data_3QER
# 
_entry.id   3QER 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QER         
NDB   NA0954       
RCSB  RCSB063552   
WWPDB D_1000063552 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QEI . unspecified 
PDB 3QEP . unspecified 
PDB 3QEX . unspecified 
PDB 3QES . unspecified 
PDB 3QET . unspecified 
PDB 3QEV . unspecified 
PDB 3QEW . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QER 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for Differential Insertion Kinetics of dNMPs Opposite a Difluorotoluene Nucleotide Residue.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                1476 
_citation.page_last                 1485 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22304682 
_citation.pdbx_database_id_DOI      10.1021/bi2016487 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Eom, S.H.'        2 
primary 'Konigsberg, W.H.' 3 
primary 'Wang, J.'         4 
# 
_cell.entry_id           3QER 
_cell.length_a           78.269 
_cell.length_b           118.705 
_cell.length_c           130.523 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QER 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                            104490.945 1   2.7.7.7 
'L561A, S565G, Y567A' ? ?              
2 polymer     syn 
;DNA (5'-D(P*TP*CP*GP*(DFT)P*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5534.583   1   ?       ?                     ? 'DNA Template' 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*(DOC))-3')
;
3951.586   1   ?       ?                     ? 'DNA Primer'   
4 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182    1   ?       ?                     ? ?              
5 non-polymer syn 'CALCIUM ION'                                                               40.078     4   ?       ? ? ? 
6 water       nat water                                                                       18.015     911 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DG)(DFT)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' TCGNGTAAGCAGTCCGCG T 
? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DOC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DFT n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DOC n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Bacteriophage RB69' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PSP72 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? 32630 ? 
3 1 sample ? ? ? ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 3QER       3QER   2 TCGNGTAAGCAGTCCGCG ? ? 
3 PDB 3QER       3QER   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QER A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 3QER T 1 ? 18  ? 3QER   1   ? 18  ? 1   18  
3 3 3QER P 1 ? 13  ? 3QER   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QER ALA A 222 ? UNP Q38087 ASP 222 CONFLICT              222 1 
1 3QER ALA A 327 ? UNP Q38087 ASP 327 CONFLICT              327 2 
1 3QER ALA A 561 ? UNP Q38087 LEU 561 'ENGINEERED MUTATION' 561 3 
1 3QER GLY A 565 ? UNP Q38087 SER 565 'ENGINEERED MUTATION' 565 4 
1 3QER ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                          ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                                                            ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                 ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                      ? 'C9 H14 N3 O7 P'    307.197 
DFT 'DNA linking'       . "1-[2-DEOXYRIBOFURANOSYL]-2,4-DIFLUORO-5-METHYL-BENZENE-5'MONOPHOSPHATE" ? 'C12 H15 F2 O6 P'   324.214 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"                                 ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                             ? 'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                    ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                   ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                               ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                            ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                   ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                               ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                   ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3QER 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   53.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'150 mM CaCl2, 15% (w/v) PEG 350 monomethyl ether (MME), 100 mM sodium cacodylate (pH 6.5), VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2010-08-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3QER 
_reflns.observed_criterion_sigma_I   1.2 
_reflns.observed_criterion_sigma_F   2.4 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.96 
_reflns.number_obs                   82929 
_reflns.number_all                   87586 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.96 
_reflns_shell.d_res_low              1.99 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3QER 
_refine.ls_number_reflns_obs                     82929 
_refine.ls_number_reflns_all                     87586 
_refine.pdbx_ls_sigma_I                          1.2 
_refine.pdbx_ls_sigma_F                          2.4 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            1.96 
_refine.ls_percent_reflns_obs                    99.35 
_refine.ls_R_factor_obs                          0.17971 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17771 
_refine.ls_R_factor_R_free                       0.21662 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4373 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               20.896 
_refine.aniso_B[1][1]                            0.35 
_refine.aniso_B[2][2]                            0.05 
_refine.aniso_B[3][3]                            -0.40 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.143 
_refine.overall_SU_ML                            0.098 
_refine.overall_SU_B                             7.539 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7361 
_refine_hist.pdbx_number_atoms_nucleic_acid   632 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             911 
_refine_hist.number_atoms_total               8938 
_refine_hist.d_res_high                       1.96 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.008  0.022  ? 8334  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.108  2.062  ? 11407 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.034  5.000  ? 918   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 34.363 24.180 ? 378   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 13.719 15.000 ? 1360  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14.662 15.000 ? 47    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.079  0.200  ? 1209  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.004  0.021  ? 6152  'X-RAY DIFFRACTION' ? 
r_mcbond_it            1.216  4.000  ? 4529  'X-RAY DIFFRACTION' ? 
r_mcangle_it           2.090  6.000  ? 7351  'X-RAY DIFFRACTION' ? 
r_scbond_it            2.502  6.000  ? 3802  'X-RAY DIFFRACTION' ? 
r_scangle_it           3.708  9.000  ? 4048  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.960 
_refine_ls_shell.d_res_low                        2.010 
_refine_ls_shell.number_reflns_R_work             5775 
_refine_ls_shell.R_factor_R_work                  0.253 
_refine_ls_shell.percent_reflns_obs               95.25 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             317 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QER 
_struct.title                     
'RB69 DNA Polymerase (L561A/S565G/Y567A) Ternary Complex with dATP Opposite Difluorotoluene Nucleoside' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QER 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            'Difluorotoluene Nucleoside, dATP, Triple mutant, Transferase-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? SER A 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P14 14 LYS A 311 ? GLN A 339 ? LYS A 311 GLN A 339 1 ? 29 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P20 20 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P21 21 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P22 22 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P24 24 ASP A 579 ? CYS A 609 ? ASP A 579 CYS A 609 1 ? 31 
HELX_P HELX_P25 25 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P26 26 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P27 27 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P28 28 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P29 29 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P30 30 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P31 31 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P32 32 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P33 33 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P34 34 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P35 35 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P36 36 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P37 37 PHE A 876 ? LYS A 888 ? PHE A 876 LYS A 888 1 ? 13 
HELX_P HELX_P38 38 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DG  3   "O3'" ? ? ? 1_555 B DFT 4  P  ? ? T DG  3   T DFT 4    1_555 ? ? ? ? ? ? ?            1.549 ? 
covale2  covale ? ? B DFT 4   "O3'" ? ? ? 1_555 B DG  5  P  ? ? T DFT 4   T DG  5    1_555 ? ? ? ? ? ? ?            1.542 ? 
covale3  covale ? ? C DA  12  "O3'" ? ? ? 1_555 C DOC 13 P  ? ? P DA  114 P DOC 115  1_555 ? ? ? ? ? ? ?            1.543 ? 
metalc1  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  905  1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc2  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531 A CA  907  1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc3  metalc ? ? D DTP .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc4  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505 A CA  907  1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc5  metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 1726 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc6  metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  908 A HOH 1594 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc7  metalc ? ? D DTP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc8  metalc ? ? D DTP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A DTP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc9  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411 A CA  906  1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc10 metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  905  1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc11 metalc ? ? F CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  906 A HOH 1020 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc12 metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507 A CA  907  1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc13 metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  908 A HOH 1536 1_555 ? ? ? ? ? ? ?            2.453 ? 
metalc14 metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  908 A HOH 970  1_555 ? ? ? ? ? ? ?            2.467 ? 
metalc15 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.481 ? 
metalc16 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 937  1_555 ? ? ? ? ? ? ?            2.484 ? 
metalc17 metalc ? ? D DTP .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A DTP 904 A CA  906  1_555 ? ? ? ? ? ? ?            2.492 ? 
metalc18 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623 A CA  906  1_555 ? ? ? ? ? ? ?            2.508 ? 
metalc19 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 1116 1_555 ? ? ? ? ? ? ?            2.550 ? 
metalc20 metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  908 A HOH 1619 1_555 ? ? ? ? ? ? ?            2.551 ? 
metalc21 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116 A CA  908  1_555 ? ? ? ? ? ? ?            2.556 ? 
metalc22 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 975  1_555 ? ? ? ? ? ? ?            2.577 ? 
metalc23 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116 A CA  908  1_555 ? ? ? ? ? ? ?            2.578 ? 
metalc24 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.738 ? 
hydrog1  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DOC 13 N3 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DOC 13 O2 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DOC 13 N4 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           255 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            255 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   MET 
_struct_mon_prot_cis.pdbx_label_seq_id_2    256 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    MET 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     256 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ALA A 135 ? ASP A 140 ? ALA A 135 ASP A 140 
D 4 VAL A 110 ? GLU A 116 ? VAL A 110 GLU A 116 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? VAL A 252 ? THR A 248 VAL A 252 
F 2 GLU A 261 ? LEU A 265 ? GLU A 261 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? GLY A 620 ? VAL A 617 GLY A 620 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N ILE A 15  ? N ILE A 15  O VAL A 31  ? O VAL A 31  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N TYR A 619 ? N TYR A 619 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
J 2 3 N LEU A 833 ? N LEU A 833 O ILE A 846 ? O ILE A 846 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DTP A 904' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 905'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 906'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 907'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 908'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 24 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 24 THR A 413 ? THR A 413  . ? 1_555 ? 
4  AC1 24 SER A 414 ? SER A 414  . ? 1_555 ? 
5  AC1 24 LEU A 415 ? LEU A 415  . ? 1_555 ? 
6  AC1 24 TYR A 416 ? TYR A 416  . ? 1_555 ? 
7  AC1 24 ARG A 482 ? ARG A 482  . ? 1_555 ? 
8  AC1 24 LYS A 560 ? LYS A 560  . ? 1_555 ? 
9  AC1 24 ASN A 564 ? ASN A 564  . ? 1_555 ? 
10 AC1 24 ASP A 623 ? ASP A 623  . ? 1_555 ? 
11 AC1 24 CA  E .   ? CA  A 905  . ? 1_555 ? 
12 AC1 24 CA  F .   ? CA  A 906  . ? 1_555 ? 
13 AC1 24 HOH I .   ? HOH A 915  . ? 1_555 ? 
14 AC1 24 HOH I .   ? HOH A 947  . ? 1_555 ? 
15 AC1 24 HOH I .   ? HOH A 1076 . ? 1_555 ? 
16 AC1 24 HOH I .   ? HOH A 1100 . ? 1_555 ? 
17 AC1 24 HOH I .   ? HOH A 1134 . ? 1_555 ? 
18 AC1 24 HOH I .   ? HOH A 1250 . ? 1_555 ? 
19 AC1 24 HOH I .   ? HOH A 1298 . ? 1_555 ? 
20 AC1 24 HOH I .   ? HOH A 1383 . ? 1_555 ? 
21 AC1 24 HOH I .   ? HOH A 1435 . ? 1_555 ? 
22 AC1 24 DOC C 13  ? DOC P 115  . ? 1_555 ? 
23 AC1 24 DFT B 4   ? DFT T 4    . ? 1_555 ? 
24 AC1 24 DG  B 5   ? DG  T 5    . ? 1_555 ? 
25 AC2 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
26 AC2 5  LEU A 412 ? LEU A 412  . ? 1_555 ? 
27 AC2 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
28 AC2 5  DTP D .   ? DTP A 904  . ? 1_555 ? 
29 AC2 5  CA  F .   ? CA  A 906  . ? 1_555 ? 
30 AC3 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
31 AC3 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
32 AC3 5  DTP D .   ? DTP A 904  . ? 1_555 ? 
33 AC3 5  CA  E .   ? CA  A 905  . ? 1_555 ? 
34 AC3 5  HOH I .   ? HOH A 1020 . ? 1_555 ? 
35 AC4 7  ASN A 505 ? ASN A 505  . ? 1_555 ? 
36 AC4 7  ASN A 507 ? ASN A 507  . ? 1_555 ? 
37 AC4 7  LYS A 531 ? LYS A 531  . ? 1_555 ? 
38 AC4 7  HOH I .   ? HOH A 937  . ? 1_555 ? 
39 AC4 7  HOH I .   ? HOH A 975  . ? 1_555 ? 
40 AC4 7  HOH I .   ? HOH A 1116 . ? 1_555 ? 
41 AC4 7  HOH I .   ? HOH A 1726 . ? 1_555 ? 
42 AC5 5  GLU A 116 ? GLU A 116  . ? 1_555 ? 
43 AC5 5  HOH I .   ? HOH A 970  . ? 1_555 ? 
44 AC5 5  HOH I .   ? HOH A 1536 . ? 1_555 ? 
45 AC5 5  HOH I .   ? HOH A 1594 . ? 1_555 ? 
46 AC5 5  HOH I .   ? HOH A 1619 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QER 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QER 
_atom_sites.fract_transf_matrix[1][1]   0.012776 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008424 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007661 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -37.907 20.727  -32.638 1.00 32.19 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.584 20.268  -33.149 1.00 31.66 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.462 18.750  -33.036 1.00 31.15 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.160 18.121  -32.234 1.00 31.49 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.438 20.966  -32.400 1.00 33.73 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.372 20.678  -30.894 1.00 35.93 ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -34.000 21.477  -30.020 1.00 40.88 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -32.595 20.551  -30.615 1.00 38.84 ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.593 18.161  -33.851 1.00 29.30 ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.307 16.732  -33.738 1.00 27.74 ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.419 16.467  -32.526 1.00 23.67 ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.547 17.269  -32.196 1.00 21.83 ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.673 16.171  -35.020 1.00 29.48 ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.658 15.440  -35.948 1.00 34.22 ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.258 14.197  -35.274 1.00 38.84 ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -37.167 13.405  -36.210 1.00 41.04 ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -36.400 12.593  -37.198 1.00 44.19 ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.661 15.343  -31.861 1.00 21.76 ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -33.918 14.995  -30.658 1.00 20.10 ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.536 14.463  -31.007 1.00 18.51 ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.326 13.917  -32.092 1.00 18.98 ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.698 13.975  -29.833 1.00 20.64 ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.108 14.450  -29.499 1.00 21.12 ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -36.798 13.635  -28.419 1.00 23.97 ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -37.890 14.060  -27.979 1.00 27.43 ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.265 12.581  -28.008 1.00 21.34 ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.594 14.633  -30.088 1.00 14.87 ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.267 14.065  -30.249 1.00 14.35 ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -29.685 13.718  -28.887 1.00 13.70 ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -29.983 14.384  -27.895 1.00 12.04 ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.343 15.004  -31.049 1.00 14.53 ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.137 16.361  -30.418 1.00 16.39 ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.042 17.400  -30.647 1.00 16.13 ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.022 16.610  -29.624 1.00 15.61 ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -29.846 18.655  -30.071 1.00 14.29 ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -27.819 17.864  -29.048 1.00 15.85 ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -28.733 18.885  -29.273 1.00 15.19 ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -28.875 12.664  -28.841 1.00 12.97 ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.249 12.238  -27.589 1.00 14.03 ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.144 13.196  -27.143 1.00 14.13 ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -26.576 13.932  -27.951 1.00 12.84 ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -27.692 10.819  -27.722 1.00 15.26 ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.520 10.677  -28.680 1.00 15.41 ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -26.728 10.407  -30.037 1.00 13.92 ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.206 10.785  -28.224 1.00 13.61 ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.660 10.259  -30.910 1.00 13.47 ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.128 10.646  -29.092 1.00 11.55 ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.360 10.384  -30.429 1.00 14.42 ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.294 10.246  -31.285 1.00 14.56 ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -26.851 13.184  -25.850 1.00 13.10 ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -25.706 13.911  -25.316 1.00 11.53 ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -24.631 12.910  -24.920 1.00 12.19 ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -23.487 13.005  -25.371 1.00 13.17 ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.120 14.776  -24.117 1.00 10.08 ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.068 15.946  -24.391 1.00 10.84 ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -27.642 16.480  -23.092 1.00 11.80 ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -26.372 17.064  -25.191 1.00 8.08  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.007 11.954  -24.071 1.00 12.80 ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.123 10.862  -23.672 1.00 13.83 ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -24.896 9.551   -23.616 1.00 15.46 ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -26.118 9.539   -23.479 1.00 15.12 ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -23.489 11.088  -22.277 1.00 12.65 ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -24.523 11.174  -21.289 1.00 13.46 ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -22.626 12.354  -22.242 1.00 11.75 ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -24.170 8.443   -23.715 1.00 17.32 ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -24.768 7.125   -23.561 1.00 15.66 ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -23.787 6.228   -22.810 1.00 15.69 ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -22.580 6.304   -23.032 1.00 17.09 ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -25.205 6.522   -24.936 1.00 15.22 ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -23.997 6.249   -25.854 1.00 11.27 ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.048 5.267   -24.747 1.00 14.71 ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -24.312 5.405   -21.906 1.00 15.99 ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -23.509 4.447   -21.146 1.00 16.05 ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -24.258 3.131   -21.000 1.00 16.29 ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -25.485 3.118   -20.903 1.00 16.29 ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -23.199 4.970   -19.736 1.00 15.36 ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -22.484 6.325   -19.643 1.00 15.42 ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -21.016 6.282   -20.042 1.00 17.50 ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -20.500 5.200   -20.398 1.00 15.87 ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -20.375 7.349   -20.003 1.00 17.87 ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -23.514 2.028   -20.972 1.00 17.19 ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -24.061 0.753   -20.526 1.00 19.27 ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -23.587 0.476   -19.100 1.00 21.19 ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -22.384 0.470   -18.826 1.00 23.06 ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -23.637 -0.396  -21.444 1.00 19.78 ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -24.189 -1.747  -20.985 1.00 21.52 ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -23.564 -2.937  -21.692 1.00 20.23 ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -22.984 -2.808  -22.767 1.00 23.91 ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -23.696 -4.111  -21.088 1.00 22.39 ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -24.545 0.263   -18.205 1.00 22.49 ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -24.273 -0.122  -16.822 1.00 25.49 ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -25.118 -1.361  -16.520 1.00 25.17 ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -26.331 -1.262  -16.323 1.00 26.98 ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -24.594 1.031   -15.821 1.00 25.90 ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -23.762 2.282   -16.153 1.00 24.83 ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -24.378 0.570   -14.370 1.00 26.91 ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -24.181 3.554   -15.420 1.00 26.08 ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -24.474 -2.527  -16.506 1.00 26.91 ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -25.184 -3.802  -16.388 1.00 25.79 ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -26.179 -3.977  -17.522 1.00 25.71 ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -25.823 -3.839  -18.692 1.00 26.71 ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -27.434 -4.247  -17.172 1.00 26.23 ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -28.499 -4.427  -18.165 1.00 25.37 ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -29.253 -3.135  -18.484 1.00 24.03 ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -30.335 -3.162  -19.083 1.00 23.50 ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -29.472 -5.527  -17.722 1.00 25.65 ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -28.862 -6.917  -17.808 1.00 26.62 ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -29.355 -7.823  -17.105 1.00 27.70 ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -27.896 -7.106  -18.582 1.00 26.49 ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -28.661 -2.007  -18.101 1.00 22.93 ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -29.249 -0.701  -18.357 1.00 22.93 ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -28.408 0.164   -19.286 1.00 20.70 ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -27.178 0.206   -19.189 1.00 19.95 ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -29.502 0.042   -17.044 1.00 23.67 ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -30.714 -0.393  -16.450 1.00 27.89 ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -29.097 0.842   -20.196 1.00 19.94 ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -28.518 1.943   -20.949 1.00 17.64 ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -28.926 3.227   -20.229 1.00 18.48 ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -30.112 3.448   -19.976 1.00 18.40 ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -29.006 1.950   -22.428 1.00 18.07 ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -28.374 0.794   -23.227 1.00 16.72 ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -28.728 3.297   -23.103 1.00 17.72 ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -26.850 0.869   -23.403 1.00 13.37 ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -27.940 4.042   -19.859 1.00 17.81 ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -28.204 5.370   -19.309 1.00 18.01 ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -27.900 6.405   -20.383 1.00 17.45 ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -26.771 6.474   -20.892 1.00 16.32 ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -27.367 5.632   -18.052 1.00 18.06 ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -27.909 4.974   -16.806 1.00 21.28 ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -28.759 5.669   -15.947 1.00 21.27 ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -27.564 3.663   -16.488 1.00 23.89 ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -29.264 5.065   -14.787 1.00 23.68 ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -28.064 3.049   -15.330 1.00 25.43 ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -28.913 3.754   -14.480 1.00 24.21 ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -28.912 7.194   -20.737 1.00 16.45 ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -28.773 8.186   -21.799 1.00 15.12 ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -29.161 9.576   -21.311 1.00 14.87 ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -30.231 9.768   -20.730 1.00 13.25 ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -29.619 7.815   -23.031 1.00 13.16 ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -29.370 8.722   -24.249 1.00 12.44 ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -30.525 8.776   -25.251 1.00 16.24 ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.407 9.535   -26.243 1.00 16.34 ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -31.541 8.069   -25.064 1.00 14.50 ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -28.274 10.534  -21.554 1.00 12.67 ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -28.620 11.944  -21.450 1.00 12.03 ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -28.851 12.423  -22.870 1.00 12.39 ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.123 12.033  -23.784 1.00 11.32 ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -27.492 12.737  -20.797 1.00 11.80 ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -27.192 12.321  -19.363 1.00 11.61 ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -25.879 12.923  -18.898 1.00 13.62 ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -25.985 14.363  -18.662 1.00 9.74  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -24.948 15.179  -18.502 1.00 11.23 ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -23.707 14.713  -18.576 1.00 9.58  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -25.156 16.472  -18.284 1.00 12.06 ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -29.881 13.240  -23.064 1.00 11.21 ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -30.249 13.673  -24.410 1.00 11.79 ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -30.954 15.020  -24.391 1.00 11.88 ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -31.317 15.537  -23.325 1.00 11.97 ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.123 12.614  -25.110 1.00 12.65 ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -32.509 12.441  -24.508 1.00 12.88 ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -32.695 11.703  -23.340 1.00 15.12 ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -33.630 13.012  -25.112 1.00 14.02 ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -33.957 11.543  -22.779 1.00 14.09 ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -34.907 12.854  -24.559 1.00 16.66 ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.056 12.115  -23.395 1.00 17.21 ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -36.300 11.958  -22.835 1.00 19.88 ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.140 15.583  -25.583 1.00 12.07 ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -31.954 16.779  -25.756 1.00 13.27 ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.283 16.371  -26.402 1.00 13.69 ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.285 15.692  -27.438 1.00 14.78 ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.208 17.847  -26.600 1.00 12.55 ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -29.888 18.258  -25.920 1.00 12.03 ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.107 19.066  -26.865 1.00 12.34 ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.040 18.986  -24.567 1.00 11.43 ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -34.401 16.760  -25.786 1.00 13.62 ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -35.732 16.386  -26.301 1.00 14.46 ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.257 17.340  -27.384 1.00 16.32 ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -35.589 18.318  -27.737 1.00 15.50 ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -36.761 16.203  -25.164 1.00 13.88 ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.157 17.521  -24.481 1.00 14.19 ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -36.981 18.619  -25.053 1.00 15.21 ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -37.662 17.449  -23.346 1.00 12.95 ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.460 17.051  -27.890 1.00 18.10 ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.069 17.805  -28.990 1.00 21.24 ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.268 19.289  -28.671 1.00 22.48 ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.317 20.125  -29.577 1.00 23.72 ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.401 17.163  -29.418 1.00 21.42 ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.390 17.272  -28.403 1.00 23.72 ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.376 19.605  -27.382 1.00 22.54 ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.506 20.986  -26.927 1.00 22.32 ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.159 21.652  -26.617 1.00 22.78 ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.110 22.800  -26.174 1.00 22.04 ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.439 21.052  -25.715 1.00 22.06 ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -40.886 20.744  -26.078 1.00 24.89 ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.433 21.313  -27.025 1.00 26.52 ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -41.508 19.840  -25.330 1.00 22.01 ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.070 20.926  -26.854 1.00 22.32 ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -34.727 21.458  -26.624 1.00 21.65 ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.310 21.459  -25.167 1.00 21.70 ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.406 22.196  -24.774 1.00 22.51 ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -34.970 20.629  -24.366 1.00 21.10 ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -34.659 20.504  -22.948 1.00 21.46 ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -33.757 19.294  -22.721 1.00 19.31 ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -33.909 18.265  -23.386 1.00 19.27 ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -35.953 20.372  -22.133 1.00 23.76 ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -35.741 20.205  -20.634 1.00 30.28 ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -37.013 20.448  -19.843 1.00 35.21 ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -37.052 21.770  -19.224 1.00 38.47 ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -37.958 22.147  -18.325 1.00 41.32 ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -38.906 21.303  -17.931 1.00 42.11 ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -37.918 23.371  -17.814 1.00 42.56 ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -32.815 19.425  -21.789 1.00 18.45 ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -31.977 18.298  -21.394 1.00 16.60 ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -32.742 17.328  -20.497 1.00 16.31 ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -33.324 17.727  -19.485 1.00 13.96 ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -30.695 18.756  -20.688 1.00 16.70 ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -29.835 17.573  -20.237 1.00 15.72 ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -28.479 17.960  -19.679 1.00 18.01 ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -27.919 18.992  -20.100 1.00 17.07 ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -27.964 17.212  -18.823 1.00 18.45 ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -32.711 16.053  -20.878 1.00 16.04 ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -33.358 14.983  -20.134 1.00 17.20 ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -32.404 13.801  -19.920 1.00 16.56 ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -31.362 13.702  -20.574 1.00 15.43 ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -34.633 14.528  -20.862 1.00 17.84 ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -35.957 15.061  -20.284 1.00 26.33 ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -36.163 16.539  -20.553 1.00 29.03 ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -37.551 16.963  -20.373 1.00 32.54 ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -38.074 17.399  -19.226 1.00 34.70 ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -37.335 17.477  -18.125 1.00 37.59 ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -39.346 17.763  -19.181 1.00 32.48 ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -32.757 12.922  -18.984 1.00 16.19 ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -32.015 11.685  -18.744 1.00 16.73 ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -33.004 10.532  -18.619 1.00 16.86 ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -34.090 10.692  -18.053 1.00 14.48 ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -31.141 11.770  -17.469 1.00 16.79 ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -30.284 12.910  -17.559 1.00 23.50 ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -30.274 10.526  -17.297 1.00 16.41 ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -32.628 9.375   -19.153 1.00 16.83 ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -33.452 8.182   -19.027 1.00 17.65 ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -32.623 6.911   -18.879 1.00 18.46 ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -31.537 6.788   -19.456 1.00 17.73 ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -34.424 8.060   -20.207 1.00 17.56 ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -33.767 7.914   -21.569 1.00 14.40 ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -34.794 8.020   -22.676 1.00 16.40 ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.159 8.286   -23.964 1.00 19.49 ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -34.776 8.839   -25.003 1.00 19.29 ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.055 9.188   -24.913 1.00 15.97 ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.112 9.049   -26.132 1.00 16.48 ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -33.147 5.976   -18.093 1.00 19.03 ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -32.563 4.647   -17.970 1.00 21.01 ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -33.434 3.667   -18.747 1.00 21.08 ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -34.632 3.591   -18.512 1.00 19.55 ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -32.460 4.234   -16.500 1.00 22.33 ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -31.933 2.812   -16.278 1.00 24.77 ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -31.935 2.392   -14.814 1.00 26.80 ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -32.218 3.237   -13.934 1.00 26.03 ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -31.644 1.209   -14.543 1.00 24.54 ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -32.822 2.929   -19.673 1.00 21.03 ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -33.557 2.025   -20.561 1.00 21.48 ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -33.026 0.599   -20.436 1.00 20.95 ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -31.838 0.354   -20.642 1.00 20.81 ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -33.499 2.493   -22.051 1.00 22.14 ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -34.263 1.533   -22.959 1.00 22.49 ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -34.055 3.909   -22.205 1.00 21.43 ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -33.914 -0.333  -20.089 1.00 21.28 ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -33.579 -1.759  -20.041 1.00 22.86 ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -33.531 -2.319  -21.461 1.00 20.73 ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -34.426 -3.050  -21.887 1.00 20.48 ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -34.595 -2.534  -19.193 1.00 24.18 ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -34.600 -2.160  -17.716 1.00 29.70 ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -35.715 -2.838  -16.940 1.00 34.72 ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -35.426 -3.398  -15.862 1.00 39.18 ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -36.878 -2.814  -17.401 1.00 37.52 ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -32.470 -1.967  -22.181 1.00 19.98 ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -32.362 -2.219  -23.617 1.00 18.36 ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -32.350 -3.701  -23.945 1.00 18.40 ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -31.596 -4.470  -23.347 1.00 19.98 ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -31.102 -1.541  -24.171 1.00 16.52 ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -30.894 -1.653  -25.669 1.00 16.62 ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -31.842 -1.159  -26.571 1.00 15.09 ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -29.721 -2.215  -26.185 1.00 17.21 ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -31.643 -1.248  -27.948 1.00 13.25 ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -29.509 -2.305  -27.563 1.00 16.19 ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.472 -1.821  -28.434 1.00 17.19 ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.264 -1.908  -29.795 1.00 14.49 ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.194 -4.084  -24.901 1.00 18.06 ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.260 -5.459  -25.381 1.00 18.09 ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.536 -5.569  -26.724 1.00 16.99 ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.099 -5.238  -27.777 1.00 17.60 ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -34.721 -5.927  -25.480 1.00 19.17 ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -35.430 -6.004  -24.124 1.00 22.50 ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.809 -6.645  -24.224 1.00 30.77 ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.885 -5.634  -24.609 1.00 35.71 ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -39.239 -6.262  -24.629 1.00 37.59 ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.272 -6.022  -26.691 1.00 16.09 ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.455 -6.044  -27.897 1.00 15.23 ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.752 -7.253  -28.777 1.00 15.03 ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.338 -8.239  -28.311 1.00 14.00 ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.031 -6.140  -27.340 1.00 15.10 ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.178 -6.895  -26.074 1.00 15.82 ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.558 -6.596  -25.531 1.00 14.81 ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.355 -7.171  -30.040 1.00 14.72 ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.445 -8.318  -30.929 1.00 15.37 ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -29.073 -8.681  -31.462 1.00 15.52 ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.214 -7.809  -31.659 1.00 15.44 ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.420 -8.062  -32.085 1.00 15.75 ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.749 -7.932  -31.604 1.00 17.04 ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.870 -9.978  -31.664 1.00 13.42 ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.710 -10.491 -32.373 1.00 13.47 ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -28.230 -11.528 -33.368 1.00 14.59 ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.436 -11.764 -33.442 1.00 15.11 ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.680 -11.077 -31.393 1.00 14.30 ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -26.002 -10.081 -30.437 1.00 11.42 ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.316 -10.799 -29.288 1.00 14.86 ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.000 -9.184  -31.178 1.00 12.91 ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -27.340 -12.124 -34.153 1.00 14.66 ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.776 -12.952 -35.275 1.00 14.51 ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.952 -14.216 -35.429 1.00 15.05 ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.759 -14.243 -35.109 1.00 13.50 ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.738 -12.144 -36.582 1.00 13.23 ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -28.593 -10.902 -36.554 1.00 13.14 ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -28.147 -9.743  -35.915 1.00 15.45 ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -29.842 -10.891 -37.164 1.00 12.27 ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.937 -8.590  -35.878 1.00 16.77 ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -30.639 -9.732  -37.142 1.00 17.91 ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -30.184 -8.586  -36.492 1.00 13.89 ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -27.604 -15.261 -35.927 1.00 16.17 ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.941 -16.525 -36.228 1.00 16.63 ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -27.278 -16.921 -37.657 1.00 17.29 ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -28.401 -16.694 -38.118 1.00 18.07 ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -27.404 -17.608 -35.256 1.00 15.92 ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -26.319 -17.518 -38.357 1.00 17.15 ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -26.591 -18.066 -39.684 1.00 18.48 ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -27.669 -19.143 -39.574 1.00 20.21 ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -27.679 -19.924 -38.621 1.00 19.35 ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -25.321 -18.641 -40.313 1.00 18.60 ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -24.340 -17.602 -40.763 1.00 17.18 ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -23.025 -17.588 -40.347 1.00 17.62 ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -24.477 -16.552 -41.608 1.00 18.94 ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -22.398 -16.567 -40.905 1.00 18.72 ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -23.256 -15.924 -41.679 1.00 19.04 ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -28.590 -19.150 -40.532 1.00 22.79 ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -29.694 -20.108 -40.555 1.00 27.39 ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -29.773 -20.764 -41.937 1.00 30.87 ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -29.141 -20.279 -42.878 1.00 32.82 ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -31.009 -19.407 -40.208 1.00 28.33 ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -31.547 -18.191 -41.437 1.00 33.93 ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -30.537 -21.871 -42.070 1.00 33.93 ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -30.589 -22.525 -43.379 1.00 37.37 ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -31.375 -21.717 -44.414 1.00 40.76 ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -32.221 -20.888 -44.053 1.00 39.80 ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -31.284 -23.859 -43.085 1.00 37.44 ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -32.084 -23.612 -41.856 1.00 36.81 ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -31.315 -22.606 -41.053 1.00 33.45 ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -31.085 -21.973 -45.688 1.00 45.09 ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -31.667 -21.224 -46.800 1.00 48.93 ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -33.188 -21.393 -46.905 1.00 50.65 ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -33.884 -20.511 -47.412 1.00 51.32 ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -30.989 -21.619 -48.115 1.00 49.64 ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -31.015 -20.529 -49.182 1.00 53.02 ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -30.068 -19.374 -48.881 1.00 55.89 ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -30.521 -18.209 -48.917 1.00 56.94 ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -28.873 -19.630 -48.607 1.00 57.51 ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -33.689 -22.523 -46.408 1.00 52.14 ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -35.120 -22.842 -46.422 1.00 52.75 ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -35.953 -21.976 -45.467 1.00 53.23 ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -37.177 -22.125 -45.391 1.00 52.69 ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -35.324 -24.324 -46.088 1.00 53.09 ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -34.759 -24.644 -44.826 1.00 53.01 ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -35.287 -21.076 -44.745 1.00 53.44 ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -35.949 -20.224 -43.760 1.00 53.69 ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -36.136 -18.803 -44.292 1.00 52.79 ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -35.174 -18.168 -44.729 1.00 53.30 ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -35.148 -20.205 -42.454 1.00 54.11 ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -35.918 -19.671 -41.254 1.00 56.54 ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -35.018 -19.351 -40.077 1.00 58.66 ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -34.849 -18.186 -39.713 1.00 60.32 ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -34.429 -20.382 -39.479 1.00 59.45 ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -37.376 -18.315 -44.246 1.00 50.77 ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -37.705 -16.963 -44.702 1.00 48.59 ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -37.286 -15.899 -43.682 1.00 47.02 ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -37.804 -15.852 -42.562 1.00 48.28 ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -39.194 -16.852 -45.014 1.00 48.77 ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -36.346 -15.048 -44.083 1.00 43.41 ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -35.813 -14.002 -43.211 1.00 40.04 ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -35.559 -12.713 -43.998 1.00 38.44 ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -35.361 -12.749 -45.217 1.00 38.04 ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -34.511 -14.474 -42.493 1.00 40.70 ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -34.095 -13.496 -41.527 1.00 38.33 ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -33.379 -14.729 -43.496 1.00 38.59 ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -35.582 -11.577 -43.308 1.00 35.57 ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -35.226 -10.313 -43.948 1.00 33.78 ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -33.782 -9.900  -43.629 1.00 30.76 ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -33.286 -8.898  -44.146 1.00 30.21 ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -36.238 -9.207  -43.610 1.00 35.74 ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -36.081 -8.542  -42.247 1.00 38.83 ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -36.841 -7.216  -42.223 1.00 43.27 ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.551 -6.399  -40.969 1.00 45.97 ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -37.330 -6.871  -39.787 1.00 48.75 ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -33.110 -10.692 -42.794 1.00 26.73 ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -31.734 -10.397 -42.398 1.00 24.15 ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -30.732 -11.253 -43.159 1.00 22.33 ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -30.881 -12.474 -43.247 1.00 22.48 ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -31.561 -10.577 -40.890 1.00 23.52 ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -32.566 -9.801  -40.071 1.00 23.58 ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -33.622 -10.453 -39.432 1.00 22.03 ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -32.469 -8.413  -39.942 1.00 22.59 ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -34.550 -9.746  -38.677 1.00 22.86 ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -33.400 -7.695  -39.194 1.00 23.71 ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -34.432 -8.371  -38.564 1.00 24.07 ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -35.346 -7.673  -37.821 1.00 27.30 ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -29.719 -10.595 -43.717 1.00 21.77 ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -28.654 -11.264 -44.459 1.00 21.54 ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -27.307 -10.694 -44.028 1.00 20.75 ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -27.198 -9.492  -43.772 1.00 20.87 ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -28.845 -11.079 -45.972 1.00 22.56 ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -30.072 -11.764 -46.524 1.00 23.29 ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -31.303 -11.109 -46.548 1.00 25.17 ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -29.996 -13.059 -47.023 1.00 23.91 ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -32.443 -11.741 -47.057 1.00 25.53 ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -31.131 -13.703 -47.535 1.00 24.60 ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -32.355 -13.040 -47.551 1.00 25.62 ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -26.286 -11.546 -43.934 1.00 18.10 ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -24.940 -11.052 -43.643 1.00 18.39 ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -24.377 -10.351 -44.886 1.00 19.34 ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -25.043 -10.325 -45.931 1.00 18.79 ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -24.019 -12.154 -43.079 1.00 18.28 ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -23.491 -13.127 -44.135 1.00 19.10 ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -23.640 -12.918 -45.358 1.00 17.99 ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -22.899 -14.135 -43.712 1.00 21.85 ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -23.175 -9.783  -44.784 1.00 16.75 ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -22.652 -8.949  -45.881 1.00 17.76 ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -22.346 -9.750  -47.156 1.00 19.88 ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -22.238 -9.179  -48.242 1.00 20.20 ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -21.442 -8.072  -45.449 1.00 16.76 ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -20.225 -8.942  -45.094 1.00 15.27 ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -21.848 -7.142  -44.301 1.00 16.31 ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -18.925 -8.148  -44.858 1.00 17.58 ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -22.235 -11.071 -47.016 1.00 20.34 ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -22.020 -11.964 -48.160 1.00 21.56 ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -23.325 -12.571 -48.684 1.00 23.20 ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -23.302 -13.491 -49.500 1.00 24.88 ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -21.025 -13.067 -47.795 1.00 22.45 ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -19.800 -12.550 -47.071 1.00 20.74 ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -19.693 -12.650 -45.682 1.00 19.93 ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -18.757 -11.944 -47.774 1.00 19.90 ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -18.567 -12.166 -45.006 1.00 19.03 ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -17.631 -11.455 -47.109 1.00 19.28 ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -17.543 -11.571 -45.729 1.00 19.73 ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -16.428 -11.093 -45.077 1.00 21.97 ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -24.458 -12.050 -48.215 1.00 23.80 ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -25.774 -12.476 -48.698 1.00 22.92 ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -26.314 -13.762 -48.092 1.00 23.10 ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -27.324 -14.285 -48.555 1.00 22.24 ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -25.644 -14.278 -47.063 1.00 21.48 ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -26.091 -15.498 -46.399 1.00 21.67 ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -27.162 -15.174 -45.358 1.00 21.13 ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -27.037 -14.189 -44.622 1.00 20.05 ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -24.915 -16.261 -45.780 1.00 23.74 ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -23.913 -16.761 -46.825 1.00 29.75 ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -23.109 -17.963 -46.345 1.00 37.09 ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -23.814 -19.283 -46.665 1.00 42.29 ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -23.952 -19.540 -48.130 1.00 44.79 ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -28.230 -15.990 -45.308 1.00 20.04 ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -29.365 -15.679 -44.433 1.00 19.66 ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -29.037 -15.827 -42.948 1.00 19.14 ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -28.278 -16.726 -42.563 1.00 16.56 ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -30.432 -16.699 -44.858 1.00 19.75 ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -29.656 -17.840 -45.451 1.00 22.25 ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -28.473 -17.197 -46.125 1.00 20.72 ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -29.617 -14.945 -42.136 1.00 17.78 ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -29.467 -14.991 -40.687 1.00 18.74 ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -30.804 -14.956 -39.956 1.00 19.69 ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -31.784 -14.393 -40.449 1.00 20.28 ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -28.611 -13.821 -40.209 1.00 19.98 ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -26.924 -13.872 -40.797 1.00 20.84 ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -30.835 -15.562 -38.774 1.00 18.47 ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -31.992 -15.456 -37.896 1.00 17.43 ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -31.659 -14.463 -36.779 1.00 17.61 ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -30.541 -14.467 -36.247 1.00 15.44 ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -32.451 -16.853 -37.358 1.00 18.52 ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -33.728 -16.739 -36.710 1.00 22.77 ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -31.434 -17.464 -36.393 1.00 20.35 ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -32.612 -13.590 -36.459 1.00 16.06 ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -32.440 -12.624 -35.379 1.00 16.14 ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.719 -13.279 -34.030 1.00 17.29 ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.683 -14.030 -33.891 1.00 15.73 ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -33.336 -11.389 -35.579 1.00 17.17 ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -33.167 -10.323 -34.484 1.00 20.10 ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -33.831 -8.981  -34.818 1.00 22.58 ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -35.276 -9.019  -34.632 1.00 26.87 ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.964 -8.288  -33.759 1.00 25.68 ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -35.365 -7.419  -32.954 1.00 27.05 ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -37.275 -8.430  -33.695 1.00 23.98 ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -31.850 -13.002 -33.059 1.00 16.96 ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -32.038 -13.424 -31.676 1.00 18.19 ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.295 -12.171 -30.835 1.00 18.10 ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.385 -11.360 -30.626 1.00 16.24 ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -30.787 -14.140 -31.150 1.00 19.72 ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.175 -15.189 -32.079 1.00 22.37 ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -30.820 -16.557 -31.908 1.00 27.04 ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -30.418 -17.207 -30.582 1.00 29.36 ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -31.142 -18.494 -30.362 1.00 31.22 ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.535 -12.012 -30.377 1.00 18.63 ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -33.908 -10.911 -29.495 1.00 19.94 ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.709 -11.373 -28.058 1.00 19.45 ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.309 -12.358 -27.630 1.00 18.94 ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.382 -10.527 -29.706 1.00 22.28 ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -35.877 -9.080  -29.520 1.00 25.16 ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -37.387 -9.054  -29.311 1.00 26.78 ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -35.177 -8.302  -28.398 1.00 26.27 ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -32.879 -10.653 -27.312 1.00 17.99 ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.581 -11.022 -25.927 1.00 18.54 ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.352 -10.185 -24.922 1.00 18.78 ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -33.584 -8.999  -25.145 1.00 18.75 ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.077 -10.914 -25.660 1.00 17.24 ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.259 -11.842 -26.500 1.00 16.10 ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -29.719 -11.411 -27.709 1.00 15.11 ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -30.055 -13.164 -26.099 1.00 15.19 ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -28.965 -12.274 -28.497 1.00 15.14 ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.306 -14.038 -26.880 1.00 13.53 ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -28.762 -13.598 -28.080 1.00 17.00 ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -33.730 -10.813 -23.810 1.00 20.88 ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -34.416 -10.123 -22.711 1.00 22.18 ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -33.543 -9.056  -22.041 1.00 21.05 ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -34.067 -8.097  -21.469 1.00 22.04 ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -34.931 -11.132 -21.675 1.00 22.35 ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -32.222 -9.228  -22.111 1.00 20.91 ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -31.274 -8.239  -21.583 1.00 19.88 ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -29.879 -8.358  -22.195 1.00 19.78 ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -29.588 -9.317  -22.918 1.00 17.85 ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -31.206 -8.295  -20.046 1.00 20.88 ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -30.858 -9.678  -19.520 1.00 20.59 ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -29.754 -10.180 -19.731 1.00 22.70 ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -31.801 -10.294 -18.817 1.00 22.35 ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.022 -7.383  -21.897 1.00 19.46 ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -27.685 -7.316  -22.492 1.00 21.02 ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -26.754 -8.426  -21.995 1.00 21.48 ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -25.963 -8.966  -22.768 1.00 21.57 ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -27.070 -5.917  -22.321 1.00 20.93 ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -27.684 -4.857  -23.261 1.00 20.58 ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -27.045 -3.164  -23.107 1.00 20.80 ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -27.804 -2.651  -21.562 1.00 19.88 ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -26.866 -8.778  -20.716 1.00 23.32 ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -26.091 -9.888  -20.160 1.00 24.89 ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -26.428 -11.193 -20.880 1.00 22.25 ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -25.530 -11.948 -21.238 1.00 23.38 ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -26.327 -10.034 -18.651 1.00 27.97 ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -25.563 -9.022  -17.797 1.00 35.18 ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -26.118 -8.988  -16.376 1.00 40.51 ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -25.803 -7.737  -15.686 1.00 44.16 ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -26.461 -7.276  -14.623 1.00 46.27 ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -27.485 -7.955  -14.119 1.00 45.59 ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -26.100 -6.126  -14.066 1.00 46.74 ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -27.718 -11.438 -21.104 1.00 21.52 ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.178 -12.615 -21.855 1.00 20.58 ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.575 -12.669 -23.251 1.00 19.16 ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.226 -13.741 -23.739 1.00 19.01 ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -29.704 -12.636 -21.970 1.00 20.45 ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -30.381 -13.188 -20.734 1.00 21.71 ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -29.691 -13.443 -19.722 1.00 19.03 ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -31.617 -13.363 -20.781 1.00 22.21 ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.464 -11.506 -23.889 1.00 17.52 ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -26.847 -11.407 -25.207 1.00 17.50 ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.348 -11.731 -25.151 1.00 17.61 ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -24.836 -12.475 -25.997 1.00 18.20 ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.082 -10.017 -25.789 1.00 15.84 ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -24.658 -11.171 -24.156 1.00 18.74 ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.225 -11.428 -23.930 1.00 20.61 ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -22.925 -12.902 -23.637 1.00 20.43 ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -21.932 -13.448 -24.124 1.00 21.60 ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -22.708 -10.575 -22.768 1.00 21.35 ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -22.654 -9.212  -23.120 1.00 23.61 ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -23.784 -13.528 -22.834 1.00 20.28 ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? -23.653 -14.946 -22.477 1.00 20.85 ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? -23.850 -15.859 -23.685 1.00 19.74 ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? -23.217 -16.910 -23.793 1.00 19.19 ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? -24.657 -15.321 -21.379 1.00 22.81 ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? -24.386 -14.687 -20.013 1.00 28.49 ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? -23.134 -15.233 -19.344 1.00 34.92 ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? -22.010 -14.861 -19.694 1.00 37.70 ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? -23.326 -16.114 -18.368 1.00 36.91 ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? -24.734 -15.453 -24.590 1.00 18.85 ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? -24.969 -16.208 -25.812 1.00 17.55 ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? -23.752 -16.158 -26.730 1.00 17.15 ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? -23.374 -17.177 -27.302 1.00 17.60 ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? -26.227 -15.714 -26.520 1.00 16.83 ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? -26.531 -16.444 -27.789 1.00 15.92 ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? -27.124 -17.671 -27.912 1.00 15.53 ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? -26.263 -15.990 -29.122 1.00 15.44 ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? -27.238 -18.008 -29.240 1.00 14.27 ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? -26.724 -16.991 -30.004 1.00 15.19 ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? -25.685 -14.827 -29.656 1.00 16.60 ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? -26.618 -16.872 -31.394 1.00 14.73 ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? -25.581 -14.708 -31.044 1.00 15.69 ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? -26.043 -15.730 -31.893 1.00 16.03 ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? -23.130 -14.984 -26.847 1.00 19.13 ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? -21.861 -14.845 -27.583 1.00 21.31 ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? -20.819 -15.872 -27.102 1.00 21.12 ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? -20.173 -16.535 -27.914 1.00 20.98 ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? -21.282 -13.398 -27.494 1.00 22.42 ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? -22.186 -12.407 -28.235 1.00 24.40 ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? -19.858 -13.335 -28.055 1.00 23.08 ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? -21.801 -10.936 -28.047 1.00 28.22 ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? -20.679 -16.007 -25.784 1.00 22.12 ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? -19.734 -16.954 -25.189 1.00 22.36 ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? -20.066 -18.404 -25.550 1.00 21.06 ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? -19.183 -19.164 -25.960 1.00 20.78 ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? -19.677 -16.777 -23.668 1.00 24.67 ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? -19.057 -15.463 -23.218 1.00 31.66 ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? -19.041 -15.344 -21.691 1.00 38.60 ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? -18.270 -14.109 -21.227 1.00 39.47 ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? -18.922 -12.834 -21.659 1.00 41.75 ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? -21.337 -18.782 -25.409 1.00 19.42 ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? -21.773 -20.130 -25.784 1.00 18.60 ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? -21.520 -20.435 -27.266 1.00 19.67 ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? -21.078 -21.540 -27.605 1.00 19.01 ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? -23.240 -20.368 -25.419 1.00 19.09 ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? -23.493 -20.501 -23.925 1.00 18.73 ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? -24.881 -21.066 -23.629 1.00 22.04 ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? -25.959 -20.210 -24.127 1.00 21.83 ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? -26.433 -19.139 -23.493 1.00 23.62 ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? -25.930 -18.766 -22.322 1.00 22.65 ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? -27.418 -18.434 -24.035 1.00 25.01 ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? -21.779 -19.454 -28.136 1.00 17.08 ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? -21.532 -19.607 -29.576 1.00 18.57 ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? -20.050 -19.835 -29.874 1.00 21.04 ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? -19.707 -20.710 -30.669 1.00 19.07 ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? -22.051 -18.399 -30.369 1.00 17.75 ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? -23.566 -18.294 -30.444 1.00 17.62 ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? -24.379 -19.661 -31.298 1.00 18.16 ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? -24.101 -19.207 -33.006 1.00 17.35 ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? -19.186 -19.040 -29.237 1.00 23.13 ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? -17.733 -19.231 -29.316 1.00 25.88 ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? -17.340 -20.668 -28.945 1.00 24.69 ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? -16.561 -21.310 -29.650 1.00 23.66 ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? -17.014 -18.243 -28.391 1.00 28.94 ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? -15.498 -18.187 -28.588 1.00 36.60 ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? -14.757 -17.643 -27.376 1.00 41.95 ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? -13.719 -18.232 -27.006 1.00 44.23 ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? -15.210 -16.636 -26.788 1.00 44.63 ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? -17.905 -21.160 -27.844 1.00 22.89 ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? -17.624 -22.500 -27.338 1.00 23.51 ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? -18.194 -23.609 -28.217 1.00 22.32 ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? -17.635 -24.703 -28.276 1.00 21.09 ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? -18.132 -22.635 -25.901 1.00 24.40 ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? -17.351 -21.765 -24.924 1.00 26.48 ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? -16.275 -21.244 -25.298 1.00 28.22 ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? -17.817 -21.598 -23.782 1.00 24.83 ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? -19.307 -23.324 -28.889 1.00 20.15 ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? -19.871 -24.244 -29.877 1.00 18.49 ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? -19.017 -24.235 -31.153 1.00 19.14 ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? -18.832 -25.271 -31.793 1.00 20.03 ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? -21.361 -23.907 -30.193 1.00 17.78 ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? -22.238 -24.193 -28.965 1.00 18.59 ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? -21.856 -24.687 -31.413 1.00 15.90 ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? -23.687 -23.700 -29.068 1.00 18.49 ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? -18.498 -23.063 -31.509 1.00 18.46 ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? -17.689 -22.906 -32.716 1.00 17.72 ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? -18.441 -22.283 -33.879 1.00 19.55 ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? -18.102 -22.531 -35.039 1.00 19.73 ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? -19.458 -21.471 -33.577 1.00 19.04 ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? -20.270 -20.814 -34.615 1.00 18.48 ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? -20.316 -19.304 -34.429 1.00 19.02 ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? -20.328 -18.808 -33.298 1.00 20.59 ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? -21.699 -21.378 -34.655 1.00 16.98 ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? -21.899 -22.805 -35.173 1.00 15.13 ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? -23.266 -23.347 -34.752 1.00 16.00 ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? -21.729 -22.883 -36.690 1.00 17.08 ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? -20.352 -18.588 -35.550 1.00 17.83 ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? -20.316 -17.128 -35.553 1.00 18.68 ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? -21.557 -16.517 -34.902 1.00 17.89 ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? -22.694 -16.929 -35.171 1.00 17.60 ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? -20.168 -16.595 -36.981 1.00 18.16 ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? -19.710 -15.133 -37.054 1.00 18.44 ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? -19.653 -14.597 -38.474 1.00 16.52 ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? -19.820 -15.388 -39.416 1.00 19.23 ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? -19.440 -13.380 -38.653 1.00 20.01 ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? -21.312 -15.544 -34.034 1.00 17.04 ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? -22.357 -14.745 -33.415 1.00 15.66 ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? -22.284 -13.361 -34.046 1.00 15.05 ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? -21.407 -12.559 -33.714 1.00 14.66 ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? -22.132 -14.668 -31.902 1.00 15.80 ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? -23.198 -13.092 -34.971 1.00 14.66 ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? -23.162 -11.863 -35.763 1.00 15.56 ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? -23.907 -10.712 -35.089 1.00 15.24 ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? -24.712 -10.932 -34.176 1.00 14.82 ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? -23.733 -12.115 -37.163 1.00 14.36 ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? -22.943 -13.035 -38.106 1.00 15.41 ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? -23.280 -14.507 -37.848 1.00 17.26 ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? -23.243 -12.676 -39.561 1.00 11.91 ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? -23.639 -9.493  -35.555 1.00 15.36 ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? -24.317 -8.294  -35.061 1.00 16.03 ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? -23.431 -7.392  -34.213 1.00 15.77 ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? -22.292 -7.738  -33.886 1.00 15.45 ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? -23.970 -6.231  -33.853 1.00 16.73 ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? -23.250 -5.241  -33.064 1.00 16.56 ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? -23.130 -5.667  -31.601 1.00 17.39 ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? -24.128 -5.717  -30.875 1.00 16.01 ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? -23.931 -3.873  -33.195 1.00 15.02 ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? -23.312 -2.761  -32.338 1.00 15.20 ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? -21.517 -2.639  -32.452 1.00 16.00 ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? -21.295 -1.935  -34.087 1.00 13.42 ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? -21.904 -5.962  -31.171 1.00 16.76 ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? -21.676 -6.433  -29.801 1.00 17.52 ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? -21.447 -5.318  -28.778 1.00 17.43 ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? -21.521 -5.551  -27.568 1.00 18.00 ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? -20.563 -7.497  -29.744 1.00 18.37 ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? -19.228 -7.003  -30.292 1.00 21.79 ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? -18.189 -7.589  -29.914 1.00 25.60 ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? -19.206 -6.060  -31.106 1.00 20.39 ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? -21.166 -4.110  -29.265 1.00 17.28 ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? -21.136 -2.915  -28.418 1.00 17.54 ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? -22.558 -2.373  -28.374 1.00 18.09 ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? -22.980 -1.613  -29.256 1.00 17.77 ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? -20.167 -1.869  -28.984 1.00 18.57 ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? -19.956 -0.679  -28.049 1.00 19.78 ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? -20.765 -0.458  -27.123 1.00 18.57 ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? -18.964 0.049   -28.251 1.00 22.71 ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? -23.299 -2.768  -27.344 1.00 17.02 ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? -24.744 -2.547  -27.325 1.00 16.84 ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? -25.184 -1.086  -27.317 1.00 15.97 ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? -26.256 -0.771  -27.821 1.00 16.14 ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? -25.408 -3.323  -26.183 1.00 18.09 ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? -25.136 -4.803  -26.221 1.00 17.59 ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? -25.492 -5.564  -27.334 1.00 17.81 ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? -24.526 -5.433  -25.146 1.00 16.39 ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? -25.233 -6.935  -27.375 1.00 18.82 ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? -24.273 -6.804  -25.173 1.00 18.90 ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? -24.623 -7.553  -26.291 1.00 17.87 ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? -24.370 -0.197  -26.757 1.00 16.21 ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? -24.719 1.223   -26.787 1.00 17.73 ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? -24.689 1.827   -28.199 1.00 17.46 ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? -25.434 2.766   -28.478 1.00 18.15 ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? -23.911 2.050   -25.777 1.00 18.39 ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? -22.433 2.158   -26.019 1.00 21.50 ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? -21.752 2.530   -24.695 1.00 24.85 ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? -20.250 2.346   -24.753 1.00 26.90 ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? -19.862 0.924   -24.919 1.00 25.14 ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? -23.855 1.280   -29.084 1.00 15.38 ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? -23.911 1.661   -30.502 1.00 15.89 ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? -25.223 1.197   -31.141 1.00 15.47 ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? -25.830 1.928   -31.938 1.00 14.32 ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? -22.701 1.124   -31.287 1.00 15.67 ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? -21.291 1.587   -30.874 1.00 17.00 ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? -20.258 1.091   -31.873 1.00 16.64 ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? -21.189 3.110   -30.728 1.00 19.09 ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? -25.654 -0.018  -30.795 1.00 13.03 ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? -26.935 -0.535  -31.282 1.00 13.63 ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? -28.074 0.332   -30.758 1.00 13.81 ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? -28.979 0.698   -31.513 1.00 11.27 ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? -27.132 -1.999  -30.878 1.00 12.49 ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? -28.003 0.686   -29.472 1.00 12.65 ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? -29.006 1.556   -28.856 1.00 13.72 ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? -29.127 2.912   -29.560 1.00 14.54 ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? -30.240 3.356   -29.859 1.00 13.94 ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? -28.739 1.745   -27.353 1.00 14.39 ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? -29.659 2.765   -26.702 1.00 14.69 ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? -29.289 4.110   -26.615 1.00 14.54 ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? -30.902 2.390   -26.202 1.00 12.73 ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? -30.135 5.057   -26.031 1.00 16.87 ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? -31.761 3.323   -25.623 1.00 16.50 ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? -31.372 4.652   -25.540 1.00 15.50 ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? -32.213 5.570   -24.961 1.00 16.18 ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? -27.990 3.564   -29.815 1.00 13.80 ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? -27.983 4.849   -30.523 1.00 15.01 ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? -28.556 4.721   -31.927 1.00 15.23 ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? -29.333 5.576   -32.370 1.00 15.14 ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? -26.568 5.442   -30.596 1.00 13.89 ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? -25.948 5.997   -29.308 1.00 14.47 ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? -24.600 6.663   -29.605 1.00 13.64 ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? -26.886 6.959   -28.590 1.00 15.30 ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? -28.177 3.644   -32.614 1.00 14.90 ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? -28.663 3.388   -33.964 1.00 16.79 ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? -30.180 3.179   -34.001 1.00 17.63 ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? -30.850 3.675   -34.911 1.00 19.73 ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? -27.934 2.200   -34.589 1.00 15.84 ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? -28.346 2.015   -35.930 1.00 16.57 ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? -30.711 2.451   -33.015 1.00 17.91 ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? -32.158 2.236   -32.883 1.00 17.36 ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? -32.923 3.506   -32.514 1.00 18.56 ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? -34.013 3.754   -33.039 1.00 19.14 ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? -32.461 1.166   -31.822 1.00 18.68 ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? -32.163 -0.245  -32.297 1.00 19.26 ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? -32.050 -1.134  -31.426 1.00 18.03 ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? -32.044 -0.468  -33.523 1.00 15.93 ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? -32.365 4.288   -31.591 1.00 18.32 ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? -33.051 5.471   -31.046 1.00 19.33 ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? -32.995 6.668   -32.002 1.00 19.49 ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? -33.916 7.503   -32.033 1.00 18.63 ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? -32.457 5.875   -29.666 1.00 19.41 ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? -32.338 4.711   -28.836 1.00 17.67 ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? -33.342 6.900   -28.958 1.00 19.36 ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? -31.913 6.745   -32.774 1.00 18.69 ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? -31.682 7.857   -33.695 1.00 19.47 ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? -31.522 7.316   -35.106 1.00 21.32 ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? -30.436 7.329   -35.674 1.00 20.71 ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? -30.477 8.702   -33.235 1.00 18.14 ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? -30.709 9.252   -31.847 1.00 16.87 ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? -30.218 8.595   -30.723 1.00 14.31 ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? -31.484 10.393  -31.657 1.00 16.46 ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? -30.472 9.081   -29.443 1.00 15.23 ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? -31.742 10.885  -30.386 1.00 14.36 ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? -31.240 10.224  -29.285 1.00 14.47 ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? -31.510 10.721  -28.031 1.00 16.36 ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? -32.625 6.823   -35.661 1.00 22.67 ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? -32.608 6.221   -36.989 1.00 25.89 ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? -32.818 7.268   -38.083 1.00 25.53 ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? -33.729 7.171   -38.905 1.00 25.18 ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? -33.621 5.075   -37.089 1.00 27.22 ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? -33.349 4.159   -38.272 1.00 32.37 ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? -32.192 3.887   -38.617 1.00 34.43 ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? -34.414 3.684   -38.903 1.00 32.21 ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? -31.949 8.272   -38.065 1.00 25.08 ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? -31.975 9.387   -38.998 1.00 24.38 ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? -30.646 10.129  -38.884 1.00 25.02 ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? -29.865 9.865   -37.969 1.00 20.63 ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? -33.148 10.340  -38.704 1.00 26.01 ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? -33.302 10.773  -37.252 1.00 26.29 ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? -34.213 10.134  -36.407 1.00 27.42 ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? -32.564 11.843  -36.735 1.00 28.31 ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? -34.373 10.536  -35.079 1.00 27.37 ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? -32.713 12.251  -35.408 1.00 27.47 ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? -33.619 11.595  -34.588 1.00 28.31 ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? -33.776 12.000  -33.280 1.00 27.07 ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? -30.392 11.043  -39.815 1.00 25.33 ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? -29.189 11.865  -39.764 1.00 26.21 ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? -29.345 12.889  -38.646 1.00 24.74 ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? -30.281 13.704  -38.659 1.00 23.59 ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? -28.948 12.558  -41.105 1.00 27.50 ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? -27.598 13.256  -41.197 1.00 32.17 ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? -27.448 14.109  -42.445 1.00 34.90 ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? -26.369 14.715  -42.609 1.00 39.07 ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? -28.397 14.183  -43.254 1.00 36.12 ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? -28.433 12.833  -37.679 1.00 23.11 ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? -28.520 13.667  -36.487 1.00 22.21 ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? -28.179 15.114  -36.804 1.00 23.53 ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? -27.100 15.422  -37.318 1.00 23.75 ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? -27.649 13.115  -35.313 1.00 23.27 ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? -28.333 11.895  -34.685 1.00 22.43 ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? -27.408 14.190  -34.246 1.00 19.37 ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? -27.432 11.049  -33.809 1.00 19.72 ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? -29.140 15.984  -36.519 1.00 24.33 ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? -28.952 17.420  -36.539 1.00 27.06 ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? -28.871 17.864  -35.091 1.00 26.68 ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? -29.862 17.802  -34.358 1.00 29.07 ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? -30.128 18.106  -37.243 1.00 28.11 ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? -29.818 18.652  -38.631 1.00 36.70 ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? -29.317 17.578  -39.593 1.00 42.69 ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? -28.346 18.182  -40.604 1.00 46.47 ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? -27.416 17.164  -41.163 1.00 47.70 ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? -27.686 18.276  -34.666 1.00 24.34 ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? -27.491 18.680  -33.281 1.00 23.00 ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? -27.407 20.197  -33.164 1.00 22.24 ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? -27.053 20.883  -34.123 1.00 20.42 ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? -26.263 17.984  -32.675 1.00 22.68 ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? -24.923 18.478  -33.175 1.00 21.37 ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? -24.381 18.017  -34.379 1.00 21.72 ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? -24.184 19.393  -32.427 1.00 20.40 ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? -23.138 18.475  -34.826 1.00 22.12 ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? -22.955 19.853  -32.860 1.00 21.84 ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? -22.432 19.394  -34.052 1.00 23.02 ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? -21.202 19.870  -34.451 1.00 26.20 ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? -27.769 20.710  -31.992 1.00 20.49 ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? -27.701 22.133  -31.711 1.00 19.46 ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? -26.677 22.326  -30.599 1.00 19.04 ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? -26.960 22.042  -29.432 1.00 17.06 ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? -29.087 22.651  -31.301 1.00 20.66 ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? -29.108 24.147  -31.018 1.00 23.07 ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? -28.044 24.804  -31.065 1.00 22.53 ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? -30.209 24.666  -30.734 1.00 25.56 ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? -25.484 22.791  -30.972 1.00 18.36 ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? -24.365 22.922  -30.036 1.00 19.81 ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? -24.671 23.841  -28.853 1.00 18.19 ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? -24.075 23.693  -27.786 1.00 16.90 ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? -23.083 23.387  -30.757 1.00 21.68 ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? -23.043 24.857  -31.047 1.00 25.37 ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? -22.565 25.782  -30.143 1.00 27.50 ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? -23.415 25.561  -32.143 1.00 27.65 ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? -22.649 26.992  -30.667 1.00 27.13 ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? -23.161 26.886  -31.881 1.00 28.75 ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? -25.596 24.782  -29.046 1.00 18.56 ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? -25.972 25.727  -27.987 1.00 18.16 ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? -26.703 25.063  -26.824 1.00 18.57 ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? -26.766 25.631  -25.728 1.00 16.24 ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? -26.831 26.921  -28.513 1.00 18.43 ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? -28.101 26.446  -28.985 1.00 20.93 ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? -26.107 27.665  -29.626 1.00 17.28 ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? -27.255 23.870  -27.071 1.00 16.01 ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? -27.937 23.086  -26.032 1.00 16.66 ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? -26.984 22.130  -25.313 1.00 16.00 ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? -27.362 21.499  -24.327 1.00 16.31 ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? -29.108 22.283  -26.623 1.00 16.94 ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? -30.040 23.055  -27.548 1.00 20.02 ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? -30.799 24.140  -26.825 1.00 23.21 ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? -31.954 24.643  -27.683 1.00 24.96 ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? -32.383 25.988  -27.232 1.00 29.02 ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? -25.752 22.027  -25.807 1.00 14.83 ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? -24.779 21.096  -25.240 1.00 14.57 ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? -23.899 21.823  -24.229 1.00 14.29 ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? -23.241 22.810  -24.566 1.00 13.78 ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? -23.901 20.440  -26.336 1.00 13.27 ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? -24.772 19.695  -27.354 1.00 10.55 ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? -22.860 19.495  -25.707 1.00 14.17 ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? -24.009 19.154  -28.572 1.00 12.14 ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? -23.889 21.333  -22.992 1.00 14.80 ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? -23.084 21.954  -21.947 1.00 14.62 ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? -21.626 21.537  -22.071 1.00 13.81 ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? -21.260 20.403  -21.756 1.00 14.48 ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? -23.631 21.620  -20.550 1.00 14.10 ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? -23.142 22.585  -19.463 1.00 14.67 ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? -23.826 22.353  -18.110 1.00 13.33 ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? -25.278 22.527  -18.200 1.00 13.47 ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? -25.917 23.690  -18.071 1.00 13.96 ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? -25.250 24.813  -17.835 1.00 14.35 ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? -27.236 23.730  -18.181 1.00 14.46 ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? -20.805 22.468  -22.543 1.00 14.21 ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? -19.374 22.262  -22.636 1.00 14.08 ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? -18.697 22.983  -21.468 1.00 15.02 ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? -18.763 24.211  -21.362 1.00 14.37 ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? -18.814 22.755  -23.999 1.00 13.88 ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? -17.317 22.523  -24.082 1.00 14.49 ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? -19.524 22.048  -25.167 1.00 14.25 ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? -18.059 22.210  -20.593 1.00 14.42 ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? -17.368 22.771  -19.439 1.00 14.63 ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? -15.854 22.747  -19.626 1.00 15.88 ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? -15.282 21.718  -20.008 1.00 15.62 ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? -17.764 22.033  -18.162 1.00 14.20 ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? -15.232 23.901  -19.382 1.00 16.03 ? 112  ASN A N     1 
ATOM   931  C  CA    A ASN A 1 112 ? -13.778 24.044  -19.374 0.50 16.74 ? 112  ASN A CA    1 
ATOM   932  C  CA    B ASN A 1 112 ? -13.775 24.032  -19.377 0.50 16.87 ? 112  ASN A CA    1 
ATOM   933  C  C     . ASN A 1 112 ? -13.352 24.401  -17.962 1.00 16.65 ? 112  ASN A C     1 
ATOM   934  O  O     . ASN A 1 112 ? -13.775 25.425  -17.430 1.00 15.96 ? 112  ASN A O     1 
ATOM   935  C  CB    A ASN A 1 112 ? -13.324 25.163  -20.323 0.50 16.08 ? 112  ASN A CB    1 
ATOM   936  C  CB    B ASN A 1 112 ? -13.322 25.114  -20.371 0.50 16.38 ? 112  ASN A CB    1 
ATOM   937  C  CG    A ASN A 1 112 ? -13.303 24.736  -21.774 0.50 17.88 ? 112  ASN A CG    1 
ATOM   938  C  CG    B ASN A 1 112 ? -11.867 24.949  -20.817 0.50 18.78 ? 112  ASN A CG    1 
ATOM   939  O  OD1   A ASN A 1 112 ? -12.245 24.704  -22.409 0.50 18.82 ? 112  ASN A OD1   1 
ATOM   940  O  OD1   B ASN A 1 112 ? -10.928 25.084  -20.026 0.50 19.41 ? 112  ASN A OD1   1 
ATOM   941  N  ND2   A ASN A 1 112 ? -14.469 24.417  -22.315 0.50 17.24 ? 112  ASN A ND2   1 
ATOM   942  N  ND2   B ASN A 1 112 ? -11.679 24.684  -22.106 0.50 18.26 ? 112  ASN A ND2   1 
ATOM   943  N  N     . PHE A 1 113 ? -12.534 23.561  -17.337 1.00 15.38 ? 113  PHE A N     1 
ATOM   944  C  CA    . PHE A 1 113 ? -12.122 23.870  -15.971 1.00 16.43 ? 113  PHE A CA    1 
ATOM   945  C  C     . PHE A 1 113 ? -10.653 23.591  -15.685 1.00 16.94 ? 113  PHE A C     1 
ATOM   946  O  O     . PHE A 1 113 ? -9.970  22.926  -16.462 1.00 14.58 ? 113  PHE A O     1 
ATOM   947  C  CB    . PHE A 1 113 ? -13.058 23.208  -14.934 1.00 17.03 ? 113  PHE A CB    1 
ATOM   948  C  CG    . PHE A 1 113 ? -12.673 21.800  -14.542 1.00 19.21 ? 113  PHE A CG    1 
ATOM   949  C  CD1   . PHE A 1 113 ? -12.555 20.793  -15.498 1.00 16.85 ? 113  PHE A CD1   1 
ATOM   950  C  CD2   . PHE A 1 113 ? -12.471 21.476  -13.197 1.00 19.65 ? 113  PHE A CD2   1 
ATOM   951  C  CE1   . PHE A 1 113 ? -12.215 19.487  -15.120 1.00 19.76 ? 113  PHE A CE1   1 
ATOM   952  C  CE2   . PHE A 1 113 ? -12.134 20.179  -12.809 1.00 17.96 ? 113  PHE A CE2   1 
ATOM   953  C  CZ    . PHE A 1 113 ? -12.003 19.182  -13.773 1.00 17.59 ? 113  PHE A CZ    1 
ATOM   954  N  N     . ASP A 1 114 ? -10.179 24.136  -14.571 1.00 16.84 ? 114  ASP A N     1 
ATOM   955  C  CA    . ASP A 1 114 ? -8.849  23.846  -14.068 1.00 18.46 ? 114  ASP A CA    1 
ATOM   956  C  C     . ASP A 1 114 ? -8.777  24.200  -12.589 1.00 17.92 ? 114  ASP A C     1 
ATOM   957  O  O     . ASP A 1 114 ? -9.512  25.073  -12.111 1.00 17.38 ? 114  ASP A O     1 
ATOM   958  C  CB    . ASP A 1 114 ? -7.780  24.610  -14.853 1.00 21.67 ? 114  ASP A CB    1 
ATOM   959  C  CG    . ASP A 1 114 ? -6.383  24.060  -14.612 1.00 26.38 ? 114  ASP A CG    1 
ATOM   960  O  OD1   . ASP A 1 114 ? -6.252  22.858  -14.253 1.00 30.91 ? 114  ASP A OD1   1 
ATOM   961  O  OD2   . ASP A 1 114 ? -5.424  24.833  -14.761 1.00 29.80 ? 114  ASP A OD2   1 
ATOM   962  N  N     . ILE A 1 115 ? -7.899  23.518  -11.866 1.00 16.35 ? 115  ILE A N     1 
ATOM   963  C  CA    . ILE A 1 115 ? -7.804  23.706  -10.420 1.00 16.99 ? 115  ILE A CA    1 
ATOM   964  C  C     . ILE A 1 115 ? -6.397  24.135  -10.013 1.00 16.96 ? 115  ILE A C     1 
ATOM   965  O  O     . ILE A 1 115 ? -5.443  23.930  -10.760 1.00 15.85 ? 115  ILE A O     1 
ATOM   966  C  CB    . ILE A 1 115 ? -8.232  22.425  -9.636  1.00 17.31 ? 115  ILE A CB    1 
ATOM   967  C  CG1   . ILE A 1 115 ? -7.185  21.308  -9.764  1.00 17.61 ? 115  ILE A CG1   1 
ATOM   968  C  CG2   . ILE A 1 115 ? -9.596  21.933  -10.117 1.00 15.35 ? 115  ILE A CG2   1 
ATOM   969  C  CD1   . ILE A 1 115 ? -7.356  20.159  -8.746  1.00 13.53 ? 115  ILE A CD1   1 
ATOM   970  N  N     . GLU A 1 116 ? -6.278  24.740  -8.835  1.00 15.22 ? 116  GLU A N     1 
ATOM   971  C  CA    . GLU A 1 116 ? -4.968  25.029  -8.261  1.00 14.99 ? 116  GLU A CA    1 
ATOM   972  C  C     . GLU A 1 116 ? -4.838  24.292  -6.941  1.00 15.16 ? 116  GLU A C     1 
ATOM   973  O  O     . GLU A 1 116 ? -5.815  24.166  -6.205  1.00 14.45 ? 116  GLU A O     1 
ATOM   974  C  CB    . GLU A 1 116 ? -4.786  26.530  -8.040  1.00 15.81 ? 116  GLU A CB    1 
ATOM   975  C  CG    . GLU A 1 116 ? -4.958  27.385  -9.294  1.00 16.28 ? 116  GLU A CG    1 
ATOM   976  C  CD    . GLU A 1 116 ? -3.907  27.116  -10.354 1.00 18.21 ? 116  GLU A CD    1 
ATOM   977  O  OE1   . GLU A 1 116 ? -2.814  26.611  -10.023 1.00 19.06 ? 116  GLU A OE1   1 
ATOM   978  O  OE2   . GLU A 1 116 ? -4.168  27.422  -11.534 1.00 20.23 ? 116  GLU A OE2   1 
ATOM   979  N  N     . VAL A 1 117 ? -3.631  23.805  -6.653  1.00 16.56 ? 117  VAL A N     1 
ATOM   980  C  CA    . VAL A 1 117 ? -3.345  23.053  -5.426  1.00 15.20 ? 117  VAL A CA    1 
ATOM   981  C  C     . VAL A 1 117 ? -1.944  23.433  -4.929  1.00 16.57 ? 117  VAL A C     1 
ATOM   982  O  O     . VAL A 1 117 ? -0.943  23.017  -5.517  1.00 14.34 ? 117  VAL A O     1 
ATOM   983  C  CB    . VAL A 1 117 ? -3.403  21.511  -5.658  1.00 15.37 ? 117  VAL A CB    1 
ATOM   984  C  CG1   . VAL A 1 117 ? -3.063  20.752  -4.373  1.00 15.58 ? 117  VAL A CG1   1 
ATOM   985  C  CG2   . VAL A 1 117 ? -4.772  21.067  -6.185  1.00 15.13 ? 117  VAL A CG2   1 
ATOM   986  N  N     . THR A 1 118 ? -1.872  24.224  -3.860  1.00 15.87 ? 118  THR A N     1 
ATOM   987  C  CA    . THR A 1 118 ? -0.581  24.571  -3.262  1.00 16.78 ? 118  THR A CA    1 
ATOM   988  C  C     . THR A 1 118 ? 0.014   23.336  -2.590  1.00 18.72 ? 118  THR A C     1 
ATOM   989  O  O     . THR A 1 118 ? -0.678  22.636  -1.843  1.00 17.52 ? 118  THR A O     1 
ATOM   990  C  CB    . THR A 1 118 ? -0.710  25.734  -2.258  1.00 16.19 ? 118  THR A CB    1 
ATOM   991  O  OG1   . THR A 1 118 ? -1.141  26.909  -2.958  1.00 14.50 ? 118  THR A OG1   1 
ATOM   992  C  CG2   . THR A 1 118 ? 0.632   26.021  -1.553  1.00 15.21 ? 118  THR A CG2   1 
ATOM   993  N  N     . SER A 1 119 ? 1.284   23.063  -2.887  1.00 20.94 ? 119  SER A N     1 
ATOM   994  C  CA    . SER A 1 119 ? 1.990   21.908  -2.331  1.00 24.55 ? 119  SER A CA    1 
ATOM   995  C  C     . SER A 1 119 ? 3.434   22.244  -1.970  1.00 26.03 ? 119  SER A C     1 
ATOM   996  O  O     . SER A 1 119 ? 4.259   22.450  -2.861  1.00 26.16 ? 119  SER A O     1 
ATOM   997  C  CB    . SER A 1 119 ? 1.971   20.732  -3.314  1.00 26.23 ? 119  SER A CB    1 
ATOM   998  O  OG    . SER A 1 119 ? 2.818   19.686  -2.855  1.00 26.36 ? 119  SER A OG    1 
ATOM   999  N  N     . PRO A 1 120 ? 3.749   22.281  -0.663  1.00 28.30 ? 120  PRO A N     1 
ATOM   1000 C  CA    . PRO A 1 120 ? 5.114   22.566  -0.213  1.00 30.02 ? 120  PRO A CA    1 
ATOM   1001 C  C     . PRO A 1 120 ? 6.069   21.361  -0.266  1.00 31.87 ? 120  PRO A C     1 
ATOM   1002 O  O     . PRO A 1 120 ? 7.241   21.500  0.086   1.00 30.91 ? 120  PRO A O     1 
ATOM   1003 C  CB    . PRO A 1 120 ? 4.910   23.019  1.235   1.00 29.78 ? 120  PRO A CB    1 
ATOM   1004 C  CG    . PRO A 1 120 ? 3.696   22.280  1.683   1.00 29.99 ? 120  PRO A CG    1 
ATOM   1005 C  CD    . PRO A 1 120 ? 2.809   22.155  0.468   1.00 29.38 ? 120  PRO A CD    1 
ATOM   1006 N  N     . ASP A 1 121 ? 5.585   20.200  -0.708  1.00 33.94 ? 121  ASP A N     1 
ATOM   1007 C  CA    . ASP A 1 121 ? 6.413   18.986  -0.712  1.00 35.27 ? 121  ASP A CA    1 
ATOM   1008 C  C     . ASP A 1 121 ? 6.446   18.239  -2.053  1.00 35.05 ? 121  ASP A C     1 
ATOM   1009 O  O     . ASP A 1 121 ? 6.335   17.010  -2.095  1.00 35.35 ? 121  ASP A O     1 
ATOM   1010 C  CB    . ASP A 1 121 ? 6.012   18.047  0.439   1.00 36.18 ? 121  ASP A CB    1 
ATOM   1011 C  CG    . ASP A 1 121 ? 4.528   17.700  0.433   1.00 39.07 ? 121  ASP A CG    1 
ATOM   1012 O  OD1   . ASP A 1 121 ? 3.971   17.489  1.530   1.00 40.58 ? 121  ASP A OD1   1 
ATOM   1013 O  OD2   . ASP A 1 121 ? 3.917   17.633  -0.658  1.00 40.16 ? 121  ASP A OD2   1 
ATOM   1014 N  N     . GLY A 1 122 ? 6.615   18.989  -3.140  1.00 34.12 ? 122  GLY A N     1 
ATOM   1015 C  CA    . GLY A 1 122 ? 6.694   18.407  -4.477  1.00 33.00 ? 122  GLY A CA    1 
ATOM   1016 C  C     . GLY A 1 122 ? 5.377   18.474  -5.226  1.00 32.56 ? 122  GLY A C     1 
ATOM   1017 O  O     . GLY A 1 122 ? 4.449   19.162  -4.801  1.00 32.07 ? 122  GLY A O     1 
ATOM   1018 N  N     . PHE A 1 123 ? 5.303   17.758  -6.346  1.00 31.27 ? 123  PHE A N     1 
ATOM   1019 C  CA    . PHE A 1 123 ? 4.097   17.718  -7.169  1.00 30.24 ? 123  PHE A CA    1 
ATOM   1020 C  C     . PHE A 1 123 ? 2.935   17.076  -6.404  1.00 28.03 ? 123  PHE A C     1 
ATOM   1021 O  O     . PHE A 1 123 ? 3.096   16.000  -5.827  1.00 28.03 ? 123  PHE A O     1 
ATOM   1022 C  CB    . PHE A 1 123 ? 4.364   16.965  -8.479  1.00 30.37 ? 123  PHE A CB    1 
ATOM   1023 C  CG    . PHE A 1 123 ? 3.262   17.103  -9.495  1.00 32.06 ? 123  PHE A CG    1 
ATOM   1024 C  CD1   . PHE A 1 123 ? 3.237   18.190  -10.371 1.00 31.29 ? 123  PHE A CD1   1 
ATOM   1025 C  CD2   . PHE A 1 123 ? 2.249   16.147  -9.580  1.00 31.47 ? 123  PHE A CD2   1 
ATOM   1026 C  CE1   . PHE A 1 123 ? 2.221   18.326  -11.314 1.00 32.15 ? 123  PHE A CE1   1 
ATOM   1027 C  CE2   . PHE A 1 123 ? 1.221   16.273  -10.520 1.00 32.54 ? 123  PHE A CE2   1 
ATOM   1028 C  CZ    . PHE A 1 123 ? 1.207   17.364  -11.386 1.00 32.52 ? 123  PHE A CZ    1 
ATOM   1029 N  N     . PRO A 1 124 ? 1.765   17.744  -6.389  1.00 26.52 ? 124  PRO A N     1 
ATOM   1030 C  CA    . PRO A 1 124 ? 0.583   17.193  -5.714  1.00 25.68 ? 124  PRO A CA    1 
ATOM   1031 C  C     . PRO A 1 124 ? -0.055  16.049  -6.510  1.00 24.98 ? 124  PRO A C     1 
ATOM   1032 O  O     . PRO A 1 124 ? -0.848  16.290  -7.424  1.00 25.86 ? 124  PRO A O     1 
ATOM   1033 C  CB    . PRO A 1 124 ? -0.364  18.395  -5.618  1.00 24.22 ? 124  PRO A CB    1 
ATOM   1034 C  CG    . PRO A 1 124 ? 0.047   19.295  -6.735  1.00 26.74 ? 124  PRO A CG    1 
ATOM   1035 C  CD    . PRO A 1 124 ? 1.514   19.085  -6.955  1.00 25.20 ? 124  PRO A CD    1 
ATOM   1036 N  N     . GLU A 1 125 ? 0.298   14.816  -6.155  1.00 23.94 ? 125  GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 125 ? -0.190  13.626  -6.858  1.00 23.21 ? 125  GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 125 ? -1.700  13.461  -6.704  1.00 21.04 ? 125  GLU A C     1 
ATOM   1039 O  O     . GLU A 1 125 ? -2.211  13.497  -5.582  1.00 18.11 ? 125  GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 125 ? 0.530   12.367  -6.360  1.00 24.32 ? 125  GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 125 ? 1.991   12.249  -6.805  1.00 31.43 ? 125  GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 125 ? 2.164   12.301  -8.319  1.00 36.00 ? 125  GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 125 ? 1.396   11.629  -9.042  1.00 37.99 ? 125  GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 125 ? 3.075   13.017  -8.784  1.00 38.85 ? 125  GLU A OE2   1 
ATOM   1045 N  N     . PRO A 1 126 ? -2.419  13.296  -7.833  1.00 21.61 ? 126  PRO A N     1 
ATOM   1046 C  CA    . PRO A 1 126 ? -3.870  13.122  -7.787  1.00 21.03 ? 126  PRO A CA    1 
ATOM   1047 C  C     . PRO A 1 126 ? -4.301  11.872  -7.027  1.00 21.96 ? 126  PRO A C     1 
ATOM   1048 O  O     . PRO A 1 126 ? -5.326  11.900  -6.346  1.00 22.92 ? 126  PRO A O     1 
ATOM   1049 C  CB    . PRO A 1 126 ? -4.261  13.015  -9.266  1.00 21.11 ? 126  PRO A CB    1 
ATOM   1050 C  CG    . PRO A 1 126 ? -3.186  13.734  -9.985  1.00 22.39 ? 126  PRO A CG    1 
ATOM   1051 C  CD    . PRO A 1 126 ? -1.932  13.423  -9.220  1.00 21.30 ? 126  PRO A CD    1 
ATOM   1052 N  N     . SER A 1 127 ? -3.532  10.791  -7.129  1.00 21.24 ? 127  SER A N     1 
ATOM   1053 C  CA    . SER A 1 127 ? -3.910  9.551   -6.452  1.00 22.85 ? 127  SER A CA    1 
ATOM   1054 C  C     . SER A 1 127 ? -3.903  9.701   -4.927  1.00 22.94 ? 127  SER A C     1 
ATOM   1055 O  O     . SER A 1 127 ? -4.670  9.033   -4.241  1.00 22.81 ? 127  SER A O     1 
ATOM   1056 C  CB    . SER A 1 127 ? -3.031  8.376   -6.899  1.00 22.76 ? 127  SER A CB    1 
ATOM   1057 O  OG    . SER A 1 127 ? -1.681  8.576   -6.527  1.00 24.84 ? 127  SER A OG    1 
ATOM   1058 N  N     . GLN A 1 128 ? -3.055  10.596  -4.414  1.00 22.46 ? 128  GLN A N     1 
ATOM   1059 C  CA    A GLN A 1 128 ? -2.968  10.836  -2.973  0.50 21.97 ? 128  GLN A CA    1 
ATOM   1060 C  CA    B GLN A 1 128 ? -2.951  10.848  -2.973  0.50 21.97 ? 128  GLN A CA    1 
ATOM   1061 C  C     . GLN A 1 128 ? -3.851  12.006  -2.535  1.00 21.41 ? 128  GLN A C     1 
ATOM   1062 O  O     . GLN A 1 128 ? -4.457  11.966  -1.459  1.00 18.28 ? 128  GLN A O     1 
ATOM   1063 C  CB    A GLN A 1 128 ? -1.514  11.062  -2.542  0.50 22.93 ? 128  GLN A CB    1 
ATOM   1064 C  CB    B GLN A 1 128 ? -1.496  11.132  -2.575  0.50 22.90 ? 128  GLN A CB    1 
ATOM   1065 C  CG    A GLN A 1 128 ? -0.563  9.941   -2.952  0.50 24.68 ? 128  GLN A CG    1 
ATOM   1066 C  CG    B GLN A 1 128 ? -0.563  9.928   -2.673  0.50 24.65 ? 128  GLN A CG    1 
ATOM   1067 C  CD    A GLN A 1 128 ? -1.135  8.564   -2.674  0.50 25.43 ? 128  GLN A CD    1 
ATOM   1068 C  CD    B GLN A 1 128 ? 0.886   10.277  -2.374  0.50 25.53 ? 128  GLN A CD    1 
ATOM   1069 O  OE1   A GLN A 1 128 ? -1.067  7.668   -3.518  0.50 26.91 ? 128  GLN A OE1   1 
ATOM   1070 O  OE1   B GLN A 1 128 ? 1.379   11.339  -2.761  0.50 25.85 ? 128  GLN A OE1   1 
ATOM   1071 N  NE2   A GLN A 1 128 ? -1.714  8.391   -1.492  0.50 25.58 ? 128  GLN A NE2   1 
ATOM   1072 N  NE2   B GLN A 1 128 ? 1.580   9.377   -1.687  0.50 25.90 ? 128  GLN A NE2   1 
ATOM   1073 N  N     . ALA A 1 129 ? -3.927  13.042  -3.374  1.00 19.62 ? 129  ALA A N     1 
ATOM   1074 C  CA    . ALA A 1 129 ? -4.721  14.246  -3.092  1.00 18.49 ? 129  ALA A CA    1 
ATOM   1075 C  C     . ALA A 1 129 ? -4.608  14.721  -1.640  1.00 18.68 ? 129  ALA A C     1 
ATOM   1076 O  O     . ALA A 1 129 ? -5.617  14.987  -0.973  1.00 16.89 ? 129  ALA A O     1 
ATOM   1077 C  CB    . ALA A 1 129 ? -6.182  14.033  -3.483  1.00 17.95 ? 129  ALA A CB    1 
ATOM   1078 N  N     . LYS A 1 130 ? -3.378  14.831  -1.151  1.00 18.79 ? 130  LYS A N     1 
ATOM   1079 C  CA    . LYS A 1 130 ? -3.171  15.138  0.263   1.00 19.89 ? 130  LYS A CA    1 
ATOM   1080 C  C     . LYS A 1 130 ? -3.222  16.627  0.590   1.00 19.28 ? 130  LYS A C     1 
ATOM   1081 O  O     . LYS A 1 130 ? -3.214  17.004  1.763   1.00 18.88 ? 130  LYS A O     1 
ATOM   1082 C  CB    . LYS A 1 130 ? -1.890  14.479  0.803   1.00 22.92 ? 130  LYS A CB    1 
ATOM   1083 C  CG    . LYS A 1 130 ? -0.588  14.897  0.135   1.00 25.63 ? 130  LYS A CG    1 
ATOM   1084 C  CD    . LYS A 1 130 ? 0.592   14.154  0.764   1.00 31.42 ? 130  LYS A CD    1 
ATOM   1085 C  CE    . LYS A 1 130 ? 1.904   14.497  0.076   1.00 34.84 ? 130  LYS A CE    1 
ATOM   1086 N  NZ    . LYS A 1 130 ? 3.037   13.670  0.584   1.00 35.54 ? 130  LYS A NZ    1 
ATOM   1087 N  N     . HIS A 1 131 ? -3.308  17.468  -0.442  1.00 17.38 ? 131  HIS A N     1 
ATOM   1088 C  CA    . HIS A 1 131 ? -3.284  18.917  -0.251  1.00 18.58 ? 131  HIS A CA    1 
ATOM   1089 C  C     . HIS A 1 131 ? -4.611  19.559  -0.633  1.00 17.32 ? 131  HIS A C     1 
ATOM   1090 O  O     . HIS A 1 131 ? -5.277  19.090  -1.553  1.00 19.82 ? 131  HIS A O     1 
ATOM   1091 C  CB    . HIS A 1 131 ? -2.153  19.548  -1.064  1.00 19.96 ? 131  HIS A CB    1 
ATOM   1092 C  CG    . HIS A 1 131 ? -0.804  18.976  -0.763  1.00 23.48 ? 131  HIS A CG    1 
ATOM   1093 N  ND1   . HIS A 1 131 ? -0.148  18.125  -1.626  1.00 27.56 ? 131  HIS A ND1   1 
ATOM   1094 C  CD2   . HIS A 1 131 ? 0.009   19.125  0.309   1.00 21.45 ? 131  HIS A CD2   1 
ATOM   1095 C  CE1   . HIS A 1 131 ? 1.015   17.782  -1.102  1.00 26.17 ? 131  HIS A CE1   1 
ATOM   1096 N  NE2   . HIS A 1 131 ? 1.136   18.378  0.071   1.00 24.57 ? 131  HIS A NE2   1 
ATOM   1097 N  N     . PRO A 1 132 ? -5.001  20.632  0.078   1.00 16.61 ? 132  PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 132 ? -6.240  21.330  -0.268  1.00 16.12 ? 132  PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 132 ? -6.295  21.828  -1.715  1.00 15.35 ? 132  PRO A C     1 
ATOM   1100 O  O     . PRO A 1 132 ? -5.290  22.302  -2.261  1.00 15.13 ? 132  PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 132 ? -6.276  22.523  0.703   1.00 16.79 ? 132  PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 132 ? -5.094  22.376  1.617   1.00 17.38 ? 132  PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 132 ? -4.465  21.049  1.386   1.00 17.24 ? 132  PRO A CD    1 
ATOM   1104 N  N     . ILE A 1 133 ? -7.464  21.691  -2.333  1.00 14.97 ? 133  ILE A N     1 
ATOM   1105 C  CA    . ILE A 1 133 ? -7.760  22.398  -3.575  1.00 15.24 ? 133  ILE A CA    1 
ATOM   1106 C  C     . ILE A 1 133 ? -8.066  23.836  -3.164  1.00 15.92 ? 133  ILE A C     1 
ATOM   1107 O  O     . ILE A 1 133 ? -8.985  24.068  -2.373  1.00 16.76 ? 133  ILE A O     1 
ATOM   1108 C  CB    . ILE A 1 133 ? -8.962  21.770  -4.326  1.00 14.84 ? 133  ILE A CB    1 
ATOM   1109 C  CG1   . ILE A 1 133 ? -8.641  20.323  -4.734  1.00 14.18 ? 133  ILE A CG1   1 
ATOM   1110 C  CG2   . ILE A 1 133 ? -9.346  22.625  -5.547  1.00 13.63 ? 133  ILE A CG2   1 
ATOM   1111 C  CD1   . ILE A 1 133 ? -9.832  19.526  -5.291  1.00 14.06 ? 133  ILE A CD1   1 
ATOM   1112 N  N     . ASP A 1 134 ? -7.279  24.792  -3.659  1.00 14.88 ? 134  ASP A N     1 
ATOM   1113 C  CA    . ASP A 1 134 ? -7.426  26.187  -3.213  1.00 14.47 ? 134  ASP A CA    1 
ATOM   1114 C  C     . ASP A 1 134 ? -7.935  27.164  -4.276  1.00 15.27 ? 134  ASP A C     1 
ATOM   1115 O  O     . ASP A 1 134 ? -8.120  28.354  -3.996  1.00 16.30 ? 134  ASP A O     1 
ATOM   1116 C  CB    . ASP A 1 134 ? -6.157  26.705  -2.503  1.00 13.70 ? 134  ASP A CB    1 
ATOM   1117 C  CG    . ASP A 1 134 ? -4.890  26.533  -3.332  1.00 15.38 ? 134  ASP A CG    1 
ATOM   1118 O  OD1   . ASP A 1 134 ? -4.957  26.543  -4.578  1.00 13.75 ? 134  ASP A OD1   1 
ATOM   1119 O  OD2   . ASP A 1 134 ? -3.808  26.402  -2.722  1.00 15.01 ? 134  ASP A OD2   1 
ATOM   1120 N  N     . ALA A 1 135 ? -8.176  26.654  -5.484  1.00 14.72 ? 135  ALA A N     1 
ATOM   1121 C  CA    . ALA A 1 135 ? -8.859  27.414  -6.532  1.00 15.38 ? 135  ALA A CA    1 
ATOM   1122 C  C     . ALA A 1 135 ? -9.470  26.495  -7.578  1.00 15.41 ? 135  ALA A C     1 
ATOM   1123 O  O     . ALA A 1 135 ? -8.868  25.491  -7.946  1.00 17.52 ? 135  ALA A O     1 
ATOM   1124 C  CB    . ALA A 1 135 ? -7.906  28.401  -7.204  1.00 13.06 ? 135  ALA A CB    1 
ATOM   1125 N  N     . ILE A 1 136 ? -10.671 26.843  -8.037  1.00 15.19 ? 136  ILE A N     1 
ATOM   1126 C  CA    . ILE A 1 136 ? -11.266 26.237  -9.226  1.00 15.83 ? 136  ILE A CA    1 
ATOM   1127 C  C     . ILE A 1 136 ? -11.865 27.345  -10.091 1.00 16.41 ? 136  ILE A C     1 
ATOM   1128 O  O     . ILE A 1 136 ? -12.609 28.195  -9.597  1.00 15.90 ? 136  ILE A O     1 
ATOM   1129 C  CB    . ILE A 1 136 ? -12.386 25.195  -8.911  1.00 13.93 ? 136  ILE A CB    1 
ATOM   1130 C  CG1   . ILE A 1 136 ? -11.908 24.122  -7.923  1.00 13.20 ? 136  ILE A CG1   1 
ATOM   1131 C  CG2   . ILE A 1 136 ? -12.860 24.532  -10.208 1.00 11.62 ? 136  ILE A CG2   1 
ATOM   1132 C  CD1   . ILE A 1 136 ? -13.021 23.208  -7.378  1.00 14.82 ? 136  ILE A CD1   1 
ATOM   1133 N  N     . THR A 1 137 ? -11.510 27.348  -11.372 1.00 15.20 ? 137  THR A N     1 
ATOM   1134 C  CA    . THR A 1 137 ? -12.237 28.130  -12.364 1.00 15.28 ? 137  THR A CA    1 
ATOM   1135 C  C     . THR A 1 137 ? -12.896 27.162  -13.341 1.00 15.59 ? 137  THR A C     1 
ATOM   1136 O  O     . THR A 1 137 ? -12.233 26.324  -13.944 1.00 15.20 ? 137  THR A O     1 
ATOM   1137 C  CB    . THR A 1 137 ? -11.342 29.157  -13.093 1.00 16.43 ? 137  THR A CB    1 
ATOM   1138 O  OG1   . THR A 1 137 ? -10.876 30.130  -12.153 1.00 14.53 ? 137  THR A OG1   1 
ATOM   1139 C  CG2   . THR A 1 137 ? -12.132 29.890  -14.197 1.00 16.15 ? 137  THR A CG2   1 
ATOM   1140 N  N     . HIS A 1 138 ? -14.212 27.290  -13.473 1.00 15.35 ? 138  HIS A N     1 
ATOM   1141 C  CA    . HIS A 1 138 ? -15.025 26.373  -14.249 1.00 14.36 ? 138  HIS A CA    1 
ATOM   1142 C  C     . HIS A 1 138 ? -15.868 27.233  -15.184 1.00 15.07 ? 138  HIS A C     1 
ATOM   1143 O  O     . HIS A 1 138 ? -16.748 27.972  -14.735 1.00 13.70 ? 138  HIS A O     1 
ATOM   1144 C  CB    . HIS A 1 138 ? -15.906 25.570  -13.278 1.00 15.46 ? 138  HIS A CB    1 
ATOM   1145 C  CG    . HIS A 1 138 ? -16.821 24.573  -13.926 1.00 14.75 ? 138  HIS A CG    1 
ATOM   1146 N  ND1   . HIS A 1 138 ? -16.781 23.227  -13.624 1.00 15.27 ? 138  HIS A ND1   1 
ATOM   1147 C  CD2   . HIS A 1 138 ? -17.836 24.728  -14.813 1.00 15.68 ? 138  HIS A CD2   1 
ATOM   1148 C  CE1   . HIS A 1 138 ? -17.721 22.595  -14.307 1.00 16.02 ? 138  HIS A CE1   1 
ATOM   1149 N  NE2   . HIS A 1 138 ? -18.376 23.482  -15.036 1.00 14.33 ? 138  HIS A NE2   1 
ATOM   1150 N  N     . TYR A 1 139 ? -15.577 27.158  -16.479 1.00 12.93 ? 139  TYR A N     1 
ATOM   1151 C  CA    . TYR A 1 139 ? -16.341 27.904  -17.471 1.00 13.60 ? 139  TYR A CA    1 
ATOM   1152 C  C     . TYR A 1 139 ? -17.450 27.041  -18.052 1.00 12.59 ? 139  TYR A C     1 
ATOM   1153 O  O     . TYR A 1 139 ? -17.207 25.913  -18.489 1.00 12.58 ? 139  TYR A O     1 
ATOM   1154 C  CB    . TYR A 1 139 ? -15.440 28.412  -18.604 1.00 14.41 ? 139  TYR A CB    1 
ATOM   1155 C  CG    . TYR A 1 139 ? -16.220 29.005  -19.754 1.00 12.71 ? 139  TYR A CG    1 
ATOM   1156 C  CD1   . TYR A 1 139 ? -16.618 28.216  -20.833 1.00 11.73 ? 139  TYR A CD1   1 
ATOM   1157 C  CD2   . TYR A 1 139 ? -16.573 30.357  -19.756 1.00 12.90 ? 139  TYR A CD2   1 
ATOM   1158 C  CE1   . TYR A 1 139 ? -17.343 28.762  -21.902 1.00 13.98 ? 139  TYR A CE1   1 
ATOM   1159 C  CE2   . TYR A 1 139 ? -17.293 30.911  -20.813 1.00 14.87 ? 139  TYR A CE2   1 
ATOM   1160 C  CZ    . TYR A 1 139 ? -17.680 30.107  -21.880 1.00 17.59 ? 139  TYR A CZ    1 
ATOM   1161 O  OH    . TYR A 1 139 ? -18.400 30.656  -22.926 1.00 15.63 ? 139  TYR A OH    1 
ATOM   1162 N  N     . ASP A 1 140 ? -18.657 27.600  -18.085 1.00 12.88 ? 140  ASP A N     1 
ATOM   1163 C  CA    . ASP A 1 140 ? -19.829 26.909  -18.609 1.00 13.11 ? 140  ASP A CA    1 
ATOM   1164 C  C     . ASP A 1 140 ? -20.265 27.556  -19.927 1.00 13.57 ? 140  ASP A C     1 
ATOM   1165 O  O     . ASP A 1 140 ? -20.552 28.755  -19.957 1.00 13.94 ? 140  ASP A O     1 
ATOM   1166 C  CB    . ASP A 1 140 ? -20.944 26.982  -17.566 1.00 14.35 ? 140  ASP A CB    1 
ATOM   1167 C  CG    . ASP A 1 140 ? -22.201 26.267  -18.005 1.00 14.96 ? 140  ASP A CG    1 
ATOM   1168 O  OD1   . ASP A 1 140 ? -22.925 26.811  -18.860 1.00 13.98 ? 140  ASP A OD1   1 
ATOM   1169 O  OD2   . ASP A 1 140 ? -22.465 25.168  -17.478 1.00 13.86 ? 140  ASP A OD2   1 
ATOM   1170 N  N     . SER A 1 141 ? -20.319 26.767  -21.006 1.00 13.97 ? 141  SER A N     1 
ATOM   1171 C  CA    . SER A 1 141 ? -20.659 27.287  -22.345 1.00 14.62 ? 141  SER A CA    1 
ATOM   1172 C  C     . SER A 1 141 ? -22.107 27.759  -22.492 1.00 16.20 ? 141  SER A C     1 
ATOM   1173 O  O     . SER A 1 141 ? -22.404 28.609  -23.340 1.00 15.46 ? 141  SER A O     1 
ATOM   1174 C  CB    . SER A 1 141 ? -20.336 26.269  -23.448 1.00 14.73 ? 141  SER A CB    1 
ATOM   1175 O  OG    . SER A 1 141 ? -21.236 25.169  -23.437 1.00 14.10 ? 141  SER A OG    1 
ATOM   1176 N  N     . ILE A 1 142 ? -23.008 27.199  -21.688 1.00 16.26 ? 142  ILE A N     1 
ATOM   1177 C  CA    . ILE A 1 142 ? -24.412 27.611  -21.734 1.00 15.21 ? 142  ILE A CA    1 
ATOM   1178 C  C     . ILE A 1 142 ? -24.600 28.971  -21.053 1.00 17.40 ? 142  ILE A C     1 
ATOM   1179 O  O     . ILE A 1 142 ? -25.229 29.865  -21.618 1.00 17.06 ? 142  ILE A O     1 
ATOM   1180 C  CB    . ILE A 1 142 ? -25.367 26.507  -21.200 1.00 14.72 ? 142  ILE A CB    1 
ATOM   1181 C  CG1   . ILE A 1 142 ? -25.335 25.308  -22.160 1.00 13.22 ? 142  ILE A CG1   1 
ATOM   1182 C  CG2   . ILE A 1 142 ? -26.814 27.034  -21.053 1.00 15.15 ? 142  ILE A CG2   1 
ATOM   1183 C  CD1   . ILE A 1 142 ? -26.192 24.136  -21.754 1.00 14.95 ? 142  ILE A CD1   1 
ATOM   1184 N  N     . ASP A 1 143 ? -24.027 29.138  -19.862 1.00 16.12 ? 143  ASP A N     1 
ATOM   1185 C  CA    . ASP A 1 143 ? -24.097 30.423  -19.166 1.00 17.73 ? 143  ASP A CA    1 
ATOM   1186 C  C     . ASP A 1 143 ? -23.155 31.464  -19.763 1.00 16.45 ? 143  ASP A C     1 
ATOM   1187 O  O     . ASP A 1 143 ? -23.378 32.665  -19.593 1.00 16.25 ? 143  ASP A O     1 
ATOM   1188 C  CB    . ASP A 1 143 ? -23.771 30.254  -17.684 1.00 17.48 ? 143  ASP A CB    1 
ATOM   1189 C  CG    . ASP A 1 143 ? -24.782 29.394  -16.955 1.00 21.90 ? 143  ASP A CG    1 
ATOM   1190 O  OD1   . ASP A 1 143 ? -25.880 29.141  -17.503 1.00 21.77 ? 143  ASP A OD1   1 
ATOM   1191 O  OD2   . ASP A 1 143 ? -24.472 28.970  -15.822 1.00 20.30 ? 143  ASP A OD2   1 
ATOM   1192 N  N     . ASP A 1 144 ? -22.118 30.995  -20.463 1.00 15.12 ? 144  ASP A N     1 
ATOM   1193 C  CA    . ASP A 1 144 ? -21.006 31.844  -20.911 1.00 15.23 ? 144  ASP A CA    1 
ATOM   1194 C  C     . ASP A 1 144 ? -20.445 32.617  -19.710 1.00 14.22 ? 144  ASP A C     1 
ATOM   1195 O  O     . ASP A 1 144 ? -20.321 33.848  -19.742 1.00 13.73 ? 144  ASP A O     1 
ATOM   1196 C  CB    . ASP A 1 144 ? -21.450 32.787  -22.043 1.00 14.81 ? 144  ASP A CB    1 
ATOM   1197 C  CG    . ASP A 1 144 ? -20.286 33.553  -22.673 1.00 17.28 ? 144  ASP A CG    1 
ATOM   1198 O  OD1   . ASP A 1 144 ? -19.141 33.041  -22.687 1.00 16.62 ? 144  ASP A OD1   1 
ATOM   1199 O  OD2   . ASP A 1 144 ? -20.525 34.679  -23.163 1.00 16.89 ? 144  ASP A OD2   1 
ATOM   1200 N  N     . ARG A 1 145 ? -20.144 31.882  -18.639 1.00 15.07 ? 145  ARG A N     1 
ATOM   1201 C  CA    . ARG A 1 145 ? -19.625 32.479  -17.403 1.00 16.81 ? 145  ARG A CA    1 
ATOM   1202 C  C     . ARG A 1 145 ? -18.471 31.670  -16.828 1.00 15.69 ? 145  ARG A C     1 
ATOM   1203 O  O     . ARG A 1 145 ? -18.472 30.441  -16.895 1.00 15.97 ? 145  ARG A O     1 
ATOM   1204 C  CB    . ARG A 1 145 ? -20.734 32.612  -16.341 1.00 15.80 ? 145  ARG A CB    1 
ATOM   1205 C  CG    . ARG A 1 145 ? -21.884 33.557  -16.715 1.00 17.43 ? 145  ARG A CG    1 
ATOM   1206 C  CD    . ARG A 1 145 ? -21.463 35.029  -16.667 1.00 18.17 ? 145  ARG A CD    1 
ATOM   1207 N  NE    . ARG A 1 145 ? -22.579 35.936  -16.946 1.00 19.69 ? 145  ARG A NE    1 
ATOM   1208 C  CZ    . ARG A 1 145 ? -22.957 36.326  -18.165 1.00 21.06 ? 145  ARG A CZ    1 
ATOM   1209 N  NH1   . ARG A 1 145 ? -22.313 35.897  -19.244 1.00 18.27 ? 145  ARG A NH1   1 
ATOM   1210 N  NH2   . ARG A 1 145 ? -23.988 37.151  -18.307 1.00 20.82 ? 145  ARG A NH2   1 
ATOM   1211 N  N     . PHE A 1 146 ? -17.497 32.380  -16.263 1.00 14.42 ? 146  PHE A N     1 
ATOM   1212 C  CA    . PHE A 1 146 ? -16.382 31.775  -15.540 1.00 14.93 ? 146  PHE A CA    1 
ATOM   1213 C  C     . PHE A 1 146 ? -16.721 31.772  -14.052 1.00 15.54 ? 146  PHE A C     1 
ATOM   1214 O  O     . PHE A 1 146 ? -16.734 32.823  -13.413 1.00 15.11 ? 146  PHE A O     1 
ATOM   1215 C  CB    . PHE A 1 146 ? -15.098 32.587  -15.753 1.00 13.40 ? 146  PHE A CB    1 
ATOM   1216 C  CG    . PHE A 1 146 ? -14.645 32.653  -17.186 1.00 13.64 ? 146  PHE A CG    1 
ATOM   1217 C  CD1   . PHE A 1 146 ? -15.222 33.565  -18.076 1.00 13.87 ? 146  PHE A CD1   1 
ATOM   1218 C  CD2   . PHE A 1 146 ? -13.633 31.820  -17.642 1.00 12.86 ? 146  PHE A CD2   1 
ATOM   1219 C  CE1   . PHE A 1 146 ? -14.807 33.630  -19.406 1.00 14.08 ? 146  PHE A CE1   1 
ATOM   1220 C  CE2   . PHE A 1 146 ? -13.202 31.882  -18.971 1.00 12.49 ? 146  PHE A CE2   1 
ATOM   1221 C  CZ    . PHE A 1 146 ? -13.793 32.792  -19.853 1.00 15.06 ? 146  PHE A CZ    1 
ATOM   1222 N  N     . TYR A 1 147 ? -16.998 30.589  -13.511 1.00 16.01 ? 147  TYR A N     1 
ATOM   1223 C  CA    . TYR A 1 147 ? -17.300 30.441  -12.091 1.00 15.65 ? 147  TYR A CA    1 
ATOM   1224 C  C     . TYR A 1 147 ? -16.013 30.159  -11.336 1.00 14.89 ? 147  TYR A C     1 
ATOM   1225 O  O     . TYR A 1 147 ? -15.354 29.148  -11.578 1.00 14.53 ? 147  TYR A O     1 
ATOM   1226 C  CB    . TYR A 1 147 ? -18.318 29.320  -11.865 1.00 15.61 ? 147  TYR A CB    1 
ATOM   1227 C  CG    . TYR A 1 147 ? -19.673 29.615  -12.461 1.00 15.34 ? 147  TYR A CG    1 
ATOM   1228 C  CD1   . TYR A 1 147 ? -19.979 29.236  -13.768 1.00 14.12 ? 147  TYR A CD1   1 
ATOM   1229 C  CD2   . TYR A 1 147 ? -20.649 30.281  -11.718 1.00 15.18 ? 147  TYR A CD2   1 
ATOM   1230 C  CE1   . TYR A 1 147 ? -21.220 29.512  -14.325 1.00 14.36 ? 147  TYR A CE1   1 
ATOM   1231 C  CE2   . TYR A 1 147 ? -21.896 30.553  -12.259 1.00 17.16 ? 147  TYR A CE2   1 
ATOM   1232 C  CZ    . TYR A 1 147 ? -22.176 30.167  -13.562 1.00 17.43 ? 147  TYR A CZ    1 
ATOM   1233 O  OH    . TYR A 1 147 ? -23.410 30.447  -14.099 1.00 15.48 ? 147  TYR A OH    1 
ATOM   1234 N  N     . VAL A 1 148 ? -15.656 31.072  -10.438 1.00 14.55 ? 148  VAL A N     1 
ATOM   1235 C  CA    . VAL A 1 148 ? -14.375 31.021  -9.733  1.00 14.48 ? 148  VAL A CA    1 
ATOM   1236 C  C     . VAL A 1 148 ? -14.600 30.709  -8.255  1.00 15.60 ? 148  VAL A C     1 
ATOM   1237 O  O     . VAL A 1 148 ? -15.278 31.453  -7.549  1.00 15.57 ? 148  VAL A O     1 
ATOM   1238 C  CB    . VAL A 1 148 ? -13.578 32.345  -9.899  1.00 14.49 ? 148  VAL A CB    1 
ATOM   1239 C  CG1   . VAL A 1 148 ? -12.203 32.263  -9.215  1.00 13.33 ? 148  VAL A CG1   1 
ATOM   1240 C  CG2   . VAL A 1 148 ? -13.422 32.697  -11.378 1.00 12.48 ? 148  VAL A CG2   1 
ATOM   1241 N  N     . PHE A 1 149 ? -14.032 29.591  -7.818  1.00 14.69 ? 149  PHE A N     1 
ATOM   1242 C  CA    . PHE A 1 149 ? -14.122 29.121  -6.442  1.00 15.28 ? 149  PHE A CA    1 
ATOM   1243 C  C     . PHE A 1 149 ? -12.769 29.370  -5.786  1.00 14.57 ? 149  PHE A C     1 
ATOM   1244 O  O     . PHE A 1 149 ? -11.760 28.768  -6.171  1.00 14.72 ? 149  PHE A O     1 
ATOM   1245 C  CB    . PHE A 1 149 ? -14.463 27.626  -6.427  1.00 14.68 ? 149  PHE A CB    1 
ATOM   1246 C  CG    . PHE A 1 149 ? -15.784 27.294  -7.079  1.00 14.03 ? 149  PHE A CG    1 
ATOM   1247 C  CD1   . PHE A 1 149 ? -15.902 27.244  -8.469  1.00 14.28 ? 149  PHE A CD1   1 
ATOM   1248 C  CD2   . PHE A 1 149 ? -16.904 27.023  -6.301  1.00 13.88 ? 149  PHE A CD2   1 
ATOM   1249 C  CE1   . PHE A 1 149 ? -17.123 26.937  -9.078  1.00 14.71 ? 149  PHE A CE1   1 
ATOM   1250 C  CE2   . PHE A 1 149 ? -18.131 26.710  -6.894  1.00 15.15 ? 149  PHE A CE2   1 
ATOM   1251 C  CZ    . PHE A 1 149 ? -18.243 26.669  -8.284  1.00 17.37 ? 149  PHE A CZ    1 
ATOM   1252 N  N     . ASP A 1 150 ? -12.744 30.271  -4.812  1.00 14.42 ? 150  ASP A N     1 
ATOM   1253 C  CA    . ASP A 1 150 ? -11.483 30.739  -4.239  1.00 16.84 ? 150  ASP A CA    1 
ATOM   1254 C  C     . ASP A 1 150 ? -11.398 30.407  -2.752  1.00 16.49 ? 150  ASP A C     1 
ATOM   1255 O  O     . ASP A 1 150 ? -12.229 30.851  -1.952  1.00 16.74 ? 150  ASP A O     1 
ATOM   1256 C  CB    . ASP A 1 150 ? -11.333 32.249  -4.480  1.00 16.56 ? 150  ASP A CB    1 
ATOM   1257 C  CG    . ASP A 1 150 ? -10.014 32.820  -3.961  1.00 17.52 ? 150  ASP A CG    1 
ATOM   1258 O  OD1   . ASP A 1 150 ? -9.102  32.056  -3.572  1.00 19.43 ? 150  ASP A OD1   1 
ATOM   1259 O  OD2   . ASP A 1 150 ? -9.892  34.064  -3.949  1.00 16.65 ? 150  ASP A OD2   1 
ATOM   1260 N  N     . LEU A 1 151 ? -10.386 29.627  -2.390  1.00 17.29 ? 151  LEU A N     1 
ATOM   1261 C  CA    . LEU A 1 151 ? -10.166 29.282  -0.992  1.00 17.45 ? 151  LEU A CA    1 
ATOM   1262 C  C     . LEU A 1 151 ? -9.340  30.342  -0.277  1.00 18.13 ? 151  LEU A C     1 
ATOM   1263 O  O     . LEU A 1 151 ? -8.179  30.574  -0.622  1.00 19.75 ? 151  LEU A O     1 
ATOM   1264 C  CB    . LEU A 1 151 ? -9.490  27.919  -0.856  1.00 16.58 ? 151  LEU A CB    1 
ATOM   1265 C  CG    . LEU A 1 151 ? -9.338  27.440  0.592   1.00 16.71 ? 151  LEU A CG    1 
ATOM   1266 C  CD1   . LEU A 1 151 ? -10.698 27.347  1.285   1.00 16.69 ? 151  LEU A CD1   1 
ATOM   1267 C  CD2   . LEU A 1 151 ? -8.620  26.107  0.640   1.00 17.00 ? 151  LEU A CD2   1 
ATOM   1268 N  N     . LEU A 1 152 ? -9.940  30.960  0.737   1.00 18.14 ? 152  LEU A N     1 
ATOM   1269 C  CA    . LEU A 1 152 ? -9.283  32.043  1.467   1.00 19.71 ? 152  LEU A CA    1 
ATOM   1270 C  C     . LEU A 1 152 ? -8.472  31.549  2.653   1.00 20.29 ? 152  LEU A C     1 
ATOM   1271 O  O     . LEU A 1 152 ? -7.417  32.109  2.954   1.00 20.44 ? 152  LEU A O     1 
ATOM   1272 C  CB    . LEU A 1 152 ? -10.291 33.103  1.919   1.00 18.32 ? 152  LEU A CB    1 
ATOM   1273 C  CG    . LEU A 1 152 ? -11.113 33.826  0.848   1.00 19.08 ? 152  LEU A CG    1 
ATOM   1274 C  CD1   . LEU A 1 152 ? -11.867 34.983  1.491   1.00 18.52 ? 152  LEU A CD1   1 
ATOM   1275 C  CD2   . LEU A 1 152 ? -10.251 34.320  -0.324  1.00 16.46 ? 152  LEU A CD2   1 
ATOM   1276 N  N     . ASN A 1 153 ? -8.958  30.498  3.314   1.00 20.15 ? 153  ASN A N     1 
ATOM   1277 C  CA    . ASN A 1 153 ? -8.259  29.925  4.465   1.00 21.33 ? 153  ASN A CA    1 
ATOM   1278 C  C     . ASN A 1 153 ? -7.768  28.506  4.216   1.00 21.45 ? 153  ASN A C     1 
ATOM   1279 O  O     . ASN A 1 153 ? -8.535  27.626  3.822   1.00 20.66 ? 153  ASN A O     1 
ATOM   1280 C  CB    . ASN A 1 153 ? -9.128  29.969  5.724   1.00 23.20 ? 153  ASN A CB    1 
ATOM   1281 C  CG    . ASN A 1 153 ? -9.488  31.382  6.144   1.00 24.45 ? 153  ASN A CG    1 
ATOM   1282 O  OD1   . ASN A 1 153 ? -8.677  32.299  6.048   1.00 24.67 ? 153  ASN A OD1   1 
ATOM   1283 N  ND2   . ASN A 1 153 ? -10.712 31.558  6.625   1.00 26.64 ? 153  ASN A ND2   1 
ATOM   1284 N  N     . SER A 1 154 ? -6.481  28.296  4.466   1.00 20.79 ? 154  SER A N     1 
ATOM   1285 C  CA    . SER A 1 154 ? -5.828  27.025  4.200   1.00 20.52 ? 154  SER A CA    1 
ATOM   1286 C  C     . SER A 1 154 ? -4.668  26.830  5.170   1.00 20.68 ? 154  SER A C     1 
ATOM   1287 O  O     . SER A 1 154 ? -4.098  27.812  5.652   1.00 20.52 ? 154  SER A O     1 
ATOM   1288 C  CB    . SER A 1 154 ? -5.331  27.000  2.748   1.00 20.37 ? 154  SER A CB    1 
ATOM   1289 O  OG    . SER A 1 154 ? -4.175  26.203  2.600   1.00 21.69 ? 154  SER A OG    1 
ATOM   1290 N  N     . PRO A 1 155 ? -4.311  25.563  5.466   1.00 22.28 ? 155  PRO A N     1 
ATOM   1291 C  CA    . PRO A 1 155 ? -3.125  25.304  6.292   1.00 22.95 ? 155  PRO A CA    1 
ATOM   1292 C  C     . PRO A 1 155 ? -1.837  25.919  5.727   1.00 23.66 ? 155  PRO A C     1 
ATOM   1293 O  O     . PRO A 1 155 ? -0.856  26.036  6.457   1.00 23.27 ? 155  PRO A O     1 
ATOM   1294 C  CB    . PRO A 1 155 ? -3.028  23.766  6.313   1.00 21.91 ? 155  PRO A CB    1 
ATOM   1295 C  CG    . PRO A 1 155 ? -3.990  23.281  5.268   1.00 23.70 ? 155  PRO A CG    1 
ATOM   1296 C  CD    . PRO A 1 155 ? -5.053  24.322  5.180   1.00 22.98 ? 155  PRO A CD    1 
ATOM   1297 N  N     . TYR A 1 156 ? -1.852  26.319  4.453   1.00 23.41 ? 156  TYR A N     1 
ATOM   1298 C  CA    . TYR A 1 156 ? -0.674  26.917  3.810   1.00 24.39 ? 156  TYR A CA    1 
ATOM   1299 C  C     . TYR A 1 156 ? -0.744  28.442  3.691   1.00 23.94 ? 156  TYR A C     1 
ATOM   1300 O  O     . TYR A 1 156 ? 0.075   29.056  3.012   1.00 24.08 ? 156  TYR A O     1 
ATOM   1301 C  CB    . TYR A 1 156 ? -0.403  26.269  2.443   1.00 24.92 ? 156  TYR A CB    1 
ATOM   1302 C  CG    . TYR A 1 156 ? -0.323  24.760  2.507   1.00 25.88 ? 156  TYR A CG    1 
ATOM   1303 C  CD1   . TYR A 1 156 ? 0.425   24.124  3.503   1.00 28.57 ? 156  TYR A CD1   1 
ATOM   1304 C  CD2   . TYR A 1 156 ? -1.000  23.968  1.583   1.00 24.58 ? 156  TYR A CD2   1 
ATOM   1305 C  CE1   . TYR A 1 156 ? 0.492   22.738  3.579   1.00 27.88 ? 156  TYR A CE1   1 
ATOM   1306 C  CE2   . TYR A 1 156 ? -0.931  22.577  1.643   1.00 26.55 ? 156  TYR A CE2   1 
ATOM   1307 C  CZ    . TYR A 1 156 ? -0.186  21.973  2.648   1.00 28.47 ? 156  TYR A CZ    1 
ATOM   1308 O  OH    . TYR A 1 156 ? -0.115  20.604  2.725   1.00 30.52 ? 156  TYR A OH    1 
ATOM   1309 N  N     . GLY A 1 157 ? -1.713  29.046  4.371   1.00 24.99 ? 157  GLY A N     1 
ATOM   1310 C  CA    . GLY A 1 157 ? -1.833  30.499  4.409   1.00 23.20 ? 157  GLY A CA    1 
ATOM   1311 C  C     . GLY A 1 157 ? -3.268  30.975  4.350   1.00 22.43 ? 157  GLY A C     1 
ATOM   1312 O  O     . GLY A 1 157 ? -4.100  30.385  3.660   1.00 21.14 ? 157  GLY A O     1 
ATOM   1313 N  N     . ASN A 1 158 ? -3.558  32.032  5.103   1.00 22.19 ? 158  ASN A N     1 
ATOM   1314 C  CA    . ASN A 1 158 ? -4.846  32.710  5.029   1.00 21.41 ? 158  ASN A CA    1 
ATOM   1315 C  C     . ASN A 1 158 ? -4.687  33.960  4.180   1.00 20.83 ? 158  ASN A C     1 
ATOM   1316 O  O     . ASN A 1 158 ? -3.784  34.764  4.412   1.00 20.39 ? 158  ASN A O     1 
ATOM   1317 C  CB    . ASN A 1 158 ? -5.361  33.067  6.425   1.00 22.22 ? 158  ASN A CB    1 
ATOM   1318 C  CG    . ASN A 1 158 ? -5.822  31.849  7.215   1.00 22.71 ? 158  ASN A CG    1 
ATOM   1319 O  OD1   . ASN A 1 158 ? -5.842  30.723  6.710   1.00 23.30 ? 158  ASN A OD1   1 
ATOM   1320 N  ND2   . ASN A 1 158 ? -6.206  32.076  8.470   1.00 24.11 ? 158  ASN A ND2   1 
ATOM   1321 N  N     . VAL A 1 159 ? -5.546  34.110  3.178   1.00 19.40 ? 159  VAL A N     1 
ATOM   1322 C  CA    . VAL A 1 159 ? -5.397  35.202  2.216   1.00 19.48 ? 159  VAL A CA    1 
ATOM   1323 C  C     . VAL A 1 159 ? -6.654  36.061  2.117   1.00 20.69 ? 159  VAL A C     1 
ATOM   1324 O  O     . VAL A 1 159 ? -7.740  35.648  2.537   1.00 19.24 ? 159  VAL A O     1 
ATOM   1325 C  CB    . VAL A 1 159 ? -5.000  34.684  0.801   1.00 18.70 ? 159  VAL A CB    1 
ATOM   1326 C  CG1   . VAL A 1 159 ? -3.636  33.991  0.832   1.00 17.17 ? 159  VAL A CG1   1 
ATOM   1327 C  CG2   . VAL A 1 159 ? -6.068  33.753  0.242   1.00 15.56 ? 159  VAL A CG2   1 
ATOM   1328 N  N     . GLU A 1 160 ? -6.491  37.255  1.552   1.00 22.04 ? 160  GLU A N     1 
ATOM   1329 C  CA    . GLU A 1 160 ? -7.601  38.165  1.308   1.00 22.77 ? 160  GLU A CA    1 
ATOM   1330 C  C     . GLU A 1 160 ? -8.278  37.803  -0.009  1.00 22.10 ? 160  GLU A C     1 
ATOM   1331 O  O     . GLU A 1 160 ? -7.722  37.050  -0.811  1.00 20.58 ? 160  GLU A O     1 
ATOM   1332 C  CB    . GLU A 1 160 ? -7.108  39.617  1.266   1.00 25.34 ? 160  GLU A CB    1 
ATOM   1333 C  CG    . GLU A 1 160 ? -6.389  40.095  2.536   1.00 30.67 ? 160  GLU A CG    1 
ATOM   1334 C  CD    . GLU A 1 160 ? -7.270  40.050  3.776   1.00 36.40 ? 160  GLU A CD    1 
ATOM   1335 O  OE1   . GLU A 1 160 ? -8.461  40.423  3.688   1.00 38.77 ? 160  GLU A OE1   1 
ATOM   1336 O  OE2   . GLU A 1 160 ? -6.764  39.644  4.846   1.00 39.81 ? 160  GLU A OE2   1 
ATOM   1337 N  N     . GLU A 1 161 ? -9.474  38.348  -0.225  1.00 20.79 ? 161  GLU A N     1 
ATOM   1338 C  CA    . GLU A 1 161 ? -10.224 38.127  -1.458  1.00 20.17 ? 161  GLU A CA    1 
ATOM   1339 C  C     . GLU A 1 161 ? -9.496  38.662  -2.687  1.00 19.55 ? 161  GLU A C     1 
ATOM   1340 O  O     . GLU A 1 161 ? -8.804  39.678  -2.619  1.00 15.99 ? 161  GLU A O     1 
ATOM   1341 C  CB    . GLU A 1 161 ? -11.599 38.789  -1.371  1.00 21.84 ? 161  GLU A CB    1 
ATOM   1342 C  CG    . GLU A 1 161 ? -12.572 38.108  -0.427  1.00 22.91 ? 161  GLU A CG    1 
ATOM   1343 C  CD    . GLU A 1 161 ? -13.974 38.670  -0.529  1.00 25.76 ? 161  GLU A CD    1 
ATOM   1344 O  OE1   . GLU A 1 161 ? -14.265 39.394  -1.504  1.00 24.62 ? 161  GLU A OE1   1 
ATOM   1345 O  OE2   . GLU A 1 161 ? -14.791 38.385  0.369   1.00 28.96 ? 161  GLU A OE2   1 
ATOM   1346 N  N     . TRP A 1 162 ? -9.668  37.959  -3.805  1.00 17.87 ? 162  TRP A N     1 
ATOM   1347 C  CA    . TRP A 1 162 ? -9.197  38.398  -5.111  1.00 18.10 ? 162  TRP A CA    1 
ATOM   1348 C  C     . TRP A 1 162 ? -9.966  39.639  -5.549  1.00 18.27 ? 162  TRP A C     1 
ATOM   1349 O  O     . TRP A 1 162 ? -11.177 39.740  -5.328  1.00 16.96 ? 162  TRP A O     1 
ATOM   1350 C  CB    . TRP A 1 162 ? -9.395  37.262  -6.115  1.00 16.63 ? 162  TRP A CB    1 
ATOM   1351 C  CG    . TRP A 1 162 ? -9.216  37.602  -7.576  1.00 16.98 ? 162  TRP A CG    1 
ATOM   1352 C  CD1   . TRP A 1 162 ? -8.036  37.678  -8.267  1.00 13.91 ? 162  TRP A CD1   1 
ATOM   1353 C  CD2   . TRP A 1 162 ? -10.259 37.838  -8.540  1.00 14.71 ? 162  TRP A CD2   1 
ATOM   1354 N  NE1   . TRP A 1 162 ? -8.280  37.966  -9.592  1.00 14.37 ? 162  TRP A NE1   1 
ATOM   1355 C  CE2   . TRP A 1 162 ? -9.634  38.067  -9.785  1.00 15.47 ? 162  TRP A CE2   1 
ATOM   1356 C  CE3   . TRP A 1 162 ? -11.661 37.888  -8.466  1.00 15.55 ? 162  TRP A CE3   1 
ATOM   1357 C  CZ2   . TRP A 1 162 ? -10.363 38.339  -10.954 1.00 15.63 ? 162  TRP A CZ2   1 
ATOM   1358 C  CZ3   . TRP A 1 162 ? -12.384 38.160  -9.629  1.00 18.90 ? 162  TRP A CZ3   1 
ATOM   1359 C  CH2   . TRP A 1 162 ? -11.729 38.382  -10.857 1.00 13.96 ? 162  TRP A CH2   1 
ATOM   1360 N  N     . SER A 1 163 ? -9.249  40.582  -6.157  1.00 17.68 ? 163  SER A N     1 
ATOM   1361 C  CA    . SER A 1 163 ? -9.840  41.823  -6.628  1.00 17.14 ? 163  SER A CA    1 
ATOM   1362 C  C     . SER A 1 163 ? -9.948  41.840  -8.147  1.00 17.76 ? 163  SER A C     1 
ATOM   1363 O  O     . SER A 1 163 ? -8.935  41.798  -8.853  1.00 17.09 ? 163  SER A O     1 
ATOM   1364 C  CB    . SER A 1 163 ? -9.021  43.025  -6.158  1.00 17.88 ? 163  SER A CB    1 
ATOM   1365 O  OG    . SER A 1 163 ? -9.430  44.198  -6.846  1.00 19.79 ? 163  SER A OG    1 
ATOM   1366 N  N     . ILE A 1 164 ? -11.185 41.914  -8.635  1.00 17.59 ? 164  ILE A N     1 
ATOM   1367 C  CA    . ILE A 1 164 ? -11.461 42.000  -10.072 1.00 18.16 ? 164  ILE A CA    1 
ATOM   1368 C  C     . ILE A 1 164 ? -10.922 43.313  -10.649 1.00 17.56 ? 164  ILE A C     1 
ATOM   1369 O  O     . ILE A 1 164 ? -10.503 43.367  -11.806 1.00 18.32 ? 164  ILE A O     1 
ATOM   1370 C  CB    . ILE A 1 164 ? -12.991 41.802  -10.383 1.00 17.78 ? 164  ILE A CB    1 
ATOM   1371 C  CG1   . ILE A 1 164 ? -13.225 41.524  -11.875 1.00 18.45 ? 164  ILE A CG1   1 
ATOM   1372 C  CG2   . ILE A 1 164 ? -13.838 42.987  -9.879  1.00 18.11 ? 164  ILE A CG2   1 
ATOM   1373 C  CD1   . ILE A 1 164 ? -14.538 40.811  -12.180 1.00 15.92 ? 164  ILE A CD1   1 
ATOM   1374 N  N     . GLU A 1 165 ? -10.914 44.361  -9.826  1.00 18.93 ? 165  GLU A N     1 
ATOM   1375 C  CA    . GLU A 1 165 ? -10.438 45.673  -10.253 1.00 19.09 ? 165  GLU A CA    1 
ATOM   1376 C  C     . GLU A 1 165 ? -8.938  45.643  -10.556 1.00 17.46 ? 165  GLU A C     1 
ATOM   1377 O  O     . GLU A 1 165 ? -8.507  46.118  -11.599 1.00 17.35 ? 165  GLU A O     1 
ATOM   1378 C  CB    . GLU A 1 165 ? -10.770 46.744  -9.201  1.00 21.09 ? 165  GLU A CB    1 
ATOM   1379 C  CG    . GLU A 1 165 ? -12.264 47.069  -9.081  1.00 24.64 ? 165  GLU A CG    1 
ATOM   1380 C  CD    . GLU A 1 165 ? -13.037 46.125  -8.155  1.00 29.64 ? 165  GLU A CD    1 
ATOM   1381 O  OE1   . GLU A 1 165 ? -12.423 45.246  -7.505  1.00 27.31 ? 165  GLU A OE1   1 
ATOM   1382 O  OE2   . GLU A 1 165 ? -14.277 46.268  -8.078  1.00 31.96 ? 165  GLU A OE2   1 
ATOM   1383 N  N     . ILE A 1 166 ? -8.153  45.068  -9.649  1.00 16.16 ? 166  ILE A N     1 
ATOM   1384 C  CA    . ILE A 1 166 ? -6.709  44.908  -9.861  1.00 15.14 ? 166  ILE A CA    1 
ATOM   1385 C  C     . ILE A 1 166 ? -6.416  43.908  -10.995 1.00 15.86 ? 166  ILE A C     1 
ATOM   1386 O  O     . ILE A 1 166 ? -5.489  44.110  -11.788 1.00 16.20 ? 166  ILE A O     1 
ATOM   1387 C  CB    . ILE A 1 166 ? -5.983  44.525  -8.542  1.00 14.58 ? 166  ILE A CB    1 
ATOM   1388 C  CG1   . ILE A 1 166 ? -6.052  45.697  -7.551  1.00 13.88 ? 166  ILE A CG1   1 
ATOM   1389 C  CG2   . ILE A 1 166 ? -4.511  44.155  -8.797  1.00 10.77 ? 166  ILE A CG2   1 
ATOM   1390 C  CD1   . ILE A 1 166 ? -5.706  45.323  -6.111  1.00 18.56 ? 166  ILE A CD1   1 
ATOM   1391 N  N     . ALA A 1 167 ? -7.228  42.856  -11.084 1.00 15.35 ? 167  ALA A N     1 
ATOM   1392 C  CA    . ALA A 1 167 ? -7.090  41.842  -12.135 1.00 15.12 ? 167  ALA A CA    1 
ATOM   1393 C  C     . ALA A 1 167 ? -7.159  42.420  -13.555 1.00 16.21 ? 167  ALA A C     1 
ATOM   1394 O  O     . ALA A 1 167 ? -6.429  41.963  -14.448 1.00 15.82 ? 167  ALA A O     1 
ATOM   1395 C  CB    . ALA A 1 167 ? -8.137  40.758  -11.957 1.00 14.76 ? 167  ALA A CB    1 
ATOM   1396 N  N     . ALA A 1 168 ? -8.024  43.424  -13.744 1.00 15.37 ? 168  ALA A N     1 
ATOM   1397 C  CA    . ALA A 1 168 ? -8.274  44.045  -15.054 1.00 17.13 ? 168  ALA A CA    1 
ATOM   1398 C  C     . ALA A 1 168 ? -7.174  45.000  -15.483 1.00 17.54 ? 168  ALA A C     1 
ATOM   1399 O  O     . ALA A 1 168 ? -6.980  45.221  -16.679 1.00 16.79 ? 168  ALA A O     1 
ATOM   1400 C  CB    . ALA A 1 168 ? -9.615  44.778  -15.059 1.00 16.90 ? 168  ALA A CB    1 
ATOM   1401 N  N     . LYS A 1 169 ? -6.479  45.581  -14.504 1.00 17.61 ? 169  LYS A N     1 
ATOM   1402 C  CA    . LYS A 1 169 ? -5.418  46.544  -14.767 1.00 17.08 ? 169  LYS A CA    1 
ATOM   1403 C  C     . LYS A 1 169 ? -4.257  45.910  -15.522 1.00 17.66 ? 169  LYS A C     1 
ATOM   1404 O  O     . LYS A 1 169 ? -4.015  44.698  -15.408 1.00 17.67 ? 169  LYS A O     1 
ATOM   1405 C  CB    . LYS A 1 169 ? -4.923  47.166  -13.458 1.00 17.85 ? 169  LYS A CB    1 
ATOM   1406 C  CG    . LYS A 1 169 ? -5.958  48.057  -12.780 1.00 20.28 ? 169  LYS A CG    1 
ATOM   1407 C  CD    . LYS A 1 169 ? -5.564  48.416  -11.356 1.00 26.20 ? 169  LYS A CD    1 
ATOM   1408 C  CE    . LYS A 1 169 ? -4.627  49.605  -11.323 1.00 28.13 ? 169  LYS A CE    1 
ATOM   1409 N  NZ    . LYS A 1 169 ? -4.304  49.994  -9.922  1.00 34.02 ? 169  LYS A NZ    1 
ATOM   1410 N  N     . LEU A 1 170 ? -3.556  46.734  -16.299 1.00 15.59 ? 170  LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 170 ? -2.336  46.320  -16.982 1.00 16.06 ? 170  LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 170 ? -1.325  45.758  -15.987 1.00 16.15 ? 170  LEU A C     1 
ATOM   1413 O  O     . LEU A 1 170 ? -1.267  46.215  -14.847 1.00 16.68 ? 170  LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 170 ? -1.710  47.515  -17.716 1.00 16.36 ? 170  LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 170 ? -2.451  48.081  -18.933 1.00 18.11 ? 170  LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 170 ? -1.765  49.343  -19.429 1.00 18.54 ? 170  LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 170 ? -2.537  47.047  -20.049 1.00 22.34 ? 170  LEU A CD2   1 
ATOM   1418 N  N     . GLN A 1 171 ? -0.531  44.778  -16.422 1.00 16.90 ? 171  GLN A N     1 
ATOM   1419 C  CA    . GLN A 1 171 ? 0.559   44.244  -15.591 1.00 19.22 ? 171  GLN A CA    1 
ATOM   1420 C  C     . GLN A 1 171 ? 1.597   45.328  -15.280 1.00 18.79 ? 171  GLN A C     1 
ATOM   1421 O  O     . GLN A 1 171 ? 2.109   45.412  -14.157 1.00 16.39 ? 171  GLN A O     1 
ATOM   1422 C  CB    . GLN A 1 171 ? 1.222   43.027  -16.246 1.00 21.14 ? 171  GLN A CB    1 
ATOM   1423 C  CG    . GLN A 1 171 ? 0.281   41.838  -16.423 1.00 25.40 ? 171  GLN A CG    1 
ATOM   1424 C  CD    . GLN A 1 171 ? 0.982   40.488  -16.354 1.00 30.21 ? 171  GLN A CD    1 
ATOM   1425 O  OE1   . GLN A 1 171 ? 2.208   40.408  -16.235 1.00 30.83 ? 171  GLN A OE1   1 
ATOM   1426 N  NE2   . GLN A 1 171 ? 0.196   39.414  -16.418 1.00 29.55 ? 171  GLN A NE2   1 
ATOM   1427 N  N     . GLU A 1 172 ? 1.868   46.175  -16.273 1.00 16.43 ? 172  GLU A N     1 
ATOM   1428 C  CA    . GLU A 1 172 ? 2.777   47.313  -16.109 1.00 17.32 ? 172  GLU A CA    1 
ATOM   1429 C  C     . GLU A 1 172 ? 2.271   48.311  -15.071 1.00 16.25 ? 172  GLU A C     1 
ATOM   1430 O  O     . GLU A 1 172 ? 3.031   49.168  -14.620 1.00 18.00 ? 172  GLU A O     1 
ATOM   1431 C  CB    . GLU A 1 172 ? 3.023   48.024  -17.448 1.00 16.50 ? 172  GLU A CB    1 
ATOM   1432 C  CG    . GLU A 1 172 ? 3.672   47.152  -18.521 1.00 20.67 ? 172  GLU A CG    1 
ATOM   1433 C  CD    . GLU A 1 172 ? 2.665   46.403  -19.377 1.00 23.14 ? 172  GLU A CD    1 
ATOM   1434 O  OE1   . GLU A 1 172 ? 3.033   45.989  -20.497 1.00 29.50 ? 172  GLU A OE1   1 
ATOM   1435 O  OE2   . GLU A 1 172 ? 1.504   46.232  -18.949 1.00 24.53 ? 172  GLU A OE2   1 
ATOM   1436 N  N     . GLN A 1 173 ? 0.994   48.199  -14.699 1.00 16.97 ? 173  GLN A N     1 
ATOM   1437 C  CA    . GLN A 1 173 ? 0.437   48.991  -13.594 1.00 17.44 ? 173  GLN A CA    1 
ATOM   1438 C  C     . GLN A 1 173 ? 0.112   48.152  -12.341 1.00 17.60 ? 173  GLN A C     1 
ATOM   1439 O  O     . GLN A 1 173 ? -0.653  48.577  -11.470 1.00 18.33 ? 173  GLN A O     1 
ATOM   1440 C  CB    . GLN A 1 173 ? -0.783  49.806  -14.054 1.00 18.72 ? 173  GLN A CB    1 
ATOM   1441 C  CG    . GLN A 1 173 ? -1.055  51.055  -13.189 1.00 18.82 ? 173  GLN A CG    1 
ATOM   1442 C  CD    . GLN A 1 173 ? -2.400  51.729  -13.472 1.00 20.19 ? 173  GLN A CD    1 
ATOM   1443 O  OE1   . GLN A 1 173 ? -3.325  51.114  -14.018 1.00 19.16 ? 173  GLN A OE1   1 
ATOM   1444 N  NE2   . GLN A 1 173 ? -2.509  52.999  -13.092 1.00 12.39 ? 173  GLN A NE2   1 
ATOM   1445 N  N     . GLY A 1 174 ? 0.714   46.969  -12.238 1.00 16.35 ? 174  GLY A N     1 
ATOM   1446 C  CA    . GLY A 1 174 ? 0.566   46.138  -11.041 1.00 14.33 ? 174  GLY A CA    1 
ATOM   1447 C  C     . GLY A 1 174 ? -0.631  45.205  -11.088 1.00 14.45 ? 174  GLY A C     1 
ATOM   1448 O  O     . GLY A 1 174 ? -0.897  44.478  -10.129 1.00 13.71 ? 174  GLY A O     1 
ATOM   1449 N  N     . GLY A 1 175 ? -1.356  45.231  -12.205 1.00 13.21 ? 175  GLY A N     1 
ATOM   1450 C  CA    . GLY A 1 175 ? -2.522  44.376  -12.387 1.00 14.44 ? 175  GLY A CA    1 
ATOM   1451 C  C     . GLY A 1 175 ? -2.168  43.029  -12.985 1.00 15.16 ? 175  GLY A C     1 
ATOM   1452 O  O     . GLY A 1 175 ? -0.994  42.680  -13.100 1.00 13.99 ? 175  GLY A O     1 
ATOM   1453 N  N     . ASP A 1 176 ? -3.188  42.270  -13.374 1.00 14.94 ? 176  ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 176 ? -2.974  40.931  -13.917 1.00 15.42 ? 176  ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 176 ? -3.337  40.807  -15.388 1.00 16.23 ? 176  ASP A C     1 
ATOM   1456 O  O     . ASP A 1 176 ? -3.114  39.756  -15.993 1.00 17.24 ? 176  ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 176 ? -3.741  39.899  -13.085 1.00 15.51 ? 176  ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 176 ? -3.366  39.945  -11.610 1.00 15.09 ? 176  ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 176 ? -2.158  40.020  -11.307 1.00 16.18 ? 176  ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 176 ? -4.280  39.902  -10.757 1.00 17.38 ? 176  ASP A OD2   1 
ATOM   1461 N  N     . GLU A 1 177 ? -3.882  41.883  -15.955 1.00 17.58 ? 177  GLU A N     1 
ATOM   1462 C  CA    . GLU A 1 177 ? -4.313  41.918  -17.353 1.00 20.04 ? 177  GLU A CA    1 
ATOM   1463 C  C     . GLU A 1 177 ? -5.274  40.793  -17.725 1.00 19.05 ? 177  GLU A C     1 
ATOM   1464 O  O     . GLU A 1 177 ? -5.150  40.205  -18.799 1.00 17.88 ? 177  GLU A O     1 
ATOM   1465 C  CB    . GLU A 1 177 ? -3.108  41.925  -18.309 1.00 22.59 ? 177  GLU A CB    1 
ATOM   1466 C  CG    . GLU A 1 177 ? -2.807  43.270  -18.930 1.00 26.97 ? 177  GLU A CG    1 
ATOM   1467 C  CD    . GLU A 1 177 ? -1.451  43.303  -19.625 1.00 31.67 ? 177  GLU A CD    1 
ATOM   1468 O  OE1   . GLU A 1 177 ? -1.319  42.698  -20.714 1.00 37.60 ? 177  GLU A OE1   1 
ATOM   1469 O  OE2   . GLU A 1 177 ? -0.519  43.940  -19.087 1.00 26.50 ? 177  GLU A OE2   1 
ATOM   1470 N  N     . VAL A 1 178 ? -6.210  40.473  -16.831 1.00 18.10 ? 178  VAL A N     1 
ATOM   1471 C  CA    . VAL A 1 178 ? -7.310  39.582  -17.196 1.00 16.63 ? 178  VAL A CA    1 
ATOM   1472 C  C     . VAL A 1 178 ? -8.051  40.262  -18.346 1.00 16.82 ? 178  VAL A C     1 
ATOM   1473 O  O     . VAL A 1 178 ? -8.486  41.405  -18.198 1.00 16.04 ? 178  VAL A O     1 
ATOM   1474 C  CB    . VAL A 1 178 ? -8.270  39.302  -16.014 1.00 16.07 ? 178  VAL A CB    1 
ATOM   1475 C  CG1   . VAL A 1 178 ? -9.495  38.503  -16.490 1.00 15.13 ? 178  VAL A CG1   1 
ATOM   1476 C  CG2   . VAL A 1 178 ? -7.554  38.538  -14.921 1.00 10.78 ? 178  VAL A CG2   1 
ATOM   1477 N  N     . PRO A 1 179 ? -8.168  39.574  -19.505 1.00 17.90 ? 179  PRO A N     1 
ATOM   1478 C  CA    . PRO A 1 179 ? -8.730  40.215  -20.693 1.00 16.62 ? 179  PRO A CA    1 
ATOM   1479 C  C     . PRO A 1 179 ? -10.060 40.900  -20.428 1.00 17.36 ? 179  PRO A C     1 
ATOM   1480 O  O     . PRO A 1 179 ? -10.912 40.363  -19.714 1.00 16.97 ? 179  PRO A O     1 
ATOM   1481 C  CB    . PRO A 1 179 ? -8.880  39.055  -21.674 1.00 16.52 ? 179  PRO A CB    1 
ATOM   1482 C  CG    . PRO A 1 179 ? -7.750  38.158  -21.328 1.00 17.91 ? 179  PRO A CG    1 
ATOM   1483 C  CD    . PRO A 1 179 ? -7.692  38.208  -19.808 1.00 17.41 ? 179  PRO A CD    1 
ATOM   1484 N  N     . SER A 1 180 ? -10.211 42.096  -20.989 1.00 17.72 ? 180  SER A N     1 
ATOM   1485 C  CA    . SER A 1 180 ? -11.403 42.915  -20.790 1.00 18.42 ? 180  SER A CA    1 
ATOM   1486 C  C     . SER A 1 180 ? -12.678 42.192  -21.210 1.00 18.65 ? 180  SER A C     1 
ATOM   1487 O  O     . SER A 1 180 ? -13.714 42.340  -20.559 1.00 18.66 ? 180  SER A O     1 
ATOM   1488 C  CB    . SER A 1 180 ? -11.277 44.245  -21.539 1.00 17.78 ? 180  SER A CB    1 
ATOM   1489 O  OG    . SER A 1 180 ? -11.092 44.025  -22.926 1.00 20.94 ? 180  SER A OG    1 
ATOM   1490 N  N     . GLU A 1 181 ? -12.593 41.392  -22.275 1.00 17.84 ? 181  GLU A N     1 
ATOM   1491 C  CA    . GLU A 1 181 ? -13.778 40.722  -22.818 1.00 19.37 ? 181  GLU A CA    1 
ATOM   1492 C  C     . GLU A 1 181 ? -14.328 39.596  -21.928 1.00 18.32 ? 181  GLU A C     1 
ATOM   1493 O  O     . GLU A 1 181 ? -15.394 39.054  -22.217 1.00 20.03 ? 181  GLU A O     1 
ATOM   1494 C  CB    . GLU A 1 181 ? -13.547 40.240  -24.261 1.00 20.36 ? 181  GLU A CB    1 
ATOM   1495 C  CG    . GLU A 1 181 ? -12.644 39.015  -24.410 1.00 20.30 ? 181  GLU A CG    1 
ATOM   1496 C  CD    . GLU A 1 181 ? -11.148 39.342  -24.499 1.00 23.29 ? 181  GLU A CD    1 
ATOM   1497 O  OE1   . GLU A 1 181 ? -10.733 40.490  -24.206 1.00 22.78 ? 181  GLU A OE1   1 
ATOM   1498 O  OE2   . GLU A 1 181 ? -10.378 38.430  -24.870 1.00 21.09 ? 181  GLU A OE2   1 
ATOM   1499 N  N     . ILE A 1 182 ? -13.612 39.242  -20.857 1.00 15.67 ? 182  ILE A N     1 
ATOM   1500 C  CA    . ILE A 1 182 ? -14.134 38.245  -19.898 1.00 15.89 ? 182  ILE A CA    1 
ATOM   1501 C  C     . ILE A 1 182 ? -14.400 38.786  -18.487 1.00 14.41 ? 182  ILE A C     1 
ATOM   1502 O  O     . ILE A 1 182 ? -14.985 38.090  -17.658 1.00 15.06 ? 182  ILE A O     1 
ATOM   1503 C  CB    . ILE A 1 182 ? -13.263 36.941  -19.810 1.00 16.74 ? 182  ILE A CB    1 
ATOM   1504 C  CG1   . ILE A 1 182 ? -11.949 37.196  -19.057 1.00 16.04 ? 182  ILE A CG1   1 
ATOM   1505 C  CG2   . ILE A 1 182 ? -13.030 36.337  -21.205 1.00 17.79 ? 182  ILE A CG2   1 
ATOM   1506 C  CD1   . ILE A 1 182 ? -11.244 35.917  -18.591 1.00 15.44 ? 182  ILE A CD1   1 
ATOM   1507 N  N     . ILE A 1 183 ? -13.984 40.024  -18.220 1.00 15.75 ? 183  ILE A N     1 
ATOM   1508 C  CA    . ILE A 1 183 ? -14.162 40.625  -16.887 1.00 16.72 ? 183  ILE A CA    1 
ATOM   1509 C  C     . ILE A 1 183 ? -15.619 40.549  -16.422 1.00 17.94 ? 183  ILE A C     1 
ATOM   1510 O  O     . ILE A 1 183 ? -15.891 40.163  -15.281 1.00 19.00 ? 183  ILE A O     1 
ATOM   1511 C  CB    . ILE A 1 183 ? -13.629 42.092  -16.816 1.00 17.38 ? 183  ILE A CB    1 
ATOM   1512 C  CG1   . ILE A 1 183 ? -12.094 42.113  -16.778 1.00 19.87 ? 183  ILE A CG1   1 
ATOM   1513 C  CG2   . ILE A 1 183 ? -14.190 42.836  -15.600 1.00 17.94 ? 183  ILE A CG2   1 
ATOM   1514 C  CD1   . ILE A 1 183 ? -11.460 41.550  -15.482 1.00 17.62 ? 183  ILE A CD1   1 
ATOM   1515 N  N     . ASP A 1 184 ? -16.547 40.881  -17.317 1.00 16.48 ? 184  ASP A N     1 
ATOM   1516 C  CA    . ASP A 1 184 ? -17.972 40.913  -16.978 1.00 17.77 ? 184  ASP A CA    1 
ATOM   1517 C  C     . ASP A 1 184 ? -18.628 39.525  -16.913 1.00 16.77 ? 184  ASP A C     1 
ATOM   1518 O  O     . ASP A 1 184 ? -19.771 39.407  -16.485 1.00 15.20 ? 184  ASP A O     1 
ATOM   1519 C  CB    . ASP A 1 184 ? -18.735 41.816  -17.957 1.00 19.38 ? 184  ASP A CB    1 
ATOM   1520 C  CG    . ASP A 1 184 ? -18.416 43.298  -17.763 1.00 25.39 ? 184  ASP A CG    1 
ATOM   1521 O  OD1   . ASP A 1 184 ? -17.727 43.647  -16.777 1.00 25.72 ? 184  ASP A OD1   1 
ATOM   1522 O  OD2   . ASP A 1 184 ? -18.865 44.116  -18.596 1.00 26.87 ? 184  ASP A OD2   1 
ATOM   1523 N  N     . LYS A 1 185 ? -17.896 38.493  -17.335 1.00 14.94 ? 185  LYS A N     1 
ATOM   1524 C  CA    . LYS A 1 185 ? -18.395 37.115  -17.359 1.00 15.64 ? 185  LYS A CA    1 
ATOM   1525 C  C     . LYS A 1 185 ? -17.903 36.275  -16.164 1.00 15.86 ? 185  LYS A C     1 
ATOM   1526 O  O     . LYS A 1 185 ? -18.208 35.082  -16.059 1.00 15.26 ? 185  LYS A O     1 
ATOM   1527 C  CB    . LYS A 1 185 ? -18.035 36.439  -18.693 1.00 15.66 ? 185  LYS A CB    1 
ATOM   1528 C  CG    . LYS A 1 185 ? -18.515 37.220  -19.931 1.00 18.83 ? 185  LYS A CG    1 
ATOM   1529 C  CD    . LYS A 1 185 ? -18.259 36.453  -21.220 1.00 19.10 ? 185  LYS A CD    1 
ATOM   1530 C  CE    . LYS A 1 185 ? -18.634 37.279  -22.435 1.00 21.20 ? 185  LYS A CE    1 
ATOM   1531 N  NZ    . LYS A 1 185 ? -18.497 36.470  -23.682 1.00 19.97 ? 185  LYS A NZ    1 
ATOM   1532 N  N     . ILE A 1 186 ? -17.158 36.907  -15.261 1.00 15.85 ? 186  ILE A N     1 
ATOM   1533 C  CA    . ILE A 1 186 ? -16.622 36.233  -14.077 1.00 14.50 ? 186  ILE A CA    1 
ATOM   1534 C  C     . ILE A 1 186 ? -17.608 36.307  -12.915 1.00 16.36 ? 186  ILE A C     1 
ATOM   1535 O  O     . ILE A 1 186 ? -18.116 37.382  -12.584 1.00 15.38 ? 186  ILE A O     1 
ATOM   1536 C  CB    . ILE A 1 186 ? -15.257 36.832  -13.658 1.00 13.24 ? 186  ILE A CB    1 
ATOM   1537 C  CG1   . ILE A 1 186 ? -14.196 36.549  -14.732 1.00 14.29 ? 186  ILE A CG1   1 
ATOM   1538 C  CG2   . ILE A 1 186 ? -14.804 36.299  -12.289 1.00 13.39 ? 186  ILE A CG2   1 
ATOM   1539 C  CD1   . ILE A 1 186 ? -12.963 37.440  -14.639 1.00 12.05 ? 186  ILE A CD1   1 
ATOM   1540 N  N     . ILE A 1 187 ? -17.879 35.151  -12.316 1.00 17.04 ? 187  ILE A N     1 
ATOM   1541 C  CA    . ILE A 1 187 ? -18.693 35.066  -11.108 1.00 16.73 ? 187  ILE A CA    1 
ATOM   1542 C  C     . ILE A 1 187 ? -17.799 34.536  -9.983  1.00 17.23 ? 187  ILE A C     1 
ATOM   1543 O  O     . ILE A 1 187 ? -17.432 33.360  -9.973  1.00 17.67 ? 187  ILE A O     1 
ATOM   1544 C  CB    . ILE A 1 187 ? -19.957 34.183  -11.325 1.00 17.07 ? 187  ILE A CB    1 
ATOM   1545 C  CG1   . ILE A 1 187 ? -20.863 34.810  -12.394 1.00 16.87 ? 187  ILE A CG1   1 
ATOM   1546 C  CG2   . ILE A 1 187 ? -20.727 33.990  -10.006 1.00 18.32 ? 187  ILE A CG2   1 
ATOM   1547 C  CD1   . ILE A 1 187 ? -21.958 33.893  -12.931 1.00 20.12 ? 187  ILE A CD1   1 
ATOM   1548 N  N     . TYR A 1 188 ? -17.438 35.428  -9.058  1.00 16.82 ? 188  TYR A N     1 
ATOM   1549 C  CA    . TYR A 1 188 ? -16.422 35.156  -8.043  1.00 15.69 ? 188  TYR A CA    1 
ATOM   1550 C  C     . TYR A 1 188 ? -17.024 34.698  -6.721  1.00 16.81 ? 188  TYR A C     1 
ATOM   1551 O  O     . TYR A 1 188 ? -17.897 35.363  -6.170  1.00 15.46 ? 188  TYR A O     1 
ATOM   1552 C  CB    . TYR A 1 188 ? -15.546 36.398  -7.818  1.00 16.73 ? 188  TYR A CB    1 
ATOM   1553 C  CG    . TYR A 1 188 ? -14.519 36.239  -6.708  1.00 15.15 ? 188  TYR A CG    1 
ATOM   1554 C  CD1   . TYR A 1 188 ? -13.440 35.371  -6.852  1.00 16.83 ? 188  TYR A CD1   1 
ATOM   1555 C  CD2   . TYR A 1 188 ? -14.629 36.960  -5.518  1.00 17.18 ? 188  TYR A CD2   1 
ATOM   1556 C  CE1   . TYR A 1 188 ? -12.495 35.224  -5.846  1.00 15.30 ? 188  TYR A CE1   1 
ATOM   1557 C  CE2   . TYR A 1 188 ? -13.686 36.814  -4.496  1.00 17.58 ? 188  TYR A CE2   1 
