HOH HOH A . 
H 7 HOH 412 958  412 HOH HOH A . 
H 7 HOH 413 959  413 HOH HOH A . 
H 7 HOH 414 960  414 HOH HOH A . 
H 7 HOH 415 961  415 HOH HOH A . 
H 7 HOH 416 962  416 HOH HOH A . 
H 7 HOH 417 963  417 HOH HOH A . 
H 7 HOH 418 964  418 HOH HOH A . 
H 7 HOH 419 965  419 HOH HOH A . 
H 7 HOH 420 966  420 HOH HOH A . 
H 7 HOH 421 967  421 HOH HOH A . 
H 7 HOH 422 968  422 HOH HOH A . 
H 7 HOH 423 969  423 HOH HOH A . 
H 7 HOH 424 970  424 HOH HOH A . 
H 7 HOH 425 971  425 HOH HOH A . 
H 7 HOH 426 972  426 HOH HOH A . 
H 7 HOH 427 973  427 HOH HOH A . 
H 7 HOH 428 974  428 HOH HOH A . 
H 7 HOH 429 975  429 HOH HOH A . 
H 7 HOH 430 976  430 HOH HOH A . 
H 7 HOH 431 977  431 HOH HOH A . 
H 7 HOH 432 978  432 HOH HOH A . 
H 7 HOH 433 979  433 HOH HOH A . 
H 7 HOH 434 980  434 HOH HOH A . 
H 7 HOH 435 981  435 HOH HOH A . 
H 7 HOH 436 982  436 HOH HOH A . 
H 7 HOH 437 983  437 HOH HOH A . 
H 7 HOH 438 984  438 HOH HOH A . 
H 7 HOH 439 985  439 HOH HOH A . 
H 7 HOH 440 986  440 HOH HOH A . 
H 7 HOH 441 987  441 HOH HOH A . 
H 7 HOH 442 988  442 HOH HOH A . 
H 7 HOH 443 989  443 HOH HOH A . 
H 7 HOH 444 990  444 HOH HOH A . 
H 7 HOH 445 991  445 HOH HOH A . 
H 7 HOH 446 992  446 HOH HOH A . 
H 7 HOH 447 993  447 HOH HOH A . 
H 7 HOH 448 994  448 HOH HOH A . 
H 7 HOH 449 995  449 HOH HOH A . 
H 7 HOH 450 996  450 HOH HOH A . 
H 7 HOH 451 997  451 HOH HOH A . 
H 7 HOH 452 998  452 HOH HOH A . 
H 7 HOH 453 999  453 HOH HOH A . 
H 7 HOH 454 1000 454 HOH HOH A . 
H 7 HOH 455 1001 455 HOH HOH A . 
H 7 HOH 456 1002 456 HOH HOH A . 
H 7 HOH 457 1003 457 HOH HOH A . 
H 7 HOH 458 1004 458 HOH HOH A . 
H 7 HOH 459 1005 459 HOH HOH A . 
H 7 HOH 460 1006 460 HOH HOH A . 
H 7 HOH 461 1007 461 HOH HOH A . 
H 7 HOH 462 1008 462 HOH HOH A . 
H 7 HOH 463 1009 463 HOH HOH A . 
H 7 HOH 464 1010 464 HOH HOH A . 
H 7 HOH 465 1011 465 HOH HOH A . 
H 7 HOH 466 1012 466 HOH HOH A . 
H 7 HOH 467 1013 467 HOH HOH A . 
H 7 HOH 468 1014 468 HOH HOH A . 
H 7 HOH 469 1015 469 HOH HOH A . 
H 7 HOH 470 1016 470 HOH HOH A . 
H 7 HOH 471 1017 471 HOH HOH A . 
H 7 HOH 472 1018 472 HOH HOH A . 
H 7 HOH 473 1019 473 HOH HOH A . 
H 7 HOH 474 1020 474 HOH HOH A . 
H 7 HOH 475 1021 475 HOH HOH A . 
H 7 HOH 476 1022 476 HOH HOH A . 
H 7 HOH 477 1023 477 HOH HOH A . 
H 7 HOH 478 1024 478 HOH HOH A . 
H 7 HOH 479 1025 479 HOH HOH A . 
H 7 HOH 480 1026 480 HOH HOH A . 