ATOM   1558 C  CZ    . TYR A 1 188 ? -12.623 35.944  -4.673  1.00 16.43 ? 188  TYR A CZ    1 
ATOM   1559 O  OH    . TYR A 1 188 ? -11.687 35.787  -3.680  1.00 16.39 ? 188  TYR A OH    1 
ATOM   1560 N  N     . MET A 1 189 ? -16.538 33.568  -6.215  1.00 16.90 ? 189  MET A N     1 
ATOM   1561 C  CA    . MET A 1 189 ? -17.087 32.949  -5.002  1.00 17.56 ? 189  MET A CA    1 
ATOM   1562 C  C     . MET A 1 189 ? -15.982 32.580  -4.011  1.00 17.87 ? 189  MET A C     1 
ATOM   1563 O  O     . MET A 1 189 ? -15.324 31.542  -4.169  1.00 17.64 ? 189  MET A O     1 
ATOM   1564 C  CB    . MET A 1 189 ? -17.904 31.707  -5.370  1.00 17.52 ? 189  MET A CB    1 
ATOM   1565 C  CG    . MET A 1 189 ? -19.217 32.009  -6.094  1.00 20.52 ? 189  MET A CG    1 
ATOM   1566 S  SD    . MET A 1 189 ? -19.903 30.582  -6.957  1.00 25.74 ? 189  MET A SD    1 
ATOM   1567 C  CE    . MET A 1 189 ? -18.680 30.352  -8.249  1.00 17.04 ? 189  MET A CE    1 
ATOM   1568 N  N     . PRO A 1 190 ? -15.758 33.435  -2.996  1.00 18.25 ? 190  PRO A N     1 
ATOM   1569 C  CA    . PRO A 1 190 ? -14.743 33.128  -1.983  1.00 17.99 ? 190  PRO A CA    1 
ATOM   1570 C  C     . PRO A 1 190 ? -15.282 32.191  -0.902  1.00 17.99 ? 190  PRO A C     1 
ATOM   1571 O  O     . PRO A 1 190 ? -16.478 32.210  -0.609  1.00 17.81 ? 190  PRO A O     1 
ATOM   1572 C  CB    . PRO A 1 190 ? -14.415 34.498  -1.392  1.00 18.60 ? 190  PRO A CB    1 
ATOM   1573 C  CG    . PRO A 1 190 ? -15.682 35.283  -1.546  1.00 18.54 ? 190  PRO A CG    1 
ATOM   1574 C  CD    . PRO A 1 190 ? -16.367 34.766  -2.789  1.00 18.51 ? 190  PRO A CD    1 
ATOM   1575 N  N     . PHE A 1 191 ? -14.401 31.373  -0.332  1.00 16.95 ? 191  PHE A N     1 
ATOM   1576 C  CA    . PHE A 1 191 ? -14.776 30.421  0.715   1.00 16.74 ? 191  PHE A CA    1 
ATOM   1577 C  C     . PHE A 1 191 ? -13.773 30.463  1.843   1.00 16.90 ? 191  PHE A C     1 
ATOM   1578 O  O     . PHE A 1 191 ? -12.566 30.573  1.605   1.00 15.95 ? 191  PHE A O     1 
ATOM   1579 C  CB    . PHE A 1 191 ? -14.870 28.989  0.152   1.00 18.96 ? 191  PHE A CB    1 
ATOM   1580 C  CG    . PHE A 1 191 ? -15.968 28.808  -0.858  1.00 16.47 ? 191  PHE A CG    1 
ATOM   1581 C  CD1   . PHE A 1 191 ? -15.738 29.056  -2.212  1.00 17.10 ? 191  PHE A CD1   1 
ATOM   1582 C  CD2   . PHE A 1 191 ? -17.242 28.407  -0.453  1.00 17.02 ? 191  PHE A CD2   1 
ATOM   1583 C  CE1   . PHE A 1 191 ? -16.762 28.898  -3.150  1.00 17.39 ? 191  PHE A CE1   1 
ATOM   1584 C  CE2   . PHE A 1 191 ? -18.268 28.242  -1.383  1.00 15.33 ? 191  PHE A CE2   1 
ATOM   1585 C  CZ    . PHE A 1 191 ? -18.028 28.493  -2.731  1.00 14.85 ? 191  PHE A CZ    1 
ATOM   1586 N  N     . ASP A 1 192 ? -14.290 30.372  3.067   1.00 17.57 ? 192  ASP A N     1 
ATOM   1587 C  CA    . ASP A 1 192 ? -13.471 30.370  4.271   1.00 20.06 ? 192  ASP A CA    1 
ATOM   1588 C  C     . ASP A 1 192 ? -12.916 28.994  4.619   1.00 19.54 ? 192  ASP A C     1 
ATOM   1589 O  O     . ASP A 1 192 ? -12.026 28.885  5.460   1.00 21.37 ? 192  ASP A O     1 
ATOM   1590 C  CB    . ASP A 1 192 ? -14.267 30.920  5.459   1.00 22.97 ? 192  ASP A CB    1 
ATOM   1591 C  CG    . ASP A 1 192 ? -14.431 32.432  5.411   1.00 26.49 ? 192  ASP A CG    1 
ATOM   1592 O  OD1   . ASP A 1 192 ? -13.683 33.106  4.668   1.00 27.61 ? 192  ASP A OD1   1 
ATOM   1593 O  OD2   . ASP A 1 192 ? -15.315 32.948  6.129   1.00 31.03 ? 192  ASP A OD2   1 
ATOM   1594 N  N     . ASN A 1 193 ? -13.452 27.945  3.997   1.00 17.71 ? 193  ASN A N     1 
ATOM   1595 C  CA    . ASN A 1 193 ? -12.910 26.594  4.176   1.00 17.95 ? 193  ASN A CA    1 
ATOM   1596 C  C     . ASN A 1 193 ? -13.160 25.665  2.986   1.00 16.67 ? 193  ASN A C     1 
ATOM   1597 O  O     . ASN A 1 193 ? -14.119 25.837  2.229   1.00 16.85 ? 193  ASN A O     1 
ATOM   1598 C  CB    . ASN A 1 193 ? -13.372 25.959  5.501   1.00 18.18 ? 193  ASN A CB    1 
ATOM   1599 C  CG    . ASN A 1 193 ? -14.869 25.763  5.568   1.00 19.67 ? 193  ASN A CG    1 
ATOM   1600 O  OD1   . ASN A 1 193 ? -15.414 24.834  4.972   1.00 19.57 ? 193  ASN A OD1   1 
ATOM   1601 N  ND2   . ASN A 1 193 ? -15.544 26.628  6.321   1.00 20.79 ? 193  ASN A ND2   1 
ATOM   1602 N  N     . GLU A 1 194 ? -12.276 24.686  2.834   1.00 16.37 ? 194  GLU A N     1 
ATOM   1603 C  CA    . GLU A 1 194 ? -12.264 23.820  1.661   1.00 15.76 ? 194  GLU A CA    1 
ATOM   1604 C  C     . GLU A 1 194 ? -13.510 22.944  1.564   1.00 15.50 ? 194  GLU A C     1 
ATOM   1605 O  O     . GLU A 1 194 ? -14.014 22.697  0.462   1.00 14.17 ? 194  GLU A O     1 
ATOM   1606 C  CB    . GLU A 1 194 ? -11.001 22.965  1.654   1.00 13.90 ? 194  GLU A CB    1 
ATOM   1607 C  CG    . GLU A 1 194 ? -10.813 22.144  0.389   1.00 15.23 ? 194  GLU A CG    1 
ATOM   1608 C  CD    . GLU A 1 194 ? -9.719  21.101  0.534   1.00 15.49 ? 194  GLU A CD    1 
ATOM   1609 O  OE1   . GLU A 1 194 ? -9.379  20.466  -0.482  1.00 14.28 ? 194  GLU A OE1   1 
ATOM   1610 O  OE2   . GLU A 1 194 ? -9.202  20.916  1.660   1.00 12.49 ? 194  GLU A OE2   1 
ATOM   1611 N  N     . LYS A 1 195 ? -14.005 22.484  2.713   1.00 15.31 ? 195  LYS A N     1 
ATOM   1612 C  CA    . LYS A 1 195 ? -15.202 21.649  2.746   1.00 15.79 ? 195  LYS A CA    1 
ATOM   1613 C  C     . LYS A 1 195 ? -16.398 22.358  2.118   1.00 16.43 ? 195  LYS A C     1 
ATOM   1614 O  O     . LYS A 1 195 ? -17.097 21.770  1.297   1.00 14.89 ? 195  LYS A O     1 
ATOM   1615 C  CB    . LYS A 1 195 ? -15.523 21.176  4.172   1.00 17.26 ? 195  LYS A CB    1 
ATOM   1616 C  CG    . LYS A 1 195 ? -14.623 20.048  4.664   1.00 19.72 ? 195  LYS A CG    1 
ATOM   1617 C  CD    . LYS A 1 195 ? -15.118 19.481  5.996   1.00 26.28 ? 195  LYS A CD    1 
ATOM   1618 C  CE    . LYS A 1 195 ? -14.139 18.458  6.564   1.00 29.64 ? 195  LYS A CE    1 
ATOM   1619 N  NZ    . LYS A 1 195 ? -14.693 17.743  7.755   1.00 32.26 ? 195  LYS A NZ    1 
ATOM   1620 N  N     . GLU A 1 196 ? -16.623 23.620  2.484   1.00 17.30 ? 196  GLU A N     1 
ATOM   1621 C  CA    . GLU A 1 196 ? -17.722 24.382  1.887   1.00 18.34 ? 196  GLU A CA    1 
ATOM   1622 C  C     . GLU A 1 196 ? -17.472 24.701  0.411   1.00 16.42 ? 196  GLU A C     1 
ATOM   1623 O  O     . GLU A 1 196 ? -18.400 24.642  -0.395  1.00 14.10 ? 196  GLU A O     1 
ATOM   1624 C  CB    . GLU A 1 196 ? -18.083 25.636  2.704   1.00 20.48 ? 196  GLU A CB    1 
ATOM   1625 C  CG    . GLU A 1 196 ? -17.033 26.737  2.746   1.00 27.58 ? 196  GLU A CG    1 
ATOM   1626 C  CD    . GLU A 1 196 ? -17.418 27.887  3.667   1.00 32.35 ? 196  GLU A CD    1 
ATOM   1627 O  OE1   . GLU A 1 196 ? -17.041 29.048  3.366   1.00 31.15 ? 196  GLU A OE1   1 
ATOM   1628 O  OE2   . GLU A 1 196 ? -18.096 27.624  4.689   1.00 32.84 ? 196  GLU A OE2   1 
ATOM   1629 N  N     . LEU A 1 197 ? -16.225 25.020  0.054   1.00 16.56 ? 197  LEU A N     1 
ATOM   1630 C  CA    . LEU A 1 197 ? -15.856 25.187  -1.356  1.00 14.43 ? 197  LEU A CA    1 
ATOM   1631 C  C     . LEU A 1 197 ? -16.256 23.949  -2.173  1.00 14.79 ? 197  LEU A C     1 
ATOM   1632 O  O     . LEU A 1 197 ? -16.958 24.058  -3.185  1.00 14.07 ? 197  LEU A O     1 
ATOM   1633 C  CB    . LEU A 1 197 ? -14.355 25.492  -1.519  1.00 14.65 ? 197  LEU A CB    1 
ATOM   1634 C  CG    . LEU A 1 197 ? -13.815 25.772  -2.935  1.00 14.32 ? 197  LEU A CG    1 
ATOM   1635 C  CD1   . LEU A 1 197 ? -12.529 26.594  -2.899  1.00 13.79 ? 197  LEU A CD1   1 
ATOM   1636 C  CD2   . LEU A 1 197 ? -13.568 24.478  -3.725  1.00 14.41 ? 197  LEU A CD2   1 
ATOM   1637 N  N     . LEU A 1 198 ? -15.816 22.776  -1.725  1.00 13.57 ? 198  LEU A N     1 
ATOM   1638 C  CA    . LEU A 1 198 ? -16.053 21.546  -2.468  1.00 15.24 ? 198  LEU A CA    1 
ATOM   1639 C  C     . LEU A 1 198 ? -17.522 21.128  -2.474  1.00 16.89 ? 198  LEU A C     1 
ATOM   1640 O  O     . LEU A 1 198 ? -18.018 20.643  -3.489  1.00 14.56 ? 198  LEU A O     1 
ATOM   1641 C  CB    . LEU A 1 198 ? -15.159 20.416  -1.953  1.00 16.36 ? 198  LEU A CB    1 
ATOM   1642 C  CG    . LEU A 1 198 ? -13.657 20.629  -2.192  1.00 15.99 ? 198  LEU A CG    1 
ATOM   1643 C  CD1   . LEU A 1 198 ? -12.849 19.603  -1.430  1.00 14.29 ? 198  LEU A CD1   1 
ATOM   1644 C  CD2   . LEU A 1 198 ? -13.304 20.603  -3.680  1.00 16.14 ? 198  LEU A CD2   1 
ATOM   1645 N  N     . MET A 1 199 ? -18.214 21.321  -1.348  1.00 17.82 ? 199  MET A N     1 
ATOM   1646 C  CA    . MET A 1 199 ? -19.647 21.027  -1.280  1.00 20.16 ? 199  MET A CA    1 
ATOM   1647 C  C     . MET A 1 199 ? -20.424 21.914  -2.246  1.00 18.73 ? 199  MET A C     1 
ATOM   1648 O  O     . MET A 1 199 ? -21.349 21.453  -2.907  1.00 18.70 ? 199  MET A O     1 
ATOM   1649 C  CB    . MET A 1 199 ? -20.192 21.204  0.140   1.00 21.99 ? 199  MET A CB    1 
ATOM   1650 C  CG    . MET A 1 199 ? -19.957 20.020  1.061   1.00 29.21 ? 199  MET A CG    1 
ATOM   1651 S  SD    . MET A 1 199 ? -20.744 20.227  2.682   1.00 41.60 ? 199  MET A SD    1 
ATOM   1652 C  CE    . MET A 1 199 ? -19.663 21.418  3.482   1.00 38.28 ? 199  MET A CE    1 
ATOM   1653 N  N     . GLU A 1 200 ? -20.046 23.186  -2.315  1.00 17.61 ? 200  GLU A N     1 
ATOM   1654 C  CA    . GLU A 1 200 ? -20.683 24.115  -3.238  1.00 19.13 ? 200  GLU A CA    1 
ATOM   1655 C  C     . GLU A 1 200 ? -20.373 23.748  -4.688  1.00 17.59 ? 200  GLU A C     1 
ATOM   1656 O  O     . GLU A 1 200 ? -21.242 23.846  -5.551  1.00 16.63 ? 200  GLU A O     1 
ATOM   1657 C  CB    . GLU A 1 200 ? -20.247 25.551  -2.946  1.00 21.83 ? 200  GLU A CB    1 
ATOM   1658 C  CG    . GLU A 1 200 ? -21.018 26.614  -3.720  1.00 29.51 ? 200  GLU A CG    1 
ATOM   1659 C  CD    . GLU A 1 200 ? -22.468 26.733  -3.272  1.00 34.51 ? 200  GLU A CD    1 
ATOM   1660 O  OE1   . GLU A 1 200 ? -22.731 26.662  -2.054  1.00 37.05 ? 200  GLU A OE1   1 
ATOM   1661 O  OE2   . GLU A 1 200 ? -23.344 26.896  -4.144  1.00 38.91 ? 200  GLU A OE2   1 
ATOM   1662 N  N     . TYR A 1 201 ? -19.135 23.329  -4.949  1.00 16.74 ? 201  TYR A N     1 
ATOM   1663 C  CA    . TYR A 1 201 ? -18.737 22.945  -6.299  1.00 15.88 ? 201  TYR A CA    1 
ATOM   1664 C  C     . TYR A 1 201 ? -19.555 21.750  -6.787  1.00 16.01 ? 201  TYR A C     1 
ATOM   1665 O  O     . TYR A 1 201 ? -20.041 21.746  -7.916  1.00 16.09 ? 201  TYR A O     1 
ATOM   1666 C  CB    . TYR A 1 201 ? -17.226 22.675  -6.388  1.00 15.19 ? 201  TYR A CB    1 
ATOM   1667 C  CG    . TYR A 1 201 ? -16.753 22.435  -7.805  1.00 15.12 ? 201  TYR A CG    1 
ATOM   1668 C  CD1   . TYR A 1 201 ? -16.750 23.466  -8.742  1.00 15.49 ? 201  TYR A CD1   1 
ATOM   1669 C  CD2   . TYR A 1 201 ? -16.326 21.171  -8.214  1.00 14.68 ? 201  TYR A CD2   1 
ATOM   1670 C  CE1   . TYR A 1 201 ? -16.330 23.246  -10.062 1.00 16.03 ? 201  TYR A CE1   1 
ATOM   1671 C  CE2   . TYR A 1 201 ? -15.894 20.942  -9.522  1.00 15.23 ? 201  TYR A CE2   1 
ATOM   1672 C  CZ    . TYR A 1 201 ? -15.902 21.982  -10.440 1.00 17.88 ? 201  TYR A CZ    1 
ATOM   1673 O  OH    . TYR A 1 201 ? -15.484 21.756  -11.737 1.00 18.46 ? 201  TYR A OH    1 
ATOM   1674 N  N     . LEU A 1 202 ? -19.733 20.757  -5.921  1.00 17.31 ? 202  LEU A N     1 
ATOM   1675 C  CA    . LEU A 1 202 ? -20.578 19.603  -6.233  1.00 16.43 ? 202  LEU A CA    1 
ATOM   1676 C  C     . LEU A 1 202 ? -22.045 19.955  -6.476  1.00 17.70 ? 202  LEU A C     1 
ATOM   1677 O  O     . LEU A 1 202 ? -22.649 19.429  -7.408  1.00 17.58 ? 202  LEU A O     1 
ATOM   1678 C  CB    . LEU A 1 202 ? -20.455 18.524  -5.156  1.00 19.35 ? 202  LEU A CB    1 
ATOM   1679 C  CG    . LEU A 1 202 ? -19.287 17.552  -5.334  1.00 18.87 ? 202  LEU A CG    1 
ATOM   1680 C  CD1   . LEU A 1 202 ? -19.116 16.703  -4.089  1.00 22.06 ? 202  LEU A CD1   1 
ATOM   1681 C  CD2   . LEU A 1 202 ? -19.491 16.665  -6.557  1.00 19.89 ? 202  LEU A CD2   1 
ATOM   1682 N  N     . ASN A 1 203 ? -22.612 20.837  -5.649  1.00 16.88 ? 203  ASN A N     1 
ATOM   1683 C  CA    . ASN A 1 203 ? -23.978 21.323  -5.861  1.00 18.35 ? 203  ASN A CA    1 
ATOM   1684 C  C     . ASN A 1 203 ? -24.100 22.036  -7.211  1.00 17.95 ? 203  ASN A C     1 
ATOM   1685 O  O     . ASN A 1 203 ? -25.002 21.743  -8.008  1.00 16.88 ? 203  ASN A O     1 
ATOM   1686 C  CB    . ASN A 1 203 ? -24.416 22.255  -4.719  1.00 20.24 ? 203  ASN A CB    1 
ATOM   1687 C  CG    . ASN A 1 203 ? -24.680 21.512  -3.408  1.00 26.54 ? 203  ASN A CG    1 
ATOM   1688 O  OD1   . ASN A 1 203 ? -24.613 22.104  -2.326  1.00 31.26 ? 203  ASN A OD1   1 
ATOM   1689 N  ND2   . ASN A 1 203 ? -24.990 20.222  -3.498  1.00 22.14 ? 203  ASN A ND2   1 
ATOM   1690 N  N     . PHE A 1 204 ? -23.173 22.965  -7.451  1.00 15.91 ? 204  PHE A N     1 
ATOM   1691 C  CA    . PHE A 1 204 ? -22.997 23.629  -8.745  1.00 15.52 ? 204  PHE A CA    1 
ATOM   1692 C  C     . PHE A 1 204 ? -22.958 22.612  -9.900  1.00 15.42 ? 204  PHE A C     1 
ATOM   1693 O  O     . PHE A 1 204 ? -23.719 22.725  -10.867 1.00 15.30 ? 204  PHE A O     1 
ATOM   1694 C  CB    . PHE A 1 204 ? -21.717 24.480  -8.679  1.00 14.52 ? 204  PHE A CB    1 
ATOM   1695 C  CG    . PHE A 1 204 ? -21.213 24.969  -10.008 1.00 14.87 ? 204  PHE A CG    1 
ATOM   1696 C  CD1   . PHE A 1 204 ? -21.779 26.086  -10.621 1.00 16.25 ? 204  PHE A CD1   1 
ATOM   1697 C  CD2   . PHE A 1 204 ? -20.130 24.343  -10.622 1.00 14.77 ? 204  PHE A CD2   1 
ATOM   1698 C  CE1   . PHE A 1 204 ? -21.289 26.558  -11.847 1.00 14.76 ? 204  PHE A CE1   1 
ATOM   1699 C  CE2   . PHE A 1 204 ? -19.639 24.797  -11.848 1.00 15.61 ? 204  PHE A CE2   1 
ATOM   1700 C  CZ    . PHE A 1 204 ? -20.219 25.908  -12.460 1.00 16.57 ? 204  PHE A CZ    1 
ATOM   1701 N  N     . TRP A 1 205 ? -22.085 21.614  -9.773  1.00 16.17 ? 205  TRP A N     1 
ATOM   1702 C  CA    . TRP A 1 205 ? -21.945 20.532  -10.757 1.00 15.71 ? 205  TRP A CA    1 
ATOM   1703 C  C     . TRP A 1 205 ? -23.267 19.799  -11.034 1.00 16.12 ? 205  TRP A C     1 
ATOM   1704 O  O     . TRP A 1 205 ? -23.548 19.442  -12.184 1.00 14.39 ? 205  TRP A O     1 
ATOM   1705 C  CB    . TRP A 1 205 ? -20.880 19.548  -10.277 1.00 14.65 ? 205  TRP A CB    1 
ATOM   1706 C  CG    . TRP A 1 205 ? -20.443 18.485  -11.267 1.00 14.69 ? 205  TRP A CG    1 
ATOM   1707 C  CD1   . TRP A 1 205 ? -21.133 17.359  -11.636 1.00 16.27 ? 205  TRP A CD1   1 
ATOM   1708 C  CD2   . TRP A 1 205 ? -19.195 18.432  -11.962 1.00 13.23 ? 205  TRP A CD2   1 
ATOM   1709 N  NE1   . TRP A 1 205 ? -20.390 16.616  -12.527 1.00 12.51 ? 205  TRP A NE1   1 
ATOM   1710 C  CE2   . TRP A 1 205 ? -19.199 17.255  -12.746 1.00 13.74 ? 205  TRP A CE2   1 
ATOM   1711 C  CE3   . TRP A 1 205 ? -18.067 19.267  -11.998 1.00 13.93 ? 205  TRP A CE3   1 
ATOM   1712 C  CZ2   . TRP A 1 205 ? -18.117 16.894  -13.565 1.00 13.11 ? 205  TRP A CZ2   1 
ATOM   1713 C  CZ3   . TRP A 1 205 ? -16.996 18.909  -12.814 1.00 14.23 ? 205  TRP A CZ3   1 
ATOM   1714 C  CH2   . TRP A 1 205 ? -17.029 17.727  -13.579 1.00 13.33 ? 205  TRP A CH2   1 
ATOM   1715 N  N     . GLN A 1 206 ? -24.072 19.573  -9.993  1.00 15.15 ? 206  GLN A N     1 
ATOM   1716 C  CA    . GLN A 1 206 ? -25.380 18.923  -10.169 1.00 17.16 ? 206  GLN A CA    1 
ATOM   1717 C  C     . GLN A 1 206 ? -26.303 19.797  -11.010 1.00 16.21 ? 206  GLN A C     1 
ATOM   1718 O  O     . GLN A 1 206 ? -27.021 19.294  -11.868 1.00 17.64 ? 206  GLN A O     1 
ATOM   1719 C  CB    . GLN A 1 206 ? -26.067 18.627  -8.826  1.00 19.28 ? 206  GLN A CB    1 
ATOM   1720 C  CG    . GLN A 1 206 ? -25.198 17.947  -7.778  1.00 26.40 ? 206  GLN A CG    1 
ATOM   1721 C  CD    . GLN A 1 206 ? -25.106 16.442  -7.950  1.00 31.66 ? 206  GLN A CD    1 
ATOM   1722 O  OE1   . GLN A 1 206 ? -24.761 15.935  -9.024  1.00 33.03 ? 206  GLN A OE1   1 
ATOM   1723 N  NE2   . GLN A 1 206 ? -25.398 15.716  -6.875  1.00 30.71 ? 206  GLN A NE2   1 
ATOM   1724 N  N     . GLN A 1 207 ? -26.287 21.101  -10.744 1.00 15.66 ? 207  GLN A N     1 
ATOM   1725 C  CA    . GLN A 1 207 ? -27.098 22.064  -11.490 1.00 17.96 ? 207  GLN A CA    1 
ATOM   1726 C  C     . GLN A 1 207 ? -26.627 22.253  -12.930 1.00 17.47 ? 207  GLN A C     1 
ATOM   1727 O  O     . GLN A 1 207 ? -27.441 22.482  -13.827 1.00 15.22 ? 207  GLN A O     1 
ATOM   1728 C  CB    . GLN A 1 207 ? -27.118 23.428  -10.782 1.00 20.25 ? 207  GLN A CB    1 
ATOM   1729 C  CG    . GLN A 1 207 ? -27.791 23.435  -9.415  1.00 26.15 ? 207  GLN A CG    1 
ATOM   1730 C  CD    . GLN A 1 207 ? -29.220 22.914  -9.454  1.00 33.36 ? 207  GLN A CD    1 
ATOM   1731 O  OE1   . GLN A 1 207 ? -30.077 23.457  -10.155 1.00 37.71 ? 207  GLN A OE1   1 
ATOM   1732 N  NE2   . GLN A 1 207 ? -29.483 21.857  -8.691  1.00 37.19 ? 207  GLN A NE2   1 
ATOM   1733 N  N     . LYS A 1 208 ? -25.314 22.180  -13.141 1.00 15.98 ? 208  LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 208 ? -24.723 22.453  -14.450 1.00 17.40 ? 208  LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 208 ? -23.771 21.319  -14.820 1.00 16.08 ? 208  LYS A C     1 
ATOM   1736 O  O     . LYS A 1 208 ? -22.552 21.510  -14.896 1.00 16.29 ? 208  LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 208 ? -23.984 23.804  -14.446 1.00 16.39 ? 208  LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 208 ? -24.853 24.985  -14.010 1.00 18.50 ? 208  LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 208 ? -24.044 26.270  -13.885 1.00 17.39 ? 208  LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 208 ? -24.785 27.305  -13.036 1.00 17.05 ? 208  LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 208 ? -25.936 27.895  -13.777 1.00 12.52 ? 208  LYS A NZ    1 
ATOM   1742 N  N     . THR A 1 209 ? -24.343 20.139  -15.042 1.00 14.52 ? 209  THR A N     1 
ATOM   1743 C  CA    . THR A 1 209 ? -23.566 18.923  -15.249 1.00 14.27 ? 209  THR A CA    1 
ATOM   1744 C  C     . THR A 1 209 ? -22.983 18.904  -16.651 1.00 14.24 ? 209  THR A C     1 
ATOM   1745 O  O     . THR A 1 209 ? -23.727 18.902  -17.632 1.00 16.60 ? 209  THR A O     1 
ATOM   1746 C  CB    . THR A 1 209 ? -24.419 17.656  -14.992 1.00 14.52 ? 209  THR A CB    1 
ATOM   1747 O  OG1   . THR A 1 209 ? -25.033 17.764  -13.704 1.00 14.69 ? 209  THR A OG1   1 
ATOM   1748 C  CG2   . THR A 1 209 ? -23.553 16.395  -15.022 1.00 16.26 ? 209  THR A CG2   1 
ATOM   1749 N  N     . PRO A 1 210 ? -21.642 18.898  -16.748 1.00 14.81 ? 210  PRO A N     1 
ATOM   1750 C  CA    . PRO A 1 210 ? -20.993 18.891  -18.055 1.00 13.73 ? 210  PRO A CA    1 
ATOM   1751 C  C     . PRO A 1 210 ? -21.455 17.704  -18.897 1.00 13.50 ? 210  PRO A C     1 
ATOM   1752 O  O     . PRO A 1 210 ? -21.689 16.614  -18.363 1.00 12.89 ? 210  PRO A O     1 
ATOM   1753 C  CB    . PRO A 1 210 ? -19.502 18.742  -17.707 1.00 13.07 ? 210  PRO A CB    1 
ATOM   1754 C  CG    . PRO A 1 210 ? -19.383 19.263  -16.312 1.00 16.05 ? 210  PRO A CG    1 
ATOM   1755 C  CD    . PRO A 1 210 ? -20.662 18.823  -15.649 1.00 13.45 ? 210  PRO A CD    1 
ATOM   1756 N  N     . VAL A 1 211 ? -21.625 17.941  -20.195 1.00 13.38 ? 211  VAL A N     1 
ATOM   1757 C  CA    . VAL A 1 211 ? -21.772 16.871  -21.172 1.00 11.73 ? 211  VAL A CA    1 
ATOM   1758 C  C     . VAL A 1 211 ? -20.374 16.622  -21.737 1.00 13.02 ? 211  VAL A C     1 
ATOM   1759 O  O     . VAL A 1 211 ? -19.852 15.501  -21.683 1.00 15.37 ? 211  VAL A O     1 
ATOM   1760 C  CB    . VAL A 1 211 ? -22.741 17.279  -22.303 1.00 11.43 ? 211  VAL A CB    1 
ATOM   1761 C  CG1   . VAL A 1 211 ? -22.702 16.265  -23.451 1.00 10.02 ? 211  VAL A CG1   1 
ATOM   1762 C  CG2   . VAL A 1 211 ? -24.171 17.455  -21.757 1.00 11.23 ? 211  VAL A CG2   1 
ATOM   1763 N  N     . ILE A 1 212 ? -19.777 17.683  -22.277 1.00 12.34 ? 212  ILE A N     1 
ATOM   1764 C  CA    . ILE A 1 212 ? -18.387 17.661  -22.722 1.00 12.42 ? 212  ILE A CA    1 
ATOM   1765 C  C     . ILE A 1 212 ? -17.555 18.325  -21.635 1.00 13.56 ? 212  ILE A C     1 
ATOM   1766 O  O     . ILE A 1 212 ? -17.811 19.474  -21.267 1.00 13.11 ? 212  ILE A O     1 
ATOM   1767 C  CB    . ILE A 1 212 ? -18.202 18.419  -24.069 1.00 12.03 ? 212  ILE A CB    1 
ATOM   1768 C  CG1   . ILE A 1 212 ? -19.169 17.894  -25.155 1.00 13.21 ? 212  ILE A CG1   1 
ATOM   1769 C  CG2   . ILE A 1 212 ? -16.738 18.372  -24.525 1.00 11.70 ? 212  ILE A CG2   1 
ATOM   1770 C  CD1   . ILE A 1 212 ? -18.967 16.431  -25.557 1.00 12.63 ? 212  ILE A CD1   1 
ATOM   1771 N  N     . LEU A 1 213 ? -16.584 17.588  -21.106 1.00 13.73 ? 213  LEU A N     1 
ATOM   1772 C  CA    . LEU A 1 213 ? -15.688 18.108  -20.086 1.00 15.44 ? 213  LEU A CA    1 
ATOM   1773 C  C     . LEU A 1 213 ? -14.288 18.239  -20.670 1.00 14.61 ? 213  LEU A C     1 
ATOM   1774 O  O     . LEU A 1 213 ? -13.721 17.262  -21.164 1.00 13.56 ? 213  LEU A O     1 
ATOM   1775 C  CB    . LEU A 1 213 ? -15.697 17.197  -18.850 1.00 15.46 ? 213  LEU A CB    1 
ATOM   1776 C  CG    . LEU A 1 213 ? -14.932 17.627  -17.587 1.00 17.04 ? 213  LEU A CG    1 
ATOM   1777 C  CD1   . LEU A 1 213 ? -15.340 19.025  -17.103 1.00 16.18 ? 213  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU A 1 213 ? -15.127 16.603  -16.483 1.00 17.43 ? 213  LEU A CD2   1 
ATOM   1779 N  N     . THR A 1 214 ? -13.741 19.449  -20.636 1.00 14.88 ? 214  THR A N     1 
ATOM   1780 C  CA    . THR A 1 214 ? -12.431 19.698  -21.229 1.00 14.88 ? 214  THR A CA    1 
ATOM   1781 C  C     . THR A 1 214 ? -11.601 20.670  -20.386 1.00 16.66 ? 214  THR A C     1 
ATOM   1782 O  O     . THR A 1 214 ? -11.969 20.994  -19.253 1.00 16.81 ? 214  THR A O     1 
ATOM   1783 C  CB    . THR A 1 214 ? -12.540 20.118  -22.741 1.00 17.46 ? 214  THR A CB    1 
ATOM   1784 O  OG1   . THR A 1 214 ? -11.235 20.160  -23.342 1.00 13.67 ? 214  THR A OG1   1 
ATOM   1785 C  CG2   . THR A 1 214 ? -13.238 21.464  -22.921 1.00 16.05 ? 214  THR A CG2   1 
ATOM   1786 N  N     . GLY A 1 215 ? -10.482 21.113  -20.947 1.00 16.64 ? 215  GLY A N     1 
ATOM   1787 C  CA    . GLY A 1 215 ? -9.468  21.869  -20.222 1.00 15.76 ? 215  GLY A CA    1 
ATOM   1788 C  C     . GLY A 1 215 ? -8.100  21.267  -20.510 1.00 17.60 ? 215  GLY A C     1 
ATOM   1789 O  O     . GLY A 1 215 ? -7.979  20.316  -21.285 1.00 18.06 ? 215  GLY A O     1 
ATOM   1790 N  N     . TRP A 1 216 ? -7.070  21.801  -19.870 1.00 16.43 ? 216  TRP A N     1 
ATOM   1791 C  CA    . TRP A 1 216 ? -5.707  21.388  -20.162 1.00 17.70 ? 216  TRP A CA    1 
ATOM   1792 C  C     . TRP A 1 216 ? -5.205  20.380  -19.142 1.00 16.72 ? 216  TRP A C     1 
ATOM   1793 O  O     . TRP A 1 216 ? -5.076  20.700  -17.962 1.00 18.14 ? 216  TRP A O     1 
ATOM   1794 C  CB    . TRP A 1 216 ? -4.784  22.603  -20.202 1.00 16.77 ? 216  TRP A CB    1 
ATOM   1795 C  CG    . TRP A 1 216 ? -3.533  22.336  -20.975 1.00 18.12 ? 216  TRP A CG    1 
ATOM   1796 C  CD1   . TRP A 1 216 ? -2.302  22.071  -20.467 1.00 18.52 ? 216  TRP A CD1   1 
ATOM   1797 C  CD2   . TRP A 1 216 ? -3.406  22.283  -22.401 1.00 18.47 ? 216  TRP A CD2   1 
ATOM   1798 N  NE1   . TRP A 1 216 ? -1.400  21.866  -21.491 1.00 20.77 ? 216  TRP A NE1   1 
ATOM   1799 C  CE2   . TRP A 1 216 ? -2.053  21.995  -22.688 1.00 19.08 ? 216  TRP A CE2   1 
ATOM   1800 C  CE3   . TRP A 1 216 ? -4.304  22.463  -23.465 1.00 20.58 ? 216  TRP A CE3   1 
ATOM   1801 C  CZ2   . TRP A 1 216 ? -1.570  21.877  -24.000 1.00 20.67 ? 216  TRP A CZ2   1 
ATOM   1802 C  CZ3   . TRP A 1 216 ? -3.826  22.342  -24.771 1.00 22.48 ? 216  TRP A CZ3   1 
ATOM   1803 C  CH2   . TRP A 1 216 ? -2.470  22.047  -25.024 1.00 22.26 ? 216  TRP A CH2   1 
ATOM   1804 N  N     . ASN A 1 217 ? -4.926  19.161  -19.599 1.00 16.41 ? 217  ASN A N     1 
ATOM   1805 C  CA    . ASN A 1 217 ? -4.465  18.085  -18.717 1.00 19.20 ? 217  ASN A CA    1 
ATOM   1806 C  C     . ASN A 1 217 ? -5.502  17.623  -17.683 1.00 19.55 ? 217  ASN A C     1 
ATOM   1807 O  O     . ASN A 1 217 ? -5.153  16.989  -16.676 1.00 19.00 ? 217  ASN A O     1 
ATOM   1808 C  CB    . ASN A 1 217 ? -3.171  18.508  -18.007 1.00 22.58 ? 217  ASN A CB    1 
ATOM   1809 C  CG    . ASN A 1 217 ? -2.160  17.399  -17.944 1.00 27.81 ? 217  ASN A CG    1 
ATOM   1810 O  OD1   . ASN A 1 217 ? -1.971  16.663  -18.913 1.00 31.76 ? 217  ASN A OD1   1 
ATOM   1811 N  ND2   . ASN A 1 217 ? -1.489  17.273  -16.802 1.00 31.69 ? 217  ASN A ND2   1 
ATOM   1812 N  N     . VAL A 1 218 ? -6.778  17.913  -17.942 1.00 18.40 ? 218  VAL A N     1 
ATOM   1813 C  CA    . VAL A 1 218 ? -7.841  17.575  -16.988 1.00 18.32 ? 218  VAL A CA    1 
ATOM   1814 C  C     . VAL A 1 218 ? -7.925  16.078  -16.692 1.00 20.02 ? 218  VAL A C     1 
ATOM   1815 O  O     . VAL A 1 218 ? -8.219  15.687  -15.566 1.00 18.50 ? 218  VAL A O     1 
ATOM   1816 C  CB    . VAL A 1 218 ? -9.233  18.121  -17.416 1.00 18.79 ? 218  VAL A CB    1 
ATOM   1817 C  CG1   . VAL A 1 218 ? -9.269  19.644  -17.297 1.00 18.61 ? 218  VAL A CG1   1 
ATOM   1818 C  CG2   . VAL A 1 218 ? -9.609  17.663  -18.832 1.00 15.34 ? 218  VAL A CG2   1 
ATOM   1819 N  N     . GLU A 1 219 ? -7.642  15.245  -17.694 1.00 21.79 ? 219  GLU A N     1 
ATOM   1820 C  CA    . GLU A 1 219 ? -7.762  13.799  -17.528 1.00 23.23 ? 219  GLU A CA    1 
ATOM   1821 C  C     . GLU A 1 219 ? -6.725  13.256  -16.552 1.00 22.66 ? 219  GLU A C     1 
ATOM   1822 O  O     . GLU A 1 219 ? -7.013  12.342  -15.785 1.00 21.26 ? 219  GLU A O     1 
ATOM   1823 C  CB    . GLU A 1 219 ? -7.643  13.078  -18.876 1.00 25.80 ? 219  GLU A CB    1 
ATOM   1824 C  CG    . GLU A 1 219 ? -8.143  11.642  -18.851 1.00 29.27 ? 219  GLU A CG    1 
ATOM   1825 C  CD    . GLU A 1 219 ? -7.744  10.843  -20.087 1.00 35.23 ? 219  GLU A CD    1 
ATOM   1826 O  OE1   . GLU A 1 219 ? -8.646  10.396  -20.825 1.00 36.56 ? 219  GLU A OE1   1 
ATOM   1827 O  OE2   . GLU A 1 219 ? -6.530  10.662  -20.322 1.00 37.79 ? 219  GLU A OE2   1 
ATOM   1828 N  N     . SER A 1 220 ? -5.526  13.827  -16.576 1.00 23.35 ? 220  SER A N     1 
ATOM   1829 C  CA    . SER A 1 220 ? -4.429  13.317  -15.759 1.00 24.19 ? 220  SER A CA    1 
ATOM   1830 C  C     . SER A 1 220 ? -4.186  14.095  -14.462 1.00 23.04 ? 220  SER A C     1 
ATOM   1831 O  O     . SER A 1 220 ? -3.512  13.590  -13.557 1.00 23.99 ? 220  SER A O     1 
ATOM   1832 C  CB    . SER A 1 220 ? -3.142  13.216  -16.590 1.00 25.87 ? 220  SER A CB    1 
ATOM   1833 O  OG    . SER A 1 220 ? -2.684  14.500  -16.964 1.00 30.22 ? 220  SER A OG    1 
ATOM   1834 N  N     . PHE A 1 221 ? -4.723  15.312  -14.363 1.00 20.28 ? 221  PHE A N     1 
ATOM   1835 C  CA    . PHE A 1 221 ? -4.588  16.084  -13.124 1.00 20.05 ? 221  PHE A CA    1 
ATOM   1836 C  C     . PHE A 1 221 ? -5.920  16.516  -12.498 1.00 19.68 ? 221  PHE A C     1 
ATOM   1837 O  O     . PHE A 1 221 ? -6.312  15.968  -11.474 1.00 17.92 ? 221  PHE A O     1 
ATOM   1838 C  CB    . PHE A 1 221 ? -3.629  17.282  -13.271 1.00 22.08 ? 221  PHE A CB    1 
ATOM   1839 C  CG    . PHE A 1 221 ? -3.493  18.103  -12.010 1.00 22.88 ? 221  PHE A CG    1 
ATOM   1840 C  CD1   . PHE A 1 221 ? -4.066  19.368  -11.923 1.00 22.80 ? 221  PHE A CD1   1 
ATOM   1841 C  CD2   . PHE A 1 221 ? -2.817  17.592  -10.897 1.00 23.02 ? 221  PHE A CD2   1 
ATOM   1842 C  CE1   . PHE A 1 221 ? -3.958  20.125  -10.753 1.00 22.42 ? 221  PHE A CE1   1 
ATOM   1843 C  CE2   . PHE A 1 221 ? -2.709  18.336  -9.720  1.00 22.30 ? 221  PHE A CE2   1 
ATOM   1844 C  CZ    . PHE A 1 221 ? -3.279  19.606  -9.649  1.00 24.80 ? 221  PHE A CZ    1 
ATOM   1845 N  N     . ALA A 1 222 ? -6.610  17.476  -13.113 1.00 18.14 ? 222  ALA A N     1 
ATOM   1846 C  CA    . ALA A 1 222 ? -7.769  18.121  -12.474 1.00 18.40 ? 222  ALA A CA    1 
ATOM   1847 C  C     . ALA A 1 222 ? -8.866  17.136  -12.057 1.00 18.05 ? 222  ALA A C     1 
ATOM   1848 O  O     . ALA A 1 222 ? -9.329  17.171  -10.917 1.00 17.60 ? 222  ALA A O     1 
ATOM   1849 C  CB    . ALA A 1 222 ? -8.340  19.223  -13.364 1.00 19.71 ? 222  ALA A CB    1 
ATOM   1850 N  N     . ILE A 1 223 ? -9.261  16.249  -12.970 1.00 16.01 ? 223  ILE A N     1 
ATOM   1851 C  CA    . ILE A 1 223 ? -10.335 15.292  -12.686 1.00 16.18 ? 223  ILE A CA    1 
ATOM   1852 C  C     . ILE A 1 223 ? -9.953  14.305  -11.569 1.00 16.98 ? 223  ILE A C     1 
ATOM   1853 O  O     . ILE A 1 223 ? -10.651 14.250  -10.554 1.00 16.34 ? 223  ILE A O     1 
ATOM   1854 C  CB    . ILE A 1 223 ? -10.853 14.581  -13.974 1.00 16.44 ? 223  ILE A CB    1 
ATOM   1855 C  CG1   . ILE A 1 223 ? -11.545 15.605  -14.892 1.00 15.03 ? 223  ILE A CG1   1 
ATOM   1856 C  CG2   . ILE A 1 223 ? -11.788 13.408  -13.623 1.00 15.85 ? 223  ILE A CG2   1 
ATOM   1857 C  CD1   . ILE A 1 223 ? -11.702 15.155  -16.351 1.00 15.56 ? 223  ILE A CD1   1 
ATOM   1858 N  N     . PRO A 1 224 ? -8.839  13.551  -11.731 1.00 16.92 ? 224  PRO A N     1 
ATOM   1859 C  CA    . PRO A 1 224 ? -8.504  12.620  -10.656 1.00 16.65 ? 224  PRO A CA    1 
ATOM   1860 C  C     . PRO A 1 224 ? -8.172  13.317  -9.329  1.00 17.04 ? 224  PRO A C     1 
ATOM   1861 O  O     . PRO A 1 224 ? -8.420  12.742  -8.270  1.00 15.63 ? 224  PRO A O     1 
ATOM   1862 C  CB    . PRO A 1 224 ? -7.289  11.850  -11.206 1.00 16.74 ? 224  PRO A CB    1 
ATOM   1863 C  CG    . PRO A 1 224 ? -6.716  12.720  -12.256 1.00 17.79 ? 224  PRO A CG    1 
ATOM   1864 C  CD    . PRO A 1 224 ? -7.894  13.443  -12.861 1.00 17.65 ? 224  PRO A CD    1 
ATOM   1865 N  N     . TYR A 1 225 ? -7.642  14.540  -9.375  1.00 16.15 ? 225  TYR A N     1 
ATOM   1866 C  CA    . TYR A 1 225 ? -7.385  15.262  -8.128  1.00 17.52 ? 225  TYR A CA    1 
ATOM   1867 C  C     . TYR A 1 225 ? -8.680  15.631  -7.414  1.00 16.74 ? 225  TYR A C     1 
ATOM   1868 O  O     . TYR A 1 225 ? -8.810  15.385  -6.214  1.00 15.41 ? 225  TYR A O     1 
ATOM   1869 C  CB    . TYR A 1 225 ? -6.488  16.505  -8.299  1.00 16.99 ? 225  TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1 225 ? -5.808  16.862  -6.992  1.00 17.74 ? 225  TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1 225 ? -6.506  17.522  -5.973  1.00 16.33 ? 225  TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1 225 ? -4.489  16.487  -6.747  1.00 19.93 ? 225  TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1 225 ? -5.902  17.818  -4.765  1.00 14.01 ? 225  TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1 225 ? -3.871  16.779  -5.530  1.00 19.39 ? 225  TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1 225 ? -4.585  17.442  -4.546  1.00 18.44 ? 225  TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1 225 ? -3.980  17.735  -3.344  1.00 16.22 ? 225  TYR A OH    1 
ATOM   1877 N  N     . VAL A 1 226 ? -9.636  16.201  -8.150  1.00 17.47 ? 226  VAL A N     1 
ATOM   1878 C  CA    . VAL A 1 226 ? -10.925 16.591  -7.567  1.00 16.21 ? 226  VAL A CA    1 
ATOM   1879 C  C     . VAL A 1 226 ? -11.650 15.366  -7.000  1.00 15.70 ? 226  VAL A C     1 
ATOM   1880 O  O     . VAL A 1 226 ? -12.126 15.391  -5.859  1.00 13.02 ? 226  VAL A O     1 
ATOM   1881 C  CB    . VAL A 1 226 ? -11.842 17.332  -8.584  1.00 16.24 ? 226  VAL A CB    1 
ATOM   1882 C  CG1   . VAL A 1 226 ? -13.228 17.570  -7.990  1.00 17.26 ? 226  VAL A CG1   1 
ATOM   1883 C  CG2   . VAL A 1 226 ? -11.241 18.667  -8.981  1.00 16.98 ? 226  VAL A CG2   1 
ATOM   1884 N  N     . TYR A 1 227 ? -11.715 14.302  -7.800  1.00 13.35 ? 227  TYR A N     1 
ATOM   1885 C  CA    . TYR A 1 227 ? -12.340 13.051  -7.389  1.00 14.84 ? 227  TYR A CA    1 
ATOM   1886 C  C     . TYR A 1 227 ? -11.699 12.501  -6.115  1.00 14.19 ? 227  TYR A C     1 
ATOM   1887 O  O     . TYR A 1 227 ? -12.400 12.195  -5.148  1.00 15.28 ? 227  TYR A O     1 
ATOM   1888 C  CB    . TYR A 1 227 ? -12.274 12.008  -8.517  1.00 14.92 ? 227  TYR A CB    1 
ATOM   1889 C  CG    . TYR A 1 227 ? -13.041 10.732  -8.220  1.00 15.14 ? 227  TYR A CG    1 
ATOM   1890 C  CD1   . TYR A 1 227 ? -14.419 10.658  -8.433  1.00 15.25 ? 227  TYR A CD1   1 
ATOM   1891 C  CD2   . TYR A 1 227 ? -12.389 9.599   -7.737  1.00 15.13 ? 227  TYR A CD2   1 
ATOM   1892 C  CE1   . TYR A 1 227 ? -15.134 9.487   -8.162  1.00 15.55 ? 227  TYR A CE1   1 
ATOM   1893 C  CE2   . TYR A 1 227 ? -13.097 8.420   -7.459  1.00 17.89 ? 227  TYR A CE2   1 
ATOM   1894 C  CZ    . TYR A 1 227 ? -14.468 8.378   -7.675  1.00 14.85 ? 227  TYR A CZ    1 
ATOM   1895 O  OH    . TYR A 1 227 ? -15.169 7.226   -7.413  1.00 15.05 ? 227  TYR A OH    1 
ATOM   1896 N  N     . ASN A 1 228 ? -10.374 12.389  -6.105  1.00 13.95 ? 228  ASN A N     1 
ATOM   1897 C  CA    . ASN A 1 228 ? -9.679  11.828  -4.942  1.00 15.13 ? 228  ASN A CA    1 
ATOM   1898 C  C     . ASN A 1 228 ? -9.701  12.707  -3.697  1.00 16.28 ? 228  ASN A C     1 
ATOM   1899 O  O     . ASN A 1 228 ? -9.780  12.196  -2.574  1.00 16.11 ? 228  ASN A O     1 
ATOM   1900 C  CB    . ASN A 1 228 ? -8.253  11.414  -5.291  1.00 15.90 ? 228  ASN A CB    1 
ATOM   1901 C  CG    . ASN A 1 228 ? -8.198  10.081  -6.001  1.00 18.78 ? 228  ASN A CG    1 
ATOM   1902 O  OD1   . ASN A 1 228 ? -8.709  9.081   -5.500  1.00 22.40 ? 228  ASN A OD1   1 
ATOM   1903 N  ND2   . ASN A 1 228 ? -7.590  10.059  -7.176  1.00 18.27 ? 228  ASN A ND2   1 
ATOM   1904 N  N     . ARG A 1 229 ? -9.636  14.024  -3.895  1.00 14.75 ? 229  ARG A N     1 
ATOM   1905 C  CA    . ARG A 1 229 ? -9.736  14.968  -2.782  1.00 14.45 ? 229  ARG A CA    1 
ATOM   1906 C  C     . ARG A 1 229 ? -11.112 14.894  -2.106  1.00 12.88 ? 229  ARG A C     1 
ATOM   1907 O  O     . ARG A 1 229 ? -11.203 14.787  -0.884  1.00 12.09 ? 229  ARG A O     1 
ATOM   1908 C  CB    . ARG A 1 229 ? -9.430  16.400  -3.242  1.00 14.07 ? 229  ARG A CB    1 
ATOM   1909 C  CG    . ARG A 1 229 ? -9.322  17.409  -2.101  1.00 15.71 ? 229  ARG A CG    1 
ATOM   1910 C  CD    . ARG A 1 229 ? -8.140  17.116  -1.164  1.00 17.22 ? 229  ARG A CD    1 
ATOM   1911 N  NE    . ARG A 1 229 ? -8.124  18.032  -0.024  1.00 16.30 ? 229  ARG A NE    1 
ATOM   1912 C  CZ    . ARG A 1 229 ? -7.303  17.943  1.022   1.00 17.84 ? 229  ARG A CZ    1 
ATOM   1913 N  NH1   . ARG A 1 229 ? -6.400  16.970  1.106   1.00 15.12 ? 229  ARG A NH1   1 
ATOM   1914 N  NH2   . ARG A 1 229 ? -7.389  18.838  1.992   1.00 14.84 ? 229  ARG A NH2   1 
ATOM   1915 N  N     . ILE A 1 230 ? -12.170 14.951  -2.910  1.00 12.52 ? 230  ILE A N     1 
ATOM   1916 C  CA    . ILE A 1 230 ? -13.535 14.759  -2.414  1.00 13.45 ? 230  ILE A CA    1 
ATOM   1917 C  C     . ILE A 1 230 ? -13.690 13.390  -1.731  1.00 14.38 ? 230  ILE A C     1 
ATOM   1918 O  O     . ILE A 1 230 ? -14.237 13.299  -0.625  1.00 14.25 ? 230  ILE A O     1 
ATOM   1919 C  CB    . ILE A 1 230 ? -14.581 14.983  -3.542  1.00 13.81 ? 230  ILE A CB    1 
ATOM   1920 C  CG1   . ILE A 1 230 ? -14.522 16.450  -4.009  1.00 11.27 ? 230  ILE A CG1   1 
ATOM   1921 C  CG2   . ILE A 1 230 ? -15.993 14.591  -3.072  1.00 12.36 ? 230  ILE A CG2   1 
ATOM   1922 C  CD1   . ILE A 1 230 ? -15.460 16.818  -5.188  1.00 8.94  ? 230  ILE A CD1   1 
ATOM   1923 N  N     . LYS A 1 231 ? -13.178 12.337  -2.371  1.00 15.87 ? 231  LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 231 ? -13.189 10.994  -1.776  1.00 17.15 ? 231  LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 231 ? -12.538 10.969  -0.383  1.00 18.01 ? 231  LYS A C     1 
ATOM   1926 O  O     . LYS A 1 231 ? -13.108 10.412  0.557   1.00 18.04 ? 231  LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 231 ? -12.526 9.965   -2.704  1.00 17.75 ? 231  LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 231 ? -12.484 8.546   -2.136  1.00 19.62 ? 231  LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 231 ? -11.674 7.608   -3.015  1.00 26.23 ? 231  LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 231 ? -11.489 6.261   -2.337  1.00 29.94 ? 231  LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 231 ? -10.607 5.353   -3.124  1.00 35.51 ? 231  LYS A NZ    1 
ATOM   1932 N  N     . ASN A 1 232 ? -11.364 11.585  -0.253  1.00 17.83 ? 232  ASN A N     1 
ATOM   1933 C  CA    . ASN A 1 232 ? -10.642 11.623  1.026   1.00 20.11 ? 232  ASN A CA    1 
ATOM   1934 C  C     . ASN A 1 232 ? -11.360 12.397  2.142   1.00 19.32 ? 232  ASN A C     1 
ATOM   1935 O  O     . ASN A 1 232 ? -11.310 12.004  3.308   1.00 18.66 ? 232  ASN A O     1 
ATOM   1936 C  CB    . ASN A 1 232 ? -9.221  12.179  0.830   1.00 20.39 ? 232  ASN A CB    1 
ATOM   1937 C  CG    . ASN A 1 232 ? -8.308  11.217  0.078   1.00 23.30 ? 232  ASN A CG    1 
ATOM   1938 O  OD1   . ASN A 1 232 ? -8.652  10.055  -0.150  1.00 23.68 ? 232  ASN A OD1   1 
ATOM   1939 N  ND2   . ASN A 1 232 ? -7.133  11.703  -0.309  1.00 23.97 ? 232  ASN A ND2   1 
ATOM   1940 N  N     . ILE A 1 233 ? -12.018 13.496  1.777   1.00 17.26 ? 233  ILE A N     1 
ATOM   1941 C  CA    . ILE A 1 233 ? -12.701 14.348  2.754   1.00 17.42 ? 233  ILE A CA    1 
ATOM   1942 C  C     . ILE A 1 233 ? -14.100 13.834  3.114   1.00 17.14 ? 233  ILE A C     1 
ATOM   1943 O  O     . ILE A 1 233 ? -14.435 13.718  4.295   1.00 16.35 ? 233  ILE A O     1 
ATOM   1944 C  CB    . ILE A 1 233 ? -12.771 15.829  2.271   1.00 17.73 ? 233  ILE A CB    1 
ATOM   1945 C  CG1   . ILE A 1 233 ? -11.365 16.436  2.224   1.00 18.26 ? 233  ILE A CG1   1 
ATOM   1946 C  CG2   . ILE A 1 233 ? -13.678 16.667  3.188   1.00 19.84 ? 233  ILE A CG2   1 
ATOM   1947 C  CD1   . ILE A 1 233 ? -11.240 17.645  1.313   1.00 18.93 ? 233  ILE A CD1   1 
ATOM   1948 N  N     . PHE A 1 234 ? -14.901 13.516  2.097   1.00 16.19 ? 234  PHE A N     1 
ATOM   1949 C  CA    . PHE A 1 234 ? -16.320 13.198  2.290   1.00 15.82 ? 234  PHE A CA    1 
ATOM   1950 C  C     . PHE A 1 234 ? -16.660 11.722  2.107   1.00 15.10 ? 234  PHE A C     1 
ATOM   1951 O  O     . PHE A 1 234 ? -17.700 11.258  2.580   1.00 13.02 ? 234  PHE A O     1 
ATOM   1952 C  CB    . PHE A 1 234 ? -17.187 14.011  1.327   1.00 16.81 ? 234  PHE A CB    1 
ATOM   1953 C  CG    . PHE A 1 234 ? -17.039 15.501  1.472   1.00 19.74 ? 234  PHE A CG    1 
ATOM   1954 C  CD1   . PHE A 1 234 ? -16.255 16.222  0.580   1.00 20.48 ? 234  PHE A CD1   1 
ATOM   1955 C  CD2   . PHE A 1 234 ? -17.701 16.186  2.490   1.00 23.67 ? 234  PHE A CD2   1 
ATOM   1956 C  CE1   . PHE A 1 234 ? -16.125 17.607  0.699   1.00 21.78 ? 234  PHE A CE1   1 
ATOM   1957 C  CE2   . PHE A 1 234 ? -17.574 17.570  2.622   1.00 23.26 ? 234  PHE A CE2   1 
ATOM   1958 C  CZ    . PHE A 1 234 ? -16.783 18.280  1.722   1.00 23.52 ? 234  PHE A CZ    1 
ATOM   1959 N  N     . GLY A 1 235 ? -15.806 10.997  1.393   1.00 15.08 ? 235  GLY A N     1 
ATOM   1960 C  CA    . GLY A 1 235 ? -16.068 9.591   1.100   1.00 16.02 ? 235  GLY A CA    1 
ATOM   1961 C  C     . GLY A 1 235 ? -16.320 9.361   -0.374  1.00 16.40 ? 235  GLY A C     1 
ATOM   1962 O  O     . GLY A 1 235 ? -16.679 10.284  -1.110  1.00 16.32 ? 235  GLY A O     1 
ATOM   1963 N  N     . GLU A 1 236 ? -16.137 8.115   -0.791  1.00 16.85 ? 236  GLU A N     1 
ATOM   1964 C  CA    . GLU A 1 236 ? -16.236 7.713   -2.187  1.00 18.29 ? 236  GLU A CA    1 
ATOM   1965 C  C     . GLU A 1 236 ? -17.601 8.016   -2.820  1.00 17.01 ? 236  GLU A C     1 
ATOM   1966 O  O     . GLU A 1 236 ? -17.667 8.438   -3.978  1.00 17.34 ? 236  GLU A O     1 
ATOM   1967 C  CB    . GLU A 1 236 ? -15.929 6.219   -2.307  1.00 20.13 ? 236  GLU A CB    1 
ATOM   1968 C  CG    . GLU A 1 236 ? -15.544 5.756   -3.700  1.00 26.71 ? 236  GLU A CG    1 
ATOM   1969 C  CD    . GLU A 1 236 ? -15.372 4.245   -3.787  1.00 31.54 ? 236  GLU A CD    1 
ATOM   1970 O  OE1   . GLU A 1 236 ? -15.968 3.511   -2.965  1.00 31.64 ? 236  GLU A OE1   1 
ATOM   1971 O  OE2   . GLU A 1 236 ? -14.643 3.787   -4.689  1.00 35.91 ? 236  GLU A OE2   1 
ATOM   1972 N  N     . SER A 1 237 ? -18.673 7.787   -2.066  1.00 15.44 ? 237  SER A N     1 
ATOM   1973 C  CA    . SER A 1 237 ? -20.044 8.004   -2.550  1.00 15.15 ? 237  SER A CA    1 
ATOM   1974 C  C     . SER A 1 237 ? -20.306 9.459   -2.932  1.00 13.24 ? 237  SER A C     1 
ATOM   1975 O  O     . SER A 1 237 ? -21.026 9.731   -3.889  1.00 13.57 ? 237  SER A O     1 
ATOM   1976 C  CB    . SER A 1 237 ? -21.059 7.560   -1.494  1.00 14.23 ? 237  SER A CB    1 
ATOM   1977 O  OG    . SER A 1 237 ? -21.020 6.157   -1.329  1.00 20.10 ? 237  SER A OG    1 
ATOM   1978 N  N     . THR A 1 238 ? -19.724 10.382  -2.172  1.00 12.34 ? 238  THR A N     1 
ATOM   1979 C  CA    . THR A 1 238 ? -19.831 11.812  -2.458  1.00 13.24 ? 238  THR A CA    1 
ATOM   1980 C  C     . THR A 1 238 ? -19.051 12.151  -3.727  1.00 14.92 ? 238  THR A C     1 
ATOM   1981 O  O     . THR A 1 238 ? -19.534 12.900  -4.580  1.00 16.14 ? 238  THR A O     1 
ATOM   1982 C  CB    . THR A 1 238 ? -19.329 12.662  -1.270  1.00 12.91 ? 238  THR A CB    1 
ATOM   1983 O  OG1   . THR A 1 238 ? -20.136 12.392  -0.118  1.00 13.10 ? 238  THR A OG1   1 
ATOM   1984 C  CG2   . THR A 1 238 ? -19.417 14.148  -1.575  1.00 10.85 ? 238  THR A CG2   1 
ATOM   1985 N  N     . ALA A 1 239 ? -17.852 11.585  -3.847  1.00 14.97 ? 239  ALA A N     1 
ATOM   1986 C  CA    . ALA A 1 239 ? -17.011 11.775  -5.035  1.00 15.03 ? 239  ALA A CA    1 
ATOM   1987 C  C     . ALA A 1 239 ? -17.717 11.323  -6.314  1.00 14.98 ? 239  ALA A C     1 
ATOM   1988 O  O     . ALA A 1 239 ? -17.561 11.950  -7.371  1.00 14.77 ? 239  ALA A O     1 
ATOM   1989 C  CB    . ALA A 1 239 ? -15.680 11.054  -4.862  1.00 14.39 ? 239  ALA A CB    1 
ATOM   1990 N  N     . LYS A 1 240 ? -18.510 10.255  -6.201  1.00 14.39 ? 240  LYS A N     1 
ATOM   1991 C  CA    A LYS A 1 240 ? -19.245 9.719   -7.347  0.50 14.68 ? 240  LYS A CA    1 
ATOM   1992 C  CA    B LYS A 1 240 ? -19.266 9.704   -7.330  0.50 15.22 ? 240  LYS A CA    1 
ATOM   1993 C  C     . LYS A 1 240 ? -20.386 10.633  -7.816  1.00 15.46 ? 240  LYS A C     1 
ATOM   1994 O  O     . LYS A 1 240 ? -20.982 10.398  -8.870  1.00 16.56 ? 240  LYS A O     1 
ATOM   1995 C  CB    A LYS A 1 240 ? -19.745 8.300   -7.056  0.50 14.92 ? 240  LYS A CB    1 
ATOM   1996 C  CB    B LYS A 1 240 ? -19.833 8.323   -6.978  0.50 15.90 ? 240  LYS A CB    1 
ATOM   1997 C  CG    A LYS A 1 240 ? -18.626 7.263   -7.051  0.50 12.54 ? 240  LYS A CG    1 
ATOM   1998 C  CG    B LYS A 1 240 ? -18.788 7.210   -6.939  0.50 15.90 ? 240  LYS A CG    1 
ATOM   1999 C  CD    A LYS A 1 240 ? -19.122 5.901   -6.594  0.50 13.60 ? 240  LYS A CD    1 
ATOM   2000 C  CD    B LYS A 1 240 ? -19.402 5.894   -6.471  0.50 17.86 ? 240  LYS A CD    1 
ATOM   2001 C  CE    A LYS A 1 240 ? -17.969 4.917   -6.478  0.50 13.23 ? 240  LYS A CE    1 
ATOM   2002 C  CE    B LYS A 1 240 ? -18.343 4.812   -6.305  0.50 19.07 ? 240  LYS A CE    1 
ATOM   2003 N  NZ    A LYS A 1 240 ? -18.434 3.548   -6.132  0.50 9.38  ? 240  LYS A NZ    1 
ATOM   2004 N  NZ    B LYS A 1 240 ? -17.616 4.531   -7.576  0.50 18.56 ? 240  LYS A NZ    1 
ATOM   2005 N  N     . ARG A 1 241 ? -20.672 11.686  -7.048  1.00 14.16 ? 241  ARG A N     1 
ATOM   2006 C  CA    . ARG A 1 241 ? -21.642 12.712  -7.464  1.00 13.92 ? 241  ARG A CA    1 
ATOM   2007 C  C     . ARG A 1 241 ? -21.145 13.479  -8.692  1.00 14.50 ? 241  ARG A C     1 
ATOM   2008 O  O     . ARG A 1 241 ? -21.915 14.182  -9.350  1.00 12.66 ? 241  ARG A O     1 
ATOM   2009 C  CB    . ARG A 1 241 ? -21.944 13.687  -6.319  1.00 13.91 ? 241  ARG A CB    1 
ATOM   2010 C  CG    . ARG A 1 241 ? -22.849 13.115  -5.215  1.00 15.51 ? 241  ARG A CG    1 
ATOM   2011 C  CD    . ARG A 1 241 ? -23.042 14.115  -4.065  1.00 19.71 ? 241  ARG A CD    1 
ATOM   2012 N  NE    . ARG A 1 241 ? -23.690 15.352  -4.508  1.00 20.96 ? 241  ARG A NE    1 
ATOM   2013 C  CZ    . ARG A 1 241 ? -23.612 16.529  -3.887  1.00 20.83 ? 241  ARG A CZ    1 
ATOM   2014 N  NH1   . ARG A 1 241 ? -22.906 16.671  -2.768  1.00 20.66 ? 241  ARG A NH1   1 
ATOM   2015 N  NH2   . ARG A 1 241 ? -24.239 17.579  -4.399  1.00 20.54 ? 241  ARG A NH2   1 
ATOM   2016 N  N     . LEU A 1 242 ? -19.853 13.336  -8.996  1.00 13.28 ? 242  LEU A N     1 
ATOM   2017 C  CA    . LEU A 1 242 ? -19.278 13.897  -10.218 1.00 15.86 ? 242  LEU A CA    1 
ATOM   2018 C  C     . LEU A 1 242 ? -19.778 13.164  -11.473 1.00 16.49 ? 242  LEU A C     1 
ATOM   2019 O  O     . LEU A 1 242 ? -19.627 13.658  -12.591 1.00 16.54 ? 242  LEU A O     1 
ATOM   2020 C  CB    . LEU A 1 242 ? -17.744 13.890  -10.159 1.00 15.32 ? 242  LEU A CB    1 
ATOM   2021 C  CG    . LEU A 1 242 ? -17.063 14.906  -9.232  1.00 17.75 ? 242  LEU A CG    1 
ATOM   2022 C  CD1   . LEU A 1 242 ? -15.557 14.669  -9.178  1.00 18.71 ? 242  LEU A CD1   1 
ATOM   2023 C  CD2   . LEU A 1 242 ? -17.357 16.346  -9.668  1.00 18.36 ? 242  LEU A CD2   1 
ATOM   2024 N  N     . SER A 1 243 ? -20.354 11.980  -11.277 1.00 16.84 ? 243  SER A N     1 
ATOM   2025 C  CA    . SER A 1 243 ? -21.025 11.250  -12.353 1.00 16.14 ? 243  SER A CA    1 
ATOM   2026 C  C     . SER A 1 243 ? -22.529 11.421  -12.215 1.00 16.11 ? 243  SER A C     1 
ATOM   2027 O  O     . SER A 1 243 ? -23.071 11.180  -11.133 1.00 16.05 ? 243  SER A O     1 
ATOM   2028 C  CB    . SER A 1 243 ? -20.673 9.762   -12.286 1.00 15.93 ? 243  SER A CB    1 
ATOM   2029 O  OG    . SER A 1 243 ? -21.582 8.991   -13.052 1.00 14.80 ? 243  SER A OG    1 
ATOM   2030 N  N     . PRO A 1 244 ? -23.218 11.833  -13.305 1.00 14.63 ? 244  PRO A N     1 
ATOM   2031 C  CA    . PRO A 1 244 ? -24.681 11.960  -13.231 1.00 14.40 ? 244  PRO A CA    1 
ATOM   2032 C  C     . PRO A 1 244 ? -25.403 10.632  -12.963 1.00 15.11 ? 244  PRO A C     1 
ATOM   2033 O  O     . PRO A 1 244 ? -26.549 10.638  -12.524 1.00 15.20 ? 244  PRO A O     1 
ATOM   2034 C  CB    . PRO A 1 244 ? -25.068 12.532  -14.605 1.00 14.82 ? 244  PRO A CB    1 
ATOM   2035 C  CG    . PRO A 1 244 ? -23.886 12.300  -15.484 1.00 14.75 ? 244  PRO A CG    1 
ATOM   2036 C  CD    . PRO A 1 244 ? -22.690 12.356  -14.576 1.00 13.88 ? 244  PRO A CD    1 
ATOM   2037 N  N     . HIS A 1 245 ? -24.734 9.507   -13.210 1.00 16.11 ? 245  HIS A N     1 
ATOM   2038 C  CA    . HIS A 1 245 ? -25.314 8.199   -12.898 1.00 16.16 ? 245  HIS A CA    1 
ATOM   2039 C  C     . HIS A 1 245 ? -24.704 7.583   -11.631 1.00 16.40 ? 245  HIS A C     1 
ATOM   2040 O  O     . HIS A 1 245 ? -25.014 6.440   -11.270 1.00 16.29 ? 245  HIS A O     1 
ATOM   2041 C  CB    . HIS A 1 245 ? -25.188 7.255   -14.097 1.00 15.10 ? 245  HIS A CB    1 
ATOM   2042 C  CG    . HIS A 1 245 ? -25.519 7.900   -15.408 1.00 15.27 ? 245  HIS A CG    1 
ATOM   2043 N  ND1   . HIS A 1 245 ? -26.740 8.488   -15.663 1.00 13.15 ? 245  HIS A ND1   1 
ATOM   2044 C  CD2   . HIS A 1 245 ? -24.785 8.054   -16.537 1.00 14.93 ? 245  HIS A CD2   1 
ATOM   2045 C  CE1   . HIS A 1 245 ? -26.743 8.977   -16.891 1.00 16.41 ? 245  HIS A CE1   1 
ATOM   2046 N  NE2   . HIS A 1 245 ? -25.568 8.726   -17.443 1.00 12.48 ? 245  HIS A NE2   1 
ATOM   2047 N  N     . ARG A 1 246 ? -23.855 8.362   -10.957 1.00 16.60 ? 246  ARG A N     1 
ATOM   2048 C  CA    . ARG A 1 246 ? -23.181 7.961   -9.711  1.00 17.94 ? 246  ARG A CA    1 
ATOM   2049 C  C     . ARG A 1 246 ? -22.303 6.721   -9.896  1.00 18.76 ? 246  ARG A C     1 
ATOM   2050 O  O     . ARG A 1 246 ? -22.135 5.919   -8.974  1.00 15.58 ? 246  ARG A O     1 
ATOM   2051 C  CB    . ARG A 1 246 ? -24.184 7.763   -8.558  1.00 17.72 ? 246  ARG A CB    1 
ATOM   2052 C  CG    . ARG A 1 246 ? -25.132 8.942   -8.312  1.00 20.63 ? 246  ARG A CG    1 
ATOM   2053 C  CD    . ARG A 1 246 ? -24.383 10.209  -7.922  1.00 22.26 ? 246  ARG A CD    1 
ATOM   2054 N  NE    . ARG A 1 246 ? -25.302 11.292  -7.575  1.00 24.35 ? 246  ARG A NE    1 
ATOM   2055 C  CZ    . ARG A 1 246 ? -25.613 12.319  -8.365  1.00 27.13 ? 246  ARG A CZ    1 
ATOM   2056 N  NH1   . ARG A 1 246 ? -25.078 12.437  -9.579  1.00 25.00 ? 246  ARG A NH1   1 
ATOM   2057 N  NH2   . ARG A 1 246 ? -26.471 13.238  -7.937  1.00 25.99 ? 246  ARG A NH2   1 
ATOM   2058 N  N     . LYS A 1 247 ? -21.742 6.576   -11.094 1.00 18.50 ? 247  LYS A N     1 
ATOM   2059 C  CA    . LYS A 1 247 ? -20.857 5.458   -11.385 1.00 20.67 ? 247  LYS A CA    1 
ATOM   2060 C  C     . LYS A 1 247 ? -19.538 5.941   -11.969 1.00 20.01 ? 247  LYS A C     1 
ATOM   2061 O  O     . LYS A 1 247 ? -19.510 6.751   -12.901 1.00 18.29 ? 247  LYS A O     1 
ATOM   2062 C  CB    . LYS A 1 247 ? -21.521 4.441   -12.321 1.00 22.18 ? 247  LYS A CB    1 
ATOM   2063 C  CG    . LYS A 1 247 ? -20.625 3.228   -12.618 1.00 29.36 ? 247  LYS A CG    1 
ATOM   2064 C  CD    . LYS A 1 247 ? -21.293 2.217   -13.532 1.00 32.92 ? 247  LYS A CD    1 
ATOM   2065 C  CE    . LYS A 1 247 ? -20.341 1.090   -13.928 1.00 34.18 ? 247  LYS A CE    1 
ATOM   2066 N  NZ    . LYS A 1 247 ? -19.957 0.238   -12.771 1.00 34.58 ? 247  LYS A NZ    1 
ATOM   2067 N  N     . THR A 1 248 ? -18.448 5.435   -11.401 1.00 20.71 ? 248  THR A N     1 
ATOM   2068 C  CA    . THR A 1 248 ? -17.104 5.757   -11.861 1.00 21.78 ? 248  THR A CA    1 
ATOM   2069 C  C     . THR A 1 248 ? -16.261 4.485   -11.979 1.00 24.05 ? 248  THR A C     1 
ATOM   2070 O  O     . THR A 1 248 ? -16.586 3.455   -11.379 1.00 21.57 ? 248  THR A O     1 
ATOM   2071 C  CB    . THR A 1 248 ? -16.400 6.757   -10.911 1.00 21.81 ? 248  THR A CB    1 
ATOM   2072 O  OG1   . THR A 1 248 ? -16.318 6.194   -9.596  1.00 19.92 ? 248  THR A OG1   1 
ATOM   2073 C  CG2   . THR A 1 248 ? -17.169 8.072   -10.840 1.00 20.86 ? 248  THR A CG2   1 
ATOM   2074 N  N     . ARG A 1 249 ? -15.200 4.558   -12.778 1.00 25.45 ? 249  ARG A N     1 
ATOM   2075 C  CA    . ARG A 1 249 ? -14.190 3.506   -12.823 1.00 28.70 ? 249  ARG A CA    1 
ATOM   2076 C  C     . ARG A 1 249 ? -12.815 4.124   -12.594 1.00 28.72 ? 249  ARG A C     1 
ATOM   2077 O  O     . ARG A 1 249 ? -12.458 5.120   -13.229 1.00 28.18 ? 249  ARG A O     1 
ATOM   2078 C  CB    . ARG A 1 249 ? -14.230 2.741   -14.151 1.00 29.67 ? 249  ARG A CB    1 
ATOM   2079 C  CG    . ARG A 1 249 ? -13.192 1.614   -14.241 1.00 35.03 ? 249  ARG A CG    1 
ATOM   2080 C  CD    . ARG A 1 249 ? -13.436 0.670   -15.407 1.00 40.09 ? 249  ARG A CD    1 
ATOM   2081 N  NE    . ARG A 1 249 ? -14.626 -0.156  -15.206 1.00 44.13 ? 249  ARG A NE    1 
ATOM   2082 C  CZ    . ARG A 1 249 ? -15.720 -0.098  -15.960 1.00 46.67 ? 249  ARG A CZ    1 
ATOM   2083 N  NH1   . ARG A 1 249 ? -15.782 0.741   -16.989 1.00 48.30 ? 249  ARG A NH1   1 
ATOM   2084 N  NH2   . ARG A 1 249 ? -16.752 -0.891  -15.693 1.00 46.35 ? 249  ARG A NH2   1 
ATOM   2085 N  N     . VAL A 1 250 ? -12.060 3.534   -11.674 1.00 30.59 ? 250  VAL A N     1 
ATOM   2086 C  CA    . VAL A 1 250 ? -10.719 4.005   -11.350 1.00 32.72 ? 250  VAL A CA    1 
ATOM   2087 C  C     . VAL A 1 250 ? -9.689  3.078   -11.992 1.00 35.09 ? 250  VAL A C     1 
ATOM   2088 O  O     . VAL A 1 250 ? -9.635  1.888   -11.683 1.00 33.15 ? 250  VAL A O     1 
ATOM   2089 C  CB    . VAL A 1 250 ? -10.487 4.088   -9.816  1.00 32.42 ? 250  VAL A CB    1 
ATOM   2090 C  CG1   . VAL A 1 250 ? -9.084  4.603   -9.507  1.00 33.92 ? 250  VAL A CG1   1 
ATOM   2091 C  CG2   . VAL A 1 250 ? -11.535 4.977   -9.149  1.00 33.15 ? 250  VAL A CG2   1 
ATOM   2092 N  N     . LYS A 1 251 ? -8.888  3.629   -12.899 1.00 39.14 ? 251  LYS A N     1 
ATOM   2093 C  CA    . LYS A 1 251 ? -7.836  2.861   -13.560 1.00 43.86 ? 251  LYS A CA    1 
ATOM   2094 C  C     . LYS A 1 251 ? -6.463  3.306   -13.058 1.00 45.98 ? 251  LYS A C     1 
ATOM   2095 O  O     . LYS A 1 251 ? -6.055  4.449   -13.277 1.00 45.62 ? 251  LYS A O     1 
ATOM   2096 C  CB    . LYS A 1 251 ? -7.939  2.993   -15.088 1.00 44.59 ? 251  LYS A CB    1 
ATOM   2097 C  CG    . LYS A 1 251 ? -7.299  1.843   -15.870 1.00 46.96 ? 251  LYS A CG    1 
ATOM   2098 C  CD    . LYS A 1 251 ? -5.795  2.039   -16.067 1.00 49.26 ? 251  LYS A CD    1 
ATOM   2099 C  CE    . LYS A 1 251 ? -5.054  0.706   -16.153 1.00 50.73 ? 251  LYS A CE    1 
ATOM   2100 N  NZ    . LYS A 1 251 ? -5.413  -0.076  -17.370 1.00 52.37 ? 251  LYS A NZ    1 
ATOM   2101 N  N     . VAL A 1 252 ? -5.764  2.392   -12.386 1.00 48.95 ? 252  VAL A N     1 
ATOM   2102 C  CA    . VAL A 1 252 ? -4.448  2.663   -11.801 1.00 52.77 ? 252  VAL A CA    1 
ATOM   2103 C  C     . VAL A 1 252 ? -3.333  2.143   -12.716 1.00 55.85 ? 252  VAL A C     1 
ATOM   2104 O  O     . VAL A 1 252 ? -3.264  0.943   -13.003 1.00 55.96 ? 252  VAL A O     1 
ATOM   2105 C  CB    . VAL A 1 252 ? -4.324  2.043   -10.377 1.00 52.46 ? 252  VAL A CB    1 
ATOM   2106 C  CG1   . VAL A 1 252 ? -2.929  2.264   -9.793  1.00 52.09 ? 252  VAL A CG1   1 
ATOM   2107 C  CG2   . VAL A 1 252 ? -5.390  2.617   -9.444  1.00 52.35 ? 252  VAL A CG2   1 
ATOM   2108 N  N     . ILE A 1 253 ? -2.471  3.050   -13.174 1.00 59.98 ? 253  ILE A N     1 
ATOM   2109 C  CA    . ILE A 1 253 ? -1.363  2.686   -14.066 1.00 64.18 ? 253  ILE A CA    1 
ATOM   2110 C  C     . ILE A 1 253 ? -0.123  2.202   -13.292 1.00 67.20 ? 253  ILE A C     1 
ATOM   2111 O  O     . ILE A 1 253 ? 0.395   1.121   -13.578 1.00 68.03 ? 253  ILE A O     1 
ATOM   2112 C  CB    . ILE A 1 253 ? -1.031  3.810   -15.113 1.00 64.19 ? 253  ILE A CB    1 
ATOM   2113 C  CG1   . ILE A 1 253 ? -0.005  3.325   -16.147 1.00 64.56 ? 253  ILE A CG1   1 
ATOM   2114 C  CG2   . ILE A 1 253 ? -0.571  5.098   -14.441 1.00 64.40 ? 253  ILE A CG2   1 
ATOM   2115 C  CD1   . ILE A 1 253 ? -0.594  2.471   -17.262 1.00 64.98 ? 253  ILE A CD1   1 
ATOM   2116 N  N     . GLU A 1 254 ? 0.330   3.004   -12.323 1.00 70.39 ? 254  GLU A N     1 
ATOM   2117 C  CA    . GLU A 1 254 ? 1.394   2.629   -11.372 1.00 73.69 ? 254  GLU A CA    1 
ATOM   2118 C  C     . GLU A 1 254 ? 2.654   2.007   -12.002 1.00 75.31 ? 254  GLU A C     1 
ATOM   2119 O  O     . GLU A 1 254 ? 2.779   0.779   -12.077 1.00 75.71 ? 254  GLU A O     1 
ATOM   2120 C  CB    . GLU A 1 254 ? 0.825   1.707   -10.279 1.00 74.03 ? 254  GLU A CB    1 
ATOM   2121 C  CG    . GLU A 1 254 ? 1.806   1.343   -9.166  1.00 75.50 ? 254  GLU A CG    1 
ATOM   2122 C  CD    . GLU A 1 254 ? 1.343   0.159   -8.331  1.00 76.60 ? 254  GLU A CD    1 
ATOM   2123 O  OE1   . GLU A 1 254 ? 0.120   -0.096  -8.262  1.00 77.00 ? 254  GLU A OE1   1 
ATOM   2124 O  OE2   . GLU A 1 254 ? 2.209   -0.518  -7.738  1.00 77.08 ? 254  GLU A OE2   1 
ATOM   2125 N  N     . ASN A 1 255 ? 3.581   2.861   -12.439 1.00 77.17 ? 255  ASN A N     1 
ATOM   2126 C  CA    . ASN A 1 255 ? 4.857   2.415   -13.010 1.00 78.91 ? 255  ASN A CA    1 
ATOM   2127 C  C     . ASN A 1 255 ? 5.819   3.582   -13.284 1.00 79.76 ? 255  ASN A C     1 
ATOM   2128 O  O     . ASN A 1 255 ? 5.630   4.315   -14.260 1.00 79.76 ? 255  ASN A O     1 
ATOM   2129 C  CB    . ASN A 1 255 ? 4.624   1.616   -14.304 1.00 79.14 ? 255  ASN A CB    1 
ATOM   2130 C  CG    . ASN A 1 255 ? 5.623   0.482   -14.485 1.00 79.97 ? 255  ASN A CG    1 
ATOM   2131 O  OD1   . ASN A 1 255 ? 6.510   0.552   -15.335 1.00 80.35 ? 255  ASN A OD1   1 
ATOM   2132 N  ND2   . ASN A 1 255 ? 5.476   -0.573  -13.688 1.00 80.31 ? 255  ASN A ND2   1 
ATOM   2133 N  N     . MET A 1 256 ? 6.837   3.784   -12.442 1.00 80.61 ? 256  MET A N     1 
ATOM   2134 C  CA    . MET A 1 256 ? 7.078   3.038   -11.198 1.00 81.12 ? 256  MET A CA    1 
ATOM   2135 C  C     . MET A 1 256 ? 7.542   3.969   -10.071 1.00 80.85 ? 256  MET A C     1 
ATOM   2136 O  O     . MET A 1 256 ? 7.753   3.530   -8.936  1.00 80.97 ? 256  MET A O     1 
ATOM   2137 C  CB    . MET A 1 256 ? 8.123   1.938   -11.413 1.00 81.70 ? 256  MET A CB    1 
ATOM   2138 C  CG    . MET A 1 256 ? 7.565   0.526   -11.329 1.00 83.03 ? 256  MET A CG    1 
ATOM   2139 S  SD    . MET A 1 256 ? 8.842   -0.748  -11.273 1.00 85.14 ? 256  MET A SD    1 
ATOM   2140 C  CE    . MET A 1 256 ? 9.541   -0.493  -9.640  1.00 84.53 ? 256  MET A CE    1 
ATOM   2141 N  N     . TYR A 1 257 ? 7.703   5.250   -10.400 1.00 79.99 ? 257  TYR A N     1 
ATOM   2142 C  CA    . TYR A 1 257 ? 8.150   6.272   -9.450  1.00 78.93 ? 257  TYR A CA    1 
ATOM   2143 C  C     . TYR A 1 257 ? 6.993   6.718   -8.561  1.00 77.37 ? 257  TYR A C     1 
ATOM   2144 O  O     . TYR A 1 257 ? 7.200   7.153   -7.426  1.00 77.68 ? 257  TYR A O     1 
ATOM   2145 C  CB    . TYR A 1 257 ? 8.727   7.481   -10.196 1.00 79.63 ? 257  TYR A CB    1 
ATOM   2146 C  CG    . TYR A 1 257 ? 9.139   7.178   -11.622 1.00 81.40 ? 257  TYR A CG    1 
ATOM   2147 C  CD1   . TYR A 1 257 ? 10.401  6.656   -11.912 1.00 81.81 ? 257  TYR A CD1   1 
ATOM   2148 C  CD2   . TYR A 1 257 ? 8.257   7.401   -12.681 1.00 82.37 ? 257  TYR A CD2   1 
ATOM   2149 C  CE1   . TYR A 1 257 ? 10.774  6.369   -13.223 1.00 82.16 ? 257  TYR A CE1   1 
ATOM   2150 C  CE2   . TYR A 1 257 ? 8.621   7.116   -13.991 1.00 83.02 ? 257  TYR A CE2   1 
ATOM   2151 C  CZ    . TYR A 1 257 ? 9.880   6.601   -14.256 1.00 82.73 ? 257  TYR A CZ    1 
ATOM   2152 O  OH    . TYR A 1 257 ? 10.241  6.319   -15.554 1.00 82.52 ? 257  TYR A OH    1 
ATOM   2153 N  N     . GLY A 1 258 ? 5.778   6.609   -9.096  1.00 75.15 ? 258  GLY A N     1 
ATOM   2154 C  CA    . GLY A 1 258 ? 4.556   6.974   -8.384  1.00 72.03 ? 258  GLY A CA    1 
ATOM   2155 C  C     . GLY A 1 258 ? 3.319   6.468   -9.104  1.00 69.51 ? 258  GLY A C     1 
ATOM   2156 O  O     . GLY A 1 258 ? 3.290   6.403   -10.336 1.00 69.99 ? 258  GLY A O     1 
ATOM   2157 N  N     . SER A 1 259 ? 2.297   6.106   -8.331  1.00 66.50 ? 259  SER A N     1 
ATOM   2158 C  CA    . SER A 1 259 ? 1.043   5.605   -8.888  1.00 63.01 ? 259  SER A CA    1 
ATOM   2159 C  C     . SER A 1 259 ? 0.181   6.751   -9.407  1.00 60.01 ? 259  SER A C     1 
ATOM   2160 O  O     . SER A 1 259 ? -0.164  7.670   -8.658  1.00 59.86 ? 259  SER A O     1 
ATOM   2161 C  CB    . SER A 1 259 ? 0.261   4.808   -7.841  1.00 62.98 ? 259  SER A CB    1 
ATOM   2162 O  OG    . SER A 1 259 ? 1.076   3.829   -7.225  1.00 65.25 ? 259  SER A OG    1 
ATOM   2163 N  N     . ARG A 1 260 ? -0.147  6.695   -10.694 1.00 56.03 ? 260  ARG A N     1 
ATOM   2164 C  CA    . ARG A 1 260 ? -1.105  7.622   -11.291 1.00 52.61 ? 260  ARG A CA    1 
ATOM   2165 C  C     . ARG A 1 260 ? -2.413  6.883   -11.545 1.00 48.57 ? 260  ARG A C     1 
ATOM   2166 O  O     . ARG A 1 260 ? -2.426  5.653   -11.652 1.00 48.27 ? 260  ARG A O     1 
ATOM   2167 C  CB    . ARG A 1 260 ? -0.564  8.200   -12.602 1.00 53.82 ? 260  ARG A CB    1 
ATOM   2168 C  CG    . ARG A 1 260 ? 0.689   9.056   -12.458 1.00 57.68 ? 260  ARG A CG    1 
ATOM   2169 C  CD    . ARG A 1 260 ? 1.433   9.187   -13.786 1.00 61.66 ? 260  ARG A CD    1 
ATOM   2170 N  NE    . ARG A 1 260 ? 0.658   9.902   -14.803 1.00 65.49 ? 260  ARG A NE    1 
ATOM   2171 C  CZ    . ARG A 1 260 ? 0.802   11.193  -15.102 1.00 67.27 ? 260  ARG A CZ    1 
ATOM   2172 N  NH1   . ARG A 1 260 ? 1.698   11.940  -14.465 1.00 68.15 ? 260  ARG A NH1   1 
ATOM   2173 N  NH2   . ARG A 1 260 ? 0.046   11.741  -16.046 1.00 66.39 ? 260  ARG A NH2   1 
ATOM   2174 N  N     . GLU A 1 261 ? -3.514  7.625   -11.622 1.00 44.32 ? 261  GLU A N     1 
ATOM   2175 C  CA    . GLU A 1 261 ? -4.802  7.027   -11.976 1.00 40.33 ? 261  GLU A CA    1 
ATOM   2176 C  C     . GLU A 1 261 ? -5.669  7.886   -12.901 1.00 37.46 ? 261  GLU A C     1 
ATOM   2177 O  O     . GLU A 1 261 ? -5.620  9.119   -12.869 1.00 34.87 ? 261  GLU A O     1 
ATOM   2178 C  CB    . GLU A 1 261 ? -5.588  6.560   -10.734 1.00 41.16 ? 261  GLU A CB    1 
ATOM   2179 C  CG    . GLU A 1 261 ? -5.788  7.596   -9.638  1.00 41.89 ? 261  GLU A CG    1 
ATOM   2180 C  CD    . GLU A 1 261 ? -6.520  7.028   -8.431  1.00 42.38 ? 261  GLU A CD    1 
ATOM   2181 O  OE1   . GLU A 1 261 ? -7.621  7.526   -8.125  1.00 43.58 ? 261  GLU A OE1   1 
ATOM   2182 O  OE2   . GLU A 1 261 ? -6.007  6.082   -7.795  1.00 40.99 ? 261  GLU A OE2   1 
ATOM   2183 N  N     . ILE A 1 262 ? -6.439  7.198   -13.739 1.00 34.03 ? 262  ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 262 ? -7.421  7.814   -14.621 1.00 31.01 ? 262  ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 262 ? -8.826  7.422   -14.148 1.00 27.72 ? 262  ILE A C     1 
ATOM   2186 O  O     . ILE A 1 262 ? -9.103  6.246   -13.894 1.00 24.60 ? 262  ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 262 ? -7.154  7.454   -16.125 1.00 32.73 ? 262  ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 262 ? -8.447  7.342   -16.940 1.00 31.94 ? 262  ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 262 ? -6.373  6.148   -16.253 1.00 35.00 ? 262  ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 262 ? -8.976  8.644   -17.444 1.00 35.19 ? 262  ILE A CD1   1 
ATOM   2191 N  N     . ILE A 1 263 ? -9.692  8.422   -14.007 1.00 25.76 ? 263  ILE A N     1 
ATOM   2192 C  CA    . ILE A 1 263 ? -11.053 8.213   -13.517 1.00 24.53 ? 263  ILE A CA    1 
ATOM   2193 C  C     . ILE A 1 263 ? -12.041 8.342   -14.668 1.00 25.35 ? 263  ILE A C     1 
ATOM   2194 O  O     . ILE A 1 263 ? -12.072 9.362   -15.363 1.00 26.75 ? 263  ILE A O     1 
ATOM   2195 C  CB    . ILE A 1 263 ? -11.444 9.240   -12.405 1.00 26.06 ? 263  ILE A CB    1 
ATOM   2196 C  CG1   . ILE A 1 263 ? -10.327 9.414   -11.355 1.00 24.75 ? 263  ILE A CG1   1 
ATOM   2197 C  CG2   . ILE A 1 263 ? -12.798 8.884   -11.771 1.00 23.48 ? 263  ILE A CG2   1 
ATOM   2198 C  CD1   . ILE A 1 263 ? -9.935  8.165   -10.592 1.00 24.05 ? 263  ILE A CD1   1 
ATOM   2199 N  N     . THR A 1 264 ? -12.844 7.306   -14.869 1.00 22.38 ? 264  THR A N     1 
ATOM   2200 C  CA    . THR A 1 264 ? -13.924 7.362   -15.835 1.00 21.56 ? 264  THR A CA    1 
ATOM   2201 C  C     . THR A 1 264 ? -15.188 7.812   -15.123 1.00 20.70 ? 264  THR A C     1 
ATOM   2202 O  O     . THR A 1 264 ? -15.611 7.195   -14.148 1.00 20.33 ? 264  THR A O     1 
ATOM   2203 C  CB    . THR A 1 264 ? -14.135 5.997   -16.520 1.00 21.40 ? 264  THR A CB    1 
ATOM   2204 O  OG1   . THR A 1 264 ? -12.919 5.614   -17.171 1.00 17.54 ? 264  THR A OG1   1 
ATOM   2205 C  CG2   . THR A 1 264 ? -15.257 6.068   -17.554 1.00 20.24 ? 264  THR A CG2   1 
ATOM   2206 N  N     . LEU A 1 265 ? -15.767 8.906   -15.604 1.00 18.56 ? 265  LEU A N     1 
ATOM   2207 C  CA    . LEU A 1 265 ? -17.009 9.436   -15.059 1.00 18.77 ? 265  LEU A CA    1 
ATOM   2208 C  C     . LEU A 1 265 ? -18.130 9.072   -16.011 1.00 17.75 ? 265  LEU A C     1 
ATOM   2209 O  O     . LEU A 1 265 ? -18.275 9.690   -17.065 1.00 19.38 ? 265  LEU A O     1 
ATOM   2210 C  CB    . LEU A 1 265 ? -16.930 10.964  -14.896 1.00 18.36 ? 265  LEU A CB    1 
ATOM   2211 C  CG    . LEU A 1 265 ? -15.840 11.570  -14.000 1.00 19.02 ? 265  LEU A CG    1 
ATOM   2212 C  CD1   . LEU A 1 265 ? -15.864 13.098  -14.099 1.00 21.27 ? 265  LEU A CD1   1 
ATOM   2213 C  CD2   . LEU A 1 265 ? -15.975 11.136  -12.543 1.00 16.23 ? 265  LEU A CD2   1 
ATOM   2214 N  N     . PHE A 1 266 ? -18.912 8.061   -15.645 1.00 16.78 ? 266  PHE A N     1 
ATOM   2215 C  CA    . PHE A 1 266 ? -20.006 7.599   -16.491 1.00 17.84 ? 266  PHE A CA    1 
ATOM   2216 C  C     . PHE A 1 266 ? -21.027 8.711   -16.678 1.00 16.33 ? 266  PHE A C     1 
ATOM   2217 O  O     . PHE A 1 266 ? -21.445 9.353   -15.711 1.00 17.64 ? 266  PHE A O     1 
ATOM   2218 C  CB    . PHE A 1 266 ? -20.662 6.341   -15.905 1.00 18.96 ? 266  PHE A CB    1 
ATOM   2219 C  CG    . PHE A 1 266 ? -19.876 5.080   -16.145 1.00 23.90 ? 266  PHE A CG    1 
ATOM   2220 C  CD1   . PHE A 1 266 ? -18.652 4.870   -15.514 1.00 27.10 ? 266  PHE A CD1   1 
ATOM   2221 C  CD2   . PHE A 1 266 ? -20.366 4.095   -16.999 1.00 29.10 ? 266  PHE A CD2   1 
ATOM   2222 C  CE1   . PHE A 1 266 ? -17.916 3.703   -15.739 1.00 28.72 ? 266  PHE A CE1   1 
ATOM   2223 C  CE2   . PHE A 1 266 ? -19.642 2.922   -17.231 1.00 30.43 ? 266  PHE A CE2   1 
ATOM   2224 C  CZ    . PHE A 1 266 ? -18.413 2.728   -16.596 1.00 30.40 ? 266  PHE A CZ    1 
ATOM   2225 N  N     . GLY A 1 267 ? -21.399 8.948   -17.931 1.00 15.59 ? 267  GLY A N     1 
ATOM   2226 C  CA    . GLY A 1 267 ? -22.396 9.961   -18.266 1.00 14.38 ? 267  GLY A CA    1 
ATOM   2227 C  C     . GLY A 1 267 ? -21.787 11.310  -18.586 1.00 14.30 ? 267  GLY A C     1 
ATOM   2228 O  O     . GLY A 1 267 ? -22.514 12.263  -18.844 1.00 14.76 ? 267  GLY A O     1 
ATOM   2229 N  N     . ILE A 1 268 ? -20.456 11.391  -18.544 1.00 14.63 ? 268  ILE A N     1 
ATOM   2230 C  CA    . ILE A 1 268 ? -19.717 12.569  -19.024 1.00 14.26 ? 268  ILE A CA    1 
ATOM   2231 C  C     . ILE A 1 268 ? -18.784 12.162  -20.178 1.00 13.94 ? 268  ILE A C     1 
ATOM   2232 O  O     . ILE A 1 268 ? -18.267 11.044  -20.197 1.00 13.49 ? 268  ILE A O     1 
ATOM   2233 C  CB    . ILE A 1 268 ? -18.912 13.238  -17.881 1.00 15.43 ? 268  ILE A CB    1 
ATOM   2234 C  CG1   . ILE A 1 268 ? -19.850 13.601  -16.715 1.00 18.33 ? 268  ILE A CG1   1 
ATOM   2235 C  CG2   . ILE A 1 268 ? -18.177 14.492  -18.377 1.00 12.88 ? 268  ILE A CG2   1 
ATOM   2236 C  CD1   . ILE A 1 268 ? -19.164 14.246  -15.549 1.00 20.51 ? 268  ILE A CD1   1 
ATOM   2237 N  N     . SER A 1 269 ? -18.601 13.055  -21.148 1.00 12.64 ? 269  SER A N     1 
ATOM   2238 C  CA    . SER A 1 269 ? -17.642 12.828  -22.230 1.00 12.85 ? 269  SER A CA    1 
ATOM   2239 C  C     . SER A 1 269 ? -16.454 13.752  -22.025 1.00 13.25 ? 269  SER A C     1 
ATOM   2240 O  O     . SER A 1 269 ? -16.526 14.952  -22.313 1.00 11.47 ? 269  SER A O     1 
ATOM   2241 C  CB    . SER A 1 269 ? -18.287 13.053  -23.602 1.00 13.73 ? 269  SER A CB    1 
ATOM   2242 O  OG    . SER A 1 269 ? -19.238 12.040  -23.881 1.00 12.92 ? 269  SER A OG    1 
ATOM   2243 N  N     . VAL A 1 270 ? -15.379 13.186  -21.484 1.00 12.59 ? 270  VAL A N     1 
ATOM   2244 C  CA    . VAL A 1 270 ? -14.138 13.914  -21.258 1.00 12.78 ? 270  VAL A CA    1 
ATOM   2245 C  C     . VAL A 1 270 ? -13.323 13.967  -22.554 1.00 14.56 ? 270  VAL A C     1 
ATOM   2246 O  O     . VAL A 1 270 ? -13.008 12.931  -23.143 1.00 13.52 ? 270  VAL A O     1 
ATOM   2247 C  CB    . VAL A 1 270 ? -13.297 13.272  -20.112 1.00 14.68 ? 270  VAL A CB    1 
ATOM   2248 C  CG1   . VAL A 1 270 ? -11.979 14.004  -19.932 1.00 13.86 ? 270  VAL A CG1   1 
ATOM   2249 C  CG2   . VAL A 1 270 ? -14.080 13.279  -18.780 1.00 11.23 ? 270  VAL A CG2   1 
ATOM   2250 N  N     . LEU A 1 271 ? -13.010 15.183  -22.998 1.00 14.64 ? 271  LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 271 ? -12.123 15.410  -24.138 1.00 15.29 ? 271  LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 271 ? -11.036 16.367  -23.669 1.00 15.53 ? 271  LEU A C     1 
ATOM   2253 O  O     . LEU A 1 271 ? -11.157 17.583  -23.830 1.00 16.82 ? 271  LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 271 ? -12.870 16.028  -25.327 1.00 16.84 ? 271  LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 271 ? -14.132 15.394  -25.919 1.00 18.34 ? 271  LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 271 ? -14.728 16.346  -26.948 1.00 20.14 ? 271  LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 271 ? -13.823 14.059  -26.559 1.00 18.13 ? 271  LEU A CD2   1 
ATOM   2258 N  N     . ASP A 1 272 ? -9.998  15.811  -23.052 1.00 14.25 ? 272  ASP A N     1 
ATOM   2259 C  CA    . ASP A 1 272 ? -8.881  16.594  -22.551 1.00 15.93 ? 272  ASP A CA    1 
ATOM   2260 C  C     . ASP A 1 272 ? -8.290  17.366  -23.735 1.00 16.39 ? 272  ASP A C     1 
ATOM   2261 O  O     . ASP A 1 272 ? -7.966  16.764  -24.764 1.00 15.47 ? 272  ASP A O     1 
ATOM   2262 C  CB    . ASP A 1 272 ? -7.844  15.659  -21.929 1.00 16.57 ? 272  ASP A CB    1 
ATOM   2263 C  CG    . ASP A 1 272 ? -6.774  16.402  -21.135 1.00 19.35 ? 272  ASP A CG    1 
ATOM   2264 O  OD1   . ASP A 1 272 ? -6.409  17.543  -21.502 1.00 20.77 ? 272  ASP A OD1   1 
ATOM   2265 O  OD2   . ASP A 1 272 ? -6.291  15.832  -20.137 1.00 16.84 ? 272  ASP A OD2   1 
ATOM   2266 N  N     . TYR A 1 273 ? -8.170  18.688  -23.610 1.00 16.12 ? 273  TYR A N     1 
ATOM   2267 C  CA    . TYR A 1 273 ? -7.779  19.490  -24.769 1.00 16.10 ? 273  TYR A CA    1 
ATOM   2268 C  C     . TYR A 1 273 ? -6.373  19.159  -25.240 1.00 16.18 ? 273  TYR A C     1 
ATOM   2269 O  O     . TYR A 1 273 ? -6.053  19.289  -26.423 1.00 15.43 ? 273  TYR A O     1 
ATOM   2270 C  CB    . TYR A 1 273 ? -7.952  21.000  -24.554 1.00 16.02 ? 273  TYR A CB    1 
ATOM   2271 C  CG    . TYR A 1 273 ? -8.312  21.666  -25.856 1.00 17.57 ? 273  TYR A CG    1 
ATOM   2272 C  CD1   . TYR A 1 273 ? -7.323  22.064  -26.757 1.00 17.74 ? 273  TYR A CD1   1 
ATOM   2273 C  CD2   . TYR A 1 273 ? -9.645  21.836  -26.219 1.00 16.63 ? 273  TYR A CD2   1 
ATOM   2274 C  CE1   . TYR A 1 273 ? -7.652  22.635  -27.975 1.00 18.07 ? 273  TYR A CE1   1 
ATOM   2275 C  CE2   . TYR A 1 273 ? -9.986  22.410  -27.432 1.00 19.07 ? 273  TYR A CE2   1 
ATOM   2276 C  CZ    . TYR A 1 273 ? -8.980  22.809  -28.306 1.00 17.42 ? 273  TYR A CZ    1 
ATOM   2277 O  OH    . TYR A 1 273 ? -9.315  23.371  -29.512 1.00 17.36 ? 273  TYR A OH    1 
ATOM   2278 N  N     . ILE A 1 274 ? -5.542  18.704  -24.312 1.00 15.79 ? 274  ILE A N     1 
ATOM   2279 C  CA    . ILE A 1 274 ? -4.212  18.241  -24.652 1.00 16.58 ? 274  ILE A CA    1 
ATOM   2280 C  C     . ILE A 1 274 ? -4.273  17.073  -25.666 1.00 14.23 ? 274  ILE A C     1 
ATOM   2281 O  O     . ILE A 1 274 ? -3.499  17.034  -26.638 1.00 14.30 ? 274  ILE A O     1 
ATOM   2282 C  CB    . ILE A 1 274 ? -3.398  17.922  -23.352 1.00 17.79 ? 274  ILE A CB    1 
ATOM   2283 C  CG1   . ILE A 1 274 ? -1.912  18.209  -23.542 1.00 24.86 ? 274  ILE A CG1   1 
ATOM   2284 C  CG2   . ILE A 1 274 ? -3.680  16.506  -22.809 1.00 22.95 ? 274  ILE A CG2   1 
ATOM   2285 C  CD1   . ILE A 1 274 ? -1.178  17.140  -24.234 1.00 26.29 ? 274  ILE A CD1   1 
ATOM   2286 N  N     . ASP A 1 275 ? -5.216  16.156  -25.465 1.00 14.21 ? 275  ASP A N     1 
ATOM   2287 C  CA    . ASP A 1 275 ? -5.395  15.009  -26.369 1.00 13.19 ? 275  ASP A CA    1 
ATOM   2288 C  C     . ASP A 1 275 ? -6.023  15.413  -27.698 1.00 12.54 ? 275  ASP A C     1 
ATOM   2289 O  O     . ASP A 1 275 ? -5.630  14.905  -28.741 1.00 12.51 ? 275  ASP A O     1 
ATOM   2290 C  CB    . ASP A 1 275 ? -6.226  13.912  -25.702 1.00 14.00 ? 275  ASP A CB    1 
ATOM   2291 C  CG    . ASP A 1 275 ? -5.544  13.335  -24.478 1.00 18.21 ? 275  ASP A CG    1 
ATOM   2292 O  OD1   . ASP A 1 275 ? -4.322  13.109  -24.537 1.00 18.89 ? 275  ASP A OD1   1 
ATOM   2293 O  OD2   . ASP A 1 275 ? -6.228  13.118  -23.462 1.00 20.32 ? 275  ASP A OD2   1 
ATOM   2294 N  N     . LEU A 1 276 ? -6.996  16.325  -27.653 1.00 13.41 ? 276  LEU A N     1 
ATOM   2295 C  CA    . LEU A 1 276 ? -7.568  16.893  -28.878 1.00 14.44 ? 276  LEU A CA    1 
ATOM   2296 C  C     . LEU A 1 276 ? -6.479  17.571  -29.700 1.00 13.72 ? 276  LEU A C     1 
ATOM   2297 O  O     . LEU A 1 276 ? -6.364  17.342  -30.905 1.00 13.64 ? 276  LEU A O     1 
ATOM   2298 C  CB    . LEU A 1 276 ? -8.673  17.906  -28.555 1.00 12.65 ? 276  LEU A CB    1 
ATOM   2299 C  CG    . LEU A 1 276 ? -9.961  17.366  -27.935 1.00 13.99 ? 276  LEU A CG    1 
ATOM   2300 C  CD1   . LEU A 1 276 ? -10.825 18.528  -27.470 1.00 13.20 ? 276  LEU A CD1   1 
ATOM   2301 C  CD2   . LEU A 1 276 ? -10.726 16.460  -28.916 1.00 13.87 ? 276  LEU A CD2   1 
ATOM   2302 N  N     . TYR A 1 277 ? -5.674  18.399  -29.035 1.00 14.27 ? 277  TYR A N     1 
ATOM   2303 C  CA    . TYR A 1 277 ? -4.598  19.112  -29.707 1.00 12.42 ? 277  TYR A CA    1 
ATOM   2304 C  C     . TYR A 1 277 ? -3.620  18.140  -30.390 1.00 11.41 ? 277  TYR A C     1 
ATOM   2305 O  O     . TYR A 1 277 ? -3.292  18.294  -31.570 1.00 12.36 ? 277  TYR A O     1 
ATOM   2306 C  CB    . TYR A 1 277 ? -3.864  20.030  -28.717 1.00 11.73 ? 277  TYR A CB    1 
ATOM   2307 C  CG    . TYR A 1 277 ? -2.886  20.956  -29.385 1.00 8.99  ? 277  TYR A CG    1 
ATOM   2308 C  CD1   . TYR A 1 277 ? -3.286  22.213  -29.831 1.00 12.51 ? 277  TYR A CD1   1 
ATOM   2309 C  CD2   . TYR A 1 277 ? -1.567  20.577  -29.581 1.00 10.02 ? 277  TYR A CD2   1 
ATOM   2310 C  CE1   . TYR A 1 277 ? -2.391  23.066  -30.468 1.00 11.67 ? 277  TYR A CE1   1 
ATOM   2311 C  CE2   . TYR A 1 277 ? -0.656  21.432  -30.207 1.00 12.31 ? 277  TYR A CE2   1 
ATOM   2312 C  CZ    . TYR A 1 277 ? -1.078  22.673  -30.647 1.00 12.08 ? 277  TYR A CZ    1 
ATOM   2313 O  OH    . TYR A 1 277 ? -0.181  23.522  -31.264 1.00 12.81 ? 277  TYR A OH    1 
ATOM   2314 N  N     . LYS A 1 278 ? -3.169  17.133  -29.655 1.00 11.77 ? 278  LYS A N     1 
ATOM   2315 C  CA    . LYS A 1 278 ? -2.255  16.133  -30.207 1.00 11.29 ? 278  LYS A CA    1 
ATOM   2316 C  C     . LYS A 1 278 ? -2.850  15.356  -31.396 1.00 12.44 ? 278  LYS A C     1 
ATOM   2317 O  O     . LYS A 1 278 ? -2.155  15.091  -32.381 1.00 10.04 ? 278  LYS A O     1 
ATOM   2318 C  CB    . LYS A 1 278 ? -1.775  15.184  -29.105 1.00 13.74 ? 278  LYS A CB    1 
ATOM   2319 C  CG    . LYS A 1 278 ? -0.772  15.829  -28.142 1.00 14.76 ? 278  LYS A CG    1 
ATOM   2320 C  CD    . LYS A 1 278 ? -0.393  14.870  -27.023 1.00 18.65 ? 278  LYS A CD    1 
ATOM   2321 C  CE    . LYS A 1 278 ? 0.771   15.409  -26.203 1.00 23.07 ? 278  LYS A CE    1 
ATOM   2322 N  NZ    . LYS A 1 278 ? 0.980   14.615  -24.955 1.00 23.24 ? 278  LYS A NZ    1 
ATOM   2323 N  N     . LYS A 1 279 ? -4.137  15.030  -31.326 1.00 12.08 ? 279  LYS A N     1 
ATOM   2324 C  CA    . LYS A 1 279 ? -4.767  14.258  -32.400 1.00 12.52 ? 279  LYS A CA    1 
ATOM   2325 C  C     . LYS A 1 279 ? -5.066  15.090  -33.647 1.00 12.32 ? 279  LYS A C     1 
ATOM   2326 O  O     . LYS A 1 279 ? -4.838  14.631  -34.770 1.00 12.03 ? 279  LYS A O     1 
ATOM   2327 C  CB    . LYS A 1 279 ? -6.048  13.550  -31.928 1.00 13.79 ? 279  LYS A CB    1 
ATOM   2328 C  CG    . LYS A 1 279 ? -6.629  12.650  -33.039 1.00 16.88 ? 279  LYS A CG    1 
ATOM   2329 C  CD    . LYS A 1 279 ? -7.839  11.858  -32.630 1.00 16.33 ? 279  LYS A CD    1 
ATOM   2330 C  CE    . LYS A 1 279 ? -8.496  11.208  -33.859 1.00 16.93 ? 279  LYS A CE    1 
ATOM   2331 N  NZ    . LYS A 1 279 ? -7.613  10.280  -34.608 1.00 17.78 ? 279  LYS A NZ    1 
ATOM   2332 N  N     . PHE A 1 280 ? -5.547  16.316  -33.439 1.00 11.54 ? 280  PHE A N     1 
ATOM   2333 C  CA    . PHE A 1 280 ? -6.149  17.116  -34.512 1.00 10.65 ? 280  PHE A CA    1 
ATOM   2334 C  C     . PHE A 1 280 ? -5.307  18.283  -35.059 1.00 11.59 ? 280  PHE A C     1 
ATOM   2335 O  O     . PHE A 1 280 ? -5.635  18.833  -36.112 1.00 11.34 ? 280  PHE A O     1 
ATOM   2336 C  CB    . PHE A 1 280 ? -7.503  17.666  -34.047 1.00 10.97 ? 280  PHE A CB    1 
ATOM   2337 C  CG    . PHE A 1 280 ? -8.555  16.617  -33.810 1.00 11.60 ? 280  PHE A CG    1 
ATOM   2338 C  CD1   . PHE A 1 280 ? -9.393  16.704  -32.701 1.00 14.30 ? 280  PHE A CD1   1 
ATOM   2339 C  CD2   . PHE A 1 280 ? -8.728  15.556  -34.695 1.00 12.76 ? 280  PHE A CD2   1 
ATOM   2340 C  CE1   . PHE A 1 280 ? -10.392 15.748  -32.476 1.00 14.48 ? 280  PHE A CE1   1 
ATOM   2341 C  CE2   . PHE A 1 280 ? -9.724  14.594  -34.481 1.00 13.11 ? 280  PHE A CE2   1 
ATOM   2342 C  CZ    . PHE A 1 280 ? -10.561 14.697  -33.370 1.00 12.49 ? 280  PHE A CZ    1 
ATOM   2343 N  N     . SER A 1 281 ? -4.235  18.657  -34.360 1.00 12.43 ? 281  SER A N     1 
ATOM   2344 C  CA    . SER A 1 281 ? -3.461  19.855  -34.726 1.00 13.08 ? 281  SER A CA    1 
ATOM   2345 C  C     . SER A 1 281 ? -2.405  19.604  -35.795 1.00 12.48 ? 281  SER A C     1 
ATOM   2346 O  O     . SER A 1 281 ? -2.005  20.534  -36.492 1.00 12.42 ? 281  SER A O     1 
ATOM   2347 C  CB    . SER A 1 281 ? -2.786  20.487  -33.497 1.00 11.67 ? 281  SER A CB    1 
ATOM   2348 O  OG    . SER A 1 281 ? -1.637  19.738  -33.118 1.00 12.40 ? 281  SER A OG    1 
ATOM   2349 N  N     . PHE A 1 282 ? -1.957  18.355  -35.915 1.00 13.44 ? 282  PHE A N     1 
ATOM   2350 C  CA    . PHE A 1 282 ? -0.822  17.995  -36.773 1.00 14.60 ? 282  PHE A CA    1 
ATOM   2351 C  C     . PHE A 1 282 ? 0.420   18.874  -36.562 1.00 17.06 ? 282  PHE A C     1 
ATOM   2352 O  O     . PHE A 1 282 ? 1.055   19.350  -37.503 1.00 15.22 ? 282  PHE A O     1 
ATOM   2353 C  CB    . PHE A 1 282 ? -1.244  17.857  -38.241 1.00 16.74 ? 282  PHE A CB    1 
ATOM   2354 C  CG    . PHE A 1 282 ? -2.123  16.658  -38.487 1.00 18.39 ? 282  PHE A CG    1 
ATOM   2355 C  CD1   . PHE A 1 282 ? -1.570  15.447  -38.894 1.00 18.10 ? 282  PHE A CD1   1 
ATOM   2356 C  CD2   . PHE A 1 282 ? -3.496  16.726  -38.257 1.00 16.37 ? 282  PHE A CD2   1 
ATOM   2357 C  CE1   . PHE A 1 282 ? -2.378  14.324  -39.098 1.00 20.06 ? 282  PHE A CE1   1 
ATOM   2358 C  CE2   . PHE A 1 282 ? -4.315  15.610  -38.453 1.00 16.44 ? 282  PHE A CE2   1 
ATOM   2359 C  CZ    . PHE A 1 282 ? -3.750  14.403  -38.874 1.00 17.45 ? 282  PHE A CZ    1 
ATOM   2360 N  N     . THR A 1 283 ? 0.745   19.073  -35.291 1.00 17.08 ? 283  THR A N     1 
ATOM   2361 C  CA    . THR A 1 283 ? 2.030   19.621  -34.888 1.00 19.72 ? 283  THR A CA    1 
ATOM   2362 C  C     . THR A 1 283 ? 2.761   18.544  -34.097 1.00 21.34 ? 283  THR A C     1 
ATOM   2363 O  O     . THR A 1 283 ? 2.145   17.599  -33.600 1.00 25.70 ? 283  THR A O     1 
ATOM   2364 C  CB    . THR A 1 283 ? 1.848   20.817  -33.953 1.00 20.28 ? 283  THR A CB    1 
ATOM   2365 O  OG1   . THR A 1 283 ? 1.169   20.380  -32.764 1.00 20.06 ? 283  THR A OG1   1 
ATOM   2366 C  CG2   . THR A 1 283 ? 1.048   21.931  -34.640 1.00 18.51 ? 283  THR A CG2   1 
ATOM   2367 N  N     . ASN A 1 284 ? 4.074   18.665  -33.994 1.00 23.16 ? 284  ASN A N     1 
ATOM   2368 C  CA    . ASN A 1 284 ? 4.774   18.014  -32.900 1.00 24.26 ? 284  ASN A CA    1 
ATOM   2369 C  C     . ASN A 1 284 ? 5.546   19.084  -32.165 1.00 21.99 ? 284  ASN A C     1 
ATOM   2370 O  O     . ASN A 1 284 ? 6.479   19.676  -32.703 1.00 26.01 ? 284  ASN A O     1 
ATOM   2371 C  CB    . ASN A 1 284 ? 5.687   16.867  -33.348 1.00 25.53 ? 284  ASN A CB    1 
ATOM   2372 C  CG    . ASN A 1 284 ? 6.148   15.989  -32.165 1.00 29.13 ? 284  ASN A CG    1 
ATOM   2373 O  OD1   . ASN A 1 284 ? 5.587   16.053  -31.065 1.00 24.40 ? 284  ASN A OD1   1 
ATOM   2374 N  ND2   . ASN A 1 284 ? 7.173   15.169  -32.396 1.00 30.82 ? 284  ASN A ND2   1 
ATOM   2375 N  N     . GLN A 1 285 ? 5.130   19.338  -30.934 1.00 20.38 ? 285  GLN A N     1 
ATOM   2376 C  CA    . GLN A 1 285 ? 5.683   20.426  -30.144 1.00 19.35 ? 285  GLN A CA    1 
ATOM   2377 C  C     . GLN A 1 285 ? 6.801   19.937  -29.229 1.00 18.21 ? 285  GLN A C     1 
ATOM   2378 O  O     . GLN A 1 285 ? 6.772   18.791  -28.785 1.00 18.69 ? 285  GLN A O     1 
ATOM   2379 C  CB    . GLN A 1 285 ? 4.557   21.079  -29.340 1.00 17.11 ? 285  GLN A CB    1 
ATOM   2380 C  CG    . GLN A 1 285 ? 3.407   21.570  -30.230 1.00 17.31 ? 285  GLN A CG    1 
ATOM   2381 C  CD    . GLN A 1 285 ? 3.726   22.873  -30.945 1.00 19.07 ? 285  GLN A CD    1 
ATOM   2382 O  OE1   . GLN A 1 285 ? 4.874   23.322  -30.967 1.00 21.10 ? 285  GLN A OE1   1 
ATOM   2383 N  NE2   . GLN A 1 285 ? 2.705   23.489  -31.531 1.00 19.64 ? 285  GLN A NE2   1 
ATOM   2384 N  N     . PRO A 1 286 ? 7.791   20.804  -28.937 1.00 17.56 ? 286  PRO A N     1 
ATOM   2385 C  CA    . PRO A 1 286 ? 8.825   20.379  -27.994 1.00 15.61 ? 286  PRO A CA    1 
ATOM   2386 C  C     . PRO A 1 286 ? 8.327   20.362  -26.548 1.00 15.95 ? 286  PRO A C     1 
ATOM   2387 O  O     . PRO A 1 286 ? 8.954   19.747  -25.688 1.00 15.52 ? 286  PRO A O     1 
ATOM   2388 C  CB    . PRO A 1 286 ? 9.923   21.435  -28.171 1.00 15.16 ? 286  PRO A CB    1 
ATOM   2389 C  CG    . PRO A 1 286 ? 9.229   22.629  -28.670 1.00 16.49 ? 286  PRO A CG    1 
ATOM   2390 C  CD    . PRO A 1 286 ? 8.077   22.134  -29.509 1.00 16.71 ? 286  PRO A CD    1 
ATOM   2391 N  N     . SER A 1 287 ? 7.203   21.030  -26.302 1.00 16.29 ? 287  SER A N     1 
ATOM   2392 C  CA    . SER A 1 287 ? 6.598   21.116  -24.984 1.00 16.83 ? 287  SER A CA    1 
ATOM   2393 C  C     . SER A 1 287 ? 5.086   21.233  -25.119 1.00 16.48 ? 287  SER A C     1 
ATOM   2394 O  O     . SER A 1 287 ? 4.591   21.816  -26.086 1.00 13.79 ? 287  SER A O     1 
ATOM   2395 C  CB    . SER A 1 287 ? 7.133   22.341  -24.241 1.00 18.22 ? 287  SER A CB    1 
ATOM   2396 O  OG    . SER A 1 287 ? 6.329   22.648  -23.112 1.00 20.45 ? 287  SER A OG    1 
ATOM   2397 N  N     . TYR A 1 288 ? 4.372   20.691  -24.136 1.00 15.44 ? 288  TYR A N     1 
ATOM   2398 C  CA    . TYR A 1 288 ? 2.916   20.785  -24.072 1.00 17.39 ? 288  TYR A CA    1 
ATOM   2399 C  C     . TYR A 1 288 ? 2.391   21.489  -22.822 1.00 18.52 ? 288  TYR A C     1 
ATOM   2400 O  O     . TYR A 1 288 ? 1.256   21.248  -22.389 1.00 18.16 ? 288  TYR A O     1 
ATOM   2401 C  CB    . TYR A 1 288 ? 2.267   19.403  -24.251 1.00 17.99 ? 288  TYR A CB    1 
ATOM   2402 C  CG    . TYR A 1 288 ? 2.414   18.907  -25.660 1.00 17.03 ? 288  TYR A CG    1 
ATOM   2403 C  CD1   . TYR A 1 288 ? 3.520   18.150  -26.036 1.00 15.63 ? 288  TYR A CD1   1 
ATOM   2404 C  CD2   . TYR A 1 288 ? 1.475   19.244  -26.637 1.00 13.66 ? 288  TYR A CD2   1 
ATOM   2405 C  CE1   . TYR A 1 288 ? 3.673   17.710  -27.342 1.00 16.91 ? 288  TYR A CE1   1 
ATOM   2406 C  CE2   . TYR A 1 288 ? 1.616   18.810  -27.941 1.00 13.19 ? 288  TYR A CE2   1 
ATOM   2407 C  CZ    . TYR A 1 288 ? 2.718   18.045  -28.287 1.00 17.15 ? 288  TYR A CZ    1 
ATOM   2408 O  OH    . TYR A 1 288 ? 2.869   17.617  -29.581 1.00 17.98 ? 288  TYR A OH    1 
ATOM   2409 N  N     . SER A 1 289 ? 3.204   22.373  -22.253 1.00 18.73 ? 289  SER A N     1 
ATOM   2410 C  CA    . SER A 1 289 ? 2.691   23.278  -21.232 1.00 19.84 ? 289  SER A CA    1 
ATOM   2411 C  C     . SER A 1 289 ? 1.716   24.224  -21.911 1.00 19.86 ? 289  SER A C     1 
ATOM   2412 O  O     . SER A 1 289 ? 1.891   24.567  -23.092 1.00 16.44 ? 289  SER A O     1 
ATOM   2413 C  CB    . SER A 1 289 ? 3.814   24.076  -20.572 1.00 20.12 ? 289  SER A CB    1 
ATOM   2414 O  OG    . SER A 1 289 ? 4.285   25.106  -21.422 1.00 20.71 ? 289  SER A OG    1 
ATOM   2415 N  N     . LEU A 1 290 ? 0.698   24.649  -21.169 1.00 18.93 ? 290  LEU A N     1 
ATOM   2416 C  CA    . LEU A 1 290 ? -0.285  25.586  -21.702 1.00 19.56 ? 290  LEU A CA    1 
ATOM   2417 C  C     . LEU A 1 290 ? 0.356   26.917  -22.103 1.00 18.14 ? 290  LEU A C     1 
ATOM   2418 O  O     . LEU A 1 290 ? -0.044  27.504  -23.105 1.00 16.82 ? 290  LEU A O     1 
ATOM   2419 C  CB    . LEU A 1 290 ? -1.451  25.796  -20.723 1.00 19.29 ? 290  LEU A CB    1 
ATOM   2420 C  CG    . LEU A 1 290 ? -2.617  26.675  -21.200 1.00 21.72 ? 290  LEU A CG    1 
ATOM   2421 C  CD1   . LEU A 1 290 ? -3.188  26.199  -22.541 1.00 19.67 ? 290  LEU A CD1   1 
ATOM   2422 C  CD2   . LEU A 1 290 ? -3.707  26.715  -20.143 1.00 20.68 ? 290  LEU A CD2   1 
ATOM   2423 N  N     . ASP A 1 291 ? 1.355   27.373  -21.338 1.00 19.55 ? 291  ASP A N     1 
ATOM   2424 C  CA    . ASP A 1 291 ? 2.143   28.565  -21.699 1.00 21.19 ? 291  ASP A CA    1 
ATOM   2425 C  C     . ASP A 1 291 ? 2.776   28.446  -23.085 1.00 20.27 ? 291  ASP A C     1 
ATOM   2426 O  O     . ASP A 1 291 ? 2.690   29.373  -23.898 1.00 18.41 ? 291  ASP A O     1 
ATOM   2427 C  CB    . ASP A 1 291 ? 3.263   28.829  -20.685 1.00 25.96 ? 291  ASP A CB    1 
ATOM   2428 C  CG    . ASP A 1 291 ? 2.802   29.630  -19.478 1.00 31.25 ? 291  ASP A CG    1 
ATOM   2429 O  OD1   . ASP A 1 291 ? 1.855   30.436  -19.586 1.00 35.24 ? 291  ASP A OD1   1 
ATOM   2430 O  OD2   . ASP A 1 291 ? 3.418   29.462  -18.409 1.00 38.91 ? 291  ASP A OD2   1 
ATOM   2431 N  N     . TYR A 1 292 ? 3.425   27.311  -23.342 1.00 19.91 ? 292  TYR A N     1 
ATOM   2432 C  CA    . TYR A 1 292 ? 4.092   27.093  -24.624 1.00 19.20 ? 292  TYR A CA    1 
ATOM   2433 C  C     . TYR A 1 292 ? 3.082   27.070  -25.775 1.00 17.45 ? 292  TYR A C     1 
ATOM   2434 O  O     . TYR A 1 292 ? 3.266   27.748  -26.790 1.00 15.70 ? 292  TYR A O     1 
ATOM   2435 C  CB    . TYR A 1 292 ? 4.933   25.808  -24.621 1.00 19.71 ? 292  TYR A CB    1 
ATOM   2436 C  CG    . TYR A 1 292 ? 5.860   25.723  -25.812 1.00 23.21 ? 292  TYR A CG    1 
ATOM   2437 C  CD1   . TYR A 1 292 ? 5.403   25.245  -27.045 1.00 24.86 ? 292  TYR A CD1   1 
ATOM   2438 C  CD2   . TYR A 1 292 ? 7.185   26.152  -25.721 1.00 28.52 ? 292  TYR A CD2   1 
ATOM   2439 C  CE1   . TYR A 1 292 ? 6.243   25.191  -28.152 1.00 28.01 ? 292  TYR A CE1   1 
ATOM   2440 C  CE2   . TYR A 1 292 ? 8.037   26.091  -26.823 1.00 29.21 ? 292  TYR A CE2   1 
ATOM   2441 C  CZ    . TYR A 1 292 ? 7.555   25.612  -28.032 1.00 30.42 ? 292  TYR A CZ    1 
ATOM   2442 O  OH    . TYR A 1 292 ? 8.382   25.551  -29.126 1.00 35.00 ? 292  TYR A OH    1 
ATOM   2443 N  N     . ILE A 1 293 ? 2.019   26.291  -25.608 1.00 16.11 ? 293  ILE A N     1 
ATOM   2444 C  CA    . ILE A 1 293 ? 1.043   26.105  -26.679 1.00 14.20 ? 293  ILE A CA    1 
ATOM   2445 C  C     . ILE A 1 293 ? 0.258   27.398  -26.937 1.00 14.69 ? 293  ILE A C     1 
ATOM   2446 O  O     . ILE A 1 293 ? -0.029  27.733  -28.091 1.00 13.65 ? 293  ILE A O     1 
ATOM   2447 C  CB    . ILE A 1 293 ? 0.114   24.888  -26.405 1.00 13.19 ? 293  ILE A CB    1 
ATOM   2448 C  CG1   . ILE A 1 293 ? 0.930   23.584  -26.301 1.00 11.37 ? 293  ILE A CG1   1 
ATOM   2449 C  CG2   . ILE A 1 293 ? -0.980  24.763  -27.472 1.00 8.96  ? 293  ILE A CG2   1 
ATOM   2450 C  CD1   . ILE A 1 293 ? 1.732   23.204  -27.551 1.00 13.03 ? 293  ILE A CD1   1 
ATOM   2451 N  N     . SER A 1 294 ? -0.053  28.132  -25.869 1.00 14.73 ? 294  SER A N     1 
ATOM   2452 C  CA    . SER A 1 294 ? -0.745  29.419  -25.994 1.00 17.27 ? 294  SER A CA    1 
ATOM   2453 C  C     . SER A 1 294 ? 0.093   30.441  -26.745 1.00 17.00 ? 294  SER A C     1 
ATOM   2454 O  O     . SER A 1 294 ? -0.441  31.193  -27.550 1.00 18.51 ? 294  SER A O     1 
ATOM   2455 C  CB    . SER A 1 294 ? -1.137  29.981  -24.625 1.00 17.33 ? 294  SER A CB    1 
ATOM   2456 O  OG    . SER A 1 294 ? -2.194  29.227  -24.072 1.00 20.07 ? 294  SER A OG    1 
ATOM   2457 N  N     . GLU A 1 295 ? 1.399   30.471  -26.477 1.00 18.11 ? 295  GLU A N     1 
ATOM   2458 C  CA    . GLU A 1 295 ? 2.317   31.338  -27.216 1.00 19.53 ? 295  GLU A CA    1 
ATOM   2459 C  C     . GLU A 1 295 ? 2.398   30.931  -28.690 1.00 17.51 ? 295  GLU A C     1 
ATOM   2460 O  O     . GLU A 1 295 ? 2.326   31.782  -29.580 1.00 15.82 ? 295  GLU A O     1 
ATOM   2461 C  CB    . GLU A 1 295 ? 3.705   31.365  -26.547 1.00 23.00 ? 295  GLU A CB    1 
ATOM   2462 C  CG    . GLU A 1 295 ? 4.918   31.496  -27.496 1.00 33.09 ? 295  GLU A CG    1 
ATOM   2463 C  CD    . GLU A 1 295 ? 5.068   32.867  -28.146 1.00 41.50 ? 295  GLU A CD    1 
ATOM   2464 O  OE1   . GLU A 1 295 ? 4.430   33.839  -27.683 1.00 46.84 ? 295  GLU A OE1   1 
ATOM   2465 O  OE2   . GLU A 1 295 ? 5.842   32.970  -29.125 1.00 45.78 ? 295  GLU A OE2   1 
ATOM   2466 N  N     . PHE A 1 296 ? 2.527   29.629  -28.941 1.00 16.35 ? 296  PHE A N     1 
ATOM   2467 C  CA    . PHE A 1 296 ? 2.576   29.114  -30.309 1.00 15.85 ? 296  PHE A CA    1 
ATOM   2468 C  C     . PHE A 1 296 ? 1.308   29.453  -31.104 1.00 14.97 ? 296  PHE A C     1 
ATOM   2469 O  O     . PHE A 1 296 ? 1.393   29.917  -32.240 1.00 15.48 ? 296  PHE A O     1 
ATOM   2470 C  CB    . PHE A 1 296 ? 2.805   27.594  -30.320 1.00 13.94 ? 296  PHE A CB    1 
ATOM   2471 C  CG    . PHE A 1 296 ? 2.902   27.007  -31.708 1.00 17.78 ? 296  PHE A CG    1 
ATOM   2472 C  CD1   . PHE A 1 296 ? 4.133   26.912  -32.352 1.00 19.67 ? 296  PHE A CD1   1 
ATOM   2473 C  CD2   . PHE A 1 296 ? 1.761   26.555  -32.373 1.00 19.21 ? 296  PHE A CD2   1 
ATOM   2474 C  CE1   . PHE A 1 296 ? 4.229   26.371  -33.638 1.00 19.76 ? 296  PHE A CE1   1 
ATOM   2475 C  CE2   . PHE A 1 296 ? 1.842   26.021  -33.659 1.00 21.48 ? 296  PHE A CE2   1 
ATOM   2476 C  CZ    . PHE A 1 296 ? 3.080   25.932  -34.297 1.00 21.92 ? 296  PHE A CZ    1 
ATOM   2477 N  N     . GLU A 1 297 ? 0.146   29.220  -30.494 1.00 14.48 ? 297  GLU A N     1 
ATOM   2478 C  CA    . GLU A 1 297 ? -1.148  29.326  -31.181 1.00 14.58 ? 297  GLU A CA    1 
ATOM   2479 C  C     . GLU A 1 297 ? -1.686  30.755  -31.280 1.00 16.75 ? 297  GLU A C     1 
ATOM   2480 O  O     . GLU A 1 297 ? -2.294  31.124  -32.288 1.00 14.87 ? 297  GLU A O     1 
ATOM   2481 C  CB    . GLU A 1 297 ? -2.196  28.447  -30.475 1.00 14.31 ? 297  GLU A CB    1 
ATOM   2482 C  CG    . GLU A 1 297 ? -1.978  26.935  -30.613 1.00 13.47 ? 297  GLU A CG    1 
ATOM   2483 C  CD    . GLU A 1 297 ? -2.113  26.443  -32.044 1.00 14.78 ? 297  GLU A CD    1 
ATOM   2484 O  OE1   . GLU A 1 297 ? -2.969  26.983  -32.779 1.00 13.90 ? 297  GLU A OE1   1 
ATOM   2485 O  OE2   . GLU A 1 297 ? -1.362  25.511  -32.438 1.00 12.26 ? 297  GLU A OE2   1 
ATOM   2486 N  N     . LEU A 1 298 ? -1.470  31.541  -30.225 1.00 16.91 ? 298  LEU A N     1 
ATOM   2487 C  CA    . LEU A 1 298 ? -2.122  32.841  -30.064 1.00 20.47 ? 298  LEU A CA    1 
ATOM   2488 C  C     . LEU A 1 298 ? -1.160  34.032  -30.020 1.00 21.56 ? 298  LEU A C     1 
ATOM   2489 O  O     . LEU A 1 298 ? -1.597  35.182  -30.045 1.00 22.36 ? 298  LEU A O     1 
ATOM   2490 C  CB    . LEU A 1 298 ? -2.980  32.835  -28.786 1.00 20.69 ? 298  LEU A CB    1 
ATOM   2491 C  CG    . LEU A 1 298 ? -3.935  31.656  -28.560 1.00 20.80 ? 298  LEU A CG    1 
ATOM   2492 C  CD1   . LEU A 1 298 ? -4.444  31.657  -27.126 1.00 21.81 ? 298  LEU A CD1   1 
ATOM   2493 C  CD2   . LEU A 1 298 ? -5.090  31.690  -29.556 1.00 21.81 ? 298  LEU A CD2   1 
ATOM   2494 N  N     . ASN A 1 299 ? 0.140   33.755  -29.949 1.00 24.53 ? 299  ASN A N     1 
ATOM   2495 C  CA    . ASN A 1 299 ? 1.158   34.805  -29.814 1.00 28.75 ? 299  ASN A CA    1 
ATOM   2496 C  C     . ASN A 1 299 ? 0.930   35.663  -28.562 1.00 30.97 ? 299  ASN A C     1 
ATOM   2497 O  O     . ASN A 1 299 ? 1.099   36.884  -28.585 1.00 32.23 ? 299  ASN A O     1 
ATOM   2498 C  CB    . ASN A 1 299 ? 1.239   35.670  -31.085 1.00 30.21 ? 299  ASN A CB    1 
ATOM   2499 C  CG    . ASN A 1 299 ? 2.519   36.494  -31.162 1.00 35.48 ? 299  ASN A CG    1 
ATOM   2500 O  OD1   . ASN A 1 299 ? 3.578   36.078  -30.681 1.00 39.16 ? 299  ASN A OD1   1 
ATOM   2501 N  ND2   . ASN A 1 299 ? 2.423   37.671  -31.768 1.00 35.67 ? 299  ASN A ND2   1 
ATOM   2502 N  N     . VAL A 1 300 ? 0.522   35.012  -27.477 1.00 31.25 ? 300  VAL A N     1 
ATOM   2503 C  CA    . VAL A 1 300 ? 0.404   35.674  -26.183 1.00 32.75 ? 300  VAL A CA    1 
ATOM   2504 C  C     . VAL A 1 300 ? 1.599   35.282  -25.320 1.00 35.23 ? 300  VAL A C     1 
ATOM   2505 O  O     . VAL A 1 300 ? 2.092   34.153  -25.408 1.00 36.55 ? 300  VAL A O     1 
ATOM   2506 C  CB    . VAL A 1 300 ? -0.940  35.363  -25.470 1.00 32.07 ? 300  VAL A CB    1 
ATOM   2507 C  CG1   . VAL A 1 300 ? -2.104  36.002  -26.224 1.00 30.13 ? 300  VAL A CG1   1 
ATOM   2508 C  CG2   . VAL A 1 300 ? -1.159  33.852  -25.309 1.00 30.98 ? 300  VAL A CG2   1 
ATOM   2509 N  N     . GLY A 1 301 ? 2.072   36.222  -24.506 1.00 36.04 ? 301  GLY A N     1 
ATOM   2510 C  CA    . GLY A 1 301 ? 3.253   36.002  -23.671 1.00 36.71 ? 301  GLY A CA    1 
ATOM   2511 C  C     . GLY A 1 301 ? 2.980   35.094  -22.485 1.00 37.11 ? 301  GLY A C     1 
ATOM   2512 O  O     . GLY A 1 301 ? 1.836   34.954  -22.049 1.00 35.68 ? 301  GLY A O     1 
ATOM   2513 N  N     . LYS A 1 302 ? 4.043   34.475  -21.974 1.00 38.14 ? 302  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 302 ? 3.978   33.598  -20.804 1.00 39.38 ? 302  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 302 ? 3.359   34.332  -19.614 1.00 38.82 ? 302  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 302 ? 3.567   35.537  -19.444 1.00 37.88 ? 302  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 302 ? 5.390   33.120  -20.441 1.00 40.39 ? 302  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 302 ? 5.444   31.871  -19.572 1.00 44.23 ? 302  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 302 ? 6.870   31.552  -19.115 1.00 47.81 ? 302  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 302 ? 7.269   32.364  -17.885 1.00 48.73 ? 302  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 302 ? 8.705   32.183  -17.540 1.00 50.62 ? 302  LYS A NZ    1 
ATOM   2522 N  N     . LEU A 1 303 ? 2.588   33.611  -18.804 1.00 39.64 ? 303  LEU A N     1 
ATOM   2523 C  CA    . LEU A 1 303 ? 2.058   34.180  -17.568 1.00 39.29 ? 303  LEU A CA    1 
ATOM   2524 C  C     . LEU A 1 303 ? 3.183   34.306  -16.544 1.00 38.96 ? 303  LEU A C     1 
ATOM   2525 O  O     . LEU A 1 303 ? 3.594   33.315  -15.933 1.00 38.72 ? 303  LEU A O     1 
ATOM   2526 C  CB    . LEU A 1 303 ? 0.893   33.349  -17.017 1.00 39.24 ? 303  LEU A CB    1 
ATOM   2527 C  CG    . LEU A 1 303 ? -0.557  33.651  -17.440 1.00 39.87 ? 303  LEU A CG    1 
ATOM   2528 C  CD1   . LEU A 1 303 ? -0.734  35.023  -18.106 1.00 39.14 ? 303  LEU A CD1   1 
ATOM   2529 C  CD2   . LEU A 1 303 ? -1.134  32.548  -18.299 1.00 40.80 ? 303  LEU A CD2   1 
ATOM   2530 N  N     . LYS A 1 304 ? 3.675   35.531  -16.372 1.00 38.38 ? 304  LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 304 ? 4.854   35.799  -15.552 1.00 39.14 ? 304  LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 304 ? 4.518   35.968  -14.067 1.00 37.72 ? 304  LYS A C     1 
ATOM   2533 O  O     . LYS A 1 304 ? 3.565   36.666  -13.710 1.00 36.87 ? 304  LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 304 ? 5.580   37.041  -16.074 1.00 40.45 ? 304  LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 304 ? 7.061   37.102  -15.717 1.00 45.73 ? 304  LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 304 ? 7.682   38.447  -16.094 1.00 48.42 ? 304  LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 304 ? 7.456   39.498  -15.009 1.00 50.48 ? 304  LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 304 ? 7.973   40.840  -15.404 1.00 51.42 ? 304  LYS A NZ    1 
ATOM   2539 N  N     . TYR A 1 305 ? 5.303   35.309  -13.214 1.00 36.96 ? 305  TYR A N     1 
ATOM   2540 C  CA    . TYR A 1 305 ? 5.225   35.490  -11.760 1.00 35.15 ? 305  TYR A CA    1 
ATOM   2541 C  C     . TYR A 1 305 ? 6.571   35.227  -11.084 1.00 34.85 ? 305  TYR A C     1 
ATOM   2542 O  O     . TYR A 1 305 ? 7.410   34.501  -11.621 1.00 34.68 ? 305  TYR A O     1 
ATOM   2543 C  CB    . TYR A 1 305 ? 4.121   34.623  -11.135 1.00 35.47 ? 305  TYR A CB    1 
ATOM   2544 C  CG    . TYR A 1 305 ? 4.290   33.123  -11.301 1.00 35.94 ? 305  TYR A CG    1 
ATOM   2545 C  CD1   . TYR A 1 305 ? 5.016   32.373  -10.375 1.00 36.62 ? 305  TYR A CD1   1 
ATOM   2546 C  CD2   . TYR A 1 305 ? 3.700   32.452  -12.372 1.00 38.47 ? 305  TYR A CD2   1 
ATOM   2547 C  CE1   . TYR A 1 305 ? 5.163   30.994  -10.521 1.00 37.62 ? 305  TYR A CE1   1 
ATOM   2548 C  CE2   . TYR A 1 305 ? 3.839   31.072  -12.527 1.00 38.78 ? 305  TYR A CE2   1 
ATOM   2549 C  CZ    . TYR A 1 305 ? 4.571   30.352  -11.600 1.00 38.81 ? 305  TYR A CZ    1 
ATOM   2550 O  OH    . TYR A 1 305 ? 4.710   28.991  -11.755 1.00 40.10 ? 305  TYR A OH    1 
ATOM   2551 N  N     . ASP A 1 306 ? 6.762   35.821  -9.908  1.00 32.27 ? 306  ASP A N     1 
ATOM   2552 C  CA    . ASP A 1 306 ? 7.991   35.665  -9.139  1.00 32.57 ? 306  ASP A CA    1 
ATOM   2553 C  C     . ASP A 1 306 ? 7.912   34.485  -8.172  1.00 31.81 ? 306  ASP A C     1 
ATOM   2554 O  O     . ASP A 1 306 ? 6.864   34.233  -7.569  1.00 29.10 ? 306  ASP A O     1 
ATOM   2555 C  CB    . ASP A 1 306 ? 8.295   36.948  -8.356  1.00 33.34 ? 306  ASP A CB    1 
ATOM   2556 C  CG    . ASP A 1 306 ? 8.449   38.168  -9.257  1.00 34.84 ? 306  ASP A CG    1 
ATOM   2557 O  OD1   . ASP A 1 306 ? 8.394   39.300  -8.728  1.00 35.05 ? 306  ASP A OD1   1 
ATOM   2558 O  OD2   . ASP A 1 306 ? 8.621   38.000  -10.485 1.00 35.16 ? 306  ASP A OD2   1 
ATOM   2559 N  N     . GLY A 1 307 ? 9.030   33.776  -8.028  1.00 31.41 ? 307  GLY A N     1 
ATOM   2560 C  CA    . GLY A 1 307 ? 9.129   32.642  -7.110  1.00 31.00 ? 307  GLY A CA    1 
ATOM   2561 C  C     . GLY A 1 307 ? 8.447   31.377  -7.610  1.00 31.12 ? 307  GLY A C     1 
ATOM   2562 O  O     . GLY A 1 307 ? 7.840   31.380  -8.684  1.00 31.83 ? 307  GLY A O     1 
ATOM   2563 N  N     . PRO A 1 308 ? 8.536   30.283  -6.827  1.00 30.51 ? 308  PRO A N     1 
ATOM   2564 C  CA    . PRO A 1 308 ? 7.939   29.006  -7.222  1.00 30.02 ? 308  PRO A CA    1 
ATOM   2565 C  C     . PRO A 1 308 ? 6.417   28.997  -7.066  1.00 29.54 ? 308  PRO A C     1 
ATOM   2566 O  O     . PRO A 1 308 ? 5.867   29.773  -6.276  1.00 27.90 ? 308  PRO A O     1 
ATOM   2567 C  CB    . PRO A 1 308 ? 8.588   28.008  -6.260  1.00 29.70 ? 308  PRO A CB    1 
ATOM   2568 C  CG    . PRO A 1 308 ? 8.905   28.805  -5.050  1.00 30.73 ? 308  PRO A CG    1 
ATOM   2569 C  CD    . PRO A 1 308 ? 9.225   30.194  -5.524  1.00 30.24 ? 308  PRO A CD    1 
ATOM   2570 N  N     . ILE A 1 309 ? 5.749   28.123  -7.815  1.00 29.50 ? 309  ILE A N     1 
ATOM   2571 C  CA    . ILE A 1 309 ? 4.288   28.027  -7.782  1.00 29.87 ? 309  ILE A CA    1 
ATOM   2572 C  C     . ILE A 1 309 ? 3.770   27.654  -6.377  1.00 28.83 ? 309  ILE A C     1 
ATOM   2573 O  O     . ILE A 1 309 ? 2.688   28.084  -5.974  1.00 28.26 ? 309  ILE A O     1 
ATOM   2574 C  CB    . ILE A 1 309 ? 3.749   27.069  -8.903  1.00 31.67 ? 309  ILE A CB    1 
ATOM   2575 C  CG1   . ILE A 1 309 ? 2.273   27.361  -9.241  1.00 32.76 ? 309  ILE A CG1   1 
ATOM   2576 C  CG2   . ILE A 1 309 ? 4.045   25.591  -8.590  1.00 32.96 ? 309  ILE A CG2   1 
ATOM   2577 C  CD1   . ILE A 1 309 ? 1.240   26.650  -8.374  1.00 36.21 ? 309  ILE A CD1   1 
ATOM   2578 N  N     . SER A 1 310 ? 4.571   26.889  -5.635  1.00 26.97 ? 310  SER A N     1 
ATOM   2579 C  CA    . SER A 1 310 ? 4.243   26.477  -4.269  1.00 28.01 ? 310  SER A CA    1 
ATOM   2580 C  C     . SER A 1 310 ? 4.135   27.652  -3.296  1.00 27.84 ? 310  SER A C     1 
ATOM   2581 O  O     . SER A 1 310 ? 3.554   27.519  -2.218  1.00 28.13 ? 310  SER A O     1 
ATOM   2582 C  CB    . SER A 1 310 ? 5.286   25.479  -3.754  1.00 28.27 ? 310  SER A CB    1 
ATOM   2583 O  OG    . SER A 1 310 ? 6.540   26.111  -3.548  1.00 29.96 ? 310  SER A OG    1 
ATOM   2584 N  N     . LYS A 1 311 ? 4.705   28.793  -3.677  1.00 26.56 ? 311  LYS A N     1 
ATOM   2585 C  CA    . LYS A 1 311 ? 4.693   29.982  -2.832  1.00 25.60 ? 311  LYS A CA    1 
ATOM   2586 C  C     . LYS A 1 311 ? 3.894   31.138  -3.440  1.00 23.70 ? 311  LYS A C     1 
ATOM   2587 O  O     . LYS A 1 311 ? 3.791   32.208  -2.838  1.00 23.51 ? 311  LYS A O     1 
ATOM   2588 C  CB    . LYS A 1 311 ? 6.127   30.412  -2.497  1.00 26.65 ? 311  LYS A CB    1 
ATOM   2589 C  CG    . LYS A 1 311 ? 6.823   29.478  -1.507  1.00 29.26 ? 311  LYS A CG    1 
ATOM   2590 C  CD    . LYS A 1 311 ? 8.316   29.736  -1.411  1.00 33.48 ? 311  LYS A CD    1 
ATOM   2591 C  CE    . LYS A 1 311 ? 8.996   28.640  -0.589  1.00 37.06 ? 311  LYS A CE    1 
ATOM   2592 N  NZ    . LYS A 1 311 ? 10.482  28.767  -0.578  1.00 40.33 ? 311  LYS A NZ    1 
ATOM   2593 N  N     . LEU A 1 312 ? 3.312   30.914  -4.618  1.00 21.56 ? 312  LEU A N     1 
ATOM   2594 C  CA    . LEU A 1 312 ? 2.586   31.973  -5.319  1.00 20.05 ? 312  LEU A CA    1 
ATOM   2595 C  C     . LEU A 1 312 ? 1.304   32.403  -4.601  1.00 19.57 ? 312  LEU A C     1 
ATOM   2596 O  O     . LEU A 1 312 ? 1.021   33.596  -4.503  1.00 18.22 ? 312  LEU A O     1 
ATOM   2597 C  CB    . LEU A 1 312 ? 2.300   31.594  -6.782  1.00 19.90 ? 312  LEU A CB    1 
ATOM   2598 C  CG    . LEU A 1 312 ? 1.611   32.663  -7.646  1.00 21.49 ? 312  LEU A CG    1 
ATOM   2599 C  CD1   . LEU A 1 312 ? 2.444   33.947  -7.743  1.00 23.02 ? 312  LEU A CD1   1 
ATOM   2600 C  CD2   . LEU A 1 312 ? 1.272   32.138  -9.041  1.00 21.82 ? 312  LEU A CD2   1 
ATOM   2601 N  N     . ARG A 1 313 ? 0.536   31.442  -4.092  1.00 19.61 ? 313  ARG A N     1 
ATOM   2602 C  CA    . ARG A 1 313 ? -0.695  31.773  -3.382  1.00 18.84 ? 313  ARG A CA    1 
ATOM   2603 C  C     . ARG A 1 313 ? -0.423  32.654  -2.157  1.00 18.87 ? 313  ARG A C     1 
ATOM   2604 O  O     . ARG A 1 313 ? -1.082  33.675  -1.973  1.00 19.32 ? 313  ARG A O     1 
ATOM   2605 C  CB    . ARG A 1 313 ? -1.475  30.512  -2.983  1.00 17.86 ? 313  ARG A CB    1 
ATOM   2606 C  CG    . ARG A 1 313 ? -2.802  30.817  -2.303  1.00 17.58 ? 313  ARG A CG    1 
ATOM   2607 C  CD    . ARG A 1 313 ? -3.515  29.546  -1.848  1.00 16.31 ? 313  ARG A CD    1 
ATOM   2608 N  NE    . ARG A 1 313 ? -4.689  29.856  -1.037  1.00 17.38 ? 313  ARG A NE    1 
ATOM   2609 C  CZ    . ARG A 1 313 ? -4.679  29.962  0.297   1.00 21.83 ? 313  ARG A CZ    1 
ATOM   2610 N  NH1   . ARG A 1 313 ? -3.556  29.778  0.984   1.00 19.00 ? 313  ARG A NH1   1 
ATOM   2611 N  NH2   . ARG A 1 313 ? -5.798  30.251  0.949   1.00 19.11 ? 313  ARG A NH2   1 
ATOM   2612 N  N     . GLU A 1 314 ? 0.548   32.267  -1.333  1.00 19.43 ? 314  GLU A N     1 
ATOM   2613 C  CA    . GLU A 1 314 ? 0.871   33.036  -0.129  1.00 20.41 ? 314  GLU A CA    1 
ATOM   2614 C  C     . GLU A 1 314 ? 1.471   34.415  -0.443  1.00 20.62 ? 314  GLU A C     1 
ATOM   2615 O  O     . GLU A 1 314 ? 1.091   35.413  0.177   1.00 18.49 ? 314  GLU A O     1 
ATOM   2616 C  CB    . GLU A 1 314 ? 1.759   32.231  0.842   1.00 22.58 ? 314  GLU A CB    1 
ATOM   2617 C  CG    . GLU A 1 314 ? 3.035   31.634  0.238   1.00 26.77 ? 314  GLU A CG    1 
ATOM   2618 C  CD    . GLU A 1 314 ? 3.734   30.657  1.174   1.00 30.78 ? 314  GLU A CD    1 
ATOM   2619 O  OE1   . GLU A 1 314 ? 4.465   31.116  2.079   1.00 30.97 ? 314  GLU A OE1   1 
ATOM   2620 O  OE2   . GLU A 1 314 ? 3.556   29.427  1.000   1.00 32.05 ? 314  GLU A OE2   1 
ATOM   2621 N  N     . SER A 1 315 ? 2.379   34.469  -1.416  1.00 19.54 ? 315  SER A N     1 
ATOM   2622 C  CA    . SER A 1 315 ? 3.061   35.718  -1.765  1.00 19.39 ? 315  SER A CA    1 
ATOM   2623 C  C     . SER A 1 315 ? 2.203   36.656  -2.621  1.00 18.60 ? 315  SER A C     1 
ATOM   2624 O  O     . SER A 1 315 ? 2.269   37.877  -2.466  1.00 18.64 ? 315  SER A O     1 
ATOM   2625 C  CB    . SER A 1 315 ? 4.391   35.432  -2.468  1.00 20.29 ? 315  SER A CB    1 
ATOM   2626 O  OG    . SER A 1 315 ? 4.192   34.701  -3.666  1.00 21.96 ? 315  SER A OG    1 
ATOM   2627 N  N     . ASN A 1 316 ? 1.403   36.085  -3.522  1.00 16.53 ? 316  ASN A N     1 
ATOM   2628 C  CA    . ASN A 1 316 ? 0.599   36.881  -4.457  1.00 15.75 ? 316  ASN A CA    1 
ATOM   2629 C  C     . ASN A 1 316 ? -0.686  36.162  -4.865  1.00 15.51 ? 316  ASN A C     1 
ATOM   2630 O  O     . ASN A 1 316 ? -0.869  35.772  -6.026  1.00 14.51 ? 316  ASN A O     1 
ATOM   2631 C  CB    . ASN A 1 316 ? 1.425   37.271  -5.691  1.00 16.12 ? 316  ASN A CB    1 
ATOM   2632 C  CG    . ASN A 1 316 ? 0.868   38.493  -6.414  1.00 16.43 ? 316  ASN A CG    1 
ATOM   2633 O  OD1   . ASN A 1 316 ? -0.304  38.837  -6.277  1.00 19.00 ? 316  ASN A OD1   1 
ATOM   2634 N  ND2   . ASN A 1 316 ? 1.713   39.149  -7.194  1.00 18.97 ? 316  ASN A ND2   1 
ATOM   2635 N  N     . HIS A 1 317 ? -1.568  35.987  -3.886  1.00 15.34 ? 317  HIS A N     1 
ATOM   2636 C  CA    . HIS A 1 317 ? -2.877  35.382  -4.096  1.00 15.20 ? 317  HIS A CA    1 
ATOM   2637 C  C     . HIS A 1 317 ? -3.659  36.068  -5.214  1.00 15.38 ? 317  HIS A C     1 
ATOM   2638 O  O     . HIS A 1 317 ? -4.339  35.403  -5.994  1.00 16.75 ? 317  HIS A O     1 
ATOM   2639 C  CB    . HIS A 1 317 ? -3.680  35.402  -2.792  1.00 14.49 ? 317  HIS A CB    1 
ATOM   2640 C  CG    . HIS A 1 317 ? -5.084  34.909  -2.940  1.00 14.33 ? 317  HIS A CG    1 
ATOM   2641 N  ND1   . HIS A 1 317 ? -6.180  35.726  -2.766  1.00 14.71 ? 317  HIS A ND1   1 
ATOM   2642 C  CD2   . HIS A 1 317 ? -5.572  33.686  -3.254  1.00 14.09 ? 317  HIS A CD2   1 
ATOM   2643 C  CE1   . HIS A 1 317 ? -7.284  35.025  -2.958  1.00 14.73 ? 317  HIS A CE1   1 
ATOM   2644 N  NE2   . HIS A 1 317 ? -6.943  33.784  -3.252  1.00 13.69 ? 317  HIS A NE2   1 
ATOM   2645 N  N     . GLN A 1 318 ? -3.557  37.394  -5.289  1.00 15.51 ? 318  GLN A N     1 
ATOM   2646 C  CA    . GLN A 1 318 ? -4.176  38.160  -6.367  1.00 16.04 ? 318  GLN A CA    1 
ATOM   2647 C  C     . GLN A 1 318 ? -3.823  37.584  -7.747  1.00 15.61 ? 318  GLN A C     1 
ATOM   2648 O  O     . GLN A 1 318 ? -4.714  37.235  -8.532  1.00 14.49 ? 318  GLN A O     1 
ATOM   2649 C  CB    . GLN A 1 318 ? -3.756  39.634  -6.277  1.00 17.40 ? 318  GLN A CB    1 
ATOM   2650 C  CG    . GLN A 1 318 ? -4.268  40.508  -7.422  1.00 14.88 ? 318  GLN A CG    1 
ATOM   2651 C  CD    . GLN A 1 318 ? -5.791  40.614  -7.457  1.00 17.70 ? 318  GLN A CD    1 
ATOM   2652 O  OE1   . GLN A 1 318 ? -6.446  40.706  -6.419  1.00 17.76 ? 318  GLN A OE1   1 
ATOM   2653 N  NE2   . GLN A 1 318 ? -6.356  40.595  -8.658  1.00 14.55 ? 318  GLN A NE2   1 
ATOM   2654 N  N     . ARG A 1 319 ? -2.525  37.473  -8.027  1.00 15.52 ? 319  ARG A N     1 
ATOM   2655 C  CA    . ARG A 1 319 ? -2.056  36.936  -9.303  1.00 16.88 ? 319  ARG A CA    1 
ATOM   2656 C  C     . ARG A 1 319 ? -2.433  35.456  -9.464  1.00 17.23 ? 319  ARG A C     1 
ATOM   2657 O  O     . ARG A 1 319 ? -2.851  35.026  -10.546 1.00 17.19 ? 319  ARG A O     1 
ATOM   2658 C  CB    . ARG A 1 319 ? -0.545  37.149  -9.455  1.00 17.98 ? 319  ARG A CB    1 
ATOM   2659 C  CG    . ARG A 1 319 ? 0.026   36.642  -10.769 1.00 21.88 ? 319  ARG A CG    1 
ATOM   2660 C  CD    . ARG A 1 319 ? 1.194   37.488  -11.225 1.00 27.57 ? 319  ARG A CD    1 
ATOM   2661 N  NE    . ARG A 1 319 ? 0.763   38.825  -11.629 1.00 32.08 ? 319  ARG A NE    1 
ATOM   2662 C  CZ    . ARG A 1 319 ? 1.550   39.726  -12.209 1.00 33.79 ? 319  ARG A CZ    1 
ATOM   2663 N  NH1   . ARG A 1 319 ? 2.823   39.441  -12.469 1.00 34.01 ? 319  ARG A NH1   1 
ATOM   2664 N  NH2   . ARG A 1 319 ? 1.061   40.915  -12.534 1.00 32.17 ? 319  ARG A NH2   1 
ATOM   2665 N  N     . TYR A 1 320 ? -2.298  34.703  -8.374  1.00 15.58 ? 320  TYR A N     1 
ATOM   2666 C  CA    . TYR A 1 320 ? -2.616  33.269  -8.316  1.00 15.20 ? 320  TYR A CA    1 
ATOM   2667 C  C     . TYR A 1 320 ? -4.002  32.952  -8.893  1.00 14.97 ? 320  TYR A C     1 
ATOM   2668 O  O     . TYR A 1 320 ? -4.145  32.059  -9.734  1.00 13.41 ? 320  TYR A O     1 
ATOM   2669 C  CB    . TYR A 1 320 ? -2.523  32.818  -6.859  1.00 15.45 ? 320  TYR A CB    1 
ATOM   2670 C  CG    . TYR A 1 320 ? -2.595  31.330  -6.591  1.00 15.66 ? 320  TYR A CG    1 
ATOM   2671 C  CD1   . TYR A 1 320 ? -1.507  30.501  -6.861  1.00 15.15 ? 320  TYR A CD1   1 
ATOM   2672 C  CD2   . TYR A 1 320 ? -3.734  30.762  -6.011  1.00 14.18 ? 320  TYR A CD2   1 
ATOM   2673 C  CE1   . TYR A 1 320 ? -1.556  29.129  -6.584  1.00 15.19 ? 320  TYR A CE1   1 
ATOM   2674 C  CE2   . TYR A 1 320 ? -3.793  29.392  -5.727  1.00 14.50 ? 320  TYR A CE2   1 
ATOM   2675 C  CZ    . TYR A 1 320 ? -2.697  28.587  -6.012  1.00 14.93 ? 320  TYR A CZ    1 
ATOM   2676 O  OH    . TYR A 1 320 ? -2.737  27.239  -5.727  1.00 17.20 ? 320  TYR A OH    1 
ATOM   2677 N  N     . ILE A 1 321 ? -5.008  33.708  -8.455  1.00 13.30 ? 321  ILE A N     1 
ATOM   2678 C  CA    . ILE A 1 321 ? -6.379  33.534  -8.931  1.00 13.95 ? 321  ILE A CA    1 
ATOM   2679 C  C     . ILE A 1 321 ? -6.562  34.025  -10.371 1.00 14.70 ? 321  ILE A C     1 
ATOM   2680 O  O     . ILE A 1 321 ? -7.181  33.343  -11.188 1.00 14.45 ? 321  ILE A O     1 
ATOM   2681 C  CB    . ILE A 1 321 ? -7.401  34.206  -7.978  1.00 13.84 ? 321  ILE A CB    1 
ATOM   2682 C  CG1   . ILE A 1 321 ? -7.336  33.573  -6.576  1.00 14.05 ? 321  ILE A CG1   1 
ATOM   2683 C  CG2   . ILE A 1 321 ? -8.828  34.151  -8.554  1.00 14.97 ? 321  ILE A CG2   1 
ATOM   2684 C  CD1   . ILE A 1 321 ? -7.574  32.056  -6.527  1.00 16.44 ? 321  ILE A CD1   1 
ATOM   2685 N  N     . SER A 1 322 ? -6.027  35.203  -10.678 1.00 14.03 ? 322  SER A N     1 
ATOM   2686 C  CA    . SER A 1 322 ? -6.094  35.729  -12.039 1.00 15.51 ? 322  SER A CA    1 
ATOM   2687 C  C     . SER A 1 322 ? -5.501  34.758  -13.056 1.00 14.81 ? 322  SER A C     1 
ATOM   2688 O  O     . SER A 1 322 ? -6.051  34.584  -14.141 1.00 14.10 ? 322  SER A O     1 
ATOM   2689 C  CB    . SER A 1 322 ? -5.387  37.076  -12.128 1.00 13.99 ? 322  SER A CB    1 
ATOM   2690 O  OG    . SER A 1 322 ? -6.151  38.069  -11.469 1.00 15.99 ? 322  SER A OG    1 
ATOM   2691 N  N     . TYR A 1 323 ? -4.394  34.120  -12.690 1.00 13.74 ? 323  TYR A N     1 
ATOM   2692 C  CA    . TYR A 1 323 ? -3.704  33.205  -13.591 1.00 16.31 ? 323  TYR A CA    1 
ATOM   2693 C  C     . TYR A 1 323 ? -4.472  31.905  -13.781 1.00 15.93 ? 323  TYR A C     1 
ATOM   2694 O  O     . TYR A 1 323 ? -4.443  31.323  -14.866 1.00 14.49 ? 323  TYR A O     1 
ATOM   2695 C  CB    . TYR A 1 323 ? -2.266  32.964  -13.125 1.00 19.06 ? 323  TYR A CB    1 
ATOM   2696 C  CG    . TYR A 1 323 ? -1.321  34.074  -13.561 1.00 25.05 ? 323  TYR A CG    1 
ATOM   2697 C  CD1   . TYR A 1 323 ? 0.060   33.917  -13.479 1.00 27.49 ? 323  TYR A CD1   1 
ATOM   2698 C  CD2   . TYR A 1 323 ? -1.818  35.279  -14.076 1.00 27.34 ? 323  TYR A CD2   1 
ATOM   2699 C  CE1   . TYR A 1 323 ? 0.921   34.936  -13.883 1.00 29.97 ? 323  TYR A CE1   1 
ATOM   2700 C  CE2   . TYR A 1 323 ? -0.968  36.299  -14.483 1.00 28.57 ? 323  TYR A CE2   1 
ATOM   2701 C  CZ    . TYR A 1 323 ? 0.397   36.121  -14.388 1.00 29.39 ? 323  TYR A CZ    1 
ATOM   2702 O  OH    . TYR A 1 323 ? 1.233   37.133  -14.794 1.00 31.55 ? 323  TYR A OH    1 
ATOM   2703 N  N     . ASN A 1 324 ? -5.165  31.470  -12.730 1.00 13.71 ? 324  ASN A N     1 
ATOM   2704 C  CA    . ASN A 1 324 ? -6.078  30.331  -12.820 1.00 14.83 ? 324  ASN A CA    1 
ATOM   2705 C  C     . ASN A 1 324 ? -7.203  30.627  -13.813 1.00 13.76 ? 324  ASN A C     1 
ATOM   2706 O  O     . ASN A 1 324 ? -7.537  29.782  -14.645 1.00 12.31 ? 324  ASN A O     1 
ATOM   2707 C  CB    . ASN A 1 324 ? -6.632  29.977  -11.434 1.00 14.79 ? 324  ASN A CB    1 
ATOM   2708 C  CG    . ASN A 1 324 ? -7.622  28.815  -11.461 1.00 18.53 ? 324  ASN A CG    1 
ATOM   2709 O  OD1   . ASN A 1 324 ? -8.748  28.952  -10.995 1.00 19.11 ? 324  ASN A OD1   1 
ATOM   2710 N  ND2   . ASN A 1 324 ? -7.197  27.666  -11.987 1.00 19.22 ? 324  ASN A ND2   1 
ATOM   2711 N  N     . ILE A 1 325 ? -7.753  31.841  -13.741 1.00 12.63 ? 325  ILE A N     1 
ATOM   2712 C  CA    . ILE A 1 325 ? -8.811  32.288  -14.659 1.00 12.91 ? 325  ILE A CA    1 
ATOM   2713 C  C     . ILE A 1 325 ? -8.306  32.367  -16.105 1.00 13.82 ? 325  ILE A C     1 
ATOM   2714 O  O     . ILE A 1 325 ? -8.932  31.824  -17.015 1.00 11.61 ? 325  ILE A O     1 
ATOM   2715 C  CB    . ILE A 1 325 ? -9.418  33.659  -14.223 1.00 13.30 ? 325  ILE A CB    1 
ATOM   2716 C  CG1   . ILE A 1 325 ? -10.093 33.532  -12.852 1.00 13.54 ? 325  ILE A CG1   1 
ATOM   2717 C  CG2   . ILE A 1 325 ? -10.425 34.180  -15.273 1.00 13.38 ? 325  ILE A CG2   1 
ATOM   2718 C  CD1   . ILE A 1 325 ? -10.363 34.872  -12.154 1.00 13.48 ? 325  ILE A CD1   1 
ATOM   2719 N  N     . ILE A 1 326 ? -7.177  33.048  -16.309 1.00 13.50 ? 326  ILE A N     1 
ATOM   2720 C  CA    . ILE A 1 326 ? -6.617  33.235  -17.658 1.00 14.53 ? 326  ILE A CA    1 
ATOM   2721 C  C     . ILE A 1 326 ? -6.264  31.895  -18.311 1.00 14.57 ? 326  ILE A C     1 
ATOM   2722 O  O     . ILE A 1 326 ? -6.482  31.715  -19.505 1.00 16.44 ? 326  ILE A O     1 
ATOM   2723 C  CB    . ILE A 1 326 ? -5.406  34.214  -17.651 1.00 13.13 ? 326  ILE A CB    1 
ATOM   2724 C  CG1   . ILE A 1 326 ? -5.869  35.618  -17.224 1.00 13.57 ? 326  ILE A CG1   1 
ATOM   2725 C  CG2   . ILE A 1 326 ? -4.728  34.284  -19.040 1.00 13.50 ? 326  ILE A CG2   1 
ATOM   2726 C  CD1   . ILE A 1 326 ? -4.737  36.590  -16.856 1.00 14.00 ? 326  ILE A CD1   1 
ATOM   2727 N  N     . ALA A 1 327 ? -5.756  30.954  -17.514 1.00 15.44 ? 327  ALA A N     1 
ATOM   2728 C  CA    . ALA A 1 327 ? -5.447  29.605  -17.995 1.00 15.83 ? 327  ALA A CA    1 
ATOM   2729 C  C     . ALA A 1 327 ? -6.664  28.909  -18.608 1.00 17.36 ? 327  ALA A C     1 
ATOM   2730 O  O     . ALA A 1 327 ? -6.560  28.285  -19.670 1.00 15.35 ? 327  ALA A O     1 
ATOM   2731 C  CB    . ALA A 1 327 ? -4.860  28.762  -16.879 1.00 16.90 ? 327  ALA A CB    1 
ATOM   2732 N  N     . VAL A 1 328 ? -7.817  29.020  -17.949 1.00 15.78 ? 328  VAL A N     1 
ATOM   2733 C  CA    . VAL A 1 328 ? -9.053  28.438  -18.484 1.00 16.52 ? 328  VAL A CA    1 
ATOM   2734 C  C     . VAL A 1 328 ? -9.437  29.143  -19.789 1.00 16.32 ? 328  VAL A C     1 
ATOM   2735 O  O     . VAL A 1 328 ? -9.744  28.485  -20.785 1.00 15.89 ? 328  VAL A O     1 
ATOM   2736 C  CB    . VAL A 1 328 ? -10.213 28.490  -17.448 1.00 17.09 ? 328  VAL A CB    1 
ATOM   2737 C  CG1   . VAL A 1 328 ? -11.544 28.084  -18.084 1.00 18.17 ? 328  VAL A CG1   1 
ATOM   2738 C  CG2   . VAL A 1 328 ? -9.897  27.598  -16.251 1.00 17.34 ? 328  VAL A CG2   1 
ATOM   2739 N  N     . TYR A 1 329 ? -9.389  30.477  -19.783 1.00 15.37 ? 329  TYR A N     1 
ATOM   2740 C  CA    . TYR A 1 329 ? -9.703  31.269  -20.974 1.00 14.67 ? 329  TYR A CA    1 
ATOM   2741 C  C     . TYR A 1 329 ? -8.794  30.954  -22.172 1.00 14.10 ? 329  TYR A C     1 
ATOM   2742 O  O     . TYR A 1 329 ? -9.259  30.914  -23.312 1.00 12.12 ? 329  TYR A O     1 
ATOM   2743 C  CB    . TYR A 1 329 ? -9.668  32.771  -20.660 1.00 14.45 ? 329  TYR A CB    1 
ATOM   2744 C  CG    . TYR A 1 329 ? -10.086 33.662  -21.816 1.00 14.75 ? 329  TYR A CG    1 
ATOM   2745 C  CD1   . TYR A 1 329 ? -11.194 33.346  -22.605 1.00 16.81 ? 329  TYR A CD1   1 
ATOM   2746 C  CD2   . TYR A 1 329 ? -9.387  34.837  -22.105 1.00 17.04 ? 329  TYR A CD2   1 
ATOM   2747 C  CE1   . TYR A 1 329 ? -11.586 34.161  -23.656 1.00 16.62 ? 329  TYR A CE1   1 
ATOM   2748 C  CE2   . TYR A 1 329 ? -9.780  35.671  -23.163 1.00 17.03 ? 329  TYR A CE2   1 
ATOM   2749 C  CZ    . TYR A 1 329 ? -10.879 35.319  -23.930 1.00 18.57 ? 329  TYR A CZ    1 
ATOM   2750 O  OH    . TYR A 1 329 ? -11.286 36.120  -24.972 1.00 19.15 ? 329  TYR A OH    1 
ATOM   2751 N  N     . ARG A 1 330 ? -7.511  30.726  -21.916 1.00 14.25 ? 330  ARG A N     1 
ATOM   2752 C  CA    . ARG A 1 330 ? -6.568  30.423  -22.998 1.00 16.56 ? 330  ARG A CA    1 
ATOM   2753 C  C     . ARG A 1 330 ? -6.951  29.183  -23.814 1.00 16.10 ? 330  ARG A C     1 
ATOM   2754 O  O     . ARG A 1 330 ? -6.800  29.172  -25.036 1.00 14.42 ? 330  ARG A O     1 
ATOM   2755 C  CB    . ARG A 1 330 ? -5.126  30.346  -22.477 1.00 17.14 ? 330  ARG A CB    1 
ATOM   2756 C  CG    . ARG A 1 330 ? -4.532  31.728  -22.248 1.00 20.40 ? 330  ARG A CG    1 
ATOM   2757 C  CD    . ARG A 1 330 ? -3.103  31.683  -21.778 1.00 27.71 ? 330  ARG A CD    1 
ATOM   2758 N  NE    . ARG A 1 330 ? -2.492  33.011  -21.810 1.00 27.80 ? 330  ARG A NE    1 
ATOM   2759 C  CZ    . ARG A 1 330 ? -1.182  33.236  -21.735 1.00 30.33 ? 330  ARG A CZ    1 
ATOM   2760 N  NH1   . ARG A 1 330 ? -0.329  32.224  -21.618 1.00 29.05 ? 330  ARG A NH1   1 
ATOM   2761 N  NH2   . ARG A 1 330 ? -0.724  34.481  -21.779 1.00 31.32 ? 330  ARG A NH2   1 
ATOM   2762 N  N     . VAL A 1 331 ? -7.464  28.155  -23.148 1.00 14.95 ? 331  VAL A N     1 
ATOM   2763 C  CA    . VAL A 1 331 ? -7.943  26.962  -23.854 1.00 15.15 ? 331  VAL A CA    1 
ATOM   2764 C  C     . VAL A 1 331 ? -9.149  27.290  -24.744 1.00 15.60 ? 331  VAL A C     1 
ATOM   2765 O  O     . VAL A 1 331 ? -9.241  26.819  -25.882 1.00 15.92 ? 331  VAL A O     1 
ATOM   2766 C  CB    . VAL A 1 331 ? -8.284  25.815  -22.878 1.00 15.44 ? 331  VAL A CB    1 
ATOM   2767 C  CG1   . VAL A 1 331 ? -8.758  24.573  -23.640 1.00 17.03 ? 331  VAL A CG1   1 
ATOM   2768 C  CG2   . VAL A 1 331 ? -7.063  25.485  -22.006 1.00 14.42 ? 331  VAL A CG2   1 
ATOM   2769 N  N     . LEU A 1 332 ? -10.062 28.108  -24.229 1.00 13.20 ? 332  LEU A N     1 
ATOM   2770 C  CA    . LEU A 1 332 ? -11.179 28.599  -25.027 1.00 14.08 ? 332  LEU A CA    1 
ATOM   2771 C  C     . LEU A 1 332 ? -10.711 29.396  -26.243 1.00 14.21 ? 332  LEU A C     1 
ATOM   2772 O  O     . LEU A 1 332 ? -11.284 29.273  -27.322 1.00 13.81 ? 332  LEU A O     1 
ATOM   2773 C  CB    . LEU A 1 332 ? -12.136 29.443  -24.177 1.00 13.89 ? 332  LEU A CB    1 
ATOM   2774 C  CG    . LEU A 1 332 ? -12.877 28.703  -23.054 1.00 14.64 ? 332  LEU A CG    1 
ATOM   2775 C  CD1   . LEU A 1 332 ? -13.460 29.693  -22.063 1.00 16.64 ? 332  LEU A CD1   1 
ATOM   2776 C  CD2   . LEU A 1 332 ? -13.968 27.779  -23.614 1.00 14.00 ? 332  LEU A CD2   1 
ATOM   2777 N  N     . GLN A 1 333 ? -9.672  30.206  -26.062 1.00 15.33 ? 333  GLN A N     1 
ATOM   2778 C  CA    . GLN A 1 333 ? -9.107  30.987  -27.160 1.00 16.15 ? 333  GLN A CA    1 
ATOM   2779 C  C     . GLN A 1 333 ? -8.477  30.075  -28.217 1.00 14.75 ? 333  GLN A C     1 
ATOM   2780 O  O     . GLN A 1 333 ? -8.631  30.305  -29.419 1.00 13.40 ? 333  GLN A O     1 
ATOM   2781 C  CB    . GLN A 1 333 ? -8.078  31.987  -26.638 1.00 15.88 ? 333  GLN A CB    1 
ATOM   2782 C  CG    . GLN A 1 333 ? -8.681  33.109  -25.800 1.00 18.61 ? 333  GLN A CG    1 
ATOM   2783 C  CD    . GLN A 1 333 ? -7.635  34.080  -25.311 1.00 20.27 ? 333  GLN A CD    1 
ATOM   2784 O  OE1   . GLN A 1 333 ? -7.545  35.204  -25.799 1.00 26.53 ? 333  GLN A OE1   1 
ATOM   2785 N  NE2   . GLN A 1 333 ? -6.826  33.648  -24.353 1.00 19.58 ? 333  GLN A NE2   1 
ATOM   2786 N  N     . ILE A 1 334 ? -7.767  29.045  -27.767 1.00 14.77 ? 334  ILE A N     1 
ATOM   2787 C  CA    . ILE A 1 334 ? -7.187  28.067  -28.688 1.00 14.16 ? 334  ILE A CA    1 
ATOM   2788 C  C     . ILE A 1 334 ? -8.299  27.356  -29.474 1.00 13.32 ? 334  ILE A C     1 
ATOM   2789 O  O     . ILE A 1 334 ? -8.181  27.175  -30.694 1.00 11.66 ? 334  ILE A O     1 
ATOM   2790 C  CB    . ILE A 1 334 ? -6.256  27.064  -27.957 1.00 14.23 ? 334  ILE A CB    1 
ATOM   2791 C  CG1   . ILE A 1 334 ? -4.967  27.762  -27.496 1.00 14.26 ? 334  ILE A CG1   1 
ATOM   2792 C  CG2   . ILE A 1 334 ? -5.910  25.866  -28.858 1.00 13.25 ? 334  ILE A CG2   1 
ATOM   2793 C  CD1   . ILE A 1 334 ? -4.229  27.026  -26.373 1.00 12.74 ? 334  ILE A CD1   1 
ATOM   2794 N  N     . ASP A 1 335 ? -9.385  26.982  -28.790 1.00 14.47 ? 335  ASP A N     1 
ATOM   2795 C  CA    . ASP A 1 335 ? -10.494 26.299  -29.466 1.00 14.09 ? 335  ASP A CA    1 
ATOM   2796 C  C     . ASP A 1 335 ? -11.264 27.206  -30.425 1.00 15.70 ? 335  ASP A C     1 
ATOM   2797 O  O     . ASP A 1 335 ? -11.757 26.736  -31.446 1.00 13.82 ? 335  ASP A O     1 
ATOM   2798 C  CB    . ASP A 1 335 ? -11.474 25.642  -28.482 1.00 13.77 ? 335  ASP A CB    1 
ATOM   2799 C  CG    . ASP A 1 335 ? -12.485 24.744  -29.189 1.00 16.55 ? 335  ASP A CG    1 
ATOM   2800 O  OD1   . ASP A 1 335 ? -12.059 23.756  -29.820 1.00 16.36 ? 335  ASP A OD1   1 
ATOM   2801 O  OD2   . ASP A 1 335 ? -13.700 25.033  -29.145 1.00 18.23 ? 335  ASP A OD2   1 
ATOM   2802 N  N     . ALA A 1 336 ? -11.385 28.489  -30.085 1.00 13.86 ? 336  ALA A N     1 
ATOM   2803 C  CA    . ALA A 1 336 ? -12.019 29.457  -30.982 1.00 15.73 ? 336  ALA A CA    1 
ATOM   2804 C  C     . ALA A 1 336 ? -11.270 29.522  -32.315 1.00 14.15 ? 336  ALA A C     1 
ATOM   2805 O  O     . ALA A 1 336 ? -11.879 29.673  -33.370 1.00 14.51 ? 336  ALA A O     1 
ATOM   2806 C  CB    . ALA A 1 336 ? -12.085 30.840  -30.330 1.00 15.53 ? 336  ALA A CB    1 
ATOM   2807 N  N     . LYS A 1 337 ? -9.945  29.396  -32.255 1.00 14.83 ? 337  LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 337 ? -9.107  29.343  -33.454 1.00 14.48 ? 337  LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 337 ? -9.186  27.986  -34.158 1.00 12.44 ? 337  LYS A C     1 
ATOM   2810 O  O     . LYS A 1 337 ? -9.475  27.915  -35.354 1.00 12.52 ? 337  LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 337 ? -7.649  29.634  -33.078 1.00 14.58 ? 337  LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 337 ? -6.661  29.550  -34.232 1.00 16.23 ? 337  LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 337 ? -5.209  29.653  -33.731 1.00 17.22 ? 337  LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 337 ? -4.226  29.596  -34.906 1.00 22.81 ? 337  LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 337 ? -2.806  29.299  -34.499 1.00 20.78 ? 337  LYS A NZ    1 
ATOM   2816 N  N     . ARG A 1 338 ? -8.920  26.921  -33.405 1.00 10.18 ? 338  ARG A N     1 
ATOM   2817 C  CA    . ARG A 1 338 ? -8.701  25.583  -33.974 1.00 9.92  ? 338  ARG A CA    1 
ATOM   2818 C  C     . ARG A 1 338 ? -9.987  24.803  -34.226 1.00 10.72 ? 338  ARG A C     1 
ATOM   2819 O  O     . ARG A 1 338 ? -10.049 24.002  -35.157 1.00 11.75 ? 338  ARG A O     1 
ATOM   2820 C  CB    . ARG A 1 338 ? -7.772  24.759  -33.076 1.00 8.98  ? 338  ARG A CB    1 
ATOM   2821 C  CG    . ARG A 1 338 ? -6.298  25.159  -33.121 1.00 10.99 ? 338  ARG A CG    1 
ATOM   2822 C  CD    . ARG A 1 338 ? -5.620  24.846  -34.463 1.00 10.33 ? 338  ARG A CD    1 
ATOM   2823 N  NE    . ARG A 1 338 ? -4.167  24.840  -34.288 1.00 10.24 ? 338  ARG A NE    1 
ATOM   2824 C  CZ    . ARG A 1 338 ? -3.313  24.122  -35.015 1.00 13.09 ? 338  ARG A CZ    1 
ATOM   2825 N  NH1   . ARG A 1 338 ? -3.743  23.327  -35.997 1.00 11.68 ? 338  ARG A NH1   1 
ATOM   2826 N  NH2   . ARG A 1 338 ? -2.018  24.194  -34.750 1.00 11.60 ? 338  ARG A NH2   1 
ATOM   2827 N  N     . GLN A 1 339 ? -10.995 25.028  -33.383 1.00 10.90 ? 339  GLN A N     1 
ATOM   2828 C  CA    . GLN A 1 339 ? -12.334 24.437  -33.553 1.00 12.44 ? 339  GLN A CA    1 
ATOM   2829 C  C     . GLN A 1 339 ? -12.354 22.899  -33.452 1.00 11.83 ? 339  GLN A C     1 
ATOM   2830 O  O     . GLN A 1 339 ? -13.037 22.211  -34.228 1.00 12.16 ? 339  GLN A O     1 
ATOM   2831 C  CB    . GLN A 1 339 ? -12.992 24.962  -34.847 1.00 12.36 ? 339  GLN A CB    1 
ATOM   2832 C  CG    . GLN A 1 339 ? -13.055 26.503  -34.869 1.00 18.20 ? 339  GLN A CG    1 
ATOM   2833 C  CD    . GLN A 1 339 ? -13.591 27.112  -36.156 1.00 22.41 ? 339  GLN A CD    1 
ATOM   2834 O  OE1   . GLN A 1 339 ? -13.629 28.336  -36.290 1.00 28.17 ? 339  GLN A OE1   1 
ATOM   2835 N  NE2   . GLN A 1 339 ? -14.015 26.278  -37.097 1.00 23.17 ? 339  GLN A NE2   1 
ATOM   2836 N  N     . PHE A 1 340 ? -11.595 22.372  -32.491 1.00 11.48 ? 340  PHE A N     1 
ATOM   2837 C  CA    . PHE A 1 340 ? -11.506 20.927  -32.265 1.00 12.89 ? 340  PHE A CA    1 
ATOM   2838 C  C     . PHE A 1 340 ? -12.742 20.359  -31.550 1.00 12.07 ? 340  PHE A C     1 
ATOM   2839 O  O     . PHE A 1 340 ? -13.118 19.206  -31.783 1.00 12.55 ? 340  PHE A O     1 
ATOM   2840 C  CB    . PHE A 1 340 ? -10.235 20.554  -31.476 1.00 11.83 ? 340  PHE A CB    1 
ATOM   2841 C  CG    . PHE A 1 340 ? -8.938  20.869  -32.188 1.00 11.03 ? 340  PHE A CG    1 
ATOM   2842 C  CD1   . PHE A 1 340 ? -8.863  20.908  -33.589 1.00 13.04 ? 340  PHE A CD1   1 
ATOM   2843 C  CD2   . PHE A 1 340 ? -7.776  21.093  -31.454 1.00 11.42 ? 340  PHE A CD2   1 
ATOM   2844 C  CE1   . PHE A 1 340 ? -7.649  21.184  -34.241 1.00 11.56 ? 340  PHE A CE1   1 
ATOM   2845 C  CE2   . PHE A 1 340 ? -6.559  21.367  -32.093 1.00 10.47 ? 340  PHE A CE2   1 
ATOM   2846 C  CZ    . PHE A 1 340 ? -6.496  21.413  -33.488 1.00 11.94 ? 340  PHE A CZ    1 
ATOM   2847 N  N     . ILE A 1 341 ? -13.358 21.146  -30.671 1.00 13.33 ? 341  ILE A N     1 
ATOM   2848 C  CA    . ILE A 1 341 ? -14.607 20.713  -30.025 1.00 12.47 ? 341  ILE A CA    1 
ATOM   2849 C  C     . ILE A 1 341 ? -15.707 20.573  -31.088 1.00 14.34 ? 341  ILE A C     1 
ATOM   2850 O  O     . ILE A 1 341 ? -16.418 19.565  -31.125 1.00 12.61 ? 341  ILE A O     1 
ATOM   2851 C  CB    . ILE A 1 341 ? -15.050 21.665  -28.870 1.00 13.93 ? 341  ILE A CB    1 
ATOM   2852 C  CG1   . ILE A 1 341 ? -14.032 21.667  -27.718 1.00 14.44 ? 341  ILE A CG1   1 
ATOM   2853 C  CG2   . ILE A 1 341 ? -16.471 21.323  -28.372 1.00 13.39 ? 341  ILE A CG2   1 
ATOM   2854 C  CD1   . ILE A 1 341 ? -13.936 20.374  -26.922 1.00 17.22 ? 341  ILE A CD1   1 
ATOM   2855 N  N     . ASN A 1 342 ? -15.830 21.584  -31.951 1.00 14.31 ? 342  ASN A N     1 
ATOM   2856 C  CA    . ASN A 1 342 ? -16.744 21.535  -33.099 1.00 14.90 ? 342  ASN A CA    1 
ATOM   2857 C  C     . ASN A 1 342 ? -16.518 20.290  -33.954 1.00 14.26 ? 342  ASN A C     1 
ATOM   2858 O  O     . ASN A 1 342 ? -17.466 19.580  -34.293 1.00 13.02 ? 342  ASN A O     1 
ATOM   2859 C  CB    . ASN A 1 342 ? -16.600 22.798  -33.965 1.00 15.33 ? 342  ASN A CB    1 
ATOM   2860 C  CG    . ASN A 1 342 ? -17.495 22.768  -35.198 1.00 21.29 ? 342  ASN A CG    1 
ATOM   2861 O  OD1   . ASN A 1 342 ? -18.716 22.849  -35.090 1.00 23.12 ? 342  ASN A OD1   1 
ATOM   2862 N  ND2   . ASN A 1 342 ? -16.885 22.654  -36.380 1.00 23.96 ? 342  ASN A ND2   1 
ATOM   2863 N  N     . LEU A 1 343 ? -15.254 20.022  -34.286 1.00 12.94 ? 343  LEU A N     1 
ATOM   2864 C  CA    . LEU A 1 343 ? -14.897 18.839  -35.063 1.00 13.10 ? 343  LEU A CA    1 
ATOM   2865 C  C     . LEU A 1 343 ? -15.339 17.551  -34.370 1.00 14.28 ? 343  LEU A C     1 
ATOM   2866 O  O     . LEU A 1 343 ? -15.874 16.646  -35.012 1.00 14.34 ? 343  LEU A O     1 
ATOM   2867 C  CB    . LEU A 1 343 ? -13.391 18.813  -35.333 1.00 12.43 ? 343  LEU A CB    1 
ATOM   2868 C  CG    . LEU A 1 343 ? -12.784 17.608  -36.064 1.00 15.10 ? 343  LEU A CG    1 
ATOM   2869 C  CD1   . LEU A 1 343 ? -13.240 17.559  -37.528 1.00 12.84 ? 343  LEU A CD1   1 
ATOM   2870 C  CD2   . LEU A 1 343 ? -11.264 17.682  -35.975 1.00 13.13 ? 343  LEU A CD2   1 
ATOM   2871 N  N     . SER A 1 344 ? -15.116 17.485  -33.059 1.00 13.76 ? 344  SER A N     1 
ATOM   2872 C  CA    . SER A 1 344 ? -15.392 16.285  -32.277 1.00 13.30 ? 344  SER A CA    1 
ATOM   2873 C  C     . SER A 1 344 ? -16.885 15.995  -32.286 1.00 13.70 ? 344  SER A C     1 
ATOM   2874 O  O     . SER A 1 344 ? -17.307 14.860  -32.540 1.00 13.08 ? 344  SER A O     1 
ATOM   2875 C  CB    . SER A 1 344 ? -14.878 16.455  -30.845 1.00 13.62 ? 344  SER A CB    1 
ATOM   2876 O  OG    . SER A 1 344 ? -13.461 16.582  -30.829 1.00 15.72 ? 344  SER A OG    1 
ATOM   2877 N  N     . LEU A 1 345 ? -17.673 17.040  -32.042 1.00 12.35 ? 345  LEU A N     1 
ATOM   2878 C  CA    . LEU A 1 345 ? -19.128 16.955  -32.128 1.00 13.60 ? 345  LEU A CA    1 
ATOM   2879 C  C     . LEU A 1 345 ? -19.603 16.541  -33.520 1.00 13.60 ? 345  LEU A C     1 
ATOM   2880 O  O     . LEU A 1 345 ? -20.388 15.604  -33.632 1.00 14.26 ? 345  LEU A O     1 
ATOM   2881 C  CB    . LEU A 1 345 ? -19.787 18.270  -31.684 1.00 11.61 ? 345  LEU A CB    1 
ATOM   2882 C  CG    . LEU A 1 345 ? -19.624 18.657  -30.200 1.00 14.39 ? 345  LEU A CG    1 
ATOM   2883 C  CD1   . LEU A 1 345 ? -20.174 20.061  -29.949 1.00 11.79 ? 345  LEU A CD1   1 
ATOM   2884 C  CD2   . LEU A 1 345 ? -20.282 17.645  -29.249 1.00 11.60 ? 345  LEU A CD2   1 
ATOM   2885 N  N     . ASP A 1 346 ? -19.126 17.226  -34.567 1.00 13.18 ? 346  ASP A N     1 
ATOM   2886 C  CA    . ASP A 1 346 ? -19.474 16.871  -35.950 1.00 15.16 ? 346  ASP A CA    1 
ATOM   2887 C  C     . ASP A 1 346 ? -19.236 15.383  -36.210 1.00 14.93 ? 346  ASP A C     1 
ATOM   2888 O  O     . ASP A 1 346 ? -20.125 14.683  -36.695 1.00 14.72 ? 346  ASP A O     1 
ATOM   2889 C  CB    . ASP A 1 346 ? -18.628 17.671  -36.950 1.00 16.60 ? 346  ASP A CB    1 
ATOM   2890 C  CG    . ASP A 1 346 ? -19.190 19.050  -37.248 1.00 22.24 ? 346  ASP A CG    1 
ATOM   2891 O  OD1   . ASP A 1 346 ? -20.271 19.412  -36.738 1.00 23.73 ? 346  ASP A OD1   1 
ATOM   2892 O  OD2   . ASP A 1 346 ? -18.535 19.771  -38.023 1.00 30.02 ? 346  ASP A OD2   1 
ATOM   2893 N  N     . MET A 1 347 ? -18.026 14.920  -35.889 1.00 14.08 ? 347  MET A N     1 
ATOM   2894 C  CA    . MET A 1 347 ? -17.609 13.533  -36.145 1.00 15.85 ? 347  MET A CA    1 
ATOM   2895 C  C     . MET A 1 347 ? -18.364 12.523  -35.290 1.00 16.11 ? 347  MET A C     1 
ATOM   2896 O  O     . MET A 1 347 ? -18.803 11.481  -35.792 1.00 14.71 ? 347  MET A O     1 
ATOM   2897 C  CB    . MET A 1 347 ? -16.099 13.368  -35.923 1.00 17.13 ? 347  MET A CB    1 
ATOM   2898 C  CG    . MET A 1 347 ? -15.227 13.949  -37.031 1.00 26.80 ? 347  MET A CG    1 
ATOM   2899 S  SD    . MET A 1 347 ? -13.450 13.722  -36.723 1.00 35.90 ? 347  MET A SD    1 
ATOM   2900 C  CE    . MET A 1 347 ? -13.368 11.946  -36.433 1.00 30.30 ? 347  MET A CE    1 
ATOM   2901 N  N     . GLY A 1 348 ? -18.505 12.828  -33.999 1.00 13.66 ? 348  GLY A N     1 
ATOM   2902 C  CA    . GLY A 1 348 ? -19.227 11.959  -33.070 1.00 13.72 ? 348  GLY A CA    1 
ATOM   2903 C  C     . GLY A 1 348 ? -20.666 11.696  -33.494 1.00 13.45 ? 348  GLY A C     1 
ATOM   2904 O  O     . GLY A 1 348 ? -21.110 10.544  -33.518 1.00 14.23 ? 348  GLY A O     1 
ATOM   2905 N  N     . TYR A 1 349 ? -21.396 12.757  -33.843 1.00 12.48 ? 349  TYR A N     1 
ATOM   2906 C  CA    . TYR A 1 349 ? -22.801 12.606  -34.241 1.00 12.92 ? 349  TYR A CA    1 
ATOM   2907 C  C     . TYR A 1 349 ? -22.978 11.990  -35.621 1.00 14.05 ? 349  TYR A C     1 
ATOM   2908 O  O     . TYR A 1 349 ? -23.946 11.266  -35.854 1.00 13.84 ? 349  TYR A O     1 
ATOM   2909 C  CB    . TYR A 1 349 ? -23.560 13.931  -34.149 1.00 14.33 ? 349  TYR A CB    1 
ATOM   2910 C  CG    . TYR A 1 349 ? -23.811 14.364  -32.729 1.00 13.50 ? 349  TYR A CG    1 
ATOM   2911 C  CD1   . TYR A 1 349 ? -24.613 13.597  -31.878 1.00 12.74 ? 349  TYR A CD1   1 
ATOM   2912 C  CD2   . TYR A 1 349 ? -23.246 15.535  -32.231 1.00 12.32 ? 349  TYR A CD2   1 
ATOM   2913 C  CE1   . TYR A 1 349 ? -24.849 13.992  -30.568 1.00 12.03 ? 349  TYR A CE1   1 
ATOM   2914 C  CE2   . TYR A 1 349 ? -23.475 15.940  -30.921 1.00 13.90 ? 349  TYR A CE2   1 
ATOM   2915 C  CZ    . TYR A 1 349 ? -24.277 15.168  -30.100 1.00 12.47 ? 349  TYR A CZ    1 
ATOM   2916 O  OH    . TYR A 1 349 ? -24.506 15.574  -28.811 1.00 14.35 ? 349  TYR A OH    1 
ATOM   2917 N  N     . TYR A 1 350 ? -22.048 12.284  -36.528 1.00 14.78 ? 350  TYR A N     1 
ATOM   2918 C  CA    . TYR A 1 350 ? -22.019 11.652  -37.847 1.00 14.16 ? 350  TYR A CA    1 
ATOM   2919 C  C     . TYR A 1 350 ? -21.923 10.127  -37.727 1.00 14.98 ? 350  TYR A C     1 
ATOM   2920 O  O     . TYR A 1 350 ? -22.653 9.400   -38.397 1.00 14.52 ? 350  TYR A O     1 
ATOM   2921 C  CB    . TYR A 1 350 ? -20.838 12.183  -38.672 1.00 13.07 ? 350  TYR A CB    1 
ATOM   2922 C  CG    . TYR A 1 350 ? -20.781 11.629  -40.078 1.00 12.37 ? 350  TYR A CG    1 
ATOM   2923 C  CD1   . TYR A 1 350 ? -21.520 12.217  -41.101 1.00 11.44 ? 350  TYR A CD1   1 
ATOM   2924 C  CD2   . TYR A 1 350 ? -19.993 10.509  -40.384 1.00 12.95 ? 350  TYR A CD2   1 
ATOM   2925 C  CE1   . TYR A 1 350 ? -21.473 11.721  -42.398 1.00 16.64 ? 350  TYR A CE1   1 
ATOM   2926 C  CE2   . TYR A 1 350 ? -19.942 10.000  -41.684 1.00 13.72 ? 350  TYR A CE2   1 
ATOM   2927 C  CZ    . TYR A 1 350 ? -20.688 10.615  -42.683 1.00 13.50 ? 350  TYR A CZ    1 
ATOM   2928 O  OH    . TYR A 1 350 ? -20.660 10.141  -43.966 1.00 14.91 ? 350  TYR A OH    1 
ATOM   2929 N  N     . ALA A 1 351 ? -21.010 9.664   -36.874 1.00 13.36 ? 351  ALA A N     1 
ATOM   2930 C  CA    . ALA A 1 351 ? -20.777 8.237   -36.655 1.00 14.39 ? 351  ALA A CA    1 
ATOM   2931 C  C     . ALA A 1 351 ? -21.828 7.562   -35.763 1.00 14.45 ? 351  ALA A C     1 
ATOM   2932 O  O     . ALA A 1 351 ? -22.042 6.353   -35.869 1.00 15.40 ? 351  ALA A O     1 
ATOM   2933 C  CB    . ALA A 1 351 ? -19.387 8.022   -36.074 1.00 12.67 ? 351  ALA A CB    1 
ATOM   2934 N  N     . LYS A 1 352 ? -22.482 8.352   -34.908 1.00 14.11 ? 352  LYS A N     1 
ATOM   2935 C  CA    . LYS A 1 352 ? -23.379 7.861   -33.845 1.00 14.95 ? 352  LYS A CA    1 
ATOM   2936 C  C     . LYS A 1 352 ? -22.612 7.054   -32.789 1.00 14.58 ? 352  LYS A C     1 
ATOM   2937 O  O     . LYS A 1 352 ? -22.910 5.885   -32.523 1.00 13.24 ? 352  LYS A O     1 
ATOM   2938 C  CB    . LYS A 1 352 ? -24.589 7.098   -34.408 1.00 14.36 ? 352  LYS A CB    1 
ATOM   2939 C  CG    . LYS A 1 352 ? -25.558 7.990   -35.177 1.00 17.39 ? 352  LYS A CG    1 
ATOM   2940 C  CD    . LYS A 1 352 ? -26.725 7.204   -35.749 1.00 19.29 ? 352  LYS A CD    1 
ATOM   2941 C  CE    . LYS A 1 352 ? -27.589 8.112   -36.607 1.00 19.47 ? 352  LYS A CE    1 
ATOM   2942 N  NZ    . LYS A 1 352 ? -28.407 7.350   -37.603 1.00 21.79 ? 352  LYS A NZ    1 
ATOM   2943 N  N     . ILE A 1 353 ? -21.619 7.712   -32.198 1.00 14.13 ? 353  ILE A N     1 
ATOM   2944 C  CA    . ILE A 1 353 ? -20.768 7.137   -31.157 1.00 12.64 ? 353  ILE A CA    1 
ATOM   2945 C  C     . ILE A 1 353 ? -20.738 8.075   -29.957 1.00 13.21 ? 353  ILE A C     1 
ATOM   2946 O  O     . ILE A 1 353 ? -21.141 9.238   -30.065 1.00 13.50 ? 353  ILE A O     1 
ATOM   2947 C  CB    . ILE A 1 353 ? -19.307 6.944   -31.668 1.00 13.27 ? 353  ILE A CB    1 
ATOM   2948 C  CG1   . ILE A 1 353 ? -18.748 8.263   -32.230 1.00 12.79 ? 353  ILE A CG1   1 
ATOM   2949 C  CG2   . ILE A 1 353 ? -19.253 5.835   -32.714 1.00 11.25 ? 353  ILE A CG2   1 
ATOM   2950 C  CD1   . ILE A 1 353 ? -17.302 8.197   -32.791 1.00 14.36 ? 353  ILE A CD1   1 
ATOM   2951 N  N     . GLN A 1 354 ? -20.252 7.581   -28.820 1.00 14.22 ? 354  GLN A N     1 
ATOM   2952 C  CA    . GLN A 1 354 ? -19.895 8.460   -27.710 1.00 15.19 ? 354  GLN A CA    1 
ATOM   2953 C  C     . GLN A 1 354 ? -18.915 9.484   -28.267 1.00 15.36 ? 354  GLN A C     1 
ATOM   2954 O  O     . GLN A 1 354 ? -18.026 9.119   -29.041 1.00 14.82 ? 354  GLN A O     1 
ATOM   2955 C  CB    . GLN A 1 354 ? -19.210 7.678   -26.591 1.00 15.76 ? 354  GLN A CB    1 
ATOM   2956 C  CG    . GLN A 1 354 ? -20.079 6.618   -25.920 1.00 15.87 ? 354  GLN A CG    1 
ATOM   2957 C  CD    . GLN A 1 354 ? -19.361 5.929   -24.778 1.00 19.99 ? 354  GLN A CD    1 
ATOM   2958 O  OE1   . GLN A 1 354 ? -19.899 5.800   -23.675 1.00 19.25 ? 354  GLN A OE1   1 
ATOM   2959 N  NE2   . GLN A 1 354 ? -18.134 5.497   -25.029 1.00 18.08 ? 354  GLN A NE2   1 
ATOM   2960 N  N     . ILE A 1 355 ? -19.071 10.754  -27.896 1.00 14.27 ? 355  ILE A N     1 
ATOM   2961 C  CA    . ILE A 1 355 ? -18.204 11.799  -28.456 1.00 14.85 ? 355  ILE A CA    1 
ATOM   2962 C  C     . ILE A 1 355 ? -16.716 11.510  -28.214 1.00 14.19 ? 355  ILE A C     1 
ATOM   2963 O  O     . ILE A 1 355 ? -15.888 11.728  -29.107 1.00 14.46 ? 355  ILE A O     1 
ATOM   2964 C  CB    . ILE A 1 355 ? -18.590 13.235  -27.984 1.00 15.85 ? 355  ILE A CB    1 
ATOM   2965 C  CG1   . ILE A 1 355 ? -20.083 13.516  -28.219 1.00 15.17 ? 355  ILE A CG1   1 
ATOM   2966 C  CG2   . ILE A 1 355 ? -17.721 14.297  -28.687 1.00 13.27 ? 355  ILE A CG2   1 
ATOM   2967 C  CD1   . ILE A 1 355 ? -20.564 13.341  -29.660 1.00 15.75 ? 355  ILE A CD1   1 
ATOM   2968 N  N     . GLN A 1 356 ? -16.376 10.994  -27.030 1.00 14.06 ? 356  GLN A N     1 
ATOM   2969 C  CA    . GLN A 1 356 ? -14.971 10.668  -26.717 1.00 14.21 ? 356  GLN A CA    1 
ATOM   2970 C  C     . GLN A 1 356 ? -14.370 9.584   -27.627 1.00 14.41 ? 356  GLN A C     1 
ATOM   2971 O  O     . GLN A 1 356 ? -13.155 9.431   -27.677 1.00 15.51 ? 356  GLN A O     1 
ATOM   2972 C  CB    . GLN A 1 356 ? -14.772 10.307  -25.232 1.00 15.22 ? 356  GLN A CB    1 
ATOM   2973 C  CG    . GLN A 1 356 ? -15.439 8.999   -24.757 1.00 16.50 ? 356  GLN A CG    1 
ATOM   2974 C  CD    . GLN A 1 356 ? -16.845 9.204   -24.186 1.00 17.94 ? 356  GLN A CD    1 
ATOM   2975 O  OE1   . GLN A 1 356 ? -17.582 10.096  -24.608 1.00 15.64 ? 356  GLN A OE1   1 
ATOM   2976 N  NE2   . GLN A 1 356 ? -17.218 8.365   -23.225 1.00 13.82 ? 356  GLN A NE2   1 
ATOM   2977 N  N     . SER A 1 357 ? -15.220 8.843   -28.340 1.00 14.06 ? 357  SER A N     1 
ATOM   2978 C  CA    . SER A 1 357 ? -14.749 7.809   -29.274 1.00 15.10 ? 357  SER A CA    1 
ATOM   2979 C  C     . SER A 1 357 ? -14.164 8.362   -30.583 1.00 14.70 ? 357  SER A C     1 
ATOM   2980 O  O     . SER A 1 357 ? -13.649 7.589   -31.410 1.00 13.12 ? 357  SER A O     1 
ATOM   2981 C  CB    . SER A 1 357 ? -15.857 6.793   -29.578 1.00 14.87 ? 357  SER A CB    1 
ATOM   2982 O  OG    . SER A 1 357 ? -16.132 5.999   -28.444 1.00 17.38 ? 357  SER A OG    1 
ATOM   2983 N  N     . VAL A 1 358 ? -14.220 9.685   -30.770 1.00 15.18 ? 358  VAL A N     1 
ATOM   2984 C  CA    . VAL A 1 358 ? -13.570 10.311  -31.923 1.00 14.65 ? 358  VAL A CA    1 
ATOM   2985 C  C     . VAL A 1 358 ? -12.056 10.072  -31.905 1.00 16.13 ? 358  VAL A C     1 
ATOM   2986 O  O     . VAL A 1 358 ? -11.402 10.161  -32.945 1.00 15.66 ? 358  VAL A O     1 
ATOM   2987 C  CB    . VAL A 1 358 ? -13.874 11.844  -32.077 1.00 16.50 ? 358  VAL A CB    1 
ATOM   2988 C  CG1   . VAL A 1 358 ? -15.363 12.093  -32.378 1.00 16.65 ? 358  VAL A CG1   1 
ATOM   2989 C  CG2   . VAL A 1 358 ? -13.381 12.657  -30.867 1.00 15.46 ? 358  VAL A CG2   1 
ATOM   2990 N  N     . PHE A 1 359 ? -11.516 9.763   -30.724 1.00 14.61 ? 359  PHE A N     1 
ATOM   2991 C  CA    . PHE A 1 359 ? -10.105 9.425   -30.578 1.00 15.86 ? 359  PHE A CA    1 
ATOM   2992 C  C     . PHE A 1 359 ? -9.763  8.086   -31.236 1.00 16.46 ? 359  PHE A C     1 
ATOM   2993 O  O     . PHE A 1 359 ? -8.593  7.791   -31.469 1.00 18.11 ? 359  PHE A O     1 
ATOM   2994 C  CB    . PHE A 1 359 ? -9.687  9.417   -29.098 1.00 15.72 ? 359  PHE A CB    1 
ATOM   2995 C  CG    . PHE A 1 359 ? -9.604  10.792  -28.483 1.00 16.61 ? 359  PHE A CG    1 
ATOM   2996 C  CD1   . PHE A 1 359 ? -8.668  11.721  -28.940 1.00 15.22 ? 359  PHE A CD1   1 
ATOM   2997 C  CD2   . PHE A 1 359 ? -10.449 11.153  -27.439 1.00 14.78 ? 359  PHE A CD2   1 
ATOM   2998 C  CE1   . PHE A 1 359 ? -8.596  13.000  -28.381 1.00 15.09 ? 359  PHE A CE1   1 
ATOM   2999 C  CE2   . PHE A 1 359 ? -10.381 12.427  -26.868 1.00 15.70 ? 359  PHE A CE2   1 
ATOM   3000 C  CZ    . PHE A 1 359 ? -9.456  13.353  -27.344 1.00 16.20 ? 359  PHE A CZ    1 
ATOM   3001 N  N     . SER A 1 360 ? -10.788 7.289   -31.533 1.00 13.56 ? 360  SER A N     1 
ATOM   3002 C  CA    . SER A 1 360 ? -10.598 5.957   -32.113 1.00 13.94 ? 360  SER A CA    1 
ATOM   3003 C  C     . SER A 1 360 ? -11.183 5.855   -33.527 1.00 12.72 ? 360  SER A C     1 
ATOM   3004 O  O     . SER A 1 360 ? -12.396 5.751   -33.683 1.00 13.45 ? 360  SER A O     1 
ATOM   3005 C  CB    . SER A 1 360 ? -11.223 4.890   -31.207 1.00 13.97 ? 360  SER A CB    1 
ATOM   3006 O  OG    . SER A 1 360 ? -11.266 3.624   -31.854 1.00 11.13 ? 360  SER A OG    1 
ATOM   3007 N  N     . PRO A 1 361 ? -10.320 5.889   -34.561 1.00 12.37 ? 361  PRO A N     1 
ATOM   3008 C  CA    . PRO A 1 361 ? -10.805 5.683   -35.932 1.00 13.66 ? 361  PRO A CA    1 
ATOM   3009 C  C     . PRO A 1 361 ? -11.486 4.316   -36.100 1.00 13.30 ? 361  PRO A C     1 
ATOM   3010 O  O     . PRO A 1 361 ? -12.397 4.192   -36.908 1.00 13.49 ? 361  PRO A O     1 
ATOM   3011 C  CB    . PRO A 1 361 ? -9.532  5.741   -36.793 1.00 12.17 ? 361  PRO A CB    1 
ATOM   3012 C  CG    . PRO A 1 361 ? -8.465  6.296   -35.926 1.00 13.53 ? 361  PRO A CG    1 
ATOM   3013 C  CD    . PRO A 1 361 ? -8.860  6.091   -34.495 1.00 13.78 ? 361  PRO A CD    1 
ATOM   3014 N  N     . ILE A 1 362 ? -11.038 3.302   -35.354 1.00 13.65 ? 362  ILE A N     1 
ATOM   3015 C  CA    . ILE A 1 362 ? -11.672 1.974   -35.433 1.00 13.96 ? 362  ILE A CA    1 
ATOM   3016 C  C     . ILE A 1 362 ? -13.112 1.980   -34.901 1.00 14.37 ? 362  ILE A C     1 
ATOM   3017 O  O     . ILE A 1 362 ? -14.016 1.433   -35.546 1.00 14.26 ? 362  ILE A O     1 
ATOM   3018 C  CB    . ILE A 1 362 ? -10.812 0.858   -34.791 1.00 15.70 ? 362  ILE A CB    1 
ATOM   3019 C  CG1   . ILE A 1 362 ? -9.613  0.562   -35.710 1.00 19.84 ? 362  ILE A CG1   1 
ATOM   3020 C  CG2   . ILE A 1 362 ? -11.668 -0.411  -34.517 1.00 16.02 ? 362  ILE A CG2   1 
ATOM   3021 C  CD1   . ILE A 1 362 ? -8.673  -0.526  -35.228 1.00 22.22 ? 362  ILE A CD1   1 
ATOM   3022 N  N     . LYS A 1 363 ? -13.332 2.611   -33.748 1.00 13.40 ? 363  LYS A N     1 
ATOM   3023 C  CA    . LYS A 1 363 ? -14.692 2.714   -33.203 1.00 12.96 ? 363  LYS A CA    1 
ATOM   3024 C  C     . LYS A 1 363 ? -15.591 3.546   -34.125 1.00 11.80 ? 363  LYS A C     1 
ATOM   3025 O  O     . LYS A 1 363 ? -16.720 3.156   -34.409 1.00 13.12 ? 363  LYS A O     1 
ATOM   3026 C  CB    . LYS A 1 363 ? -14.673 3.274   -31.773 1.00 11.72 ? 363  LYS A CB    1 
ATOM   3027 C  CG    . LYS A 1 363 ? -16.024 3.275   -31.052 1.00 15.61 ? 363  LYS A CG    1 
ATOM   3028 C  CD    . LYS A 1 363 ? -16.637 1.878   -30.912 1.00 16.76 ? 363  LYS A CD    1 
ATOM   3029 C  CE    . LYS A 1 363 ? -15.921 1.025   -29.883 1.00 18.86 ? 363  LYS A CE    1 
ATOM   3030 N  NZ    . LYS A 1 363 ? -16.673 -0.256  -29.676 1.00 20.13 ? 363  LYS A NZ    1 
ATOM   3031 N  N     . THR A 1 364 ? -15.067 4.674   -34.602 1.00 13.33 ? 364  THR A N     1 
ATOM   3032 C  CA    . THR A 1 364 ? -15.768 5.575   -35.519 1.00 13.44 ? 364  THR A CA    1 
ATOM   3033 C  C     . THR A 1 364 ? -16.219 4.853   -36.800 1.00 13.57 ? 364  THR A C     1 
ATOM   3034 O  O     . THR A 1 364 ? -17.396 4.902   -37.166 1.00 12.74 ? 364  THR A O     1 
ATOM   3035 C  CB    . THR A 1 364 ? -14.866 6.795   -35.874 1.00 15.39 ? 364  THR A CB    1 
ATOM   3036 O  OG1   . THR A 1 364 ? -14.426 7.428   -34.666 1.00 14.97 ? 364  THR A OG1   1 
ATOM   3037 C  CG2   . THR A 1 364 ? -15.623 7.824   -36.712 1.00 14.35 ? 364  THR A CG2   1 
ATOM   3038 N  N     . TRP A 1 365 ? -15.285 4.174   -37.467 1.00 12.43 ? 365  TRP A N     1 
ATOM   3039 C  CA    . TRP A 1 365 ? -15.617 3.420   -38.673 1.00 13.30 ? 365  TRP A CA    1 
ATOM   3040 C  C     . TRP A 1 365 ? -16.500 2.210   -38.412 1.00 12.80 ? 365  TRP A C     1 
ATOM   3041 O  O     . TRP A 1 365 ? -17.393 1.923   -39.207 1.00 13.19 ? 365  TRP A O     1 
ATOM   3042 C  CB    . TRP A 1 365 ? -14.361 3.036   -39.462 1.00 10.62 ? 365  TRP A CB    1 
ATOM   3043 C  CG    . TRP A 1 365 ? -13.835 4.197   -40.243 1.00 11.51 ? 365  TRP A CG    1 
ATOM   3044 C  CD1   . TRP A 1 365 ? -12.645 4.850   -40.048 1.00 9.86  ? 365  TRP A CD1   1 
ATOM   3045 C  CD2   . TRP A 1 365 ? -14.497 4.877   -41.323 1.00 10.16 ? 365  TRP A CD2   1 
ATOM   3046 N  NE1   . TRP A 1 365 ? -12.524 5.880   -40.950 1.00 12.36 ? 365  TRP A NE1   1 
ATOM   3047 C  CE2   . TRP A 1 365 ? -13.648 5.922   -41.738 1.00 11.88 ? 365  TRP A CE2   1 
ATOM   3048 C  CE3   . TRP A 1 365 ? -15.729 4.697   -41.983 1.00 13.89 ? 365  TRP A CE3   1 
ATOM   3049 C  CZ2   . TRP A 1 365 ? -13.982 6.790   -42.787 1.00 12.49 ? 365  TRP A CZ2   1 
ATOM   3050 C  CZ3   . TRP A 1 365 ? -16.062 5.563   -43.028 1.00 9.94  ? 365  TRP A CZ3   1 
ATOM   3051 C  CH2   . TRP A 1 365 ? -15.186 6.592   -43.418 1.00 11.98 ? 365  TRP A CH2   1 
ATOM   3052 N  N     . ASP A 1 366 ? -16.274 1.502   -37.307 1.00 13.16 ? 366  ASP A N     1 
ATOM   3053 C  CA    . ASP A 1 366 ? -17.182 0.398   -36.956 1.00 13.52 ? 366  ASP A CA    1 
ATOM   3054 C  C     . ASP A 1 366 ? -18.627 0.889   -36.881 1.00 13.87 ? 366  ASP A C     1 
ATOM   3055 O  O     . ASP A 1 366 ? -19.545 0.252   -37.421 1.00 12.41 ? 366  ASP A O     1 
ATOM   3056 C  CB    . ASP A 1 366 ? -16.785 -0.277  -35.638 1.00 12.59 ? 366  ASP A CB    1 
ATOM   3057 C  CG    . ASP A 1 366 ? -17.354 -1.686  -35.510 1.00 16.32 ? 366  ASP A CG    1 
ATOM   3058 O  OD1   . ASP A 1 366 ? -17.282 -2.459  -36.488 1.00 16.34 ? 366  ASP A OD1   1 
ATOM   3059 O  OD2   . ASP A 1 366 ? -17.869 -2.029  -34.428 1.00 19.11 ? 366  ASP A OD2   1 
ATOM   3060 N  N     . ALA A 1 367 ? -18.824 2.028   -36.221 1.00 12.67 ? 367  ALA A N     1 
ATOM   3061 C  CA    . ALA A 1 367 ? -20.152 2.606   -36.073 1.00 12.37 ? 367  ALA A CA    1 
ATOM   3062 C  C     . ALA A 1 367 ? -20.733 3.103   -37.399 1.00 13.69 ? 367  ALA A C     1 
ATOM   3063 O  O     . ALA A 1 367 ? -21.893 2.835   -37.703 1.00 12.33 ? 367  ALA A O     1 
ATOM   3064 C  CB    . ALA A 1 367 ? -20.133 3.728   -35.035 1.00 13.10 ? 367  ALA A CB    1 
ATOM   3065 N  N     . ILE A 1 368 ? -19.936 3.822   -38.187 1.00 15.03 ? 368  ILE A N     1 
ATOM   3066 C  CA    . ILE A 1 368 ? -20.402 4.305   -39.500 1.00 14.32 ? 368  ILE A CA    1 
ATOM   3067 C  C     . ILE A 1 368 ? -20.860 3.128   -40.380 1.00 13.82 ? 368  ILE A C     1 
ATOM   3068 O  O     . ILE A 1 368 ? -21.968 3.135   -40.939 1.00 12.66 ? 368  ILE A O     1 
ATOM   3069 C  CB    . ILE A 1 368 ? -19.308 5.138   -40.225 1.00 14.67 ? 368  ILE A CB    1 
ATOM   3070 C  CG1   . ILE A 1 368 ? -19.098 6.485   -39.512 1.00 14.94 ? 368  ILE A CG1   1 
ATOM   3071 C  CG2   . ILE A 1 368 ? -19.671 5.348   -41.702 1.00 13.87 ? 368  ILE A CG2   1 
ATOM   3072 C  CD1   . ILE A 1 368 ? -17.848 7.244   -39.946 1.00 14.18 ? 368  ILE A CD1   1 
ATOM   3073 N  N     . ILE A 1 369 ? -20.003 2.112   -40.483 1.00 13.74 ? 369  ILE A N     1 
ATOM   3074 C  CA    . ILE A 1 369 ? -20.272 0.954   -41.335 1.00 13.09 ? 369  ILE A CA    1 
ATOM   3075 C  C     . ILE A 1 369 ? -21.466 0.147   -40.822 1.00 12.93 ? 369  ILE A C     1 
ATOM   3076 O  O     . ILE A 1 369 ? -22.289 -0.317  -41.616 1.00 11.81 ? 369  ILE A O     1 
ATOM   3077 C  CB    . ILE A 1 369 ? -18.999 0.072   -41.511 1.00 13.46 ? 369  ILE A CB    1 
ATOM   3078 C  CG1   . ILE A 1 369 ? -17.943 0.845   -42.313 1.00 12.39 ? 369  ILE A CG1   1 
ATOM   3079 C  CG2   . ILE A 1 369 ? -19.320 -1.238  -42.225 1.00 11.43 ? 369  ILE A CG2   1 
ATOM   3080 C  CD1   . ILE A 1 369 ? -16.516 0.278   -42.204 1.00 11.15 ? 369  ILE A CD1   1 
ATOM   3081 N  N     . PHE A 1 370 ? -21.561 -0.006  -39.502 1.00 13.14 ? 370  PHE A N     1 
ATOM   3082 C  CA    . PHE A 1 370 ? -22.699 -0.699  -38.873 1.00 13.77 ? 370  PHE A CA    1 
ATOM   3083 C  C     . PHE A 1 370 ? -24.023 -0.020  -39.205 1.00 13.78 ? 370  PHE A C     1 
ATOM   3084 O  O     . PHE A 1 370 ? -24.965 -0.680  -39.670 1.00 15.70 ? 370  PHE A O     1 
ATOM   3085 C  CB    . PHE A 1 370 ? -22.498 -0.809  -37.352 1.00 14.00 ? 370  PHE A CB    1 
ATOM   3086 C  CG    . PHE A 1 370 ? -23.781 -0.988  -36.561 1.00 14.70 ? 370  PHE A CG    1 
ATOM   3087 C  CD1   . PHE A 1 370 ? -24.158 -0.039  -35.612 1.00 13.68 ? 370  PHE A CD1   1 
ATOM   3088 C  CD2   . PHE A 1 370 ? -24.604 -2.101  -36.762 1.00 14.69 ? 370  PHE A CD2   1 
ATOM   3089 C  CE1   . PHE A 1 370 ? -25.333 -0.192  -34.863 1.00 14.28 ? 370  PHE A CE1   1 
ATOM   3090 C  CE2   . PHE A 1 370 ? -25.798 -2.262  -36.028 1.00 16.45 ? 370  PHE A CE2   1 
ATOM   3091 C  CZ    . PHE A 1 370 ? -26.163 -1.306  -35.081 1.00 15.38 ? 370  PHE A CZ    1 
ATOM   3092 N  N     . ASN A 1 371 ? -24.094 1.292   -38.980 1.00 13.07 ? 371  ASN A N     1 
ATOM   3093 C  CA    . ASN A 1 371 ? -25.304 2.055   -39.314 1.00 15.93 ? 371  ASN A CA    1 
ATOM   3094 C  C     . ASN A 1 371 ? -25.695 1.969   -40.787 1.00 15.26 ? 371  ASN A C     1 
ATOM   3095 O  O     . ASN A 1 371 ? -26.884 1.869   -41.117 1.00 14.52 ? 371  ASN A O     1 
ATOM   3096 C  CB    . ASN A 1 371 ? -25.159 3.511   -38.876 1.00 14.16 ? 371  ASN A CB    1 
ATOM   3097 C  CG    . ASN A 1 371 ? -25.446 3.692   -37.404 1.00 16.61 ? 371  ASN A CG    1 
ATOM   3098 O  OD1   . ASN A 1 371 ? -26.605 3.750   -36.994 1.00 18.02 ? 371  ASN A OD1   1 
ATOM   3099 N  ND2   . ASN A 1 371 ? -24.396 3.771   -36.599 1.00 13.60 ? 371  ASN A ND2   1 
ATOM   3100 N  N     . SER A 1 372 ? -24.686 2.004   -41.659 1.00 15.90 ? 372  SER A N     1 
ATOM   3101 C  CA    . SER A 1 372 ? -24.888 1.913   -43.103 1.00 15.72 ? 372  SER A CA    1 
ATOM   3102 C  C     . SER A 1 372 ? -25.493 0.562   -43.492 1.00 14.46 ? 372  SER A C     1 
ATOM   3103 O  O     . SER A 1 372 ? -26.485 0.506   -44.226 1.00 15.90 ? 372  SER A O     1 
ATOM   3104 C  CB    . SER A 1 372 ? -23.557 2.127   -43.843 1.00 16.64 ? 372  SER A CB    1 
ATOM   3105 O  OG    . SER A 1 372 ? -23.767 2.245   -45.241 1.00 16.39 ? 372  SER A OG    1 
ATOM   3106 N  N     . LEU A 1 373 ? -24.894 -0.520  -42.995 1.00 12.95 ? 373  LEU A N     1 
ATOM   3107 C  CA    . LEU A 1 373 ? -25.373 -1.871  -43.293 1.00 14.00 ? 373  LEU A CA    1 
ATOM   3108 C  C     . LEU A 1 373 ? -26.749 -2.150  -42.683 1.00 15.77 ? 373  LEU A C     1 
ATOM   3109 O  O     . LEU A 1 373 ? -27.603 -2.784  -43.323 1.00 15.27 ? 373  LEU A O     1 
ATOM   3110 C  CB    . LEU A 1 373 ? -24.351 -2.921  -42.847 1.00 15.36 ? 373  LEU A CB    1 
ATOM   3111 C  CG    . LEU A 1 373 ? -22.990 -2.880  -43.564 1.00 13.65 ? 373  LEU A CG    1 
ATOM   3112 C  CD1   . LEU A 1 373 ? -21.975 -3.728  -42.821 1.00 14.29 ? 373  LEU A CD1   1 
ATOM   3113 C  CD2   . LEU A 1 373 ? -23.107 -3.343  -45.010 1.00 15.68 ? 373  LEU A CD2   1 
ATOM   3114 N  N     . LYS A 1 374 ? -26.968 -1.654  -41.465 1.00 15.38 ? 374  LYS A N     1 
ATOM   3115 C  CA    . LYS A 1 374 ? -28.244 -1.834  -40.767 1.00 18.59 ? 374  LYS A CA    1 
ATOM   3116 C  C     . LYS A 1 374 ? -29.424 -1.265  -41.566 1.00 20.93 ? 374  LYS A C     1 
ATOM   3117 O  O     . LYS A 1 374 ? -30.503 -1.862  -41.584 1.00 21.86 ? 374  LYS A O     1 
ATOM   3118 C  CB    . LYS A 1 374 ? -28.194 -1.227  -39.358 1.00 18.45 ? 374  LYS A CB    1 
ATOM   3119 C  CG    . LYS A 1 374 ? -29.499 -1.352  -38.572 1.00 19.02 ? 374  LYS A CG    1 
ATOM   3120 C  CD    . LYS A 1 374 ? -29.336 -0.863  -37.142 1.00 22.57 ? 374  LYS A CD    1 
ATOM   3121 C  CE    . LYS A 1 374 ? -30.668 -0.379  -36.572 1.00 24.17 ? 374  LYS A CE    1 
ATOM   3122 N  NZ    . LYS A 1 374 ? -30.966 0.988   -37.056 1.00 26.04 ? 374  LYS A NZ    1 
ATOM   3123 N  N     . GLU A 1 375 ? -29.208 -0.131  -42.237 1.00 22.20 ? 375  GLU A N     1 
ATOM   3124 C  CA    . GLU A 1 375 ? -30.232 0.494   -43.089 1.00 25.21 ? 375  GLU A CA    1 
ATOM   3125 C  C     . GLU A 1 375 ? -30.720 -0.410  -44.222 1.00 24.91 ? 375  GLU A C     1 
ATOM   3126 O  O     . GLU A 1 375 ? -31.874 -0.301  -44.666 1.00 25.13 ? 375  GLU A O     1 
ATOM   3127 C  CB    . GLU A 1 375 ? -29.715 1.813   -43.668 1.00 27.91 ? 375  GLU A CB    1 
ATOM   3128 C  CG    . GLU A 1 375 ? -29.909 3.002   -42.751 1.00 33.76 ? 375  GLU A CG    1 
ATOM   3129 C  CD    . GLU A 1 375 ? -31.367 3.404   -42.617 1.00 40.62 ? 375  GLU A CD    1 
ATOM   3130 O  OE1   . GLU A 1 375 ? -31.984 3.788   -43.638 1.00 42.40 ? 375  GLU A OE1   1 
ATOM   3131 O  OE2   . GLU A 1 375 ? -31.894 3.343   -41.485 1.00 44.04 ? 375  GLU A OE2   1 
ATOM   3132 N  N     . GLN A 1 376 ? -29.835 -1.295  -44.675 1.00 22.22 ? 376  GLN A N     1 
ATOM   3133 C  CA    . GLN A 1 376 ? -30.136 -2.268  -45.717 1.00 23.78 ? 376  GLN A CA    1 
ATOM   3134 C  C     . GLN A 1 376 ? -30.573 -3.620  -45.139 1.00 22.52 ? 376  GLN A C     1 
ATOM   3135 O  O     . GLN A 1 376 ? -30.691 -4.592  -45.878 1.00 23.40 ? 376  GLN A O     1 
ATOM   3136 C  CB    . GLN A 1 376 ? -28.907 -2.484  -46.606 1.00 24.89 ? 376  GLN A CB    1 
ATOM   3137 C  CG    . GLN A 1 376 ? -28.383 -1.246  -47.328 1.00 29.82 ? 376  GLN A CG    1 
ATOM   3138 C  CD    . GLN A 1 376 ? -27.077 -1.524  -48.059 1.00 34.26 ? 376  GLN A CD    1 
ATOM   3139 O  OE1   . GLN A 1 376 ? -26.021 -1.653  -47.441 1.00 38.04 ? 376  GLN A OE1   1 
ATOM   3140 N  NE2   . GLN A 1 376 ? -27.146 -1.622  -49.381 1.00 37.67 ? 376  GLN A NE2   1 
ATOM   3141 N  N     . ASN A 1 377 ? -30.810 -3.671  -43.825 1.00 22.44 ? 377  ASN A N     1 
ATOM   3142 C  CA    . ASN A 1 377 ? -31.149 -4.912  -43.102 1.00 23.10 ? 377  ASN A CA    1 
ATOM   3143 C  C     . ASN A 1 377 ? -30.042 -5.965  -43.173 1.00 21.65 ? 377  ASN A C     1 
ATOM   3144 O  O     . ASN A 1 377 ? -30.310 -7.167  -43.097 1.00 22.33 ? 377  ASN A O     1 
ATOM   3145 C  CB    . ASN A 1 377 ? -32.494 -5.507  -43.575 1.00 23.65 ? 377  ASN A CB    1 
ATOM   3146 C  CG    . ASN A 1 377 ? -33.694 -4.680  -43.139 1.00 26.58 ? 377  ASN A CG    1 
ATOM   3147 O  OD1   . ASN A 1 377 ? -33.635 -3.937  -42.161 1.00 29.43 ? 377  ASN A OD1   1 
ATOM   3148 N  ND2   . ASN A 1 377 ? -34.799 -4.815  -43.868 1.00 29.54 ? 377  ASN A ND2   1 
ATOM   3149 N  N     . LYS A 1 378 ? -28.804 -5.501  -43.333 1.00 18.05 ? 378  LYS A N     1 
ATOM   3150 C  CA    . LYS A 1 378 ? -27.653 -6.387  -43.390 1.00 19.03 ? 378  LYS A CA    1 
ATOM   3151 C  C     . LYS A 1 378 ? -27.087 -6.575  -41.993 1.00 17.53 ? 378  LYS A C     1 
ATOM   3152 O  O     . LYS A 1 378 ? -27.245 -5.712  -41.126 1.00 17.31 ? 378  LYS A O     1 
ATOM   3153 C  CB    . LYS A 1 378 ? -26.589 -5.860  -44.367 1.00 18.56 ? 378  LYS A CB    1 
ATOM   3154 C  CG    . LYS A 1 378 ? -27.079 -5.846  -45.817 1.00 21.02 ? 378  LYS A CG    1 
ATOM   3155 C  CD    . LYS A 1 378 ? -25.978 -5.548  -46.822 1.00 26.05 ? 378  LYS A CD    1 
ATOM   3156 C  CE    . LYS A 1 378 ? -26.509 -5.685  -48.251 1.00 29.12 ? 378  LYS A CE    1 
ATOM   3157 N  NZ    . LYS A 1 378 ? -25.518 -5.256  -49.276 1.00 31.49 ? 378  LYS A NZ    1 
ATOM   3158 N  N     . VAL A 1 379 ? -26.442 -7.714  -41.780 1.00 17.46 ? 379  VAL A N     1 
ATOM   3159 C  CA    . VAL A 1 379 ? -25.930 -8.088  -40.464 1.00 17.23 ? 379  VAL A CA    1 
ATOM   3160 C  C     . VAL A 1 379 ? -24.403 -8.112  -40.475 1.00 15.98 ? 379  VAL A C     1 
ATOM   3161 O  O     . VAL A 1 379 ? -23.801 -8.816  -41.292 1.00 16.17 ? 379  VAL A O     1 
ATOM   3162 C  CB    . VAL A 1 379 ? -26.470 -9.476  -40.048 1.00 17.17 ? 379  VAL A CB    1 
ATOM   3163 C  CG1   . VAL A 1 379 ? -25.833 -9.932  -38.756 1.00 17.93 ? 379  VAL A CG1   1 
ATOM   3164 C  CG2   . VAL A 1 379 ? -27.998 -9.436  -39.904 1.00 17.89 ? 379  VAL A CG2   1 
ATOM   3165 N  N     . ILE A 1 380 ? -23.782 -7.371  -39.553 1.00 15.31 ? 380  ILE A N     1 
ATOM   3166 C  CA    . ILE A 1 380 ? -22.316 -7.257  -39.512 1.00 14.38 ? 380  ILE A CA    1 
ATOM   3167 C  C     . ILE A 1 380 ? -21.639 -8.539  -38.992 1.00 14.64 ? 380  ILE A C     1 
ATOM   3168 O  O     . ILE A 1 380 ? -22.204 -9.248  -38.151 1.00 13.69 ? 380  ILE A O     1 
ATOM   3169 C  CB    . ILE A 1 380 ? -21.836 -6.000  -38.712 1.00 14.73 ? 380  ILE A CB    1 
ATOM   3170 C  CG1   . ILE A 1 380 ? -22.048 -6.170  -37.198 1.00 14.12 ? 380  ILE A CG1   1 
ATOM   3171 C  CG2   . ILE A 1 380 ? -22.514 -4.717  -39.242 1.00 13.67 ? 380  ILE A CG2   1 
ATOM   3172 C  CD1   . ILE A 1 380 ? -21.515 -4.998  -36.366 1.00 12.23 ? 380  ILE A CD1   1 
ATOM   3173 N  N     . PRO A 1 381 ? -20.426 -8.843  -39.495 1.00 14.95 ? 381  PRO A N     1 
ATOM   3174 C  CA    . PRO A 1 381 ? -19.725 -10.052 -39.069 1.00 14.49 ? 381  PRO A CA    1 
ATOM   3175 C  C     . PRO A 1 381 ? -19.206 -9.951  -37.633 1.00 15.37 ? 381  PRO A C     1 
ATOM   3176 O  O     . PRO A 1 381 ? -19.010 -8.846  -37.123 1.00 13.75 ? 381  PRO A O     1 
ATOM   3177 C  CB    . PRO A 1 381 ? -18.555 -10.140 -40.059 1.00 17.70 ? 381  PRO A CB    1 
ATOM   3178 C  CG    . PRO A 1 381 ? -18.295 -8.745  -40.470 1.00 14.09 ? 381  PRO A CG    1 
ATOM   3179 C  CD    . PRO A 1 381 ? -19.625 -8.047  -40.450 1.00 15.18 ? 381  PRO A CD    1 
ATOM   3180 N  N     . GLN A 1 382 ? -19.000 -11.094 -36.983 1.00 15.33 ? 382  GLN A N     1 
ATOM   3181 C  CA    . GLN A 1 382 ? -18.366 -11.103 -35.669 1.00 15.83 ? 382  GLN A CA    1 
ATOM   3182 C  C     . GLN A 1 382 ? -16.898 -10.718 -35.802 1.00 17.97 ? 382  GLN A C     1 
ATOM   3183 O  O     . GLN A 1 382 ? -16.235 -11.090 -36.772 1.00 16.43 ? 382  GLN A O     1 
ATOM   3184 C  CB    . GLN A 1 382 ? -18.489 -12.475 -35.000 1.00 16.60 ? 382  GLN A CB    1 
ATOM   3185 C  CG    . GLN A 1 382 ? -18.016 -12.495 -33.548 1.00 18.31 ? 382  GLN A CG    1 
ATOM   3186 C  CD    . GLN A 1 382 ? -18.340 -13.785 -32.818 1.00 21.41 ? 382  GLN A CD    1 
ATOM   3187 O  OE1   . GLN A 1 382 ? -18.494 -14.850 -33.424 1.00 19.93 ? 382  GLN A OE1   1 
ATOM   3188 N  NE2   . GLN A 1 382 ? -18.445 -13.692 -31.497 1.00 24.03 ? 382  GLN A NE2   1 
ATOM   3189 N  N     . GLY A 1 383 ? -16.403 -9.958  -34.830 1.00 17.75 ? 383  GLY A N     1 
ATOM   3190 C  CA    . GLY A 1 383 ? -14.981 -9.657  -34.752 1.00 21.95 ? 383  GLY A CA    1 
ATOM   3191 C  C     . GLY A 1 383 ? -14.228 -10.931 -34.434 1.00 23.88 ? 383  GLY A C     1 
ATOM   3192 O  O     . GLY A 1 383 ? -14.717 -11.775 -33.671 1.00 24.21 ? 383  GLY A O     1 
ATOM   3193 N  N     . ARG A 1 384 ? -13.055 -11.090 -35.040 1.00 24.08 ? 384  ARG A N     1 
ATOM   3194 C  CA    . ARG A 1 384 ? -12.244 -12.293 -34.843 1.00 24.42 ? 384  ARG A CA    1 
ATOM   3195 C  C     . ARG A 1 384 ? -10.827 -11.947 -34.418 1.00 23.41 ? 384  ARG A C     1 
ATOM   3196 O  O     . ARG A 1 384 ? -10.374 -10.818 -34.601 1.00 20.54 ? 384  ARG A O     1 
ATOM   3197 C  CB    . ARG A 1 384 ? -12.198 -13.133 -36.121 1.00 26.67 ? 384  ARG A CB    1 
ATOM   3198 C  CG    . ARG A 1 384 ? -13.468 -13.903 -36.402 1.00 31.49 ? 384  ARG A CG    1 
ATOM   3199 C  CD    . ARG A 1 384 ? -13.559 -14.270 -37.867 1.00 37.10 ? 384  ARG A CD    1 
ATOM   3200 N  NE    . ARG A 1 384 ? -14.617 -15.250 -38.102 1.00 43.33 ? 384  ARG A NE    1 
ATOM   3201 C  CZ    . ARG A 1 384 ? -15.894 -14.953 -38.336 1.00 45.42 ? 384  ARG A CZ    1 
ATOM   3202 N  NH1   . ARG A 1 384 ? -16.311 -13.686 -38.378 1.00 42.71 ? 384  ARG A NH1   1 
ATOM   3203 N  NH2   . ARG A 1 384 ? -16.760 -15.938 -38.532 1.00 46.64 ? 384  ARG A NH2   1 
ATOM   3204 N  N     . SER A 1 385 ? -10.144 -12.942 -33.859 1.00 23.09 ? 385  SER A N     1 
ATOM   3205 C  CA    . SER A 1 385 ? -8.752  -12.834 -33.441 1.00 23.69 ? 385  SER A CA    1 
ATOM   3206 C  C     . SER A 1 385 ? -7.819  -13.001 -34.639 1.00 21.41 ? 385  SER A C     1 
ATOM   3207 O  O     . SER A 1 385 ? -7.995  -13.919 -35.441 1.00 20.73 ? 385  SER A O     1 
ATOM   3208 C  CB    . SER A 1 385 ? -8.452  -13.908 -32.388 1.00 24.47 ? 385  SER A CB    1 
ATOM   3209 O  OG    . SER A 1 385 ? -7.095  -13.873 -31.963 1.00 31.18 ? 385  SER A OG    1 
ATOM   3210 N  N     . HIS A 1 386 ? -6.830  -12.116 -34.760 1.00 18.44 ? 386  HIS A N     1 
ATOM   3211 C  CA    . HIS A 1 386 ? -5.811  -12.252 -35.808 1.00 17.44 ? 386  HIS A CA    1 
ATOM   3212 C  C     . HIS A 1 386 ? -4.420  -11.997 -35.252 1.00 14.74 ? 386  HIS A C     1 
ATOM   3213 O  O     . HIS A 1 386 ? -4.236  -11.076 -34.453 1.00 15.08 ? 386  HIS A O     1 
ATOM   3214 C  CB    . HIS A 1 386 ? -6.065  -11.292 -36.978 1.00 15.31 ? 386  HIS A CB    1 
ATOM   3215 C  CG    . HIS A 1 386 ? -7.467  -11.322 -37.497 1.00 16.91 ? 386  HIS A CG    1 
ATOM   3216 N  ND1   . HIS A 1 386 ? -7.900  -12.244 -38.428 1.00 16.02 ? 386  HIS A ND1   1 
ATOM   3217 C  CD2   . HIS A 1 386 ? -8.537  -10.544 -37.210 1.00 17.09 ? 386  HIS A CD2   1 
ATOM   3218 C  CE1   . HIS A 1 386 ? -9.177  -12.030 -38.691 1.00 20.02 ? 386  HIS A CE1   1 
ATOM   3219 N  NE2   . HIS A 1 386 ? -9.585  -11.002 -37.968 1.00 19.76 ? 386  HIS A NE2   1 
ATOM   3220 N  N     . PRO A 1 387 ? -3.430  -12.809 -35.670 1.00 16.68 ? 387  PRO A N     1 
ATOM   3221 C  CA    . PRO A 1 387 ? -2.059  -12.488 -35.272 1.00 17.87 ? 387  PRO A CA    1 
ATOM   3222 C  C     . PRO A 1 387 ? -1.563  -11.253 -36.024 1.00 17.26 ? 387  PRO A C     1 
ATOM   3223 O  O     . PRO A 1 387 ? -1.916  -11.065 -37.184 1.00 17.01 ? 387  PRO A O     1 
ATOM   3224 C  CB    . PRO A 1 387 ? -1.262  -13.730 -35.691 1.00 18.09 ? 387  PRO A CB    1 
ATOM   3225 C  CG    . PRO A 1 387 ? -2.066  -14.356 -36.786 1.00 19.26 ? 387  PRO A CG    1 
ATOM   3226 C  CD    . PRO A 1 387 ? -3.508  -14.023 -36.509 1.00 16.49 ? 387  PRO A CD    1 
ATOM   3227 N  N     . VAL A 1 388 ? -0.762  -10.422 -35.364 1.00 18.08 ? 388  VAL A N     1 
ATOM   3228 C  CA    . VAL A 1 388 ? -0.165  -9.250  -36.008 1.00 18.52 ? 388  VAL A CA    1 
ATOM   3229 C  C     . VAL A 1 388 ? 0.837   -9.708  -37.075 1.00 19.11 ? 388  VAL A C     1 