H 7 HOH 481 1027 481 HOH HOH A . 
H 7 HOH 482 1028 482 HOH HOH A . 
H 7 HOH 483 1029 483 HOH HOH A . 
H 7 HOH 484 1030 484 HOH HOH A . 
H 7 HOH 485 1031 485 HOH HOH A . 
H 7 HOH 486 1032 486 HOH HOH A . 
H 7 HOH 487 1033 487 HOH HOH A . 
H 7 HOH 488 1034 488 HOH HOH A . 
H 7 HOH 489 1035 489 HOH HOH A . 
H 7 HOH 490 1036 490 HOH HOH A . 
H 7 HOH 491 1037 491 HOH HOH A . 
H 7 HOH 492 1038 492 HOH HOH A . 
H 7 HOH 493 1039 493 HOH HOH A . 
H 7 HOH 494 1040 494 HOH HOH A . 
H 7 HOH 495 1041 495 HOH HOH A . 
H 7 HOH 496 1042 496 HOH HOH A . 
H 7 HOH 497 1043 497 HOH HOH A . 
H 7 HOH 498 1044 498 HOH HOH A . 
H 7 HOH 499 1045 499 HOH HOH A . 
H 7 HOH 500 1046 500 HOH HOH A . 
H 7 HOH 501 1047 501 HOH HOH A . 
H 7 HOH 502 1048 502 HOH HOH A . 
H 7 HOH 503 1049 503 HOH HOH A . 
H 7 HOH 504 1050 504 HOH HOH A . 
H 7 HOH 505 1051 505 HOH HOH A . 
H 7 HOH 506 1052 506 HOH HOH A . 
H 7 HOH 507 1053 507 HOH HOH A . 
H 7 HOH 508 1054 508 HOH HOH A . 
H 7 HOH 509 1055 509 HOH HOH A . 
H 7 HOH 510 1056 510 HOH HOH A . 
H 7 HOH 511 1057 511 HOH HOH A . 
H 7 HOH 512 1058 512 HOH HOH A . 
H 7 HOH 513 1059 513 HOH HOH A . 
H 7 HOH 514 1060 514 HOH HOH A . 
H 7 HOH 515 1061 515 HOH HOH A . 
H 7 HOH 516 1062 516 HOH HOH A . 
H 7 HOH 517 1063 517 HOH HOH A . 
H 7 HOH 518 1064 518 HOH HOH A . 
H 7 HOH 519 1065 519 HOH HOH A . 
H 7 HOH 520 1066 520 HOH HOH A . 
H 7 HOH 521 1067 521 HOH HOH A . 
H 7 HOH 522 1068 522 HOH HOH A . 
H 7 HOH 523 1069 523 HOH HOH A . 
H 7 HOH 524 1070 524 HOH HOH A . 
H 7 HOH 525 1071 525 HOH HOH A . 
H 7 HOH 526 1072 526 HOH HOH A . 
H 7 HOH 527 1073 527 HOH HOH A . 
H 7 HOH 528 1074 528 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14060 ? 
1 MORE         -84   ? 
1 'SSA (A^2)'  38470 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? A GLU 64 ? A GLU 61  ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 574 ? 1_555 75.5  ? 