ATOM   3230 O  O     . VAL A 1 388 ? 1.729   -10.520 -36.802 1.00 16.19 ? 388  VAL A O     1 
ATOM   3231 C  CB    . VAL A 1 388 ? 0.500   -8.302  -34.979 1.00 19.85 ? 388  VAL A CB    1 
ATOM   3232 C  CG1   . VAL A 1 388 ? 1.157   -7.099  -35.668 1.00 20.90 ? 388  VAL A CG1   1 
ATOM   3233 C  CG2   . VAL A 1 388 ? -0.526  -7.829  -33.947 1.00 21.04 ? 388  VAL A CG2   1 
ATOM   3234 N  N     . GLN A 1 389 ? 0.654   -9.209  -38.296 1.00 17.64 ? 389  GLN A N     1 
ATOM   3235 C  CA    . GLN A 1 389 ? 1.529   -9.554  -39.418 1.00 18.61 ? 389  GLN A CA    1 
ATOM   3236 C  C     . GLN A 1 389 ? 1.974   -8.292  -40.165 1.00 17.51 ? 389  GLN A C     1 
ATOM   3237 O  O     . GLN A 1 389 ? 1.132   -7.515  -40.628 1.00 18.80 ? 389  GLN A O     1 
ATOM   3238 C  CB    . GLN A 1 389 ? 0.818   -10.536 -40.360 1.00 18.99 ? 389  GLN A CB    1 
ATOM   3239 C  CG    . GLN A 1 389 ? 1.454   -10.710 -41.743 1.00 23.61 ? 389  GLN A CG    1 
ATOM   3240 C  CD    . GLN A 1 389 ? 2.742   -11.517 -41.725 1.00 26.32 ? 389  GLN A CD    1 
ATOM   3241 O  OE1   . GLN A 1 389 ? 3.826   -10.990 -41.995 1.00 27.79 ? 389  GLN A OE1   1 
ATOM   3242 N  NE2   . GLN A 1 389 ? 2.630   -12.804 -41.413 1.00 26.32 ? 389  GLN A NE2   1 
ATOM   3243 N  N     . PRO A 1 390 ? 3.298   -8.077  -40.276 1.00 18.25 ? 390  PRO A N     1 
ATOM   3244 C  CA    . PRO A 1 390 ? 3.794   -6.973  -41.097 1.00 17.34 ? 390  PRO A CA    1 
ATOM   3245 C  C     . PRO A 1 390 ? 3.344   -7.124  -42.549 1.00 15.56 ? 390  PRO A C     1 
ATOM   3246 O  O     . PRO A 1 390 ? 3.187   -8.247  -43.032 1.00 16.07 ? 390  PRO A O     1 
ATOM   3247 C  CB    . PRO A 1 390 ? 5.317   -7.113  -40.996 1.00 18.67 ? 390  PRO A CB    1 
ATOM   3248 C  CG    . PRO A 1 390 ? 5.545   -7.830  -39.695 1.00 21.48 ? 390  PRO A CG    1 
ATOM   3249 C  CD    . PRO A 1 390 ? 4.395   -8.795  -39.594 1.00 19.37 ? 390  PRO A CD    1 
ATOM   3250 N  N     . TYR A 1 391 ? 3.123   -6.006  -43.231 1.00 14.75 ? 391  TYR A N     1 
ATOM   3251 C  CA    . TYR A 1 391 ? 2.741   -6.038  -44.647 1.00 14.66 ? 391  TYR A CA    1 
ATOM   3252 C  C     . TYR A 1 391 ? 3.308   -4.840  -45.402 1.00 14.67 ? 391  TYR A C     1 
ATOM   3253 O  O     . TYR A 1 391 ? 3.663   -3.844  -44.777 1.00 12.87 ? 391  TYR A O     1 
ATOM   3254 C  CB    . TYR A 1 391 ? 1.220   -6.146  -44.816 1.00 14.15 ? 391  TYR A CB    1 
ATOM   3255 C  CG    . TYR A 1 391 ? 0.413   -4.938  -44.389 1.00 15.68 ? 391  TYR A CG    1 
ATOM   3256 C  CD1   . TYR A 1 391 ? -0.034  -4.804  -43.071 1.00 13.93 ? 391  TYR A CD1   1 
ATOM   3257 C  CD2   . TYR A 1 391 ? 0.060   -3.948  -45.313 1.00 14.80 ? 391  TYR A CD2   1 
ATOM   3258 C  CE1   . TYR A 1 391 ? -0.801  -3.702  -42.675 1.00 14.33 ? 391  TYR A CE1   1 
ATOM   3259 C  CE2   . TYR A 1 391 ? -0.714  -2.834  -44.927 1.00 15.62 ? 391  TYR A CE2   1 
ATOM   3260 C  CZ    . TYR A 1 391 ? -1.138  -2.726  -43.609 1.00 16.99 ? 391  TYR A CZ    1 
ATOM   3261 O  OH    . TYR A 1 391 ? -1.896  -1.649  -43.219 1.00 14.95 ? 391  TYR A OH    1 
ATOM   3262 N  N     . PRO A 1 392 ? 3.414   -4.939  -46.741 1.00 14.11 ? 392  PRO A N     1 
ATOM   3263 C  CA    . PRO A 1 392 ? 4.103   -3.863  -47.467 1.00 14.92 ? 392  PRO A CA    1 
ATOM   3264 C  C     . PRO A 1 392 ? 3.260   -2.605  -47.663 1.00 14.16 ? 392  PRO A C     1 
ATOM   3265 O  O     . PRO A 1 392 ? 2.034   -2.679  -47.808 1.00 13.16 ? 392  PRO A O     1 
ATOM   3266 C  CB    . PRO A 1 392 ? 4.441   -4.496  -48.821 1.00 15.30 ? 392  PRO A CB    1 
ATOM   3267 C  CG    . PRO A 1 392 ? 3.500   -5.617  -48.976 1.00 18.04 ? 392  PRO A CG    1 
ATOM   3268 C  CD    . PRO A 1 392 ? 3.136   -6.104  -47.604 1.00 13.51 ? 392  PRO A CD    1 
ATOM   3269 N  N     . GLY A 1 393 ? 3.943   -1.464  -47.652 1.00 14.02 ? 393  GLY A N     1 
ATOM   3270 C  CA    . GLY A 1 393 ? 3.314   -0.169  -47.799 1.00 13.06 ? 393  GLY A CA    1 
ATOM   3271 C  C     . GLY A 1 393 ? 3.645   0.476   -49.126 1.00 13.79 ? 393  GLY A C     1 
ATOM   3272 O  O     . GLY A 1 393 ? 3.559   -0.159  -50.185 1.00 14.53 ? 393  GLY A O     1 
ATOM   3273 N  N     . ALA A 1 394 ? 4.024   1.746   -49.061 1.00 13.18 ? 394  ALA A N     1 
ATOM   3274 C  CA    . ALA A 1 394 ? 4.236   2.562   -50.247 1.00 13.27 ? 394  ALA A CA    1 
ATOM   3275 C  C     . ALA A 1 394 ? 5.643   2.429   -50.826 1.00 14.17 ? 394  ALA A C     1 
ATOM   3276 O  O     . ALA A 1 394 ? 6.553   1.909   -50.178 1.00 13.43 ? 394  ALA A O     1 
ATOM   3277 C  CB    . ALA A 1 394 ? 3.953   4.019   -49.919 1.00 14.12 ? 394  ALA A CB    1 
ATOM   3278 N  N     . PHE A 1 395 ? 5.800   2.922   -52.053 1.00 13.52 ? 395  PHE A N     1 
ATOM   3279 C  CA    . PHE A 1 395 ? 7.094   3.006   -52.710 1.00 14.64 ? 395  PHE A CA    1 
ATOM   3280 C  C     . PHE A 1 395 ? 7.674   4.411   -52.582 1.00 13.82 ? 395  PHE A C     1 
ATOM   3281 O  O     . PHE A 1 395 ? 6.966   5.403   -52.736 1.00 12.46 ? 395  PHE A O     1 
ATOM   3282 C  CB    . PHE A 1 395 ? 6.980   2.624   -54.190 1.00 14.85 ? 395  PHE A CB    1 
ATOM   3283 C  CG    . PHE A 1 395 ? 8.272   2.782   -54.960 1.00 16.46 ? 395  PHE A CG    1 
ATOM   3284 C  CD1   . PHE A 1 395 ? 9.287   1.832   -54.851 1.00 16.22 ? 395  PHE A CD1   1 
ATOM   3285 C  CD2   . PHE A 1 395 ? 8.476   3.885   -55.782 1.00 18.20 ? 395  PHE A CD2   1 
ATOM   3286 C  CE1   . PHE A 1 395 ? 10.484  1.979   -55.555 1.00 19.64 ? 395  PHE A CE1   1 
ATOM   3287 C  CE2   . PHE A 1 395 ? 9.681   4.040   -56.491 1.00 17.09 ? 395  PHE A CE2   1 
ATOM   3288 C  CZ    . PHE A 1 395 ? 10.675  3.085   -56.374 1.00 15.18 ? 395  PHE A CZ    1 
ATOM   3289 N  N     . VAL A 1 396 ? 8.971   4.482   -52.305 1.00 14.41 ? 396  VAL A N     1 
ATOM   3290 C  CA    . VAL A 1 396 ? 9.701   5.752   -52.288 1.00 14.78 ? 396  VAL A CA    1 
ATOM   3291 C  C     . VAL A 1 396 ? 10.941  5.615   -53.172 1.00 13.97 ? 396  VAL A C     1 
ATOM   3292 O  O     . VAL A 1 396 ? 11.743  4.700   -52.980 1.00 13.10 ? 396  VAL A O     1 
ATOM   3293 C  CB    . VAL A 1 396 ? 10.128  6.163   -50.858 1.00 15.31 ? 396  VAL A CB    1 
ATOM   3294 C  CG1   . VAL A 1 396 ? 10.741  7.555   -50.865 1.00 14.63 ? 396  VAL A CG1   1 
ATOM   3295 C  CG2   . VAL A 1 396 ? 8.935   6.110   -49.885 1.00 14.11 ? 396  VAL A CG2   1 
ATOM   3296 N  N     . LYS A 1 397 ? 11.079  6.520   -54.139 1.00 14.49 ? 397  LYS A N     1 
ATOM   3297 C  CA    . LYS A 1 397 ? 12.222  6.537   -55.067 1.00 13.74 ? 397  LYS A CA    1 
ATOM   3298 C  C     . LYS A 1 397 ? 13.483  7.053   -54.383 1.00 13.32 ? 397  LYS A C     1 
ATOM   3299 O  O     . LYS A 1 397 ? 13.425  7.997   -53.605 1.00 13.94 ? 397  LYS A O     1 
ATOM   3300 C  CB    . LYS A 1 397 ? 11.897  7.434   -56.264 1.00 13.35 ? 397  LYS A CB    1 
ATOM   3301 C  CG    . LYS A 1 397 ? 12.953  7.453   -57.366 1.00 12.97 ? 397  LYS A CG    1 
ATOM   3302 C  CD    . LYS A 1 397 ? 12.526  8.343   -58.525 1.00 14.47 ? 397  LYS A CD    1 
ATOM   3303 C  CE    . LYS A 1 397 ? 13.649  8.482   -59.560 1.00 18.47 ? 397  LYS A CE    1 
ATOM   3304 N  NZ    . LYS A 1 397 ? 13.993  7.180   -60.197 1.00 15.21 ? 397  LYS A NZ    1 
ATOM   3305 N  N     . GLU A 1 398 ? 14.624  6.438   -54.682 1.00 13.15 ? 398  GLU A N     1 
ATOM   3306 C  CA    . GLU A 1 398 ? 15.906  6.928   -54.181 1.00 14.69 ? 398  GLU A CA    1 
ATOM   3307 C  C     . GLU A 1 398 ? 16.361  8.101   -55.048 1.00 15.23 ? 398  GLU A C     1 
ATOM   3308 O  O     . GLU A 1 398 ? 16.631  7.920   -56.234 1.00 13.16 ? 398  GLU A O     1 
ATOM   3309 C  CB    . GLU A 1 398 ? 16.962  5.819   -54.194 1.00 15.31 ? 398  GLU A CB    1 
ATOM   3310 C  CG    . GLU A 1 398 ? 18.263  6.195   -53.467 1.00 18.49 ? 398  GLU A CG    1 
ATOM   3311 C  CD    . GLU A 1 398 ? 18.105  6.189   -51.959 1.00 16.99 ? 398  GLU A CD    1 
ATOM   3312 O  OE1   . GLU A 1 398 ? 17.876  5.106   -51.396 1.00 16.85 ? 398  GLU A OE1   1 
ATOM   3313 O  OE2   . GLU A 1 398 ? 18.203  7.263   -51.333 1.00 17.93 ? 398  GLU A OE2   1 
ATOM   3314 N  N     . PRO A 1 399 ? 16.438  9.309   -54.466 1.00 13.60 ? 399  PRO A N     1 
ATOM   3315 C  CA    . PRO A 1 399 ? 16.860  10.431  -55.303 1.00 14.13 ? 399  PRO A CA    1 
ATOM   3316 C  C     . PRO A 1 399 ? 18.379  10.521  -55.383 1.00 15.93 ? 399  PRO A C     1 
ATOM   3317 O  O     . PRO A 1 399 ? 19.074  10.100  -54.457 1.00 15.61 ? 399  PRO A O     1 
ATOM   3318 C  CB    . PRO A 1 399 ? 16.300  11.645  -54.558 1.00 14.02 ? 399  PRO A CB    1 
ATOM   3319 C  CG    . PRO A 1 399 ? 16.313  11.227  -53.111 1.00 13.76 ? 399  PRO A CG    1 
ATOM   3320 C  CD    . PRO A 1 399 ? 16.161  9.721   -53.076 1.00 12.51 ? 399  PRO A CD    1 
ATOM   3321 N  N     . ILE A 1 400 ? 18.890  11.053  -56.489 1.00 14.06 ? 400  ILE A N     1 
ATOM   3322 C  CA    . ILE A 1 400 ? 20.302  11.392  -56.570 1.00 13.63 ? 400  ILE A CA    1 
ATOM   3323 C  C     . ILE A 1 400 ? 20.535  12.664  -55.746 1.00 13.96 ? 400  ILE A C     1 
ATOM   3324 O  O     . ILE A 1 400 ? 19.941  13.708  -56.032 1.00 14.32 ? 400  ILE A O     1 
ATOM   3325 C  CB    . ILE A 1 400 ? 20.756  11.594  -58.029 1.00 13.61 ? 400  ILE A CB    1 
ATOM   3326 C  CG1   . ILE A 1 400 ? 20.596  10.287  -58.817 1.00 15.66 ? 400  ILE A CG1   1 
ATOM   3327 C  CG2   . ILE A 1 400 ? 22.212  12.097  -58.082 1.00 13.48 ? 400  ILE A CG2   1 
ATOM   3328 C  CD1   . ILE A 1 400 ? 20.708  10.444  -60.338 1.00 18.35 ? 400  ILE A CD1   1 
ATOM   3329 N  N     . PRO A 1 401 ? 21.385  12.580  -54.707 1.00 14.09 ? 401  PRO A N     1 
ATOM   3330 C  CA    . PRO A 1 401 ? 21.569  13.783  -53.901 1.00 14.17 ? 401  PRO A CA    1 
ATOM   3331 C  C     . PRO A 1 401 ? 22.211  14.872  -54.744 1.00 12.76 ? 401  PRO A C     1 
ATOM   3332 O  O     . PRO A 1 401 ? 23.219  14.635  -55.410 1.00 12.79 ? 401  PRO A O     1 
ATOM   3333 C  CB    . PRO A 1 401 ? 22.495  13.322  -52.768 1.00 14.08 ? 401  PRO A CB    1 
ATOM   3334 C  CG    . PRO A 1 401 ? 22.295  11.826  -52.704 1.00 17.63 ? 401  PRO A CG    1 
ATOM   3335 C  CD    . PRO A 1 401 ? 22.095  11.418  -54.141 1.00 15.38 ? 401  PRO A CD    1 
ATOM   3336 N  N     . ASN A 1 402 ? 21.590  16.042  -54.758 1.00 12.15 ? 402  ASN A N     1 
ATOM   3337 C  CA    . ASN A 1 402 ? 22.043  17.127  -55.623 1.00 12.67 ? 402  ASN A CA    1 
ATOM   3338 C  C     . ASN A 1 402 ? 21.263  18.395  -55.348 1.00 11.91 ? 402  ASN A C     1 
ATOM   3339 O  O     . ASN A 1 402 ? 20.274  18.376  -54.617 1.00 11.80 ? 402  ASN A O     1 
ATOM   3340 C  CB    . ASN A 1 402 ? 21.882  16.742  -57.098 1.00 11.65 ? 402  ASN A CB    1 
ATOM   3341 C  CG    . ASN A 1 402 ? 22.934  17.376  -57.988 1.00 14.42 ? 402  ASN A CG    1 
ATOM   3342 O  OD1   . ASN A 1 402 ? 23.718  18.219  -57.546 1.00 15.19 ? 402  ASN A OD1   1 
ATOM   3343 N  ND2   . ASN A 1 402 ? 22.957  16.969  -59.253 1.00 12.66 ? 402  ASN A ND2   1 
ATOM   3344 N  N     . ARG A 1 403 ? 21.742  19.500  -55.912 1.00 13.07 ? 403  ARG A N     1 
ATOM   3345 C  CA    . ARG A 1 403 ? 20.933  20.697  -56.056 1.00 12.56 ? 403  ARG A CA    1 
ATOM   3346 C  C     . ARG A 1 403 ? 20.015  20.468  -57.251 1.00 13.36 ? 403  ARG A C     1 
ATOM   3347 O  O     . ARG A 1 403 ? 20.405  19.802  -58.214 1.00 14.60 ? 403  ARG A O     1 
ATOM   3348 C  CB    . ARG A 1 403 ? 21.820  21.933  -56.276 1.00 13.23 ? 403  ARG A CB    1 
ATOM   3349 C  CG    . ARG A 1 403 ? 22.652  21.913  -57.564 1.00 13.13 ? 403  ARG A CG    1 
ATOM   3350 C  CD    . ARG A 1 403 ? 23.421  23.215  -57.772 1.00 15.54 ? 403  ARG A CD    1 
ATOM   3351 N  NE    . ARG A 1 403 ? 24.503  23.358  -56.808 1.00 16.46 ? 403  ARG A NE    1 
ATOM   3352 C  CZ    . ARG A 1 403 ? 25.363  24.374  -56.772 1.00 19.48 ? 403  ARG A CZ    1 
ATOM   3353 N  NH1   . ARG A 1 403 ? 25.277  25.367  -57.647 1.00 16.00 ? 403  ARG A NH1   1 
ATOM   3354 N  NH2   . ARG A 1 403 ? 26.316  24.394  -55.851 1.00 18.05 ? 403  ARG A NH2   1 
ATOM   3355 N  N     . TYR A 1 404 ? 18.793  20.990  -57.176 1.00 11.82 ? 404  TYR A N     1 
ATOM   3356 C  CA    . TYR A 1 404 ? 17.844  20.920  -58.293 1.00 12.40 ? 404  TYR A CA    1 
ATOM   3357 C  C     . TYR A 1 404 ? 17.241  22.298  -58.536 1.00 12.67 ? 404  TYR A C     1 
ATOM   3358 O  O     . TYR A 1 404 ? 16.503  22.818  -57.687 1.00 11.76 ? 404  TYR A O     1 
ATOM   3359 C  CB    . TYR A 1 404 ? 16.758  19.868  -58.019 1.00 13.78 ? 404  TYR A CB    1 
ATOM   3360 C  CG    . TYR A 1 404 ? 17.300  18.455  -58.073 1.00 13.48 ? 404  TYR A CG    1 
ATOM   3361 C  CD1   . TYR A 1 404 ? 17.316  17.736  -59.277 1.00 13.47 ? 404  TYR A CD1   1 
ATOM   3362 C  CD2   . TYR A 1 404 ? 17.839  17.852  -56.935 1.00 14.51 ? 404  TYR A CD2   1 
ATOM   3363 C  CE1   . TYR A 1 404 ? 17.829  16.441  -59.331 1.00 10.83 ? 404  TYR A CE1   1 
ATOM   3364 C  CE2   . TYR A 1 404 ? 18.365  16.562  -56.979 1.00 10.67 ? 404  TYR A CE2   1 
ATOM   3365 C  CZ    . TYR A 1 404 ? 18.358  15.865  -58.179 1.00 12.49 ? 404  TYR A CZ    1 
ATOM   3366 O  OH    . TYR A 1 404 ? 18.875  14.590  -58.219 1.00 13.61 ? 404  TYR A OH    1 
ATOM   3367 N  N     . LYS A 1 405 ? 17.570  22.890  -59.688 1.00 11.93 ? 405  LYS A N     1 
ATOM   3368 C  CA    . LYS A 1 405 ? 17.262  24.294  -59.942 1.00 11.75 ? 405  LYS A CA    1 
ATOM   3369 C  C     . LYS A 1 405 ? 15.768  24.570  -60.115 1.00 13.80 ? 405  LYS A C     1 
ATOM   3370 O  O     . LYS A 1 405 ? 15.184  25.322  -59.331 1.00 13.00 ? 405  LYS A O     1 
ATOM   3371 C  CB    . LYS A 1 405 ? 18.066  24.835  -61.130 1.00 13.99 ? 405  LYS A CB    1 
ATOM   3372 C  CG    . LYS A 1 405 ? 18.000  26.351  -61.271 1.00 16.32 ? 405  LYS A CG    1 
ATOM   3373 C  CD    . LYS A 1 405 ? 18.823  26.865  -62.450 1.00 19.86 ? 405  LYS A CD    1 
ATOM   3374 C  CE    . LYS A 1 405 ? 18.784  28.389  -62.506 1.00 23.58 ? 405  LYS A CE    1 
ATOM   3375 N  NZ    . LYS A 1 405 ? 19.737  28.997  -63.500 1.00 25.76 ? 405  LYS A NZ    1 
ATOM   3376 N  N     . TYR A 1 406 ? 15.165  23.979  -61.145 1.00 11.87 ? 406  TYR A N     1 
ATOM   3377 C  CA    . TYR A 1 406 ? 13.736  24.162  -61.405 1.00 14.54 ? 406  TYR A CA    1 
ATOM   3378 C  C     . TYR A 1 406 ? 13.015  22.849  -61.162 1.00 13.05 ? 406  TYR A C     1 
ATOM   3379 O  O     . TYR A 1 406 ? 13.379  21.820  -61.736 1.00 14.53 ? 406  TYR A O     1 
ATOM   3380 C  CB    . TYR A 1 406 ? 13.482  24.649  -62.839 1.00 12.59 ? 406  TYR A CB    1 
ATOM   3381 C  CG    . TYR A 1 406 ? 13.975  26.054  -63.144 1.00 14.45 ? 406  TYR A CG    1 
ATOM   3382 C  CD1   . TYR A 1 406 ? 15.145  26.264  -63.886 1.00 14.13 ? 406  TYR A CD1   1 
ATOM   3383 C  CD2   . TYR A 1 406 ? 13.262  27.172  -62.706 1.00 13.73 ? 406  TYR A CD2   1 
ATOM   3384 C  CE1   . TYR A 1 406 ? 15.596  27.557  -64.173 1.00 14.91 ? 406  TYR A CE1   1 
ATOM   3385 C  CE2   . TYR A 1 406 ? 13.701  28.459  -62.976 1.00 15.55 ? 406  TYR A CE2   1 
ATOM   3386 C  CZ    . TYR A 1 406 ? 14.866  28.648  -63.711 1.00 18.00 ? 406  TYR A CZ    1 
ATOM   3387 O  OH    . TYR A 1 406 ? 15.293  29.930  -63.975 1.00 17.41 ? 406  TYR A OH    1 
ATOM   3388 N  N     . VAL A 1 407 ? 12.002  22.886  -60.300 1.00 13.39 ? 407  VAL A N     1 
ATOM   3389 C  CA    . VAL A 1 407 ? 11.244  21.690  -59.942 1.00 12.51 ? 407  VAL A CA    1 
ATOM   3390 C  C     . VAL A 1 407 ? 9.742   21.972  -60.003 1.00 13.19 ? 407  VAL A C     1 
ATOM   3391 O  O     . VAL A 1 407 ? 9.274   23.014  -59.532 1.00 12.65 ? 407  VAL A O     1 
ATOM   3392 C  CB    . VAL A 1 407 ? 11.620  21.162  -58.518 1.00 11.98 ? 407  VAL A CB    1 
ATOM   3393 C  CG1   . VAL A 1 407 ? 10.671  20.041  -58.062 1.00 12.21 ? 407  VAL A CG1   1 
ATOM   3394 C  CG2   . VAL A 1 407 ? 13.072  20.671  -58.464 1.00 13.69 ? 407  VAL A CG2   1 
ATOM   3395 N  N     . MET A 1 408 ? 9.003   21.035  -60.588 1.00 12.71 ? 408  MET A N     1 
ATOM   3396 C  CA    . MET A 1 408 ? 7.552   21.029  -60.506 1.00 15.47 ? 408  MET A CA    1 
ATOM   3397 C  C     . MET A 1 408 ? 7.113   19.703  -59.934 1.00 15.01 ? 408  MET A C     1 
ATOM   3398 O  O     . MET A 1 408 ? 7.556   18.656  -60.397 1.00 15.41 ? 408  MET A O     1 
ATOM   3399 C  CB    . MET A 1 408 ? 6.921   21.226  -61.881 1.00 18.17 ? 408  MET A CB    1 
ATOM   3400 C  CG    . MET A 1 408 ? 6.707   22.667  -62.254 1.00 24.87 ? 408  MET A CG    1 
ATOM   3401 S  SD    . MET A 1 408 ? 5.448   22.821  -63.541 1.00 32.23 ? 408  MET A SD    1 
ATOM   3402 C  CE    . MET A 1 408 ? 6.329   22.040  -64.892 1.00 14.70 ? 408  MET A CE    1 
ATOM   3403 N  N     . SER A 1 409 ? 6.250   19.747  -58.923 1.00 12.52 ? 409  SER A N     1 
ATOM   3404 C  CA    . SER A 1 409 ? 5.777   18.526  -58.290 1.00 12.82 ? 409  SER A CA    1 
ATOM   3405 C  C     . SER A 1 409 ? 4.307   18.275  -58.617 1.00 13.23 ? 409  SER A C     1 
ATOM   3406 O  O     . SER A 1 409 ? 3.563   19.208  -58.940 1.00 12.63 ? 409  SER A O     1 
ATOM   3407 C  CB    . SER A 1 409 ? 5.996   18.575  -56.777 1.00 12.20 ? 409  SER A CB    1 
ATOM   3408 O  OG    . SER A 1 409 ? 5.159   19.538  -56.177 1.00 13.18 ? 409  SER A OG    1 
ATOM   3409 N  N     . PHE A 1 410 ? 3.910   17.007  -58.564 1.00 12.70 ? 410  PHE A N     1 
ATOM   3410 C  CA    . PHE A 1 410 ? 2.531   16.596  -58.848 1.00 12.05 ? 410  PHE A CA    1 
ATOM   3411 C  C     . PHE A 1 410 ? 2.160   15.539  -57.833 1.00 12.95 ? 410  PHE A C     1 
ATOM   3412 O  O     . PHE A 1 410 ? 3.012   14.749  -57.417 1.00 13.41 ? 410  PHE A O     1 
ATOM   3413 C  CB    . PHE A 1 410 ? 2.416   16.003  -60.262 1.00 13.05 ? 410  PHE A CB    1 
ATOM   3414 C  CG    . PHE A 1 410 ? 2.711   16.985  -61.365 1.00 14.46 ? 410  PHE A CG    1 
ATOM   3415 C  CD1   . PHE A 1 410 ? 4.024   17.342  -61.669 1.00 16.05 ? 410  PHE A CD1   1 
ATOM   3416 C  CD2   . PHE A 1 410 ? 1.673   17.534  -62.118 1.00 14.22 ? 410  PHE A CD2   1 
ATOM   3417 C  CE1   . PHE A 1 410 ? 4.300   18.258  -62.678 1.00 12.71 ? 410  PHE A CE1   1 
ATOM   3418 C  CE2   . PHE A 1 410 ? 1.939   18.447  -63.137 1.00 15.40 ? 410  PHE A CE2   1 
ATOM   3419 C  CZ    . PHE A 1 410 ? 3.256   18.806  -63.422 1.00 15.53 ? 410  PHE A CZ    1 
ATOM   3420 N  N     . ASP A 1 411 ? 0.889   15.516  -57.445 1.00 12.81 ? 411  ASP A N     1 
ATOM   3421 C  CA    . ASP A 1 411 ? 0.449   14.678  -56.349 1.00 13.61 ? 411  ASP A CA    1 
ATOM   3422 C  C     . ASP A 1 411 ? -0.977  14.180  -56.598 1.00 12.80 ? 411  ASP A C     1 
ATOM   3423 O  O     . ASP A 1 411 ? -1.811  14.908  -57.139 1.00 14.06 ? 411  ASP A O     1 
ATOM   3424 C  CB    . ASP A 1 411 ? 0.540   15.480  -55.041 1.00 18.33 ? 411  ASP A CB    1 
ATOM   3425 C  CG    . ASP A 1 411 ? -0.045  14.746  -53.874 1.00 20.14 ? 411  ASP A CG    1 
ATOM   3426 O  OD1   . ASP A 1 411 ? -1.183  15.046  -53.499 1.00 26.51 ? 411  ASP A OD1   1 
ATOM   3427 O  OD2   . ASP A 1 411 ? 0.608   13.831  -53.353 1.00 28.49 ? 411  ASP A OD2   1 
ATOM   3428 N  N     . LEU A 1 412 ? -1.242  12.935  -56.213 1.00 14.14 ? 412  LEU A N     1 
ATOM   3429 C  CA    . LEU A 1 412 ? -2.564  12.322  -56.385 1.00 14.41 ? 412  LEU A CA    1 
ATOM   3430 C  C     . LEU A 1 412 ? -3.521  12.725  -55.270 1.00 15.46 ? 412  LEU A C     1 
ATOM   3431 O  O     . LEU A 1 412 ? -3.168  12.663  -54.089 1.00 16.58 ? 412  LEU A O     1 
ATOM   3432 C  CB    . LEU A 1 412 ? -2.431  10.794  -56.452 1.00 13.37 ? 412  LEU A CB    1 
ATOM   3433 C  CG    . LEU A 1 412 ? -1.856  10.255  -57.777 1.00 12.08 ? 412  LEU A CG    1 
ATOM   3434 C  CD1   . LEU A 1 412 ? -1.090  8.979   -57.568 1.00 10.79 ? 412  LEU A CD1   1 
ATOM   3435 C  CD2   . LEU A 1 412 ? -2.975  10.055  -58.813 1.00 13.88 ? 412  LEU A CD2   1 
ATOM   3436 N  N     . THR A 1 413 ? -4.729  13.146  -55.648 1.00 13.89 ? 413  THR A N     1 
ATOM   3437 C  CA    . THR A 1 413 ? -5.769  13.498  -54.679 1.00 16.18 ? 413  THR A CA    1 
ATOM   3438 C  C     . THR A 1 413 ? -6.151  12.297  -53.816 1.00 14.91 ? 413  THR A C     1 
ATOM   3439 O  O     . THR A 1 413 ? -6.422  11.219  -54.340 1.00 13.73 ? 413  THR A O     1 
ATOM   3440 C  CB    . THR A 1 413 ? -7.035  14.039  -55.389 1.00 16.01 ? 413  THR A CB    1 
ATOM   3441 O  OG1   . THR A 1 413 ? -6.672  15.155  -56.211 1.00 18.87 ? 413  THR A OG1   1 
ATOM   3442 C  CG2   . THR A 1 413 ? -8.096  14.483  -54.377 1.00 16.49 ? 413  THR A CG2   1 
ATOM   3443 N  N     . SER A 1 414 ? -6.143  12.497  -52.496 1.00 13.28 ? 414  SER A N     1 
ATOM   3444 C  CA    . SER A 1 414 ? -6.605  11.494  -51.527 1.00 15.08 ? 414  SER A CA    1 
ATOM   3445 C  C     . SER A 1 414 ? -6.346  10.057  -52.000 1.00 13.90 ? 414  SER A C     1 
ATOM   3446 O  O     . SER A 1 414 ? -7.282  9.310   -52.273 1.00 12.68 ? 414  SER A O     1 
ATOM   3447 C  CB    . SER A 1 414 ? -8.102  11.724  -51.247 1.00 16.68 ? 414  SER A CB    1 
ATOM   3448 O  OG    . SER A 1 414 ? -8.586  10.884  -50.221 1.00 24.35 ? 414  SER A OG    1 
ATOM   3449 N  N     . LEU A 1 415 ? -5.077  9.675   -52.108 1.00 12.39 ? 415  LEU A N     1 
ATOM   3450 C  CA    . LEU A 1 415 ? -4.742  8.459   -52.854 1.00 13.65 ? 415  LEU A CA    1 
ATOM   3451 C  C     . LEU A 1 415 ? -5.408  7.182   -52.353 1.00 12.20 ? 415  LEU A C     1 
ATOM   3452 O  O     . LEU A 1 415 ? -6.090  6.504   -53.122 1.00 12.33 ? 415  LEU A O     1 
ATOM   3453 C  CB    . LEU A 1 415 ? -3.231  8.235   -52.968 1.00 12.44 ? 415  LEU A CB    1 
ATOM   3454 C  CG    . LEU A 1 415 ? -2.965  6.946   -53.759 1.00 14.73 ? 415  LEU A CG    1 
ATOM   3455 C  CD1   . LEU A 1 415 ? -3.391  7.098   -55.242 1.00 11.35 ? 415  LEU A CD1   1 
ATOM   3456 C  CD2   . LEU A 1 415 ? -1.528  6.476   -53.643 1.00 11.96 ? 415  LEU A CD2   1 
ATOM   3457 N  N     . TYR A 1 416 ? -5.200  6.836   -51.087 1.00 12.00 ? 416  TYR A N     1 
ATOM   3458 C  CA    . TYR A 1 416 ? -5.665  5.530   -50.610 1.00 12.43 ? 416  TYR A CA    1 
ATOM   3459 C  C     . TYR A 1 416 ? -7.195  5.406   -50.665 1.00 12.42 ? 416  TYR A C     1 
ATOM   3460 O  O     . TYR A 1 416 ? -7.698  4.391   -51.143 1.00 13.05 ? 416  TYR A O     1 
ATOM   3461 C  CB    . TYR A 1 416 ? -5.079  5.178   -49.234 1.00 11.54 ? 416  TYR A CB    1 
ATOM   3462 C  CG    . TYR A 1 416 ? -3.631  4.681   -49.281 1.00 10.79 ? 416  TYR A CG    1 
ATOM   3463 C  CD1   . TYR A 1 416 ? -2.850  4.816   -50.438 1.00 11.17 ? 416  TYR A CD1   1 
ATOM   3464 C  CD2   . TYR A 1 416 ? -3.045  4.099   -48.155 1.00 10.73 ? 416  TYR A CD2   1 
ATOM   3465 C  CE1   . TYR A 1 416 ? -1.523  4.365   -50.475 1.00 11.29 ? 416  TYR A CE1   1 
ATOM   3466 C  CE2   . TYR A 1 416 ? -1.720  3.640   -48.177 1.00 11.79 ? 416  TYR A CE2   1 
ATOM   3467 C  CZ    . TYR A 1 416 ? -0.966  3.783   -49.336 1.00 15.24 ? 416  TYR A CZ    1 
ATOM   3468 O  OH    . TYR A 1 416 ? 0.335   3.334   -49.353 1.00 16.19 ? 416  TYR A OH    1 
ATOM   3469 N  N     . PRO A 1 417 ? -7.937  6.442   -50.210 1.00 11.66 ? 417  PRO A N     1 
ATOM   3470 C  CA    . PRO A 1 417 ? -9.392  6.425   -50.403 1.00 12.10 ? 417  PRO A CA    1 
ATOM   3471 C  C     . PRO A 1 417 ? -9.810  6.365   -51.880 1.00 12.88 ? 417  PRO A C     1 
ATOM   3472 O  O     . PRO A 1 417 ? -10.767 5.670   -52.209 1.00 13.89 ? 417  PRO A O     1 
ATOM   3473 C  CB    . PRO A 1 417 ? -9.846  7.733   -49.749 1.00 12.53 ? 417  PRO A CB    1 
ATOM   3474 C  CG    . PRO A 1 417 ? -8.820  7.954   -48.671 1.00 9.01  ? 417  PRO A CG    1 
ATOM   3475 C  CD    . PRO A 1 417 ? -7.532  7.564   -49.342 1.00 11.23 ? 417  PRO A CD    1 
ATOM   3476 N  N     . SER A 1 418 ? -9.087  7.066   -52.754 1.00 13.45 ? 418  SER A N     1 
ATOM   3477 C  CA    . SER A 1 418 ? -9.350  7.009   -54.198 1.00 12.52 ? 418  SER A CA    1 
ATOM   3478 C  C     . SER A 1 418 ? -9.099  5.616   -54.782 1.00 12.43 ? 418  SER A C     1 
ATOM   3479 O  O     . SER A 1 418 ? -9.846  5.169   -55.648 1.00 13.61 ? 418  SER A O     1 
ATOM   3480 C  CB    . SER A 1 418 ? -8.517  8.055   -54.953 1.00 12.43 ? 418  SER A CB    1 
ATOM   3481 O  OG    . SER A 1 418 ? -8.884  9.370   -54.562 1.00 12.67 ? 418  SER A OG    1 
ATOM   3482 N  N     . ILE A 1 419 ? -8.057  4.934   -54.308 1.00 10.59 ? 419  ILE A N     1 
ATOM   3483 C  CA    . ILE A 1 419 ? -7.806  3.547   -54.719 1.00 11.70 ? 419  ILE A CA    1 
ATOM   3484 C  C     . ILE A 1 419 ? -8.960  2.635   -54.291 1.00 12.43 ? 419  ILE A C     1 
ATOM   3485 O  O     . ILE A 1 419 ? -9.462  1.833   -55.092 1.00 12.88 ? 419  ILE A O     1 
ATOM   3486 C  CB    . ILE A 1 419 ? -6.475  3.005   -54.159 1.00 9.71  ? 419  ILE A CB    1 
ATOM   3487 C  CG1   . ILE A 1 419 ? -5.291  3.769   -54.780 1.00 12.93 ? 419  ILE A CG1   1 
ATOM   3488 C  CG2   . ILE A 1 419 ? -6.358  1.495   -54.424 1.00 10.04 ? 419  ILE A CG2   1 
ATOM   3489 C  CD1   . ILE A 1 419 ? -3.953  3.426   -54.182 1.00 12.03 ? 419  ILE A CD1   1 
ATOM   3490 N  N     . ILE A 1 420 ? -9.368  2.762   -53.032 1.00 10.92 ? 420  ILE A N     1 
ATOM   3491 C  CA    . ILE A 1 420 ? -10.541 2.036   -52.501 1.00 10.04 ? 420  ILE A CA    1 
ATOM   3492 C  C     . ILE A 1 420 ? -11.757 2.204   -53.416 1.00 12.23 ? 420  ILE A C     1 
ATOM   3493 O  O     . ILE A 1 420 ? -12.430 1.229   -53.766 1.00 13.19 ? 420  ILE A O     1 
ATOM   3494 C  CB    . ILE A 1 420 ? -10.877 2.505   -51.052 1.00 9.77  ? 420  ILE A CB    1 
ATOM   3495 C  CG1   . ILE A 1 420 ? -9.860  1.925   -50.066 1.00 9.58  ? 420  ILE A CG1   1 
ATOM   3496 C  CG2   . ILE A 1 420 ? -12.299 2.091   -50.630 1.00 8.56  ? 420  ILE A CG2   1 
ATOM   3497 C  CD1   . ILE A 1 420 ? -9.957  2.489   -48.627 1.00 9.37  ? 420  ILE A CD1   1 
ATOM   3498 N  N     . ARG A 1 421 ? -12.013 3.443   -53.818 1.00 11.18 ? 421  ARG A N     1 
ATOM   3499 C  CA    . ARG A 1 421 ? -13.179 3.779   -54.632 1.00 11.19 ? 421  ARG A CA    1 
ATOM   3500 C  C     . ARG A 1 421 ? -13.021 3.301   -56.082 1.00 12.17 ? 421  ARG A C     1 
ATOM   3501 O  O     . ARG A 1 421 ? -13.961 2.753   -56.672 1.00 11.18 ? 421  ARG A O     1 
ATOM   3502 C  CB    . ARG A 1 421 ? -13.427 5.290   -54.589 1.00 13.62 ? 421  ARG A CB    1 
ATOM   3503 C  CG    . ARG A 1 421 ? -13.893 5.839   -53.229 1.00 14.25 ? 421  ARG A CG    1 
ATOM   3504 C  CD    . ARG A 1 421 ? -13.875 7.373   -53.228 1.00 13.71 ? 421  ARG A CD    1 
ATOM   3505 N  NE    . ARG A 1 421 ? -14.799 7.911   -54.226 1.00 14.90 ? 421  ARG A NE    1 
ATOM   3506 C  CZ    . ARG A 1 421 ? -14.586 9.011   -54.945 1.00 13.93 ? 421  ARG A CZ    1 
ATOM   3507 N  NH1   . ARG A 1 421 ? -13.470 9.719   -54.790 1.00 14.25 ? 421  ARG A NH1   1 
ATOM   3508 N  NH2   . ARG A 1 421 ? -15.488 9.392   -55.835 1.00 15.35 ? 421  ARG A NH2   1 
ATOM   3509 N  N     . GLN A 1 422 ? -11.828 3.491   -56.637 1.00 9.92  ? 422  GLN A N     1 
ATOM   3510 C  CA    . GLN A 1 422 ? -11.528 3.104   -58.019 1.00 10.81 ? 422  GLN A CA    1 
ATOM   3511 C  C     . GLN A 1 422 ? -11.626 1.592   -58.230 1.00 10.96 ? 422  GLN A C     1 
ATOM   3512 O  O     . GLN A 1 422 ? -12.273 1.123   -59.174 1.00 11.84 ? 422  GLN A O     1 
ATOM   3513 C  CB    . GLN A 1 422 ? -10.140 3.625   -58.426 1.00 10.39 ? 422  GLN A CB    1 
ATOM   3514 C  CG    . GLN A 1 422 ? -9.523  2.957   -59.665 1.00 12.05 ? 422  GLN A CG    1 
ATOM   3515 C  CD    . GLN A 1 422 ? -8.680  3.907   -60.505 1.00 11.94 ? 422  GLN A CD    1 
ATOM   3516 O  OE1   . GLN A 1 422 ? -8.710  5.126   -60.314 1.00 10.42 ? 422  GLN A OE1   1 
ATOM   3517 N  NE2   . GLN A 1 422 ? -7.923  3.348   -61.446 1.00 9.40  ? 422  GLN A NE2   1 
ATOM   3518 N  N     . VAL A 1 423 ? -10.986 0.845   -57.335 1.00 10.01 ? 423  VAL A N     1 
ATOM   3519 C  CA    . VAL A 1 423 ? -10.879 -0.602  -57.442 1.00 12.18 ? 423  VAL A CA    1 
ATOM   3520 C  C     . VAL A 1 423 ? -12.144 -1.274  -56.892 1.00 12.54 ? 423  VAL A C     1 
ATOM   3521 O  O     . VAL A 1 423 ? -12.505 -2.369  -57.329 1.00 12.94 ? 423  VAL A O     1 
ATOM   3522 C  CB    . VAL A 1 423 ? -9.601  -1.114  -56.730 1.00 12.34 ? 423  VAL A CB    1 
ATOM   3523 C  CG1   . VAL A 1 423 ? -9.443  -2.627  -56.873 1.00 14.36 ? 423  VAL A CG1   1 
ATOM   3524 C  CG2   . VAL A 1 423 ? -8.356  -0.405  -57.284 1.00 13.69 ? 423  VAL A CG2   1 
ATOM   3525 N  N     . ASN A 1 424 ? -12.821 -0.588  -55.969 1.00 12.73 ? 424  ASN A N     1 
ATOM   3526 C  CA    . ASN A 1 424 ? -14.034 -1.079  -55.285 1.00 11.90 ? 424  ASN A CA    1 
ATOM   3527 C  C     . ASN A 1 424 ? -13.697 -2.097  -54.195 1.00 12.66 ? 424  ASN A C     1 
ATOM   3528 O  O     . ASN A 1 424 ? -14.231 -3.211  -54.164 1.00 13.22 ? 424  ASN A O     1 
ATOM   3529 C  CB    . ASN A 1 424 ? -15.081 -1.648  -56.263 1.00 10.44 ? 424  ASN A CB    1 
ATOM   3530 C  CG    . ASN A 1 424 ? -16.473 -1.695  -55.657 1.00 12.97 ? 424  ASN A CG    1 
ATOM   3531 O  OD1   . ASN A 1 424 ? -16.815 -0.865  -54.820 1.00 12.09 ? 424  ASN A OD1   1 
ATOM   3532 N  ND2   . ASN A 1 424 ? -17.285 -2.658  -56.082 1.00 11.95 ? 424  ASN A ND2   1 
ATOM   3533 N  N     . ILE A 1 425 ? -12.805 -1.688  -53.303 1.00 13.20 ? 425  ILE A N     1 
ATOM   3534 C  CA    . ILE A 1 425 ? -12.262 -2.547  -52.258 1.00 12.79 ? 425  ILE A CA    1 
ATOM   3535 C  C     . ILE A 1 425 ? -13.141 -2.468  -51.013 1.00 14.01 ? 425  ILE A C     1 
ATOM   3536 O  O     . ILE A 1 425 ? -13.301 -1.399  -50.414 1.00 13.99 ? 425  ILE A O     1 
ATOM   3537 C  CB    . ILE A 1 425 ? -10.810 -2.133  -51.915 1.00 11.66 ? 425  ILE A CB    1 
ATOM   3538 C  CG1   . ILE A 1 425 ? -9.909  -2.291  -53.152 1.00 11.50 ? 425  ILE A CG1   1 
ATOM   3539 C  CG2   . ILE A 1 425 ? -10.288 -2.941  -50.728 1.00 11.44 ? 425  ILE A CG2   1 
ATOM   3540 C  CD1   . ILE A 1 425 ? -8.506  -1.668  -53.017 1.00 11.45 ? 425  ILE A CD1   1 
ATOM   3541 N  N     . SER A 1 426 ? -13.700 -3.615  -50.635 1.00 13.01 ? 426  SER A N     1 
ATOM   3542 C  CA    . SER A 1 426 ? -14.630 -3.718  -49.517 1.00 11.99 ? 426  SER A CA    1 
ATOM   3543 C  C     . SER A 1 426 ? -14.617 -5.192  -49.107 1.00 13.83 ? 426  SER A C     1 
ATOM   3544 O  O     . SER A 1 426 ? -14.284 -6.044  -49.929 1.00 14.43 ? 426  SER A O     1 
ATOM   3545 C  CB    . SER A 1 426 ? -16.030 -3.311  -49.982 1.00 11.37 ? 426  SER A CB    1 
ATOM   3546 O  OG    . SER A 1 426 ? -16.835 -2.837  -48.912 1.00 10.30 ? 426  SER A OG    1 
ATOM   3547 N  N     . PRO A 1 427 ? -14.968 -5.506  -47.845 1.00 13.64 ? 427  PRO A N     1 
ATOM   3548 C  CA    . PRO A 1 427 ? -15.044 -6.912  -47.451 1.00 14.42 ? 427  PRO A CA    1 
ATOM   3549 C  C     . PRO A 1 427 ? -15.985 -7.746  -48.334 1.00 15.74 ? 427  PRO A C     1 
ATOM   3550 O  O     . PRO A 1 427 ? -15.661 -8.887  -48.658 1.00 15.32 ? 427  PRO A O     1 
ATOM   3551 C  CB    . PRO A 1 427 ? -15.577 -6.849  -46.009 1.00 14.00 ? 427  PRO A CB    1 
ATOM   3552 C  CG    . PRO A 1 427 ? -16.138 -5.455  -45.850 1.00 14.29 ? 427  PRO A CG    1 
ATOM   3553 C  CD    . PRO A 1 427 ? -15.246 -4.616  -46.707 1.00 14.63 ? 427  PRO A CD    1 
ATOM   3554 N  N     . GLU A 1 428 ? -17.112 -7.164  -48.741 1.00 15.61 ? 428  GLU A N     1 
ATOM   3555 C  CA    . GLU A 1 428 ? -18.155 -7.906  -49.450 1.00 16.01 ? 428  GLU A CA    1 
ATOM   3556 C  C     . GLU A 1 428 ? -18.104 -7.817  -50.987 1.00 15.19 ? 428  GLU A C     1 
ATOM   3557 O  O     . GLU A 1 428 ? -18.964 -8.377  -51.663 1.00 15.75 ? 428  GLU A O     1 
ATOM   3558 C  CB    . GLU A 1 428 ? -19.546 -7.506  -48.926 1.00 14.13 ? 428  GLU A CB    1 
ATOM   3559 C  CG    . GLU A 1 428 ? -20.139 -6.222  -49.525 1.00 15.67 ? 428  GLU A CG    1 
ATOM   3560 C  CD    . GLU A 1 428 ? -19.591 -4.939  -48.914 1.00 15.45 ? 428  GLU A CD    1 
ATOM   3561 O  OE1   . GLU A 1 428 ? -18.410 -4.898  -48.509 1.00 14.45 ? 428  GLU A OE1   1 
ATOM   3562 O  OE2   . GLU A 1 428 ? -20.346 -3.949  -48.857 1.00 16.85 ? 428  GLU A OE2   1 
ATOM   3563 N  N     . THR A 1 429 ? -17.104 -7.126  -51.534 1.00 14.77 ? 429  THR A N     1 
ATOM   3564 C  CA    . THR A 1 429 ? -16.973 -7.003  -52.996 1.00 15.05 ? 429  THR A CA    1 
ATOM   3565 C  C     . THR A 1 429 ? -15.851 -7.860  -53.597 1.00 14.93 ? 429  THR A C     1 
ATOM   3566 O  O     . THR A 1 429 ? -15.544 -7.745  -54.787 1.00 14.86 ? 429  THR A O     1 
ATOM   3567 C  CB    . THR A 1 429 ? -16.776 -5.538  -53.438 1.00 14.42 ? 429  THR A CB    1 
ATOM   3568 O  OG1   . THR A 1 429 ? -15.607 -5.000  -52.804 1.00 13.05 ? 429  THR A OG1   1 
ATOM   3569 C  CG2   . THR A 1 429 ? -17.998 -4.702  -53.075 1.00 13.51 ? 429  THR A CG2   1 
ATOM   3570 N  N     . ILE A 1 430 ? -15.243 -8.712  -52.779 1.00 14.21 ? 430  ILE A N     1 
ATOM   3571 C  CA    . ILE A 1 430 ? -14.209 -9.621  -53.262 1.00 15.23 ? 430  ILE A CA    1 
ATOM   3572 C  C     . ILE A 1 430 ? -14.806 -10.646 -54.238 1.00 15.56 ? 430  ILE A C     1 
ATOM   3573 O  O     . ILE A 1 430 ? -15.727 -11.387 -53.891 1.00 15.24 ? 430  ILE A O     1 
ATOM   3574 C  CB    . ILE A 1 430 ? -13.465 -10.312 -52.094 1.00 15.59 ? 430  ILE A CB    1 
ATOM   3575 C  CG1   . ILE A 1 430 ? -12.688 -9.268  -51.278 1.00 14.72 ? 430  ILE A CG1   1 
ATOM   3576 C  CG2   . ILE A 1 430 ? -12.516 -11.402 -52.616 1.00 16.73 ? 430  ILE A CG2   1 
ATOM   3577 C  CD1   . ILE A 1 430 ? -12.149 -9.766  -49.956 1.00 17.02 ? 430  ILE A CD1   1 
ATOM   3578 N  N     . ALA A 1 431 ? -14.285 -10.664 -55.462 1.00 15.78 ? 431  ALA A N     1 
ATOM   3579 C  CA    . ALA A 1 431 ? -14.768 -11.585 -56.495 1.00 15.88 ? 431  ALA A CA    1 
ATOM   3580 C  C     . ALA A 1 431 ? -13.866 -12.802 -56.671 1.00 16.19 ? 431  ALA A C     1 
ATOM   3581 O  O     . ALA A 1 431 ? -14.315 -13.846 -57.150 1.00 18.23 ? 431  ALA A O     1 
ATOM   3582 C  CB    . ALA A 1 431 ? -14.943 -10.860 -57.818 1.00 15.23 ? 431  ALA A CB    1 
ATOM   3583 N  N     . GLY A 1 432 ? -12.597 -12.665 -56.296 1.00 16.18 ? 432  GLY A N     1 
ATOM   3584 C  CA    . GLY A 1 432 ? -11.646 -13.769 -56.392 1.00 15.48 ? 432  GLY A CA    1 
ATOM   3585 C  C     . GLY A 1 432 ? -10.214 -13.291 -56.507 1.00 15.76 ? 432  GLY A C     1 
ATOM   3586 O  O     . GLY A 1 432 ? -9.885  -12.191 -56.056 1.00 14.62 ? 432  GLY A O     1 
ATOM   3587 N  N     . THR A 1 433 ? -9.363  -14.126 -57.105 1.00 14.76 ? 433  THR A N     1 
ATOM   3588 C  CA    . THR A 1 433 ? -7.948  -13.797 -57.280 1.00 16.71 ? 433  THR A CA    1 
ATOM   3589 C  C     . THR A 1 433 ? -7.478  -14.074 -58.702 1.00 16.09 ? 433  THR A C     1 
ATOM   3590 O  O     . THR A 1 433 ? -8.157  -14.757 -59.474 1.00 16.35 ? 433  THR A O     1 
ATOM   3591 C  CB    . THR A 1 433 ? -7.023  -14.572 -56.292 1.00 16.43 ? 433  THR A CB    1 
ATOM   3592 O  OG1   . THR A 1 433 ? -7.104  -15.977 -56.553 1.00 17.01 ? 433  THR A OG1   1 
ATOM   3593 C  CG2   . THR A 1 433 ? -7.387  -14.296 -54.832 1.00 17.93 ? 433  THR A CG2   1 
ATOM   3594 N  N     . PHE A 1 434 ? -6.319  -13.518 -59.042 1.00 14.97 ? 434  PHE A N     1 
ATOM   3595 C  CA    . PHE A 1 434 ? -5.624  -13.858 -60.278 1.00 15.33 ? 434  PHE A CA    1 
ATOM   3596 C  C     . PHE A 1 434 ? -4.149  -14.089 -59.964 1.00 15.49 ? 434  PHE A C     1 
ATOM   3597 O  O     . PHE A 1 434 ? -3.653  -13.631 -58.934 1.00 13.71 ? 434  PHE A O     1 
ATOM   3598 C  CB    . PHE A 1 434 ? -5.802  -12.762 -61.339 1.00 14.93 ? 434  PHE A CB    1 
ATOM   3599 C  CG    . PHE A 1 434 ? -5.127  -11.454 -60.999 1.00 13.56 ? 434  PHE A CG    1 
ATOM   3600 C  CD1   . PHE A 1 434 ? -5.824  -10.446 -60.336 1.00 13.21 ? 434  PHE A CD1   1 
ATOM   3601 C  CD2   . PHE A 1 434 ? -3.805  -11.224 -61.357 1.00 13.60 ? 434  PHE A CD2   1 
ATOM   3602 C  CE1   . PHE A 1 434 ? -5.208  -9.229  -60.028 1.00 12.37 ? 434  PHE A CE1   1 
ATOM   3603 C  CE2   . PHE A 1 434 ? -3.180  -10.014 -61.053 1.00 14.45 ? 434  PHE A CE2   1 
ATOM   3604 C  CZ    . PHE A 1 434 ? -3.884  -9.016  -60.392 1.00 12.41 ? 434  PHE A CZ    1 
ATOM   3605 N  N     . LYS A 1 435 ? -3.460  -14.800 -60.851 1.00 14.98 ? 435  LYS A N     1 
ATOM   3606 C  CA    . LYS A 1 435 ? -2.047  -15.101 -60.679 1.00 16.80 ? 435  LYS A CA    1 
ATOM   3607 C  C     . LYS A 1 435 ? -1.188  -13.867 -60.954 1.00 16.65 ? 435  LYS A C     1 
ATOM   3608 O  O     . LYS A 1 435 ? -1.195  -13.335 -62.061 1.00 17.09 ? 435  LYS A O     1 
ATOM   3609 C  CB    . LYS A 1 435 ? -1.646  -16.254 -61.599 1.00 18.44 ? 435  LYS A CB    1 
ATOM   3610 C  CG    . LYS A 1 435 ? -0.295  -16.856 -61.284 1.00 19.62 ? 435  LYS A CG    1 
ATOM   3611 C  CD    . LYS A 1 435 ? -0.202  -18.296 -61.781 1.00 22.51 ? 435  LYS A CD    1 
ATOM   3612 C  CE    . LYS A 1 435 ? -0.071  -18.370 -63.300 1.00 19.98 ? 435  LYS A CE    1 
ATOM   3613 N  NZ    . LYS A 1 435 ? 0.021   -19.784 -63.758 1.00 24.08 ? 435  LYS A NZ    1 
ATOM   3614 N  N     . VAL A 1 436 ? -0.452  -13.423 -59.937 1.00 17.45 ? 436  VAL A N     1 
ATOM   3615 C  CA    . VAL A 1 436 ? 0.335   -12.190 -60.022 1.00 17.40 ? 436  VAL A CA    1 
ATOM   3616 C  C     . VAL A 1 436 ? 1.626   -12.355 -60.816 1.00 17.47 ? 436  VAL A C     1 
ATOM   3617 O  O     . VAL A 1 436 ? 2.276   -13.402 -60.766 1.00 16.68 ? 436  VAL A O     1 
ATOM   3618 C  CB    . VAL A 1 436 ? 0.686   -11.596 -58.619 1.00 18.91 ? 436  VAL A CB    1 
ATOM   3619 C  CG1   . VAL A 1 436 ? -0.567  -11.391 -57.794 1.00 17.82 ? 436  VAL A CG1   1 
ATOM   3620 C  CG2   . VAL A 1 436 ? 1.690   -12.484 -57.859 1.00 19.42 ? 436  VAL A CG2   1 
ATOM   3621 N  N     . ALA A 1 437 ? 1.975   -11.304 -61.549 1.00 15.59 ? 437  ALA A N     1 
ATOM   3622 C  CA    . ALA A 1 437 ? 3.283   -11.177 -62.165 1.00 17.83 ? 437  ALA A CA    1 
ATOM   3623 C  C     . ALA A 1 437 ? 4.098   -10.274 -61.235 1.00 17.15 ? 437  ALA A C     1 
ATOM   3624 O  O     . ALA A 1 437 ? 3.528   -9.679  -60.316 1.00 17.63 ? 437  ALA A O     1 
ATOM   3625 C  CB    . ALA A 1 437 ? 3.147   -10.553 -63.545 1.00 15.74 ? 437  ALA A CB    1 
ATOM   3626 N  N     . PRO A 1 438 ? 5.426   -10.183 -61.444 1.00 17.47 ? 438  PRO A N     1 
ATOM   3627 C  CA    . PRO A 1 438 ? 6.212   -9.210  -60.689 1.00 17.23 ? 438  PRO A CA    1 
ATOM   3628 C  C     . PRO A 1 438 ? 5.662   -7.799  -60.905 1.00 17.52 ? 438  PRO A C     1 
ATOM   3629 O  O     . PRO A 1 438 ? 5.242   -7.478  -62.019 1.00 17.52 ? 438  PRO A O     1 
ATOM   3630 C  CB    . PRO A 1 438 ? 7.597   -9.327  -61.319 1.00 18.22 ? 438  PRO A CB    1 
ATOM   3631 C  CG    . PRO A 1 438 ? 7.661   -10.725 -61.813 1.00 17.26 ? 438  PRO A CG    1 
ATOM   3632 C  CD    . PRO A 1 438 ? 6.280   -11.038 -62.295 1.00 18.16 ? 438  PRO A CD    1 
ATOM   3633 N  N     . LEU A 1 439 ? 5.666   -6.973  -59.856 1.00 16.43 ? 439  LEU A N     1 
ATOM   3634 C  CA    . LEU A 1 439 ? 5.110   -5.616  -59.940 1.00 17.26 ? 439  LEU A CA    1 
ATOM   3635 C  C     . LEU A 1 439 ? 5.665   -4.832  -61.126 1.00 16.81 ? 439  LEU A C     1 
ATOM   3636 O  O     . LEU A 1 439 ? 4.914   -4.164  -61.841 1.00 17.72 ? 439  LEU A O     1 
ATOM   3637 C  CB    . LEU A 1 439 ? 5.333   -4.832  -58.637 1.00 17.08 ? 439  LEU A CB    1 
ATOM   3638 C  CG    . LEU A 1 439 ? 4.550   -3.515  -58.526 1.00 18.70 ? 439  LEU A CG    1 
ATOM   3639 C  CD1   . LEU A 1 439 ? 3.052   -3.773  -58.385 1.00 17.21 ? 439  LEU A CD1   1 
ATOM   3640 C  CD2   . LEU A 1 439 ? 5.054   -2.665  -57.363 1.00 18.57 ? 439  LEU A CD2   1 
ATOM   3641 N  N     . HIS A 1 440 ? 6.979   -4.926  -61.321 1.00 17.31 ? 440  HIS A N     1 
ATOM   3642 C  CA    . HIS A 1 440 ? 7.679   -4.281  -62.438 1.00 18.91 ? 440  HIS A CA    1 
ATOM   3643 C  C     . HIS A 1 440 ? 7.006   -4.566  -63.792 1.00 17.50 ? 440  HIS A C     1 
ATOM   3644 O  O     . HIS A 1 440 ? 6.973   -3.700  -64.672 1.00 16.28 ? 440  HIS A O     1 
ATOM   3645 C  CB    . HIS A 1 440 ? 9.163   -4.692  -62.407 1.00 21.70 ? 440  HIS A CB    1 
ATOM   3646 C  CG    . HIS A 1 440 ? 9.837   -4.723  -63.746 1.00 30.05 ? 440  HIS A CG    1 
ATOM   3647 N  ND1   . HIS A 1 440 ? 10.728  -3.752  -64.153 1.00 34.22 ? 440  HIS A ND1   1 
ATOM   3648 C  CD2   . HIS A 1 440 ? 9.786   -5.631  -64.751 1.00 32.91 ? 440  HIS A CD2   1 
ATOM   3649 C  CE1   . HIS A 1 440 ? 11.184  -4.052  -65.357 1.00 35.17 ? 440  HIS A CE1   1 
ATOM   3650 N  NE2   . HIS A 1 440 ? 10.621  -5.182  -65.746 1.00 36.61 ? 440  HIS A NE2   1 
ATOM   3651 N  N     . ASP A 1 441 ? 6.450   -5.769  -63.942 1.00 16.17 ? 441  ASP A N     1 
ATOM   3652 C  CA    . ASP A 1 441 ? 5.754   -6.147  -65.174 1.00 15.36 ? 441  ASP A CA    1 
ATOM   3653 C  C     . ASP A 1 441 ? 4.451   -5.364  -65.397 1.00 15.89 ? 441  ASP A C     1 
ATOM   3654 O  O     . ASP A 1 441 ? 4.085   -5.084  -66.542 1.00 15.01 ? 441  ASP A O     1 
ATOM   3655 C  CB    . ASP A 1 441 ? 5.498   -7.660  -65.227 1.00 15.87 ? 441  ASP A CB    1 
ATOM   3656 C  CG    . ASP A 1 441 ? 6.754   -8.463  -65.548 1.00 18.70 ? 441  ASP A CG    1 
ATOM   3657 O  OD1   . ASP A 1 441 ? 7.789   -7.864  -65.908 1.00 20.59 ? 441  ASP A OD1   1 
ATOM   3658 O  OD2   . ASP A 1 441 ? 6.701   -9.706  -65.458 1.00 19.90 ? 441  ASP A OD2   1 
ATOM   3659 N  N     . TYR A 1 442 ? 3.755   -5.017  -64.313 1.00 14.23 ? 442  TYR A N     1 
ATOM   3660 C  CA    . TYR A 1 442 ? 2.559   -4.169  -64.417 1.00 15.35 ? 442  TYR A CA    1 
ATOM   3661 C  C     . TYR A 1 442 ? 2.939   -2.717  -64.690 1.00 16.18 ? 442  TYR A C     1 
ATOM   3662 O  O     . TYR A 1 442 ? 2.345   -2.060  -65.553 1.00 17.47 ? 442  TYR A O     1 
ATOM   3663 C  CB    . TYR A 1 442 ? 1.673   -4.289  -63.166 1.00 14.71 ? 442  TYR A CB    1 
ATOM   3664 C  CG    . TYR A 1 442 ? 1.128   -5.688  -62.987 1.00 13.59 ? 442  TYR A CG    1 
ATOM   3665 C  CD1   . TYR A 1 442 ? 0.190   -6.208  -63.880 1.00 12.84 ? 442  TYR A CD1   1 
ATOM   3666 C  CD2   . TYR A 1 442 ? 1.574   -6.504  -61.945 1.00 16.20 ? 442  TYR A CD2   1 
ATOM   3667 C  CE1   . TYR A 1 442 ? -0.303  -7.501  -63.735 1.00 15.48 ? 442  TYR A CE1   1 
ATOM   3668 C  CE2   . TYR A 1 442 ? 1.088   -7.799  -61.789 1.00 17.68 ? 442  TYR A CE2   1 
ATOM   3669 C  CZ    . TYR A 1 442 ? 0.155   -8.292  -62.694 1.00 19.73 ? 442  TYR A CZ    1 
ATOM   3670 O  OH    . TYR A 1 442 ? -0.331  -9.571  -62.550 1.00 21.26 ? 442  TYR A OH    1 
ATOM   3671 N  N     . ILE A 1 443 ? 3.944   -2.235  -63.961 1.00 14.96 ? 443  ILE A N     1 
ATOM   3672 C  CA    . ILE A 1 443 ? 4.477   -0.881  -64.127 1.00 15.47 ? 443  ILE A CA    1 
ATOM   3673 C  C     . ILE A 1 443 ? 4.866   -0.617  -65.582 1.00 15.65 ? 443  ILE A C     1 
ATOM   3674 O  O     . ILE A 1 443 ? 4.640   0.476   -66.107 1.00 15.38 ? 443  ILE A O     1 
ATOM   3675 C  CB    . ILE A 1 443 ? 5.688   -0.655  -63.198 1.00 15.30 ? 443  ILE A CB    1 
ATOM   3676 C  CG1   . ILE A 1 443 ? 5.243   -0.717  -61.727 1.00 15.64 ? 443  ILE A CG1   1 
ATOM   3677 C  CG2   . ILE A 1 443 ? 6.392   0.672   -63.517 1.00 14.46 ? 443  ILE A CG2   1 
ATOM   3678 C  CD1   . ILE A 1 443 ? 6.389   -0.918  -60.732 1.00 14.24 ? 443  ILE A CD1   1 
ATOM   3679 N  N     . ASN A 1 444 ? 5.430   -1.634  -66.227 1.00 14.96 ? 444  ASN A N     1 
ATOM   3680 C  CA    . ASN A 1 444 ? 5.890   -1.516  -67.611 1.00 16.21 ? 444  ASN A CA    1 
ATOM   3681 C  C     . ASN A 1 444 ? 4.903   -2.033  -68.652 1.00 15.42 ? 444  ASN A C     1 
ATOM   3682 O  O     . ASN A 1 444 ? 5.230   -2.098  -69.838 1.00 15.58 ? 444  ASN A O     1 
ATOM   3683 C  CB    . ASN A 1 444 ? 7.242   -2.198  -67.771 1.00 17.66 ? 444  ASN A CB    1 
ATOM   3684 C  CG    . ASN A 1 444 ? 8.332   -1.498  -66.993 1.00 23.41 ? 444  ASN A CG    1 
ATOM   3685 O  OD1   . ASN A 1 444 ? 8.465   -0.273  -67.047 1.00 21.65 ? 444  ASN A OD1   1 
ATOM   3686 N  ND2   . ASN A 1 444 ? 9.116   -2.270  -66.260 1.00 24.33 ? 444  ASN A ND2   1 
ATOM   3687 N  N     . ALA A 1 445 ? 3.709   -2.410  -68.196 1.00 15.71 ? 445  ALA A N     1 
ATOM   3688 C  CA    . ALA A 1 445 ? 2.616   -2.856  -69.068 1.00 17.02 ? 445  ALA A CA    1 
ATOM   3689 C  C     . ALA A 1 445 ? 2.957   -4.078  -69.929 1.00 18.17 ? 445  ALA A C     1 
ATOM   3690 O  O     . ALA A 1 445 ? 2.492   -4.192  -71.066 1.00 19.83 ? 445  ALA A O     1 
ATOM   3691 C  CB    . ALA A 1 445 ? 2.112   -1.692  -69.942 1.00 16.62 ? 445  ALA A CB    1 
ATOM   3692 N  N     . VAL A 1 446 ? 3.766   -4.988  -69.390 1.00 17.68 ? 446  VAL A N     1 
ATOM   3693 C  CA    . VAL A 1 446 ? 4.125   -6.215  -70.107 1.00 18.85 ? 446  VAL A CA    1 
ATOM   3694 C  C     . VAL A 1 446 ? 3.423   -7.456  -69.545 1.00 17.55 ? 446  VAL A C     1 
ATOM   3695 O  O     . VAL A 1 446 ? 3.352   -8.489  -70.211 1.00 16.10 ? 446  VAL A O     1 
ATOM   3696 C  CB    . VAL A 1 446 ? 5.664   -6.441  -70.183 1.00 20.53 ? 446  VAL A CB    1 
ATOM   3697 C  CG1   . VAL A 1 446 ? 6.344   -5.318  -70.970 1.00 22.46 ? 446  VAL A CG1   1 
ATOM   3698 C  CG2   . VAL A 1 446 ? 6.277   -6.567  -68.796 1.00 20.47 ? 446  VAL A CG2   1 
ATOM   3699 N  N     . ALA A 1 447 ? 2.911   -7.351  -68.320 1.00 16.47 ? 447  ALA A N     1 
ATOM   3700 C  CA    . ALA A 1 447 ? 2.146   -8.435  -67.705 1.00 17.08 ? 447  ALA A CA    1 
ATOM   3701 C  C     . ALA A 1 447 ? 0.791   -8.588  -68.381 1.00 17.42 ? 447  ALA A C     1 
ATOM   3702 O  O     . ALA A 1 447 ? 0.238   -7.621  -68.901 1.00 16.92 ? 447  ALA A O     1 
ATOM   3703 C  CB    . ALA A 1 447 ? 1.955   -8.170  -66.231 1.00 18.37 ? 447  ALA A CB    1 
ATOM   3704 N  N     . GLU A 1 448 ? 0.268   -9.810  -68.367 1.00 17.35 ? 448  GLU A N     1 
ATOM   3705 C  CA    . GLU A 1 448 ? -1.071  -10.097 -68.868 1.00 19.19 ? 448  GLU A CA    1 
ATOM   3706 C  C     . GLU A 1 448 ? -2.119  -9.286  -68.106 1.00 17.41 ? 448  GLU A C     1 
ATOM   3707 O  O     . GLU A 1 448 ? -2.013  -9.106  -66.889 1.00 17.56 ? 448  GLU A O     1 
ATOM   3708 C  CB    . GLU A 1 448 ? -1.358  -11.594 -68.722 1.00 20.96 ? 448  GLU A CB    1 
ATOM   3709 C  CG    . GLU A 1 448 ? -2.555  -12.100 -69.510 1.00 29.20 ? 448  GLU A CG    1 
ATOM   3710 C  CD    . GLU A 1 448 ? -2.940  -13.531 -69.152 1.00 34.74 ? 448  GLU A CD    1 
ATOM   3711 O  OE1   . GLU A 1 448 ? -4.137  -13.868 -69.283 1.00 37.78 ? 448  GLU A OE1   1 
ATOM   3712 O  OE2   . GLU A 1 448 ? -2.054  -14.314 -68.736 1.00 34.81 ? 448  GLU A OE2   1 
ATOM   3713 N  N     . ARG A 1 449 ? -3.116  -8.779  -68.821 1.00 17.76 ? 449  ARG A N     1 
ATOM   3714 C  CA    . ARG A 1 449 ? -4.234  -8.089  -68.179 1.00 16.84 ? 449  ARG A CA    1 
ATOM   3715 C  C     . ARG A 1 449 ? -4.879  -9.039  -67.171 1.00 15.65 ? 449  ARG A C     1 
ATOM   3716 O  O     . ARG A 1 449 ? -5.302  -10.131 -67.539 1.00 16.40 ? 449  ARG A O     1 
ATOM   3717 C  CB    . ARG A 1 449 ? -5.252  -7.630  -69.221 1.00 17.25 ? 449  ARG A CB    1 
ATOM   3718 C  CG    . ARG A 1 449 ? -6.396  -6.781  -68.675 1.00 16.88 ? 449  ARG A CG    1 
ATOM   3719 C  CD    . ARG A 1 449 ? -6.973  -5.916  -69.786 1.00 17.25 ? 449  ARG A CD    1 
ATOM   3720 N  NE    . ARG A 1 449 ? -7.996  -4.979  -69.326 1.00 14.88 ? 449  ARG A NE    1 
ATOM   3721 C  CZ    . ARG A 1 449 ? -9.294  -5.100  -69.587 1.00 13.22 ? 449  ARG A CZ    1 
ATOM   3722 N  NH1   . ARG A 1 449 ? -9.742  -6.127  -70.293 1.00 13.04 ? 449  ARG A NH1   1 
ATOM   3723 N  NH2   . ARG A 1 449 ? -10.148 -4.191  -69.139 1.00 13.13 ? 449  ARG A NH2   1 
ATOM   3724 N  N     . PRO A 1 450 ? -4.928  -8.633  -65.890 1.00 14.03 ? 450  PRO A N     1 
ATOM   3725 C  CA    . PRO A 1 450 ? -5.412  -9.504  -64.819 1.00 14.34 ? 450  PRO A CA    1 
ATOM   3726 C  C     . PRO A 1 450 ? -6.803  -10.088 -65.061 1.00 13.85 ? 450  PRO A C     1 
ATOM   3727 O  O     . PRO A 1 450 ? -7.012  -11.283 -64.827 1.00 14.04 ? 450  PRO A O     1 
ATOM   3728 C  CB    . PRO A 1 450 ? -5.419  -8.574  -63.602 1.00 13.21 ? 450  PRO A CB    1 
ATOM   3729 C  CG    . PRO A 1 450 ? -4.311  -7.629  -63.876 1.00 15.81 ? 450  PRO A CG    1 
ATOM   3730 C  CD    . PRO A 1 450 ? -4.393  -7.364  -65.356 1.00 13.70 ? 450  PRO A CD    1 
ATOM   3731 N  N     . SER A 1 451 ? -7.730  -9.259  -65.540 1.00 12.51 ? 451  SER A N     1 
ATOM   3732 C  CA    . SER A 1 451 ? -9.107  -9.681  -65.758 1.00 13.77 ? 451  SER A CA    1 
ATOM   3733 C  C     . SER A 1 451 ? -9.811  -8.764  -66.758 1.00 13.96 ? 451  SER A C     1 
ATOM   3734 O  O     . SER A 1 451 ? -9.533  -7.563  -66.812 1.00 13.22 ? 451  SER A O     1 
ATOM   3735 C  CB    . SER A 1 451 ? -9.876  -9.705  -64.429 1.00 11.93 ? 451  SER A CB    1 
ATOM   3736 O  OG    . SER A 1 451 ? -11.226 -10.118 -64.612 1.00 12.55 ? 451  SER A OG    1 
ATOM   3737 N  N     . ASP A 1 452 ? -10.708 -9.337  -67.555 1.00 12.26 ? 452  ASP A N     1 
ATOM   3738 C  CA    . ASP A 1 452 ? -11.583 -8.537  -68.416 1.00 12.71 ? 452  ASP A CA    1 
ATOM   3739 C  C     . ASP A 1 452 ? -13.018 -8.538  -67.888 1.00 10.77 ? 452  ASP A C     1 
ATOM   3740 O  O     . ASP A 1 452 ? -13.945 -8.072  -68.556 1.00 10.49 ? 452  ASP A O     1 
ATOM   3741 C  CB    . ASP A 1 452 ? -11.512 -8.996  -69.881 1.00 14.86 ? 452  ASP A CB    1 
ATOM   3742 C  CG    . ASP A 1 452 ? -11.884 -10.460 -70.074 1.00 19.65 ? 452  ASP A CG    1 
ATOM   3743 O  OD1   . ASP A 1 452 ? -12.342 -11.121 -69.115 1.00 22.76 ? 452  ASP A OD1   1 
ATOM   3744 O  OD2   . ASP A 1 452 ? -11.716 -10.953 -71.210 1.00 23.85 ? 452  ASP A OD2   1 
ATOM   3745 N  N     . VAL A 1 453 ? -13.183 -9.061  -66.675 1.00 10.94 ? 453  VAL A N     1 
ATOM   3746 C  CA    . VAL A 1 453 ? -14.487 -9.134  -66.024 1.00 11.91 ? 453  VAL A CA    1 
ATOM   3747 C  C     . VAL A 1 453 ? -14.527 -8.323  -64.726 1.00 12.85 ? 453  VAL A C     1 
ATOM   3748 O  O     . VAL A 1 453 ? -15.485 -7.573  -64.486 1.00 12.65 ? 453  VAL A O     1 
ATOM   3749 C  CB    . VAL A 1 453 ? -14.889 -10.600 -65.741 1.00 13.34 ? 453  VAL A CB    1 
ATOM   3750 C  CG1   . VAL A 1 453 ? -16.195 -10.662 -64.963 1.00 13.59 ? 453  VAL A CG1   1 
ATOM   3751 C  CG2   . VAL A 1 453 ? -15.011 -11.377 -67.047 1.00 13.56 ? 453  VAL A CG2   1 
ATOM   3752 N  N     . TYR A 1 454 ? -13.491 -8.478  -63.902 1.00 11.71 ? 454  TYR A N     1 
ATOM   3753 C  CA    . TYR A 1 454 ? -13.452 -7.879  -62.564 1.00 13.01 ? 454  TYR A CA    1 
ATOM   3754 C  C     . TYR A 1 454 ? -12.448 -6.741  -62.434 1.00 12.69 ? 454  TYR A C     1 
ATOM   3755 O  O     . TYR A 1 454 ? -11.551 -6.591  -63.264 1.00 12.82 ? 454  TYR A O     1 
ATOM   3756 C  CB    . TYR A 1 454 ? -13.183 -8.961  -61.506 1.00 13.77 ? 454  TYR A CB    1 
ATOM   3757 C  CG    . TYR A 1 454 ? -14.219 -10.065 -61.521 1.00 15.98 ? 454  TYR A CG    1 
ATOM   3758 C  CD1   . TYR A 1 454 ? -15.550 -9.799  -61.188 1.00 14.64 ? 454  TYR A CD1   1 
ATOM   3759 C  CD2   . TYR A 1 454 ? -13.874 -11.368 -61.889 1.00 17.08 ? 454  TYR A CD2   1 
ATOM   3760 C  CE1   . TYR A 1 454 ? -16.509 -10.800 -61.212 1.00 17.14 ? 454  TYR A CE1   1 
ATOM   3761 C  CE2   . TYR A 1 454 ? -14.827 -12.383 -61.911 1.00 17.10 ? 454  TYR A CE2   1 
ATOM   3762 C  CZ    . TYR A 1 454 ? -16.143 -12.088 -61.570 1.00 17.85 ? 454  TYR A CZ    1 
ATOM   3763 O  OH    . TYR A 1 454 ? -17.095 -13.077 -61.588 1.00 16.31 ? 454  TYR A OH    1 
ATOM   3764 N  N     . SER A 1 455 ? -12.618 -5.944  -61.379 1.00 11.37 ? 455  SER A N     1 
ATOM   3765 C  CA    . SER A 1 455 ? -11.764 -4.798  -61.105 1.00 12.71 ? 455  SER A CA    1 
ATOM   3766 C  C     . SER A 1 455 ? -10.601 -5.236  -60.225 1.00 12.30 ? 455  SER A C     1 
ATOM   3767 O  O     . SER A 1 455 ? -10.826 -5.854  -59.185 1.00 12.59 ? 455  SER A O     1 
ATOM   3768 C  CB    . SER A 1 455 ? -12.564 -3.706  -60.400 1.00 10.11 ? 455  SER A CB    1 
ATOM   3769 O  OG    . SER A 1 455 ? -11.686 -2.750  -59.841 1.00 14.04 ? 455  SER A OG    1 
ATOM   3770 N  N     . CYS A 1 456 ? -9.375  -4.892  -60.625 1.00 10.87 ? 456  CYS A N     1 
ATOM   3771 C  CA    . CYS A 1 456 ? -8.185  -5.538  -60.062 1.00 10.48 ? 456  CYS A CA    1 
ATOM   3772 C  C     . CYS A 1 456 ? -7.126  -4.642  -59.411 1.00 11.91 ? 456  CYS A C     1 
ATOM   3773 O  O     . CYS A 1 456 ? -7.002  -3.460  -59.731 1.00 11.96 ? 456  CYS A O     1 
ATOM   3774 C  CB    . CYS A 1 456 ? -7.509  -6.400  -61.133 1.00 11.07 ? 456  CYS A CB    1 
ATOM   3775 S  SG    . CYS A 1 456 ? -8.555  -7.710  -61.805 1.00 14.37 ? 456  CYS A SG    1 
ATOM   3776 N  N     . SER A 1 457 ? -6.364  -5.245  -58.499 1.00 10.53 ? 457  SER A N     1 
ATOM   3777 C  CA    . SER A 1 457 ? -5.172  -4.642  -57.924 1.00 11.68 ? 457  SER A CA    1 
ATOM   3778 C  C     . SER A 1 457 ? -3.988  -5.564  -58.202 1.00 12.58 ? 457  SER A C     1 
ATOM   3779 O  O     . SER A 1 457 ? -4.137  -6.786  -58.172 1.00 13.57 ? 457  SER A O     1 
ATOM   3780 C  CB    . SER A 1 457 ? -5.336  -4.447  -56.418 1.00 12.17 ? 457  SER A CB    1 
ATOM   3781 O  OG    . SER A 1 457 ? -4.106  -4.058  -55.822 1.00 9.18  ? 457  SER A OG    1 
ATOM   3782 N  N     . PRO A 1 458 ? -2.802  -4.990  -58.452 1.00 13.58 ? 458  PRO A N     1 
ATOM   3783 C  CA    . PRO A 1 458 ? -1.648  -5.834  -58.768 1.00 13.59 ? 458  PRO A CA    1 
ATOM   3784 C  C     . PRO A 1 458 ? -1.168  -6.755  -57.625 1.00 14.88 ? 458  PRO A C     1 
ATOM   3785 O  O     . PRO A 1 458 ? -0.186  -7.482  -57.809 1.00 13.65 ? 458  PRO A O     1 
ATOM   3786 C  CB    . PRO A 1 458 ? -0.568  -4.817  -59.146 1.00 12.75 ? 458  PRO A CB    1 
ATOM   3787 C  CG    . PRO A 1 458 ? -0.964  -3.567  -58.443 1.00 12.40 ? 458  PRO A CG    1 
ATOM   3788 C  CD    . PRO A 1 458 ? -2.462  -3.557  -58.533 1.00 14.06 ? 458  PRO A CD    1 
ATOM   3789 N  N     . ASN A 1 459 ? -1.857  -6.746  -56.482 1.00 12.12 ? 459  ASN A N     1 
ATOM   3790 C  CA    . ASN A 1 459 ? -1.576  -7.722  -55.416 1.00 13.71 ? 459  ASN A CA    1 
ATOM   3791 C  C     . ASN A 1 459 ? -2.259  -9.077  -55.638 1.00 13.76 ? 459  ASN A C     1 
ATOM   3792 O  O     . ASN A 1 459 ? -2.084  -10.003 -54.847 1.00 14.41 ? 459  ASN A O     1 
ATOM   3793 C  CB    . ASN A 1 459 ? -1.960  -7.169  -54.040 1.00 11.94 ? 459  ASN A CB    1 
ATOM   3794 C  CG    . ASN A 1 459 ? -3.439  -7.320  -53.739 1.00 13.79 ? 459  ASN A CG    1 
ATOM   3795 O  OD1   . ASN A 1 459 ? -4.284  -7.163  -54.619 1.00 14.09 ? 459  ASN A OD1   1 
ATOM   3796 N  ND2   . ASN A 1 459 ? -3.761  -7.626  -52.485 1.00 10.22 ? 459  ASN A ND2   1 
ATOM   3797 N  N     . GLY A 1 460 ? -3.061  -9.177  -56.694 1.00 14.35 ? 460  GLY A N     1 
ATOM   3798 C  CA    . GLY A 1 460 ? -3.707  -10.438 -57.051 1.00 14.01 ? 460  GLY A CA    1 
ATOM   3799 C  C     . GLY A 1 460 ? -5.186  -10.507 -56.744 1.00 13.42 ? 460  GLY A C     1 
ATOM   3800 O  O     . GLY A 1 460 ? -5.817  -11.522 -57.008 1.00 12.83 ? 460  GLY A O     1 
ATOM   3801 N  N     . MET A 1 461 ? -5.741  -9.427  -56.198 1.00 11.33 ? 461  MET A N     1 
ATOM   3802 C  CA    . MET A 1 461 ? -7.153  -9.395  -55.812 1.00 12.49 ? 461  MET A CA    1 
ATOM   3803 C  C     . MET A 1 461 ? -8.076  -8.902  -56.925 1.00 12.22 ? 461  MET A C     1 
ATOM   3804 O  O     . MET A 1 461 ? -7.711  -8.005  -57.694 1.00 11.18 ? 461  MET A O     1 
ATOM   3805 C  CB    . MET A 1 461 ? -7.343  -8.538  -54.551 1.00 12.63 ? 461  MET A CB    1 
ATOM   3806 C  CG    . MET A 1 461 ? -6.751  -9.162  -53.288 1.00 13.61 ? 461  MET A CG    1 
ATOM   3807 S  SD    . MET A 1 461 ? -7.480  -10.773 -52.908 1.00 16.16 ? 461  MET A SD    1 
ATOM   3808 C  CE    . MET A 1 461 ? -9.159  -10.308 -52.500 1.00 16.21 ? 461  MET A CE    1 
ATOM   3809 N  N     . MET A 1 462 ? -9.270  -9.498  -56.998 1.00 11.04 ? 462  MET A N     1 
ATOM   3810 C  CA    . MET A 1 462 ? -10.312 -9.082  -57.943 1.00 12.37 ? 462  MET A CA    1 
ATOM   3811 C  C     . MET A 1 462 ? -11.581 -8.686  -57.205 1.00 12.71 ? 462  MET A C     1 
ATOM   3812 O  O     . MET A 1 462 ? -11.958 -9.322  -56.216 1.00 13.49 ? 462  MET A O     1 
ATOM   3813 C  CB    . MET A 1 462 ? -10.635 -10.199 -58.945 1.00 13.44 ? 462  MET A CB    1 
ATOM   3814 C  CG    . MET A 1 462 ? -9.429  -10.716 -59.715 1.00 11.66 ? 462  MET A CG    1 
ATOM   3815 S  SD    . MET A 1 462 ? -9.871  -11.673 -61.180 1.00 14.54 ? 462  MET A SD    1 
ATOM   3816 C  CE    . MET A 1 462 ? -10.921 -12.971 -60.518 1.00 11.35 ? 462  MET A CE    1 
ATOM   3817 N  N     . TYR A 1 463 ? -12.241 -7.641  -57.699 1.00 11.21 ? 463  TYR A N     1 
ATOM   3818 C  CA    . TYR A 1 463 ? -13.460 -7.119  -57.078 1.00 11.10 ? 463  TYR A CA    1 
ATOM   3819 C  C     . TYR A 1 463 ? -14.588 -6.970  -58.085 1.00 13.09 ? 463  TYR A C     1 
ATOM   3820 O  O     . TYR A 1 463 ? -14.346 -6.719  -59.272 1.00 12.05 ? 463  TYR A O     1 
ATOM   3821 C  CB    . TYR A 1 463 ? -13.170 -5.773  -56.392 1.00 12.15 ? 463  TYR A CB    1 
ATOM   3822 C  CG    . TYR A 1 463 ? -12.057 -5.878  -55.370 1.00 13.71 ? 463  TYR A CG    1 
ATOM   3823 C  CD1   . TYR A 1 463 ? -10.714 -5.726  -55.742 1.00 13.05 ? 463  TYR A CD1   1 
ATOM   3824 C  CD2   . TYR A 1 463 ? -12.344 -6.174  -54.036 1.00 12.88 ? 463  TYR A CD2   1 
ATOM   3825 C  CE1   . TYR A 1 463 ? -9.681  -5.850  -54.796 1.00 13.72 ? 463  TYR A CE1   1 
ATOM   3826 C  CE2   . TYR A 1 463 ? -11.333 -6.292  -53.093 1.00 10.72 ? 463  TYR A CE2   1 
ATOM   3827 C  CZ    . TYR A 1 463 ? -10.006 -6.135  -53.475 1.00 14.31 ? 463  TYR A CZ    1 
ATOM   3828 O  OH    . TYR A 1 463 ? -9.019  -6.270  -52.518 1.00 10.74 ? 463  TYR A OH    1 
ATOM   3829 N  N     . TYR A 1 464 ? -15.824 -7.138  -57.614 1.00 13.66 ? 464  TYR A N     1 
ATOM   3830 C  CA    . TYR A 1 464 ? -16.996 -6.876  -58.442 1.00 16.74 ? 464  TYR A CA    1 
ATOM   3831 C  C     . TYR A 1 464 ? -17.038 -5.410  -58.854 1.00 16.80 ? 464  TYR A C     1 
ATOM   3832 O  O     . TYR A 1 464 ? -16.737 -4.528  -58.054 1.00 16.98 ? 464  TYR A O     1 
ATOM   3833 C  CB    . TYR A 1 464 ? -18.282 -7.263  -57.707 1.00 18.51 ? 464  TYR A CB    1 
ATOM   3834 C  CG    . TYR A 1 464 ? -18.384 -8.742  -57.397 1.00 22.76 ? 464  TYR A CG    1 
ATOM   3835 C  CD1   . TYR A 1 464 ? -18.243 -9.209  -56.091 1.00 25.44 ? 464  TYR A CD1   1 
ATOM   3836 C  CD2   . TYR A 1 464 ? -18.609 -9.675  -58.413 1.00 26.07 ? 464  TYR A CD2   1 
ATOM   3837 C  CE1   . TYR A 1 464 ? -18.330 -10.568 -55.801 1.00 27.05 ? 464  TYR A CE1   1 
ATOM   3838 C  CE2   . TYR A 1 464 ? -18.695 -11.034 -58.132 1.00 26.59 ? 464  TYR A CE2   1 
ATOM   3839 C  CZ    . TYR A 1 464 ? -18.553 -11.471 -56.824 1.00 27.93 ? 464  TYR A CZ    1 
ATOM   3840 O  OH    . TYR A 1 464 ? -18.636 -12.812 -56.539 1.00 29.55 ? 464  TYR A OH    1 
ATOM   3841 N  N     . LYS A 1 465 ? -17.403 -5.166  -60.108 1.00 19.46 ? 465  LYS A N     1 
ATOM   3842 C  CA    . LYS A 1 465 ? -17.476 -3.812  -60.665 1.00 21.55 ? 465  LYS A CA    1 
ATOM   3843 C  C     . LYS A 1 465 ? -18.894 -3.270  -60.608 1.00 22.19 ? 465  LYS A C     1 
ATOM   3844 O  O     . LYS A 1 465 ? -19.103 -2.061  -60.647 1.00 23.75 ? 465  LYS A O     1 
ATOM   3845 C  CB    . LYS A 1 465 ? -17.054 -3.812  -62.136 1.00 21.18 ? 465  LYS A CB    1 
ATOM   3846 C  CG    . LYS A 1 465 ? -15.627 -4.221  -62.410 1.00 20.76 ? 465  LYS A CG    1 
ATOM   3847 C  CD    . LYS A 1 465 ? -15.335 -4.150  -63.898 1.00 18.31 ? 465  LYS A CD    1 
ATOM   3848 C  CE    . LYS A 1 465 ? -15.285 -2.720  -64.409 1.00 16.66 ? 465  LYS A CE    1 
ATOM   3849 N  NZ    . LYS A 1 465 ? -14.939 -2.682  -65.856 1.00 20.04 ? 465  LYS A NZ    1 
ATOM   3850 N  N     . ASP A 1 466 ? -19.865 -4.170  -60.541 1.00 22.00 ? 466  ASP A N     1 
ATOM   3851 C  CA    . ASP A 1 466 ? -21.260 -3.808  -60.773 1.00 25.21 ? 466  ASP A CA    1 
ATOM   3852 C  C     . ASP A 1 466 ? -22.104 -3.809  -59.500 1.00 26.87 ? 466  ASP A C     1 
ATOM   3853 O  O     . ASP A 1 466 ? -23.337 -3.828  -59.560 1.00 26.83 ? 466  ASP A O     1 
ATOM   3854 C  CB    . ASP A 1 466 ? -21.870 -4.735  -61.834 1.00 26.48 ? 466  ASP A CB    1 
ATOM   3855 C  CG    . ASP A 1 466 ? -21.812 -6.205  -61.439 1.00 29.11 ? 466  ASP A CG    1 
ATOM   3856 O  OD1   . ASP A 1 466 ? -20.918 -6.596  -60.649 1.00 32.73 ? 466  ASP A OD1   1 
ATOM   3857 O  OD2   . ASP A 1 466 ? -22.663 -6.975  -61.932 1.00 31.11 ? 466  ASP A OD2   1 
ATOM   3858 N  N     . ARG A 1 467 ? -21.439 -3.802  -58.350 1.00 26.94 ? 467  ARG A N     1 
ATOM   3859 C  CA    . ARG A 1 467 ? -22.140 -3.634  -57.081 1.00 28.47 ? 467  ARG A CA    1 
ATOM   3860 C  C     . ARG A 1 467 ? -21.400 -2.736  -56.097 1.00 27.40 ? 467  ARG A C     1 
ATOM   3861 O  O     . ARG A 1 467 ? -20.172 -2.606  -56.138 1.00 23.22 ? 467  ARG A O     1 
ATOM   3862 C  CB    . ARG A 1 467 ? -22.534 -4.977  -56.442 1.00 31.02 ? 467  ARG A CB    1 
ATOM   3863 C  CG    . ARG A 1 467 ? -21.508 -6.099  -56.481 1.00 35.50 ? 467  ARG A CG    1 
ATOM   3864 C  CD    . ARG A 1 467 ? -21.959 -7.227  -55.551 1.00 41.34 ? 467  ARG A CD    1 
ATOM   3865 N  NE    . ARG A 1 467 ? -21.524 -8.561  -55.975 1.00 45.32 ? 467  ARG A NE    1 
ATOM   3866 C  CZ    . ARG A 1 467 ? -22.307 -9.461  -56.571 1.00 47.15 ? 467  ARG A CZ    1 
ATOM   3867 N  NH1   . ARG A 1 467 ? -23.579 -9.183  -56.832 1.00 49.64 ? 467  ARG A NH1   1 
ATOM   3868 N  NH2   . ARG A 1 467 ? -21.816 -10.646 -56.911 1.00 46.38 ? 467  ARG A NH2   1 
ATOM   3869 N  N     . ASP A 1 468 ? -22.180 -2.099  -55.233 1.00 26.51 ? 468  ASP A N     1 
ATOM   3870 C  CA    . ASP A 1 468 ? -21.654 -1.156  -54.263 1.00 27.93 ? 468  ASP A CA    1 
ATOM   3871 C  C     . ASP A 1 468 ? -21.008 -1.880  -53.086 1.00 23.84 ? 468  ASP A C     1 
ATOM   3872 O  O     . ASP A 1 468 ? -21.454 -2.958  -52.669 1.00 25.30 ? 468  ASP A O     1 
ATOM   3873 C  CB    . ASP A 1 468 ? -22.764 -0.212  -53.785 1.00 30.79 ? 468  ASP A CB    1 
ATOM   3874 C  CG    . ASP A 1 468 ? -23.346 0.632   -54.918 1.00 34.83 ? 468  ASP A CG    1 
ATOM   3875 O  OD1   . ASP A 1 468 ? -22.581 1.388   -55.558 1.00 39.09 ? 468  ASP A OD1   1 
ATOM   3876 O  OD2   . ASP A 1 468 ? -24.568 0.543   -55.164 1.00 37.71 ? 468  ASP A OD2   1 
ATOM   3877 N  N     . GLY A 1 469 ? -19.931 -1.298  -52.587 1.00 20.26 ? 469  GLY A N     1 
ATOM   3878 C  CA    . GLY A 1 469 ? -19.268 -1.786  -51.388 1.00 15.93 ? 469  GLY A CA    1 
ATOM   3879 C  C     . GLY A 1 469 ? -19.492 -0.760  -50.305 1.00 13.76 ? 469  GLY A C     1 
ATOM   3880 O  O     . GLY A 1 469 ? -19.439 0.440   -50.568 1.00 13.26 ? 469  GLY A O     1 
ATOM   3881 N  N     . VAL A 1 470 ? -19.747 -1.232  -49.089 1.00 14.10 ? 470  VAL A N     1 
ATOM   3882 C  CA    . VAL A 1 470 ? -19.988 -0.345  -47.953 1.00 12.99 ? 470  VAL A CA    1 
ATOM   3883 C  C     . VAL A 1 470 ? -18.764 0.509   -47.634 1.00 11.85 ? 470  VAL A C     1 
ATOM   3884 O  O     . VAL A 1 470 ? -18.898 1.668   -47.231 1.00 12.24 ? 470  VAL A O     1 
ATOM   3885 C  CB    . VAL A 1 470 ? -20.481 -1.128  -46.698 1.00 14.72 ? 470  VAL A CB    1 
ATOM   3886 C  CG1   . VAL A 1 470 ? -19.368 -1.999  -46.106 1.00 9.99  ? 470  VAL A CG1   1 
ATOM   3887 C  CG2   . VAL A 1 470 ? -21.059 -0.171  -45.647 1.00 12.69 ? 470  VAL A CG2   1 
ATOM   3888 N  N     . VAL A 1 471 ? -17.570 -0.055  -47.811 1.00 11.18 ? 471  VAL A N     1 
ATOM   3889 C  CA    . VAL A 1 471 ? -16.355 0.719   -47.558 1.00 11.80 ? 471  VAL A CA    1 
ATOM   3890 C  C     . VAL A 1 471 ? -16.221 1.859   -48.591 1.00 10.07 ? 471  VAL A C     1 
ATOM   3891 O  O     . VAL A 1 471 ? -16.107 3.013   -48.194 1.00 10.51 ? 471  VAL A O     1 
ATOM   3892 C  CB    . VAL A 1 471 ? -15.076 -0.166  -47.408 1.00 10.84 ? 471  VAL A CB    1 
ATOM   3893 C  CG1   . VAL A 1 471 ? -13.806 0.683   -47.425 1.00 10.65 ? 471  VAL A CG1   1 
ATOM   3894 C  CG2   . VAL A 1 471 ? -15.136 -0.958  -46.110 1.00 16.01 ? 471  VAL A CG2   1 
ATOM   3895 N  N     . PRO A 1 472 ? -16.271 1.552   -49.904 1.00 11.16 ? 472  PRO A N     1 
ATOM   3896 C  CA    . PRO A 1 472 ? -16.301 2.653   -50.886 1.00 10.86 ? 472  PRO A CA    1 
ATOM   3897 C  C     . PRO A 1 472 ? -17.447 3.656   -50.682 1.00 12.37 ? 472  PRO A C     1 
ATOM   3898 O  O     . PRO A 1 472 ? -17.239 4.863   -50.825 1.00 13.27 ? 472  PRO A O     1 
ATOM   3899 C  CB    . PRO A 1 472 ? -16.475 1.922   -52.218 1.00 11.17 ? 472  PRO A CB    1 
ATOM   3900 C  CG    . PRO A 1 472 ? -15.772 0.626   -52.004 1.00 11.14 ? 472  PRO A CG    1 
ATOM   3901 C  CD    . PRO A 1 472 ? -16.053 0.251   -50.565 1.00 11.60 ? 472  PRO A CD    1 
ATOM   3902 N  N     . THR A 1 473 ? -18.642 3.167   -50.365 1.00 11.87 ? 473  THR A N     1 
ATOM   3903 C  CA    . THR A 1 473 ? -19.804 4.052   -50.208 1.00 12.28 ? 473  THR A CA    1 
ATOM   3904 C  C     . THR A 1 473 ? -19.570 5.071   -49.096 1.00 10.80 ? 473  THR A C     1 
ATOM   3905 O  O     . THR A 1 473 ? -19.731 6.272   -49.296 1.00 9.88  ? 473  THR A O     1 
ATOM   3906 C  CB    . THR A 1 473 ? -21.095 3.241   -49.944 1.00 11.89 ? 473  THR A CB    1 
ATOM   3907 O  OG1   . THR A 1 473 ? -21.378 2.443   -51.095 1.00 14.56 ? 473  THR A OG1   1 
ATOM   3908 C  CG2   . THR A 1 473 ? -22.290 4.151   -49.678 1.00 15.35 ? 473  THR A CG2   1 
ATOM   3909 N  N     . GLU A 1 474 ? -19.166 4.582   -47.934 1.00 10.56 ? 474  GLU A N     1 
ATOM   3910 C  CA    . GLU A 1 474 ? -19.029 5.444   -46.765 1.00 12.33 ? 474  GLU A CA    1 
ATOM   3911 C  C     . GLU A 1 474 ? -17.755 6.283   -46.789 1.00 11.60 ? 474  GLU A C     1 
ATOM   3912 O  O     . GLU A 1 474 ? -17.742 7.398   -46.264 1.00 12.51 ? 474  GLU A O     1 
ATOM   3913 C  CB    . GLU A 1 474 ? -19.126 4.617   -45.479 1.00 10.30 ? 474  GLU A CB    1 
ATOM   3914 C  CG    . GLU A 1 474 ? -20.495 3.950   -45.288 1.00 12.34 ? 474  GLU A CG    1 
ATOM   3915 C  CD    . GLU A 1 474 ? -21.649 4.954   -45.249 1.00 13.77 ? 474  GLU A CD    1 
ATOM   3916 O  OE1   . GLU A 1 474 ? -22.739 4.637   -45.772 1.00 14.08 ? 474  GLU A OE1   1 
ATOM   3917 O  OE2   . GLU A 1 474 ? -21.465 6.065   -44.710 1.00 12.78 ? 474  GLU A OE2   1 
ATOM   3918 N  N     . ILE A 1 475 ? -16.694 5.764   -47.407 1.00 12.71 ? 475  ILE A N     1 
ATOM   3919 C  CA    . ILE A 1 475 ? -15.460 6.545   -47.541 1.00 13.77 ? 475  ILE A CA    1 
ATOM   3920 C  C     . ILE A 1 475 ? -15.673 7.736   -48.490 1.00 13.46 ? 475  ILE A C     1 
ATOM   3921 O  O     . ILE A 1 475 ? -15.123 8.816   -48.266 1.00 12.17 ? 475  ILE A O     1 
ATOM   3922 C  CB    . ILE A 1 475 ? -14.219 5.674   -47.925 1.00 14.73 ? 475  ILE A CB    1 
ATOM   3923 C  CG1   . ILE A 1 475 ? -12.952 6.243   -47.272 1.00 13.64 ? 475  ILE A CG1   1 
ATOM   3924 C  CG2   . ILE A 1 475 ? -14.056 5.533   -49.457 1.00 13.30 ? 475  ILE A CG2   1 
ATOM   3925 C  CD1   . ILE A 1 475 ? -11.692 5.422   -47.498 1.00 11.58 ? 475  ILE A CD1   1 
ATOM   3926 N  N     . THR A 1 476 ? -16.486 7.531   -49.529 1.00 12.94 ? 476  THR A N     1 
ATOM   3927 C  CA    . THR A 1 476 ? -16.854 8.593   -50.472 1.00 13.41 ? 476  THR A CA    1 
ATOM   3928 C  C     . THR A 1 476 ? -17.587 9.759   -49.788 1.00 12.12 ? 476  THR A C     1 
ATOM   3929 O  O     . THR A 1 476 ? -17.299 10.924  -50.073 1.00 12.25 ? 476  THR A O     1 
ATOM   3930 C  CB    . THR A 1 476 ? -17.700 8.042   -51.642 1.00 15.13 ? 476  THR A CB    1 
ATOM   3931 O  OG1   . THR A 1 476 ? -16.956 7.023   -52.326 1.00 13.57 ? 476  THR A OG1   1 
ATOM   3932 C  CG2   . THR A 1 476 ? -18.091 9.155   -52.636 1.00 13.11 ? 476  THR A CG2   1 
ATOM   3933 N  N     . LYS A 1 477 ? -18.519 9.449   -48.888 1.00 9.73  ? 477  LYS A N     1 
ATOM   3934 C  CA    . LYS A 1 477 ? -19.256 10.499  -48.172 1.00 12.44 ? 477  LYS A CA    1 
ATOM   3935 C  C     . LYS A 1 477 ? -18.295 11.417  -47.395 1.00 12.37 ? 477  LYS A C     1 
ATOM   3936 O  O     . LYS A 1 477 ? -18.369 12.653  -47.487 1.00 12.94 ? 477  LYS A O     1 
ATOM   3937 C  CB    . LYS A 1 477 ? -20.310 9.891   -47.233 1.00 12.32 ? 477  LYS A CB    1 
ATOM   3938 C  CG    . LYS A 1 477 ? -21.482 9.202   -47.935 1.00 16.56 ? 477  LYS A CG    1 
ATOM   3939 C  CD    . LYS A 1 477 ? -22.396 8.499   -46.930 1.00 19.51 ? 477  LYS A CD    1 
ATOM   3940 C  CE    . LYS A 1 477 ? -23.354 7.560   -47.638 1.00 23.98 ? 477  LYS A CE    1 
ATOM   3941 N  NZ    . LYS A 1 477 ? -24.240 6.784   -46.700 1.00 28.79 ? 477  LYS A NZ    1 
ATOM   3942 N  N     . VAL A 1 478 ? -17.375 10.817  -46.652 1.00 13.54 ? 478  VAL A N     1 
ATOM   3943 C  CA    . VAL A 1 478 ? -16.430 11.609  -45.858 1.00 13.35 ? 478  VAL A CA    1 
ATOM   3944 C  C     . VAL A 1 478 ? -15.427 12.328  -46.760 1.00 14.93 ? 478  VAL A C     1 
ATOM   3945 O  O     . VAL A 1 478 ? -15.097 13.492  -46.511 1.00 14.53 ? 478  VAL A O     1 
ATOM   3946 C  CB    . VAL A 1 478 ? -15.736 10.769  -44.755 1.00 14.18 ? 478  VAL A CB    1 
ATOM   3947 C  CG1   . VAL A 1 478 ? -14.764 11.632  -43.938 1.00 13.43 ? 478  VAL A CG1   1 
ATOM   3948 C  CG2   . VAL A 1 478 ? -16.772 10.162  -43.830 1.00 10.18 ? 478  VAL A CG2   1 
ATOM   3949 N  N     . PHE A 1 479 ? -14.962 11.654  -47.817 1.00 13.33 ? 479  PHE A N     1 
ATOM   3950 C  CA    . PHE A 1 479 ? -14.102 12.314  -48.793 1.00 14.42 ? 479  PHE A CA    1 
ATOM   3951 C  C     . PHE A 1 479 ? -14.747 13.588  -49.370 1.00 14.67 ? 479  PHE A C     1 
ATOM   3952 O  O     . PHE A 1 479 ? -14.090 14.621  -49.482 1.00 15.21 ? 479  PHE A O     1 
ATOM   3953 C  CB    . PHE A 1 479 ? -13.687 11.383  -49.938 1.00 14.07 ? 479  PHE A CB    1 
ATOM   3954 C  CG    . PHE A 1 479 ? -13.009 12.115  -51.070 1.00 17.40 ? 479  PHE A CG    1 
ATOM   3955 C  CD1   . PHE A 1 479 ? -11.692 12.564  -50.938 1.00 18.25 ? 479  PHE A CD1   1 
ATOM   3956 C  CD2   . PHE A 1 479 ? -13.704 12.401  -52.248 1.00 17.14 ? 479  PHE A CD2   1 
ATOM   3957 C  CE1   . PHE A 1 479 ? -11.072 13.280  -51.977 1.00 18.64 ? 479  PHE A CE1   1 
ATOM   3958 C  CE2   . PHE A 1 479 ? -13.093 13.105  -53.291 1.00 18.63 ? 479  PHE A CE2   1 
ATOM   3959 C  CZ    . PHE A 1 479 ? -11.776 13.543  -53.159 1.00 19.55 ? 479  PHE A CZ    1 
ATOM   3960 N  N     . ASN A 1 480 ? -16.026 13.507  -49.734 1.00 15.01 ? 480  ASN A N     1 
ATOM   3961 C  CA    . ASN A 1 480 ? -16.715 14.656  -50.317 1.00 15.29 ? 480  ASN A CA    1 
ATOM   3962 C  C     . ASN A 1 480 ? -16.812 15.850  -49.357 1.00 15.30 ? 480  ASN A C     1 
ATOM   3963 O  O     . ASN A 1 480 ? -16.657 16.999  -49.775 1.00 14.83 ? 480  ASN A O     1 
ATOM   3964 C  CB    . ASN A 1 480 ? -18.085 14.250  -50.874 1.00 16.79 ? 480  ASN A CB    1 
ATOM   3965 C  CG    . ASN A 1 480 ? -17.981 13.513  -52.204 1.00 20.38 ? 480  ASN A CG    1 
ATOM   3966 O  OD1   . ASN A 1 480 ? -17.036 13.715  -52.967 1.00 19.70 ? 480  ASN A OD1   1 
ATOM   3967 N  ND2   . ASN A 1 480 ? -18.969 12.669  -52.497 1.00 18.32 ? 480  ASN A ND2   1 
ATOM   3968 N  N     . GLN A 1 481 ? -17.046 15.572  -48.076 1.00 13.75 ? 481  GLN A N     1 
ATOM   3969 C  CA    . GLN A 1 481 ? -16.971 16.594  -47.022 1.00 16.28 ? 481  GLN A CA    1 
ATOM   3970 C  C     . GLN A 1 481 ? -15.589 17.211  -46.943 1.00 16.18 ? 481  GLN A C     1 
ATOM   3971 O  O     . GLN A 1 481 ? -15.456 18.436  -46.857 1.00 18.01 ? 481  GLN A O     1 
ATOM   3972 C  CB    . GLN A 1 481 ? -17.293 15.994  -45.654 1.00 16.10 ? 481  GLN A CB    1 
ATOM   3973 C  CG    . GLN A 1 481 ? -18.732 15.571  -45.445 1.00 22.45 ? 481  GLN A CG    1 
ATOM   3974 C  CD    . GLN A 1 481 ? -18.912 14.801  -44.146 1.00 28.17 ? 481  GLN A CD    1 
ATOM   3975 O  OE1   . GLN A 1 481 ? -17.955 14.579  -43.394 1.00 27.92 ? 481  GLN A OE1   1 
ATOM   3976 N  NE2   . GLN A 1 481 ? -20.140 14.386  -43.876 1.00 33.24 ? 481  GLN A NE2   1 
ATOM   3977 N  N     . ARG A 1 482 ? -14.567 16.355  -46.945 1.00 16.77 ? 482  ARG A N     1 
ATOM   3978 C  CA    . ARG A 1 482 ? -13.168 16.792  -46.908 1.00 17.74 ? 482  ARG A CA    1 
ATOM   3979 C  C     . ARG A 1 482 ? -12.879 17.749  -48.060 1.00 17.76 ? 482  ARG A C     1 
ATOM   3980 O  O     . ARG A 1 482 ? -12.279 18.806  -47.858 1.00 17.06 ? 482  ARG A O     1 
ATOM   3981 C  CB    . ARG A 1 482 ? -12.218 15.587  -46.968 1.00 17.91 ? 482  ARG A CB    1 
ATOM   3982 C  CG    . ARG A 1 482 ? -10.725 15.918  -46.790 1.00 17.80 ? 482  ARG A CG    1 
ATOM   3983 C  CD    . ARG A 1 482 ? -10.005 16.245  -48.104 1.00 17.85 ? 482  ARG A CD    1 
ATOM   3984 N  NE    . ARG A 1 482 ? -8.647  16.725  -47.834 1.00 16.11 ? 482  ARG A NE    1 
ATOM   3985 C  CZ    . ARG A 1 482 ? -7.573  16.456  -48.574 1.00 16.70 ? 482  ARG A CZ    1 
ATOM   3986 N  NH1   . ARG A 1 482 ? -7.666  15.704  -49.666 1.00 17.95 ? 482  ARG A NH1   1 
ATOM   3987 N  NH2   . ARG A 1 482 ? -6.389  16.937  -48.208 1.00 13.85 ? 482  ARG A NH2   1 
ATOM   3988 N  N     . LYS A 1 483 ? -13.316 17.366  -49.259 1.00 17.38 ? 483  LYS A N     1 
ATOM   3989 C  CA    . LYS A 1 483 ? -13.093 18.153  -50.472 1.00 17.41 ? 483  LYS A CA    1 
ATOM   3990 C  C     . LYS A 1 483 ? -13.722 19.545  -50.376 1.00 16.34 ? 483  LYS A C     1 
ATOM   3991 O  O     . LYS A 1 483 ? -13.104 20.535  -50.761 1.00 15.49 ? 483  LYS A O     1 
ATOM   3992 C  CB    . LYS A 1 483 ? -13.635 17.409  -51.698 1.00 17.76 ? 483  LYS A CB    1 
ATOM   3993 C  CG    . LYS A 1 483 ? -13.314 18.082  -53.021 1.00 19.49 ? 483  LYS A CG    1 
ATOM   3994 C  CD    . LYS A 1 483 ? -13.997 17.378  -54.172 1.00 24.51 ? 483  LYS A CD    1 
ATOM   3995 C  CE    . LYS A 1 483 ? -13.611 18.012  -55.488 1.00 27.54 ? 483  LYS A CE    1 
ATOM   3996 N  NZ    . LYS A 1 483 ? -14.375 17.413  -56.611 1.00 33.50 ? 483  LYS A NZ    1 
ATOM   3997 N  N     . GLU A 1 484 ? -14.946 19.609  -49.860 1.00 14.90 ? 484  GLU A N     1 
ATOM   3998 C  CA    . GLU A 1 484 ? -15.638 20.885  -49.668 1.00 16.31 ? 484  GLU A CA    1 
ATOM   3999 C  C     . GLU A 1 484 ? -14.814 21.818  -48.778 1.00 15.83 ? 484  GLU A C     1 
ATOM   4000 O  O     . GLU A 1 484 ? -14.570 22.970  -49.147 1.00 16.88 ? 484  GLU A O     1 
ATOM   4001 C  CB    . GLU A 1 484 ? -17.039 20.672  -49.071 1.00 16.34 ? 484  GLU A CB    1 
ATOM   4002 C  CG    . GLU A 1 484 ? -17.814 21.973  -48.789 1.00 19.20 ? 484  GLU A CG    1 
ATOM   4003 C  CD    . GLU A 1 484 ? -19.082 21.765  -47.945 1.00 25.63 ? 484  GLU A CD    1 
ATOM   4004 O  OE1   . GLU A 1 484 ? -19.428 20.611  -47.617 1.00 27.90 ? 484  GLU A OE1   1 
ATOM   4005 O  OE2   . GLU A 1 484 ? -19.737 22.769  -47.606 1.00 25.50 ? 484  GLU A OE2   1 
ATOM   4006 N  N     . HIS A 1 485 ? -14.380 21.310  -47.622 1.00 12.74 ? 485  HIS A N     1 
ATOM   4007 C  CA    . HIS A 1 485 ? -13.626 22.109  -46.655 1.00 14.10 ? 485  HIS A CA    1 
ATOM   4008 C  C     . HIS A 1 485 ? -12.243 22.510  -47.149 1.00 14.46 ? 485  HIS A C     1 
ATOM   4009 O  O     . HIS A 1 485 ? -11.800 23.626  -46.888 1.00 14.47 ? 485  HIS A O     1 
ATOM   4010 C  CB    . HIS A 1 485 ? -13.532 21.402  -45.296 1.00 13.18 ? 485  HIS A CB    1 
ATOM   4011 C  CG    . HIS A 1 485 ? -14.828 21.382  -44.544 1.00 13.41 ? 485  HIS A CG    1 
ATOM   4012 N  ND1   . HIS A 1 485 ? -15.363 22.509  -43.959 1.00 12.44 ? 485  HIS A ND1   1 
ATOM   4013 C  CD2   . HIS A 1 485 ? -15.697 20.376  -44.286 1.00 15.51 ? 485  HIS A CD2   1 
ATOM   4014 C  CE1   . HIS A 1 485 ? -16.510 22.200  -43.376 1.00 16.32 ? 485  HIS A CE1   1 
ATOM   4015 N  NE2   . HIS A 1 485 ? -16.736 20.911  -43.560 1.00 15.40 ? 485  HIS A NE2   1 
ATOM   4016 N  N     . LYS A 1 486 ? -11.566 21.611  -47.863 1.00 13.79 ? 486  LYS A N     1 
ATOM   4017 C  CA    . LYS A 1 486 ? -10.259 21.942  -48.428 1.00 13.40 ? 486  LYS A CA    1 
ATOM   4018 C  C     . LYS A 1 486 ? -10.388 23.083  -49.452 1.00 12.21 ? 486  LYS A C     1 
ATOM   4019 O  O     . LYS A 1 486 ? -9.512  23.947  -49.549 1.00 10.87 ? 486  LYS A O     1 
ATOM   4020 C  CB    . LYS A 1 486 ? -9.582  20.719  -49.052 1.00 15.47 ? 486  LYS A CB    1 
ATOM   4021 C  CG    . LYS A 1 486 ? -8.133  21.027  -49.467 1.00 18.72 ? 486  LYS A CG    1 
ATOM   4022 C  CD    . LYS A 1 486 ? -7.475  19.933  -50.267 1.00 22.08 ? 486  LYS A CD    1 
ATOM   4023 C  CE    . LYS A 1 486 ? -6.051  20.339  -50.624 1.00 24.81 ? 486  LYS A CE    1 
ATOM   4024 N  NZ    . LYS A 1 486 ? -5.301  19.278  -51.366 1.00 27.48 ? 486  LYS A NZ    1 
ATOM   4025 N  N     . GLY A 1 487 ? -11.490 23.081  -50.199 1.00 12.63 ? 487  GLY A N     1 
ATOM   4026 C  CA    . GLY A 1 487 ? -11.842 24.191  -51.091 1.00 13.78 ? 487  GLY A CA    1 
ATOM   4027 C  C     . GLY A 1 487 ? -11.940 25.528  -50.370 1.00 14.65 ? 487  GLY A C     1 
ATOM   4028 O  O     . GLY A 1 487 ? -11.372 26.528  -50.826 1.00 14.72 ? 487  GLY A O     1 
ATOM   4029 N  N     . TYR A 1 488 ? -12.648 25.543  -49.239 1.00 15.18 ? 488  TYR A N     1 
ATOM   4030 C  CA    . TYR A 1 488 ? -12.752 26.743  -48.398 1.00 16.22 ? 488  TYR A CA    1 
ATOM   4031 C  C     . TYR A 1 488 ? -11.397 27.177  -47.858 1.00 14.95 ? 488  TYR A C     1 
ATOM   4032 O  O     . TYR A 1 488 ? -11.108 28.371  -47.793 1.00 16.06 ? 488  TYR A O     1 
ATOM   4033 C  CB    . TYR A 1 488 ? -13.700 26.525  -47.211 1.00 15.01 ? 488  TYR A CB    1 
ATOM   4034 C  CG    . TYR A 1 488 ? -15.123 26.126  -47.549 1.00 17.09 ? 488  TYR A CG    1 
ATOM   4035 C  CD1   . TYR A 1 488 ? -15.731 26.530  -48.741 1.00 17.67 ? 488  TYR A CD1   1 
ATOM   4036 C  CD2   . TYR A 1 488 ? -15.878 25.390  -46.642 1.00 17.74 ? 488  TYR A CD2   1 
ATOM   4037 C  CE1   . TYR A 1 488 ? -17.049 26.175  -49.035 1.00 18.95 ? 488  TYR A CE1   1 
ATOM   4038 C  CE2   . TYR A 1 488 ? -17.200 25.032  -46.921 1.00 18.80 ? 488  TYR A CE2   1 
ATOM   4039 C  CZ    . TYR A 1 488 ? -17.774 25.432  -48.116 1.00 19.57 ? 488  TYR A CZ    1 
ATOM   4040 O  OH    . TYR A 1 488 ? -19.073 25.077  -48.390 1.00 18.77 ? 488  TYR A OH    1 
ATOM   4041 N  N     . MET A 1 489 ? -10.579 26.206  -47.457 1.00 13.75 ? 489  MET A N     1 
ATOM   4042 C  CA    . MET A 1 489 ? -9.245  26.488  -46.920 1.00 13.93 ? 489  MET A CA    1 
ATOM   4043 C  C     . MET A 1 489 ? -8.357  27.155  -47.970 1.00 13.14 ? 489  MET A C     1 
ATOM   4044 O  O     . MET A 1 489 ? -7.679  28.146  -47.680 1.00 13.96 ? 489  MET A O     1 
ATOM   4045 C  CB    . MET A 1 489 ? -8.583  25.201  -46.405 1.00 14.23 ? 489  MET A CB    1 
ATOM   4046 C  CG    . MET A 1 489 ? -7.187  25.409  -45.816 1.00 15.68 ? 489  MET A CG    1 
ATOM   4047 S  SD    . MET A 1 489 ? -6.255  23.875  -45.598 1.00 21.38 ? 489  MET A SD    1 
ATOM   4048 C  CE    . MET A 1 489 ? -5.716  23.529  -47.275 1.00 18.08 ? 489  MET A CE    1 
ATOM   4049 N  N     . LEU A 1 490 ? -8.370  26.611  -49.184 1.00 12.78 ? 490  LEU A N     1 
ATOM   4050 C  CA    . LEU A 1 490 ? -7.522  27.115  -50.264 1.00 12.93 ? 490  LEU A CA    1 
ATOM   4051 C  C     . LEU A 1 490 ? -7.963  28.486  -50.776 1.00 12.93 ? 490  LEU A C     1 
ATOM   4052 O  O     . LEU A 1 490 ? -7.126  29.331  -51.105 1.00 13.59 ? 490  LEU A O     1 
ATOM   4053 C  CB    . LEU A 1 490 ? -7.430  26.101  -51.414 1.00 13.46 ? 490  LEU A CB    1 
ATOM   4054 C  CG    . LEU A 1 490 ? -6.641  24.812  -51.127 1.00 15.41 ? 490  LEU A CG    1 
ATOM   4055 C  CD1   . LEU A 1 490 ? -6.551  23.935  -52.373 1.00 18.28 ? 490  LEU A CD1   1 
ATOM   4056 C  CD2   . LEU A 1 490 ? -5.242  25.112  -50.585 1.00 14.06 ? 490  LEU A CD2   1 
ATOM   4057 N  N     . ALA A 1 491 ? -9.273  28.700  -50.856 1.00 11.66 ? 491  ALA A N     1 
ATOM   4058 C  CA    . ALA A 1 491 ? -9.800  30.011  -51.223 1.00 12.02 ? 491  ALA A CA    1 
ATOM   4059 C  C     . ALA A 1 491 ? -9.367  31.060  -50.198 1.00 12.83 ? 491  ALA A C     1 
ATOM   4060 O  O     . ALA A 1 491 ? -8.960  32.160  -50.573 1.00 14.51 ? 491  ALA A O     1 
ATOM   4061 C  CB    . ALA A 1 491 ? -11.321 29.970  -51.346 1.00 10.62 ? 491  ALA A CB    1 
ATOM   4062 N  N     . ALA A 1 492 ? -9.455  30.716  -48.911 1.00 12.96 ? 492  ALA A N     1 
ATOM   4063 C  CA    . ALA A 1 492 ? -9.051  31.632  -47.831 1.00 13.86 ? 492  ALA A CA    1 
ATOM   4064 C  C     . ALA A 1 492 ? -7.553  31.937  -47.895 1.00 13.42 ? 492  ALA A C     1 
ATOM   4065 O  O     . ALA A 1 492 ? -7.123  33.065  -47.652 1.00 12.56 ? 492  ALA A O     1 
ATOM   4066 C  CB    . ALA A 1 492 ? -9.429  31.064  -46.466 1.00 13.22 ? 492  ALA A CB    1 
ATOM   4067 N  N     . GLN A 1 493 ? -6.773  30.915  -48.232 1.00 12.85 ? 493  GLN A N     1 
ATOM   4068 C  CA    . GLN A 1 493 ? -5.341  31.045  -48.437 1.00 14.21 ? 493  GLN A CA    1 
ATOM   4069 C  C     . GLN A 1 493 ? -5.047  31.992  -49.608 1.00 14.35 ? 493  GLN A C     1 
ATOM   4070 O  O     . GLN A 1 493 ? -4.199  32.879  -49.502 1.00 14.53 ? 493  GLN A O     1 
ATOM   4071 C  CB    . GLN A 1 493 ? -4.752  29.660  -48.696 1.00 15.82 ? 493  GLN A CB    1 
ATOM   4072 C  CG    . GLN A 1 493 ? -3.241  29.593  -48.776 1.00 15.80 ? 493  GLN A CG    1 
ATOM   4073 C  CD    . GLN A 1 493 ? -2.772  28.175  -48.985 1.00 21.02 ? 493  GLN A CD    1 
ATOM   4074 O  OE1   . GLN A 1 493 ? -2.445  27.780  -50.102 1.00 18.14 ? 493  GLN A OE1   1 
ATOM   4075 N  NE2   . GLN A 1 493 ? -2.768  27.386  -47.914 1.00 20.65 ? 493  GLN A NE2   1 
ATOM   4076 N  N     . ARG A 1 494 ? -5.767  31.809  -50.712 1.00 14.07 ? 494  ARG A N     1 
ATOM   4077 C  CA    . ARG A 1 494 ? -5.601  32.660  -51.894 1.00 14.54 ? 494  ARG A CA    1 
ATOM   4078 C  C     . ARG A 1 494 ? -5.999  34.097  -51.574 1.00 13.91 ? 494  ARG A C     1 
ATOM   4079 O  O     . ARG A 1 494 ? -5.305  35.035  -51.960 1.00 13.01 ? 494  ARG A O     1 
ATOM   4080 C  CB    . ARG A 1 494 ? -6.404  32.117  -53.083 1.00 12.48 ? 494  ARG A CB    1 
ATOM   4081 C  CG    . ARG A 1 494 ? -5.779  30.872  -53.716 1.00 14.35 ? 494  ARG A CG    1 
ATOM   4082 C  CD    . ARG A 1 494 ? -6.460  30.450  -55.016 1.00 14.65 ? 494  ARG A CD    1 
ATOM   4083 N  NE    . ARG A 1 494 ? -7.893  30.176  -54.867 1.00 14.32 ? 494  ARG A NE    1 
ATOM   4084 C  CZ    . ARG A 1 494 ? -8.432  28.974  -54.660 1.00 16.28 ? 494  ARG A CZ    1 
ATOM   4085 N  NH1   . ARG A 1 494 ? -7.670  27.886  -54.550 1.00 12.31 ? 494  ARG A NH1   1 
ATOM   4086 N  NH2   . ARG A 1 494 ? -9.751  28.862  -54.554 1.00 14.75 ? 494  ARG A NH2   1 
ATOM   4087 N  N     . ASN A 1 495 ? -7.112  34.249  -50.858 1.00 13.14 ? 495  ASN A N     1 
ATOM   4088 C  CA    . ASN A 1 495 ? -7.585  35.561  -50.411 1.00 14.66 ? 495  ASN A CA    1 
ATOM   4089 C  C     . ASN A 1 495 ? -6.564  36.271  -49.520 1.00 14.06 ? 495  ASN A C     1 
ATOM   4090 O  O     . ASN A 1 495 ? -6.377  37.483  -49.625 1.00 15.29 ? 495  ASN A O     1 
ATOM   4091 C  CB    . ASN A 1 495 ? -8.937  35.421  -49.700 1.00 13.78 ? 495  ASN A CB    1 
ATOM   4092 C  CG    . ASN A 1 495 ? -10.078 35.141  -50.665 1.00 17.16 ? 495  ASN A CG    1 
ATOM   4093 O  OD1   . ASN A 1 495 ? -9.998  35.459  -51.860 1.00 15.25 ? 495  ASN A OD1   1 
ATOM   4094 N  ND2   . ASN A 1 495 ? -11.152 34.542  -50.152 1.00 17.96 ? 495  ASN A ND2   1 
ATOM   4095 N  N     . GLY A 1 496 ? -5.902  35.505  -48.655 1.00 14.79 ? 496  GLY A N     1 
ATOM   4096 C  CA    . GLY A 1 496 ? -4.819  36.023  -47.808 1.00 13.65 ? 496  GLY A CA    1 
ATOM   4097 C  C     . GLY A 1 496 ? -3.708  36.678  -48.612 1.00 15.86 ? 496  GLY A C     1 
ATOM   4098 O  O     . GLY A 1 496 ? -3.272  37.784  -48.282 1.00 16.48 ? 496  GLY A O     1 
ATOM   4099 N  N     . GLU A 1 497 ? -3.266  36.006  -49.679 1.00 15.29 ? 497  GLU A N     1 
ATOM   4100 C  CA    . GLU A 1 497 ? -2.204  36.525  -50.544 1.00 14.87 ? 497  GLU A CA    1 
ATOM   4101 C  C     . GLU A 1 497 ? -2.621  37.798  -51.266 1.00 14.71 ? 497  GLU A C     1 
ATOM   4102 O  O     . GLU A 1 497 ? -1.798  38.687  -51.471 1.00 15.21 ? 497  GLU A O     1 
ATOM   4103 C  CB    . GLU A 1 497 ? -1.730  35.476  -51.555 1.00 15.12 ? 497  GLU A CB    1 
ATOM   4104 C  CG    . GLU A 1 497 ? -1.109  34.221  -50.928 1.00 15.78 ? 497  GLU A CG    1 
ATOM   4105 C  CD    . GLU A 1 497 ? 0.035   34.524  -49.964 1.00 18.72 ? 497  GLU A CD    1 
ATOM   4106 O  OE1   . GLU A 1 497 ? 0.932   35.321  -50.315 1.00 18.06 ? 497  GLU A OE1   1 
ATOM   4107 O  OE2   . GLU A 1 497 ? 0.034   33.957  -48.853 1.00 14.67 ? 497  GLU A OE2   1 
ATOM   4108 N  N     . ILE A 1 498 ? -3.896  37.881  -51.644 1.00 15.26 ? 498  ILE A N     1 
ATOM   4109 C  CA    . ILE A 1 498 ? -4.459  39.109  -52.219 1.00 15.19 ? 498  ILE A CA    1 
ATOM   4110 C  C     . ILE A 1 498 ? -4.292  40.283  -51.246 1.00 15.79 ? 498  ILE A C     1 
ATOM   4111 O  O     . ILE A 1 498 ? -3.929  41.395  -51.652 1.00 17.20 ? 498  ILE A O     1 
ATOM   4112 C  CB    . ILE A 1 498 ? -5.955  38.921  -52.606 1.00 16.04 ? 498  ILE A CB    1 
ATOM   4113 C  CG1   . ILE A 1 498 ? -6.074  37.995  -53.825 1.00 15.27 ? 498  ILE A CG1   1 
ATOM   4114 C  CG2   . ILE A 1 498 ? -6.641  40.278  -52.870 1.00 15.55 ? 498  ILE A CG2   1 
ATOM   4115 C  CD1   . ILE A 1 498 ? -7.500  37.625  -54.198 1.00 17.70 ? 498  ILE A CD1   1 
ATOM   4116 N  N     . ILE A 1 499 ? -4.549  40.021  -49.964 1.00 14.96 ? 499  ILE A N     1 
ATOM   4117 C  CA    . ILE A 1 499 ? -4.446  41.040  -48.917 1.00 14.73 ? 499  ILE A CA    1 
ATOM   4118 C  C     . ILE A 1 499 ? -2.983  41.413  -48.641 1.00 15.07 ? 499  ILE A C     1 
ATOM   4119 O  O     . ILE A 1 499 ? -2.667  42.591  -48.435 1.00 15.33 ? 499  ILE A O     1 
ATOM   4120 C  CB    . ILE A 1 499 ? -5.170  40.597  -47.619 1.00 13.59 ? 499  ILE A CB    1 
ATOM   4121 C  CG1   . ILE A 1 499 ? -6.674  40.421  -47.884 1.00 15.69 ? 499  ILE A CG1   1 
ATOM   4122 C  CG2   . ILE A 1 499 ? -4.933  41.602  -46.494 1.00 12.89 ? 499  ILE A CG2   1 
ATOM   4123 C  CD1   . ILE A 1 499 ? -7.386  39.473  -46.906 1.00 15.18 ? 499  ILE A CD1   1 
ATOM   4124 N  N     . LYS A 1 500 ? -2.103  40.413  -48.646 1.00 15.91 ? 500  LYS A N     1 
ATOM   4125 C  CA    . LYS A 1 500 ? -0.656  40.638  -48.499 1.00 18.12 ? 500  LYS A CA    1 
ATOM   4126 C  C     . LYS A 1 500 ? -0.065  41.471  -49.635 1.00 19.64 ? 500  LYS A C     1 
ATOM   4127 O  O     . LYS A 1 500 ? 0.833   42.286  -49.405 1.00 20.59 ? 500  LYS A O     1 
ATOM   4128 C  CB    . LYS A 1 500 ? 0.095   39.313  -48.387 1.00 17.54 ? 500  LYS A CB    1 
ATOM   4129 C  CG    . LYS A 1 500 ? -0.093  38.602  -47.060 1.00 17.40 ? 500  LYS A CG    1 
ATOM   4130 C  CD    . LYS A 1 500 ? 0.645   37.272  -47.062 1.00 17.00 ? 500  LYS A CD    1 
ATOM   4131 C  CE    . LYS A 1 500 ? 0.233   36.410  -45.885 1.00 17.91 ? 500  LYS A CE    1 
ATOM   4132 N  NZ    . LYS A 1 500 ? 0.826   35.044  -45.995 1.00 18.58 ? 500  LYS A NZ    1 
ATOM   4133 N  N     . GLU A 1 501 ? -0.563  41.265  -50.854 1.00 21.06 ? 501  GLU A N     1 
ATOM   4134 C  CA    . GLU A 1 501 ? -0.149  42.078  -52.006 1.00 21.74 ? 501  GLU A CA    1 
ATOM   4135 C  C     . GLU A 1 501 ? -0.599  43.529  -51.841 1.00 21.50 ? 501  GLU A C     1 
ATOM   4136 O  O     . GLU A 1 501 ? 0.163   44.459  -52.115 1.00 20.99 ? 501  GLU A O     1 
ATOM   4137 C  CB    . GLU A 1 501 ? -0.697  41.506  -53.319 1.00 21.43 ? 501  GLU A CB    1 
ATOM   4138 C  CG    . GLU A 1 501 ? -0.076  40.175  -53.761 1.00 25.19 ? 501  GLU A CG    1 
ATOM   4139 C  CD    . GLU A 1 501 ? 1.274   40.318  -54.465 1.00 27.46 ? 501  GLU A CD    1 
ATOM   4140 O  OE1   . GLU A 1 501 ? 1.824   41.445  -54.538 1.00 28.05 ? 501  GLU A OE1   1 
ATOM   4141 O  OE2   . GLU A 1 501 ? 1.788   39.283  -54.947 1.00 26.77 ? 501  GLU A OE2   1 
ATOM   4142 N  N     . ALA A 1 502 ? -1.839  43.713  -51.392 1.00 21.95 ? 502  ALA A N     1 
ATOM   4143 C  CA    . ALA A 1 502 ? -2.405  45.048  -51.180 1.00 22.11 ? 502  ALA A CA    1 
ATOM   4144 C  C     . ALA A 1 502 ? -1.692  45.813  -50.059 1.00 23.45 ? 502  ALA A C     1 
ATOM   4145 O  O     . ALA A 1 502 ? -1.606  47.044  -50.098 1.00 23.87 ? 502  ALA A O     1 
ATOM   4146 C  CB    . ALA A 1 502 ? -3.885  44.952  -50.890 1.00 21.27 ? 502  ALA A CB    1 
ATOM   4147 N  N     . LEU A 1 503 ? -1.180  45.078  -49.070 1.00 24.70 ? 503  LEU A N     1 
ATOM   4148 C  CA    . LEU A 1 503 ? -0.460  45.674  -47.936 1.00 26.73 ? 503  LEU A CA    1 
ATOM   4149 C  C     . LEU A 1 503 ? 0.868   46.341  -48.312 1.00 27.99 ? 503  LEU A C     1 
ATOM   4150 O  O     . LEU A 1 503 ? 1.463   47.052  -47.495 1.00 27.82 ? 503  LEU A O     1 
ATOM   4151 C  CB    . LEU A 1 503 ? -0.253  44.645  -46.817 1.00 25.96 ? 503  LEU A CB    1 
ATOM   4152 C  CG    . LEU A 1 503 ? -1.383  44.538  -45.787 1.00 26.80 ? 503  LEU A CG    1 
ATOM   4153 C  CD1   . LEU A 1 503 ? -1.325  43.218  -45.029 1.00 23.23 ? 503  LEU A CD1   1 
ATOM   4154 C  CD2   . LEU A 1 503 ? -1.358  45.718  -44.815 1.00 25.62 ? 503  LEU A CD2   1 
ATOM   4155 N  N     . HIS A 1 504 ? 1.324   46.123  -49.544 1.00 29.15 ? 504  HIS A N     1 
ATOM   4156 C  CA    . HIS A 1 504 ? 2.503   46.820  -50.056 1.00 30.38 ? 504  HIS A CA    1 
ATOM   4157 C  C     . HIS A 1 504 ? 2.206   48.292  -50.335 1.00 30.21 ? 504  HIS A C     1 
ATOM   4158 O  O     . HIS A 1 504 ? 3.102   49.134  -50.263 1.00 30.25 ? 504  HIS A O     1 
ATOM   4159 C  CB    . HIS A 1 504 ? 3.048   46.135  -51.312 1.00 31.68 ? 504  HIS A CB    1 
ATOM   4160 C  CG    . HIS A 1 504 ? 3.519   44.732  -51.080 1.00 35.01 ? 504  HIS A CG    1 
ATOM   4161 N  ND1   . HIS A 1 504 ? 4.276   44.370  -49.986 1.00 36.80 ? 504  HIS A ND1   1 
ATOM   4162 C  CD2   . HIS A 1 504 ? 3.347   43.603  -51.807 1.00 36.58 ? 504  HIS A CD2   1 
ATOM   4163 C  CE1   . HIS A 1 504 ? 4.540   43.078  -50.044 1.00 36.87 ? 504  HIS A CE1   1 
ATOM   4164 N  NE2   . HIS A 1 504 ? 3.991   42.589  -51.141 1.00 36.31 ? 504  HIS A NE2   1 
ATOM   4165 N  N     . ASN A 1 505 ? 0.947   48.594  -50.650 1.00 29.16 ? 505  ASN A N     1 
ATOM   4166 C  CA    . ASN A 1 505 ? 0.513   49.969  -50.911 1.00 28.40 ? 505  ASN A CA    1 
ATOM   4167 C  C     . ASN A 1 505 ? -0.774  50.331  -50.158 1.00 26.68 ? 505  ASN A C     1 
ATOM   4168 O  O     . ASN A 1 505 ? -1.825  50.510  -50.781 1.00 24.18 ? 505  ASN A O     1 
ATOM   4169 C  CB    . ASN A 1 505 ? 0.324   50.196  -52.416 1.00 29.21 ? 505  ASN A CB    1 
ATOM   4170 C  CG    . ASN A 1 505 ? 1.624   50.105  -53.194 1.00 32.47 ? 505  ASN A CG    1 
ATOM   4171 O  OD1   . ASN A 1 505 ? 1.894   49.104  -53.859 1.00 33.99 ? 505  ASN A OD1   1 
ATOM   4172 N  ND2   . ASN A 1 505 ? 2.438   51.152  -53.113 1.00 34.20 ? 505  ASN A ND2   1 
ATOM   4173 N  N     . PRO A 1 506 ? -0.698  50.447  -48.818 1.00 26.44 ? 506  PRO A N     1 
ATOM   4174 C  CA    . PRO A 1 506 ? -1.909  50.754  -48.057 1.00 26.86 ? 506  PRO A CA    1 
ATOM   4175 C  C     . PRO A 1 506 ? -2.290  52.228  -48.160 1.00 27.29 ? 506  PRO A C     1 
ATOM   4176 O  O     . PRO A 1 506 ? -1.412  53.090  -48.249 1.00 28.26 ? 506  PRO A O     1 
ATOM   4177 C  CB    . PRO A 1 506 ? -1.519  50.400  -46.621 1.00 26.93 ? 506  PRO A CB    1 
ATOM   4178 C  CG    . PRO A 1 506 ? -0.044  50.597  -46.567 1.00 27.44 ? 506  PRO A CG    1 
ATOM   4179 C  CD    . PRO A 1 506 ? 0.492   50.340  -47.949 1.00 27.28 ? 506  PRO A CD    1 
ATOM   4180 N  N     . ASN A 1 507 ? -3.592  52.507  -48.151 1.00 26.45 ? 507  ASN A N     1 
ATOM   4181 C  CA    . ASN A 1 507 ? -4.082  53.881  -48.265 1.00 26.23 ? 507  ASN A CA    1 
ATOM   4182 C  C     . ASN A 1 507 ? -4.110  54.610  -46.927 1.00 26.52 ? 507  ASN A C     1 
ATOM   4183 O  O     . ASN A 1 507 ? -4.368  54.007  -45.884 1.00 24.60 ? 507  ASN A O     1 
ATOM   4184 C  CB    . ASN A 1 507 ? -5.468  53.917  -48.912 1.00 25.29 ? 507  ASN A CB    1 
ATOM   4185 C  CG    . ASN A 1 507 ? -5.463  53.392  -50.333 1.00 24.51 ? 507  ASN A CG    1 
ATOM   4186 O  OD1   . ASN A 1 507 ? -5.106  52.238  -50.582 1.00 24.52 ? 507  ASN A OD1   1 
ATOM   4187 N  ND2   . ASN A 1 507 ? -5.871  54.234  -51.275 1.00 24.38 ? 507  ASN A ND2   1 
ATOM   4188 N  N     . LEU A 1 508 ? -3.831  55.910  -46.967 1.00 27.88 ? 508  LEU A N     1 
ATOM   4189 C  CA    . LEU A 1 508 ? -3.916  56.743  -45.777 1.00 29.89 ? 508  LEU A CA    1 
ATOM   4190 C  C     . LEU A 1 508 ? -5.344  57.258  -45.638 1.00 30.18 ? 508  LEU A C     1 
ATOM   4191 O  O     . LEU A 1 508 ? -5.680  58.346  -46.119 1.00 29.14 ? 508  LEU A O     1 
ATOM   4192 C  CB    . LEU A 1 508 ? -2.900  57.893  -45.829 1.00 31.02 ? 508  LEU A CB    1 
ATOM   4193 C  CG    . LEU A 1 508 ? -1.412  57.530  -45.718 1.00 33.02 ? 508  LEU A CG    1 
ATOM   4194 C  CD1   . LEU A 1 508 ? -0.547  58.772  -45.896 1.00 34.19 ? 508  LEU A CD1   1 
ATOM   4195 C  CD2   . LEU A 1 508 ? -1.085  56.831  -44.394 1.00 33.43 ? 508  LEU A CD2   1 
ATOM   4196 N  N     . SER A 1 509 ? -6.181  56.449  -44.993 1.00 30.51 ? 509  SER A N     1 
ATOM   4197 C  CA    . SER A 1 509 ? -7.600  56.759  -44.822 1.00 31.31 ? 509  SER A CA    1 
ATOM   4198 C  C     . SER A 1 509 ? -8.186  56.049  -43.604 1.00 30.84 ? 509  SER A C     1 
ATOM   4199 O  O     . SER A 1 509 ? -7.576  55.127  -43.060 1.00 31.60 ? 509  SER A O     1 
ATOM   4200 C  CB    . SER A 1 509 ? -8.382  56.380  -46.083 1.00 31.65 ? 509  SER A CB    1 
ATOM   4201 O  OG    . SER A 1 509 ? -8.219  55.008  -46.390 1.00 34.28 ? 509  SER A OG    1 
ATOM   4202 N  N     . VAL A 1 510 ? -9.360  56.502  -43.172 1.00 30.86 ? 510  VAL A N     1 
ATOM   4203 C  CA    . VAL A 1 510 ? -10.117 55.839  -42.112 1.00 29.73 ? 510  VAL A CA    1 
ATOM   4204 C  C     . VAL A 1 510 ? -11.244 55.046  -42.768 1.00 28.89 ? 510  VAL A C     1 
ATOM   4205 O  O     . VAL A 1 510 ? -12.169 55.623  -43.349 1.00 28.77 ? 510  VAL A O     1 
ATOM   4206 C  CB    . VAL A 1 510 ? -10.687 56.845  -41.072 1.00 30.10 ? 510  VAL A CB    1 
ATOM   4207 C  CG1   . VAL A 1 510 ? -11.527 56.128  -40.018 1.00 29.99 ? 510  VAL A CG1   1 
ATOM   4208 C  CG2   . VAL A 1 510 ? -9.561  57.628  -40.403 1.00 30.98 ? 510  VAL A CG2   1 
ATOM   4209 N  N     . ASP A 1 511 ? -11.141 53.722  -42.695 1.00 27.76 ? 511  ASP A N     1 
ATOM   4210 C  CA    . ASP A 1 511 ? -12.130 52.832  -43.297 1.00 25.46 ? 511  ASP A CA    1 
ATOM   4211 C  C     . ASP A 1 511 ? -12.365 51.593  -42.431 1.00 25.47 ? 511  ASP A C     1 
ATOM   4212 O  O     . ASP A 1 511 ? -11.808 51.476  -41.335 1.00 24.50 ? 511  ASP A O     1 
ATOM   4213 C  CB    . ASP A 1 511 ? -11.715 52.445  -44.728 1.00 25.62 ? 511  ASP A CB    1 
ATOM   4214 C  CG    . ASP A 1 511 ? -10.263 51.985  -44.825 1.00 25.24 ? 511  ASP A CG    1 
ATOM   4215 O  OD1   . ASP A 1 511 ? -9.766  51.348  -43.871 1.00 24.35 ? 511  ASP A OD1   1 
ATOM   4216 O  OD2   . ASP A 1 511 ? -9.619  52.257  -45.864 1.00 21.17 ? 511  ASP A OD2   1 
ATOM   4217 N  N     . GLU A 1 512 ? -13.199 50.681  -42.927 1.00 24.09 ? 512  GLU A N     1 
ATOM   4218 C  CA    . GLU A 1 512 ? -13.527 49.452  -42.213 1.00 23.81 ? 512  GLU A CA    1 
ATOM   4219 C  C     . GLU A 1 512 ? -13.155 48.223  -43.048 1.00 22.89 ? 512  GLU A C     1 
ATOM   4220 O  O     . GLU A 1 512 ? -13.107 48.304  -44.282 1.00 20.78 ? 512  GLU A O     1 
ATOM   4221 C  CB    . GLU A 1 512 ? -15.019 49.422  -41.848 1.00 24.32 ? 512  GLU A CB    1 
ATOM   4222 C  CG    . GLU A 1 512 ? -15.439 50.437  -40.785 1.00 27.82 ? 512  GLU A CG    1 
ATOM   4223 C  CD    . GLU A 1 512 ? -14.748 50.211  -39.446 1.00 32.42 ? 512  GLU A CD    1 
ATOM   4224 O  OE1   . GLU A 1 512 ? -13.824 50.985  -39.118 1.00 34.99 ? 512  GLU A OE1   1 
ATOM   4225 O  OE2   . GLU A 1 512 ? -15.116 49.255  -38.729 1.00 33.04 ? 512  GLU A OE2   1 
ATOM   4226 N  N     . PRO A 1 513 ? -12.874 47.084  -42.380 1.00 22.94 ? 513  PRO A N     1 
ATOM   4227 C  CA    . PRO A 1 513 ? -12.696 45.835  -43.124 1.00 23.01 ? 513  PRO A CA    1 
ATOM   4228 C  C     . PRO A 1 513 ? -13.978 45.478  -43.872 1.00 23.20 ? 513  PRO A C     1 
ATOM   4229 O  O     . PRO A 1 513 ? -15.077 45.735  -43.367 1.00 24.00 ? 513  PRO A O     1 
ATOM   4230 C  CB    . PRO A 1 513 ? -12.412 44.803  -42.025 1.00 22.29 ? 513  PRO A CB    1 
ATOM   4231 C  CG    . PRO A 1 513 ? -12.883 45.434  -40.757 1.00 22.23 ? 513  PRO A CG    1 
ATOM   4232 C  CD    . PRO A 1 513 ? -12.643 46.892  -40.936 1.00 22.24 ? 513  PRO A CD    1 
ATOM   4233 N  N     . LEU A 1 514 ? -13.834 44.918  -45.070 1.00 22.24 ? 514  LEU A N     1 
ATOM   4234 C  CA    . LEU A 1 514 ? -14.985 44.558  -45.895 1.00 23.38 ? 514  LEU A CA    1 
ATOM   4235 C  C     . LEU A 1 514 ? -15.730 43.370  -45.313 1.00 24.13 ? 514  LEU A C     1 
ATOM   4236 O  O     . LEU A 1 514 ? -15.115 42.433  -44.804 1.00 24.58 ? 514  LEU A O     1 
ATOM   4237 C  CB    . LEU A 1 514 ? -14.545 44.232  -47.322 1.00 22.89 ? 514  LEU A CB    1 
ATOM   4238 C  CG    . LEU A 1 514 ? -14.482 45.298  -48.417 1.00 24.49 ? 514  LEU A CG    1 
ATOM   4239 C  CD1   . LEU A 1 514 ? -14.369 46.725  -47.894 1.00 23.09 ? 514  LEU A CD1   1 
ATOM   4240 C  CD2   . LEU A 1 514 ? -13.333 44.960  -49.352 1.00 21.73 ? 514  LEU A CD2   1 
ATOM   4241 N  N     . ASP A 1 515 ? -17.055 43.421  -45.397 1.00 24.23 ? 515  ASP A N     1 
ATOM   4242 C  CA    . ASP A 1 515 ? -17.910 42.323  -44.972 1.00 25.32 ? 515  ASP A CA    1 
ATOM   4243 C  C     . ASP A 1 515 ? -17.904 41.234  -46.047 1.00 23.81 ? 515  ASP A C     1 
ATOM   4244 O  O     . ASP A 1 515 ? -18.698 41.282  -46.988 1.00 24.44 ? 515  ASP A O     1 
ATOM   4245 C  CB    . ASP A 1 515 ? -19.335 42.839  -44.734 1.00 27.08 ? 515  ASP A CB    1 
ATOM   4246 C  CG    . ASP A 1 515 ? -20.135 41.954  -43.792 1.00 32.58 ? 515  ASP A CG    1 
ATOM   4247 O  OD1   . ASP A 1 515 ? -20.982 42.499  -43.049 1.00 37.08 ? 515  ASP A OD1   1 
ATOM   4248 O  OD2   . ASP A 1 515 ? -19.928 40.721  -43.787 1.00 35.26 ? 515  ASP A OD2   1 
ATOM   4249 N  N     . VAL A 1 516 ? -16.999 40.264  -45.914 1.00 20.38 ? 516  VAL A N     1 
ATOM   4250 C  CA    . VAL A 1 516 ? -16.858 39.204  -46.917 1.00 19.74 ? 516  VAL A CA    1 
ATOM   4251 C  C     . VAL A 1 516 ? -16.780 37.798  -46.313 1.00 18.47 ? 516  VAL A C     1 
ATOM   4252 O  O     . VAL A 1 516 ? -16.410 37.623  -45.149 1.00 18.98 ? 516  VAL A O     1 
ATOM   4253 C  CB    . VAL A 1 516 ? -15.619 39.423  -47.846 1.00 19.21 ? 516  VAL A CB    1 
ATOM   4254 C  CG1   . VAL A 1 516 ? -15.772 40.686  -48.685 1.00 19.81 ? 516  VAL A CG1   1 
ATOM   4255 C  CG2   . VAL A 1 516 ? -14.326 39.461  -47.033 1.00 18.82 ? 516  VAL A CG2   1 
ATOM   4256 N  N     . ASP A 1 517 ? -17.128 36.806  -47.126 1.00 17.39 ? 517  ASP A N     1 
ATOM   4257 C  CA    . ASP A 1 517 ? -16.967 35.403  -46.775 1.00 16.66 ? 517  ASP A CA    1 
ATOM   4258 C  C     . ASP A 1 517 ? -15.640 34.933  -47.368 1.00 15.06 ? 517  ASP A C     1 
ATOM   4259 O  O     . ASP A 1 517 ? -15.502 34.789  -48.585 1.00 15.30 ? 517  ASP A O     1 
ATOM   4260 C  CB    . ASP A 1 517 ? -18.145 34.577  -47.314 1.00 17.65 ? 517  ASP A CB    1 
ATOM   4261 C  CG    . ASP A 1 517 ? -18.124 33.124  -46.837 1.00 19.22 ? 517  ASP A CG    1 
ATOM   4262 O  OD1   . ASP A 1 517 ? -19.165 32.451  -46.982 1.00 20.33 ? 517  ASP A OD1   1 
ATOM   4263 O  OD2   . ASP A 1 517 ? -17.084 32.644  -46.330 1.00 17.52 ? 517  ASP A OD2   1 
ATOM   4264 N  N     . TYR A 1 518 ? -14.663 34.715  -46.495 1.00 13.40 ? 518  TYR A N     1 
ATOM   4265 C  CA    . TYR A 1 518 ? -13.298 34.388  -46.914 1.00 13.26 ? 518  TYR A CA    1 
ATOM   4266 C  C     . TYR A 1 518 ? -13.147 32.983  -47.499 1.00 12.96 ? 518  TYR A C     1 
ATOM   4267 O  O     . TYR A 1 518 ? -12.105 32.657  -48.067 1.00 11.57 ? 518  TYR A O     1 
ATOM   4268 C  CB    . TYR A 1 518 ? -12.329 34.587  -45.750 1.00 14.16 ? 518  TYR A CB    1 
ATOM   4269 C  CG    . TYR A 1 518 ? -12.237 36.016  -45.272 1.00 14.08 ? 518  TYR A CG    1 
ATOM   4270 C  CD1   . TYR A 1 518 ? -13.070 36.491  -44.254 1.00 11.95 ? 518  TYR A CD1   1 
ATOM   4271 C  CD2   . TYR A 1 518 ? -11.315 36.894  -45.832 1.00 14.32 ? 518  TYR A CD2   1 
ATOM   4272 C  CE1   . TYR A 1 518 ? -12.983 37.801  -43.812 1.00 13.35 ? 518  TYR A CE1   1 
ATOM   4273 C  CE2   . TYR A 1 518 ? -11.224 38.208  -45.402 1.00 15.32 ? 518  TYR A CE2   1 
ATOM   4274 C  CZ    . TYR A 1 518 ? -12.054 38.653  -44.391 1.00 16.72 ? 518  TYR A CZ    1 
ATOM   4275 O  OH    . TYR A 1 518 ? -11.956 39.955  -43.966 1.00 19.91 ? 518  TYR A OH    1 
ATOM   4276 N  N     . ARG A 1 519 ? -14.198 32.172  -47.374 1.00 13.86 ? 519  ARG A N     1 
ATOM   4277 C  CA    . ARG A 1 519 ? -14.213 30.804  -47.898 1.00 13.73 ? 519  ARG A CA    1 
ATOM   4278 C  C     . ARG A 1 519 ? -14.348 30.753  -49.421 1.00 14.46 ? 519  ARG A C     1 
ATOM   4279 O  O     . ARG A 1 519 ? -14.230 29.683  -50.027 1.00 13.06 ? 519  ARG A O     1 
ATOM   4280 C  CB    . ARG A 1 519 ? -15.341 30.006  -47.248 1.00 12.96 ? 519  ARG A CB    1 
ATOM   4281 C  CG    . ARG A 1 519 ? -15.189 29.843  -45.733 1.00 12.56 ? 519  ARG A CG    1 
ATOM   4282 C  CD    . ARG A 1 519 ? -16.400 29.180  -45.115 1.00 13.82 ? 519  ARG A CD    1 
ATOM   4283 N  NE    . ARG A 1 519 ? -17.639 29.883  -45.452 1.00 15.85 ? 519  ARG A NE    1 
ATOM   4284 C  CZ    . ARG A 1 519 ? -18.846 29.328  -45.420 1.00 20.40 ? 519  ARG A CZ    1 
ATOM   4285 N  NH1   . ARG A 1 519 ? -18.993 28.053  -45.071 1.00 19.74 ? 519  ARG A NH1   1 
ATOM   4286 N  NH2   . ARG A 1 519 ? -19.909 30.045  -45.747 1.00 20.74 ? 519  ARG A NH2   1 
ATOM   4287 N  N     . PHE A 1 520 ? -14.593 31.910  -50.029 1.00 14.47 ? 520  PHE A N     1 
ATOM   4288 C  CA    . PHE A 1 520 ? -14.772 32.009  -51.479 1.00 17.12 ? 520  PHE A CA    1 
ATOM   4289 C  C     . PHE A 1 520 ? -13.827 33.059  -52.065 1.00 14.96 ? 520  PHE A C     1 
ATOM   4290 O  O     . PHE A 1 520 ? -13.611 34.114  -51.462 1.00 14.79 ? 520  PHE A O     1 
ATOM   4291 C  CB    . PHE A 1 520 ? -16.245 32.316  -51.822 1.00 18.27 ? 520  PHE A CB    1 
ATOM   4292 C  CG    . PHE A 1 520 ? -17.213 31.285  -51.287 1.00 21.00 ? 520  PHE A CG    1 
ATOM   4293 C  CD1   . PHE A 1 520 ? -17.520 30.148  -52.030 1.00 21.00 ? 520  PHE A CD1   1 
ATOM   4294 C  CD2   . PHE A 1 520 ? -17.781 31.432  -50.022 1.00 19.88 ? 520  PHE A CD2   1 
ATOM   4295 C  CE1   . PHE A 1 520 ? -18.387 29.178  -51.529 1.00 24.35 ? 520  PHE A CE1   1 
ATOM   4296 C  CE2   . PHE A 1 520 ? -18.655 30.468  -49.513 1.00 21.72 ? 520  PHE A CE2   1 
ATOM   4297 C  CZ    . PHE A 1 520 ? -18.957 29.339  -50.270 1.00 21.90 ? 520  PHE A CZ    1 
ATOM   4298 N  N     . ASP A 1 521 ? -13.251 32.757  -53.227 1.00 15.33 ? 521  ASP A N     1 
ATOM   4299 C  CA    . ASP A 1 521 ? -12.348 33.687  -53.905 1.00 14.93 ? 521  ASP A CA    1 
ATOM   4300 C  C     . ASP A 1 521 ? -13.012 35.045  -54.084 1.00 14.56 ? 521  ASP A C     1 
ATOM   4301 O  O     . ASP A 1 521 ? -14.154 35.127  -54.561 1.00 11.87 ? 521  ASP A O     1 
ATOM   4302 C  CB    . ASP A 1 521 ? -11.927 33.139  -55.272 1.00 17.31 ? 521  ASP A CB    1 
ATOM   4303 C  CG    . ASP A 1 521 ? -10.961 31.986  -55.159 1.00 18.56 ? 521  ASP A CG    1 
ATOM   4304 O  OD1   . ASP A 1 521 ? -9.838  32.189  -54.642 1.00 14.43 ? 521  ASP A OD1   1 
ATOM   4305 O  OD2   . ASP A 1 521 ? -11.330 30.873  -55.584 1.00 22.10 ? 521  ASP A OD2   1 
ATOM   4306 N  N     . PHE A 1 522 ? -12.297 36.096  -53.688 1.00 13.66 ? 522  PHE A N     1 
ATOM   4307 C  CA    . PHE A 1 522 ? -12.779 37.469  -53.814 1.00 13.58 ? 522  PHE A CA    1 
ATOM   4308 C  C     . PHE A 1 522 ? -13.150 37.794  -55.252 1.00 14.82 ? 522  PHE A C     1 
ATOM   4309 O  O     . PHE A 1 522 ? -12.405 37.478  -56.183 1.00 13.79 ? 522  PHE A O     1 
ATOM   4310 C  CB    . PHE A 1 522 ? -11.718 38.479  -53.366 1.00 13.77 ? 522  PHE A CB    1 
ATOM   4311 C  CG    . PHE A 1 522 ? -11.399 38.442  -51.893 1.00 15.24 ? 522  PHE A CG    1 
ATOM   4312 C  CD1   . PHE A 1 522 ? -12.348 38.026  -50.955 1.00 14.61 ? 522  PHE A CD1   1 
ATOM   4313 C  CD2   . PHE A 1 522 ? -10.149 38.867  -51.443 1.00 13.52 ? 522  PHE A CD2   1 
ATOM   4314 C  CE1   . PHE A 1 522 ? -12.046 38.003  -49.592 1.00 15.77 ? 522  PHE A CE1   1 
ATOM   4315 C  CE2   . PHE A 1 522 ? -9.839  38.856  -50.084 1.00 16.64 ? 522  PHE A CE2   1 
ATOM   4316 C  CZ    . PHE A 1 522 ? -10.793 38.424  -49.154 1.00 15.91 ? 522  PHE A CZ    1 
ATOM   4317 N  N     . SER A 1 523 ? -14.300 38.439  -55.417 1.00 13.69 ? 523  SER A N     1 
ATOM   4318 C  CA    . SER A 1 523 ? -14.726 38.952  -56.712 1.00 14.99 ? 523  SER A CA    1 
ATOM   4319 C  C     . SER A 1 523 ? -13.806 40.095  -57.148 1.00 15.43 ? 523  SER A C     1 
ATOM   4320 O  O     . SER A 1 523 ? -13.064 40.651  -56.334 1.00 13.71 ? 523  SER A O     1 
ATOM   4321 C  CB    . SER A 1 523 ? -16.149 39.482  -56.603 1.00 14.73 ? 523  SER A CB    1 
ATOM   4322 O  OG    . SER A 1 523 ? -16.175 40.615  -55.750 1.00 15.05 ? 523  SER A OG    1 
ATOM   4323 N  N     . ASP A 1 524 ? -13.872 40.451  -58.428 1.00 16.35 ? 524  ASP A N     1 
ATOM   4324 C  CA    . ASP A 1 524 ? -13.118 41.592  -58.941 1.00 18.29 ? 524  ASP A CA    1 
ATOM   4325 C  C     . ASP A 1 524 ? -13.457 42.884  -58.192 1.00 17.80 ? 524  ASP A C     1 
ATOM   4326 O  O     . ASP A 1 524 ? -12.569 43.691  -57.905 1.00 18.32 ? 524  ASP A O     1 
ATOM   4327 C  CB    . ASP A 1 524 ? -13.348 41.752  -60.449 1.00 19.52 ? 524  ASP A CB    1 
ATOM   4328 C  CG    . ASP A 1 524 ? -12.697 40.641  -61.259 1.00 21.03 ? 524  ASP A CG    1 
ATOM   4329 O  OD1   . ASP A 1 524 ? -12.003 39.783  -60.667 1.00 20.60 ? 524  ASP A OD1   1 
ATOM   4330 O  OD2   . ASP A 1 524 ? -12.877 40.626  -62.493 1.00 24.33 ? 524  ASP A OD2   1 
ATOM   4331 N  N     . GLU A 1 525 ? -14.733 43.062  -57.854 1.00 16.33 ? 525  GLU A N     1 
ATOM   4332 C  CA    . GLU A 1 525 ? -15.177 44.260  -57.133 1.00 17.48 ? 525  GLU A CA    1 
ATOM   4333 C  C     . GLU A 1 525 ? -14.620 44.362  -55.708 1.00 15.92 ? 525  GLU A C     1 
ATOM   4334 O  O     . GLU A 1 525 ? -14.269 45.455  -55.263 1.00 15.86 ? 525  GLU A O     1 
ATOM   4335 C  CB    . GLU A 1 525 ? -16.706 44.427  -57.160 1.00 20.36 ? 525  GLU A CB    1 
ATOM   4336 C  CG    . GLU A 1 525 ? -17.515 43.163  -57.467 1.00 25.45 ? 525  GLU A CG    1 
ATOM   4337 C  CD    . GLU A 1 525 ? -17.516 42.786  -58.946 1.00 25.20 ? 525  GLU A CD    1 
ATOM   4338 O  OE1   . GLU A 1 525 ? -17.333 41.588  -59.243 1.00 26.77 ? 525  GLU A OE1   1 
ATOM   4339 O  OE2   . GLU A 1 525 ? -17.686 43.679  -59.806 1.00 23.36 ? 525  GLU A OE2   1 
ATOM   4340 N  N     . ILE A 1 526 ? -14.527 43.229  -55.009 1.00 14.75 ? 526  ILE A N     1 
ATOM   4341 C  CA    . ILE A 1 526 ? -13.864 43.176  -53.697 1.00 15.74 ? 526  ILE A CA    1 
ATOM   4342 C  C     . ILE A 1 526 ? -12.374 43.518  -53.822 1.00 15.22 ? 526  ILE A C     1 
ATOM   4343 O  O     . ILE A 1 526 ? -11.835 44.275  -53.015 1.00 14.76 ? 526  ILE A O     1 
ATOM   4344 C  CB    . ILE A 1 526 ? -14.023 41.789  -53.017 1.00 16.30 ? 526  ILE A CB    1 
ATOM   4345 C  CG1   . ILE A 1 526 ? -15.469 41.573  -52.557 1.00 17.01 ? 526  ILE A CG1   1 
ATOM   4346 C  CG2   . ILE A 1 526 ? -13.058 41.642  -51.825 1.00 14.15 ? 526  ILE A CG2   1 
ATOM   4347 C  CD1   . ILE A 1 526 ? -15.827 40.108  -52.338 1.00 22.92 ? 526  ILE A CD1   1 
ATOM   4348 N  N     . LYS A 1 527 ? -11.720 42.955  -54.836 1.00 16.23 ? 527  LYS A N     1 
ATOM   4349 C  CA    . LYS A 1 527 ? -10.299 43.209  -55.075 1.00 17.23 ? 527  LYS A CA    1 
ATOM   4350 C  C     . LYS A 1 527 ? -10.025 44.685  -55.357 1.00 18.06 ? 527  LYS A C     1 
ATOM   4351 O  O     . LYS A 1 527 ? -9.002  45.221  -54.935 1.00 17.25 ? 527  LYS A O     1 
ATOM   4352 C  CB    . LYS A 1 527 ? -9.762  42.321  -56.202 1.00 17.40 ? 527  LYS A CB    1 
ATOM   4353 C  CG    . LYS A 1 527 ? -9.611  40.864  -55.786 1.00 20.08 ? 527  LYS A CG    1 
ATOM   4354 C  CD    . LYS A 1 527 ? -8.728  40.066  -56.731 1.00 24.34 ? 527  LYS A CD    1 
ATOM   4355 C  CE    . LYS A 1 527 ? -9.490  39.590  -57.945 1.00 25.37 ? 527  LYS A CE    1 
ATOM   4356 N  NZ    . LYS A 1 527 ? -8.862  38.369  -58.521 1.00 25.08 ? 527  LYS A NZ    1 
ATOM   4357 N  N     . GLU A 1 528 ? -10.950 45.341  -56.053 1.00 19.39 ? 528  GLU A N     1 
ATOM   4358 C  CA    . GLU A 1 528 ? -10.841 46.775  -56.290 1.00 21.89 ? 528  GLU A CA    1 
ATOM   4359 C  C     . GLU A 1 528 ? -10.945 47.565  -54.989 1.00 21.37 ? 528  GLU A C     1 
ATOM   4360 O  O     . GLU A 1 528 ? -10.163 48.491  -54.767 1.00 22.50 ? 528  GLU A O     1 
ATOM   4361 C  CB    . GLU A 1 528 ? -11.892 47.252  -57.300 1.00 24.17 ? 528  GLU A CB    1 
ATOM   4362 C  CG    . GLU A 1 528 ? -11.541 46.958  -58.760 1.00 30.59 ? 528  GLU A CG    1 
ATOM   4363 C  CD    . GLU A 1 528 ? -10.519 47.930  -59.344 1.00 36.22 ? 528  GLU A CD    1 
ATOM   4364 O  OE1   . GLU A 1 528 ? -9.401  48.044  -58.794 1.00 38.21 ? 528  GLU A OE1   1 
ATOM   4365 O  OE2   . GLU A 1 528 ? -10.835 48.573  -60.371 1.00 39.95 ? 528  GLU A OE2   1 
ATOM   4366 N  N     . LYS A 1 529 ? -11.901 47.189  -54.135 1.00 19.65 ? 529  LYS A N     1 
ATOM   4367 C  CA    . LYS A 1 529 ? -12.098 47.843  -52.837 1.00 18.98 ? 529  LYS A CA    1 
ATOM   4368 C  C     . LYS A 1 529 ? -10.898 47.643  -51.913 1.00 18.87 ? 529  LYS A C     1 
ATOM   4369 O  O     . LYS A 1 529 ? -10.537 48.540  -51.154 1.00 17.61 ? 529  LYS A O     1 
ATOM   4370 C  CB    . LYS A 1 529 ? -13.362 47.326  -52.143 1.00 20.18 ? 529  LYS A CB    1 
ATOM   4371 C  CG    . LYS A 1 529 ? -14.677 47.726  -52.798 1.00 21.81 ? 529  LYS A CG    1 
ATOM   4372 C  CD    . LYS A 1 529 ? -15.858 47.176  -52.002 1.00 24.57 ? 529  LYS A CD    1 
ATOM   4373 C  CE    . LYS A 1 529 ? -17.135 47.141  -52.834 1.00 25.81 ? 529  LYS A CE    1 
ATOM   4374 N  NZ    . LYS A 1 529 ? -17.561 48.493  -53.276 1.00 23.77 ? 529  LYS A NZ    1 
ATOM   4375 N  N     . ILE A 1 530 ? -10.297 46.456  -51.983 1.00 18.39 ? 530  ILE A N     1 
ATOM   4376 C  CA    . ILE A 1 530 ? -9.124  46.108  -51.183 1.00 18.86 ? 530  ILE A CA    1 
ATOM   4377 C  C     . ILE A 1 530 ? -7.922  47.013  -51.491 1.00 19.87 ? 530  ILE A C     1 
ATOM   4378 O  O     . ILE A 1 530 ? -7.203  47.427  -50.582 1.00 20.58 ? 530  ILE A O     1 
ATOM   4379 C  CB    . ILE A 1 530 ? -8.782  44.599  -51.339 1.00 17.97 ? 530  ILE A CB    1 
ATOM   4380 C  CG1   . ILE A 1 530 ? -9.753  43.767  -50.492 1.00 15.72 ? 530  ILE A CG1   1 
ATOM   4381 C  CG2   . ILE A 1 530 ? -7.327  44.303  -50.955 1.00 18.58 ? 530  ILE A CG2   1 
ATOM   4382 C  CD1   . ILE A 1 530 ? -9.574  42.266  -50.613 1.00 17.22 ? 530  ILE A CD1   1 
ATOM   4383 N  N     . LYS A 1 531 ? -7.736  47.337  -52.767 1.00 21.47 ? 531  LYS A N     1 
ATOM   4384 C  CA    . LYS A 1 531 ? -6.667  48.237  -53.210 1.00 22.16 ? 531  LYS A CA    1 
ATOM   4385 C  C     . LYS A 1 531 ? -6.813  49.684  -52.706 1.00 22.77 ? 531  LYS A C     1 
ATOM   4386 O  O     . LYS A 1 531 ? -5.878  50.480  -52.836 1.00 22.52 ? 531  LYS A O     1 
ATOM   4387 C  CB    . LYS A 1 531 ? -6.575  48.233  -54.740 1.00 23.49 ? 531  LYS A CB    1 
ATOM   4388 C  CG    . LYS A 1 531 ? -6.078  46.925  -55.343 1.00 26.03 ? 531  LYS A CG    1 
ATOM   4389 C  CD    . LYS A 1 531 ? -6.195  46.965  -56.855 1.00 29.84 ? 531  LYS A CD    1 
ATOM   4390 C  CE    . LYS A 1 531 ? -6.209  45.571  -57.451 1.00 33.84 ? 531  LYS A CE    1 
ATOM   4391 N  NZ    . LYS A 1 531 ? -6.337  45.637  -58.935 1.00 38.26 ? 531  LYS A NZ    1 
ATOM   4392 N  N     . LYS A 1 532 ? -7.974  50.018  -52.143 1.00 23.18 ? 532  LYS A N     1 
ATOM   4393 C  CA    . LYS A 1 532 ? -8.221  51.347  -51.575 1.00 23.96 ? 532  LYS A CA    1 
ATOM   4394 C  C     . LYS A 1 532 ? -8.199  51.374  -50.041 1.00 24.01 ? 532  LYS A C     1 
ATOM   4395 O  O     . LYS A 1 532 ? -8.300  52.446  -49.435 1.00 23.41 ? 532  LYS A O     1 
ATOM   4396 C  CB    . LYS A 1 532 ? -9.556  51.914  -52.071 1.00 25.31 ? 532  LYS A CB    1 
ATOM   4397 C  CG    . LYS A 1 532 ? -9.474  52.707  -53.359 1.00 28.25 ? 532  LYS A CG    1 
ATOM   4398 C  CD    . LYS A 1 532 ? -10.010 51.928  -54.543 1.00 32.94 ? 532  LYS A CD    1 
ATOM   4399 C  CE    . LYS A 1 532 ? -10.193 52.839  -55.757 1.00 35.73 ? 532  LYS A CE    1 
ATOM   4400 N  NZ    . LYS A 1 532 ? -10.881 52.142  -56.885 1.00 37.03 ? 532  LYS A NZ    1 
ATOM   4401 N  N     . LEU A 1 533 ? -8.071  50.203  -49.417 1.00 21.00 ? 533  LEU A N     1 
ATOM   4402 C  CA    . LEU A 1 533 ? -8.160  50.100  -47.959 1.00 19.88 ? 533  LEU A CA    1 
ATOM   4403 C  C     . LEU A 1 533 ? -6.887  50.525  -47.236 1.00 18.65 ? 533  LEU A C     1 
ATOM   4404 O  O     . LEU A 1 533 ? -5.781  50.407  -47.773 1.00 17.88 ? 533  LEU A O     1 
ATOM   4405 C  CB    . LEU A 1 533 ? -8.552  48.679  -47.528 1.00 18.46 ? 533  LEU A CB    1 
ATOM   4406 C  CG    . LEU A 1 533 ? -9.997  48.228  -47.762 1.00 19.44 ? 533  LEU A CG    1 
ATOM   4407 C  CD1   . LEU A 1 533 ? -10.145 46.751  -47.415 1.00 17.98 ? 533  LEU A CD1   1 
ATOM   4408 C  CD2   . LEU A 1 533 ? -10.995 49.068  -46.970 1.00 16.87 ? 533  LEU A CD2   1 
ATOM   4409 N  N     . SER A 1 534 ? -7.070  51.022  -46.013 1.00 19.00 ? 534  SER A N     1 
ATOM   4410 C  CA    . SER A 1 534 ? -5.975  51.347  -45.099 1.00 19.40 ? 534  SER A CA    1 
ATOM   4411 C  C     . SER A 1 534 ? -5.264  50.090  -44.602 1.00 20.71 ? 534  SER A C     1 
ATOM   4412 O  O     . SER A 1 534 ? -5.795  48.976  -44.722 1.00 20.47 ? 534  SER A O     1 
ATOM   4413 C  CB    . SER A 1 534 ? -6.513  52.122  -43.898 1.00 19.93 ? 534  SER A CB    1 
ATOM   4414 O  OG    . SER A 1 534 ? -7.396  51.318  -43.130 1.00 19.78 ? 534  SER A OG    1 
ATOM   4415 N  N     . ALA A 1 535 ? -4.073  50.280  -44.033 1.00 20.23 ? 535  ALA A N     1 
ATOM   4416 C  CA    . ALA A 1 535 ? -3.300  49.187  -43.439 1.00 20.37 ? 535  ALA A CA    1 
ATOM   4417 C  C     . ALA A 1 535 ? -4.063  48.523  -42.297 1.00 20.64 ? 535  ALA A C     1 
ATOM   4418 O  O     . ALA A 1 535 ? -4.067  47.297  -42.174 1.00 19.93 ? 535  ALA A O     1 
ATOM   4419 C  CB    . ALA A 1 535 ? -1.948  49.696  -42.946 1.00 19.59 ? 535  ALA A CB    1 
ATOM   4420 N  N     . LYS A 1 536 ? -4.704  49.343  -41.466 1.00 21.20 ? 536  LYS A N     1 
ATOM   4421 C  CA    . LYS A 1 536 ? -5.479  48.863  -40.319 1.00 21.96 ? 536  LYS A CA    1 
ATOM   4422 C  C     . LYS A 1 536 ? -6.584  47.885  -40.750 1.00 20.95 ? 536  LYS A C     1 
ATOM   4423 O  O     . LYS A 1 536 ? -6.694  46.784  -40.208 1.00 21.85 ? 536  LYS A O     1 
ATOM   4424 C  CB    . LYS A 1 536 ? -6.058  50.056  -39.546 1.00 22.15 ? 536  LYS A CB    1 
ATOM   4425 C  CG    . LYS A 1 536 ? -6.887  49.701  -38.317 1.00 24.73 ? 536  LYS A CG    1 
ATOM   4426 C  CD    . LYS A 1 536 ? -7.244  50.959  -37.527 1.00 28.16 ? 536  LYS A CD    1 
ATOM   4427 C  CE    . LYS A 1 536 ? -8.432  50.738  -36.601 1.00 30.64 ? 536  LYS A CE    1 
ATOM   4428 N  NZ    . LYS A 1 536 ? -8.180  49.703  -35.559 1.00 30.57 ? 536  LYS A NZ    1 
ATOM   4429 N  N     . SER A 1 537 ? -7.390  48.284  -41.730 1.00 19.64 ? 537  SER A N     1 
ATOM   4430 C  CA    . SER A 1 537 ? -8.446  47.412  -42.243 1.00 19.25 ? 537  SER A CA    1 
ATOM   4431 C  C     . SER A 1 537 ? -7.893  46.179  -42.967 1.00 17.80 ? 537  SER A C     1 
ATOM   4432 O  O     . SER A 1 537 ? -8.431  45.085  -42.820 1.00 16.51 ? 537  SER A O     1 
ATOM   4433 C  CB    . SER A 1 537 ? -9.412  48.188  -43.137 1.00 19.17 ? 537  SER A CB    1 
ATOM   4434 O  OG    . SER A 1 537 ? -10.165 49.107  -42.361 1.00 19.95 ? 537  SER A OG    1 
ATOM   4435 N  N     . LEU A 1 538 ? -6.812  46.358  -43.727 1.00 17.85 ? 538  LEU A N     1 
ATOM   4436 C  CA    . LEU A 1 538 ? -6.179  45.243  -44.444 1.00 18.59 ? 538  LEU A CA    1 
ATOM   4437 C  C     . LEU A 1 538 ? -5.638  44.172  -43.499 1.00 19.49 ? 538  LEU A C     1 
ATOM   4438 O  O     . LEU A 1 538 ? -5.813  42.981  -43.746 1.00 18.63 ? 538  LEU A O     1 
ATOM   4439 C  CB    . LEU A 1 538 ? -5.071  45.738  -45.382 1.00 18.49 ? 538  LEU A CB    1 
ATOM   4440 C  CG    . LEU A 1 538 ? -5.496  46.391  -46.704 1.00 20.64 ? 538  LEU A CG    1 
ATOM   4441 C  CD1   . LEU A 1 538 ? -4.304  47.073  -47.374 1.00 20.30 ? 538  LEU A CD1   1 
ATOM   4442 C  CD2   . LEU A 1 538 ? -6.141  45.381  -47.653 1.00 19.52 ? 538  LEU A CD2   1 
ATOM   4443 N  N     . ASN A 1 539 ? -4.989  44.603  -42.419 1.00 20.42 ? 539  ASN A N     1 
ATOM   4444 C  CA    . ASN A 1 539 ? -4.462  43.684  -41.412 1.00 20.77 ? 539  ASN A CA    1 
ATOM   4445 C  C     . ASN A 1 539 ? -5.566  42.944  -40.665 1.00 20.42 ? 539  ASN A C     1 
ATOM   4446 O  O     . ASN A 1 539 ? -5.408  41.773  -40.309 1.00 19.46 ? 539  ASN A O     1 
ATOM   4447 C  CB    . ASN A 1 539 ? -3.549  44.424  -40.430 1.00 21.58 ? 539  ASN A CB    1 
ATOM   4448 C  CG    . ASN A 1 539 ? -2.177  44.713  -41.014 1.00 22.52 ? 539  ASN A CG    1 
ATOM   4449 O  OD1   . ASN A 1 539 ? -1.706  45.849  -40.984 1.00 27.02 ? 539  ASN A OD1   1 
ATOM   4450 N  ND2   . ASN A 1 539 ? -1.529  43.685  -41.547 1.00 22.48 ? 539  ASN A ND2   1 
ATOM   4451 N  N     . GLU A 1 540 ? -6.684  43.629  -40.436 1.00 19.58 ? 540  GLU A N     1 
ATOM   4452 C  CA    . GLU A 1 540 ? -7.854  42.988  -39.844 1.00 19.94 ? 540  GLU A CA    1 
ATOM   4453 C  C     . GLU A 1 540 ? -8.434  41.936  -40.797 1.00 18.77 ? 540  GLU A C     1 
ATOM   4454 O  O     . GLU A 1 540 ? -8.784  40.837  -40.366 1.00 18.23 ? 540  GLU A O     1 
ATOM   4455 C  CB    . GLU A 1 540 ? -8.908  44.024  -39.436 1.00 20.99 ? 540  GLU A CB    1 
ATOM   4456 C  CG    . GLU A 1 540 ? -10.166 43.433  -38.778 1.00 27.60 ? 540  GLU A CG    1 
ATOM   4457 C  CD    . GLU A 1 540 ? -9.873  42.565  -37.550 1.00 32.07 ? 540  GLU A CD    1 
ATOM   4458 O  OE1   . GLU A 1 540 ? -9.040  42.966  -36.708 1.00 35.41 ? 540  GLU A OE1   1 
ATOM   4459 O  OE2   . GLU A 1 540 ? -10.490 41.483  -37.420 1.00 33.56 ? 540  GLU A OE2   1 
ATOM   4460 N  N     . MET A 1 541 ? -8.512  42.266  -42.085 1.00 16.42 ? 541  MET A N     1 
ATOM   4461 C  CA    . MET A 1 541 ? -8.975  41.312  -43.099 1.00 16.99 ? 541  MET A CA    1 
ATOM   4462 C  C     . MET A 1 541 ? -8.050  40.099  -43.213 1.00 16.76 ? 541  MET A C     1 
ATOM   4463 O  O     . MET A 1 541 ? -8.519  38.965  -43.352 1.00 15.54 ? 541  MET A O     1 
ATOM   4464 C  CB    . MET A 1 541 ? -9.155  41.993  -44.461 1.00 16.04 ? 541  MET A CB    1 
ATOM   4465 C  CG    . MET A 1 541 ? -10.382 42.904  -44.534 1.00 16.75 ? 541  MET A CG    1 
ATOM   4466 S  SD    . MET A 1 541 ? -10.744 43.542  -46.189 1.00 18.80 ? 541  MET A SD    1 
ATOM   4467 C  CE    . MET A 1 541 ? -11.458 42.099  -46.979 1.00 16.80 ? 541  MET A CE    1 
ATOM   4468 N  N     . LEU A 1 542 ? -6.742  40.343  -43.136 1.00 15.66 ? 542  LEU A N     1 
ATOM   4469 C  CA    . LEU A 1 542 ? -5.754  39.267  -43.198 1.00 15.66 ? 542  LEU A CA    1 
ATOM   4470 C  C     . LEU A 1 542 ? -5.897  38.323  -42.009 1.00 14.78 ? 542  LEU A C     1 
ATOM   4471 O  O     . LEU A 1 542 ? -5.809  37.110  -42.168 1.00 12.06 ? 542  LEU A O     1 
ATOM   4472 C  CB    . LEU A 1 542 ? -4.324  39.819  -43.289 1.00 16.07 ? 542  LEU A CB    1 
ATOM   4473 C  CG    . LEU A 1 542 ? -3.175  38.798  -43.412 1.00 14.59 ? 542  LEU A CG    1 
ATOM   4474 C  CD1   . LEU A 1 542 ? -3.367  37.876  -44.612 1.00 17.35 ? 542  LEU A CD1   1 
ATOM   4475 C  CD2   . LEU A 1 542 ? -1.817  39.494  -43.486 1.00 15.39 ? 542  LEU A CD2   1 
ATOM   4476 N  N     . PHE A 1 543 ? -6.130  38.883  -40.824 1.00 16.49 ? 543  PHE A N     1 
ATOM   4477 C  CA    . PHE A 1 543 ? -6.387  38.074  -39.633 1.00 16.79 ? 543  PHE A CA    1 
ATOM   4478 C  C     . PHE A 1 543 ? -7.612  37.177  -39.834 1.00 15.00 ? 543  PHE A C     1 
ATOM   4479 O  O     . PHE A 1 543 ? -7.574  35.988  -39.522 1.00 15.96 ? 543  PHE A O     1 
ATOM   4480 C  CB    . PHE A 1 543 ? -6.549  38.962  -38.391 1.00 17.29 ? 543  PHE A CB    1 
ATOM   4481 C  CG    . PHE A 1 543 ? -6.940  38.207  -37.142 1.00 19.90 ? 543  PHE A CG    1 
ATOM   4482 C  CD1   . PHE A 1 543 ? -5.983  37.533  -36.390 1.00 19.43 ? 543  PHE A CD1   1 
ATOM   4483 C  CD2   . PHE A 1 543 ? -8.265  38.178  -36.717 1.00 21.73 ? 543  PHE A CD2   1 
ATOM   4484 C  CE1   . PHE A 1 543 ? -6.340  36.836  -35.230 1.00 23.01 ? 543  PHE A CE1   1 
ATOM   4485 C  CE2   . PHE A 1 543 ? -8.636  37.478  -35.560 1.00 23.78 ? 543  PHE A CE2   1 
ATOM   4486 C  CZ    . PHE A 1 543 ? -7.669  36.805  -34.817 1.00 22.42 ? 543  PHE A CZ    1 
ATOM   4487 N  N     . ARG A 1 544 ? -8.688  37.753  -40.362 1.00 15.31 ? 544  ARG A N     1 
ATOM   4488 C  CA    . ARG A 1 544 ? -9.931  37.014  -40.585 1.00 15.75 ? 544  ARG A CA    1 
ATOM   4489 C  C     . ARG A 1 544 ? -9.788  35.941  -41.669 1.00 15.07 ? 544  ARG A C     1 
ATOM   4490 O  O     . ARG A 1 544 ? -10.348 34.850  -41.543 1.00 15.04 ? 544  ARG A O     1 
ATOM   4491 C  CB    . ARG A 1 544 ? -11.079 37.974  -40.915 1.00 17.22 ? 544  ARG A CB    1 
ATOM   4492 C  CG    . ARG A 1 544 ? -11.467 38.896  -39.762 1.00 16.96 ? 544  ARG A CG    1 
ATOM   4493 C  CD    . ARG A 1 544 ? -12.444 39.969  -40.205 1.00 16.83 ? 544  ARG A CD    1 
ATOM   4494 N  NE    . ARG A 1 544 ? -12.716 40.904  -39.117 1.00 20.06 ? 544  ARG A NE    1 
ATOM   4495 C  CZ    . ARG A 1 544 ? -13.584 41.913  -39.174 1.00 21.29 ? 544  ARG A CZ    1 
ATOM   4496 N  NH1   . ARG A 1 544 ? -14.292 42.145  -40.276 1.00 21.08 ? 544  ARG A NH1   1 
ATOM   4497 N  NH2   . ARG A 1 544 ? -13.745 42.693  -38.116 1.00 18.09 ? 544  ARG A NH2   1 
ATOM   4498 N  N     . ALA A 1 545 ? -9.044  36.259  -42.727 1.00 14.33 ? 545  ALA A N     1 
ATOM   4499 C  CA    . ALA A 1 545 ? -8.753  35.293  -43.786 1.00 14.43 ? 545  ALA A CA    1 
ATOM   4500 C  C     . ALA A 1 545 ? -7.966  34.102  -43.238 1.00 13.59 ? 545  ALA A C     1 
ATOM   4501 O  O     . ALA A 1 545 ? -8.269  32.961  -43.568 1.00 13.71 ? 545  ALA A O     1 
ATOM   4502 C  CB    . ALA A 1 545 ? -7.994  35.956  -44.934 1.00 12.56 ? 545  ALA A CB    1 
ATOM   4503 N  N     . GLN A 1 546 ? -6.968  34.380  -42.398 1.00 14.23 ? 546  GLN A N     1 
ATOM   4504 C  CA    . GLN A 1 546 ? -6.115  33.336  -41.816 1.00 14.90 ? 546  GLN A CA    1 
ATOM   4505 C  C     . GLN A 1 546 ? -6.868  32.466  -40.812 1.00 15.21 ? 546  GLN A C     1 
ATOM   4506 O  O     . GLN A 1 546 ? -6.656  31.246  -40.760 1.00 14.25 ? 546  GLN A O     1 
ATOM   4507 C  CB    . GLN A 1 546 ? -4.854  33.949  -41.190 1.00 17.05 ? 546  GLN A CB    1 
ATOM   4508 C  CG    . GLN A 1 546 ? -3.911  34.537  -42.237 1.00 20.39 ? 546  GLN A CG    1 
ATOM   4509 C  CD    . GLN A 1 546 ? -2.666  35.195  -41.658 1.00 22.78 ? 546  GLN A CD    1 
ATOM   4510 O  OE1   . GLN A 1 546 ? -1.588  35.101  -42.240 1.00 27.87 ? 546  GLN A OE1   1 
ATOM   4511 N  NE2   . GLN A 1 546 ? -2.813  35.879  -40.530 1.00 18.26 ? 546  GLN A NE2   1 
ATOM   4512 N  N     . ARG A 1 547 ? -7.758  33.087  -40.034 1.00 13.50 ? 547  ARG A N     1 
ATOM   4513 C  CA    . ARG A 1 547 ? -8.629  32.339  -39.133 1.00 14.57 ? 547  ARG A CA    1 
ATOM   4514 C  C     . ARG A 1 547 ? -9.586  31.437  -39.906 1.00 13.84 ? 547  ARG A C     1 
ATOM   4515 O  O     . ARG A 1 547 ? -9.819  30.299  -39.509 1.00 13.48 ? 547  ARG A O     1 
ATOM   4516 C  CB    . ARG A 1 547 ? -9.400  33.271  -38.187 1.00 14.95 ? 547  ARG A CB    1 
ATOM   4517 C  CG    . ARG A 1 547 ? -8.590  33.745  -36.979 1.00 17.31 ? 547  ARG A CG    1 
ATOM   4518 C  CD    . ARG A 1 547 ? -8.075  32.556  -36.176 1.00 19.29 ? 547  ARG A CD    1 
ATOM   4519 N  NE    . ARG A 1 547 ? -7.174  32.925  -35.087 1.00 19.88 ? 547  ARG A NE    1 
ATOM   4520 C  CZ    . ARG A 1 547 ? -7.569  33.244  -33.862 1.00 19.48 ? 547  ARG A CZ    1 
ATOM   4521 N  NH1   . ARG A 1 547 ? -8.861  33.267  -33.559 1.00 23.87 ? 547  ARG A NH1   1 
ATOM   4522 N  NH2   . ARG A 1 547 ? -6.668  33.549  -32.937 1.00 20.57 ? 547  ARG A NH2   1 
ATOM   4523 N  N     . THR A 1 548 ? -10.121 31.950  -41.013 1.00 13.03 ? 548  THR A N     1 
ATOM   4524 C  CA    . THR A 1 548 ? -10.936 31.155  -41.935 1.00 13.96 ? 548  THR A CA    1 
ATOM   4525 C  C     . THR A 1 548 ? -10.143 29.981  -42.513 1.00 13.22 ? 548  THR A C     1 
ATOM   4526 O  O     . THR A 1 548 ? -10.669 28.869  -42.618 1.00 12.91 ? 548  THR A O     1 
ATOM   4527 C  CB    . THR A 1 548 ? -11.519 32.027  -43.083 1.00 15.30 ? 548  THR A CB    1 
ATOM   4528 O  OG1   . THR A 1 548 ? -12.310 33.084  -42.525 1.00 12.47 ? 548  THR A OG1   1 
ATOM   4529 C  CG2   . THR A 1 548 ? -12.401 31.192  -44.015 1.00 15.36 ? 548  THR A CG2   1 
ATOM   4530 N  N     . GLU A 1 549 ? -8.878  30.226  -42.861 1.00 13.26 ? 549  GLU A N     1 
ATOM   4531 C  CA    . GLU A 1 549 ? -7.997  29.179  -43.398 1.00 12.46 ? 549  GLU A CA    1 
ATOM   4532 C  C     . GLU A 1 549 ? -7.725  28.073  -42.381 1.00 12.32 ? 549  GLU A C     1 
ATOM   4533 O  O     . GLU A 1 549 ? -7.784  26.885  -42.717 1.00 12.09 ? 549  GLU A O     1 
ATOM   4534 C  CB    . GLU A 1 549 ? -6.669  29.777  -43.877 1.00 13.10 ? 549  GLU A CB    1 
ATOM   4535 C  CG    . GLU A 1 549 ? -5.815  28.787  -44.662 1.00 14.89 ? 549  GLU A CG    1 
ATOM   4536 C  CD    . GLU A 1 549 ? -4.422  29.304  -44.977 1.00 17.19 ? 549  GLU A CD    1 
ATOM   4537 O  OE1   . GLU A 1 549 ? -4.220  30.538  -45.003 1.00 16.40 ? 549  GLU A OE1   1 
ATOM   4538 O  OE2   . GLU A 1 549 ? -3.531  28.463  -45.210 1.00 16.11 ? 549  GLU A OE2   1 
ATOM   4539 N  N     . VAL A 1 550 ? -7.420  28.471  -41.146 1.00 10.94 ? 550  VAL A N     1 
ATOM   4540 C  CA    . VAL A 1 550 ? -7.233  27.527  -40.034 1.00 11.91 ? 550  VAL A CA    1 
ATOM   4541 C  C     . VAL A 1 550 ? -8.486  26.669  -39.803 1.00 12.71 ? 550  VAL A C     1 
ATOM   4542 O  O     . VAL A 1 550 ? -8.382  25.455  -39.620 1.00 11.68 ? 550  VAL A O     1 
ATOM   4543 C  CB    . VAL A 1 550 ? -6.835  28.264  -38.718 1.00 11.21 ? 550  VAL A CB    1 
ATOM   4544 C  CG1   . VAL A 1 550 ? -6.854  27.309  -37.518 1.00 11.34 ? 550  VAL A CG1   1 
ATOM   4545 C  CG2   . VAL A 1 550 ? -5.467  28.909  -38.864 1.00 13.06 ? 550  VAL A CG2   1 
ATOM   4546 N  N     . ALA A 1 551 ? -9.662  27.299  -39.818 1.00 14.24 ? 551  ALA A N     1 
ATOM   4547 C  CA    . ALA A 1 551 ? -10.916 26.572  -39.613 1.00 14.30 ? 551  ALA A CA    1 
ATOM   4548 C  C     . ALA A 1 551 ? -11.102 25.514  -40.696 1.00 14.55 ? 551  ALA A C     1 
ATOM   4549 O  O     . ALA A 1 551 ? -11.474 24.373  -40.405 1.00 14.52 ? 551  ALA A O     1 
ATOM   4550 C  CB    . ALA A 1 551 ? -12.112 27.532  -39.578 1.00 15.22 ? 551  ALA A CB    1 
ATOM   4551 N  N     . GLY A 1 552 ? -10.843 25.900  -41.944 1.00 14.13 ? 552  GLY A N     1 
ATOM   4552 C  CA    . GLY A 1 552 ? -10.914 24.977  -43.068 1.00 12.91 ? 552  GLY A CA    1 
ATOM   4553 C  C     . GLY A 1 552 ? -9.868  23.878  -42.983 1.00 12.54 ? 552  GLY A C     1 
ATOM   4554 O  O     . GLY A 1 552 ? -10.151 22.727  -43.325 1.00 13.02 ? 552  GLY A O     1 
ATOM   4555 N  N     . MET A 1 553 ? -8.665  24.236  -42.528 1.00 10.88 ? 553  MET A N     1 
ATOM   4556 C  CA    . MET A 1 553 ? -7.587  23.272  -42.322 1.00 12.53 ? 553  MET A CA    1 
ATOM   4557 C  C     . MET A 1 553 ? -8.017  22.216  -41.301 1.00 13.13 ? 553  MET A C     1 
ATOM   4558 O  O     . MET A 1 553 ? -7.907  21.027  -41.568 1.00 13.54 ? 553  MET A O     1 
ATOM   4559 C  CB    . MET A 1 553 ? -6.288  23.964  -41.875 1.00 10.86 ? 553  MET A CB    1 
ATOM   4560 C  CG    . MET A 1 553 ? -5.176  23.008  -41.432 1.00 13.05 ? 553  MET A CG    1 
ATOM   4561 S  SD    . MET A 1 553 ? -4.548  21.950  -42.770 1.00 22.05 ? 553  MET A SD    1 
ATOM   4562 C  CE    . MET A 1 553 ? -3.178  22.921  -43.395 1.00 21.70 ? 553  MET A CE    1 
ATOM   4563 N  N     . THR A 1 554 ? -8.522  22.654  -40.146 1.00 11.10 ? 554  THR A N     1 
ATOM   4564 C  CA    . THR A 1 554 ? -9.018  21.708  -39.133 1.00 12.23 ? 554  THR A CA    1 
ATOM   4565 C  C     . THR A 1 554 ? -10.032 20.736  -39.731 1.00 13.37 ? 554  THR A C     1 
ATOM   4566 O  O     . THR A 1 554 ? -9.909  19.510  -39.569 1.00 13.94 ? 554  THR A O     1 
ATOM   4567 C  CB    . THR A 1 554 ? -9.637  22.433  -37.924 1.00 11.97 ? 554  THR A CB    1 
ATOM   4568 O  OG1   . THR A 1 554 ? -8.598  23.087  -37.182 1.00 14.23 ? 554  THR A OG1   1 
ATOM   4569 C  CG2   . THR A 1 554 ? -10.364 21.435  -36.998 1.00 9.63  ? 554  THR A CG2   1 
ATOM   4570 N  N     . ALA A 1 555 ? -11.021 21.292  -40.431 1.00 11.07 ? 555  ALA A N     1 
ATOM   4571 C  CA    . ALA A 1 555 ? -12.122 20.507  -40.977 1.00 13.53 ? 555  ALA A CA    1 
ATOM   4572 C  C     . ALA A 1 555 ? -11.665 19.499  -42.038 1.00 12.72 ? 555  ALA A C     1 
ATOM   4573 O  O     . ALA A 1 555 ? -12.103 18.343  -42.035 1.00 14.44 ? 555  ALA A O     1 
ATOM   4574 C  CB    . ALA A 1 555 ? -13.229 21.442  -41.531 1.00 11.09 ? 555  ALA A CB    1 
ATOM   4575 N  N     . GLN A 1 556 ? -10.780 19.934  -42.931 1.00 13.54 ? 556  GLN A N     1 
ATOM   4576 C  CA    . GLN A 1 556 ? -10.319 19.081  -44.029 1.00 12.84 ? 556  GLN A CA    1 
ATOM   4577 C  C     . GLN A 1 556 ? -9.240  18.048  -43.651 1.00 12.68 ? 556  GLN A C     1 
ATOM   4578 O  O     . GLN A 1 556 ? -9.361  16.883  -44.040 1.00 12.29 ? 556  GLN A O     1 
ATOM   4579 C  CB    . GLN A 1 556 ? -9.882  19.922  -45.249 1.00 12.02 ? 556  GLN A CB    1 
ATOM   4580 C  CG    . GLN A 1 556 ? -8.506  20.615  -45.141 1.00 12.94 ? 556  GLN A CG    1 
ATOM   4581 C  CD    . GLN A 1 556 ? -7.348  19.746  -45.629 1.00 18.20 ? 556  GLN A CD    1 
ATOM   4582 O  OE1   . GLN A 1 556 ? -7.558  18.726  -46.287 1.00 20.46 ? 556  GLN A OE1   1 
ATOM   4583 N  NE2   . GLN A 1 556 ? -6.118  20.148  -45.302 1.00 11.49 ? 556  GLN A NE2   1 
ATOM   4584 N  N     . ILE A 1 557 ? -8.200  18.464  -42.915 1.00 12.59 ? 557  ILE A N     1 
ATOM   4585 C  CA    B ILE A 1 557 ? -7.082  17.574  -42.587 0.25 12.50 ? 557  ILE A CA    1 
ATOM   4586 C  CA    C ILE A 1 557 ? -7.097  17.556  -42.619 0.50 12.60 ? 557  ILE A CA    1 
ATOM   4587 C  C     . ILE A 1 557 ? -7.537  16.396  -41.724 1.00 11.92 ? 557  ILE A C     1 
ATOM   4588 O  O     . ILE A 1 557 ? -7.017  15.293  -41.839 1.00 13.03 ? 557  ILE A O     1 
ATOM   4589 C  CB    B ILE A 1 557 ? -5.889  18.334  -41.922 0.25 12.91 ? 557  ILE A CB    1 
ATOM   4590 C  CB    C ILE A 1 557 ? -5.847  18.284  -42.058 0.50 13.41 ? 557  ILE A CB    1 
ATOM   4591 C  CG1   A ILE A 1 557 ? -4.582  17.550  -42.085 0.25 13.55 ? 557  ILE A CG1   1 
ATOM   4592 C  CG1   B ILE A 1 557 ? -4.582  17.550  -42.084 0.25 13.55 ? 557  ILE A CG1   1 
ATOM   4593 C  CG1   C ILE A 1 557 ? -4.581  17.498  -42.415 0.50 14.57 ? 557  ILE A CG1   1 
ATOM   4594 C  CG2   A ILE A 1 557 ? -6.155  18.646  -40.445 0.25 13.50 ? 557  ILE A CG2   1 
ATOM   4595 C  CG2   B ILE A 1 557 ? -6.155  18.646  -40.444 0.25 13.50 ? 557  ILE A CG2   1 
ATOM   4596 C  CG2   C ILE A 1 557 ? -5.950  18.530  -40.545 0.50 14.37 ? 557  ILE A CG2   1 
ATOM   4597 C  CD1   A ILE A 1 557 ? -4.015  17.587  -43.484 0.25 11.49 ? 557  ILE A CD1   1 
ATOM   4598 C  CD1   B ILE A 1 557 ? -4.015  17.588  -43.484 0.25 11.48 ? 557  ILE A CD1   1 
ATOM   4599 C  CD1   C ILE A 1 557 ? -3.338  18.006  -41.736 0.50 12.41 ? 557  ILE A CD1   1 
ATOM   4600 N  N     . ASN A 1 558 ? -8.516  16.636  -40.863 1.00 12.15 ? 558  ASN A N     1 
ATOM   4601 C  CA    . ASN A 1 558 ? -8.958  15.584  -39.968 1.00 13.04 ? 558  ASN A CA    1 
ATOM   4602 C  C     . ASN A 1 558 ? -9.977  14.649  -40.591 1.00 12.52 ? 558  ASN A C     1 
ATOM   4603 O  O     . ASN A 1 558 ? -10.139 13.512  -40.142 1.00 14.64 ? 558  ASN A O     1 
ATOM   4604 C  CB    . ASN A 1 558 ? -9.423  16.177  -38.648 1.00 11.91 ? 558  ASN A CB    1 
ATOM   4605 C  CG    . ASN A 1 558 ? -8.265  16.739  -37.847 1.00 12.95 ? 558  ASN A CG    1 
ATOM   4606 O  OD1   . ASN A 1 558 ? -7.408  15.988  -37.407 1.00 11.19 ? 558  ASN A OD1   1 
ATOM   4607 N  ND2   . ASN A 1 558 ? -8.237  18.065  -37.653 1.00 10.17 ? 558  ASN A ND2   1 
ATOM   4608 N  N     . ARG A 1 559 ? -10.648 15.122  -41.633 1.00 14.23 ? 559  ARG A N     1 
ATOM   4609 C  CA    . ARG A 1 559 ? -11.508 14.249  -42.425 1.00 15.13 ? 559  ARG A CA    1 
ATOM   4610 C  C     . ARG A 1 559 ? -10.634 13.415  -43.359 1.00 14.39 ? 559  ARG A C     1 
ATOM   4611 O  O     . ARG A 1 559 ? -10.898 12.234  -43.576 1.00 14.41 ? 559  ARG A O     1 
ATOM   4612 C  CB    . ARG A 1 559 ? -12.568 15.055  -43.182 1.00 12.48 ? 559  ARG A CB    1 
ATOM   4613 C  CG    . ARG A 1 559 ? -13.751 15.473  -42.284 1.00 14.51 ? 559  ARG A CG    1 
ATOM   4614 C  CD    . ARG A 1 559 ? -14.738 16.415  -42.999 1.00 12.18 ? 559  ARG A CD    1 
ATOM   4615 N  NE    . ARG A 1 559 ? -15.901 16.704  -42.156 1.00 16.23 ? 559  ARG A NE    1 
ATOM   4616 C  CZ    . ARG A 1 559 ? -15.934 17.605  -41.174 1.00 18.64 ? 559  ARG A CZ    1 
ATOM   4617 N  NH1   . ARG A 1 559 ? -14.864 18.342  -40.897 1.00 16.15 ? 559  ARG A NH1   1 
ATOM   4618 N  NH2   . ARG A 1 559 ? -17.051 17.775  -40.463 1.00 18.15 ? 559  ARG A NH2   1 
ATOM   4619 N  N     . LYS A 1 560 ? -9.583  14.036  -43.893 1.00 14.44 ? 560  LYS A N     1 
ATOM   4620 C  CA    . LYS A 1 560 ? -8.540  13.304  -44.608 1.00 13.42 ? 560  LYS A CA    1 
ATOM   4621 C  C     . LYS A 1 560 ? -7.944  12.215  -43.699 1.00 13.98 ? 560  LYS A C     1 
ATOM   4622 O  O     . LYS A 1 560 ? -7.776  11.064  -44.122 1.00 13.92 ? 560  LYS A O     1 
ATOM   4623 C  CB    . LYS A 1 560 ? -7.446  14.265  -45.120 1.00 12.07 ? 560  LYS A CB    1 
ATOM   4624 C  CG    . LYS A 1 560 ? -6.117  13.592  -45.389 1.00 14.68 ? 560  LYS A CG    1 
ATOM   4625 C  CD    . LYS A 1 560 ? -5.061  14.561  -45.901 1.00 14.61 ? 560  LYS A CD    1 
ATOM   4626 C  CE    . LYS A 1 560 ? -3.703  13.885  -45.914 1.00 15.91 ? 560  LYS A CE    1 
ATOM   4627 N  NZ    . LYS A 1 560 ? -2.686  14.757  -46.585 1.00 22.66 ? 560  LYS A NZ    1 
ATOM   4628 N  N     . ALA A 1 561 ? -7.633  12.580  -42.455 1.00 13.24 ? 561  ALA A N     1 
ATOM   4629 C  CA    . ALA A 1 561 ? -7.076  11.624  -41.489 1.00 12.63 ? 561  ALA A CA    1 
ATOM   4630 C  C     . ALA A 1 561 ? -8.029  10.459  -41.207 1.00 12.61 ? 561  ALA A C     1 
ATOM   4631 O  O     . ALA A 1 561 ? -7.585  9.324   -41.079 1.00 11.98 ? 561  ALA A O     1 
ATOM   4632 C  CB    . ALA A 1 561 ? -6.701  12.324  -40.184 1.00 12.28 ? 561  ALA A CB    1 
ATOM   4633 N  N     . LEU A 1 562 ? -9.330  10.747  -41.114 1.00 11.80 ? 562  LEU A N     1 
ATOM   4634 C  CA    . LEU A 1 562 ? -10.340 9.709   -40.846 1.00 12.18 ? 562  LEU A CA    1 
ATOM   4635 C  C     . LEU A 1 562 ? -10.431 8.702   -41.998 1.00 13.30 ? 562  LEU A C     1 
ATOM   4636 O  O     . LEU A 1 562 ? -10.436 7.482   -41.772 1.00 12.92 ? 562  LEU A O     1 
ATOM   4637 C  CB    . LEU A 1 562 ? -11.716 10.325  -40.546 1.00 12.96 ? 562  LEU A CB    1 
ATOM   4638 C  CG    . LEU A 1 562 ? -12.869 9.362   -40.185 1.00 13.26 ? 562  LEU A CG    1 
ATOM   4639 C  CD1   . LEU A 1 562 ? -12.595 8.636   -38.878 1.00 13.89 ? 562  LEU A CD1   1 
ATOM   4640 C  CD2   . LEU A 1 562 ? -14.226 10.088  -40.118 1.00 12.93 ? 562  LEU A CD2   1 
ATOM   4641 N  N     . ILE A 1 563 ? -10.482 9.203   -43.230 1.00 10.82 ? 563  ILE A N     1 
ATOM   4642 C  CA    . ILE A 1 563 ? -10.540 8.307   -44.393 1.00 10.35 ? 563  ILE A CA    1 
ATOM   4643 C  C     . ILE A 1 563 ? -9.236  7.527   -44.641 1.00 10.77 ? 563  ILE A C     1 
ATOM   4644 O  O     . ILE A 1 563 ? -9.286  6.360   -45.030 1.00 11.14 ? 563  ILE A O     1 
ATOM   4645 C  CB    . ILE A 1 563 ? -11.063 9.000   -45.694 1.00 10.00 ? 563  ILE A CB    1 
ATOM   4646 C  CG1   . ILE A 1 563 ? -10.202 10.200  -46.100 1.00 12.78 ? 563  ILE A CG1   1 
ATOM   4647 C  CG2   . ILE A 1 563 ? -12.513 9.408   -45.513 1.00 11.05 ? 563  ILE A CG2   1 
ATOM   4648 C  CD1   . ILE A 1 563 ? -10.671 10.893  -47.391 1.00 11.34 ? 563  ILE A CD1   1 
ATOM   4649 N  N     . ASN A 1 564 ? -8.077  8.165   -44.434 1.00 10.49 ? 564  ASN A N     1 
ATOM   4650 C  CA    A ASN A 1 564 ? -6.804  7.447   -44.500 0.50 10.25 ? 564  ASN A CA    1 
ATOM   4651 C  CA    B ASN A 1 564 ? -6.804  7.449   -44.504 0.50 10.43 ? 564  ASN A CA    1 
ATOM   4652 C  C     . ASN A 1 564 ? -6.732  6.427   -43.373 1.00 10.49 ? 564  ASN A C     1 
ATOM   4653 O  O     . ASN A 1 564 ? -6.117  5.363   -43.522 1.00 11.73 ? 564  ASN A O     1 
ATOM   4654 C  CB    A ASN A 1 564 ? -5.608  8.403   -44.429 0.50 7.56  ? 564  ASN A CB    1 
ATOM   4655 C  CB    B ASN A 1 564 ? -5.608  8.411   -44.449 0.50 8.08  ? 564  ASN A CB    1 
ATOM   4656 C  CG    A ASN A 1 564 ? -5.400  9.173   -45.724 0.50 8.43  ? 564  ASN A CG    1 
ATOM   4657 C  CG    B ASN A 1 564 ? -5.468  9.246   -45.721 0.50 9.23  ? 564  ASN A CG    1 
ATOM   4658 N  ND2   A ASN A 1 564 ? -6.158  8.815   -46.751 0.50 2.00  ? 564  ASN A ND2   1 
ATOM   4659 N  ND2   B ASN A 1 564 ? -4.587  10.247  -45.684 0.50 2.00  ? 564  ASN A ND2   1 
ATOM   4660 N  N     . GLY A 1 565 ? -7.373  6.764   -42.252 1.00 12.25 ? 565  GLY A N     1 
ATOM   4661 C  CA    . GLY A 1 565 ? -7.488  5.876   -41.096 1.00 13.36 ? 565  GLY A CA    1 
ATOM   4662 C  C     . GLY A 1 565 ? -8.214  4.581   -41.442 1.00 14.10 ? 565  GLY A C     1 
ATOM   4663 O  O     . GLY A 1 565 ? -7.849  3.510   -40.952 1.00 13.48 ? 565  GLY A O     1 
ATOM   4664 N  N     . LEU A 1 566 ? -9.240  4.676   -42.288 1.00 12.42 ? 566  LEU A N     1 
ATOM   4665 C  CA    . LEU A 1 566 ? -9.972  3.485   -42.733 1.00 11.43 ? 566  LEU A CA    1 
ATOM   4666 C  C     . LEU A 1 566 ? -9.085  2.556   -43.573 1.00 11.41 ? 566  LEU A C     1 
ATOM   4667 O  O     . LEU A 1 566 ? -9.120  1.333   -43.401 1.00 11.51 ? 566  LEU A O     1 
ATOM   4668 C  CB    . LEU A 1 566 ? -11.262 3.873   -43.489 1.00 11.67 ? 566  LEU A CB    1 
ATOM   4669 C  CG    . LEU A 1 566 ? -12.155 2.780   -44.088 1.00 10.85 ? 566  LEU A CG    1 
ATOM   4670 C  CD1   . LEU A 1 566 ? -12.548 1.727   -43.043 1.00 12.42 ? 566  LEU A CD1   1 
ATOM   4671 C  CD2   . LEU A 1 566 ? -13.424 3.377   -44.719 1.00 12.74 ? 566  LEU A CD2   1 
ATOM   4672 N  N     . ALA A 1 567 ? -8.287  3.133   -44.474 1.00 12.08 ? 567  ALA A N     1 
ATOM   4673 C  CA    . ALA A 1 567 ? -7.361  2.340   -45.281 1.00 12.94 ? 567  ALA A CA    1 
ATOM   4674 C  C     . ALA A 1 567 ? -6.357  1.594   -44.395 1.00 13.47 ? 567  ALA A C     1 
ATOM   4675 O  O     . ALA A 1 567 ? -6.051  0.423   -44.644 1.00 13.52 ? 567  ALA A O     1 
ATOM   4676 C  CB    . ALA A 1 567 ? -6.640  3.223   -46.314 1.00 11.48 ? 567  ALA A CB    1 
ATOM   4677 N  N     . GLY A 1 568 ? -5.856  2.275   -43.360 1.00 13.31 ? 568  GLY A N     1 
ATOM   4678 C  CA    . GLY A 1 568 ? -4.929  1.666   -42.402 1.00 13.27 ? 568  GLY A CA    1 
ATOM   4679 C  C     . GLY A 1 568 ? -5.604  0.661   -41.477 1.00 12.70 ? 568  GLY A C     1 
ATOM   4680 O  O     . GLY A 1 568 ? -4.998  -0.350  -41.089 1.00 11.95 ? 568  GLY A O     1 
ATOM   4681 N  N     . ALA A 1 569 ? -6.866  0.924   -41.136 1.00 12.14 ? 569  ALA A N     1 
ATOM   4682 C  CA    . ALA A 1 569 ? -7.631  0.053   -40.227 1.00 12.35 ? 569  ALA A CA    1 
ATOM   4683 C  C     . ALA A 1 569 ? -7.819  -1.354  -40.791 1.00 12.55 ? 569  ALA A C     1 
ATOM   4684 O  O     . ALA A 1 569 ? -7.905  -2.332  -40.036 1.00 14.01 ? 569  ALA A O     1 
ATOM   4685 C  CB    . ALA A 1 569 ? -8.980  0.674   -39.888 1.00 13.43 ? 569  ALA A CB    1 
ATOM   4686 N  N     . LEU A 1 570 ? -7.878  -1.449  -42.119 1.00 11.48 ? 570  LEU A N     1 
ATOM   4687 C  CA    . LEU A 1 570 ? -7.957  -2.732  -42.814 1.00 11.26 ? 570  LEU A CA    1 
ATOM   4688 C  C     . LEU A 1 570 ? -6.749  -3.613  -42.488 1.00 12.26 ? 570  LEU A C     1 
ATOM   4689 O  O     . LEU A 1 570 ? -6.793  -4.825  -42.683 1.00 11.01 ? 570  LEU A O     1 
ATOM   4690 C  CB    . LEU A 1 570 ? -8.069  -2.509  -44.327 1.00 12.27 ? 570  LEU A CB    1 
ATOM   4691 C  CG    . LEU A 1 570 ? -9.398  -1.908  -44.804 1.00 13.30 ? 570  LEU A CG    1 
ATOM   4692 C  CD1   . LEU A 1 570 ? -9.258  -1.316  -46.188 1.00 14.18 ? 570  LEU A CD1   1 
ATOM   4693 C  CD2   . LEU A 1 570 ? -10.517 -2.950  -44.779 1.00 11.11 ? 570  LEU A CD2   1 
ATOM   4694 N  N     . GLY A 1 571 ? -5.680  -2.985  -41.999 1.00 12.63 ? 571  GLY A N     1 
ATOM   4695 C  CA    . GLY A 1 571 ? -4.460  -3.682  -41.573 1.00 11.65 ? 571  GLY A CA    1 
ATOM   4696 C  C     . GLY A 1 571 ? -4.259  -3.683  -40.059 1.00 11.64 ? 571  GLY A C     1 
ATOM   4697 O  O     . GLY A 1 571 ? -3.165  -3.967  -39.585 1.00 10.22 ? 571  GLY A O     1 
ATOM   4698 N  N     . ASN A 1 572 ? -5.314  -3.373  -39.299 1.00 11.49 ? 572  ASN A N     1 
ATOM   4699 C  CA    . ASN A 1 572 ? -5.278  -3.481  -37.829 1.00 12.75 ? 572  ASN A CA    1 
ATOM   4700 C  C     . ASN A 1 572 ? -6.106  -4.677  -37.358 1.00 12.59 ? 572  ASN A C     1 
ATOM   4701 O  O     . ASN A 1 572 ? -7.290  -4.782  -37.672 1.00 10.35 ? 572  ASN A O     1 
ATOM   4702 C  CB    . ASN A 1 572 ? -5.752  -2.178  -37.156 1.00 14.14 ? 572  ASN A CB    1 
ATOM   4703 C  CG    . ASN A 1 572 ? -5.804  -2.279  -35.631 1.00 17.79 ? 572  ASN A CG    1 
ATOM   4704 O  OD1   . ASN A 1 572 ? -6.628  -3.003  -35.072 1.00 17.59 ? 572  ASN A OD1   1 
ATOM   4705 N  ND2   . ASN A 1 572 ? -4.939  -1.535  -34.957 1.00 18.05 ? 572  ASN A ND2   1 
ATOM   4706 N  N     . VAL A 1 573 ? -5.483  -5.564  -36.585 1.00 12.11 ? 573  VAL A N     1 
ATOM   4707 C  CA    . VAL A 1 573 ? -6.099  -6.846  -36.218 1.00 12.06 ? 573  VAL A CA    1 
ATOM   4708 C  C     . VAL A 1 573 ? -7.355  -6.721  -35.351 1.00 12.51 ? 573  VAL A C     1 
ATOM   4709 O  O     . VAL A 1 573 ? -8.102  -7.679  -35.221 1.00 12.67 ? 573  VAL A O     1 
ATOM   4710 C  CB    . VAL A 1 573 ? -5.087  -7.820  -35.534 1.00 13.46 ? 573  VAL A CB    1 
ATOM   4711 C  CG1   . VAL A 1 573 ? -3.912  -8.145  -36.474 1.00 13.54 ? 573  VAL A CG1   1 
ATOM   4712 C  CG2   . VAL A 1 573 ? -4.583  -7.254  -34.205 1.00 12.52 ? 573  VAL A CG2   1 
ATOM   4713 N  N     . TRP A 1 574 ? -7.584  -5.543  -34.772 1.00 12.47 ? 574  TRP A N     1 
ATOM   4714 C  CA    . TRP A 1 574 ? -8.765  -5.314  -33.940 1.00 13.72 ? 574  TRP A CA    1 
ATOM   4715 C  C     . TRP A 1 574 ? -9.962  -4.739  -34.707 1.00 15.06 ? 574  TRP A C     1 
ATOM   4716 O  O     . TRP A 1 574 ? -11.058 -4.660  -34.162 1.00 15.27 ? 574  TRP A O     1 
ATOM   4717 C  CB    . TRP A 1 574 ? -8.419  -4.426  -32.741 1.00 12.90 ? 574  TRP A CB    1 
ATOM   4718 C  CG    . TRP A 1 574 ? -7.252  -4.938  -31.952 1.00 17.73 ? 574  TRP A CG    1 
ATOM   4719 C  CD1   . TRP A 1 574 ? -5.999  -4.401  -31.908 1.00 19.11 ? 574  TRP A CD1   1 
ATOM   4720 C  CD2   . TRP A 1 574 ? -7.219  -6.104  -31.114 1.00 21.08 ? 574  TRP A CD2   1 
ATOM   4721 N  NE1   . TRP A 1 574 ? -5.189  -5.153  -31.087 1.00 21.14 ? 574  TRP A NE1   1 
ATOM   4722 C  CE2   . TRP A 1 574 ? -5.911  -6.205  -30.590 1.00 21.66 ? 574  TRP A CE2   1 
ATOM   4723 C  CE3   . TRP A 1 574 ? -8.166  -7.074  -30.759 1.00 25.36 ? 574  TRP A CE3   1 
ATOM   4724 C  CZ2   . TRP A 1 574 ? -5.526  -7.236  -29.719 1.00 26.30 ? 574  TRP A CZ2   1 
ATOM   4725 C  CZ3   . TRP A 1 574 ? -7.783  -8.102  -29.892 1.00 26.45 ? 574  TRP A CZ3   1 
ATOM   4726 C  CH2   . TRP A 1 574 ? -6.475  -8.172  -29.384 1.00 25.39 ? 574  TRP A CH2   1 
ATOM   4727 N  N     . PHE A 1 575 ? -9.749  -4.351  -35.965 1.00 14.13 ? 575  PHE A N     1 
ATOM   4728 C  CA    . PHE A 1 575 ? -10.826 -3.861  -36.831 1.00 12.38 ? 575  PHE A CA    1 
ATOM   4729 C  C     . PHE A 1 575 ? -11.705 -5.026  -37.253 1.00 13.97 ? 575  PHE A C     1 
ATOM   4730 O  O     . PHE A 1 575 ? -11.196 -6.079  -37.649 1.00 14.06 ? 575  PHE A O     1 
ATOM   4731 C  CB    . PHE A 1 575 ? -10.222 -3.187  -38.070 1.00 12.80 ? 575  PHE A CB    1 
ATOM   4732 C  CG    . PHE A 1 575 ? -11.203 -2.393  -38.908 1.00 12.87 ? 575  PHE A CG    1 
ATOM   4733 C  CD1   . PHE A 1 575 ? -12.125 -1.530  -38.319 1.00 13.95 ? 575  PHE A CD1   1 
ATOM   4734 C  CD2   . PHE A 1 575 ? -11.160 -2.471  -40.296 1.00 11.71 ? 575  PHE A CD2   1 
ATOM   4735 C  CE1   . PHE A 1 575 ? -13.006 -0.781  -39.098 1.00 15.13 ? 575  PHE A CE1   1 
ATOM   4736 C  CE2   . PHE A 1 575 ? -12.034 -1.712  -41.087 1.00 11.74 ? 575  PHE A CE2   1 
ATOM   4737 C  CZ    . PHE A 1 575 ? -12.956 -0.865  -40.481 1.00 12.65 ? 575  PHE A CZ    1 
ATOM   4738 N  N     . ARG A 1 576 ? -13.025 -4.835  -37.178 1.00 12.69 ? 576  ARG A N     1 
ATOM   4739 C  CA    . ARG A 1 576 ? -13.985 -5.862  -37.599 1.00 13.48 ? 576  ARG A CA    1 
ATOM   4740 C  C     . ARG A 1 576 ? -13.748 -6.329  -39.040 1.00 14.19 ? 576  ARG A C     1 
ATOM   4741 O  O     . ARG A 1 576 ? -13.976 -7.496  -39.356 1.00 14.49 ? 576  ARG A O     1 
ATOM   4742 C  CB    . ARG A 1 576 ? -15.422 -5.347  -37.449 1.00 12.65 ? 576  ARG A CB    1 
ATOM   4743 C  CG    . ARG A 1 576 ? -16.516 -6.414  -37.575 1.00 12.68 ? 576  ARG A CG    1 
ATOM   4744 C  CD    . ARG A 1 576 ? -17.907 -5.801  -37.401 1.00 8.79  ? 576  ARG A CD    1 
ATOM   4745 N  NE    . ARG A 1 576 ? -18.025 -5.064  -36.145 1.00 10.46 ? 576  ARG A NE    1 
ATOM   4746 C  CZ    . ARG A 1 576 ? -18.342 -5.605  -34.973 1.00 10.23 ? 576  ARG A CZ    1 
ATOM   4747 N  NH1   . ARG A 1 576 ? -18.596 -6.911  -34.863 1.00 9.87  ? 576  ARG A NH1   1 
ATOM   4748 N  NH2   . ARG A 1 576 ? -18.416 -4.833  -33.902 1.00 7.74  ? 576  ARG A NH2   1 
ATOM   4749 N  N     . TYR A 1 577 ? -13.293 -5.419  -39.903 1.00 12.40 ? 577  TYR A N     1 
ATOM   4750 C  CA    . TYR A 1 577 ? -13.078 -5.739  -41.319 1.00 11.60 ? 577  TYR A CA    1 
ATOM   4751 C  C     . TYR A 1 577 ? -11.597 -5.860  -41.695 1.00 13.21 ? 577  TYR A C     1 
ATOM   4752 O  O     . TYR A 1 577 ? -11.225 -5.662  -42.854 1.00 13.01 ? 577  TYR A O     1 
ATOM   4753 C  CB    . TYR A 1 577 ? -13.832 -4.746  -42.215 1.00 10.49 ? 577  TYR A CB    1 
ATOM   4754 C  CG    . TYR A 1 577 ? -15.268 -4.601  -41.767 1.00 10.68 ? 577  TYR A CG    1 
ATOM   4755 C  CD1   . TYR A 1 577 ? -15.649 -3.548  -40.935 1.00 8.10  ? 577  TYR A CD1   1 
ATOM   4756 C  CD2   . TYR A 1 577 ? -16.226 -5.551  -42.120 1.00 8.32  ? 577  TYR A CD2   1 
ATOM   4757 C  CE1   . TYR A 1 577 ? -16.962 -3.426  -40.479 1.00 9.50  ? 577  TYR A CE1   1 
ATOM   4758 C  CE2   . TYR A 1 577 ? -17.544 -5.434  -41.686 1.00 9.39  ? 577  TYR A CE2   1 
ATOM   4759 C  CZ    . TYR A 1 577 ? -17.900 -4.373  -40.861 1.00 9.87  ? 577  TYR A CZ    1 
ATOM   4760 O  OH    . TYR A 1 577 ? -19.187 -4.254  -40.423 1.00 8.75  ? 577  TYR A OH    1 
ATOM   4761 N  N     . TYR A 1 578 ? -10.766 -6.189  -40.702 1.00 10.66 ? 578  TYR A N     1 
ATOM   4762 C  CA    . TYR A 1 578 ? -9.366  -6.527  -40.933 1.00 12.19 ? 578  TYR A CA    1 
ATOM   4763 C  C     . TYR A 1 578 ? -9.233  -7.553  -42.047 1.00 10.90 ? 578  TYR A C     1 
ATOM   4764 O  O     . TYR A 1 578 ? -9.897  -8.586  -42.028 1.00 9.96  ? 578  TYR A O     1 
ATOM   4765 C  CB    . TYR A 1 578 ? -8.739  -7.101  -39.658 1.00 12.48 ? 578  TYR A CB    1 
ATOM   4766 C  CG    . TYR A 1 578 ? -7.344  -7.647  -39.851 1.00 11.31 ? 578  TYR A CG    1 
ATOM   4767 C  CD1   . TYR A 1 578 ? -7.113  -9.023  -39.947 1.00 12.44 ? 578  TYR A CD1   1 
ATOM   4768 C  CD2   . TYR A 1 578 ? -6.251  -6.789  -39.930 1.00 11.51 ? 578  TYR A CD2   1 
ATOM   4769 C  CE1   . TYR A 1 578 ? -5.814  -9.530  -40.107 1.00 15.99 ? 578  TYR A CE1   1 
ATOM   4770 C  CE2   . TYR A 1 578 ? -4.957  -7.285  -40.086 1.00 16.04 ? 578  TYR A CE2   1 
ATOM   4771 C  CZ    . TYR A 1 578 ? -4.745  -8.650  -40.173 1.00 15.62 ? 578  TYR A CZ    1 
ATOM   4772 O  OH    . TYR A 1 578 ? -3.460  -9.114  -40.337 1.00 16.93 ? 578  TYR A OH    1 
ATOM   4773 N  N     . ASP A 1 579 ? -8.370  -7.265  -43.014 1.00 12.52 ? 579  ASP A N     1 
ATOM   4774 C  CA    . ASP A 1 579 ? -8.134  -8.179  -44.131 1.00 12.86 ? 579  ASP A CA    1 
ATOM   4775 C  C     . ASP A 1 579 ? -6.917  -7.675  -44.874 1.00 14.62 ? 579  ASP A C     1 
ATOM   4776 O  O     . ASP A 1 579 ? -6.957  -6.621  -45.515 1.00 12.86 ? 579  ASP A O     1 
ATOM   4777 C  CB    . ASP A 1 579 ? -9.353  -8.242  -45.070 1.00 13.00 ? 579  ASP A CB    1 
ATOM   4778 C  CG    . ASP A 1 579 ? -9.304  -9.436  -46.032 1.00 14.93 ? 579  ASP A CG    1 
ATOM   4779 O  OD1   . ASP A 1 579 ? -10.384 -9.876  -46.484 1.00 16.57 ? 579  ASP A OD1   1 
ATOM   4780 O  OD2   . ASP A 1 579 ? -8.197  -9.948  -46.327 1.00 14.31 ? 579  ASP A OD2   1 
ATOM   4781 N  N     . LEU A 1 580 ? -5.825  -8.428  -44.772 1.00 12.69 ? 580  LEU A N     1 
ATOM   4782 C  CA    . LEU A 1 580 ? -4.593  -8.061  -45.456 1.00 14.24 ? 580  LEU A CA    1 
ATOM   4783 C  C     . LEU A 1 580 ? -4.704  -8.099  -46.984 1.00 12.85 ? 580  LEU A C     1 
ATOM   4784 O  O     . LEU A 1 580 ? -3.925  -7.442  -47.662 1.00 14.67 ? 580  LEU A O     1 
ATOM   4785 C  CB    . LEU A 1 580 ? -3.424  -8.911  -44.955 1.00 14.98 ? 580  LEU A CB    1 
ATOM   4786 C  CG    . LEU A 1 580 ? -2.450  -8.281  -43.949 1.00 20.92 ? 580  LEU A CG    1 
ATOM   4787 C  CD1   . LEU A 1 580 ? -3.061  -7.199  -43.063 1.00 19.10 ? 580  LEU A CD1   1 
ATOM   4788 C  CD2   . LEU A 1 580 ? -1.724  -9.338  -43.121 1.00 19.46 ? 580  LEU A CD2   1 
ATOM   4789 N  N     . ARG A 1 581 ? -5.672  -8.849  -47.518 1.00 12.01 ? 581  ARG A N     1 
ATOM   4790 C  CA    . ARG A 1 581 ? -5.929  -8.854  -48.962 1.00 13.54 ? 581  ARG A CA    1 
ATOM   4791 C  C     . ARG A 1 581 ? -6.384  -7.461  -49.414 1.00 13.44 ? 581  ARG A C     1 
ATOM   4792 O  O     . ARG A 1 581 ? -5.934  -6.947  -50.439 1.00 12.66 ? 581  ARG A O     1 
ATOM   4793 C  CB    . ARG A 1 581 ? -6.991  -9.891  -49.339 1.00 12.50 ? 581  ARG A CB    1 
ATOM   4794 C  CG    . ARG A 1 581 ? -6.614  -11.342 -49.039 1.00 14.40 ? 581  ARG A CG    1 
ATOM   4795 C  CD    . ARG A 1 581 ? -7.788  -12.289 -49.320 1.00 16.72 ? 581  ARG A CD    1 
ATOM   4796 N  NE    . ARG A 1 581 ? -8.943  -12.016 -48.462 1.00 17.17 ? 581  ARG A NE    1 
ATOM   4797 C  CZ    . ARG A 1 581 ? -10.137 -12.596 -48.590 1.00 19.86 ? 581  ARG A CZ    1 
ATOM   4798 N  NH1   . ARG A 1 581 ? -10.350 -13.494 -49.542 1.00 15.42 ? 581  ARG A NH1   1 
ATOM   4799 N  NH2   . ARG A 1 581 ? -11.128 -12.271 -47.767 1.00 18.01 ? 581  ARG A NH2   1 
ATOM   4800 N  N     . ASN A 1 582 ? -7.269  -6.855  -48.628 1.00 11.35 ? 582  ASN A N     1 
ATOM   4801 C  CA    . ASN A 1 582 ? -7.729  -5.501  -48.891 1.00 11.59 ? 582  ASN A CA    1 
ATOM   4802 C  C     . ASN A 1 582 ? -6.703  -4.428  -48.549 1.00 12.33 ? 582  ASN A C     1 
ATOM   4803 O  O     . ASN A 1 582 ? -6.525  -3.475  -49.319 1.00 12.91 ? 582  ASN A O     1 
ATOM   4804 C  CB    . ASN A 1 582 ? -9.072  -5.251  -48.191 1.00 11.70 ? 582  ASN A CB    1 
ATOM   4805 C  CG    . ASN A 1 582 ? -10.222 -5.991  -48.871 1.00 14.31 ? 582  ASN A CG    1 
ATOM   4806 O  OD1   . ASN A 1 582 ? -10.090 -6.445  -50.009 1.00 13.02 ? 582  ASN A OD1   1 
ATOM   4807 N  ND2   . ASN A 1 582 ? -11.355 -6.100  -48.183 1.00 14.40 ? 582  ASN A ND2   1 
ATOM   4808 N  N     . ALA A 1 583 ? -6.026  -4.571  -47.406 1.00 12.55 ? 583  ALA A N     1 
ATOM   4809 C  CA    . ALA A 1 583 ? -4.981  -3.612  -47.032 1.00 13.30 ? 583  ALA A CA    1 
ATOM   4810 C  C     . ALA A 1 583 ? -3.866  -3.560  -48.093 1.00 13.77 ? 583  ALA A C     1 
ATOM   4811 O  O     . ALA A 1 583 ? -3.504  -2.469  -48.555 1.00 11.13 ? 583  ALA A O     1 
ATOM   4812 C  CB    . ALA A 1 583 ? -4.415  -3.912  -45.633 1.00 13.76 ? 583  ALA A CB    1 
ATOM   4813 N  N     . THR A 1 584 ? -3.353  -4.724  -48.506 1.00 11.51 ? 584  THR A N     1 
ATOM   4814 C  CA    A THR A 1 584 ? -2.287  -4.764  -49.513 0.50 13.42 ? 584  THR A CA    1 
ATOM   4815 C  CA    B THR A 1 584 ? -2.288  -4.764  -49.518 0.50 10.26 ? 584  THR A CA    1 
ATOM   4816 C  C     . THR A 1 584 ? -2.791  -4.481  -50.937 1.00 12.58 ? 584  THR A C     1 
ATOM   4817 O  O     . THR A 1 584 ? -2.012  -4.064  -51.801 1.00 12.64 ? 584  THR A O     1 
ATOM   4818 C  CB    A THR A 1 584 ? -1.432  -6.067  -49.449 0.50 14.19 ? 584  THR A CB    1 
ATOM   4819 C  CB    B THR A 1 584 ? -1.470  -6.080  -49.492 0.50 9.06  ? 584  THR A CB    1 
ATOM   4820 O  OG1   A THR A 1 584 ? -0.282  -5.920  -50.286 0.50 19.98 ? 584  THR A OG1   1 
ATOM   4821 O  OG1   B THR A 1 584 ? -2.317  -7.190  -49.817 0.50 8.50  ? 584  THR A OG1   1 
ATOM   4822 C  CG2   A THR A 1 584 ? -2.213  -7.270  -49.917 0.50 14.64 ? 584  THR A CG2   1 
ATOM   4823 C  CG2   B THR A 1 584 ? -0.830  -6.286  -48.129 0.50 2.00  ? 584  THR A CG2   1 
ATOM   4824 N  N     . ALA A 1 585 ? -4.088  -4.704  -51.184 1.00 11.16 ? 585  ALA A N     1 
ATOM   4825 C  CA    . ALA A 1 585 ? -4.667  -4.342  -52.491 1.00 12.22 ? 585  ALA A CA    1 
ATOM   4826 C  C     . ALA A 1 585 ? -4.496  -2.838  -52.706 1.00 13.81 ? 585  ALA A C     1 
ATOM   4827 O  O     . ALA A 1 585 ? -4.187  -2.398  -53.809 1.00 13.43 ? 585  ALA A O     1 
ATOM   4828 C  CB    . ALA A 1 585 ? -6.134  -4.728  -52.589 1.00 12.52 ? 585  ALA A CB    1 
ATOM   4829 N  N     . ILE A 1 586 ? -4.688  -2.072  -51.630 1.00 11.35 ? 586  ILE A N     1 
ATOM   4830 C  CA    . ILE A 1 586 ? -4.502  -0.624  -51.645 1.00 11.13 ? 586  ILE A CA    1 
ATOM   4831 C  C     . ILE A 1 586 ? -3.028  -0.243  -51.843 1.00 12.38 ? 586  ILE A C     1 
ATOM   4832 O  O     . ILE A 1 586 ? -2.695  0.478   -52.777 1.00 11.24 ? 586  ILE A O     1 
ATOM   4833 C  CB    . ILE A 1 586 ? -5.040  0.035   -50.339 1.00 11.91 ? 586  ILE A CB    1 
ATOM   4834 C  CG1   . ILE A 1 586 ? -6.559  -0.146  -50.218 1.00 11.55 ? 586  ILE A CG1   1 
ATOM   4835 C  CG2   . ILE A 1 586 ? -4.684  1.541   -50.281 1.00 10.20 ? 586  ILE A CG2   1 
ATOM   4836 C  CD1   . ILE A 1 586 ? -7.075  0.028   -48.793 1.00 12.60 ? 586  ILE A CD1   1 
ATOM   4837 N  N     . THR A 1 587 ? -2.154  -0.714  -50.958 1.00 11.53 ? 587  THR A N     1 
ATOM   4838 C  CA    . THR A 1 587 ? -0.763  -0.254  -50.985 1.00 13.46 ? 587  THR A CA    1 
ATOM   4839 C  C     . THR A 1 587 ? -0.028  -0.691  -52.255 1.00 12.64 ? 587  THR A C     1 
ATOM   4840 O  O     . THR A 1 587 ? 0.782   0.066   -52.789 1.00 14.15 ? 587  THR A O     1 
ATOM   4841 C  CB    . THR A 1 587 ? 0.032   -0.684  -49.733 1.00 13.14 ? 587  THR A CB    1 
ATOM   4842 O  OG1   . THR A 1 587 ? 0.072   -2.111  -49.657 1.00 11.31 ? 587  THR A OG1   1 
ATOM   4843 C  CG2   . THR A 1 587 ? -0.606  -0.119  -48.456 1.00 12.43 ? 587  THR A CG2   1 
ATOM   4844 N  N     . THR A 1 588 ? -0.315  -1.901  -52.734 1.00 13.33 ? 588  THR A N     1 
ATOM   4845 C  CA    . THR A 1 588 ? 0.330   -2.422  -53.947 1.00 13.39 ? 588  THR A CA    1 
ATOM   4846 C  C     . THR A 1 588 ? -0.100  -1.639  -55.188 1.00 12.73 ? 588  THR A C     1 
ATOM   4847 O  O     . THR A 1 588 ? 0.728   -1.314  -56.036 1.00 10.37 ? 588  THR A O     1 
ATOM   4848 C  CB    . THR A 1 588 ? 0.079   -3.933  -54.135 1.00 12.95 ? 588  THR A CB    1 
ATOM   4849 O  OG1   . THR A 1 588 ? 0.338   -4.613  -52.900 1.00 15.03 ? 588  THR A OG1   1 
ATOM   4850 C  CG2   . THR A 1 588 ? 0.991   -4.503  -55.218 1.00 14.90 ? 588  THR A CG2   1 
ATOM   4851 N  N     . PHE A 1 589 ? -1.395  -1.332  -55.274 1.00 12.70 ? 589  PHE A N     1 
ATOM   4852 C  CA    . PHE A 1 589 ? -1.932  -0.475  -56.333 1.00 12.12 ? 589  PHE A CA    1 
ATOM   4853 C  C     . PHE A 1 589 ? -1.234  0.895   -56.330 1.00 13.25 ? 589  PHE A C     1 
ATOM   4854 O  O     . PHE A 1 589 ? -0.849  1.402   -57.390 1.00 13.77 ? 589  PHE A O     1 
ATOM   4855 C  CB    . PHE A 1 589 ? -3.448  -0.318  -56.159 1.00 11.18 ? 589  PHE A CB    1 
ATOM   4856 C  CG    . PHE A 1 589 ? -4.144  0.342   -57.335 1.00 12.20 ? 589  PHE A CG    1 
ATOM   4857 C  CD1   . PHE A 1 589 ? -4.163  1.729   -57.465 1.00 11.46 ? 589  PHE A CD1   1 
ATOM   4858 C  CD2   . PHE A 1 589 ? -4.798  -0.427  -58.286 1.00 10.69 ? 589  PHE A CD2   1 
ATOM   4859 C  CE1   . PHE A 1 589 ? -4.809  2.344   -58.536 1.00 12.51 ? 589  PHE A CE1   1 
ATOM   4860 C  CE2   . PHE A 1 589 ? -5.448  0.171   -59.369 1.00 11.53 ? 589  PHE A CE2   1 
ATOM   4861 C  CZ    . PHE A 1 589 ? -5.459  1.563   -59.489 1.00 14.22 ? 589  PHE A CZ    1 
ATOM   4862 N  N     . GLY A 1 590 ? -1.060  1.471   -55.136 1.00 12.94 ? 590  GLY A N     1 
ATOM   4863 C  CA    . GLY A 1 590 ? -0.327  2.735   -54.967 1.00 11.54 ? 590  GLY A CA    1 
ATOM   4864 C  C     . GLY A 1 590 ? 1.096   2.670   -55.498 1.00 12.54 ? 590  GLY A C     1 
ATOM   4865 O  O     . GLY A 1 590 ? 1.535   3.565   -56.224 1.00 12.49 ? 590  GLY A O     1 
ATOM   4866 N  N     . GLN A 1 591 ? 1.819   1.610   -55.144 1.00 13.45 ? 591  GLN A N     1 
ATOM   4867 C  CA    . GLN A 1 591 ? 3.175   1.417   -55.660 1.00 13.72 ? 591  GLN A CA    1 
ATOM   4868 C  C     . GLN A 1 591 ? 3.192   1.376   -57.185 1.00 14.39 ? 591  GLN A C     1 
ATOM   4869 O  O     . GLN A 1 591 ? 4.056   1.994   -57.822 1.00 12.67 ? 591  GLN A O     1 
ATOM   4870 C  CB    . GLN A 1 591 ? 3.807   0.142   -55.103 1.00 14.68 ? 591  GLN A CB    1 
ATOM   4871 C  CG    . GLN A 1 591 ? 4.208   0.228   -53.638 1.00 18.01 ? 591  GLN A CG    1 
ATOM   4872 C  CD    . GLN A 1 591 ? 5.404   -0.647  -53.328 1.00 24.38 ? 591  GLN A CD    1 
ATOM   4873 O  OE1   . GLN A 1 591 ? 6.117   -1.084  -54.234 1.00 26.40 ? 591  GLN A OE1   1 
ATOM   4874 N  NE2   . GLN A 1 591 ? 5.630   -0.911  -52.048 1.00 25.78 ? 591  GLN A NE2   1 
ATOM   4875 N  N     . MET A 1 592 ? 2.240   0.648   -57.766 1.00 12.61 ? 592  MET A N     1 
ATOM   4876 C  CA    . MET A 1 592 ? 2.129   0.568   -59.220 1.00 13.43 ? 592  MET A CA    1 
ATOM   4877 C  C     . MET A 1 592 ? 1.845   1.936   -59.836 1.00 12.60 ? 592  MET A C     1 
ATOM   4878 O  O     . MET A 1 592 ? 2.479   2.325   -60.820 1.00 11.99 ? 592  MET A O     1 
ATOM   4879 C  CB    . MET A 1 592 ? 1.032   -0.419  -59.635 1.00 14.10 ? 592  MET A CB    1 
ATOM   4880 C  CG    . MET A 1 592 ? 0.872   -0.532  -61.154 1.00 13.18 ? 592  MET A CG    1 
ATOM   4881 S  SD    . MET A 1 592 ? -0.482  -1.614  -61.616 1.00 15.28 ? 592  MET A SD    1 
ATOM   4882 C  CE    . MET A 1 592 ? -1.888  -0.617  -61.131 1.00 17.47 ? 592  MET A CE    1 
ATOM   4883 N  N     . ALA A 1 593 ? 0.894   2.653   -59.242 1.00 13.48 ? 593  ALA A N     1 
ATOM   4884 C  CA    . ALA A 1 593 ? 0.436   3.938   -59.763 1.00 14.63 ? 593  ALA A CA    1 
ATOM   4885 C  C     . ALA A 1 593 ? 1.563   4.961   -59.839 1.00 14.74 ? 593  ALA A C     1 
ATOM   4886 O  O     . ALA A 1 593 ? 1.733   5.637   -60.864 1.00 13.89 ? 593  ALA A O     1 
ATOM   4887 C  CB    . ALA A 1 593 ? -0.724  4.469   -58.924 1.00 14.69 ? 593  ALA A CB    1 
ATOM   4888 N  N     . LEU A 1 594 ? 2.329   5.073   -58.757 1.00 14.35 ? 594  LEU A N     1 
ATOM   4889 C  CA    . LEU A 1 594 ? 3.455   6.001   -58.720 1.00 14.85 ? 594  LEU A CA    1 
ATOM   4890 C  C     . LEU A 1 594 ? 4.497   5.669   -59.794 1.00 14.12 ? 594  LEU A C     1 
ATOM   4891 O  O     . LEU A 1 594 ? 4.950   6.552   -60.530 1.00 14.82 ? 594  LEU A O     1 
ATOM   4892 C  CB    . LEU A 1 594 ? 4.099   6.026   -57.326 1.00 13.94 ? 594  LEU A CB    1 
ATOM   4893 C  CG    . LEU A 1 594 ? 5.332   6.924   -57.134 1.00 18.82 ? 594  LEU A CG    1 
ATOM   4894 C  CD1   . LEU A 1 594 ? 5.086   8.330   -57.674 1.00 19.89 ? 594  LEU A CD1   1 
ATOM   4895 C  CD2   . LEU A 1 594 ? 5.738   6.994   -55.671 1.00 15.23 ? 594  LEU A CD2   1 
ATOM   4896 N  N     . GLN A 1 595 ? 4.864   4.397   -59.895 1.00 13.87 ? 595  GLN A N     1 
ATOM   4897 C  CA    . GLN A 1 595 ? 5.936   4.001   -60.807 1.00 12.42 ? 595  GLN A CA    1 
ATOM   4898 C  C     . GLN A 1 595 ? 5.479   3.965   -62.271 1.00 11.76 ? 595  GLN A C     1 
ATOM   4899 O  O     . GLN A 1 595 ? 6.271   4.215   -63.190 1.00 10.86 ? 595  GLN A O     1 
ATOM   4900 C  CB    . GLN A 1 595 ? 6.587   2.695   -60.335 1.00 11.81 ? 595  GLN A CB    1 
ATOM   4901 C  CG    . GLN A 1 595 ? 7.247   2.854   -58.957 1.00 14.22 ? 595  GLN A CG    1 
ATOM   4902 C  CD    . GLN A 1 595 ? 7.781   1.564   -58.367 1.00 17.30 ? 595  GLN A CD    1 
ATOM   4903 O  OE1   . GLN A 1 595 ? 8.894   1.147   -58.666 1.00 19.81 ? 595  GLN A OE1   1 
ATOM   4904 N  NE2   . GLN A 1 595 ? 6.992   0.937   -57.505 1.00 18.42 ? 595  GLN A NE2   1 
ATOM   4905 N  N     . TRP A 1 596 ? 4.196   3.670   -62.472 1.00 11.75 ? 596  TRP A N     1 
ATOM   4906 C  CA    . TRP A 1 596 ? 3.554   3.740   -63.781 1.00 12.93 ? 596  TRP A CA    1 
ATOM   4907 C  C     . TRP A 1 596 ? 3.615   5.168   -64.312 1.00 13.47 ? 596  TRP A C     1 