2 O ? A GLU 64 ? A GLU 61  ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 573 ? 1_555 89.0  ? 
3 O ? H HOH .  ? A HOH 574 ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 573 ? 1_555 155.8 ? 
4 O ? A GLU 64 ? A GLU 61  ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 592 ? 1_555 77.0  ? 
5 O ? H HOH .  ? A HOH 574 ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 592 ? 1_555 81.3  ? 
6 O ? H HOH .  ? A HOH 573 ? 1_555 CA ? G CA . ? A CA 606 ? 1_555 O ? H HOH . ? A HOH 592 ? 1_555 77.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-02-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         47.0016 
_pdbx_refine_tls.origin_y         57.0068 
_pdbx_refine_tls.origin_z         2.6093 
_pdbx_refine_tls.T[1][1]          0.0091 
_pdbx_refine_tls.T[2][2]          0.0279 
_pdbx_refine_tls.T[3][3]          0.0189 
_pdbx_refine_tls.T[1][2]          -0.0124 
_pdbx_refine_tls.T[1][3]          -0.0121 
_pdbx_refine_tls.T[2][3]          0.0144 
_pdbx_refine_tls.L[1][1]          0.7219 
_pdbx_refine_tls.L[2][2]          0.5051 
_pdbx_refine_tls.L[3][3]          0.3829 
_pdbx_refine_tls.L[1][2]          -0.2347 
_pdbx_refine_tls.L[1][3]          0.2500 
_pdbx_refine_tls.L[2][3]          -0.1715 
_pdbx_refine_tls.S[1][1]          -0.0094 
_pdbx_refine_tls.S[2][2]          -0.0411 
_pdbx_refine_tls.S[3][3]          0.0504 
_pdbx_refine_tls.S[1][2]          0.0163 
_pdbx_refine_tls.S[1][3]          0.0387 
_pdbx_refine_tls.S[2][3]          -0.0630 
_pdbx_refine_tls.S[2][1]          0.0362 
_pdbx_refine_tls.S[3][1]          -0.0289 
_pdbx_refine_tls.S[3][2]          0.0795 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     -10 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     9999 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 SBC-Collect .        ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-3000    .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
7 HKL-3000    .        ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
8 MOLREP      .        ?               ?       ?                    ?                        phasing           ? ?          ? 
9 HKL-3000    .        ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 A ASP 338 ? B O A HOH 782  ? ? 1.47 
2 1 O   A HOH 571 ? ? O A HOH 713  ? ? 1.95 
3 1 O   A HOH 875 ? ? O A HOH 1019 ? ? 1.99 
4 1 O   A HOH 835 ? ? O A HOH 1036 ? ? 2.02 
5 1 O   A HOH 812 ? ? O A HOH 1038 ? ? 2.14 
6 1 CG1 A VAL 501 ? A O A HOH 978  ? ? 2.16 
7 1 O   A HOH 568 ? ? O A HOH 650  ? ? 2.17 
8 1 O   A HOH 580 ? ? O A HOH 806  ? ? 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             251 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            B 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             251 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.701 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.111 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 116 ? ? CZ A ARG 116 ? ? NH2 A ARG 116 ? ? 115.81 120.30 -4.49  0.50 N 
2 1 CB A ASP 188 ? ? CG A ASP 188 ? ? OD1 A ASP 188 ? ? 123.80 118.30 5.50   0.90 N 
3 1 CB A ALA 378 ? ? CA A ALA 378 ? ? C   A ALA 378 ? B 99.71  110.10 -10.39 1.50 N 
4 1 N  A ALA 378 ? ? CA A ALA 378 ? ? C   A ALA 378 ? B 129.22 111.00 18.22  2.70 N 
5 1 CB A ASP 466 ? ? CG A ASP 466 ? ? OD1 A ASP 466 ? ? 126.65 118.30 8.35   0.90 N 
6 1 CB A ASP 466 ? ? CG A ASP 466 ? ? OD2 A ASP 466 ? ? 110.13 118.30 -8.17  0.90 N 
7 1 CA A LEU 507 ? B CB A LEU 507 ? B CG  A LEU 507 ? B 129.88 115.30 14.58  2.30 N 
8 1 CB A LEU 507 ? B CG A LEU 507 ? B CD1 A LEU 507 ? B 84.72  111.00 -26.28 1.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 37  ? ? 50.53   -122.00 
2  1 ASP A 149 ? ? -134.25 -57.26  
3  1 CYS A 164 ? ? -156.70 12.36   
4  1 SER A 173 ? ? -143.17 -67.28  
5  1 LYS A 237 ? ? -115.83 73.46   
6  1 THR A 363 ? ? -109.82 -130.06 
7  1 ALA A 378 ? ? -142.49 -108.30 
8  1 ALA A 378 ? ? -148.32 -47.26  
9  1 SER A 400 ? ? -98.08  -159.09 
10 1 GLN A 498 ? ? -159.13 62.99   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER -2  ? A SER 1   
2 1 Y 1 A LYS 540 ? A LYS 543 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '6-PHOSPHOGLUCONIC ACID'               6PG 
3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
4 'PHOSPHATE ION'                        PO4 
5 'ISOPROPYL ALCOHOL'                    IPA 
6 'CALCIUM ION'                          CA  
7 water                                  HOH 
#