ATOM   4908 O  O     . TRP A 1 596 ? 4.038   5.395   -65.447 1.00 12.98 ? 596  TRP A O     1 
ATOM   4909 C  CB    . TRP A 1 596 ? 2.090   3.293   -63.665 1.00 12.56 ? 596  TRP A CB    1 
ATOM   4910 C  CG    . TRP A 1 596 ? 1.261   3.470   -64.900 1.00 11.61 ? 596  TRP A CG    1 
ATOM   4911 C  CD1   . TRP A 1 596 ? 0.671   4.622   -65.334 1.00 11.75 ? 596  TRP A CD1   1 
ATOM   4912 C  CD2   . TRP A 1 596 ? 0.900   2.453   -65.842 1.00 11.41 ? 596  TRP A CD2   1 
ATOM   4913 N  NE1   . TRP A 1 596 ? -0.030  4.387   -66.494 1.00 12.36 ? 596  TRP A NE1   1 
ATOM   4914 C  CE2   . TRP A 1 596 ? 0.093   3.063   -66.827 1.00 13.48 ? 596  TRP A CE2   1 
ATOM   4915 C  CE3   . TRP A 1 596 ? 1.173   1.080   -65.944 1.00 14.05 ? 596  TRP A CE3   1 
ATOM   4916 C  CZ2   . TRP A 1 596 ? -0.434  2.352   -67.914 1.00 12.67 ? 596  TRP A CZ2   1 
ATOM   4917 C  CZ3   . TRP A 1 596 ? 0.654   0.373   -67.028 1.00 12.64 ? 596  TRP A CZ3   1 
ATOM   4918 C  CH2   . TRP A 1 596 ? -0.143  1.014   -67.998 1.00 14.97 ? 596  TRP A CH2   1 
ATOM   4919 N  N     . ILE A 1 597 ? 3.178   6.123   -63.493 1.00 12.92 ? 597  ILE A N     1 
ATOM   4920 C  CA    . ILE A 1 597 ? 3.105   7.510   -63.940 1.00 12.70 ? 597  ILE A CA    1 
ATOM   4921 C  C     . ILE A 1 597 ? 4.495   8.144   -64.041 1.00 13.31 ? 597  ILE A C     1 
ATOM   4922 O  O     . ILE A 1 597 ? 4.694   9.069   -64.823 1.00 12.97 ? 597  ILE A O     1 
ATOM   4923 C  CB    . ILE A 1 597 ? 2.125   8.366   -63.090 1.00 10.94 ? 597  ILE A CB    1 
ATOM   4924 C  CG1   . ILE A 1 597 ? 1.533   9.507   -63.935 1.00 11.25 ? 597  ILE A CG1   1 
ATOM   4925 C  CG2   . ILE A 1 597 ? 2.789   8.898   -61.802 1.00 10.37 ? 597  ILE A CG2   1 
ATOM   4926 C  CD1   . ILE A 1 597 ? 0.673   9.029   -65.115 1.00 12.28 ? 597  ILE A CD1   1 
ATOM   4927 N  N     . GLU A 1 598 ? 5.452   7.650   -63.255 1.00 14.83 ? 598  GLU A N     1 
ATOM   4928 C  CA    . GLU A 1 598 ? 6.841   8.079   -63.421 1.00 15.09 ? 598  GLU A CA    1 
ATOM   4929 C  C     . GLU A 1 598 ? 7.282   7.778   -64.855 1.00 15.11 ? 598  GLU A C     1 
ATOM   4930 O  O     . GLU A 1 598 ? 7.840   8.644   -65.542 1.00 15.43 ? 598  GLU A O     1 
ATOM   4931 C  CB    . GLU A 1 598 ? 7.782   7.388   -62.423 1.00 14.87 ? 598  GLU A CB    1 
ATOM   4932 C  CG    . GLU A 1 598 ? 9.255   7.757   -62.646 1.00 13.29 ? 598  GLU A CG    1 
ATOM   4933 C  CD    . GLU A 1 598 ? 10.238  6.934   -61.829 1.00 17.06 ? 598  GLU A CD    1 
ATOM   4934 O  OE1   . GLU A 1 598 ? 9.840   5.896   -61.263 1.00 19.46 ? 598  GLU A OE1   1 
ATOM   4935 O  OE2   . GLU A 1 598 ? 11.424  7.326   -61.763 1.00 14.30 ? 598  GLU A OE2   1 
ATOM   4936 N  N     . ARG A 1 599 ? 7.012   6.550   -65.296 1.00 14.14 ? 599  ARG A N     1 
ATOM   4937 C  CA    . ARG A 1 599 ? 7.334   6.118   -66.650 1.00 14.42 ? 599  ARG A CA    1 
ATOM   4938 C  C     . ARG A 1 599 ? 6.633   6.990   -67.687 1.00 15.19 ? 599  ARG A C     1 
ATOM   4939 O  O     . ARG A 1 599 ? 7.260   7.452   -68.649 1.00 14.87 ? 599  ARG A O     1 
ATOM   4940 C  CB    . ARG A 1 599 ? 6.963   4.638   -66.863 1.00 12.22 ? 599  ARG A CB    1 
ATOM   4941 C  CG    . ARG A 1 599 ? 7.244   4.141   -68.289 1.00 13.84 ? 599  ARG A CG    1 
ATOM   4942 C  CD    . ARG A 1 599 ? 7.036   2.637   -68.479 1.00 14.97 ? 599  ARG A CD    1 
ATOM   4943 N  NE    . ARG A 1 599 ? 5.681   2.173   -68.162 1.00 15.74 ? 599  ARG A NE    1 
ATOM   4944 C  CZ    . ARG A 1 599 ? 4.619   2.290   -68.963 1.00 17.00 ? 599  ARG A CZ    1 
ATOM   4945 N  NH1   . ARG A 1 599 ? 4.710   2.889   -70.147 1.00 15.12 ? 599  ARG A NH1   1 
ATOM   4946 N  NH2   . ARG A 1 599 ? 3.449   1.807   -68.570 1.00 18.01 ? 599  ARG A NH2   1 
ATOM   4947 N  N     . LYS A 1 600 ? 5.335   7.209   -67.485 1.00 13.04 ? 600  LYS A N     1 
ATOM   4948 C  CA    . LYS A 1 600 ? 4.521   7.975   -68.431 1.00 11.88 ? 600  LYS A CA    1 
ATOM   4949 C  C     . LYS A 1 600 ? 5.004   9.412   -68.563 1.00 12.52 ? 600  LYS A C     1 
ATOM   4950 O  O     . LYS A 1 600 ? 5.012   9.959   -69.662 1.00 11.14 ? 600  LYS A O     1 
ATOM   4951 C  CB    . LYS A 1 600 ? 3.039   7.960   -68.028 1.00 11.47 ? 600  LYS A CB    1 
ATOM   4952 C  CG    . LYS A 1 600 ? 2.321   6.619   -68.241 1.00 11.82 ? 600  LYS A CG    1 
ATOM   4953 C  CD    . LYS A 1 600 ? 2.241   6.247   -69.715 1.00 12.97 ? 600  LYS A CD    1 
ATOM   4954 C  CE    . LYS A 1 600 ? 1.363   5.020   -69.940 1.00 14.19 ? 600  LYS A CE    1 
ATOM   4955 N  NZ    . LYS A 1 600 ? 1.214   4.715   -71.389 1.00 18.65 ? 600  LYS A NZ    1 
ATOM   4956 N  N     . VAL A 1 601 ? 5.396   10.019  -67.441 1.00 10.82 ? 601  VAL A N     1 
ATOM   4957 C  CA    . VAL A 1 601 ? 5.869   11.406  -67.448 1.00 11.37 ? 601  VAL A CA    1 
ATOM   4958 C  C     . VAL A 1 601 ? 7.245   11.542  -68.129 1.00 12.86 ? 601  VAL A C     1 
ATOM   4959 O  O     . VAL A 1 601 ? 7.461   12.468  -68.919 1.00 11.80 ? 601  VAL A O     1 
ATOM   4960 C  CB    . VAL A 1 601 ? 5.853   12.009  -66.021 1.00 12.23 ? 601  VAL A CB    1 
ATOM   4961 C  CG1   . VAL A 1 601 ? 6.701   13.277  -65.930 1.00 12.93 ? 601  VAL A CG1   1 
ATOM   4962 C  CG2   . VAL A 1 601 ? 4.413   12.297  -65.599 1.00 11.04 ? 601  VAL A CG2   1 
ATOM   4963 N  N     . ASN A 1 602 ? 8.164   10.623  -67.826 1.00 12.53 ? 602  ASN A N     1 
ATOM   4964 C  CA    . ASN A 1 602 ? 9.457   10.580  -68.524 1.00 14.00 ? 602  ASN A CA    1 
ATOM   4965 C  C     . ASN A 1 602 ? 9.269   10.429  -70.031 1.00 14.40 ? 602  ASN A C     1 
ATOM   4966 O  O     . ASN A 1 602 ? 9.879   11.158  -70.812 1.00 13.31 ? 602  ASN A O     1 
ATOM   4967 C  CB    . ASN A 1 602 ? 10.357  9.459   -67.976 1.00 13.08 ? 602  ASN A CB    1 
ATOM   4968 C  CG    . ASN A 1 602 ? 11.009  9.824   -66.646 1.00 13.79 ? 602  ASN A CG    1 
ATOM   4969 O  OD1   . ASN A 1 602 ? 11.180  11.006  -66.320 1.00 14.20 ? 602  ASN A OD1   1 
ATOM   4970 N  ND2   . ASN A 1 602 ? 11.383  8.810   -65.874 1.00 12.52 ? 602  ASN A ND2   1 
ATOM   4971 N  N     . GLU A 1 603 ? 8.407   9.499   -70.429 1.00 15.22 ? 603  GLU A N     1 
ATOM   4972 C  CA    . GLU A 1 603 ? 8.098   9.278   -71.846 1.00 16.12 ? 603  GLU A CA    1 
ATOM   4973 C  C     . GLU A 1 603 ? 7.578   10.553  -72.513 1.00 15.55 ? 603  GLU A C     1 
ATOM   4974 O  O     . GLU A 1 603 ? 8.065   10.947  -73.579 1.00 14.49 ? 603  GLU A O     1 
ATOM   4975 C  CB    . GLU A 1 603 ? 7.076   8.147   -72.008 1.00 16.12 ? 603  GLU A CB    1 
ATOM   4976 C  CG    . GLU A 1 603 ? 7.677   6.748   -71.924 1.00 20.58 ? 603  GLU A CG    1 
ATOM   4977 C  CD    . GLU A 1 603 ? 6.626   5.642   -71.880 1.00 22.50 ? 603  GLU A CD    1 
ATOM   4978 O  OE1   . GLU A 1 603 ? 5.425   5.929   -72.086 1.00 25.06 ? 603  GLU A OE1   1 
ATOM   4979 O  OE2   . GLU A 1 603 ? 7.005   4.478   -71.636 1.00 19.61 ? 603  GLU A OE2   1 
ATOM   4980 N  N     . TYR A 1 604 ? 6.600   11.191  -71.870 1.00 14.34 ? 604  TYR A N     1 
ATOM   4981 C  CA    . TYR A 1 604 ? 5.963   12.389  -72.407 1.00 14.37 ? 604  TYR A CA    1 
ATOM   4982 C  C     . TYR A 1 604 ? 6.919   13.585  -72.538 1.00 13.31 ? 604  TYR A C     1 
ATOM   4983 O  O     . TYR A 1 604 ? 6.922   14.267  -73.564 1.00 12.26 ? 604  TYR A O     1 
ATOM   4984 C  CB    . TYR A 1 604 ? 4.743   12.793  -71.566 1.00 14.60 ? 604  TYR A CB    1 
ATOM   4985 C  CG    . TYR A 1 604 ? 4.150   14.104  -72.026 1.00 17.30 ? 604  TYR A CG    1 
ATOM   4986 C  CD1   . TYR A 1 604 ? 4.365   15.282  -71.312 1.00 18.35 ? 604  TYR A CD1   1 
ATOM   4987 C  CD2   . TYR A 1 604 ? 3.417   14.174  -73.211 1.00 18.00 ? 604  TYR A CD2   1 
ATOM   4988 C  CE1   . TYR A 1 604 ? 3.839   16.495  -71.757 1.00 18.59 ? 604  TYR A CE1   1 
ATOM   4989 C  CE2   . TYR A 1 604 ? 2.891   15.373  -73.658 1.00 18.76 ? 604  TYR A CE2   1 
ATOM   4990 C  CZ    . TYR A 1 604 ? 3.104   16.530  -72.929 1.00 19.72 ? 604  TYR A CZ    1 
ATOM   4991 O  OH    . TYR A 1 604 ? 2.578   17.719  -73.388 1.00 18.00 ? 604  TYR A OH    1 
ATOM   4992 N  N     . LEU A 1 605 ? 7.707   13.848  -71.499 1.00 12.43 ? 605  LEU A N     1 
ATOM   4993 C  CA    . LEU A 1 605 ? 8.599   15.006  -71.521 1.00 12.46 ? 605  LEU A CA    1 
ATOM   4994 C  C     . LEU A 1 605 ? 9.769   14.847  -72.502 1.00 13.73 ? 605  LEU A C     1 
ATOM   4995 O  O     . LEU A 1 605 ? 10.153  15.809  -73.166 1.00 13.48 ? 605  LEU A O     1 
ATOM   4996 C  CB    . LEU A 1 605 ? 9.063   15.376  -70.114 1.00 13.21 ? 605  LEU A CB    1 
ATOM   4997 C  CG    . LEU A 1 605 ? 7.950   15.946  -69.224 1.00 13.18 ? 605  LEU A CG    1 
ATOM   4998 C  CD1   . LEU A 1 605 ? 8.429   16.061  -67.790 1.00 10.50 ? 605  LEU A CD1   1 
ATOM   4999 C  CD2   . LEU A 1 605 ? 7.460   17.305  -69.755 1.00 13.22 ? 605  LEU A CD2   1 
ATOM   5000 N  N     . ASN A 1 606 ? 10.315  13.636  -72.609 1.00 15.45 ? 606  ASN A N     1 
ATOM   5001 C  CA    . ASN A 1 606 ? 11.294  13.329  -73.658 1.00 16.64 ? 606  ASN A CA    1 
ATOM   5002 C  C     . ASN A 1 606 ? 10.728  13.609  -75.050 1.00 18.87 ? 606  ASN A C     1 
ATOM   5003 O  O     . ASN A 1 606 ? 11.393  14.229  -75.886 1.00 18.06 ? 606  ASN A O     1 
ATOM   5004 C  CB    . ASN A 1 606 ? 11.769  11.877  -73.555 1.00 17.30 ? 606  ASN A CB    1 
ATOM   5005 C  CG    . ASN A 1 606 ? 12.981  11.724  -72.657 1.00 17.02 ? 606  ASN A CG    1 
ATOM   5006 O  OD1   . ASN A 1 606 ? 14.094  12.116  -73.025 1.00 18.66 ? 606  ASN A OD1   1 
ATOM   5007 N  ND2   . ASN A 1 606 ? 12.777  11.151  -71.476 1.00 16.06 ? 606  ASN A ND2   1 
ATOM   5008 N  N     . GLU A 1 607 ? 9.489   13.169  -75.276 1.00 17.96 ? 607  GLU A N     1 
ATOM   5009 C  CA    . GLU A 1 607 ? 8.796   13.379  -76.544 1.00 19.68 ? 607  GLU A CA    1 
ATOM   5010 C  C     . GLU A 1 607 ? 8.646   14.864  -76.893 1.00 19.27 ? 607  GLU A C     1 
ATOM   5011 O  O     . GLU A 1 607 ? 8.990   15.275  -78.000 1.00 19.79 ? 607  GLU A O     1 
ATOM   5012 C  CB    . GLU A 1 607 ? 7.429   12.670  -76.535 1.00 20.34 ? 607  GLU A CB    1 
ATOM   5013 C  CG    . GLU A 1 607 ? 6.550   12.928  -77.752 1.00 28.64 ? 607  GLU A CG    1 
ATOM   5014 C  CD    . GLU A 1 607 ? 5.174   12.289  -77.629 1.00 36.44 ? 607  GLU A CD    1 
ATOM   5015 O  OE1   . GLU A 1 607 ? 4.170   13.037  -77.582 1.00 38.51 ? 607  GLU A OE1   1 
ATOM   5016 O  OE2   . GLU A 1 607 ? 5.097   11.041  -77.569 1.00 39.25 ? 607  GLU A OE2   1 
ATOM   5017 N  N     . VAL A 1 608 ? 8.150   15.670  -75.956 1.00 18.09 ? 608  VAL A N     1 
ATOM   5018 C  CA    . VAL A 1 608 ? 7.911   17.090  -76.250 1.00 18.74 ? 608  VAL A CA    1 
ATOM   5019 C  C     . VAL A 1 608 ? 9.201   17.920  -76.286 1.00 19.36 ? 608  VAL A C     1 
ATOM   5020 O  O     . VAL A 1 608 ? 9.246   18.979  -76.917 1.00 17.20 ? 608  VAL A O     1 
ATOM   5021 C  CB    . VAL A 1 608 ? 6.847   17.735  -75.317 1.00 19.19 ? 608  VAL A CB    1 
ATOM   5022 C  CG1   . VAL A 1 608 ? 5.500   17.035  -75.491 1.00 17.57 ? 608  VAL A CG1   1 
ATOM   5023 C  CG2   . VAL A 1 608 ? 7.295   17.718  -73.848 1.00 18.98 ? 608  VAL A CG2   1 
ATOM   5024 N  N     . CYS A 1 609 ? 10.244  17.433  -75.618 1.00 19.23 ? 609  CYS A N     1 
ATOM   5025 C  CA    . CYS A 1 609 ? 11.543  18.096  -75.658 1.00 20.95 ? 609  CYS A CA    1 
ATOM   5026 C  C     . CYS A 1 609 ? 12.427  17.578  -76.791 1.00 22.45 ? 609  CYS A C     1 
ATOM   5027 O  O     . CYS A 1 609 ? 13.551  18.053  -76.973 1.00 21.98 ? 609  CYS A O     1 
ATOM   5028 C  CB    . CYS A 1 609 ? 12.253  17.981  -74.308 1.00 20.90 ? 609  CYS A CB    1 
ATOM   5029 S  SG    . CYS A 1 609 ? 11.446  18.930  -73.020 1.00 24.31 ? 609  CYS A SG    1 
ATOM   5030 N  N     . GLY A 1 610 ? 11.904  16.615  -77.552 1.00 23.18 ? 610  GLY A N     1 
ATOM   5031 C  CA    . GLY A 1 610 ? 12.591  16.071  -78.728 1.00 24.46 ? 610  GLY A CA    1 
ATOM   5032 C  C     . GLY A 1 610 ? 13.787  15.185  -78.427 1.00 24.59 ? 610  GLY A C     1 
ATOM   5033 O  O     . GLY A 1 610 ? 14.661  15.004  -79.280 1.00 25.21 ? 610  GLY A O     1 
ATOM   5034 N  N     . THR A 1 611 ? 13.823  14.633  -77.216 1.00 24.57 ? 611  THR A N     1 
ATOM   5035 C  CA    . THR A 1 611 ? 14.916  13.765  -76.774 1.00 25.18 ? 611  THR A CA    1 
ATOM   5036 C  C     . THR A 1 611 ? 14.421  12.361  -76.424 1.00 25.39 ? 611  THR A C     1 
ATOM   5037 O  O     . THR A 1 611 ? 13.235  12.056  -76.574 1.00 25.18 ? 611  THR A O     1 
ATOM   5038 C  CB    . THR A 1 611 ? 15.677  14.367  -75.572 1.00 24.58 ? 611  THR A CB    1 
ATOM   5039 O  OG1   . THR A 1 611 ? 14.794  14.496  -74.448 1.00 27.59 ? 611  THR A OG1   1 
ATOM   5040 C  CG2   . THR A 1 611 ? 16.260  15.734  -75.934 1.00 25.37 ? 611  THR A CG2   1 
ATOM   5041 N  N     . GLU A 1 612 ? 15.343  11.507  -75.980 1.00 25.55 ? 612  GLU A N     1 
ATOM   5042 C  CA    . GLU A 1 612 ? 15.021  10.138  -75.579 1.00 24.82 ? 612  GLU A CA    1 
ATOM   5043 C  C     . GLU A 1 612 ? 15.882  9.744   -74.388 1.00 22.89 ? 612  GLU A C     1 
ATOM   5044 O  O     . GLU A 1 612 ? 17.072  10.050  -74.354 1.00 22.20 ? 612  GLU A O     1 
ATOM   5045 C  CB    . GLU A 1 612 ? 15.260  9.154   -76.734 1.00 25.91 ? 612  GLU A CB    1 
ATOM   5046 C  CG    . GLU A 1 612 ? 14.328  9.319   -77.943 1.00 30.63 ? 612  GLU A CG    1 
ATOM   5047 C  CD    . GLU A 1 612 ? 14.653  8.356   -79.081 1.00 34.50 ? 612  GLU A CD    1 
ATOM   5048 O  OE1   . GLU A 1 612 ? 14.895  8.830   -80.213 1.00 36.08 ? 612  GLU A OE1   1 
ATOM   5049 O  OE2   . GLU A 1 612 ? 14.672  7.128   -78.844 1.00 35.37 ? 612  GLU A OE2   1 
ATOM   5050 N  N     . GLY A 1 613 ? 15.271  9.087   -73.405 1.00 20.66 ? 613  GLY A N     1 
ATOM   5051 C  CA    . GLY A 1 613 ? 16.011  8.488   -72.296 1.00 19.43 ? 613  GLY A CA    1 
ATOM   5052 C  C     . GLY A 1 613 ? 16.481  9.388   -71.162 1.00 20.09 ? 613  GLY A C     1 
ATOM   5053 O  O     . GLY A 1 613 ? 17.175  8.924   -70.259 1.00 19.93 ? 613  GLY A O     1 
ATOM   5054 N  N     . GLU A 1 614 ? 16.121  10.668  -71.192 1.00 19.58 ? 614  GLU A N     1 
ATOM   5055 C  CA    . GLU A 1 614 ? 16.468  11.564  -70.084 1.00 20.88 ? 614  GLU A CA    1 
ATOM   5056 C  C     . GLU A 1 614 ? 15.530  11.347  -68.899 1.00 21.01 ? 614  GLU A C     1 
ATOM   5057 O  O     . GLU A 1 614 ? 14.338  11.060  -69.080 1.00 20.45 ? 614  GLU A O     1 
ATOM   5058 C  CB    . GLU A 1 614 ? 16.455  13.029  -70.529 1.00 22.14 ? 614  GLU A CB    1 
ATOM   5059 C  CG    . GLU A 1 614 ? 17.608  13.397  -71.477 1.00 26.54 ? 614  GLU A CG    1 
ATOM   5060 C  CD    . GLU A 1 614 ? 17.564  14.844  -71.963 1.00 28.28 ? 614  GLU A CD    1 
ATOM   5061 O  OE1   . GLU A 1 614 ? 16.962  15.705  -71.280 1.00 26.49 ? 614  GLU A OE1   1 
ATOM   5062 O  OE2   . GLU A 1 614 ? 18.144  15.121  -73.035 1.00 28.89 ? 614  GLU A OE2   1 
ATOM   5063 N  N     . ALA A 1 615 ? 16.078  11.460  -67.691 1.00 20.74 ? 615  ALA A N     1 
ATOM   5064 C  CA    . ALA A 1 615 ? 15.293  11.303  -66.473 1.00 23.00 ? 615  ALA A CA    1 
ATOM   5065 C  C     . ALA A 1 615 ? 14.746  12.651  -66.028 1.00 22.34 ? 615  ALA A C     1 
ATOM   5066 O  O     . ALA A 1 615 ? 15.493  13.516  -65.564 1.00 25.65 ? 615  ALA A O     1 
ATOM   5067 C  CB    . ALA A 1 615 ? 16.126  10.671  -65.368 1.00 23.22 ? 615  ALA A CB    1 
ATOM   5068 N  N     . PHE A 1 616 ? 13.443  12.833  -66.190 1.00 17.51 ? 616  PHE A N     1 
ATOM   5069 C  CA    . PHE A 1 616 ? 12.793  14.052  -65.737 1.00 14.56 ? 616  PHE A CA    1 
ATOM   5070 C  C     . PHE A 1 616 ? 12.321  13.939  -64.296 1.00 14.04 ? 616  PHE A C     1 
ATOM   5071 O  O     . PHE A 1 616 ? 12.456  14.891  -63.526 1.00 13.93 ? 616  PHE A O     1 
ATOM   5072 C  CB    . PHE A 1 616 ? 11.632  14.422  -66.663 1.00 14.75 ? 616  PHE A CB    1 
ATOM   5073 C  CG    . PHE A 1 616 ? 12.073  15.032  -67.961 1.00 16.00 ? 616  PHE A CG    1 
ATOM   5074 C  CD1   . PHE A 1 616 ? 12.230  16.412  -68.073 1.00 16.23 ? 616  PHE A CD1   1 
ATOM   5075 C  CD2   . PHE A 1 616 ? 12.338  14.230  -69.071 1.00 14.50 ? 616  PHE A CD2   1 
ATOM   5076 C  CE1   . PHE A 1 616 ? 12.639  16.990  -69.275 1.00 15.48 ? 616  PHE A CE1   1 
ATOM   5077 C  CE2   . PHE A 1 616 ? 12.750  14.800  -70.281 1.00 16.33 ? 616  PHE A CE2   1 
ATOM   5078 C  CZ    . PHE A 1 616 ? 12.897  16.182  -70.383 1.00 14.27 ? 616  PHE A CZ    1 
ATOM   5079 N  N     . VAL A 1 617 ? 11.776  12.777  -63.938 1.00 12.95 ? 617  VAL A N     1 
ATOM   5080 C  CA    . VAL A 1 617 ? 11.283  12.545  -62.580 1.00 12.42 ? 617  VAL A CA    1 
ATOM   5081 C  C     . VAL A 1 617 ? 12.484  12.229  -61.691 1.00 12.82 ? 617  VAL A C     1 
ATOM   5082 O  O     . VAL A 1 617 ? 13.142  11.203  -61.869 1.00 13.55 ? 617  VAL A O     1 
ATOM   5083 C  CB    . VAL A 1 617 ? 10.231  11.411  -62.532 1.00 11.88 ? 617  VAL A CB    1 
ATOM   5084 C  CG1   . VAL A 1 617 ? 9.790   11.125  -61.085 1.00 11.60 ? 617  VAL A CG1   1 
ATOM   5085 C  CG2   . VAL A 1 617 ? 9.014   11.765  -63.395 1.00 11.08 ? 617  VAL A CG2   1 
ATOM   5086 N  N     . LEU A 1 618 ? 12.782  13.131  -60.760 1.00 12.37 ? 618  LEU A N     1 
ATOM   5087 C  CA    . LEU A 1 618 ? 13.982  13.018  -59.919 1.00 13.45 ? 618  LEU A CA    1 
ATOM   5088 C  C     . LEU A 1 618 ? 13.700  12.316  -58.586 1.00 11.78 ? 618  LEU A C     1 
ATOM   5089 O  O     . LEU A 1 618 ? 14.624  11.837  -57.912 1.00 13.71 ? 618  LEU A O     1 
ATOM   5090 C  CB    . LEU A 1 618 ? 14.573  14.414  -59.659 1.00 13.47 ? 618  LEU A CB    1 
ATOM   5091 C  CG    . LEU A 1 618 ? 13.801  15.355  -58.719 1.00 14.39 ? 618  LEU A CG    1 
ATOM   5092 C  CD1   . LEU A 1 618 ? 14.496  15.415  -57.360 1.00 15.19 ? 618  LEU A CD1   1 
ATOM   5093 C  CD2   . LEU A 1 618 ? 13.676  16.754  -59.306 1.00 12.46 ? 618  LEU A CD2   1 
ATOM   5094 N  N     . TYR A 1 619 ? 12.423  12.269  -58.210 1.00 12.44 ? 619  TYR A N     1 
ATOM   5095 C  CA    . TYR A 1 619 ? 12.003  11.779  -56.893 1.00 11.57 ? 619  TYR A CA    1 
ATOM   5096 C  C     . TYR A 1 619 ? 10.493  11.545  -56.863 1.00 12.40 ? 619  TYR A C     1 
ATOM   5097 O  O     . TYR A 1 619 ? 9.753   12.123  -57.651 1.00 11.51 ? 619  TYR A O     1 
ATOM   5098 C  CB    . TYR A 1 619 ? 12.366  12.797  -55.799 1.00 13.17 ? 619  TYR A CB    1 
ATOM   5099 C  CG    . TYR A 1 619 ? 12.025  12.351  -54.393 1.00 13.51 ? 619  TYR A CG    1 
ATOM   5100 C  CD1   . TYR A 1 619 ? 11.047  13.009  -53.640 1.00 15.35 ? 619  TYR A CD1   1 
ATOM   5101 C  CD2   . TYR A 1 619 ? 12.678  11.262  -53.815 1.00 12.75 ? 619  TYR A CD2   1 
ATOM   5102 C  CE1   . TYR A 1 619 ? 10.744  12.587  -52.328 1.00 13.89 ? 619  TYR A CE1   1 
ATOM   5103 C  CE2   . TYR A 1 619 ? 12.380  10.836  -52.529 1.00 11.14 ? 619  TYR A CE2   1 
ATOM   5104 C  CZ    . TYR A 1 619 ? 11.417  11.498  -51.789 1.00 13.03 ? 619  TYR A CZ    1 
ATOM   5105 O  OH    . TYR A 1 619 ? 11.135  11.043  -50.514 1.00 12.30 ? 619  TYR A OH    1 
ATOM   5106 N  N     . GLY A 1 620 ? 10.061  10.695  -55.938 1.00 13.38 ? 620  GLY A N     1 
ATOM   5107 C  CA    . GLY A 1 620 ? 8.646   10.453  -55.678 1.00 13.24 ? 620  GLY A CA    1 
ATOM   5108 C  C     . GLY A 1 620 ? 8.492   9.711   -54.370 1.00 12.06 ? 620  GLY A C     1 
ATOM   5109 O  O     . GLY A 1 620 ? 9.353   8.912   -54.009 1.00 13.88 ? 620  GLY A O     1 
ATOM   5110 N  N     . ASP A 1 621 ? 7.405   9.987   -53.651 1.00 13.34 ? 621  ASP A N     1 
ATOM   5111 C  CA    . ASP A 1 621 ? 7.127   9.329   -52.370 1.00 14.37 ? 621  ASP A CA    1 
ATOM   5112 C  C     . ASP A 1 621 ? 5.647   9.004   -52.315 1.00 13.31 ? 621  ASP A C     1 
ATOM   5113 O  O     . ASP A 1 621 ? 4.817   9.905   -52.203 1.00 14.24 ? 621  ASP A O     1 
ATOM   5114 C  CB    . ASP A 1 621 ? 7.551   10.226  -51.182 1.00 12.79 ? 621  ASP A CB    1 
ATOM   5115 C  CG    . ASP A 1 621 ? 7.300   9.583   -49.807 1.00 16.93 ? 621  ASP A CG    1 
ATOM   5116 O  OD1   . ASP A 1 621 ? 6.450   8.671   -49.671 1.00 15.90 ? 621  ASP A OD1   1 
ATOM   5117 O  OD2   . ASP A 1 621 ? 7.944   10.028  -48.829 1.00 18.02 ? 621  ASP A OD2   1 
ATOM   5118 N  N     . THR A 1 622 ? 5.335   7.712   -52.434 1.00 12.89 ? 622  THR A N     1 
ATOM   5119 C  CA    . THR A 1 622 ? 3.977   7.174   -52.270 1.00 13.34 ? 622  THR A CA    1 
ATOM   5120 C  C     . THR A 1 622 ? 3.041   7.502   -53.437 1.00 13.34 ? 622  THR A C     1 
ATOM   5121 O  O     . THR A 1 622 ? 2.570   6.594   -54.127 1.00 13.41 ? 622  THR A O     1 
ATOM   5122 C  CB    . THR A 1 622 ? 3.353   7.601   -50.906 1.00 10.87 ? 622  THR A CB    1 
ATOM   5123 O  OG1   . THR A 1 622 ? 4.257   7.252   -49.846 1.00 15.90 ? 622  THR A OG1   1 
ATOM   5124 C  CG2   . THR A 1 622 ? 2.006   6.925   -50.669 1.00 11.77 ? 622  THR A CG2   1 
ATOM   5125 N  N     . ASP A 1 623 ? 2.788   8.791   -53.663 1.00 13.52 ? 623  ASP A N     1 
ATOM   5126 C  CA    . ASP A 1 623 ? 1.827   9.228   -54.675 1.00 13.30 ? 623  ASP A CA    1 
ATOM   5127 C  C     . ASP A 1 623 ? 2.197   10.577  -55.301 1.00 15.53 ? 623  ASP A C     1 
ATOM   5128 O  O     . ASP A 1 623 ? 1.351   11.241  -55.896 1.00 14.15 ? 623  ASP A O     1 
ATOM   5129 C  CB    . ASP A 1 623 ? 0.438   9.351   -54.042 1.00 13.71 ? 623  ASP A CB    1 
ATOM   5130 C  CG    . ASP A 1 623 ? 0.335   10.531  -53.088 1.00 15.17 ? 623  ASP A CG    1 
ATOM   5131 O  OD1   . ASP A 1 623 ? -0.778  11.072  -52.939 1.00 19.14 ? 623  ASP A OD1   1 
ATOM   5132 O  OD2   . ASP A 1 623 ? 1.365   10.937  -52.493 1.00 18.42 ? 623  ASP A OD2   1 
ATOM   5133 N  N     . SER A 1 624 ? 3.451   10.986  -55.139 1.00 15.43 ? 624  SER A N     1 
ATOM   5134 C  CA    . SER A 1 624 ? 3.905   12.270  -55.648 1.00 16.82 ? 624  SER A CA    1 
ATOM   5135 C  C     . SER A 1 624 ? 5.089   12.063  -56.566 1.00 16.58 ? 624  SER A C     1 
ATOM   5136 O  O     . SER A 1 624 ? 5.849   11.112  -56.393 1.00 17.85 ? 624  SER A O     1 
ATOM   5137 C  CB    . SER A 1 624 ? 4.336   13.167  -54.495 1.00 17.97 ? 624  SER A CB    1 
ATOM   5138 O  OG    . SER A 1 624 ? 5.519   12.651  -53.901 1.00 20.58 ? 624  SER A OG    1 
ATOM   5139 N  N     . ILE A 1 625 ? 5.235   12.947  -57.547 1.00 14.25 ? 625  ILE A N     1 
ATOM   5140 C  CA    . ILE A 1 625 ? 6.435   12.970  -58.377 1.00 15.84 ? 625  ILE A CA    1 
ATOM   5141 C  C     . ILE A 1 625 ? 7.025   14.375  -58.395 1.00 15.53 ? 625  ILE A C     1 
ATOM   5142 O  O     . ILE A 1 625 ? 6.292   15.364  -58.384 1.00 14.54 ? 625  ILE A O     1 
ATOM   5143 C  CB    . ILE A 1 625 ? 6.173   12.499  -59.830 1.00 14.41 ? 625  ILE A CB    1 
ATOM   5144 C  CG1   . ILE A 1 625 ? 4.984   13.257  -60.443 1.00 12.88 ? 625  ILE A CG1   1 
ATOM   5145 C  CG2   . ILE A 1 625 ? 5.972   10.975  -59.880 1.00 13.69 ? 625  ILE A CG2   1 
ATOM   5146 C  CD1   . ILE A 1 625 ? 5.003   13.313  -61.969 1.00 16.42 ? 625  ILE A CD1   1 
ATOM   5147 N  N     . TYR A 1 626 ? 8.352   14.438  -58.406 1.00 13.93 ? 626  TYR A N     1 
ATOM   5148 C  CA    . TYR A 1 626 ? 9.078   15.690  -58.524 1.00 14.30 ? 626  TYR A CA    1 
ATOM   5149 C  C     . TYR A 1 626 ? 9.804   15.705  -59.852 1.00 13.30 ? 626  TYR A C     1 
ATOM   5150 O  O     . TYR A 1 626 ? 10.621  14.832  -60.130 1.00 13.16 ? 626  TYR A O     1 
ATOM   5151 C  CB    . TYR A 1 626 ? 10.033  15.864  -57.340 1.00 15.24 ? 626  TYR A CB    1 
ATOM   5152 C  CG    . TYR A 1 626 ? 9.258   16.121  -56.076 1.00 16.80 ? 626  TYR A CG    1 
ATOM   5153 C  CD1   . TYR A 1 626 ? 8.624   15.079  -55.399 1.00 15.84 ? 626  TYR A CD1   1 
ATOM   5154 C  CD2   . TYR A 1 626 ? 9.110   17.415  -55.586 1.00 18.45 ? 626  TYR A CD2   1 
ATOM   5155 C  CE1   . TYR A 1 626 ? 7.870   15.319  -54.248 1.00 16.62 ? 626  TYR A CE1   1 
ATOM   5156 C  CE2   . TYR A 1 626 ? 8.375   17.662  -54.437 1.00 20.63 ? 626  TYR A CE2   1 
ATOM   5157 C  CZ    . TYR A 1 626 ? 7.755   16.611  -53.779 1.00 21.41 ? 626  TYR A CZ    1 
ATOM   5158 O  OH    . TYR A 1 626 ? 7.023   16.868  -52.643 1.00 26.87 ? 626  TYR A OH    1 
ATOM   5159 N  N     . VAL A 1 627 ? 9.465   16.690  -60.680 1.00 12.42 ? 627  VAL A N     1 
ATOM   5160 C  CA    . VAL A 1 627 ? 9.946   16.751  -62.046 1.00 13.30 ? 627  VAL A CA    1 
ATOM   5161 C  C     . VAL A 1 627 ? 10.943  17.897  -62.177 1.00 14.49 ? 627  VAL A C     1 
ATOM   5162 O  O     . VAL A 1 627 ? 10.616  19.049  -61.870 1.00 12.62 ? 627  VAL A O     1 
ATOM   5163 C  CB    . VAL A 1 627 ? 8.774   16.968  -63.049 1.00 14.17 ? 627  VAL A CB    1 
ATOM   5164 C  CG1   . VAL A 1 627 ? 9.280   16.974  -64.479 1.00 14.98 ? 627  VAL A CG1   1 
ATOM   5165 C  CG2   . VAL A 1 627 ? 7.690   15.896  -62.865 1.00 14.85 ? 627  VAL A CG2   1 
ATOM   5166 N  N     . SER A 1 628 ? 12.156  17.570  -62.622 1.00 14.27 ? 628  SER A N     1 
ATOM   5167 C  CA    . SER A 1 628 ? 13.145  18.588  -62.978 1.00 14.20 ? 628  SER A CA    1 
ATOM   5168 C  C     . SER A 1 628 ? 12.673  19.338  -64.219 1.00 15.34 ? 628  SER A C     1 
ATOM   5169 O  O     . SER A 1 628 ? 12.435  18.737  -65.272 1.00 17.19 ? 628  SER A O     1 
ATOM   5170 C  CB    . SER A 1 628 ? 14.517  17.957  -63.212 1.00 13.43 ? 628  SER A CB    1 
ATOM   5171 O  OG    . SER A 1 628 ? 15.446  18.934  -63.650 1.00 15.23 ? 628  SER A OG    1 
ATOM   5172 N  N     . ALA A 1 629 ? 12.512  20.650  -64.081 1.00 16.59 ? 629  ALA A N     1 
ATOM   5173 C  CA    . ALA A 1 629 ? 11.991  21.481  -65.162 1.00 15.65 ? 629  ALA A CA    1 
ATOM   5174 C  C     . ALA A 1 629 ? 13.090  22.262  -65.880 1.00 14.74 ? 629  ALA A C     1 
ATOM   5175 O  O     . ALA A 1 629 ? 12.795  23.137  -66.695 1.00 13.66 ? 629  ALA A O     1 
ATOM   5176 C  CB    . ALA A 1 629 ? 10.920  22.426  -64.637 1.00 16.36 ? 629  ALA A CB    1 
ATOM   5177 N  N     . ASP A 1 630 ? 14.347  21.946  -65.574 1.00 15.09 ? 630  ASP A N     1 
ATOM   5178 C  CA    . ASP A 1 630 ? 15.503  22.581  -66.233 1.00 14.47 ? 630  ASP A CA    1 
ATOM   5179 C  C     . ASP A 1 630 ? 15.427  22.537  -67.756 1.00 13.56 ? 630  ASP A C     1 
ATOM   5180 O  O     . ASP A 1 630 ? 15.598  23.562  -68.418 1.00 12.40 ? 630  ASP A O     1 
ATOM   5181 C  CB    . ASP A 1 630 ? 16.808  21.928  -65.786 1.00 14.94 ? 630  ASP A CB    1 
ATOM   5182 C  CG    . ASP A 1 630 ? 17.133  22.183  -64.323 1.00 17.72 ? 630  ASP A CG    1 
ATOM   5183 O  OD1   . ASP A 1 630 ? 16.284  22.717  -63.567 1.00 17.92 ? 630  ASP A OD1   1 
ATOM   5184 O  OD2   . ASP A 1 630 ? 18.259  21.838  -63.930 1.00 18.69 ? 630  ASP A OD2   1 
ATOM   5185 N  N     . LYS A 1 631 ? 15.183  21.352  -68.310 1.00 14.22 ? 631  LYS A N     1 
ATOM   5186 C  CA    . LYS A 1 631 ? 15.125  21.188  -69.770 1.00 16.40 ? 631  LYS A CA    1 
ATOM   5187 C  C     . LYS A 1 631 ? 13.963  21.950  -70.408 1.00 15.91 ? 631  LYS A C     1 
ATOM   5188 O  O     . LYS A 1 631 ? 14.048  22.355  -71.566 1.00 16.13 ? 631  LYS A O     1 
ATOM   5189 C  CB    . LYS A 1 631 ? 15.074  19.707  -70.170 1.00 16.51 ? 631  LYS A CB    1 
ATOM   5190 C  CG    . LYS A 1 631 ? 16.323  18.916  -69.804 1.00 20.22 ? 631  LYS A CG    1 
ATOM   5191 C  CD    . LYS A 1 631 ? 17.504  19.276  -70.678 1.00 25.21 ? 631  LYS A CD    1 
ATOM   5192 C  CE    . LYS A 1 631 ? 18.808  18.704  -70.130 1.00 30.78 ? 631  LYS A CE    1 
ATOM   5193 N  NZ    . LYS A 1 631 ? 18.757  17.229  -69.902 1.00 35.02 ? 631  LYS A NZ    1 
ATOM   5194 N  N     . ILE A 1 632 ? 12.886  22.126  -69.644 1.00 16.31 ? 632  ILE A N     1 
ATOM   5195 C  CA    . ILE A 1 632 ? 11.701  22.858  -70.090 1.00 15.79 ? 632  ILE A CA    1 
ATOM   5196 C  C     . ILE A 1 632 ? 12.027  24.345  -70.170 1.00 15.93 ? 632  ILE A C     1 
ATOM   5197 O  O     . ILE A 1 632 ? 11.738  24.992  -71.180 1.00 17.20 ? 632  ILE A O     1 
ATOM   5198 C  CB    . ILE A 1 632 ? 10.479  22.609  -69.147 1.00 16.77 ? 632  ILE A CB    1 
ATOM   5199 C  CG1   . ILE A 1 632 ? 10.153  21.110  -69.069 1.00 16.66 ? 632  ILE A CG1   1 
ATOM   5200 C  CG2   . ILE A 1 632 ? 9.249   23.406  -69.606 1.00 15.17 ? 632  ILE A CG2   1 
ATOM   5201 C  CD1   . ILE A 1 632 ? 9.175   20.733  -67.949 1.00 18.60 ? 632  ILE A CD1   1 
ATOM   5202 N  N     . ILE A 1 633 ? 12.639  24.875  -69.110 1.00 15.75 ? 633  ILE A N     1 
ATOM   5203 C  CA    . ILE A 1 633 ? 13.107  26.265  -69.085 1.00 16.57 ? 633  ILE A CA    1 
ATOM   5204 C  C     . ILE A 1 633 ? 14.154  26.508  -70.183 1.00 17.29 ? 633  ILE A C     1 
ATOM   5205 O  O     . ILE A 1 633 ? 14.078  27.507  -70.903 1.00 18.53 ? 633  ILE A O     1 
ATOM   5206 C  CB    . ILE A 1 633 ? 13.682  26.666  -67.682 1.00 15.53 ? 633  ILE A CB    1 
ATOM   5207 C  CG1   . ILE A 1 633 ? 12.591  26.669  -66.595 1.00 16.62 ? 633  ILE A CG1   1 
ATOM   5208 C  CG2   . ILE A 1 633 ? 14.402  28.016  -67.737 1.00 16.84 ? 633  ILE A CG2   1 
ATOM   5209 C  CD1   . ILE A 1 633 ? 11.509  27.769  -66.734 1.00 14.06 ? 633  ILE A CD1   1 
ATOM   5210 N  N     . ASP A 1 634 ? 15.119  25.593  -70.314 1.00 17.58 ? 634  ASP A N     1 
ATOM   5211 C  CA    . ASP A 1 634 ? 16.198  25.730  -71.309 1.00 18.67 ? 634  ASP A CA    1 
ATOM   5212 C  C     . ASP A 1 634 ? 15.717  25.582  -72.750 1.00 19.49 ? 634  ASP A C     1 
ATOM   5213 O  O     . ASP A 1 634 ? 16.339  26.113  -73.673 1.00 18.09 ? 634  ASP A O     1 
ATOM   5214 C  CB    . ASP A 1 634 ? 17.320  24.722  -71.047 1.00 19.77 ? 634  ASP A CB    1 
ATOM   5215 C  CG    . ASP A 1 634 ? 18.071  24.996  -69.760 1.00 23.72 ? 634  ASP A CG    1 
ATOM   5216 O  OD1   . ASP A 1 634 ? 18.043  26.150  -69.273 1.00 26.63 ? 634  ASP A OD1   1 
ATOM   5217 O  OD2   . ASP A 1 634 ? 18.697  24.048  -69.238 1.00 27.67 ? 634  ASP A OD2   1 
ATOM   5218 N  N     . LYS A 1 635 ? 14.624  24.846  -72.942 1.00 19.12 ? 635  LYS A N     1 
ATOM   5219 C  CA    . LYS A 1 635 ? 14.051  24.662  -74.269 1.00 21.44 ? 635  LYS A CA    1 
ATOM   5220 C  C     . LYS A 1 635 ? 13.610  26.004  -74.841 1.00 22.12 ? 635  LYS A C     1 
ATOM   5221 O  O     . LYS A 1 635 ? 13.839  26.284  -76.017 1.00 21.12 ? 635  LYS A O     1 
ATOM   5222 C  CB    . LYS A 1 635 ? 12.862  23.698  -74.229 1.00 22.03 ? 635  LYS A CB    1 
ATOM   5223 C  CG    . LYS A 1 635 ? 12.966  22.524  -75.202 1.00 28.62 ? 635  LYS A CG    1 
ATOM   5224 C  CD    . LYS A 1 635 ? 13.091  22.965  -76.652 1.00 29.88 ? 635  LYS A CD    1 
ATOM   5225 C  CE    . LYS A 1 635 ? 13.983  22.020  -77.433 1.00 33.73 ? 635  LYS A CE    1 
ATOM   5226 N  NZ    . LYS A 1 635 ? 13.346  20.706  -77.695 1.00 36.91 ? 635  LYS A NZ    1 
ATOM   5227 N  N     . VAL A 1 636 ? 12.982  26.834  -74.011 1.00 22.78 ? 636  VAL A N     1 
ATOM   5228 C  CA    . VAL A 1 636 ? 12.571  28.164  -74.465 1.00 25.00 ? 636  VAL A CA    1 
ATOM   5229 C  C     . VAL A 1 636 ? 13.703  29.176  -74.326 1.00 25.27 ? 636  VAL A C     1 
ATOM   5230 O  O     . VAL A 1 636 ? 13.769  30.146  -75.080 1.00 25.90 ? 636  VAL A O     1 
ATOM   5231 C  CB    . VAL A 1 636 ? 11.278  28.683  -73.766 1.00 25.57 ? 636  VAL A CB    1 
ATOM   5232 C  CG1   . VAL A 1 636 ? 10.103  27.749  -74.036 1.00 26.01 ? 636  VAL A CG1   1 
ATOM   5233 C  CG2   . VAL A 1 636 ? 11.484  28.854  -72.288 1.00 27.61 ? 636  VAL A CG2   1 
ATOM   5234 N  N     . GLY A 1 637 ? 14.595  28.934  -73.369 1.00 23.79 ? 637  GLY A N     1 
ATOM   5235 C  CA    . GLY A 1 637 ? 15.707  29.836  -73.106 1.00 25.02 ? 637  GLY A CA    1 
ATOM   5236 C  C     . GLY A 1 637 ? 15.364  30.782  -71.978 1.00 24.53 ? 637  GLY A C     1 
ATOM   5237 O  O     . GLY A 1 637 ? 14.365  31.499  -72.042 1.00 25.05 ? 637  GLY A O     1 
ATOM   5238 N  N     . GLU A 1 638 ? 16.205  30.784  -70.949 1.00 24.25 ? 638  GLU A N     1 
ATOM   5239 C  CA    . GLU A 1 638 ? 15.965  31.558  -69.734 1.00 25.20 ? 638  GLU A CA    1 
ATOM   5240 C  C     . GLU A 1 638 ? 15.880  33.062  -69.990 1.00 24.38 ? 638  GLU A C     1 
ATOM   5241 O  O     . GLU A 1 638 ? 15.120  33.765  -69.326 1.00 22.49 ? 638  GLU A O     1 
ATOM   5242 C  CB    . GLU A 1 638 ? 17.047  31.253  -68.690 1.00 25.75 ? 638  GLU A CB    1 
ATOM   5243 C  CG    . GLU A 1 638 ? 16.570  31.371  -67.252 1.00 28.36 ? 638  GLU A CG    1 
ATOM   5244 C  CD    . GLU A 1 638 ? 17.662  31.085  -66.232 1.00 29.90 ? 638  GLU A CD    1 
ATOM   5245 O  OE1   . GLU A 1 638 ? 17.394  30.343  -65.267 1.00 31.81 ? 638  GLU A OE1   1 
ATOM   5246 O  OE2   . GLU A 1 638 ? 18.787  31.603  -66.386 1.00 34.53 ? 638  GLU A OE2   1 
ATOM   5247 N  N     . SER A 1 639 ? 16.652  33.541  -70.963 1.00 25.06 ? 639  SER A N     1 
ATOM   5248 C  CA    . SER A 1 639 ? 16.708  34.966  -71.299 1.00 26.31 ? 639  SER A CA    1 
ATOM   5249 C  C     . SER A 1 639 ? 15.378  35.529  -71.812 1.00 25.24 ? 639  SER A C     1 
ATOM   5250 O  O     . SER A 1 639 ? 15.186  36.743  -71.840 1.00 26.29 ? 639  SER A O     1 
ATOM   5251 C  CB    . SER A 1 639 ? 17.819  35.231  -72.321 1.00 26.72 ? 639  SER A CB    1 
ATOM   5252 O  OG    . SER A 1 639 ? 17.585  34.505  -73.517 1.00 29.14 ? 639  SER A OG    1 
ATOM   5253 N  N     . LYS A 1 640 ? 14.468  34.646  -72.212 1.00 25.02 ? 640  LYS A N     1 
ATOM   5254 C  CA    . LYS A 1 640 ? 13.147  35.055  -72.693 1.00 25.45 ? 640  LYS A CA    1 
ATOM   5255 C  C     . LYS A 1 640 ? 12.201  35.552  -71.591 1.00 23.23 ? 640  LYS A C     1 
ATOM   5256 O  O     . LYS A 1 640 ? 11.187  36.180  -71.890 1.00 22.52 ? 640  LYS A O     1 
ATOM   5257 C  CB    . LYS A 1 640 ? 12.491  33.922  -73.498 1.00 26.85 ? 640  LYS A CB    1 
ATOM   5258 C  CG    . LYS A 1 640 ? 12.287  34.217  -74.993 1.00 33.75 ? 640  LYS A CG    1 
ATOM   5259 C  CD    . LYS A 1 640 ? 13.594  34.397  -75.774 1.00 39.61 ? 640  LYS A CD    1 
ATOM   5260 C  CE    . LYS A 1 640 ? 14.208  33.065  -76.213 1.00 43.28 ? 640  LYS A CE    1 
ATOM   5261 N  NZ    . LYS A 1 640 ? 13.344  32.291  -77.158 1.00 42.16 ? 640  LYS A NZ    1 
ATOM   5262 N  N     . PHE A 1 641 ? 12.530  35.277  -70.326 1.00 20.85 ? 641  PHE A N     1 
ATOM   5263 C  CA    . PHE A 1 641 ? 11.648  35.646  -69.213 1.00 18.89 ? 641  PHE A CA    1 
ATOM   5264 C  C     . PHE A 1 641 ? 11.930  37.027  -68.627 1.00 19.78 ? 641  PHE A C     1 
ATOM   5265 O  O     . PHE A 1 641 ? 13.081  37.383  -68.381 1.00 20.14 ? 641  PHE A O     1 
ATOM   5266 C  CB    . PHE A 1 641 ? 11.672  34.566  -68.126 1.00 18.18 ? 641  PHE A CB    1 
ATOM   5267 C  CG    . PHE A 1 641 ? 11.217  33.225  -68.616 1.00 15.74 ? 641  PHE A CG    1 
ATOM   5268 C  CD1   . PHE A 1 641 ? 12.135  32.212  -68.861 1.00 14.03 ? 641  PHE A CD1   1 
ATOM   5269 C  CD2   . PHE A 1 641 ? 9.870   32.989  -68.874 1.00 14.61 ? 641  PHE A CD2   1 
ATOM   5270 C  CE1   . PHE A 1 641 ? 11.710  30.969  -69.329 1.00 16.56 ? 641  PHE A CE1   1 
ATOM   5271 C  CE2   . PHE A 1 641 ? 9.435   31.751  -69.346 1.00 13.85 ? 641  PHE A CE2   1 
ATOM   5272 C  CZ    . PHE A 1 641 ? 10.355  30.741  -69.574 1.00 14.03 ? 641  PHE A CZ    1 
ATOM   5273 N  N     . ARG A 1 642 ? 10.863  37.790  -68.400 1.00 20.49 ? 642  ARG A N     1 
ATOM   5274 C  CA    . ARG A 1 642 ? 10.963  39.174  -67.928 1.00 21.23 ? 642  ARG A CA    1 
ATOM   5275 C  C     . ARG A 1 642 ? 11.314  39.269  -66.447 1.00 19.97 ? 642  ARG A C     1 
ATOM   5276 O  O     . ARG A 1 642 ? 12.044  40.169  -66.026 1.00 18.16 ? 642  ARG A O     1 
ATOM   5277 C  CB    . ARG A 1 642 ? 9.651   39.914  -68.183 1.00 22.78 ? 642  ARG A CB    1 
ATOM   5278 C  CG    . ARG A 1 642 ? 9.358   40.185  -69.650 1.00 27.99 ? 642  ARG A CG    1 
ATOM   5279 C  CD    . ARG A 1 642 ? 7.970   40.785  -69.834 1.00 31.92 ? 642  ARG A CD    1 
ATOM   5280 N  NE    . ARG A 1 642 ? 6.939   39.757  -69.960 1.00 36.49 ? 642  ARG A NE    1 
ATOM   5281 C  CZ    . ARG A 1 642 ? 6.110   39.385  -68.988 1.00 38.42 ? 642  ARG A CZ    1 
ATOM   5282 N  NH1   . ARG A 1 642 ? 6.168   39.955  -67.791 1.00 40.40 ? 642  ARG A NH1   1 
ATOM   5283 N  NH2   . ARG A 1 642 ? 5.214   38.437  -69.216 1.00 38.17 ? 642  ARG A NH2   1 
ATOM   5284 N  N     . ASP A 1 643 ? 10.766  38.341  -65.669 1.00 18.52 ? 643  ASP A N     1 
ATOM   5285 C  CA    . ASP A 1 643 ? 10.964  38.284  -64.230 1.00 16.79 ? 643  ASP A CA    1 
ATOM   5286 C  C     . ASP A 1 643 ? 10.656  36.874  -63.735 1.00 16.51 ? 643  ASP A C     1 
ATOM   5287 O  O     . ASP A 1 643 ? 10.336  35.989  -64.535 1.00 17.20 ? 643  ASP A O     1 
ATOM   5288 C  CB    . ASP A 1 643 ? 10.100  39.336  -63.504 1.00 17.45 ? 643  ASP A CB    1 
ATOM   5289 C  CG    . ASP A 1 643 ? 8.637   39.329  -63.950 1.00 21.06 ? 643  ASP A CG    1 
ATOM   5290 O  OD1   . ASP A 1 643 ? 8.117   38.271  -64.365 1.00 20.12 ? 643  ASP A OD1   1 
ATOM   5291 O  OD2   . ASP A 1 643 ? 7.995   40.397  -63.863 1.00 23.06 ? 643  ASP A OD2   1 
ATOM   5292 N  N     . THR A 1 644 ? 10.748  36.666  -62.422 1.00 14.59 ? 644  THR A N     1 
ATOM   5293 C  CA    . THR A 1 644 ? 10.453  35.364  -61.830 1.00 13.14 ? 644  THR A CA    1 
ATOM   5294 C  C     . THR A 1 644 ? 9.015   34.923  -62.140 1.00 14.96 ? 644  THR A C     1 
ATOM   5295 O  O     . THR A 1 644 ? 8.787   33.798  -62.583 1.00 14.02 ? 644  THR A O     1 
ATOM   5296 C  CB    . THR A 1 644 ? 10.690  35.374  -60.306 1.00 12.88 ? 644  THR A CB    1 
ATOM   5297 O  OG1   . THR A 1 644 ? 12.063  35.696  -60.034 1.00 14.92 ? 644  THR A OG1   1 
ATOM   5298 C  CG2   . THR A 1 644 ? 10.358  34.012  -59.703 1.00 11.32 ? 644  THR A CG2   1 
ATOM   5299 N  N     . ASN A 1 645 ? 8.056   35.822  -61.922 1.00 14.95 ? 645  ASN A N     1 
ATOM   5300 C  CA    . ASN A 1 645 ? 6.640   35.505  -62.105 1.00 17.56 ? 645  ASN A CA    1 
ATOM   5301 C  C     . ASN A 1 645 ? 6.307   35.063  -63.537 1.00 16.79 ? 645  ASN A C     1 
ATOM   5302 O  O     . ASN A 1 645 ? 5.398   34.256  -63.749 1.00 16.71 ? 645  ASN A O     1 
ATOM   5303 C  CB    . ASN A 1 645 ? 5.758   36.692  -61.684 1.00 17.83 ? 645  ASN A CB    1 
ATOM   5304 C  CG    . ASN A 1 645 ? 4.355   36.262  -61.270 1.00 21.98 ? 645  ASN A CG    1 
ATOM   5305 O  OD1   . ASN A 1 645 ? 4.180   35.472  -60.337 1.00 25.65 ? 645  ASN A OD1   1 
ATOM   5306 N  ND2   . ASN A 1 645 ? 3.349   36.788  -61.956 1.00 19.29 ? 645  ASN A ND2   1 
ATOM   5307 N  N     . HIS A 1 646 ? 7.055   35.587  -64.507 1.00 15.71 ? 646  HIS A N     1 
ATOM   5308 C  CA    . HIS A 1 646 ? 6.915   35.177  -65.904 1.00 16.31 ? 646  HIS A CA    1 
ATOM   5309 C  C     . HIS A 1 646 ? 7.218   33.685  -66.111 1.00 15.41 ? 646  HIS A C     1 
ATOM   5310 O  O     . HIS A 1 646 ? 6.399   32.969  -66.696 1.00 14.02 ? 646  HIS A O     1 
ATOM   5311 C  CB    . HIS A 1 646 ? 7.767   36.062  -66.827 1.00 17.34 ? 646  HIS A CB    1 
ATOM   5312 C  CG    . HIS A 1 646 ? 7.514   35.848  -68.289 1.00 18.04 ? 646  HIS A CG    1 
ATOM   5313 N  ND1   . HIS A 1 646 ? 8.360   36.329  -69.265 1.00 20.86 ? 646  HIS A ND1   1 
ATOM   5314 C  CD2   . HIS A 1 646 ? 6.521   35.198  -68.943 1.00 18.72 ? 646  HIS A CD2   1 
ATOM   5315 C  CE1   . HIS A 1 646 ? 7.897   35.993  -70.455 1.00 19.59 ? 646  HIS A CE1   1 
ATOM   5316 N  NE2   . HIS A 1 646 ? 6.786   35.299  -70.288 1.00 17.96 ? 646  HIS A NE2   1 
ATOM   5317 N  N     . TRP A 1 647 ? 8.369   33.207  -65.631 1.00 14.17 ? 647  TRP A N     1 
ATOM   5318 C  CA    . TRP A 1 647 ? 8.660   31.773  -65.760 1.00 15.77 ? 647  TRP A CA    1 
ATOM   5319 C  C     . TRP A 1 647 ? 7.754   30.901  -64.894 1.00 14.48 ? 647  TRP A C     1 
ATOM   5320 O  O     . TRP A 1 647 ? 7.442   29.774  -65.272 1.00 19.87 ? 647  TRP A O     1 
ATOM   5321 C  CB    . TRP A 1 647 ? 10.161  31.428  -65.603 1.00 14.65 ? 647  TRP A CB    1 
ATOM   5322 C  CG    . TRP A 1 647 ? 10.770  31.554  -64.222 1.00 15.00 ? 647  TRP A CG    1 
ATOM   5323 C  CD1   . TRP A 1 647 ? 11.628  32.534  -63.797 1.00 13.12 ? 647  TRP A CD1   1 
ATOM   5324 C  CD2   . TRP A 1 647 ? 10.629  30.642  -63.116 1.00 13.73 ? 647  TRP A CD2   1 
ATOM   5325 N  NE1   . TRP A 1 647 ? 12.003  32.304  -62.494 1.00 13.52 ? 647  TRP A NE1   1 
ATOM   5326 C  CE2   . TRP A 1 647 ? 11.407  31.152  -62.052 1.00 11.18 ? 647  TRP A CE2   1 
ATOM   5327 C  CE3   . TRP A 1 647 ? 9.915   29.450  -62.920 1.00 13.53 ? 647  TRP A CE3   1 
ATOM   5328 C  CZ2   . TRP A 1 647 ? 11.488  30.515  -60.802 1.00 14.97 ? 647  TRP A CZ2   1 
ATOM   5329 C  CZ3   . TRP A 1 647 ? 9.995   28.814  -61.673 1.00 9.63  ? 647  TRP A CZ3   1 
ATOM   5330 C  CH2   . TRP A 1 647 ? 10.772  29.354  -60.632 1.00 10.68 ? 647  TRP A CH2   1 
ATOM   5331 N  N     . VAL A 1 648 ? 7.318   31.425  -63.751 1.00 14.05 ? 648  VAL A N     1 
ATOM   5332 C  CA    . VAL A 1 648 ? 6.347   30.722  -62.909 1.00 14.16 ? 648  VAL A CA    1 
ATOM   5333 C  C     . VAL A 1 648 ? 5.023   30.523  -63.667 1.00 14.71 ? 648  VAL A C     1 
ATOM   5334 O  O     . VAL A 1 648 ? 4.476   29.407  -63.694 1.00 13.27 ? 648  VAL A O     1 
ATOM   5335 C  CB    . VAL A 1 648 ? 6.124   31.446  -61.550 1.00 14.62 ? 648  VAL A CB    1 
ATOM   5336 C  CG1   . VAL A 1 648 ? 4.991   30.795  -60.763 1.00 15.14 ? 648  VAL A CG1   1 
ATOM   5337 C  CG2   . VAL A 1 648 ? 7.409   31.451  -60.725 1.00 14.45 ? 648  VAL A CG2   1 
ATOM   5338 N  N     . ASP A 1 649 ? 4.532   31.599  -64.291 1.00 13.81 ? 649  ASP A N     1 
ATOM   5339 C  CA    . ASP A 1 649 ? 3.332   31.552  -65.138 1.00 15.57 ? 649  ASP A CA    1 
ATOM   5340 C  C     . ASP A 1 649 ? 3.485   30.535  -66.269 1.00 15.89 ? 649  ASP A C     1 
ATOM   5341 O  O     . ASP A 1 649 ? 2.541   29.807  -66.591 1.00 15.30 ? 649  ASP A O     1 
ATOM   5342 C  CB    . ASP A 1 649 ? 3.043   32.930  -65.758 1.00 16.46 ? 649  ASP A CB    1 
ATOM   5343 C  CG    . ASP A 1 649 ? 2.293   33.870  -64.815 1.00 21.15 ? 649  ASP A CG    1 
ATOM   5344 O  OD1   . ASP A 1 649 ? 1.629   33.407  -63.864 1.00 23.33 ? 649  ASP A OD1   1 
ATOM   5345 O  OD2   . ASP A 1 649 ? 2.352   35.093  -65.045 1.00 22.50 ? 649  ASP A OD2   1 
ATOM   5346 N  N     . PHE A 1 650 ? 4.672   30.508  -66.875 1.00 16.66 ? 650  PHE A N     1 
ATOM   5347 C  CA    . PHE A 1 650 ? 4.957   29.614  -67.991 1.00 16.66 ? 650  PHE A CA    1 
ATOM   5348 C  C     . PHE A 1 650 ? 4.900   28.150  -67.563 1.00 16.24 ? 650  PHE A C     1 
ATOM   5349 O  O     . PHE A 1 650 ? 4.265   27.336  -68.233 1.00 15.36 ? 650  PHE A O     1 
ATOM   5350 C  CB    . PHE A 1 650 ? 6.320   29.930  -68.625 1.00 17.95 ? 650  PHE A CB    1 
ATOM   5351 C  CG    . PHE A 1 650 ? 6.797   28.870  -69.583 1.00 19.90 ? 650  PHE A CG    1 
ATOM   5352 C  CD1   . PHE A 1 650 ? 6.153   28.677  -70.811 1.00 22.00 ? 650  PHE A CD1   1 
ATOM   5353 C  CD2   . PHE A 1 650 ? 7.874   28.056  -69.256 1.00 20.83 ? 650  PHE A CD2   1 
ATOM   5354 C  CE1   . PHE A 1 650 ? 6.580   27.688  -71.692 1.00 24.05 ? 650  PHE A CE1   1 
ATOM   5355 C  CE2   . PHE A 1 650 ? 8.313   27.066  -70.132 1.00 24.02 ? 650  PHE A CE2   1 
ATOM   5356 C  CZ    . PHE A 1 650 ? 7.666   26.880  -71.352 1.00 24.33 ? 650  PHE A CZ    1 
ATOM   5357 N  N     . LEU A 1 651 ? 5.565   27.822  -66.455 1.00 13.69 ? 651  LEU A N     1 
ATOM   5358 C  CA    . LEU A 1 651 ? 5.521   26.461  -65.913 1.00 13.38 ? 651  LEU A CA    1 
ATOM   5359 C  C     . LEU A 1 651 ? 4.128   26.061  -65.424 1.00 13.51 ? 651  LEU A C     1 
ATOM   5360 O  O     . LEU A 1 651 ? 3.722   24.909  -65.596 1.00 12.77 ? 651  LEU A O     1 
ATOM   5361 C  CB    . LEU A 1 651 ? 6.555   26.267  -64.795 1.00 12.66 ? 651  LEU A CB    1 
ATOM   5362 C  CG    . LEU A 1 651 ? 8.032   26.345  -65.193 1.00 13.08 ? 651  LEU A CG    1 
ATOM   5363 C  CD1   . LEU A 1 651 ? 8.929   26.032  -63.998 1.00 12.08 ? 651  LEU A CD1   1 
ATOM   5364 C  CD2   . LEU A 1 651 ? 8.358   25.419  -66.363 1.00 13.33 ? 651  LEU A CD2   1 
ATOM   5365 N  N     . ASP A 1 652 ? 3.406   27.012  -64.826 1.00 13.72 ? 652  ASP A N     1 
ATOM   5366 C  CA    . ASP A 1 652 ? 2.023   26.780  -64.393 1.00 14.73 ? 652  ASP A CA    1 
ATOM   5367 C  C     . ASP A 1 652 ? 1.158   26.359  -65.578 1.00 14.55 ? 652  ASP A C     1 
ATOM   5368 O  O     . ASP A 1 652 ? 0.423   25.364  -65.513 1.00 13.96 ? 652  ASP A O     1 
ATOM   5369 C  CB    . ASP A 1 652 ? 1.428   28.029  -63.722 1.00 15.81 ? 652  ASP A CB    1 
ATOM   5370 C  CG    . ASP A 1 652 ? -0.061  27.877  -63.423 1.00 19.12 ? 652  ASP A CG    1 
ATOM   5371 O  OD1   . ASP A 1 652 ? -0.433  26.898  -62.749 1.00 20.19 ? 652  ASP A OD1   1 
ATOM   5372 O  OD2   . ASP A 1 652 ? -0.867  28.717  -63.889 1.00 24.29 ? 652  ASP A OD2   1 
ATOM   5373 N  N     . LYS A 1 653 ? 1.260   27.129  -66.658 1.00 16.25 ? 653  LYS A N     1 
ATOM   5374 C  CA    . LYS A 1 653 ? 0.524   26.856  -67.884 1.00 18.51 ? 653  LYS A CA    1 
ATOM   5375 C  C     . LYS A 1 653 ? 0.964   25.517  -68.482 1.00 16.76 ? 653  LYS A C     1 
ATOM   5376 O  O     . LYS A 1 653 ? 0.125   24.707  -68.876 1.00 16.95 ? 653  LYS A O     1 
ATOM   5377 C  CB    . LYS A 1 653 ? 0.727   28.006  -68.873 1.00 20.31 ? 653  LYS A CB    1 
ATOM   5378 C  CG    . LYS A 1 653 ? -0.356  28.142  -69.939 1.00 27.14 ? 653  LYS A CG    1 
ATOM   5379 C  CD    . LYS A 1 653 ? -0.166  29.435  -70.731 1.00 30.73 ? 653  LYS A CD    1 
ATOM   5380 C  CE    . LYS A 1 653 ? -0.953  29.429  -72.038 1.00 35.13 ? 653  LYS A CE    1 
ATOM   5381 N  NZ    . LYS A 1 653 ? -2.398  29.744  -71.843 1.00 38.27 ? 653  LYS A NZ    1 
ATOM   5382 N  N     . PHE A 1 654 ? 2.277   25.289  -68.530 1.00 15.89 ? 654  PHE A N     1 
ATOM   5383 C  CA    . PHE A 1 654 ? 2.841   24.038  -69.042 1.00 16.56 ? 654  PHE A CA    1 
ATOM   5384 C  C     . PHE A 1 654 ? 2.294   22.818  -68.283 1.00 17.26 ? 654  PHE A C     1 
ATOM   5385 O  O     . PHE A 1 654 ? 1.906   21.820  -68.896 1.00 17.73 ? 654  PHE A O     1 
ATOM   5386 C  CB    . PHE A 1 654 ? 4.377   24.066  -68.957 1.00 15.83 ? 654  PHE A CB    1 
ATOM   5387 C  CG    . PHE A 1 654 ? 5.053   22.959  -69.723 1.00 16.18 ? 654  PHE A CG    1 
ATOM   5388 C  CD1   . PHE A 1 654 ? 5.368   21.750  -69.101 1.00 16.49 ? 654  PHE A CD1   1 
ATOM   5389 C  CD2   . PHE A 1 654 ? 5.378   23.123  -71.067 1.00 14.17 ? 654  PHE A CD2   1 
ATOM   5390 C  CE1   . PHE A 1 654 ? 5.992   20.717  -69.812 1.00 15.85 ? 654  PHE A CE1   1 
ATOM   5391 C  CE2   . PHE A 1 654 ? 6.002   22.099  -71.784 1.00 17.05 ? 654  PHE A CE2   1 
ATOM   5392 C  CZ    . PHE A 1 654 ? 6.310   20.894  -71.156 1.00 15.84 ? 654  PHE A CZ    1 
ATOM   5393 N  N     . ALA A 1 655 ? 2.264   22.915  -66.953 1.00 17.25 ? 655  ALA A N     1 
ATOM   5394 C  CA    . ALA A 1 655 ? 1.783   21.831  -66.098 1.00 17.24 ? 655  ALA A CA    1 
ATOM   5395 C  C     . ALA A 1 655 ? 0.312   21.536  -66.361 1.00 18.81 ? 655  ALA A C     1 
ATOM   5396 O  O     . ALA A 1 655 ? -0.073  20.377  -66.541 1.00 19.86 ? 655  ALA A O     1 
ATOM   5397 C  CB    . ALA A 1 655 ? 2.003   22.171  -64.636 1.00 17.31 ? 655  ALA A CB    1 
ATOM   5398 N  N     . ARG A 1 656 ? -0.499  22.592  -66.412 1.00 18.80 ? 656  ARG A N     1 
ATOM   5399 C  CA    . ARG A 1 656 ? -1.951  22.446  -66.522 1.00 20.85 ? 656  ARG A CA    1 
ATOM   5400 C  C     . ARG A 1 656 ? -2.415  22.071  -67.927 1.00 20.68 ? 656  ARG A C     1 
ATOM   5401 O  O     . ARG A 1 656 ? -3.319  21.248  -68.081 1.00 21.24 ? 656  ARG A O     1 
ATOM   5402 C  CB    . ARG A 1 656 ? -2.663  23.720  -66.038 1.00 22.53 ? 656  ARG A CB    1 
ATOM   5403 C  CG    . ARG A 1 656 ? -4.192  23.730  -66.230 1.00 28.74 ? 656  ARG A CG    1 
ATOM   5404 C  CD    . ARG A 1 656 ? -4.850  24.992  -65.666 1.00 31.74 ? 656  ARG A CD    1 
ATOM   5405 N  NE    . ARG A 1 656 ? -4.296  26.210  -66.258 1.00 35.18 ? 656  ARG A NE    1 
ATOM   5406 C  CZ    . ARG A 1 656 ? -3.360  26.965  -65.687 1.00 34.76 ? 656  ARG A CZ    1 
ATOM   5407 N  NH1   . ARG A 1 656 ? -2.874  26.638  -64.496 1.00 33.34 ? 656  ARG A NH1   1 
ATOM   5408 N  NH2   . ARG A 1 656 ? -2.912  28.049  -66.308 1.00 33.97 ? 656  ARG A NH2   1 
ATOM   5409 N  N     . GLU A 1 657 ? -1.799  22.671  -68.943 1.00 19.00 ? 657  GLU A N     1 
ATOM   5410 C  CA    . GLU A 1 657 ? -2.279  22.526  -70.314 1.00 20.69 ? 657  GLU A CA    1 
ATOM   5411 C  C     . GLU A 1 657 ? -1.642  21.362  -71.066 1.00 18.99 ? 657  GLU A C     1 
ATOM   5412 O  O     . GLU A 1 657 ? -2.238  20.837  -71.998 1.00 18.07 ? 657  GLU A O     1 
ATOM   5413 C  CB    . GLU A 1 657 ? -2.083  23.825  -71.100 1.00 22.72 ? 657  GLU A CB    1 
ATOM   5414 C  CG    . GLU A 1 657 ? -2.956  24.978  -70.623 1.00 27.02 ? 657  GLU A CG    1 
ATOM   5415 C  CD    . GLU A 1 657 ? -2.883  26.190  -71.535 1.00 29.37 ? 657  GLU A CD    1 
ATOM   5416 O  OE1   . GLU A 1 657 ? -2.088  26.176  -72.500 1.00 32.33 ? 657  GLU A OE1   1 
ATOM   5417 O  OE2   . GLU A 1 657 ? -3.625  27.161  -71.286 1.00 31.45 ? 657  GLU A OE2   1 
ATOM   5418 N  N     . ARG A 1 658 ? -0.440  20.960  -70.663 1.00 16.91 ? 658  ARG A N     1 
ATOM   5419 C  CA    . ARG A 1 658 ? 0.284   19.918  -71.393 1.00 16.86 ? 658  ARG A CA    1 
ATOM   5420 C  C     . ARG A 1 658 ? 0.512   18.652  -70.569 1.00 17.01 ? 658  ARG A C     1 
ATOM   5421 O  O     . ARG A 1 658 ? 0.176   17.550  -71.009 1.00 17.64 ? 658  ARG A O     1 
ATOM   5422 C  CB    . ARG A 1 658 ? 1.619   20.449  -71.935 1.00 16.81 ? 658  ARG A CB    1 
ATOM   5423 C  CG    . ARG A 1 658 ? 1.532   21.780  -72.693 1.00 20.82 ? 658  ARG A CG    1 
ATOM   5424 C  CD    . ARG A 1 658 ? 0.653   21.695  -73.940 1.00 25.29 ? 658  ARG A CD    1 
ATOM   5425 N  NE    . ARG A 1 658 ? 0.615   22.974  -74.650 1.00 28.74 ? 658  ARG A NE    1 
ATOM   5426 C  CZ    . ARG A 1 658 ? 0.258   23.124  -75.924 1.00 32.26 ? 658  ARG A CZ    1 
ATOM   5427 N  NH1   . ARG A 1 658 ? -0.101  22.075  -76.656 1.00 32.92 ? 658  ARG A NH1   1 
ATOM   5428 N  NH2   . ARG A 1 658 ? 0.266   24.334  -76.472 1.00 34.18 ? 658  ARG A NH2   1 
ATOM   5429 N  N     . MET A 1 659 ? 1.069   18.815  -69.373 1.00 15.25 ? 659  MET A N     1 
ATOM   5430 C  CA    . MET A 1 659 ? 1.442   17.675  -68.544 1.00 15.34 ? 659  MET A CA    1 
ATOM   5431 C  C     . MET A 1 659 ? 0.254   16.961  -67.904 1.00 15.03 ? 659  MET A C     1 
ATOM   5432 O  O     . MET A 1 659 ? 0.148   15.739  -67.993 1.00 13.94 ? 659  MET A O     1 
ATOM   5433 C  CB    . MET A 1 659 ? 2.455   18.096  -67.483 1.00 16.06 ? 659  MET A CB    1 
ATOM   5434 C  CG    . MET A 1 659 ? 3.827   18.383  -68.062 1.00 16.59 ? 659  MET A CG    1 
ATOM   5435 S  SD    . MET A 1 659 ? 5.034   18.733  -66.785 1.00 18.93 ? 659  MET A SD    1 
ATOM   5436 C  CE    . MET A 1 659 ? 5.240   17.109  -66.041 1.00 14.42 ? 659  MET A CE    1 
ATOM   5437 N  N     . GLU A 1 660 ? -0.636  17.716  -67.267 1.00 14.39 ? 660  GLU A N     1 
ATOM   5438 C  CA    . GLU A 1 660 ? -1.817  17.108  -66.646 1.00 17.16 ? 660  GLU A CA    1 
ATOM   5439 C  C     . GLU A 1 660 ? -2.694  16.296  -67.619 1.00 16.24 ? 660  GLU A C     1 
ATOM   5440 O  O     . GLU A 1 660 ? -3.107  15.190  -67.273 1.00 19.09 ? 660  GLU A O     1 
ATOM   5441 C  CB    . GLU A 1 660 ? -2.630  18.136  -65.846 1.00 16.35 ? 660  GLU A CB    1 
ATOM   5442 C  CG    . GLU A 1 660 ? -1.978  18.488  -64.499 1.00 20.13 ? 660  GLU A CG    1 
ATOM   5443 C  CD    . GLU A 1 660 ? -2.738  19.550  -63.712 1.00 22.21 ? 660  GLU A CD    1 
ATOM   5444 O  OE1   . GLU A 1 660 ? -3.864  19.897  -64.109 1.00 21.60 ? 660  GLU A OE1   1 
ATOM   5445 O  OE2   . GLU A 1 660 ? -2.207  20.032  -62.687 1.00 25.08 ? 660  GLU A OE2   1 
ATOM   5446 N  N     . PRO A 1 661 ? -2.966  16.816  -68.837 1.00 16.40 ? 661  PRO A N     1 
ATOM   5447 C  CA    . PRO A 1 661 ? -3.678  15.959  -69.789 1.00 15.41 ? 661  PRO A CA    1 
ATOM   5448 C  C     . PRO A 1 661 ? -2.938  14.651  -70.115 1.00 15.32 ? 661  PRO A C     1 
ATOM   5449 O  O     . PRO A 1 661 ? -3.575  13.600  -70.243 1.00 15.44 ? 661  PRO A O     1 
ATOM   5450 C  CB    . PRO A 1 661 ? -3.800  16.846  -71.032 1.00 16.79 ? 661  PRO A CB    1 
ATOM   5451 C  CG    . PRO A 1 661 ? -3.824  18.229  -70.482 1.00 17.94 ? 661  PRO A CG    1 
ATOM   5452 C  CD    . PRO A 1 661 ? -2.814  18.186  -69.364 1.00 15.59 ? 661  PRO A CD    1 
ATOM   5453 N  N     . ALA A 1 662 ? -1.614  14.714  -70.245 1.00 13.52 ? 662  ALA A N     1 
ATOM   5454 C  CA    . ALA A 1 662 ? -0.814  13.513  -70.495 1.00 13.46 ? 662  ALA A CA    1 
ATOM   5455 C  C     . ALA A 1 662 ? -0.853  12.556  -69.302 1.00 13.33 ? 662  ALA A C     1 
ATOM   5456 O  O     . ALA A 1 662 ? -0.962  11.341  -69.480 1.00 14.00 ? 662  ALA A O     1 
ATOM   5457 C  CB    . ALA A 1 662 ? 0.620   13.879  -70.846 1.00 13.16 ? 662  ALA A CB    1 
ATOM   5458 N  N     . ILE A 1 663 ? -0.777  13.116  -68.096 1.00 11.35 ? 663  ILE A N     1 
ATOM   5459 C  CA    . ILE A 1 663 ? -0.877  12.335  -66.856 1.00 12.65 ? 663  ILE A CA    1 
ATOM   5460 C  C     . ILE A 1 663 ? -2.244  11.652  -66.774 1.00 14.07 ? 663  ILE A C     1 
ATOM   5461 O  O     . ILE A 1 663 ? -2.330  10.450  -66.494 1.00 14.34 ? 663  ILE A O     1 
ATOM   5462 C  CB    . ILE A 1 663 ? -0.578  13.206  -65.603 1.00 12.17 ? 663  ILE A CB    1 
ATOM   5463 C  CG1   . ILE A 1 663 ? 0.924   13.526  -65.547 1.00 10.44 ? 663  ILE A CG1   1 
ATOM   5464 C  CG2   . ILE A 1 663 ? -1.037  12.494  -64.304 1.00 10.43 ? 663  ILE A CG2   1 
ATOM   5465 C  CD1   . ILE A 1 663 ? 1.310   14.673  -64.608 1.00 13.28 ? 663  ILE A CD1   1 
ATOM   5466 N  N     . ASP A 1 664 ? -3.298  12.419  -67.049 1.00 14.17 ? 664  ASP A N     1 
ATOM   5467 C  CA    . ASP A 1 664 ? -4.663  11.889  -67.116 1.00 15.00 ? 664  ASP A CA    1 
ATOM   5468 C  C     . ASP A 1 664 ? -4.785  10.738  -68.112 1.00 14.67 ? 664  ASP A C     1 
ATOM   5469 O  O     . ASP A 1 664 ? -5.351  9.695   -67.787 1.00 13.52 ? 664  ASP A O     1 
ATOM   5470 C  CB    . ASP A 1 664 ? -5.658  12.998  -67.469 1.00 18.76 ? 664  ASP A CB    1 
ATOM   5471 C  CG    . ASP A 1 664 ? -5.778  14.057  -66.377 1.00 23.14 ? 664  ASP A CG    1 
ATOM   5472 O  OD1   . ASP A 1 664 ? -6.364  15.122  -66.655 1.00 28.87 ? 664  ASP A OD1   1 
ATOM   5473 O  OD2   . ASP A 1 664 ? -5.292  13.837  -65.247 1.00 27.00 ? 664  ASP A OD2   1 
ATOM   5474 N  N     . ARG A 1 665 ? -4.244  10.921  -69.316 1.00 15.10 ? 665  ARG A N     1 
ATOM   5475 C  CA    . ARG A 1 665 ? -4.245  9.857   -70.329 1.00 16.63 ? 665  ARG A CA    1 
ATOM   5476 C  C     . ARG A 1 665 ? -3.534  8.603   -69.817 1.00 15.94 ? 665  ARG A C     1 
ATOM   5477 O  O     . ARG A 1 665 ? -4.015  7.480   -70.005 1.00 15.92 ? 665  ARG A O     1 
ATOM   5478 C  CB    . ARG A 1 665 ? -3.596  10.332  -71.635 1.00 17.62 ? 665  ARG A CB    1 
ATOM   5479 C  CG    . ARG A 1 665 ? -4.530  11.122  -72.551 1.00 23.81 ? 665  ARG A CG    1 
ATOM   5480 C  CD    . ARG A 1 665 ? -3.927  11.324  -73.952 1.00 22.54 ? 665  ARG A CD    1 
ATOM   5481 N  NE    . ARG A 1 665 ? -2.671  12.080  -73.934 1.00 23.95 ? 665  ARG A NE    1 
ATOM   5482 C  CZ    . ARG A 1 665 ? -2.584  13.408  -73.843 1.00 24.90 ? 665  ARG A CZ    1 
ATOM   5483 N  NH1   . ARG A 1 665 ? -3.681  14.157  -73.763 1.00 28.94 ? 665  ARG A NH1   1 
ATOM   5484 N  NH2   . ARG A 1 665 ? -1.396  13.994  -73.836 1.00 17.86 ? 665  ARG A NH2   1 
ATOM   5485 N  N     . GLY A 1 666 ? -2.389  8.807   -69.172 1.00 15.17 ? 666  GLY A N     1 
ATOM   5486 C  CA    . GLY A 1 666 ? -1.612  7.714   -68.591 1.00 15.23 ? 666  GLY A CA    1 
ATOM   5487 C  C     . GLY A 1 666 ? -2.391  6.904   -67.570 1.00 15.79 ? 666  GLY A C     1 
ATOM   5488 O  O     . GLY A 1 666 ? -2.374  5.671   -67.610 1.00 14.99 ? 666  GLY A O     1 
ATOM   5489 N  N     . PHE A 1 667 ? -3.089  7.595   -66.669 1.00 13.84 ? 667  PHE A N     1 
ATOM   5490 C  CA    . PHE A 1 667 ? -3.869  6.922   -65.624 1.00 14.69 ? 667  PHE A CA    1 
ATOM   5491 C  C     . PHE A 1 667 ? -5.159  6.266   -66.127 1.00 14.73 ? 667  PHE A C     1 
ATOM   5492 O  O     . PHE A 1 667 ? -5.588  5.239   -65.585 1.00 13.66 ? 667  PHE A O     1 
ATOM   5493 C  CB    . PHE A 1 667 ? -4.136  7.862   -64.437 1.00 14.40 ? 667  PHE A CB    1 
ATOM   5494 C  CG    . PHE A 1 667 ? -2.994  7.931   -63.440 1.00 14.77 ? 667  PHE A CG    1 
ATOM   5495 C  CD1   . PHE A 1 667 ? -2.476  6.768   -62.874 1.00 12.59 ? 667  PHE A CD1   1 
ATOM   5496 C  CD2   . PHE A 1 667 ? -2.467  9.154   -63.042 1.00 11.28 ? 667  PHE A CD2   1 
ATOM   5497 C  CE1   . PHE A 1 667 ? -1.438  6.821   -61.951 1.00 11.04 ? 667  PHE A CE1   1 
ATOM   5498 C  CE2   . PHE A 1 667 ? -1.431  9.219   -62.113 1.00 12.45 ? 667  PHE A CE2   1 
ATOM   5499 C  CZ    . PHE A 1 667 ? -0.918  8.050   -61.561 1.00 12.60 ? 667  PHE A CZ    1 
ATOM   5500 N  N     . ARG A 1 668 ? -5.779  6.847   -67.154 1.00 14.76 ? 668  ARG A N     1 
ATOM   5501 C  CA    A ARG A 1 668 ? -6.945  6.230   -67.789 0.50 15.92 ? 668  ARG A CA    1 
ATOM   5502 C  CA    B ARG A 1 668 ? -6.947  6.219   -67.770 0.50 15.91 ? 668  ARG A CA    1 
ATOM   5503 C  C     . ARG A 1 668 ? -6.579  4.875   -68.394 1.00 15.62 ? 668  ARG A C     1 
ATOM   5504 O  O     . ARG A 1 668 ? -7.369  3.922   -68.347 1.00 16.02 ? 668  ARG A O     1 
ATOM   5505 C  CB    A ARG A 1 668 ? -7.547  7.156   -68.852 0.50 16.35 ? 668  ARG A CB    1 
ATOM   5506 C  CB    B ARG A 1 668 ? -7.601  7.143   -68.796 0.50 16.27 ? 668  ARG A CB    1 
ATOM   5507 C  CG    A ARG A 1 668 ? -8.325  8.327   -68.271 0.50 19.57 ? 668  ARG A CG    1 
ATOM   5508 C  CG    B ARG A 1 668 ? -8.636  8.076   -68.191 0.50 19.52 ? 668  ARG A CG    1 
ATOM   5509 C  CD    A ARG A 1 668 ? -9.324  8.901   -69.266 0.50 22.47 ? 668  ARG A CD    1 
ATOM   5510 C  CD    B ARG A 1 668 ? -9.443  8.772   -69.269 0.50 21.34 ? 668  ARG A CD    1 
ATOM   5511 N  NE    A ARG A 1 668 ? -10.472 9.484   -68.577 0.50 25.18 ? 668  ARG A NE    1 
ATOM   5512 N  NE    B ARG A 1 668 ? -8.601  9.629   -70.093 0.50 22.42 ? 668  ARG A NE    1 
ATOM   5513 C  CZ    A ARG A 1 668 ? -11.537 8.787   -68.189 0.50 24.77 ? 668  ARG A CZ    1 
ATOM   5514 C  CZ    B ARG A 1 668 ? -8.326  10.897  -69.811 0.50 23.06 ? 668  ARG A CZ    1 
ATOM   5515 N  NH1   A ARG A 1 668 ? -11.600 7.483   -68.423 0.50 25.45 ? 668  ARG A NH1   1 
ATOM   5516 N  NH1   B ARG A 1 668 ? -8.828  11.463  -68.720 0.50 25.61 ? 668  ARG A NH1   1 
ATOM   5517 N  NH2   A ARG A 1 668 ? -12.536 9.388   -67.563 0.50 25.13 ? 668  ARG A NH2   1 
ATOM   5518 N  NH2   B ARG A 1 668 ? -7.552  11.597  -70.620 0.50 19.27 ? 668  ARG A NH2   1 
ATOM   5519 N  N     . GLU A 1 669 ? -5.376  4.797   -68.958 1.00 14.49 ? 669  GLU A N     1 
ATOM   5520 C  CA    . GLU A 1 669 ? -4.857  3.548   -69.530 1.00 16.39 ? 669  GLU A CA    1 
ATOM   5521 C  C     . GLU A 1 669 ? -4.602  2.501   -68.437 1.00 15.62 ? 669  GLU A C     1 
ATOM   5522 O  O     . GLU A 1 669 ? -4.879  1.308   -68.622 1.00 14.44 ? 669  GLU A O     1 
ATOM   5523 C  CB    . GLU A 1 669 ? -3.570  3.815   -70.315 1.00 16.75 ? 669  GLU A CB    1 
ATOM   5524 C  CG    . GLU A 1 669 ? -2.948  2.580   -70.946 1.00 20.18 ? 669  GLU A CG    1 
ATOM   5525 C  CD    . GLU A 1 669 ? -1.684  2.895   -71.720 1.00 23.54 ? 669  GLU A CD    1 
ATOM   5526 O  OE1   . GLU A 1 669 ? -1.753  3.665   -72.703 1.00 27.59 ? 669  GLU A OE1   1 
ATOM   5527 O  OE2   . GLU A 1 669 ? -0.622  2.363   -71.356 1.00 24.37 ? 669  GLU A OE2   1 
ATOM   5528 N  N     . MET A 1 670 ? -4.058  2.959   -67.311 1.00 13.52 ? 670  MET A N     1 
ATOM   5529 C  CA    . MET A 1 670 ? -3.826  2.099   -66.150 1.00 15.08 ? 670  MET A CA    1 
ATOM   5530 C  C     . MET A 1 670 ? -5.142  1.551   -65.601 1.00 14.44 ? 670  MET A C     1 
ATOM   5531 O  O     . MET A 1 670 ? -5.222  0.387   -65.219 1.00 14.29 ? 670  MET A O     1 
ATOM   5532 C  CB    . MET A 1 670 ? -3.085  2.866   -65.054 1.00 14.55 ? 670  MET A CB    1 
ATOM   5533 C  CG    . MET A 1 670 ? -2.429  1.962   -64.010 1.00 14.78 ? 670  MET A CG    1 
ATOM   5534 S  SD    . MET A 1 670 ? -1.693  2.873   -62.645 1.00 15.54 ? 670  MET A SD    1 
ATOM   5535 C  CE    . MET A 1 670 ? -3.119  3.224   -61.615 1.00 13.37 ? 670  MET A CE    1 
ATOM   5536 N  N     . CYS A 1 671 ? -6.161  2.405   -65.568 1.00 15.12 ? 671  CYS A N     1 
ATOM   5537 C  CA    . CYS A 1 671 ? -7.506  2.023   -65.135 1.00 15.02 ? 671  CYS A CA    1 
ATOM   5538 C  C     . CYS A 1 671 ? -8.101  0.923   -66.020 1.00 15.14 ? 671  CYS A C     1 
ATOM   5539 O  O     . CYS A 1 671 ? -8.678  -0.047  -65.517 1.00 12.41 ? 671  CYS A O     1 
ATOM   5540 C  CB    . CYS A 1 671 ? -8.423  3.251   -65.126 1.00 15.87 ? 671  CYS A CB    1 
ATOM   5541 S  SG    . CYS A 1 671 ? -10.100 2.932   -64.537 1.00 17.06 ? 671  CYS A SG    1 
ATOM   5542 N  N     . GLU A 1 672 ? -7.960  1.059   -67.335 1.00 16.59 ? 672  GLU A N     1 
ATOM   5543 C  CA    . GLU A 1 672 ? -8.460  0.003   -68.222 1.00 18.28 ? 672  GLU A CA    1 
ATOM   5544 C  C     . GLU A 1 672 ? -7.610  -1.272  -68.134 1.00 16.59 ? 672  GLU A C     1 
ATOM   5545 O  O     . GLU A 1 672 ? -8.141  -2.375  -68.234 1.00 14.97 ? 672  GLU A O     1 
ATOM   5546 C  CB    . GLU A 1 672 ? -8.688  0.487   -69.663 1.00 21.86 ? 672  GLU A CB    1 
ATOM   5547 C  CG    . GLU A 1 672 ? -7.528  1.191   -70.330 1.00 31.08 ? 672  GLU A CG    1 
ATOM   5548 C  CD    . GLU A 1 672 ? -7.844  1.629   -71.759 1.00 38.26 ? 672  GLU A CD    1 
ATOM   5549 O  OE1   . GLU A 1 672 ? -8.983  2.091   -72.005 1.00 40.59 ? 672  GLU A OE1   1 
ATOM   5550 O  OE2   . GLU A 1 672 ? -6.949  1.520   -72.635 1.00 39.39 ? 672  GLU A OE2   1 
ATOM   5551 N  N     . TYR A 1 673 ? -6.309  -1.109  -67.895 1.00 13.98 ? 673  TYR A N     1 
ATOM   5552 C  CA    . TYR A 1 673 ? -5.396  -2.236  -67.665 1.00 13.75 ? 673  TYR A CA    1 
ATOM   5553 C  C     . TYR A 1 673 ? -5.856  -3.103  -66.481 1.00 13.95 ? 673  TYR A C     1 
ATOM   5554 O  O     . TYR A 1 673 ? -5.926  -4.334  -66.588 1.00 12.02 ? 673  TYR A O     1 
ATOM   5555 C  CB    . TYR A 1 673 ? -3.974  -1.701  -67.450 1.00 12.19 ? 673  TYR A CB    1 
ATOM   5556 C  CG    . TYR A 1 673 ? -2.847  -2.717  -67.449 1.00 15.10 ? 673  TYR A CG    1 
ATOM   5557 C  CD1   . TYR A 1 673 ? -2.950  -3.930  -68.141 1.00 17.67 ? 673  TYR A CD1   1 
ATOM   5558 C  CD2   . TYR A 1 673 ? -1.645  -2.435  -66.797 1.00 14.94 ? 673  TYR A CD2   1 
ATOM   5559 C  CE1   . TYR A 1 673 ? -1.899  -4.849  -68.144 1.00 16.54 ? 673  TYR A CE1   1 
ATOM   5560 C  CE2   . TYR A 1 673 ? -0.586  -3.343  -66.801 1.00 16.42 ? 673  TYR A CE2   1 
ATOM   5561 C  CZ    . TYR A 1 673 ? -0.719  -4.548  -67.480 1.00 17.45 ? 673  TYR A CZ    1 
ATOM   5562 O  OH    . TYR A 1 673 ? 0.326   -5.448  -67.484 1.00 16.98 ? 673  TYR A OH    1 
ATOM   5563 N  N     . MET A 1 674 ? -6.203  -2.447  -65.375 1.00 10.51 ? 674  MET A N     1 
ATOM   5564 C  CA    . MET A 1 674 ? -6.694  -3.122  -64.173 1.00 12.40 ? 674  MET A CA    1 
ATOM   5565 C  C     . MET A 1 674 ? -8.202  -3.356  -64.219 1.00 12.17 ? 674  MET A C     1 
ATOM   5566 O  O     . MET A 1 674 ? -8.775  -3.926  -63.283 1.00 13.59 ? 674  MET A O     1 
ATOM   5567 C  CB    . MET A 1 674 ? -6.350  -2.306  -62.919 1.00 11.12 ? 674  MET A CB    1 
ATOM   5568 C  CG    . MET A 1 674 ? -4.866  -2.255  -62.555 1.00 11.60 ? 674  MET A CG    1 
ATOM   5569 S  SD    . MET A 1 674 ? -4.122  -3.862  -62.184 1.00 15.16 ? 674  MET A SD    1 
ATOM   5570 C  CE    . MET A 1 674 ? -3.127  -4.093  -63.661 1.00 15.10 ? 674  MET A CE    1 
ATOM   5571 N  N     . ASN A 1 675 ? -8.835  -2.896  -65.301 1.00 12.16 ? 675  ASN A N     1 
ATOM   5572 C  CA    . ASN A 1 675 ? -10.287 -3.013  -65.512 1.00 13.29 ? 675  ASN A CA    1 
ATOM   5573 C  C     . ASN A 1 675 ? -11.096 -2.471  -64.325 1.00 12.50 ? 675  ASN A C     1 
ATOM   5574 O  O     . ASN A 1 675 ? -12.050 -3.104  -63.870 1.00 11.66 ? 675  ASN A O     1 
ATOM   5575 C  CB    . ASN A 1 675 ? -10.667 -4.471  -65.825 1.00 12.70 ? 675  ASN A CB    1 
ATOM   5576 C  CG    . ASN A 1 675 ? -12.089 -4.611  -66.363 1.00 14.60 ? 675  ASN A CG    1 
ATOM   5577 O  OD1   . ASN A 1 675 ? -12.601 -3.714  -67.026 1.00 11.54 ? 675  ASN A OD1   1 
ATOM   5578 N  ND2   . ASN A 1 675 ? -12.729 -5.742  -66.069 1.00 13.66 ? 675  ASN A ND2   1 
ATOM   5579 N  N     . ASN A 1 676 ? -10.702 -1.301  -63.824 1.00 13.44 ? 676  ASN A N     1 
ATOM   5580 C  CA    . ASN A 1 676 ? -11.246 -0.782  -62.566 1.00 12.71 ? 676  ASN A CA    1 
ATOM   5581 C  C     . ASN A 1 676 ? -12.657 -0.220  -62.728 1.00 14.44 ? 676  ASN A C     1 
ATOM   5582 O  O     . ASN A 1 676 ? -13.102 0.070   -63.849 1.00 12.94 ? 676  ASN A O     1 
ATOM   5583 C  CB    . ASN A 1 676 ? -10.316 0.268   -61.945 1.00 14.04 ? 676  ASN A CB    1 
ATOM   5584 C  CG    . ASN A 1 676 ? -9.009  -0.320  -61.419 1.00 13.96 ? 676  ASN A CG    1 
ATOM   5585 O  OD1   . ASN A 1 676 ? -7.959  0.298   -61.552 1.00 13.00 ? 676  ASN A OD1   1 
ATOM   5586 N  ND2   . ASN A 1 676 ? -9.071  -1.505  -60.810 1.00 9.94  ? 676  ASN A ND2   1 
ATOM   5587 N  N     . LYS A 1 677 ? -13.354 -0.077  -61.604 1.00 13.53 ? 677  LYS A N     1 
ATOM   5588 C  CA    . LYS A 1 677 ? -14.753 0.356   -61.605 1.00 14.32 ? 677  LYS A CA    1 
ATOM   5589 C  C     . LYS A 1 677 ? -14.885 1.803   -62.092 1.00 14.70 ? 677  LYS A C     1 
ATOM   5590 O  O     . LYS A 1 677 ? -15.734 2.103   -62.936 1.00 14.69 ? 677  LYS A O     1 
ATOM   5591 C  CB    . LYS A 1 677 ? -15.371 0.170   -60.209 1.00 14.23 ? 677  LYS A CB    1 
ATOM   5592 C  CG    . LYS A 1 677 ? -16.869 0.436   -60.112 1.00 16.65 ? 677  LYS A CG    1 
ATOM   5593 C  CD    . LYS A 1 677 ? -17.400 0.103   -58.717 1.00 16.93 ? 677  LYS A CD    1 
ATOM   5594 C  CE    . LYS A 1 677 ? -18.908 0.291   -58.600 1.00 23.13 ? 677  LYS A CE    1 
ATOM   5595 N  NZ    . LYS A 1 677 ? -19.331 1.699   -58.822 1.00 27.05 ? 677  LYS A NZ    1 
ATOM   5596 N  N     . GLN A 1 678 ? -14.030 2.684   -61.578 1.00 13.01 ? 678  GLN A N     1 
ATOM   5597 C  CA    . GLN A 1 678 ? -14.104 4.110   -61.885 1.00 16.02 ? 678  GLN A CA    1 
ATOM   5598 C  C     . GLN A 1 678 ? -12.710 4.734   -61.860 1.00 15.73 ? 678  GLN A C     1 
ATOM   5599 O  O     . GLN A 1 678 ? -11.953 4.514   -60.923 1.00 16.50 ? 678  GLN A O     1 
ATOM   5600 C  CB    . GLN A 1 678 ? -15.015 4.808   -60.863 1.00 16.49 ? 678  GLN A CB    1 
ATOM   5601 C  CG    . GLN A 1 678 ? -15.155 6.321   -61.033 1.00 20.48 ? 678  GLN A CG    1 
ATOM   5602 C  CD    . GLN A 1 678 ? -16.146 6.942   -60.056 1.00 21.50 ? 678  GLN A CD    1 
ATOM   5603 O  OE1   . GLN A 1 678 ? -16.487 6.351   -59.030 1.00 21.19 ? 678  GLN A OE1   1 
ATOM   5604 N  NE2   . GLN A 1 678 ? -16.610 8.146   -60.374 1.00 24.73 ? 678  GLN A NE2   1 
ATOM   5605 N  N     . HIS A 1 679 ? -12.375 5.512   -62.886 1.00 13.55 ? 679  HIS A N     1 
ATOM   5606 C  CA    . HIS A 1 679 ? -11.104 6.232   -62.908 1.00 14.01 ? 679  HIS A CA    1 
ATOM   5607 C  C     . HIS A 1 679 ? -11.116 7.385   -61.899 1.00 12.81 ? 679  HIS A C     1 
ATOM   5608 O  O     . HIS A 1 679 ? -11.889 8.339   -62.037 1.00 13.87 ? 679  HIS A O     1 
ATOM   5609 C  CB    . HIS A 1 679 ? -10.787 6.731   -64.327 1.00 14.65 ? 679  HIS A CB    1 
ATOM   5610 C  CG    . HIS A 1 679 ? -9.733  7.796   -64.375 1.00 14.98 ? 679  HIS A CG    1 
ATOM   5611 N  ND1   . HIS A 1 679 ? -8.467  7.618   -63.858 1.00 14.69 ? 679  HIS A ND1   1 
ATOM   5612 C  CD2   . HIS A 1 679 ? -9.762  9.055   -64.878 1.00 16.73 ? 679  HIS A CD2   1 
ATOM   5613 C  CE1   . HIS A 1 679 ? -7.760  8.720   -64.041 1.00 18.13 ? 679  HIS A CE1   1 
ATOM   5614 N  NE2   . HIS A 1 679 ? -8.522  9.607   -64.659 1.00 19.19 ? 679  HIS A NE2   1 
ATOM   5615 N  N     . LEU A 1 680 ? -10.266 7.283   -60.877 1.00 11.72 ? 680  LEU A N     1 
ATOM   5616 C  CA    . LEU A 1 680 ? -10.186 8.321   -59.831 1.00 11.13 ? 680  LEU A CA    1 
ATOM   5617 C  C     . LEU A 1 680 ? -8.753  8.726   -59.489 1.00 13.06 ? 680  LEU A C     1 
ATOM   5618 O  O     . LEU A 1 680 ? -8.518  9.391   -58.472 1.00 14.23 ? 680  LEU A O     1 
ATOM   5619 C  CB    . LEU A 1 680 ? -10.941 7.881   -58.570 1.00 10.88 ? 680  LEU A CB    1 
ATOM   5620 C  CG    . LEU A 1 680 ? -12.465 7.755   -58.710 1.00 13.94 ? 680  LEU A CG    1 
ATOM   5621 C  CD1   . LEU A 1 680 ? -13.056 6.919   -57.584 1.00 10.80 ? 680  LEU A CD1   1 
ATOM   5622 C  CD2   . LEU A 1 680 ? -13.157 9.128   -58.801 1.00 12.86 ? 680  LEU A CD2   1 
ATOM   5623 N  N     . MET A 1 681 ? -7.800  8.339   -60.342 1.00 12.51 ? 681  MET A N     1 
ATOM   5624 C  CA    . MET A 1 681 ? -6.400  8.730   -60.156 1.00 13.95 ? 681  MET A CA    1 
ATOM   5625 C  C     . MET A 1 681 ? -6.208  10.133  -60.734 1.00 14.35 ? 681  MET A C     1 
ATOM   5626 O  O     . MET A 1 681 ? -5.982  10.302  -61.941 1.00 13.79 ? 681  MET A O     1 
ATOM   5627 C  CB    . MET A 1 681 ? -5.441  7.722   -60.805 1.00 13.09 ? 681  MET A CB    1 
ATOM   5628 C  CG    . MET A 1 681 ? -5.421  6.326   -60.167 1.00 12.18 ? 681  MET A CG    1 
ATOM   5629 S  SD    . MET A 1 681 ? -4.925  6.292   -58.425 1.00 14.10 ? 681  MET A SD    1 
ATOM   5630 C  CE    . MET A 1 681 ? -6.505  6.242   -57.604 1.00 10.84 ? 681  MET A CE    1 
ATOM   5631 N  N     . PHE A 1 682 ? -6.345  11.132  -59.864 1.00 12.53 ? 682  PHE A N     1 
ATOM   5632 C  CA    . PHE A 1 682 ? -6.305  12.534  -60.269 1.00 14.51 ? 682  PHE A CA    1 
ATOM   5633 C  C     . PHE A 1 682 ? -5.044  13.153  -59.706 1.00 14.60 ? 682  PHE A C     1 
ATOM   5634 O  O     . PHE A 1 682 ? -4.950  13.412  -58.510 1.00 14.05 ? 682  PHE A O     1 
ATOM   5635 C  CB    . PHE A 1 682 ? -7.548  13.307  -59.779 1.00 15.00 ? 682  PHE A CB    1 
ATOM   5636 C  CG    . PHE A 1 682 ? -8.876  12.737  -60.254 1.00 15.47 ? 682  PHE A CG    1 
ATOM   5637 C  CD1   . PHE A 1 682 ? -9.004  12.137  -61.507 1.00 17.27 ? 682  PHE A CD1   1 
ATOM   5638 C  CD2   . PHE A 1 682 ? -10.013 12.841  -59.450 1.00 17.29 ? 682  PHE A CD2   1 
ATOM   5639 C  CE1   . PHE A 1 682 ? -10.231 11.627  -61.938 1.00 18.26 ? 682  PHE A CE1   1 
ATOM   5640 C  CE2   . PHE A 1 682 ? -11.247 12.334  -59.874 1.00 17.42 ? 682  PHE A CE2   1 
ATOM   5641 C  CZ    . PHE A 1 682 ? -11.357 11.730  -61.121 1.00 15.80 ? 682  PHE A CZ    1 
ATOM   5642 N  N     . MET A 1 683 ? -4.062  13.355  -60.575 1.00 14.74 ? 683  MET A N     1 
ATOM   5643 C  CA    . MET A 1 683 ? -2.758  13.868  -60.168 1.00 16.24 ? 683  MET A CA    1 
ATOM   5644 C  C     . MET A 1 683 ? -2.585  15.277  -60.717 1.00 18.15 ? 683  MET A C     1 
ATOM   5645 O  O     . MET A 1 683 ? -2.416  15.468  -61.921 1.00 19.29 ? 683  MET A O     1 
ATOM   5646 C  CB    . MET A 1 683 ? -1.638  12.932  -60.641 1.00 14.65 ? 683  MET A CB    1 
ATOM   5647 C  CG    . MET A 1 683 ? -0.232  13.521  -60.550 1.00 16.42 ? 683  MET A CG    1 
ATOM   5648 S  SD    . MET A 1 683 ? 1.051   12.320  -60.924 1.00 15.52 ? 683  MET A SD    1 
ATOM   5649 C  CE    . MET A 1 683 ? 1.490   11.770  -59.268 1.00 13.89 ? 683  MET A CE    1 
ATOM   5650 N  N     . ASP A 1 684 ? -2.659  16.253  -59.815 1.00 17.83 ? 684  ASP A N     1 
ATOM   5651 C  CA    . ASP A 1 684 ? -2.574  17.663  -60.168 1.00 19.67 ? 684  ASP A CA    1 
ATOM   5652 C  C     . ASP A 1 684 ? -1.229  18.231  -59.743 1.00 17.17 ? 684  ASP A C     1 
ATOM   5653 O  O     . ASP A 1 684 ? -0.585  17.704  -58.836 1.00 16.36 ? 684  ASP A O     1 
ATOM   5654 C  CB    . ASP A 1 684 ? -3.692  18.451  -59.474 1.00 21.10 ? 684  ASP A CB    1 
ATOM   5655 C  CG    . ASP A 1 684 ? -5.076  18.065  -59.964 1.00 26.59 ? 684  ASP A CG    1 
ATOM   5656 O  OD1   . ASP A 1 684 ? -5.226  17.759  -61.165 1.00 27.30 ? 684  ASP A OD1   1 
ATOM   5657 O  OD2   . ASP A 1 684 ? -6.017  18.079  -59.144 1.00 30.17 ? 684  ASP A OD2   1 
ATOM   5658 N  N     . ARG A 1 685 ? -0.822  19.311  -60.398 1.00 16.22 ? 685  ARG A N     1 
ATOM   5659 C  CA    . ARG A 1 685 ? 0.395   20.017  -60.040 1.00 16.69 ? 685  ARG A CA    1 
ATOM   5660 C  C     . ARG A 1 685 ? 0.303   20.533  -58.609 1.00 16.11 ? 685  ARG A C     1 
ATOM   5661 O  O     . ARG A 1 685 ? -0.738  21.043  -58.184 1.00 15.52 ? 685  ARG A O     1 
ATOM   5662 C  CB    . ARG A 1 685 ? 0.637   21.173  -61.018 1.00 15.06 ? 685  ARG A CB    1 
ATOM   5663 C  CG    . ARG A 1 685 ? 2.029   21.796  -60.940 1.00 12.82 ? 685  ARG A CG    1 
ATOM   5664 C  CD    . ARG A 1 685 ? 2.071   22.957  -59.953 1.00 12.11 ? 685  ARG A CD    1 
ATOM   5665 N  NE    . ARG A 1 685 ? 1.266   24.091  -60.412 1.00 14.50 ? 685  ARG A NE    1 
ATOM   5666 C  CZ    . ARG A 1 685 ? 0.953   25.149  -59.667 1.00 16.51 ? 685  ARG A CZ    1 
ATOM   5667 N  NH1   . ARG A 1 685 ? 1.367   25.234  -58.408 1.00 12.24 ? 685  ARG A NH1   1 
ATOM   5668 N  NH2   . ARG A 1 685 ? 0.214   26.127  -60.184 1.00 15.50 ? 685  ARG A NH2   1 
ATOM   5669 N  N     . GLU A 1 686 ? 1.392   20.385  -57.865 1.00 14.87 ? 686  GLU A N     1 
ATOM   5670 C  CA    . GLU A 1 686 ? 1.443   20.891  -56.507 1.00 18.02 ? 686  GLU A CA    1 
ATOM   5671 C  C     . GLU A 1 686 ? 2.343   22.127  -56.441 1.00 16.58 ? 686  GLU A C     1 
ATOM   5672 O  O     . GLU A 1 686 ? 1.835   23.255  -56.417 1.00 17.21 ? 686  GLU A O     1 
ATOM   5673 C  CB    . GLU A 1 686 ? 1.886   19.790  -55.534 1.00 20.45 ? 686  GLU A CB    1 
ATOM   5674 C  CG    . GLU A 1 686 ? 1.522   20.069  -54.085 1.00 28.45 ? 686  GLU A CG    1 
ATOM   5675 C  CD    . GLU A 1 686 ? 1.674   18.850  -53.194 1.00 37.42 ? 686  GLU A CD    1 
ATOM   5676 O  OE1   . GLU A 1 686 ? 0.645   18.211  -52.883 1.00 38.31 ? 686  GLU A OE1   1 
ATOM   5677 O  OE2   . GLU A 1 686 ? 2.820   18.528  -52.807 1.00 40.25 ? 686  GLU A OE2   1 
ATOM   5678 N  N     . ALA A 1 687 ? 3.663   21.925  -56.442 1.00 14.65 ? 687  ALA A N     1 
ATOM   5679 C  CA    . ALA A 1 687 ? 4.616   23.037  -56.278 1.00 14.07 ? 687  ALA A CA    1 
ATOM   5680 C  C     . ALA A 1 687 ? 5.298   23.455  -57.572 1.00 12.75 ? 687  ALA A C     1 
ATOM   5681 O  O     . ALA A 1 687 ? 5.633   22.613  -58.414 1.00 11.25 ? 687  ALA A O     1 
ATOM   5682 C  CB    . ALA A 1 687 ? 5.683   22.699  -55.219 1.00 14.21 ? 687  ALA A CB    1 
ATOM   5683 N  N     . ILE A 1 688 ? 5.488   24.764  -57.727 1.00 12.39 ? 688  ILE A N     1 
ATOM   5684 C  CA    . ILE A 1 688 ? 6.417   25.298  -58.728 1.00 12.25 ? 688  ILE A CA    1 
ATOM   5685 C  C     . ILE A 1 688 ? 7.583   25.942  -57.978 1.00 14.00 ? 688  ILE A C     1 
ATOM   5686 O  O     . ILE A 1 688 ? 7.384   26.888  -57.199 1.00 13.57 ? 688  ILE A O     1 
ATOM   5687 C  CB    . ILE A 1 688 ? 5.729   26.293  -59.690 1.00 12.18 ? 688  ILE A CB    1 
ATOM   5688 C  CG1   . ILE A 1 688 ? 4.703   25.546  -60.552 1.00 12.93 ? 688  ILE A CG1   1 
ATOM   5689 C  CG2   . ILE A 1 688 ? 6.768   26.983  -60.584 1.00 10.38 ? 688  ILE A CG2   1 
ATOM   5690 C  CD1   . ILE A 1 688 ? 3.817   26.435  -61.362 1.00 15.53 ? 688  ILE A CD1   1 
ATOM   5691 N  N     . ALA A 1 689 ? 8.787   25.410  -58.208 1.00 13.51 ? 689  ALA A N     1 
ATOM   5692 C  CA    . ALA A 1 689 ? 9.980   25.783  -57.438 1.00 12.69 ? 689  ALA A CA    1 
ATOM   5693 C  C     . ALA A 1 689 ? 11.162  26.215  -58.303 1.00 11.28 ? 689  ALA A C     1 
ATOM   5694 O  O     . ALA A 1 689 ? 11.383  25.688  -59.401 1.00 13.00 ? 689  ALA A O     1 
ATOM   5695 C  CB    . ALA A 1 689 ? 10.407  24.630  -56.512 1.00 10.98 ? 689  ALA A CB    1 
ATOM   5696 N  N     . GLY A 1 690 ? 11.921  27.178  -57.792 1.00 11.83 ? 690  GLY A N     1 
ATOM   5697 C  CA    . GLY A 1 690 ? 13.123  27.654  -58.461 1.00 12.16 ? 690  GLY A CA    1 
ATOM   5698 C  C     . GLY A 1 690 ? 13.720  28.848  -57.749 1.00 13.41 ? 690  GLY A C     1 
ATOM   5699 O  O     . GLY A 1 690 ? 13.106  29.383  -56.815 1.00 13.63 ? 690  GLY A O     1 
ATOM   5700 N  N     . PRO A 1 691 ? 14.929  29.268  -58.174 1.00 13.25 ? 691  PRO A N     1 
ATOM   5701 C  CA    . PRO A 1 691 ? 15.543  30.465  -57.603 1.00 13.28 ? 691  PRO A CA    1 
ATOM   5702 C  C     . PRO A 1 691 ? 14.950  31.728  -58.226 1.00 12.98 ? 691  PRO A C     1 
ATOM   5703 O  O     . PRO A 1 691 ? 14.411  31.663  -59.335 1.00 14.74 ? 691  PRO A O     1 
ATOM   5704 C  CB    . PRO A 1 691 ? 17.021  30.321  -57.979 1.00 11.24 ? 691  PRO A CB    1 
ATOM   5705 C  CG    . PRO A 1 691 ? 17.023  29.503  -59.242 1.00 14.52 ? 691  PRO A CG    1 
ATOM   5706 C  CD    . PRO A 1 691 ? 15.752  28.667  -59.243 1.00 11.19 ? 691  PRO A CD    1 
ATOM   5707 N  N     . PRO A 1 692 ? 15.035  32.872  -57.520 1.00 14.14 ? 692  PRO A N     1 
ATOM   5708 C  CA    . PRO A 1 692 ? 14.611  34.118  -58.165 1.00 14.22 ? 692  PRO A CA    1 
ATOM   5709 C  C     . PRO A 1 692 ? 15.431  34.341  -59.433 1.00 15.15 ? 692  PRO A C     1 
ATOM   5710 O  O     . PRO A 1 692 ? 16.635  34.072  -59.435 1.00 16.83 ? 692  PRO A O     1 
ATOM   5711 C  CB    . PRO A 1 692 ? 14.939  35.194  -57.122 1.00 13.66 ? 692  PRO A CB    1 
ATOM   5712 C  CG    . PRO A 1 692 ? 15.020  34.461  -55.816 1.00 15.65 ? 692  PRO A CG    1 
ATOM   5713 C  CD    . PRO A 1 692 ? 15.524  33.091  -56.146 1.00 13.00 ? 692  PRO A CD    1 
ATOM   5714 N  N     . LEU A 1 693 ? 14.782  34.800  -60.503 1.00 16.59 ? 693  LEU A N     1 
ATOM   5715 C  CA    . LEU A 1 693 ? 15.470  35.070  -61.767 1.00 17.37 ? 693  LEU A CA    1 
ATOM   5716 C  C     . LEU A 1 693 ? 16.627  36.042  -61.542 1.00 19.18 ? 693  LEU A C     1 
ATOM   5717 O  O     . LEU A 1 693 ? 16.477  37.047  -60.835 1.00 19.14 ? 693  LEU A O     1 
ATOM   5718 C  CB    . LEU A 1 693 ? 14.504  35.666  -62.795 1.00 18.65 ? 693  LEU A CB    1 
ATOM   5719 C  CG    . LEU A 1 693 ? 14.521  35.220  -64.268 1.00 20.30 ? 693  LEU A CG    1 
ATOM   5720 C  CD1   . LEU A 1 693 ? 14.270  36.421  -65.172 1.00 18.87 ? 693  LEU A CD1   1 
ATOM   5721 C  CD2   . LEU A 1 693 ? 15.788  34.497  -64.693 1.00 19.86 ? 693  LEU A CD2   1 
ATOM   5722 N  N     . GLY A 1 694 ? 17.779  35.727  -62.130 1.00 18.44 ? 694  GLY A N     1 
ATOM   5723 C  CA    . GLY A 1 694 ? 18.950  36.590  -62.038 1.00 18.63 ? 694  GLY A CA    1 
ATOM   5724 C  C     . GLY A 1 694 ? 19.809  36.374  -60.805 1.00 19.23 ? 694  GLY A C     1 
ATOM   5725 O  O     . GLY A 1 694 ? 20.900  36.943  -60.706 1.00 17.90 ? 694  GLY A O     1 
ATOM   5726 N  N     . SER A 1 695 ? 19.332  35.553  -59.867 1.00 18.61 ? 695  SER A N     1 
ATOM   5727 C  CA    . SER A 1 695 ? 20.048  35.311  -58.608 1.00 16.85 ? 695  SER A CA    1 
ATOM   5728 C  C     . SER A 1 695 ? 21.033  34.151  -58.720 1.00 16.64 ? 695  SER A C     1 
ATOM   5729 O  O     . SER A 1 695 ? 21.047  33.429  -59.716 1.00 17.21 ? 695  SER A O     1 
ATOM   5730 C  CB    . SER A 1 695 ? 19.056  35.011  -57.478 1.00 16.79 ? 695  SER A CB    1 
ATOM   5731 O  OG    . SER A 1 695 ? 18.506  33.711  -57.644 1.00 14.42 ? 695  SER A OG    1 
ATOM   5732 N  N     . LYS A 1 696 ? 21.836  33.960  -57.676 1.00 15.48 ? 696  LYS A N     1 
ATOM   5733 C  CA    . LYS A 1 696 ? 22.731  32.804  -57.600 1.00 14.55 ? 696  LYS A CA    1 
ATOM   5734 C  C     . LYS A 1 696 ? 22.140  31.682  -56.744 1.00 13.63 ? 696  LYS A C     1 
ATOM   5735 O  O     . LYS A 1 696 ? 22.835  30.726  -56.393 1.00 13.45 ? 696  LYS A O     1 
ATOM   5736 C  CB    . LYS A 1 696 ? 24.116  33.221  -57.085 1.00 14.86 ? 696  LYS A CB    1 
ATOM   5737 C  CG    . LYS A 1 696 ? 24.865  34.154  -58.037 1.00 18.58 ? 696  LYS A CG    1 
ATOM   5738 C  CD    . LYS A 1 696 ? 26.202  34.569  -57.453 1.00 22.26 ? 696  LYS A CD    1 
ATOM   5739 C  CE    . LYS A 1 696 ? 26.904  35.581  -58.345 1.00 26.98 ? 696  LYS A CE    1 
ATOM   5740 N  NZ    . LYS A 1 696 ? 28.162  36.060  -57.703 1.00 33.03 ? 696  LYS A NZ    1 
ATOM   5741 N  N     . GLY A 1 697 ? 20.851  31.793  -56.430 1.00 13.78 ? 697  GLY A N     1 
ATOM   5742 C  CA    . GLY A 1 697 ? 20.152  30.775  -55.649 1.00 13.95 ? 697  GLY A CA    1 
ATOM   5743 C  C     . GLY A 1 697 ? 20.095  29.443  -56.372 1.00 13.87 ? 697  GLY A C     1 
ATOM   5744 O  O     . GLY A 1 697 ? 20.020  29.397  -57.606 1.00 11.77 ? 697  GLY A O     1 
ATOM   5745 N  N     . ILE A 1 698 ? 20.130  28.356  -55.611 1.00 12.40 ? 698  ILE A N     1 
ATOM   5746 C  CA    . ILE A 1 698 ? 20.179  27.021  -56.215 1.00 12.29 ? 698  ILE A CA    1 
ATOM   5747 C  C     . ILE A 1 698 ? 18.795  26.415  -56.456 1.00 10.96 ? 698  ILE A C     1 
ATOM   5748 O  O     . ILE A 1 698 ? 18.688  25.374  -57.102 1.00 10.90 ? 698  ILE A O     1 
ATOM   5749 C  CB    . ILE A 1 698 ? 21.092  26.039  -55.425 1.00 9.79  ? 698  ILE A CB    1 
ATOM   5750 C  CG1   . ILE A 1 698 ? 20.480  25.692  -54.063 1.00 10.73 ? 698  ILE A CG1   1 
ATOM   5751 C  CG2   . ILE A 1 698 ? 22.526  26.613  -55.293 1.00 11.58 ? 698  ILE A CG2   1 
ATOM   5752 C  CD1   . ILE A 1 698 ? 21.075  24.452  -53.415 1.00 8.06  ? 698  ILE A CD1   1 
ATOM   5753 N  N     . GLY A 1 699 ? 17.750  27.067  -55.940 1.00 11.08 ? 699  GLY A N     1 
ATOM   5754 C  CA    . GLY A 1 699 ? 16.362  26.624  -56.144 1.00 12.20 ? 699  GLY A CA    1 
ATOM   5755 C  C     . GLY A 1 699 ? 15.890  25.554  -55.171 1.00 13.40 ? 699  GLY A C     1 
ATOM   5756 O  O     . GLY A 1 699 ? 14.905  25.741  -54.451 1.00 14.02 ? 699  GLY A O     1 
ATOM   5757 N  N     . GLY A 1 700 ? 16.597  24.430  -55.150 1.00 11.55 ? 700  GLY A N     1 
ATOM   5758 C  CA    . GLY A 1 700 ? 16.248  23.317  -54.273 1.00 10.85 ? 700  GLY A CA    1 
ATOM   5759 C  C     . GLY A 1 700 ? 17.398  22.345  -54.112 1.00 10.57 ? 700  GLY A C     1 
ATOM   5760 O  O     . GLY A 1 700 ? 18.429  22.499  -54.760 1.00 10.43 ? 700  GLY A O     1 
ATOM   5761 N  N     . PHE A 1 701 ? 17.220  21.361  -53.225 1.00 11.70 ? 701  PHE A N     1 
ATOM   5762 C  CA    . PHE A 1 701 ? 18.155  20.241  -53.075 1.00 12.40 ? 701  PHE A CA    1 
ATOM   5763 C  C     . PHE A 1 701 ? 17.503  19.051  -52.380 1.00 13.29 ? 701  PHE A C     1 
ATOM   5764 O  O     . PHE A 1 701 ? 16.545  19.216  -51.615 1.00 12.66 ? 701  PHE A O     1 
ATOM   5765 C  CB    . PHE A 1 701 ? 19.467  20.653  -52.368 1.00 13.31 ? 701  PHE A CB    1 
ATOM   5766 C  CG    . PHE A 1 701 ? 19.311  21.010  -50.906 1.00 13.21 ? 701  PHE A CG    1 
ATOM   5767 C  CD1   . PHE A 1 701 ? 19.200  22.340  -50.515 1.00 11.86 ? 701  PHE A CD1   1 
ATOM   5768 C  CD2   . PHE A 1 701 ? 19.306  20.023  -49.923 1.00 13.78 ? 701  PHE A CD2   1 
ATOM   5769 C  CE1   . PHE A 1 701 ? 19.070  22.686  -49.169 1.00 8.42  ? 701  PHE A CE1   1 
ATOM   5770 C  CE2   . PHE A 1 701 ? 19.170  20.355  -48.572 1.00 10.89 ? 701  PHE A CE2   1 
ATOM   5771 C  CZ    . PHE A 1 701 ? 19.056  21.689  -48.197 1.00 11.92 ? 701  PHE A CZ    1 
ATOM   5772 N  N     . TRP A 1 702 ? 18.013  17.860  -52.690 1.00 12.57 ? 702  TRP A N     1 
ATOM   5773 C  CA    . TRP A 1 702 ? 17.673  16.619  -51.989 1.00 13.01 ? 702  TRP A CA    1 
ATOM   5774 C  C     . TRP A 1 702 ? 18.944  16.063  -51.345 1.00 12.85 ? 702  TRP A C     1 
ATOM   5775 O  O     . TRP A 1 702 ? 20.006  16.057  -51.977 1.00 12.54 ? 702  TRP A O     1 
ATOM   5776 C  CB    . TRP A 1 702 ? 17.130  15.580  -52.982 1.00 12.27 ? 702  TRP A CB    1 
ATOM   5777 C  CG    . TRP A 1 702 ? 15.619  15.530  -53.092 1.00 11.07 ? 702  TRP A CG    1 
ATOM   5778 C  CD1   . TRP A 1 702 ? 14.789  14.601  -52.527 1.00 11.99 ? 702  TRP A CD1   1 
ATOM   5779 C  CD2   . TRP A 1 702 ? 14.774  16.449  -53.797 1.00 10.76 ? 702  TRP A CD2   1 
ATOM   5780 N  NE1   . TRP A 1 702 ? 13.475  14.882  -52.837 1.00 10.93 ? 702  TRP A NE1   1 
ATOM   5781 C  CE2   . TRP A 1 702 ? 13.438  16.008  -53.620 1.00 12.13 ? 702  TRP A CE2   1 
ATOM   5782 C  CE3   . TRP A 1 702 ? 15.016  17.601  -54.566 1.00 12.21 ? 702  TRP A CE3   1 
ATOM   5783 C  CZ2   . TRP A 1 702 ? 12.346  16.683  -54.173 1.00 10.66 ? 702  TRP A CZ2   1 
ATOM   5784 C  CZ3   . TRP A 1 702 ? 13.928  18.270  -55.124 1.00 13.22 ? 702  TRP A CZ3   1 
ATOM   5785 C  CH2   . TRP A 1 702 ? 12.608  17.806  -54.924 1.00 12.53 ? 702  TRP A CH2   1 
ATOM   5786 N  N     . THR A 1 703 ? 18.840  15.588  -50.106 1.00 13.64 ? 703  THR A N     1 
ATOM   5787 C  CA    . THR A 1 703 ? 19.941  14.836  -49.485 1.00 14.56 ? 703  THR A CA    1 
ATOM   5788 C  C     . THR A 1 703 ? 19.689  13.328  -49.560 1.00 14.02 ? 703  THR A C     1 
ATOM   5789 O  O     . THR A 1 703 ? 20.622  12.541  -49.487 1.00 12.62 ? 703  THR A O     1 
ATOM   5790 C  CB    . THR A 1 703 ? 20.224  15.237  -48.005 1.00 13.20 ? 703  THR A CB    1 
ATOM   5791 O  OG1   . THR A 1 703 ? 19.235  14.669  -47.141 1.00 12.35 ? 703  THR A OG1   1 
ATOM   5792 C  CG2   . THR A 1 703 ? 20.267  16.757  -47.830 1.00 12.77 ? 703  THR A CG2   1 
ATOM   5793 N  N     . GLY A 1 704 ? 18.425  12.942  -49.713 1.00 13.77 ? 704  GLY A N     1 
ATOM   5794 C  CA    . GLY A 1 704 ? 18.031  11.532  -49.731 1.00 13.97 ? 704  GLY A CA    1 
ATOM   5795 C  C     . GLY A 1 704 ? 16.521  11.393  -49.656 1.00 13.82 ? 704  GLY A C     1 
ATOM   5796 O  O     . GLY A 1 704 ? 15.797  12.382  -49.777 1.00 12.29 ? 704  GLY A O     1 
ATOM   5797 N  N     . LYS A 1 705 ? 16.038  10.168  -49.463 1.00 13.28 ? 705  LYS A N     1 
ATOM   5798 C  CA    . LYS A 1 705 ? 14.596  9.946   -49.304 1.00 13.80 ? 705  LYS A CA    1 
ATOM   5799 C  C     . LYS A 1 705 ? 14.062  10.749  -48.110 1.00 12.84 ? 705  LYS A C     1 
ATOM   5800 O  O     . LYS A 1 705 ? 14.704  10.806  -47.056 1.00 13.28 ? 705  LYS A O     1 
ATOM   5801 C  CB    . LYS A 1 705 ? 14.277  8.457   -49.120 1.00 13.92 ? 705  LYS A CB    1 
ATOM   5802 C  CG    . LYS A 1 705 ? 14.558  7.571   -50.334 1.00 15.25 ? 705  LYS A CG    1 
ATOM   5803 C  CD    . LYS A 1 705 ? 14.235  6.103   -50.021 1.00 11.48 ? 705  LYS A CD    1 
ATOM   5804 C  CE    . LYS A 1 705 ? 14.433  5.200   -51.231 1.00 14.19 ? 705  LYS A CE    1 
ATOM   5805 N  NZ    . LYS A 1 705 ? 14.225  3.752   -50.906 1.00 13.31 ? 705  LYS A NZ    1 
ATOM   5806 N  N     . LYS A 1 706 ? 12.909  11.387  -48.309 1.00 12.09 ? 706  LYS A N     1 
ATOM   5807 C  CA    . LYS A 1 706 ? 12.178  12.144  -47.268 1.00 11.61 ? 706  LYS A CA    1 
ATOM   5808 C  C     . LYS A 1 706 ? 12.963  13.339  -46.706 1.00 13.87 ? 706  LYS A C     1 
ATOM   5809 O  O     . LYS A 1 706 ? 12.666  13.826  -45.612 1.00 13.47 ? 706  LYS A O     1 
ATOM   5810 C  CB    . LYS A 1 706 ? 11.683  11.201  -46.156 1.00 12.17 ? 706  LYS A CB    1 
ATOM   5811 C  CG    . LYS A 1 706 ? 10.663  10.158  -46.672 1.00 13.31 ? 706  LYS A CG    1 
ATOM   5812 C  CD    . LYS A 1 706 ? 10.181  9.195   -45.581 1.00 14.16 ? 706  LYS A CD    1 
ATOM   5813 C  CE    . LYS A 1 706 ? 9.363   8.045   -46.174 1.00 12.78 ? 706  LYS A CE    1 
ATOM   5814 N  NZ    . LYS A 1 706 ? 7.991   8.488   -46.623 1.00 10.71 ? 706  LYS A NZ    1 
ATOM   5815 N  N     . ARG A 1 707 ? 13.949  13.816  -47.474 1.00 9.97  ? 707  ARG A N     1 
ATOM   5816 C  CA    . ARG A 1 707 ? 14.838  14.891  -47.034 1.00 7.96  ? 707  ARG A CA    1 
ATOM   5817 C  C     . ARG A 1 707 ? 15.166  15.860  -48.174 1.00 9.91  ? 707  ARG A C     1 
ATOM   5818 O  O     . ARG A 1 707 ? 16.044  15.585  -49.006 1.00 10.34 ? 707  ARG A O     1 
ATOM   5819 C  CB    . ARG A 1 707 ? 16.132  14.300  -46.456 1.00 9.14  ? 707  ARG A CB    1 
ATOM   5820 C  CG    . ARG A 1 707 ? 16.001  13.740  -45.045 1.00 9.90  ? 707  ARG A CG    1 
ATOM   5821 C  CD    . ARG A 1 707 ? 17.357  13.308  -44.504 1.00 16.78 ? 707  ARG A CD    1 
ATOM   5822 N  NE    . ARG A 1 707 ? 18.262  14.437  -44.267 1.00 19.34 ? 707  ARG A NE    1 
ATOM   5823 C  CZ    . ARG A 1 707 ? 18.348  15.107  -43.117 1.00 20.75 ? 707  ARG A CZ    1 
ATOM   5824 N  NH1   . ARG A 1 707 ? 17.592  14.774  -42.083 1.00 17.90 ? 707  ARG A NH1   1 
ATOM   5825 N  NH2   . ARG A 1 707 ? 19.197  16.115  -43.002 1.00 19.90 ? 707  ARG A NH2   1 
ATOM   5826 N  N     . TYR A 1 708 ? 14.463  16.991  -48.210 1.00 8.86  ? 708  TYR A N     1 
ATOM   5827 C  CA    . TYR A 1 708 ? 14.626  17.959  -49.293 1.00 8.68  ? 708  TYR A CA    1 
ATOM   5828 C  C     . TYR A 1 708 ? 14.120  19.350  -48.926 1.00 10.38 ? 708  TYR A C     1 
ATOM   5829 O  O     . TYR A 1 708 ? 13.406  19.523  -47.933 1.00 9.50  ? 708  TYR A O     1 
ATOM   5830 C  CB    . TYR A 1 708 ? 13.947  17.462  -50.584 1.00 9.15  ? 708  TYR A CB    1 
ATOM   5831 C  CG    . TYR A 1 708 ? 12.439  17.255  -50.496 1.00 10.23 ? 708  TYR A CG    1 
ATOM   5832 C  CD1   . TYR A 1 708 ? 11.902  16.040  -50.061 1.00 11.09 ? 708  TYR A CD1   1 
ATOM   5833 C  CD2   . TYR A 1 708 ? 11.556  18.268  -50.875 1.00 8.11  ? 708  TYR A CD2   1 
ATOM   5834 C  CE1   . TYR A 1 708 ? 10.519  15.840  -49.998 1.00 10.42 ? 708  TYR A CE1   1 
ATOM   5835 C  CE2   . TYR A 1 708 ? 10.167  18.077  -50.823 1.00 12.48 ? 708  TYR A CE2   1 
ATOM   5836 C  CZ    . TYR A 1 708 ? 9.660   16.863  -50.379 1.00 12.61 ? 708  TYR A CZ    1 
ATOM   5837 O  OH    . TYR A 1 708 ? 8.295   16.684  -50.309 1.00 10.79 ? 708  TYR A OH    1 
ATOM   5838 N  N     . ALA A 1 709 ? 14.526  20.338  -49.724 1.00 9.27  ? 709  ALA A N     1 
ATOM   5839 C  CA    . ALA A 1 709 ? 14.092  21.721  -49.551 1.00 10.59 ? 709  ALA A CA    1 
ATOM   5840 C  C     . ALA A 1 709 ? 13.865  22.353  -50.919 1.00 10.58 ? 709  ALA A C     1 
ATOM   5841 O  O     . ALA A 1 709 ? 14.644  22.120  -51.844 1.00 9.58  ? 709  ALA A O     1 
ATOM   5842 C  CB    . ALA A 1 709 ? 15.131  22.520  -48.753 1.00 10.81 ? 709  ALA A CB    1 
ATOM   5843 N  N     . LEU A 1 710 ? 12.792  23.137  -51.041 1.00 9.09  ? 710  LEU A N     1 
ATOM   5844 C  CA    . LEU A 1 710 ? 12.446  23.817  -52.291 1.00 9.86  ? 710  LEU A CA    1 
ATOM   5845 C  C     . LEU A 1 710 ? 12.008  25.255  -52.040 1.00 10.31 ? 710  LEU A C     1 
ATOM   5846 O  O     . LEU A 1 710 ? 11.322  25.546  -51.057 1.00 11.72 ? 710  LEU A O     1 
ATOM   5847 C  CB    . LEU A 1 710 ? 11.310  23.080  -53.028 1.00 10.67 ? 710  LEU A CB    1 
ATOM   5848 C  CG    . LEU A 1 710 ? 11.542  21.658  -53.559 1.00 10.93 ? 710  LEU A CG    1 
ATOM   5849 C  CD1   . LEU A 1 710 ? 10.213  21.020  -53.910 1.00 12.73 ? 710  LEU A CD1   1 
ATOM   5850 C  CD2   . LEU A 1 710 ? 12.487  21.662  -54.768 1.00 7.66  ? 710  LEU A CD2   1 
ATOM   5851 N  N     . ASN A 1 711 ? 12.400  26.147  -52.943 1.00 10.36 ? 711  ASN A N     1 
ATOM   5852 C  CA    . ASN A 1 711 ? 11.943  27.528  -52.923 1.00 10.58 ? 711  ASN A CA    1 
ATOM   5853 C  C     . ASN A 1 711 ? 10.689  27.665  -53.780 1.00 10.07 ? 711  ASN A C     1 
ATOM   5854 O  O     . ASN A 1 711 ? 10.773  27.713  -55.008 1.00 9.53  ? 711  ASN A O     1 
ATOM   5855 C  CB    . ASN A 1 711 ? 13.046  28.454  -53.433 1.00 11.26 ? 711  ASN A CB    1 
ATOM   5856 C  CG    . ASN A 1 711 ? 12.718  29.922  -53.235 1.00 14.08 ? 711  ASN A CG    1 
ATOM   5857 O  OD1   . ASN A 1 711 ? 12.356  30.351  -52.134 1.00 12.06 ? 711  ASN A OD1   1 
ATOM   5858 N  ND2   . ASN A 1 711 ? 12.864  30.706  -54.300 1.00 13.80 ? 711  ASN A ND2   1 
ATOM   5859 N  N     . VAL A 1 712 ? 9.531   27.738  -53.130 1.00 9.85  ? 712  VAL A N     1 
ATOM   5860 C  CA    . VAL A 1 712 ? 8.243   27.622  -53.830 1.00 9.91  ? 712  VAL A CA    1 
ATOM   5861 C  C     . VAL A 1 712 ? 7.566   28.978  -54.099 1.00 10.59 ? 712  VAL A C     1 
ATOM   5862 O  O     . VAL A 1 712 ? 7.446   29.816  -53.193 1.00 10.64 ? 712  VAL A O     1 
ATOM   5863 C  CB    . VAL A 1 712 ? 7.274   26.689  -53.053 1.00 10.18 ? 712  VAL A CB    1 
ATOM   5864 C  CG1   . VAL A 1 712 ? 5.951   26.506  -53.802 1.00 9.17  ? 712  VAL A CG1   1 
ATOM   5865 C  CG2   . VAL A 1 712 ? 7.931   25.327  -52.799 1.00 10.39 ? 712  VAL A CG2   1 
ATOM   5866 N  N     . TRP A 1 713 ? 7.117   29.172  -55.342 1.00 9.40  ? 713  TRP A N     1 
ATOM   5867 C  CA    . TRP A 1 713 ? 6.431   30.405  -55.757 1.00 9.38  ? 713  TRP A CA    1 
ATOM   5868 C  C     . TRP A 1 713 ? 4.925   30.206  -55.875 1.00 11.02 ? 713  TRP A C     1 
ATOM   5869 O  O     . TRP A 1 713 ? 4.155   31.167  -55.759 1.00 10.38 ? 713  TRP A O     1 
ATOM   5870 C  CB    . TRP A 1 713 ? 6.985   30.905  -57.095 1.00 10.93 ? 713  TRP A CB    1 
ATOM   5871 C  CG    . TRP A 1 713 ? 8.462   31.104  -57.063 1.00 12.25 ? 713  TRP A CG    1 
ATOM   5872 C  CD1   . TRP A 1 713 ? 9.420   30.181  -57.364 1.00 11.01 ? 713  TRP A CD1   1 
ATOM   5873 C  CD2   . TRP A 1 713 ? 9.153   32.294  -56.672 1.00 12.64 ? 713  TRP A CD2   1 
ATOM   5874 N  NE1   . TRP A 1 713 ? 10.672  30.731  -57.204 1.00 11.27 ? 713  TRP A NE1   1 
ATOM   5875 C  CE2   . TRP A 1 713 ? 10.536  32.025  -56.772 1.00 11.77 ? 713  TRP A CE2   1 
ATOM   5876 C  CE3   . TRP A 1 713 ? 8.736   33.571  -56.254 1.00 10.24 ? 713  TRP A CE3   1 
ATOM   5877 C  CZ2   . TRP A 1 713 ? 11.511  32.983  -56.471 1.00 10.81 ? 713  TRP A CZ2   1 
ATOM   5878 C  CZ3   . TRP A 1 713 ? 9.701   34.521  -55.951 1.00 12.78 ? 713  TRP A CZ3   1 
ATOM   5879 C  CH2   . TRP A 1 713 ? 11.078  34.221  -56.060 1.00 11.24 ? 713  TRP A CH2   1 
ATOM   5880 N  N     . ASP A 1 714 ? 4.511   28.963  -56.118 1.00 8.87  ? 714  ASP A N     1 
ATOM   5881 C  CA    . ASP A 1 714 ? 3.094   28.630  -56.256 1.00 9.89  ? 714  ASP A CA    1 
ATOM   5882 C  C     . ASP A 1 714 ? 2.850   27.228  -55.710 1.00 11.81 ? 714  ASP A C     1 
ATOM   5883 O  O     . ASP A 1 714 ? 3.568   26.286  -56.057 1.00 13.76 ? 714  ASP A O     1 
ATOM   5884 C  CB    . ASP A 1 714 ? 2.650   28.721  -57.726 1.00 9.61  ? 714  ASP A CB    1 
ATOM   5885 C  CG    . ASP A 1 714 ? 1.125   28.701  -57.887 1.00 12.80 ? 714  ASP A CG    1 
ATOM   5886 O  OD1   . ASP A 1 714 ? 0.487   27.656  -57.619 1.00 10.23 ? 714  ASP A OD1   1 
ATOM   5887 O  OD2   . ASP A 1 714 ? 0.566   29.741  -58.275 1.00 9.22  ? 714  ASP A OD2   1 
ATOM   5888 N  N     . MET A 1 715 ? 1.845   27.102  -54.850 1.00 10.65 ? 715  MET A N     1 
ATOM   5889 C  CA    . MET A 1 715 ? 1.500   25.826  -54.246 1.00 12.81 ? 715  MET A CA    1 
ATOM   5890 C  C     . MET A 1 715 ? 0.014   25.566  -54.417 1.00 13.15 ? 715  MET A C     1 
ATOM   5891 O  O     . MET A 1 715 ? -0.811  26.292  -53.861 1.00 12.06 ? 715  MET A O     1 
ATOM   5892 C  CB    . MET A 1 715 ? 1.862   25.822  -52.758 1.00 14.54 ? 715  MET A CB    1 
ATOM   5893 C  CG    . MET A 1 715 ? 1.636   24.486  -52.055 1.00 20.79 ? 715  MET A CG    1 
ATOM   5894 S  SD    . MET A 1 715 ? 2.700   23.175  -52.711 1.00 25.51 ? 715  MET A SD    1 
ATOM   5895 C  CE    . MET A 1 715 ? 2.869   22.130  -51.264 1.00 32.09 ? 715  MET A CE    1 
ATOM   5896 N  N     . GLU A 1 716 ? -0.320  24.533  -55.192 1.00 14.68 ? 716  GLU A N     1 
ATOM   5897 C  CA    . GLU A 1 716 ? -1.717  24.142  -55.425 1.00 17.15 ? 716  GLU A CA    1 
ATOM   5898 C  C     . GLU A 1 716 ? -2.603  25.306  -55.876 1.00 16.31 ? 716  GLU A C     1 
ATOM   5899 O  O     . GLU A 1 716 ? -3.776  25.381  -55.491 1.00 16.25 ? 716  GLU A O     1 
ATOM   5900 C  CB    . GLU A 1 716 ? -2.324  23.508  -54.166 1.00 18.02 ? 716  GLU A CB    1 
ATOM   5901 C  CG    . GLU A 1 716 ? -1.914  22.080  -53.898 1.00 27.99 ? 716  GLU A CG    1 
ATOM   5902 C  CD    . GLU A 1 716 ? -2.756  21.444  -52.806 1.00 31.96 ? 716  GLU A CD    1 
ATOM   5903 O  OE1   . GLU A 1 716 ? -3.734  20.749  -53.146 1.00 33.72 ? 716  GLU A OE1   1 
ATOM   5904 O  OE2   . GLU A 1 716 ? -2.453  21.661  -51.613 1.00 34.27 ? 716  GLU A OE2   1 
ATOM   5905 N  N     . GLY A 1 717 ? -2.048  26.220  -56.669 1.00 14.27 ? 717  GLY A N     1 
ATOM   5906 C  CA    . GLY A 1 717 ? -2.827  27.346  -57.186 1.00 13.98 ? 717  GLY A CA    1 
ATOM   5907 C  C     . GLY A 1 717 ? -2.792  28.607  -56.334 1.00 14.53 ? 717  GLY A C     1 
ATOM   5908 O  O     . GLY A 1 717 ? -3.425  29.602  -56.672 1.00 13.47 ? 717  GLY A O     1 
ATOM   5909 N  N     . THR A 1 718 ? -2.055  28.573  -55.228 1.00 13.19 ? 718  THR A N     1 
ATOM   5910 C  CA    . THR A 1 718 ? -1.810  29.784  -54.444 1.00 12.00 ? 718  THR A CA    1 
ATOM   5911 C  C     . THR A 1 718 ? -0.498  30.425  -54.896 1.00 13.10 ? 718  THR A C     1 
ATOM   5912 O  O     . THR A 1 718 ? 0.588   29.891  -54.630 1.00 12.21 ? 718  THR A O     1 
ATOM   5913 C  CB    . THR A 1 718 ? -1.751  29.482  -52.928 1.00 11.55 ? 718  THR A CB    1 
ATOM   5914 O  OG1   . THR A 1 718 ? -3.005  28.944  -52.490 1.00 12.94 ? 718  THR A OG1   1 
ATOM   5915 C  CG2   . THR A 1 718 ? -1.440  30.744  -52.129 1.00 10.18 ? 718  THR A CG2   1 
ATOM   5916 N  N     . ARG A 1 719 ? -0.604  31.565  -55.580 1.00 12.48 ? 719  ARG A N     1 
ATOM   5917 C  CA    . ARG A 1 719 ? 0.566   32.335  -55.980 1.00 12.76 ? 719  ARG A CA    1 
ATOM   5918 C  C     . ARG A 1 719 ? 0.987   33.234  -54.821 1.00 12.41 ? 719  ARG A C     1 
ATOM   5919 O  O     . ARG A 1 719 ? 0.293   34.192  -54.477 1.00 12.28 ? 719  ARG A O     1 
ATOM   5920 C  CB    . ARG A 1 719 ? 0.268   33.165  -57.240 1.00 13.44 ? 719  ARG A CB    1 
ATOM   5921 C  CG    . ARG A 1 719 ? 1.496   33.848  -57.859 1.00 15.58 ? 719  ARG A CG    1 
ATOM   5922 C  CD    . ARG A 1 719 ? 2.482   32.841  -58.468 1.00 13.95 ? 719  ARG A CD    1 
ATOM   5923 N  NE    . ARG A 1 719 ? 1.849   32.042  -59.519 1.00 13.69 ? 719  ARG A NE    1 
ATOM   5924 C  CZ    . ARG A 1 719 ? 1.738   32.417  -60.794 1.00 14.03 ? 719  ARG A CZ    1 
ATOM   5925 N  NH1   . ARG A 1 719 ? 2.237   33.573  -61.203 1.00 13.41 ? 719  ARG A NH1   1 
ATOM   5926 N  NH2   . ARG A 1 719 ? 1.137   31.623  -61.669 1.00 14.61 ? 719  ARG A NH2   1 
ATOM   5927 N  N     . TYR A 1 720 ? 2.122   32.918  -54.209 1.00 12.87 ? 720  TYR A N     1 
ATOM   5928 C  CA    . TYR A 1 720 ? 2.551   33.639  -53.015 1.00 14.10 ? 720  TYR A CA    1 
ATOM   5929 C  C     . TYR A 1 720 ? 3.017   35.054  -53.325 1.00 14.94 ? 720  TYR A C     1 
ATOM   5930 O  O     . TYR A 1 720 ? 3.703   35.288  -54.327 1.00 14.69 ? 720  TYR A O     1 
ATOM   5931 C  CB    . TYR A 1 720 ? 3.692   32.911  -52.312 1.00 14.12 ? 720  TYR A CB    1 
ATOM   5932 C  CG    . TYR A 1 720 ? 3.408   31.508  -51.818 1.00 15.83 ? 720  TYR A CG    1 
ATOM   5933 C  CD1   . TYR A 1 720 ? 2.310   31.229  -50.993 1.00 15.69 ? 720  TYR A CD1   1 
ATOM   5934 C  CD2   . TYR A 1 720 ? 4.286   30.467  -52.123 1.00 17.69 ? 720  TYR A CD2   1 
ATOM   5935 C  CE1   . TYR A 1 720 ? 2.079   29.935  -50.517 1.00 20.69 ? 720  TYR A CE1   1 
ATOM   5936 C  CE2   . TYR A 1 720 ? 4.069   29.177  -51.653 1.00 21.46 ? 720  TYR A CE2   1 
ATOM   5937 C  CZ    . TYR A 1 720 ? 2.969   28.915  -50.855 1.00 21.00 ? 720  TYR A CZ    1 
ATOM   5938 O  OH    . TYR A 1 720 ? 2.775   27.634  -50.391 1.00 23.91 ? 720  TYR A OH    1 
ATOM   5939 N  N     . ALA A 1 721 ? 2.652   35.986  -52.444 1.00 14.54 ? 721  ALA A N     1 
ATOM   5940 C  CA    . ALA A 1 721 ? 3.213   37.338  -52.456 1.00 15.01 ? 721  ALA A CA    1 
ATOM   5941 C  C     . ALA A 1 721 ? 4.726   37.255  -52.289 1.00 15.94 ? 721  ALA A C     1 
ATOM   5942 O  O     . ALA A 1 721 ? 5.467   37.983  -52.940 1.00 17.06 ? 721  ALA A O     1 
ATOM   5943 C  CB    . ALA A 1 721 ? 2.596   38.191  -51.345 1.00 13.77 ? 721  ALA A CB    1 
ATOM   5944 N  N     . GLU A 1 722 ? 5.175   36.352  -51.421 1.00 16.00 ? 722  GLU A N     1 
ATOM   5945 C  CA    . GLU A 1 722 ? 6.603   36.141  -51.187 1.00 17.71 ? 722  GLU A CA    1 
ATOM   5946 C  C     . GLU A 1 722 ? 6.931   34.651  -51.228 1.00 15.00 ? 722  GLU A C     1 
ATOM   5947 O  O     . GLU A 1 722 ? 6.186   33.852  -50.664 1.00 15.74 ? 722  GLU A O     1 
ATOM   5948 C  CB    . GLU A 1 722 ? 7.021   36.717  -49.824 1.00 19.86 ? 722  GLU A CB    1 
ATOM   5949 C  CG    . GLU A 1 722 ? 6.890   38.239  -49.695 1.00 25.70 ? 722  GLU A CG    1 
ATOM   5950 C  CD    . GLU A 1 722 ? 7.843   39.003  -50.602 1.00 30.20 ? 722  GLU A CD    1 
ATOM   5951 O  OE1   . GLU A 1 722 ? 8.996   38.556  -50.784 1.00 32.71 ? 722  GLU A OE1   1 
ATOM   5952 O  OE2   . GLU A 1 722 ? 7.439   40.063  -51.125 1.00 34.37 ? 722  GLU A OE2   1 
ATOM   5953 N  N     . PRO A 1 723 ? 8.066   34.276  -51.854 1.00 15.68 ? 723  PRO A N     1 
ATOM   5954 C  CA    . PRO A 1 723 ? 8.410   32.857  -51.969 1.00 14.26 ? 723  PRO A CA    1 
ATOM   5955 C  C     . PRO A 1 723 ? 8.467   32.165  -50.607 1.00 15.31 ? 723  PRO A C     1 
ATOM   5956 O  O     . PRO A 1 723 ? 8.902   32.765  -49.618 1.00 15.98 ? 723  PRO A O     1 
ATOM   5957 C  CB    . PRO A 1 723 ? 9.796   32.878  -52.621 1.00 15.38 ? 723  PRO A CB    1 
ATOM   5958 C  CG    . PRO A 1 723 ? 10.349  34.239  -52.311 1.00 16.53 ? 723  PRO A CG    1 
ATOM   5959 C  CD    . PRO A 1 723 ? 9.155   35.143  -52.347 1.00 15.12 ? 723  PRO A CD    1 
ATOM   5960 N  N     . LYS A 1 724 ? 8.030   30.913  -50.567 1.00 13.72 ? 724  LYS A N     1 
ATOM   5961 C  CA    . LYS A 1 724 ? 7.953   30.160  -49.324 1.00 16.90 ? 724  LYS A CA    1 
ATOM   5962 C  C     . LYS A 1 724 ? 8.797   28.902  -49.415 1.00 14.64 ? 724  LYS A C     1 
ATOM   5963 O  O     . LYS A 1 724 ? 8.717   28.166  -50.397 1.00 15.09 ? 724  LYS A O     1 
ATOM   5964 C  CB    . LYS A 1 724 ? 6.494   29.790  -49.027 1.00 17.18 ? 724  LYS A CB    1 
ATOM   5965 C  CG    . LYS A 1 724 ? 6.249   29.186  -47.652 1.00 24.77 ? 724  LYS A CG    1 
ATOM   5966 C  CD    . LYS A 1 724 ? 4.796   28.718  -47.526 1.00 31.24 ? 724  LYS A CD    1 
ATOM   5967 C  CE    . LYS A 1 724 ? 4.494   28.157  -46.142 1.00 34.54 ? 724  LYS A CE    1 
ATOM   5968 N  NZ    . LYS A 1 724 ? 4.346   29.230  -45.127 1.00 36.60 ? 724  LYS A NZ    1 
ATOM   5969 N  N     . LEU A 1 725 ? 9.590   28.638  -48.382 1.00 14.27 ? 725  LEU A N     1 
ATOM   5970 C  CA    . LEU A 1 725 ? 10.402  27.425  -48.372 1.00 15.06 ? 725  LEU A CA    1 
ATOM   5971 C  C     . LEU A 1 725 ? 9.527   26.226  -48.038 1.00 15.29 ? 725  LEU A C     1 
ATOM   5972 O  O     . LEU A 1 725 ? 8.805   26.246  -47.045 1.00 14.82 ? 725  LEU A O     1 
ATOM   5973 C  CB    . LEU A 1 725 ? 11.544  27.530  -47.357 1.00 14.26 ? 725  LEU A CB    1 
ATOM   5974 C  CG    . LEU A 1 725 ? 12.493  28.723  -47.442 1.00 15.90 ? 725  LEU A CG    1 
ATOM   5975 C  CD1   . LEU A 1 725 ? 13.565  28.596  -46.358 1.00 15.10 ? 725  LEU A CD1   1 
ATOM   5976 C  CD2   . LEU A 1 725 ? 13.132  28.814  -48.828 1.00 12.94 ? 725  LEU A CD2   1 
ATOM   5977 N  N     . LYS A 1 726 ? 9.573   25.202  -48.884 1.00 12.06 ? 726  LYS A N     1 
ATOM   5978 C  CA    . LYS A 1 726 ? 8.983   23.921  -48.545 1.00 12.65 ? 726  LYS A CA    1 
ATOM   5979 C  C     . LYS A 1 726 ? 10.126  22.990  -48.126 1.00 12.90 ? 726  LYS A C     1 
ATOM   5980 O  O     . LYS A 1 726 ? 10.901  22.514  -48.963 1.00 12.24 ? 726  LYS A O     1 
ATOM   5981 C  CB    . LYS A 1 726 ? 8.187   23.335  -49.717 1.00 11.34 ? 726  LYS A CB    1 
ATOM   5982 C  CG    . LYS A 1 726 ? 7.638   21.945  -49.436 1.00 15.10 ? 726  LYS A CG    1 
ATOM   5983 C  CD    . LYS A 1 726 ? 6.744   21.430  -50.551 1.00 20.03 ? 726  LYS A CD    1 
ATOM   5984 C  CE    . LYS A 1 726 ? 6.232   20.032  -50.228 1.00 17.01 ? 726  LYS A CE    1 
ATOM   5985 N  NZ    . LYS A 1 726 ? 5.237   20.078  -49.125 1.00 23.06 ? 726  LYS A NZ    1 
ATOM   5986 N  N     . ILE A 1 727 ? 10.239  22.758  -46.823 1.00 10.53 ? 727  ILE A N     1 
ATOM   5987 C  CA    . ILE A 1 727 ? 11.298  21.911  -46.302 1.00 11.22 ? 727  ILE A CA    1 
ATOM   5988 C  C     . ILE A 1 727 ? 10.691  20.665  -45.676 1.00 10.49 ? 727  ILE A C     1 
ATOM   5989 O  O     . ILE A 1 727 ? 9.873   20.756  -44.763 1.00 11.40 ? 727  ILE A O     1 
ATOM   5990 C  CB    . ILE A 1 727 ? 12.187  22.645  -45.265 1.00 11.60 ? 727  ILE A CB    1 
ATOM   5991 C  CG1   . ILE A 1 727 ? 12.707  23.980  -45.836 1.00 13.35 ? 727  ILE A CG1   1 
ATOM   5992 C  CG2   . ILE A 1 727 ? 13.342  21.743  -44.861 1.00 10.26 ? 727  ILE A CG2   1 
ATOM   5993 C  CD1   . ILE A 1 727 ? 13.449  24.881  -44.822 1.00 13.45 ? 727  ILE A CD1   1 
ATOM   5994 N  N     . MET A 1 728 ? 11.096  19.504  -46.174 1.00 8.52  ? 728  MET A N     1 
ATOM   5995 C  CA    . MET A 1 728 ? 10.612  18.243  -45.630 1.00 10.16 ? 728  MET A CA    1 
ATOM   5996 C  C     . MET A 1 728 ? 11.744  17.411  -45.031 1.00 9.73  ? 728  MET A C     1 
ATOM   5997 O  O     . MET A 1 728 ? 12.785  17.208  -45.667 1.00 8.27  ? 728  MET A O     1 
ATOM   5998 C  CB    . MET A 1 728 ? 9.855   17.454  -46.707 1.00 11.53 ? 728  MET A CB    1 
ATOM   5999 C  CG    . MET A 1 728 ? 8.807   18.277  -47.490 1.00 14.25 ? 728  MET A CG    1 
ATOM   6000 S  SD    . MET A 1 728 ? 7.585   19.166  -46.493 1.00 23.52 ? 728  MET A SD    1 
ATOM   6001 C  CE    . MET A 1 728 ? 7.049   17.859  -45.410 1.00 6.57  ? 728  MET A CE    1 
ATOM   6002 N  N     . GLY A 1 729 ? 11.558  16.980  -43.787 1.00 8.78  ? 729  GLY A N     1 
ATOM   6003 C  CA    . GLY A 1 729 ? 12.433  15.973  -43.176 1.00 9.11  ? 729  GLY A CA    1 
ATOM   6004 C  C     . GLY A 1 729 ? 13.716  16.486  -42.550 1.00 8.63  ? 729  GLY A C     1 
ATOM   6005 O  O     . GLY A 1 729 ? 14.235  15.888  -41.612 1.00 10.27 ? 729  GLY A O     1 
ATOM   6006 N  N     . LEU A 1 730 ? 14.232  17.586  -43.082 1.00 8.60  ? 730  LEU A N     1 
ATOM   6007 C  CA    . LEU A 1 730 ? 15.456  18.206  -42.579 1.00 8.94  ? 730  LEU A CA    1 
ATOM   6008 C  C     . LEU A 1 730 ? 15.270  18.717  -41.141 1.00 8.61  ? 730  LEU A C     1 
ATOM   6009 O  O     . LEU A 1 730 ? 14.143  18.956  -40.702 1.00 8.91  ? 730  LEU A O     1 
ATOM   6010 C  CB    . LEU A 1 730 ? 15.878  19.343  -43.512 1.00 7.07  ? 730  LEU A CB    1 
ATOM   6011 C  CG    . LEU A 1 730 ? 15.995  19.054  -45.017 1.00 10.59 ? 730  LEU A CG    1 
ATOM   6012 C  CD1   . LEU A 1 730 ? 16.624  20.254  -45.725 1.00 11.38 ? 730  LEU A CD1   1 
ATOM   6013 C  CD2   . LEU A 1 730 ? 16.801  17.781  -45.311 1.00 12.03 ? 730  LEU A CD2   1 
ATOM   6014 N  N     . GLU A 1 731 ? 16.378  18.892  -40.429 1.00 8.92  ? 731  GLU A N     1 
ATOM   6015 C  CA    . GLU A 1 731 ? 16.376  19.222  -38.998 1.00 10.49 ? 731  GLU A CA    1 
ATOM   6016 C  C     . GLU A 1 731 ? 15.544  20.449  -38.617 1.00 10.93 ? 731  GLU A C     1 
ATOM   6017 O  O     . GLU A 1 731 ? 15.066  20.547  -37.487 1.00 8.32  ? 731  GLU A O     1 
ATOM   6018 C  CB    . GLU A 1 731 ? 17.813  19.377  -38.492 1.00 10.10 ? 731  GLU A CB    1 
ATOM   6019 C  CG    . GLU A 1 731 ? 18.558  18.045  -38.268 1.00 11.09 ? 731  GLU A CG    1 
ATOM   6020 C  CD    . GLU A 1 731 ? 18.894  17.282  -39.553 1.00 10.97 ? 731  GLU A CD    1 
ATOM   6021 O  OE1   . GLU A 1 731 ? 18.751  17.829  -40.671 1.00 8.81  ? 731  GLU A OE1   1 
ATOM   6022 O  OE2   . GLU A 1 731 ? 19.298  16.112  -39.438 1.00 13.06 ? 731  GLU A OE2   1 
ATOM   6023 N  N     . THR A 1 732 ? 15.366  21.377  -39.558 1.00 9.71  ? 732  THR A N     1 
ATOM   6024 C  CA    . THR A 1 732 ? 14.471  22.522  -39.344 1.00 11.21 ? 732  THR A CA    1 
ATOM   6025 C  C     . THR A 1 732 ? 13.033  22.098  -38.992 1.00 12.18 ? 732  THR A C     1 
ATOM   6026 O  O     . THR A 1 732 ? 12.288  22.863  -38.377 1.00 11.45 ? 732  THR A O     1 
ATOM   6027 C  CB    . THR A 1 732 ? 14.422  23.425  -40.592 1.00 13.07 ? 732  THR A CB    1 
ATOM   6028 O  OG1   . THR A 1 732 ? 14.090  22.628  -41.736 1.00 12.95 ? 732  THR A OG1   1 
ATOM   6029 C  CG2   . THR A 1 732 ? 15.775  24.103  -40.825 1.00 10.10 ? 732  THR A CG2   1 
ATOM   6030 N  N     . GLN A 1 733 ? 12.663  20.877  -39.383 1.00 12.81 ? 733  GLN A N     1 
ATOM   6031 C  CA    . GLN A 1 733 ? 11.288  20.375  -39.260 1.00 11.61 ? 733  GLN A CA    1 
ATOM   6032 C  C     . GLN A 1 733 ? 11.089  19.469  -38.053 1.00 13.41 ? 733  GLN A C     1 
ATOM   6033 O  O     . GLN A 1 733 ? 9.975   19.013  -37.795 1.00 15.30 ? 733  GLN A O     1 
ATOM   6034 C  CB    . GLN A 1 733 ? 10.893  19.605  -40.526 1.00 12.14 ? 733  GLN A CB    1 
ATOM   6035 C  CG    . GLN A 1 733 ? 11.170  20.353  -41.823 1.00 11.01 ? 733  GLN A CG    1 
ATOM   6036 C  CD    . GLN A 1 733 ? 10.632  21.773  -41.810 1.00 11.04 ? 733  GLN A CD    1 
ATOM   6037 O  OE1   . GLN A 1 733 ? 11.399  22.736  -41.842 1.00 9.84  ? 733  GLN A OE1   1 
ATOM   6038 N  NE2   . GLN A 1 733 ? 9.308   21.911  -41.756 1.00 9.22  ? 733  GLN A NE2   1 
ATOM   6039 N  N     . LYS A 1 734 ? 12.171  19.203  -37.325 1.00 11.57 ? 734  LYS A N     1 
ATOM   6040 C  CA    . LYS A 1 734 ? 12.145  18.251  -36.224 1.00 13.29 ? 734  LYS A CA    1 
ATOM   6041 C  C     . LYS A 1 734 ? 12.082  18.961  -34.878 1.00 12.97 ? 734  LYS A C     1 
ATOM   6042 O  O     . LYS A 1 734 ? 12.840  19.907  -34.625 1.00 10.07 ? 734  LYS A O     1 
ATOM   6043 C  CB    . LYS A 1 734 ? 13.366  17.326  -36.285 1.00 15.25 ? 734  LYS A CB    1 
ATOM   6044 C  CG    . LYS A 1 734 ? 13.525  16.596  -37.624 1.00 19.38 ? 734  LYS A CG    1 
ATOM   6045 C  CD    . LYS A 1 734 ? 14.793  15.749  -37.675 1.00 25.81 ? 734  LYS A CD    1 
ATOM   6046 C  CE    . LYS A 1 734 ? 14.599  14.410  -36.968 1.00 31.21 ? 734  LYS A CE    1 
ATOM   6047 N  NZ    . LYS A 1 734 ? 15.711  13.455  -37.248 1.00 35.75 ? 734  LYS A NZ    1 
ATOM   6048 N  N     . SER A 1 735 ? 11.167  18.499  -34.024 1.00 11.45 ? 735  SER A N     1 
ATOM   6049 C  CA    . SER A 1 735 ? 10.961  19.090  -32.704 1.00 12.40 ? 735  SER A CA    1 
ATOM   6050 C  C     . SER A 1 735 ? 12.146  18.851  -31.766 1.00 11.36 ? 735  SER A C     1 
ATOM   6051 O  O     . SER A 1 735 ? 12.298  19.553  -30.773 1.00 12.54 ? 735  SER A O     1 
ATOM   6052 C  CB    . SER A 1 735 ? 9.655   18.587  -32.070 1.00 11.20 ? 735  SER A CB    1 
ATOM   6053 O  OG    . SER A 1 735 ? 9.686   17.188  -31.873 1.00 14.53 ? 735  SER A OG    1 
ATOM   6054 N  N     . SER A 1 736 ? 12.979  17.867  -32.097 1.00 11.32 ? 736  SER A N     1 
ATOM   6055 C  CA    . SER A 1 736 ? 14.187  17.564  -31.330 1.00 11.66 ? 736  SER A CA    1 
ATOM   6056 C  C     . SER A 1 736 ? 15.319  18.576  -31.551 1.00 11.20 ? 736  SER A C     1 
ATOM   6057 O  O     . SER A 1 736 ? 16.235  18.668  -30.733 1.00 9.10  ? 736  SER A O     1 
ATOM   6058 C  CB    . SER A 1 736 ? 14.679  16.158  -31.679 1.00 12.07 ? 736  SER A CB    1 
ATOM   6059 O  OG    . SER A 1 736 ? 14.760  16.023  -33.086 1.00 16.48 ? 736  SER A OG    1 
ATOM   6060 N  N     . THR A 1 737 ? 15.263  19.308  -32.664 1.00 10.65 ? 737  THR A N     1 
ATOM   6061 C  CA    . THR A 1 737 ? 16.288  20.301  -33.012 1.00 10.98 ? 737  THR A CA    1 
ATOM   6062 C  C     . THR A 1 737 ? 16.105  21.561  -32.158 1.00 10.90 ? 737  THR A C     1 
ATOM   6063 O  O     . THR A 1 737 ? 14.985  22.050  -32.025 1.00 11.99 ? 737  THR A O     1 
ATOM   6064 C  CB    . THR A 1 737 ? 16.211  20.676  -34.516 1.00 10.86 ? 737  THR A CB    1 
ATOM   6065 O  OG1   . THR A 1 737 ? 16.399  19.501  -35.317 1.00 15.79 ? 737  THR A OG1   1 
ATOM   6066 C  CG2   . THR A 1 737 ? 17.278  21.714  -34.899 1.00 9.98  ? 737  THR A CG2   1 
ATOM   6067 N  N     . PRO A 1 738 ? 17.203  22.095  -31.581 1.00 12.86 ? 738  PRO A N     1 
ATOM   6068 C  CA    . PRO A 1 738 ? 17.063  23.308  -30.772 1.00 13.99 ? 738  PRO A CA    1 
ATOM   6069 C  C     . PRO A 1 738 ? 16.363  24.431  -31.548 1.00 13.57 ? 738  PRO A C     1 
ATOM   6070 O  O     . PRO A 1 738 ? 16.583  24.581  -32.753 1.00 13.93 ? 738  PRO A O     1 
ATOM   6071 C  CB    . PRO A 1 738 ? 18.514  23.684  -30.449 1.00 14.37 ? 738  PRO A CB    1 
ATOM   6072 C  CG    . PRO A 1 738 ? 19.267  22.379  -30.500 1.00 13.85 ? 738  PRO A CG    1 
ATOM   6073 C  CD    . PRO A 1 738 ? 18.589  21.578  -31.582 1.00 12.33 ? 738  PRO A CD    1 
ATOM   6074 N  N     . LYS A 1 739 ? 15.513  25.195  -30.867 1.00 15.15 ? 739  LYS A N     1 
ATOM   6075 C  CA    . LYS A 1 739 ? 14.766  26.293  -31.498 1.00 15.19 ? 739  LYS A CA    1 
ATOM   6076 C  C     . LYS A 1 739 ? 15.622  27.258  -32.321 1.00 15.30 ? 739  LYS A C     1 
ATOM   6077 O  O     . LYS A 1 739 ? 15.300  27.544  -33.475 1.00 14.73 ? 739  LYS A O     1 
ATOM   6078 C  CB    . LYS A 1 739 ? 13.961  27.081  -30.455 1.00 19.32 ? 739  LYS A CB    1 
ATOM   6079 C  CG    . LYS A 1 739 ? 12.757  26.342  -29.890 1.00 27.42 ? 739  LYS A CG    1 
ATOM   6080 C  CD    . LYS A 1 739 ? 11.452  26.650  -30.630 1.00 31.86 ? 739  LYS A CD    1 
ATOM   6081 C  CE    . LYS A 1 739 ? 11.233  25.789  -31.876 1.00 34.62 ? 739  LYS A CE    1 
ATOM   6082 N  NZ    . LYS A 1 739 ? 11.309  24.313  -31.650 1.00 30.90 ? 739  LYS A NZ    1 
ATOM   6083 N  N     . ALA A 1 740 ? 16.702  27.766  -31.727 1.00 16.25 ? 740  ALA A N     1 
ATOM   6084 C  CA    . ALA A 1 740 ? 17.562  28.745  -32.400 1.00 17.23 ? 740  ALA A CA    1 
ATOM   6085 C  C     . ALA A 1 740 ? 18.334  28.107  -33.552 1.00 15.93 ? 740  ALA A C     1 
ATOM   6086 O  O     . ALA A 1 740 ? 18.696  28.782  -34.519 1.00 14.86 ? 740  ALA A O     1 
ATOM   6087 C  CB    . ALA A 1 740 ? 18.516  29.399  -31.408 1.00 17.34 ? 740  ALA A CB    1 
ATOM   6088 N  N     . VAL A 1 741 ? 18.567  26.799  -33.439 1.00 14.92 ? 741  VAL A N     1 
ATOM   6089 C  CA    . VAL A 1 741 ? 19.228  26.026  -34.484 1.00 14.68 ? 741  VAL A CA    1 
ATOM   6090 C  C     . VAL A 1 741 ? 18.283  25.790  -35.673 1.00 15.27 ? 741  VAL A C     1 
ATOM   6091 O  O     . VAL A 1 741 ? 18.708  25.897  -36.823 1.00 13.93 ? 741  VAL A O     1 
ATOM   6092 C  CB    . VAL A 1 741 ? 19.853  24.713  -33.914 1.00 15.76 ? 741  VAL A CB    1 
ATOM   6093 C  CG1   . VAL A 1 741 ? 20.299  23.762  -35.023 1.00 15.17 ? 741  VAL A CG1   1 
ATOM   6094 C  CG2   . VAL A 1 741 ? 21.035  25.055  -32.990 1.00 14.83 ? 741  VAL A CG2   1 
ATOM   6095 N  N     . GLN A 1 742 ? 17.007  25.510  -35.397 1.00 13.64 ? 742  GLN A N     1 
ATOM   6096 C  CA    . GLN A 1 742 ? 15.993  25.432  -36.456 1.00 13.63 ? 742  GLN A CA    1 
ATOM   6097 C  C     . GLN A 1 742 ? 15.997  26.731  -37.252 1.00 14.51 ? 742  GLN A C     1 
ATOM   6098 O  O     . GLN A 1 742 ? 16.043  26.712  -38.485 1.00 13.55 ? 742  GLN A O     1 
ATOM   6099 C  CB    . GLN A 1 742 ? 14.589  25.218  -35.880 1.00 16.03 ? 742  GLN A CB    1 
ATOM   6100 C  CG    . GLN A 1 742 ? 14.322  23.846  -35.286 1.00 13.01 ? 742  GLN A CG    1 
ATOM   6101 C  CD    . GLN A 1 742 ? 12.966  23.783  -34.598 1.00 15.18 ? 742  GLN A CD    1 
ATOM   6102 O  OE1   . GLN A 1 742 ? 12.417  24.804  -34.201 1.00 15.61 ? 742  GLN A OE1   1 
ATOM   6103 N  NE2   . GLN A 1 742 ? 12.428  22.586  -34.454 1.00 13.36 ? 742  GLN A NE2   1 
ATOM   6104 N  N     . LYS A 1 743 ? 15.950  27.856  -36.534 1.00 14.54 ? 743  LYS A N     1 
ATOM   6105 C  CA    . LYS A 1 743 ? 15.973  29.181  -37.153 1.00 16.55 ? 743  LYS A CA    1 
ATOM   6106 C  C     . LYS A 1 743 ? 17.185  29.400  -38.048 1.00 14.35 ? 743  LYS A C     1 
ATOM   6107 O  O     . LYS A 1 743 ? 17.038  29.865  -39.177 1.00 14.91 ? 743  LYS A O     1 
ATOM   6108 C  CB    . LYS A 1 743 ? 15.932  30.280  -36.096 1.00 18.53 ? 743  LYS A CB    1 
ATOM   6109 C  CG    . LYS A 1 743 ? 14.593  30.972  -35.968 1.00 27.66 ? 743  LYS A CG    1 
ATOM   6110 C  CD    . LYS A 1 743 ? 14.675  32.132  -34.981 1.00 29.67 ? 743  LYS A CD    1 
ATOM   6111 C  CE    . LYS A 1 743 ? 15.357  33.346  -35.589 1.00 31.42 ? 743  LYS A CE    1 
ATOM   6112 N  NZ    . LYS A 1 743 ? 14.459  34.130  -36.495 1.00 30.59 ? 743  LYS A NZ    1 
ATOM   6113 N  N     . ALA A 1 744 ? 18.370  29.068  -37.536 1.00 13.89 ? 744  ALA A N     1 
ATOM   6114 C  CA    . ALA A 1 744 ? 19.632  29.307  -38.246 1.00 13.47 ? 744  ALA A CA    1 
ATOM   6115 C  C     . ALA A 1 744 ? 19.784  28.398  -39.460 1.00 12.70 ? 744  ALA A C     1 
ATOM   6116 O  O     . ALA A 1 744 ? 20.225  28.841  -40.517 1.00 14.92 ? 744  ALA A O     1 
ATOM   6117 C  CB    . ALA A 1 744 ? 20.809  29.124  -37.305 1.00 12.24 ? 744  ALA A CB    1 
ATOM   6118 N  N     . LEU A 1 745 ? 19.434  27.123  -39.294 1.00 12.20 ? 745  LEU A N     1 
ATOM   6119 C  CA    . LEU A 1 745 ? 19.409  26.191  -40.415 1.00 11.57 ? 745  LEU A CA    1 
ATOM   6120 C  C     . LEU A 1 745 ? 18.433  26.616  -41.516 1.00 12.39 ? 745  LEU A C     1 
ATOM   6121 O  O     . LEU A 1 745 ? 18.756  26.496  -42.697 1.00 12.86 ? 745  LEU A O     1 
ATOM   6122 C  CB    . LEU A 1 745 ? 19.132  24.753  -39.946 1.00 9.72  ? 745  LEU A CB    1 
ATOM   6123 C  CG    . LEU A 1 745 ? 20.282  24.039  -39.214 1.00 12.23 ? 745  LEU A CG    1 
ATOM   6124 C  CD1   . LEU A 1 745 ? 19.821  22.687  -38.669 1.00 11.90 ? 745  LEU A CD1   1 
ATOM   6125 C  CD2   . LEU A 1 745 ? 21.494  23.865  -40.145 1.00 10.09 ? 745  LEU A CD2   1 
ATOM   6126 N  N     . LYS A 1 746 ? 17.255  27.116  -41.143 1.00 12.20 ? 746  LYS A N     1 
ATOM   6127 C  CA    . LYS A 1 746 ? 16.277  27.556  -42.147 1.00 13.26 ? 746  LYS A CA    1 
ATOM   6128 C  C     . LYS A 1 746 ? 16.803  28.756  -42.953 1.00 13.40 ? 746  LYS A C     1 
ATOM   6129 O  O     . LYS A 1 746 ? 16.613  28.839  -44.179 1.00 13.56 ? 746  LYS A O     1 
ATOM   6130 C  CB    . LYS A 1 746 ? 14.927  27.879  -41.499 1.00 13.09 ? 746  LYS A CB    1 
ATOM   6131 C  CG    . LYS A 1 746 ? 13.848  28.289  -42.505 1.00 15.52 ? 746  LYS A CG    1 
ATOM   6132 C  CD    . LYS A 1 746 ? 12.464  28.361  -41.873 1.00 21.61 ? 746  LYS A CD    1 
ATOM   6133 C  CE    . LYS A 1 746 ? 11.410  28.615  -42.947 1.00 22.60 ? 746  LYS A CE    1 
ATOM   6134 N  NZ    . LYS A 1 746 ? 10.025  28.583  -42.407 1.00 24.82 ? 746  LYS A NZ    1 
ATOM   6135 N  N     . GLU A 1 747 ? 17.467  29.673  -42.260 1.00 11.91 ? 747  GLU A N     1 
ATOM   6136 C  CA    . GLU A 1 747 ? 18.060  30.843  -42.905 1.00 13.68 ? 747  GLU A CA    1 
ATOM   6137 C  C     . GLU A 1 747 ? 19.238  30.440  -43.794 1.00 13.05 ? 747  GLU A C     1 
ATOM   6138 O  O     . GLU A 1 747 ? 19.406  30.982  -44.888 1.00 11.57 ? 747  GLU A O     1 
ATOM   6139 C  CB    . GLU A 1 747 ? 18.470  31.886  -41.857 1.00 13.81 ? 747  GLU A CB    1 
ATOM   6140 C  CG    . GLU A 1 747 ? 19.181  33.129  -42.411 1.00 14.32 ? 747  GLU A CG    1 
ATOM   6141 C  CD    . GLU A 1 747 ? 18.327  33.977  -43.353 1.00 15.94 ? 747  GLU A CD    1 
ATOM   6142 O  OE1   . GLU A 1 747 ? 18.912  34.860  -44.002 1.00 14.40 ? 747  GLU A OE1   1 
ATOM   6143 O  OE2   . GLU A 1 747 ? 17.090  33.778  -43.454 1.00 13.59 ? 747  GLU A OE2   1 
ATOM   6144 N  N     . CYS A 1 748 ? 20.028  29.472  -43.334 1.00 13.19 ? 748  CYS A N     1 
ATOM   6145 C  CA    . CYS A 1 748 ? 21.071  28.872  -44.175 1.00 14.75 ? 748  CYS A CA    1 
ATOM   6146 C  C     . CYS A 1 748 ? 20.460  28.308  -45.453 1.00 13.66 ? 748  CYS A C     1 
ATOM   6147 O  O     . CYS A 1 748 ? 20.963  28.551  -46.546 1.00 12.58 ? 748  CYS A O     1 
ATOM   6148 C  CB    . CYS A 1 748 ? 21.819  27.769  -43.420 1.00 14.88 ? 748  CYS A CB    1 
ATOM   6149 S  SG    . CYS A 1 748 ? 23.037  28.394  -42.217 1.00 16.91 ? 748  CYS A SG    1 
ATOM   6150 N  N     . ILE A 1 749 ? 19.373  27.555  -45.305 1.00 12.94 ? 749  ILE A N     1 
ATOM   6151 C  CA    . ILE A 1 749 ? 18.648  27.014  -46.449 1.00 13.66 ? 749  ILE A CA    1 
ATOM   6152 C  C     . ILE A 1 749 ? 18.086  28.144  -47.333 1.00 13.70 ? 749  ILE A C     1 
ATOM   6153 O  O     . ILE A 1 749 ? 18.287  28.137  -48.549 1.00 12.73 ? 749  ILE A O     1 
ATOM   6154 C  CB    . ILE A 1 749 ? 17.531  26.023  -45.998 1.00 11.43 ? 749  ILE A CB    1 
ATOM   6155 C  CG1   . ILE A 1 749 ? 18.161  24.743  -45.432 1.00 11.09 ? 749  ILE A CG1   1 
ATOM   6156 C  CG2   . ILE A 1 749 ? 16.564  25.710  -47.152 1.00 10.56 ? 749  ILE A CG2   1 
ATOM   6157 C  CD1   . ILE A 1 749 ? 17.212  23.905  -44.563 1.00 12.00 ? 749  ILE A CD1   1 
ATOM   6158 N  N     . ARG A 1 750 ? 17.410  29.119  -46.721 1.00 12.76 ? 750  ARG A N     1 
ATOM   6159 C  CA    . ARG A 1 750 ? 16.855  30.240  -47.476 1.00 13.71 ? 750  ARG A CA    1 
ATOM   6160 C  C     . ARG A 1 750 ? 17.926  30.879  -48.354 1.00 12.51 ? 750  ARG A C     1 
ATOM   6161 O  O     . ARG A 1 750 ? 17.692  31.143  -49.530 1.00 13.28 ? 750  ARG A O     1 
ATOM   6162 C  CB    . ARG A 1 750 ? 16.213  31.300  -46.569 1.00 13.15 ? 750  ARG A CB    1 
ATOM   6163 C  CG    . ARG A 1 750 ? 15.347  32.308  -47.355 1.00 14.27 ? 750  ARG A CG    1 
ATOM   6164 C  CD    . ARG A 1 750 ? 15.089  33.628  -46.612 1.00 14.84 ? 750  ARG A CD    1 
ATOM   6165 N  NE    . ARG A 1 750 ? 16.326  34.331  -46.255 1.00 14.49 ? 750  ARG A NE    1 
ATOM   6166 C  CZ    . ARG A 1 750 ? 17.067  35.076  -47.079 1.00 16.54 ? 750  ARG A CZ    1 
ATOM   6167 N  NH1   . ARG A 1 750 ? 16.726  35.250  -48.355 1.00 12.22 ? 750  ARG A NH1   1 
ATOM   6168 N  NH2   . ARG A 1 750 ? 18.167  35.659  -46.616 1.00 15.36 ? 750  ARG A NH2   1 
ATOM   6169 N  N     . ARG A 1 751 ? 19.099  31.114  -47.775 1.00 11.85 ? 751  ARG A N     1 
ATOM   6170 C  CA    . ARG A 1 751 ? 20.205  31.724  -48.503 1.00 13.08 ? 751  ARG A CA    1 
ATOM   6171 C  C     . ARG A 1 751 ? 20.733  30.841  -49.635 1.00 12.39 ? 751  ARG A C     1 
ATOM   6172 O  O     . ARG A 1 751 ? 20.974  31.329  -50.731 1.00 12.67 ? 751  ARG A O     1 
ATOM   6173 C  CB    . ARG A 1 751 ? 21.317  32.146  -47.539 1.00 12.71 ? 751  ARG A CB    1 
ATOM   6174 C  CG    . ARG A 1 751 ? 20.971  33.419  -46.770 1.00 12.58 ? 751  ARG A CG    1 
ATOM   6175 C  CD    . ARG A 1 751 ? 21.973  33.687  -45.672 1.00 13.91 ? 751  ARG A CD    1 
ATOM   6176 N  NE    . ARG A 1 751 ? 21.703  34.943  -44.970 1.00 16.24 ? 751  ARG A NE    1 
ATOM   6177 C  CZ    . ARG A 1 751 ? 22.480  36.027  -45.019 1.00 16.02 ? 751  ARG A CZ    1 
ATOM   6178 N  NH1   . ARG A 1 751 ? 23.590  36.032  -45.752 1.00 15.80 ? 751  ARG A NH1   1 
ATOM   6179 N  NH2   . ARG A 1 751 ? 22.138  37.115  -44.336 1.00 14.28 ? 751  ARG A NH2   1 
ATOM   6180 N  N     . MET A 1 752 ? 20.895  29.544  -49.372 1.00 14.36 ? 752  MET A N     1 
ATOM   6181 C  CA    . MET A 1 752 ? 21.285  28.581  -50.412 1.00 13.67 ? 752  MET A CA    1 
ATOM   6182 C  C     . MET A 1 752 ? 20.327  28.625  -51.601 1.00 13.28 ? 752  MET A C     1 
ATOM   6183 O  O     . MET A 1 752 ? 20.749  28.728  -52.755 1.00 12.84 ? 752  MET A O     1 
ATOM   6184 C  CB    . MET A 1 752 ? 21.294  27.155  -49.849 1.00 13.42 ? 752  MET A CB    1 
ATOM   6185 C  CG    . MET A 1 752 ? 22.419  26.876  -48.868 1.00 13.20 ? 752  MET A CG    1 
ATOM   6186 S  SD    . MET A 1 752 ? 22.254  25.313  -47.997 1.00 15.72 ? 752  MET A SD    1 
ATOM   6187 C  CE    . MET A 1 752 ? 22.403  24.137  -49.341 1.00 14.86 ? 752  MET A CE    1 
ATOM   6188 N  N     . LEU A 1 753 ? 19.033  28.558  -51.311 1.00 11.07 ? 753  LEU A N     1 
ATOM   6189 C  CA    . LEU A 1 753 ? 18.035  28.408  -52.365 1.00 12.29 ? 753  LEU A CA    1 
ATOM   6190 C  C     . LEU A 1 753 ? 17.794  29.694  -53.142 1.00 10.31 ? 753  LEU A C     1 
ATOM   6191 O  O     . LEU A 1 753 ? 17.544  29.646  -54.350 1.00 11.38 ? 753  LEU A O     1 
ATOM   6192 C  CB    . LEU A 1 753 ? 16.710  27.862  -51.806 1.00 10.19 ? 753  LEU A CB    1 
ATOM   6193 C  CG    . LEU A 1 753 ? 16.715  26.529  -51.033 1.00 13.85 ? 753  LEU A CG    1 
ATOM   6194 C  CD1   . LEU A 1 753 ? 15.303  25.970  -50.951 1.00 10.96 ? 753  LEU A CD1   1 
ATOM   6195 C  CD2   . LEU A 1 753 ? 17.650  25.488  -51.633 1.00 14.77 ? 753  LEU A CD2   1 
ATOM   6196 N  N     . GLN A 1 754 ? 17.870  30.828  -52.445 1.00 10.19 ? 754  GLN A N     1 
ATOM   6197 C  CA    . GLN A 1 754 ? 17.471  32.128  -53.001 1.00 11.24 ? 754  GLN A CA    1 
ATOM   6198 C  C     . GLN A 1 754 ? 18.630  33.039  -53.386 1.00 12.48 ? 754  GLN A C     1 
ATOM   6199 O  O     . GLN A 1 754 ? 18.476  33.904  -54.253 1.00 11.09 ? 754  GLN A O     1 
ATOM   6200 C  CB    . GLN A 1 754 ? 16.581  32.883  -52.011 1.00 11.79 ? 754  GLN A CB    1 
ATOM   6201 C  CG    . GLN A 1 754 ? 15.216  32.227  -51.740 1.00 12.22 ? 754  GLN A CG    1 
ATOM   6202 C  CD    . GLN A 1 754 ? 14.399  32.993  -50.714 1.00 15.56 ? 754  GLN A CD    1 
ATOM   6203 O  OE1   . GLN A 1 754 ? 14.857  33.999  -50.166 1.00 11.87 ? 754  GLN A OE1   1 
ATOM   6204 N  NE2   . GLN A 1 754 ? 13.183  32.513  -50.442 1.00 13.95 ? 754  GLN A NE2   1 
ATOM   6205 N  N     . GLU A 1 755 ? 19.776  32.866  -52.731 1.00 12.71 ? 755  GLU A N     1 
ATOM   6206 C  CA    . GLU A 1 755 ? 20.865  33.837  -52.865 1.00 13.53 ? 755  GLU A CA    1 
ATOM   6207 C  C     . GLU A 1 755 ? 22.192  33.237  -53.321 1.00 13.87 ? 755  GLU A C     1 
ATOM   6208 O  O     . GLU A 1 755 ? 22.924  33.871  -54.080 1.00 15.53 ? 755  GLU A O     1 
ATOM   6209 C  CB    . GLU A 1 755 ? 21.024  34.639  -51.565 1.00 12.76 ? 755  GLU A CB    1 
ATOM   6210 C  CG    . GLU A 1 755 ? 19.768  35.452  -51.226 1.00 15.09 ? 755  GLU A CG    1 
ATOM   6211 C  CD    . GLU A 1 755 ? 19.841  36.194  -49.901 1.00 15.58 ? 755  GLU A CD    1 
ATOM   6212 O  OE1   . GLU A 1 755 ? 18.822  36.820  -49.531 1.00 16.46 ? 755  GLU A OE1   1 
ATOM   6213 O  OE2   . GLU A 1 755 ? 20.902  36.169  -49.239 1.00 17.85 ? 755  GLU A OE2   1 
ATOM   6214 N  N     . GLY A 1 756 ? 22.506  32.032  -52.851 1.00 15.30 ? 756  GLY A N     1 
ATOM   6215 C  CA    . GLY A 1 756 ? 23.707  31.324  -53.295 1.00 15.05 ? 756  GLY A CA    1 
ATOM   6216 C  C     . GLY A 1 756 ? 24.760  31.079  -52.225 1.00 15.67 ? 756  GLY A C     1 
ATOM   6217 O  O     . GLY A 1 756 ? 24.558  31.381  -51.049 1.00 16.14 ? 756  GLY A O     1 
ATOM   6218 N  N     . GLU A 1 757 ? 25.903  30.553  -52.653 1.00 15.39 ? 757  GLU A N     1 
ATOM   6219 C  CA    . GLU A 1 757 ? 26.956  30.097  -51.744 1.00 15.80 ? 757  GLU A CA    1 
ATOM   6220 C  C     . GLU A 1 757 ? 27.589  31.192  -50.878 1.00 17.43 ? 757  GLU A C     1 
ATOM   6221 O  O     . GLU A 1 757 ? 27.780  31.006  -49.678 1.00 17.97 ? 757  GLU A O     1 
ATOM   6222 C  CB    . GLU A 1 757 ? 28.041  29.348  -52.531 1.00 16.58 ? 757  GLU A CB    1 
ATOM   6223 C  CG    . GLU A 1 757 ? 29.050  28.614  -51.650 1.00 17.40 ? 757  GLU A CG    1 
ATOM   6224 C  CD    . GLU A 1 757 ? 30.144  27.936  -52.453 1.00 19.52 ? 757  GLU A CD    1 
ATOM   6225 O  OE1   . GLU A 1 757 ? 30.676  28.570  -53.384 1.00 20.74 ? 757  GLU A OE1   1 
ATOM   6226 O  OE2   . GLU A 1 757 ? 30.471  26.771  -52.154 1.00 17.95 ? 757  GLU A OE2   1 
ATOM   6227 N  N     . GLU A 1 758 ? 27.914  32.329  -51.486 1.00 18.48 ? 758  GLU A N     1 
ATOM   6228 C  CA    . GLU A 1 758 ? 28.566  33.420  -50.764 1.00 19.67 ? 758  GLU A CA    1 
ATOM   6229 C  C     . GLU A 1 758 ? 27.668  33.931  -49.630 1.00 18.06 ? 758  GLU A C     1 
ATOM   6230 O  O     . GLU A 1 758 ? 28.131  34.161  -48.510 1.00 15.67 ? 758  GLU A O     1 
ATOM   6231 C  CB    . GLU A 1 758 ? 28.929  34.542  -51.738 1.00 22.28 ? 758  GLU A CB    1 
ATOM   6232 C  CG    . GLU A 1 758 ? 29.944  35.543  -51.219 1.00 28.51 ? 758  GLU A CG    1 
ATOM   6233 C  CD    . GLU A 1 758 ? 30.381  36.528  -52.295 1.00 35.55 ? 758  GLU A CD    1 
ATOM   6234 O  OE1   . GLU A 1 758 ? 31.097  36.109  -53.233 1.00 38.27 ? 758  GLU A OE1   1 
ATOM   6235 O  OE2   . GLU A 1 758 ? 30.013  37.721  -52.204 1.00 36.80 ? 758  GLU A OE2   1 
ATOM   6236 N  N     . SER A 1 759 ? 26.381  34.082  -49.920 1.00 16.01 ? 759  SER A N     1 
ATOM   6237 C  CA    . SER A 1 759 ? 25.412  34.496  -48.905 1.00 16.11 ? 759  SER A CA    1 
ATOM   6238 C  C     . SER A 1 759 ? 25.376  33.524  -47.718 1.00 15.21 ? 759  SER A C     1 
ATOM   6239 O  O     . SER A 1 759 ? 25.444  33.945  -46.558 1.00 14.96 ? 759  SER A O     1 
ATOM   6240 C  CB    . SER A 1 759 ? 24.028  34.628  -49.525 1.00 15.53 ? 759  SER A CB    1 
ATOM   6241 O  OG    . SER A 1 759 ? 23.085  35.045  -48.557 1.00 16.60 ? 759  SER A OG    1 
ATOM   6242 N  N     . LEU A 1 760 ? 25.281  32.229  -48.021 1.00 15.55 ? 760  LEU A N     1 
ATOM   6243 C  CA    . LEU A 1 760 ? 25.370  31.164  -47.012 1.00 15.17 ? 760  LEU A CA    1 
ATOM   6244 C  C     . LEU A 1 760 ? 26.611  31.326  -46.136 1.00 13.50 ? 760  LEU A C     1 
ATOM   6245 O  O     . LEU A 1 760 ? 26.529  31.249  -44.909 1.00 12.57 ? 760  LEU A O     1 
ATOM   6246 C  CB    . LEU A 1 760 ? 25.454  29.795  -47.694 1.00 13.70 ? 760  LEU A CB    1 
ATOM   6247 C  CG    . LEU A 1 760 ? 25.012  28.475  -47.041 1.00 21.84 ? 760  LEU A CG    1 
ATOM   6248 C  CD1   . LEU A 1 760 ? 25.996  27.370  -47.428 1.00 14.01 ? 760  LEU A CD1   1 
ATOM   6249 C  CD2   . LEU A 1 760 ? 24.763  28.475  -45.517 1.00 15.92 ? 760  LEU A CD2   1 
ATOM   6250 N  N     . GLN A 1 761 ? 27.763  31.513  -46.777 1.00 13.92 ? 761  GLN A N     1 
ATOM   6251 C  CA    . GLN A 1 761 ? 29.044  31.590  -46.064 1.00 14.48 ? 761  GLN A CA    1 
ATOM   6252 C  C     . GLN A 1 761 ? 29.089  32.786  -45.118 1.00 16.41 ? 761  GLN A C     1 
ATOM   6253 O  O     . GLN A 1 761 ? 29.641  32.703  -44.013 1.00 15.50 ? 761  GLN A O     1 
ATOM   6254 C  CB    . GLN A 1 761 ? 30.210  31.624  -47.056 1.00 15.30 ? 761  GLN A CB    1 
ATOM   6255 C  CG    . GLN A 1 761 ? 30.461  30.283  -47.740 1.00 15.61 ? 761  GLN A CG    1 
ATOM   6256 C  CD    . GLN A 1 761 ? 31.500  30.335  -48.863 1.00 19.85 ? 761  GLN A CD    1 
ATOM   6257 O  OE1   . GLN A 1 761 ? 31.714  29.347  -49.565 1.00 21.11 ? 761  GLN A OE1   1 
ATOM   6258 N  NE2   . GLN A 1 761 ? 32.142  31.476  -49.032 1.00 16.77 ? 761  GLN A NE2   1 
ATOM   6259 N  N     . GLU A 1 762 ? 28.498  33.894  -45.562 1.00 17.80 ? 762  GLU A N     1 
ATOM   6260 C  CA    . GLU A 1 762 ? 28.378  35.103  -44.757 1.00 18.28 ? 762  GLU A CA    1 
ATOM   6261 C  C     . GLU A 1 762 ? 27.551  34.856  -43.491 1.00 16.66 ? 762  GLU A C     1 
ATOM   6262 O  O     . GLU A 1 762 ? 27.960  35.253  -42.398 1.00 15.66 ? 762  GLU A O     1 
ATOM   6263 C  CB    . GLU A 1 762 ? 27.754  36.221  -45.590 1.00 20.69 ? 762  GLU A CB    1 
ATOM   6264 C  CG    . GLU A 1 762 ? 27.565  37.533  -44.850 1.00 25.62 ? 762  GLU A CG    1 
ATOM   6265 C  CD    . GLU A 1 762 ? 26.775  38.538  -45.664 1.00 29.04 ? 762  GLU A CD    1 
ATOM   6266 O  OE1   . GLU A 1 762 ? 25.527  38.431  -45.706 1.00 28.63 ? 762  GLU A OE1   1 
ATOM   6267 O  OE2   . GLU A 1 762 ? 27.407  39.436  -46.257 1.00 30.59 ? 762  GLU A OE2   1 
ATOM   6268 N  N     . TYR A 1 763 ? 26.404  34.191  -43.635 1.00 13.90 ? 763  TYR A N     1 
ATOM   6269 C  CA    . TYR A 1 763 ? 25.555  33.888  -42.479 1.00 13.76 ? 763  TYR A CA    1 
ATOM   6270 C  C     . TYR A 1 763 ? 26.186  32.879  -41.532 1.00 15.68 ? 763  TYR A C     1 
ATOM   6271 O  O     . TYR A 1 763 ? 26.105  33.044  -40.310 1.00 13.50 ? 763  TYR A O     1 
ATOM   6272 C  CB    . TYR A 1 763 ? 24.167  33.382  -42.891 1.00 13.75 ? 763  TYR A CB    1 
ATOM   6273 C  CG    . TYR A 1 763 ? 23.164  33.412  -41.747 1.00 16.89 ? 763  TYR A CG    1 
ATOM   6274 C  CD1   . TYR A 1 763 ? 22.756  32.237  -41.104 1.00 18.47 ? 763  TYR A CD1   1 
ATOM   6275 C  CD2   . TYR A 1 763 ? 22.638  34.623  -41.295 1.00 16.63 ? 763  TYR A CD2   1 
ATOM   6276 C  CE1   . TYR A 1 763 ? 21.837  32.277  -40.042 1.00 15.61 ? 763  TYR A CE1   1 
ATOM   6277 C  CE2   . TYR A 1 763 ? 21.722  34.670  -40.246 1.00 18.50 ? 763  TYR A CE2   1 
ATOM   6278 C  CZ    . TYR A 1 763 ? 21.327  33.499  -39.627 1.00 18.27 ? 763  TYR A CZ    1 
ATOM   6279 O  OH    . TYR A 1 763 ? 20.418  33.566  -38.591 1.00 25.84 ? 763  TYR A OH    1 
ATOM   6280 N  N     . PHE A 1 764 ? 26.800  31.833  -42.091 1.00 14.56 ? 764  PHE A N     1 
ATOM   6281 C  CA    . PHE A 1 764 ? 27.420  30.807  -41.261 1.00 15.61 ? 764  PHE A CA    1 
ATOM   6282 C  C     . PHE A 1 764 ? 28.462  31.414  -40.340 1.00 15.07 ? 764  PHE A C     1 
ATOM   6283 O  O     . PHE A 1 764 ? 28.526  31.073  -39.159 1.00 15.69 ? 764  PHE A O     1 
ATOM   6284 C  CB    . PHE A 1 764 ? 28.050  29.676  -42.088 1.00 15.45 ? 764  PHE A CB    1 
ATOM   6285 C  CG    . PHE A 1 764 ? 28.825  28.696  -41.250 1.00 17.32 ? 764  PHE A CG    1 
ATOM   6286 C  CD1   . PHE A 1 764 ? 28.187  27.602  -40.662 1.00 15.44 ? 764  PHE A CD1   1 
ATOM   6287 C  CD2   . PHE A 1 764 ? 30.185  28.887  -41.011 1.00 16.60 ? 764  PHE A CD2   1 
ATOM   6288 C  CE1   . PHE A 1 764 ? 28.901  26.699  -39.869 1.00 16.28 ? 764  PHE A CE1   1 
ATOM   6289 C  CE2   . PHE A 1 764 ? 30.909  27.997  -40.210 1.00 16.16 ? 764  PHE A CE2   1 
ATOM   6290 C  CZ    . PHE A 1 764 ? 30.270  26.906  -39.636 1.00 14.08 ? 764  PHE A CZ    1 
ATOM   6291 N  N     . LYS A 1 765 ? 29.271  32.314  -40.893 1.00 16.01 ? 765  LYS A N     1 
ATOM   6292 C  CA    . LYS A 1 765 ? 30.336  32.975  -40.148 1.00 18.90 ? 765  LYS A CA    1 
ATOM   6293 C  C     . LYS A 1 765 ? 29.768  33.762  -38.966 1.00 17.92 ? 765  LYS A C     1 
ATOM   6294 O  O     . LYS A 1 765 ? 30.328  33.734  -37.866 1.00 17.69 ? 765  LYS A O     1 
ATOM   6295 C  CB    . LYS A 1 765 ? 31.133  33.892  -41.085 1.00 20.99 ? 765  LYS A CB    1 
ATOM   6296 C  CG    . LYS A 1 765 ? 32.409  34.482  -40.484 1.00 28.61 ? 765  LYS A CG    1 
ATOM   6297 C  CD    . LYS A 1 765 ? 33.413  34.871  -41.568 1.00 33.09 ? 765  LYS A CD    1 
ATOM   6298 C  CE    . LYS A 1 765 ? 34.050  33.642  -42.209 1.00 36.22 ? 765  LYS A CE    1 
ATOM   6299 N  NZ    . LYS A 1 765 ? 35.041  34.000  -43.259 1.00 39.67 ? 765  LYS A NZ    1 
ATOM   6300 N  N     . GLU A 1 766 ? 28.651  34.448  -39.195 1.00 16.55 ? 766  GLU A N     1 
ATOM   6301 C  CA    . GLU A 1 766 ? 28.024  35.261  -38.155 1.00 17.27 ? 766  GLU A CA    1 
ATOM   6302 C  C     . GLU A 1 766 ? 27.459  34.397  -37.043 1.00 17.41 ? 766  GLU A C     1 
ATOM   6303 O  O     . GLU A 1 766 ? 27.660  34.689  -35.862 1.00 18.78 ? 766  GLU A O     1 
ATOM   6304 C  CB    . GLU A 1 766 ? 26.910  36.137  -38.736 1.00 18.01 ? 766  GLU A CB    1 
ATOM   6305 C  CG    . GLU A 1 766 ? 26.654  37.395  -37.927 1.00 20.10 ? 766  GLU A CG    1 
ATOM   6306 C  CD    . GLU A 1 766 ? 27.796  38.379  -38.048 1.00 23.23 ? 766  GLU A CD    1 
ATOM   6307 O  OE1   . GLU A 1 766 ? 27.997  38.916  -39.160 1.00 25.75 ? 766  GLU A OE1   1 
ATOM   6308 O  OE2   . GLU A 1 766 ? 28.498  38.606  -37.039 1.00 25.37 ? 766  GLU A OE2   1 
ATOM   6309 N  N     . PHE A 1 767 ? 26.755  33.333  -37.426 1.00 16.29 ? 767  PHE A N     1 
ATOM   6310 C  CA    . PHE A 1 767 ? 26.125  32.451  -36.460 1.00 16.49 ? 767  PHE A CA    1 
ATOM   6311 C  C     . PHE A 1 767 ? 27.158  31.763  -35.575 1.00 17.90 ? 767  PHE A C     1 
ATOM   6312 O  O     . PHE A 1 767 ? 26.973  31.679  -34.365 1.00 19.10 ? 767  PHE A O     1 
ATOM   6313 C  CB    . PHE A 1 767 ? 25.235  31.413  -37.146 1.00 15.51 ? 767  PHE A CB    1 
ATOM   6314 C  CG    . PHE A 1 767 ? 24.438  30.585  -36.187 1.00 15.14 ? 767  PHE A CG    1 
ATOM   6315 C  CD1   . PHE A 1 767 ? 24.807  29.274  -35.908 1.00 15.94 ? 767  PHE A CD1   1 
ATOM   6316 C  CD2   . PHE A 1 767 ? 23.327  31.123  -35.541 1.00 13.94 ? 767  PHE A CD2   1 
ATOM   6317 C  CE1   . PHE A 1 767 ? 24.074  28.502  -35.014 1.00 18.28 ? 767  PHE A CE1   1 
ATOM   6318 C  CE2   . PHE A 1 767 ? 22.596  30.364  -34.633 1.00 16.03 ? 767  PHE A CE2   1 
ATOM   6319 C  CZ    . PHE A 1 767 ? 22.962  29.049  -34.375 1.00 15.50 ? 767  PHE A CZ    1 
ATOM   6320 N  N     . GLU A 1 768 ? 28.244  31.280  -36.177 1.00 18.55 ? 768  GLU A N     1 
ATOM   6321 C  CA    . GLU A 1 768 ? 29.318  30.641  -35.406 1.00 19.88 ? 768  GLU A CA    1 
ATOM   6322 C  C     . GLU A 1 768 ? 29.953  31.605  -34.400 1.00 18.19 ? 768  GLU A C     1 
ATOM   6323 O  O     . GLU A 1 768 ? 30.267  31.213  -33.273 1.00 18.14 ? 768  GLU A O     1 
ATOM   6324 C  CB    . GLU A 1 768 ? 30.383  30.029  -36.328 1.00 21.30 ? 768  GLU A CB    1 
ATOM   6325 C  CG    . GLU A 1 768 ? 31.531  29.343  -35.575 1.00 25.18 ? 768  GLU A CG    1 
ATOM   6326 C  CD    . GLU A 1 768 ? 32.387  28.450  -36.461 1.00 30.07 ? 768  GLU A CD    1 
ATOM   6327 O  OE1   . GLU A 1 768 ? 32.643  27.296  -36.059 1.00 36.86 ? 768  GLU A OE1   1 
ATOM   6328 O  OE2   . GLU A 1 768 ? 32.810  28.893  -37.548 1.00 27.43 ? 768  GLU A OE2   1 
ATOM   6329 N  N     . LYS A 1 769 ? 30.123  32.863  -34.810 1.00 17.57 ? 769  LYS A N     1 
ATOM   6330 C  CA    . LYS A 1 769 ? 30.666  33.912  -33.941 1.00 18.47 ? 769  LYS A CA    1 
ATOM   6331 C  C     . LYS A 1 769 ? 29.746  34.261  -32.773 1.00 18.56 ? 769  LYS A C     1 
ATOM   6332 O  O     . LYS A 1 769 ? 30.218  34.630  -31.703 1.00 16.57 ? 769  LYS A O     1 
ATOM   6333 C  CB    . LYS A 1 769 ? 30.966  35.181  -34.746 1.00 19.82 ? 769  LYS A CB    1 
ATOM   6334 C  CG    . LYS A 1 769 ? 32.366  35.211  -35.341 1.00 26.06 ? 769  LYS A CG    1 
ATOM   6335 C  CD    . LYS A 1 769 ? 32.419  36.004  -36.638 1.00 29.43 ? 769  LYS A CD    1 
ATOM   6336 C  CE    . LYS A 1 769 ? 32.825  37.450  -36.426 1.00 30.69 ? 769  LYS A CE    1 
ATOM   6337 N  NZ    . LYS A 1 769 ? 33.044  38.108  -37.746 1.00 29.61 ? 769  LYS A NZ    1 
ATOM   6338 N  N     . GLU A 1 770 ? 28.437  34.147  -32.982 1.00 19.35 ? 770  GLU A N     1 
ATOM   6339 C  CA    . GLU A 1 770 ? 27.469  34.601  -31.983 1.00 20.22 ? 770  GLU A CA    1 
ATOM   6340 C  C     . GLU A 1 770 ? 26.794  33.469  -31.205 1.00 20.93 ? 770  GLU A C     1 
ATOM   6341 O  O     . GLU A 1 770 ? 26.098  33.725  -30.223 1.00 20.83 ? 770  GLU A O     1 
ATOM   6342 C  CB    . GLU A 1 770 ? 26.413  35.516  -32.627 1.00 20.76 ? 770  GLU A CB    1 
ATOM   6343 C  CG    . GLU A 1 770 ? 26.969  36.788  -33.282 1.00 21.78 ? 770  GLU A CG    1 
ATOM   6344 C  CD    . GLU A 1 770 ? 27.543  37.801  -32.292 1.00 23.67 ? 770  GLU A CD    1 
ATOM   6345 O  OE1   . GLU A 1 770 ? 28.165  38.775  -32.757 1.00 27.47 ? 770  GLU A OE1   1 
ATOM   6346 O  OE2   . GLU A 1 770 ? 27.373  37.640  -31.062 1.00 26.82 ? 770  GLU A OE2   1 
ATOM   6347 N  N     . PHE A 1 771 ? 27.015  32.228  -31.641 1.00 22.19 ? 771  PHE A N     1 
ATOM   6348 C  CA    . PHE A 1 771 ? 26.382  31.032  -31.055 1.00 23.36 ? 771  PHE A CA    1 
ATOM   6349 C  C     . PHE A 1 771 ? 26.416  31.004  -29.521 1.00 22.77 ? 771  PHE A C     1 
ATOM   6350 O  O     . PHE A 1 771 ? 25.396  30.756  -28.865 1.00 21.21 ? 771  PHE A O     1 
ATOM   6351 C  CB    . PHE A 1 771 ? 27.045  29.762  -31.619 1.00 23.55 ? 771  PHE A CB    1 
ATOM   6352 C  CG    . PHE A 1 771 ? 26.424  28.476  -31.139 1.00 23.22 ? 771  PHE A CG    1 
ATOM   6353 C  CD1   . PHE A 1 771 ? 27.074  27.687  -30.197 1.00 23.29 ? 771  PHE A CD1   1 
ATOM   6354 C  CD2   . PHE A 1 771 ? 25.202  28.040  -31.650 1.00 26.10 ? 771  PHE A CD2   1 
ATOM   6355 C  CE1   . PHE A 1 771 ? 26.512  26.492  -29.755 1.00 25.98 ? 771  PHE A CE1   1 
ATOM   6356 C  CE2   . PHE A 1 771 ? 24.623  26.844  -31.212 1.00 24.09 ? 771  PHE A CE2   1 
ATOM   6357 C  CZ    . PHE A 1 771 ? 25.279  26.068  -30.265 1.00 27.18 ? 771  PHE A CZ    1 
ATOM   6358 N  N     . ARG A 1 772 ? 27.588  31.272  -28.955 1.00 23.02 ? 772  ARG A N     1 
ATOM   6359 C  CA    . ARG A 1 772 ? 27.781  31.185  -27.507 1.00 23.45 ? 772  ARG A CA    1 
ATOM   6360 C  C     . ARG A 1 772 ? 26.948  32.188  -26.698 1.00 23.02 ? 772  ARG A C     1 
ATOM   6361 O  O     . ARG A 1 772 ? 26.844  32.060  -25.476 1.00 22.83 ? 772  ARG A O     1 
ATOM   6362 C  CB    . ARG A 1 772 ? 29.273  31.273  -27.158 1.00 25.60 ? 772  ARG A CB    1 
ATOM   6363 C  CG    . ARG A 1 772 ? 30.056  30.039  -27.581 1.00 28.36 ? 772  ARG A CG    1 
ATOM   6364 C  CD    . ARG A 1 772 ? 31.548  30.191  -27.339 1.00 34.13 ? 772  ARG A CD    1 
ATOM   6365 N  NE    . ARG A 1 772 ? 32.245  28.913  -27.488 1.00 37.38 ? 772  ARG A NE    1 
ATOM   6366 C  CZ    . ARG A 1 772 ? 32.575  28.108  -26.480 1.00 40.32 ? 772  ARG A CZ    1 
ATOM   6367 N  NH1   . ARG A 1 772 ? 32.283  28.438  -25.226 1.00 40.47 ? 772  ARG A NH1   1 
ATOM   6368 N  NH2   . ARG A 1 772 ? 33.204  26.968  -26.727 1.00 42.41 ? 772  ARG A NH2   1 
ATOM   6369 N  N     . GLN A 1 773 ? 26.332  33.156  -27.383 1.00 20.36 ? 773  GLN A N     1 
ATOM   6370 C  CA    . GLN A 1 773 ? 25.515  34.184  -26.726 1.00 20.20 ? 773  GLN A CA    1 
ATOM   6371 C  C     . GLN A 1 773 ? 24.020  33.885  -26.698 1.00 19.34 ? 773  GLN A C     1 
ATOM   6372 O  O     . GLN A 1 773 ? 23.247  34.610  -26.068 1.00 18.43 ? 773  GLN A O     1 
ATOM   6373 C  CB    . GLN A 1 773 ? 25.751  35.555  -27.365 1.00 22.44 ? 773  GLN A CB    1 
ATOM   6374 C  CG    . GLN A 1 773 ? 26.911  36.321  -26.760 1.00 27.66 ? 773  GLN A CG    1 
ATOM   6375 C  CD    . GLN A 1 773 ? 28.244  35.643  -26.989 1.00 32.32 ? 773  GLN A CD    1 
ATOM   6376 O  OE1   . GLN A 1 773 ? 28.674  35.457  -28.131 1.00 33.27 ? 773  GLN A OE1   1 
ATOM   6377 N  NE2   . GLN A 1 773 ? 28.907  35.264  -25.900 1.00 35.65 ? 773  GLN A NE2   1 
ATOM   6378 N  N     . LEU A 1 774 ? 23.616  32.824  -27.388 1.00 17.21 ? 774  LEU A N     1 
ATOM   6379 C  CA    . LEU A 1 774 ? 22.219  32.412  -27.415 1.00 17.31 ? 774  LEU A CA    1 
ATOM   6380 C  C     . LEU A 1 774 ? 21.799  31.863  -26.052 1.00 17.67 ? 774  LEU A C     1 
ATOM   6381 O  O     . LEU A 1 774 ? 22.613  31.266  -25.335 1.00 17.69 ? 774  LEU A O     1 
ATOM   6382 C  CB    . LEU A 1 774 ? 21.990  31.381  -28.528 1.00 17.08 ? 774  LEU A CB    1 
ATOM   6383 C  CG    . LEU A 1 774 ? 22.246  31.866  -29.963 1.00 18.83 ? 774  LEU A CG    1 
ATOM   6384 C  CD1   . LEU A 1 774 ? 22.469  30.696  -30.941 1.00 15.60 ? 774  LEU A CD1   1 
ATOM   6385 C  CD2   . LEU A 1 774 ? 21.112  32.764  -30.447 1.00 15.18 ? 774  LEU A CD2   1 
ATOM   6386 N  N     . ASN A 1 775 ? 20.543  32.110  -25.688 1.00 16.77 ? 775  ASN A N     1 
ATOM   6387 C  CA    . ASN A 1 775 ? 19.953  31.600  -24.448 1.00 18.06 ? 775  ASN A CA    1 
ATOM   6388 C  C     . ASN A 1 775 ? 19.999  30.072  -24.422 1.00 17.74 ? 775  ASN A C     1 
ATOM   6389 O  O     . ASN A 1 775 ? 19.742  29.424  -25.441 1.00 17.21 ? 775  ASN A O     1 
ATOM   6390 C  CB    . ASN A 1 775 ? 18.504  32.081  -24.329 1.00 20.01 ? 775  ASN A CB    1 
ATOM   6391 C  CG    . ASN A 1 775 ? 17.855  31.680  -23.015 1.00 23.72 ? 775  ASN A CG    1 
ATOM   6392 O  OD1   . ASN A 1 775 ? 17.143  30.680  -22.943 1.00 28.01 ? 775  ASN A OD1   1 
ATOM   6393 N  ND2   . ASN A 1 775 ? 18.106  32.456  -21.969 1.00 24.36 ? 775  ASN A ND2   1 
ATOM   6394 N  N     . TYR A 1 776 ? 20.323  29.504  -23.263 1.00 15.97 ? 776  TYR A N     1 
ATOM   6395 C  CA    . TYR A 1 776 ? 20.540  28.058  -23.147 1.00 15.14 ? 776  TYR A CA    1 
ATOM   6396 C  C     . TYR A 1 776 ? 19.343  27.205  -23.597 1.00 15.88 ? 776  TYR A C     1 
ATOM   6397 O  O     . TYR A 1 776 ? 19.534  26.141  -24.185 1.00 17.42 ? 776  TYR A O     1 
ATOM   6398 C  CB    . TYR A 1 776 ? 21.005  27.678  -21.729 1.00 14.96 ? 776  TYR A CB    1 
ATOM   6399 C  CG    . TYR A 1 776 ? 19.928  27.659  -20.667 1.00 16.70 ? 776  TYR A CG    1 
ATOM   6400 C  CD1   . TYR A 1 776 ? 19.559  26.462  -20.047 1.00 17.44 ? 776  TYR A CD1   1 
ATOM   6401 C  CD2   . TYR A 1 776 ? 19.286  28.833  -20.268 1.00 15.37 ? 776  TYR A CD2   1 
ATOM   6402 C  CE1   . TYR A 1 776 ? 18.574  26.435  -19.066 1.00 18.88 ? 776  TYR A CE1   1 
ATOM   6403 C  CE2   . TYR A 1 776 ? 18.303  28.817  -19.294 1.00 16.56 ? 776  TYR A CE2   1 
ATOM   6404 C  CZ    . TYR A 1 776 ? 17.949  27.613  -18.697 1.00 18.73 ? 776  TYR A CZ    1 
ATOM   6405 O  OH    . TYR A 1 776 ? 16.974  27.591  -17.729 1.00 19.53 ? 776  TYR A OH    1 
ATOM   6406 N  N     . ILE A 1 777 ? 18.125  27.681  -23.337 1.00 14.33 ? 777  ILE A N     1 
ATOM   6407 C  CA    . ILE A 1 777 ? 16.911  26.964  -23.725 1.00 16.12 ? 777  ILE A CA    1 
ATOM   6408 C  C     . ILE A 1 777 ? 16.745  26.921  -25.246 1.00 16.14 ? 777  ILE A C     1 
ATOM   6409 O  O     . ILE A 1 777 ? 16.282  25.917  -25.794 1.00 17.67 ? 777  ILE A O     1 
ATOM   6410 C  CB    . ILE A 1 777 ? 15.641  27.560  -23.051 1.00 17.60 ? 777  ILE A CB    1 
ATOM   6411 C  CG1   . ILE A 1 777 ? 15.639  27.252  -21.550 1.00 18.09 ? 777  ILE A CG1   1 
ATOM   6412 C  CG2   . ILE A 1 777 ? 14.356  27.022  -23.704 1.00 19.14 ? 777  ILE A CG2   1 
ATOM   6413 C  CD1   . ILE A 1 777 ? 14.662  28.090  -20.748 1.00 21.34 ? 777  ILE A CD1   1 
ATOM   6414 N  N     . SER A 1 778 ? 17.139  28.003  -25.916 1.00 13.83 ? 778  SER A N     1 
ATOM   6415 C  CA    . SER A 1 778 ? 17.026  28.103  -27.369 1.00 15.33 ? 778  SER A CA    1 
ATOM   6416 C  C     . SER A 1 778 ? 18.013  27.172  -28.084 1.00 14.52 ? 778  SER A C     1 
ATOM   6417 O  O     . SER A 1 778 ? 17.819  26.849  -29.253 1.00 12.96 ? 778  SER A O     1 
ATOM   6418 C  CB    . SER A 1 778 ? 17.230  29.551  -27.831 1.00 15.42 ? 778  SER A CB    1 
ATOM   6419 O  OG    . SER A 1 778 ? 18.609  29.893  -27.816 1.00 17.70 ? 778  SER A OG    1 
ATOM   6420 N  N     . ILE A 1 779 ? 19.062  26.748  -27.382 1.00 13.67 ? 779  ILE A N     1 
ATOM   6421 C  CA    . ILE A 1 779 ? 20.059  25.859  -27.986 1.00 14.74 ? 779  ILE A CA    1 
ATOM   6422 C  C     . ILE A 1 779 ? 20.061  24.441  -27.407 1.00 14.77 ? 779  ILE A C     1 
ATOM   6423 O  O     . ILE A 1 779 ? 20.891  23.614  -27.790 1.00 16.15 ? 779  ILE A O     1 
ATOM   6424 C  CB    . ILE A 1 779 ? 21.497  26.479  -28.014 1.00 15.68 ? 779  ILE A CB    1 
ATOM   6425 C  CG1   . ILE A 1 779 ? 21.977  26.857  -26.610 1.00 14.37 ? 779  ILE A CG1   1 
ATOM   6426 C  CG2   . ILE A 1 779 ? 21.536  27.675  -28.963 1.00 14.50 ? 779  ILE A CG2   1 
ATOM   6427 C  CD1   . ILE A 1 779 ? 23.394  27.443  -26.577 1.00 17.25 ? 779  ILE A CD1   1 
ATOM   6428 N  N     . ALA A 1 780 ? 19.108  24.155  -26.521 1.00 13.23 ? 780  ALA A N     1 
ATOM   6429 C  CA    . ALA A 1 780 ? 18.935  22.801  -25.989 1.00 14.11 ? 780  ALA A CA    1 
ATOM   6430 C  C     . ALA A 1 780 ? 18.188  21.896  -26.975 1.00 14.21 ? 780  ALA A C     1 
ATOM   6431 O  O     . ALA A 1 780 ? 17.217  22.318  -27.605 1.00 13.14 ? 780  ALA A O     1 
ATOM   6432 C  CB    . ALA A 1 780 ? 18.196  22.851  -24.650 1.00 13.89 ? 780  ALA A CB    1 
ATOM   6433 N  N     . SER A 1 781 ? 18.639  20.651  -27.090 1.00 13.70 ? 781  SER A N     1 
ATOM   6434 C  CA    . SER A 1 781 ? 17.933  19.637  -27.867 1.00 16.06 ? 781  SER A CA    1 
ATOM   6435 C  C     . SER A 1 781 ? 16.699  19.197  -27.092 1.00 15.73 ? 781  SER A C     1 
ATOM   6436 O  O     . SER A 1 781 ? 16.556  19.532  -25.915 1.00 15.30 ? 781  SER A O     1 
ATOM   6437 C  CB    . SER A 1 781 ? 18.851  18.435  -28.138 1.00 15.88 ? 781  SER A CB    1 
ATOM   6438 O  OG    . SER A 1 781 ? 19.961  18.836  -28.922 1.00 25.32 ? 781  SER A OG    1 
ATOM   6439 N  N     . VAL A 1 782 ? 15.796  18.478  -27.756 1.00 15.05 ? 782  VAL A N     1 
ATOM   6440 C  CA    . VAL A 1 782 ? 14.572  17.981  -27.111 1.00 14.46 ? 782  VAL A CA    1 
ATOM   6441 C  C     . VAL A 1 782 ? 14.411  16.493  -27.398 1.00 15.07 ? 782  VAL A C     1 
ATOM   6442 O  O     . VAL A 1 782 ? 14.707  16.035  -28.505 1.00 14.00 ? 782  VAL A O     1 
ATOM   6443 C  CB    . VAL A 1 782 ? 13.313  18.743  -27.590 1.00 14.31 ? 782  VAL A CB    1 
ATOM   6444 C  CG1   . VAL A 1 782 ? 12.047  18.180  -26.945 1.00 14.66 ? 782  VAL A CG1   1 
ATOM   6445 C  CG2   . VAL A 1 782 ? 13.440  20.248  -27.312 1.00 14.95 ? 782  VAL A CG2   1 
ATOM   6446 N  N     . SER A 1 783 ? 13.965  15.736  -26.398 1.00 14.14 ? 783  SER A N     1 
ATOM   6447 C  CA    . SER A 1 783 ? 13.591  14.344  -26.620 1.00 18.07 ? 783  SER A CA    1 
ATOM   6448 C  C     . SER A 1 783 ? 12.454  13.908  -25.713 1.00 19.50 ? 783  SER A C     1 
ATOM   6449 O  O     . SER A 1 783 ? 12.292  14.430  -24.610 1.00 18.44 ? 783  SER A O     1 
ATOM   6450 C  CB    . SER A 1 783 ? 14.789  13.404  -26.447 1.00 20.56 ? 783  SER A CB    1 
ATOM   6451 O  OG    . SER A 1 783 ? 14.476  12.118  -26.966 1.00 23.66 ? 783  SER A OG    1 
ATOM   6452 N  N     . SER A 1 784 ? 11.655  12.963  -26.202 1.00 21.51 ? 784  SER A N     1 
ATOM   6453 C  CA    . SER A 1 784 ? 10.667  12.282  -25.372 1.00 21.87 ? 784  SER A CA    1 
ATOM   6454 C  C     . SER A 1 784 ? 11.406  11.326  -24.450 1.00 23.15 ? 784  SER A C     1 
ATOM   6455 O  O     . SER A 1 784 ? 12.380  10.692  -24.858 1.00 25.03 ? 784  SER A O     1 
ATOM   6456 C  CB    . SER A 1 784 ? 9.674   11.508  -26.234 1.00 20.26 ? 784  SER A CB    1 
ATOM   6457 O  OG    . SER A 1 784 ? 8.954   12.377  -27.089 1.00 21.51 ? 784  SER A OG    1 
ATOM   6458 N  N     . ALA A 1 785 ? 10.946  11.230  -23.207 1.00 24.91 ? 785  ALA A N     1 
ATOM   6459 C  CA    . ALA A 1 785 ? 11.616  10.416  -22.198 1.00 27.06 ? 785  ALA A CA    1 
ATOM   6460 C  C     . ALA A 1 785 ? 10.840  9.130   -21.896 1.00 27.14 ? 785  ALA A C     1 
ATOM   6461 O  O     . ALA A 1 785 ? 10.035  9.088   -20.966 1.00 27.01 ? 785  ALA A O     1 
ATOM   6462 C  CB    . ALA A 1 785 ? 11.822  11.231  -20.934 1.00 27.19 ? 785  ALA A CB    1 
ATOM   6463 N  N     . ASN A 1 786 ? 11.088  8.088   -22.687 1.00 27.72 ? 786  ASN A N     1 
ATOM   6464 C  CA    . ASN A 1 786 ? 10.406  6.804   -22.511 1.00 28.96 ? 786  ASN A CA    1 
ATOM   6465 C  C     . ASN A 1 786 ? 11.260  5.760   -21.789 1.00 28.65 ? 786  ASN A C     1 
ATOM   6466 O  O     . ASN A 1 786 ? 12.471  5.668   -22.013 1.00 26.53 ? 786  ASN A O     1 
ATOM   6467 C  CB    . ASN A 1 786 ? 9.932   6.246   -23.857 1.00 29.91 ? 786  ASN A CB    1 
ATOM   6468 C  CG    . ASN A 1 786 ? 9.007   7.198   -24.597 1.00 32.59 ? 786  ASN A CG    1 
ATOM   6469 O  OD1   . ASN A 1 786 ? 7.969   7.612   -24.076 1.00 33.95 ? 786  ASN A OD1   1 
ATOM   6470 N  ND2   . ASN A 1 786 ? 9.380   7.544   -25.826 1.00 30.06 ? 786  ASN A ND2   1 
ATOM   6471 N  N     . ASN A 1 787 ? 10.606  4.978   -20.929 1.00 29.33 ? 787  ASN A N     1 
ATOM   6472 C  CA    . ASN A 1 787 ? 11.239  3.901   -20.150 1.00 30.04 ? 787  ASN A CA    1 
ATOM   6473 C  C     . ASN A 1 787 ? 12.473  4.328   -19.353 1.00 29.29 ? 787  ASN A C     1 
ATOM   6474 O  O     . ASN A 1 787 ? 13.519  3.677   -19.417 1.00 29.87 ? 787  ASN A O     1 
ATOM   6475 C  CB    . ASN A 1 787 ? 11.570  2.690   -21.041 1.00 31.62 ? 787  ASN A CB    1 
ATOM   6476 C  CG    . ASN A 1 787 ? 10.365  2.181   -21.821 1.00 33.59 ? 787  ASN A CG    1 
ATOM   6477 O  OD1   . ASN A 1 787 ? 10.426  2.033   -23.041 1.00 34.33 ? 787  ASN A OD1   1 
ATOM   6478 N  ND2   . ASN A 1 787 ? 9.266   1.912   -21.120 1.00 34.71 ? 787  ASN A ND2   1 
ATOM   6479 N  N     . ILE A 1 788 ? 12.336  5.421   -18.602 1.00 28.21 ? 788  ILE A N     1 
ATOM   6480 C  CA    . ILE A 1 788 ? 13.425  5.947   -17.770 1.00 28.03 ? 788  ILE A CA    1 
ATOM   6481 C  C     . ILE A 1 788 ? 13.893  4.911   -16.739 1.00 27.90 ? 788  ILE A C     1 
ATOM   6482 O  O     . ILE A 1 788 ? 15.095  4.666   -16.601 1.00 26.21 ? 788  ILE A O     1 
ATOM   6483 C  CB    . ILE A 1 788 ? 13.017  7.264   -17.054 1.00 28.39 ? 788  ILE A CB    1 
ATOM   6484 C  CG1   . ILE A 1 788 ? 12.449  8.278   -18.057 1.00 28.73 ? 788  ILE A CG1   1 
ATOM   6485 C  CG2   . ILE A 1 788 ? 14.203  7.853   -16.280 1.00 28.56 ? 788  ILE A CG2   1 
ATOM   6486 C  CD1   . ILE A 1 788 ? 11.642  9.399   -17.421 1.00 29.05 ? 788  ILE A CD1   1 
ATOM   6487 N  N     . ALA A 1 789 ? 12.930  4.303   -16.041 1.00 27.81 ? 789  ALA A N     1 
ATOM   6488 C  CA    . ALA A 1 789 ? 13.191  3.293   -15.011 1.00 28.42 ? 789  ALA A CA    1 
ATOM   6489 C  C     . ALA A 1 789 ? 14.039  2.128   -15.516 1.00 28.85 ? 789  ALA A C     1 
ATOM   6490 O  O     . ALA A 1 789 ? 14.900  1.625   -14.793 1.00 29.05 ? 789  ALA A O     1 
ATOM   6491 C  CB    . ALA A 1 789 ? 11.875  2.778   -14.433 1.00 28.08 ? 789  ALA A CB    1 
ATOM   6492 N  N     . LYS A 1 790 ? 13.797  1.720   -16.761 1.00 29.30 ? 790  LYS A N     1 
ATOM   6493 C  CA    . LYS A 1 790 ? 14.512  0.611   -17.400 1.00 30.10 ? 790  LYS A CA    1 
ATOM   6494 C  C     . LYS A 1 790 ? 16.038  0.745   -17.316 1.00 29.96 ? 790  LYS A C     1 
ATOM   6495 O  O     . LYS A 1 790 ? 16.742  -0.250  -17.140 1.00 30.28 ? 790  LYS A O     1 
ATOM   6496 C  CB    . LYS A 1 790 ? 14.064  0.489   -18.863 1.00 30.56 ? 790  LYS A CB    1 
ATOM   6497 C  CG    . LYS A 1 790 ? 14.286  -0.871  -19.516 1.00 32.59 ? 790  LYS A CG    1 
ATOM   6498 C  CD    . LYS A 1 790 ? 15.593  -0.927  -20.295 1.00 34.58 ? 790  LYS A CD    1 
ATOM   6499 C  CE    . LYS A 1 790 ? 15.531  -1.946  -21.427 1.00 34.72 ? 790  LYS A CE    1 
ATOM   6500 N  NZ    . LYS A 1 790 ? 14.656  -1.486  -22.545 1.00 32.38 ? 790  LYS A NZ    1 
ATOM   6501 N  N     . TYR A 1 791 ? 16.536  1.975   -17.434 1.00 28.73 ? 791  TYR A N     1 
ATOM   6502 C  CA    . TYR A 1 791 ? 17.973  2.236   -17.498 1.00 27.49 ? 791  TYR A CA    1 
ATOM   6503 C  C     . TYR A 1 791 ? 18.521  2.878   -16.217 1.00 26.75 ? 791  TYR A C     1 
ATOM   6504 O  O     . TYR A 1 791 ? 19.663  3.351   -16.184 1.00 24.66 ? 791  TYR A O     1 
ATOM   6505 C  CB    . TYR A 1 791 ? 18.288  3.119   -18.715 1.00 28.12 ? 791  TYR A CB    1 
ATOM   6506 C  CG    . TYR A 1 791 ? 17.872  2.525   -20.047 1.00 27.69 ? 791  TYR A CG    1 
ATOM   6507 C  CD1   . TYR A 1 791 ? 16.674  2.897   -20.653 1.00 28.17 ? 791  TYR A CD1   1 
ATOM   6508 C  CD2   . TYR A 1 791 ? 18.681  1.591   -20.704 1.00 27.65 ? 791  TYR A CD2   1 
ATOM   6509 C  CE1   . TYR A 1 791 ? 16.288  2.358   -21.875 1.00 28.77 ? 791  TYR A CE1   1 
ATOM   6510 C  CE2   . TYR A 1 791 ? 18.304  1.047   -21.926 1.00 27.22 ? 791  TYR A CE2   1 
ATOM   6511 C  CZ    . TYR A 1 791 ? 17.109  1.439   -22.506 1.00 28.79 ? 791  TYR A CZ    1 
ATOM   6512 O  OH    . TYR A 1 791 ? 16.726  0.910   -23.716 1.00 30.92 ? 791  TYR A OH    1 
ATOM   6513 N  N     . ASP A 1 792 ? 17.699  2.881   -15.169 1.00 26.38 ? 792  ASP A N     1 
ATOM   6514 C  CA    . ASP A 1 792 ? 18.029  3.509   -13.892 1.00 26.53 ? 792  ASP A CA    1 
ATOM   6515 C  C     . ASP A 1 792 ? 18.611  2.472   -12.927 1.00 26.46 ? 792  ASP A C     1 
ATOM   6516 O  O     . ASP A 1 792 ? 17.874  1.682   -12.336 1.00 26.44 ? 792  ASP A O     1 
ATOM   6517 C  CB    . ASP A 1 792 ? 16.770  4.163   -13.300 1.00 26.95 ? 792  ASP A CB    1 
ATOM   6518 C  CG    . ASP A 1 792 ? 17.057  5.036   -12.080 1.00 28.86 ? 792  ASP A CG    1 
ATOM   6519 O  OD1   . ASP A 1 792 ? 18.206  5.059   -11.582 1.00 28.29 ? 792  ASP A OD1   1 
ATOM   6520 O  OD2   . ASP A 1 792 ? 16.109  5.708   -11.615 1.00 29.89 ? 792  ASP A OD2   1 
ATOM   6521 N  N     . VAL A 1 793 ? 19.935  2.480   -12.783 1.00 26.43 ? 793  VAL A N     1 
ATOM   6522 C  CA    . VAL A 1 793 ? 20.631  1.547   -11.886 1.00 26.10 ? 793  VAL A CA    1 
ATOM   6523 C  C     . VAL A 1 793 ? 21.317  2.301   -10.743 1.00 25.78 ? 793  VAL A C     1 
ATOM   6524 O  O     . VAL A 1 793 ? 22.438  2.800   -10.893 1.00 26.01 ? 793  VAL A O     1 
ATOM   6525 C  CB    . VAL A 1 793 ? 21.655  0.655   -12.644 1.00 25.57 ? 793  VAL A CB    1 
ATOM   6526 C  CG1   . VAL A 1 793 ? 22.212  -0.428  -11.721 1.00 25.38 ? 793  VAL A CG1   1 
ATOM   6527 C  CG2   . VAL A 1 793 ? 21.018  0.021   -13.876 1.00 24.62 ? 793  VAL A CG2   1 
ATOM   6528 N  N     . GLY A 1 794 ? 20.628  2.377   -9.605  1.00 26.42 ? 794  GLY A N     1 
ATOM   6529 C  CA    . GLY A 1 794 ? 21.095  3.139   -8.444  1.00 27.10 ? 794  GLY A CA    1 
ATOM   6530 C  C     . GLY A 1 794 ? 21.331  4.608   -8.756  1.00 27.62 ? 794  GLY A C     1 
ATOM   6531 O  O     . GLY A 1 794 ? 22.301  5.203   -8.279  1.00 27.55 ? 794  GLY A O     1 
ATOM   6532 N  N     . GLY A 1 795 ? 20.447  5.186   -9.570  1.00 27.45 ? 795  GLY A N     1 
ATOM   6533 C  CA    . GLY A 1 795 ? 20.570  6.578   -9.998  1.00 27.47 ? 795  GLY A CA    1 
ATOM   6534 C  C     . GLY A 1 795 ? 21.549  6.798   -11.142 1.00 27.72 ? 795  GLY A C     1 
ATOM   6535 O  O     . GLY A 1 795 ? 21.729  7.926   -11.598 1.00 27.92 ? 795  GLY A O     1 
ATOM   6536 N  N     . PHE A 1 796 ? 22.183  5.718   -11.600 1.00 27.65 ? 796  PHE A N     1 
ATOM   6537 C  CA    . PHE A 1 796 ? 23.198  5.776   -12.654 1.00 26.91 ? 796  PHE A CA    1 
ATOM   6538 C  C     . PHE A 1 796 ? 22.752  4.999   -13.898 1.00 26.24 ? 796  PHE A C     1 
ATOM   6539 O  O     . PHE A 1 796 ? 21.897  4.115   -13.799 1.00 26.65 ? 796  PHE A O     1 
ATOM   6540 C  CB    . PHE A 1 796 ? 24.541  5.247   -12.134 1.00 27.32 ? 796  PHE A CB    1 
ATOM   6541 C  CG    . PHE A 1 796 ? 25.232  6.181   -11.174 1.00 28.05 ? 796  PHE A CG    1 
ATOM   6542 C  CD1   . PHE A 1 796 ? 26.055  7.201   -11.644 1.00 27.79 ? 796  PHE A CD1   1 
ATOM   6543 C  CD2   . PHE A 1 796 ? 25.062  6.038   -9.800  1.00 28.16 ? 796  PHE A CD2   1 
ATOM   6544 C  CE1   . PHE A 1 796 ? 26.697  8.068   -10.760 1.00 28.33 ? 796  PHE A CE1   1 
ATOM   6545 C  CE2   . PHE A 1 796 ? 25.700  6.900   -8.906  1.00 28.66 ? 796  PHE A CE2   1 
ATOM   6546 C  CZ    . PHE A 1 796 ? 26.520  7.916   -9.387  1.00 27.33 ? 796  PHE A CZ    1 
ATOM   6547 N  N     . PRO A 1 797 ? 23.313  5.340   -15.075 1.00 26.04 ? 797  PRO A N     1 
ATOM   6548 C  CA    . PRO A 1 797 ? 22.908  4.691   -16.331 1.00 25.75 ? 797  PRO A CA    1 
ATOM   6549 C  C     . PRO A 1 797 ? 23.311  3.220   -16.455 1.00 26.34 ? 797  PRO A C     1 
ATOM   6550 O  O     . PRO A 1 797 ? 24.478  2.864   -16.241 1.00 24.50 ? 797  PRO A O     1 
ATOM   6551 C  CB    . PRO A 1 797 ? 23.605  5.533   -17.410 1.00 24.49 ? 797  PRO A CB    1 
ATOM   6552 C  CG    . PRO A 1 797 ? 24.688  6.252   -16.706 1.00 26.77 ? 797  PRO A CG    1 
ATOM   6553 C  CD    . PRO A 1 797 ? 24.209  6.486   -15.317 1.00 26.25 ? 797  PRO A CD    1 
ATOM   6554 N  N     . GLY A 1 798 ? 22.333  2.382   -16.792 1.00 27.17 ? 798  GLY A N     1 
ATOM   6555 C  CA    . GLY A 1 798 ? 22.572  0.972   -17.101 1.00 28.01 ? 798  GLY A CA    1 
ATOM   6556 C  C     . GLY A 1 798 ? 23.027  0.784   -18.541 1.00 29.19 ? 798  GLY A C     1 
ATOM   6557 O  O     . GLY A 1 798 ? 23.210  1.767   -19.266 1.00 29.48 ? 798  GLY A O     1 
ATOM   6558 N  N     . PRO A 1 799 ? 23.222  -0.479  -18.968 1.00 29.28 ? 799  PRO A N     1 
ATOM   6559 C  CA    . PRO A 1 799 ? 23.663  -0.766  -20.341 1.00 28.48 ? 799  PRO A CA    1 
ATOM   6560 C  C     . PRO A 1 799 ? 22.691  -0.262  -21.419 1.00 27.63 ? 799  PRO A C     1 
ATOM   6561 O  O     . PRO A 1 799 ? 21.473  -0.320  -21.235 1.00 26.62 ? 799  PRO A O     1 
ATOM   6562 C  CB    . PRO A 1 799 ? 23.773  -2.298  -20.372 1.00 29.26 ? 799  PRO A CB    1 
ATOM   6563 C  CG    . PRO A 1 799 ? 23.011  -2.781  -19.175 1.00 30.25 ? 799  PRO A CG    1 
ATOM   6564 C  CD    . PRO A 1 799 ? 23.141  -1.703  -18.151 1.00 29.89 ? 799  PRO A CD    1 
ATOM   6565 N  N     . LYS A 1 800 ? 23.254  0.232   -22.523 1.00 27.01 ? 800  LYS A N     1 
ATOM   6566 C  CA    . LYS A 1 800 ? 22.503  0.772   -23.671 1.00 26.75 ? 800  LYS A CA    1 
ATOM   6567 C  C     . LYS A 1 800 ? 21.623  1.991   -23.340 1.00 26.29 ? 800  LYS A C     1 
ATOM   6568 O  O     . LYS A 1 800 ? 20.730  2.348   -24.118 1.00 25.73 ? 800  LYS A O     1 
ATOM   6569 C  CB    . LYS A 1 800 ? 21.670  -0.318  -24.365 1.00 28.20 ? 800  LYS A CB    1 
ATOM   6570 C  CG    . LYS A 1 800 ? 22.467  -1.488  -24.932 1.00 30.72 ? 800  LYS A CG    1 
ATOM   6571 C  CD    . LYS A 1 800 ? 21.631  -2.315  -25.914 1.00 34.07 ? 800  LYS A CD    1 
ATOM   6572 C  CE    . LYS A 1 800 ? 20.594  -3.194  -25.213 1.00 35.50 ? 800  LYS A CE    1 
ATOM   6573 N  NZ    . LYS A 1 800 ? 21.190  -4.434  -24.645 1.00 36.43 ? 800  LYS A NZ    1 
ATOM   6574 N  N     . CYS A 1 801 ? 21.883  2.629   -22.198 1.00 23.76 ? 801  CYS A N     1 
ATOM   6575 C  CA    . CYS A 1 801 ? 21.130  3.810   -21.787 1.00 22.09 ? 801  CYS A CA    1 
ATOM   6576 C  C     . CYS A 1 801 ? 21.221  4.922   -22.833 1.00 20.37 ? 801  CYS A C     1 
ATOM   6577 O  O     . CYS A 1 801 ? 22.320  5.385   -23.149 1.00 18.70 ? 801  CYS A O     1 
ATOM   6578 C  CB    . CYS A 1 801 ? 21.614  4.327   -20.429 1.00 21.74 ? 801  CYS A CB    1 
ATOM   6579 S  SG    . CYS A 1 801 ? 20.745  5.819   -19.866 1.00 22.06 ? 801  CYS A SG    1 
ATOM   6580 N  N     . PRO A 1 802 ? 20.063  5.353   -23.374 1.00 19.55 ? 802  PRO A N     1 
ATOM   6581 C  CA    . PRO A 1 802 ? 20.060  6.432   -24.369 1.00 19.47 ? 802  PRO A CA    1 
ATOM   6582 C  C     . PRO A 1 802 ? 20.585  7.740   -23.783 1.00 18.07 ? 802  PRO A C     1 
ATOM   6583 O  O     . PRO A 1 802 ? 20.505  7.952   -22.567 1.00 19.72 ? 802  PRO A O     1 
ATOM   6584 C  CB    . PRO A 1 802 ? 18.574  6.569   -24.746 1.00 19.16 ? 802  PRO A CB    1 
ATOM   6585 C  CG    . PRO A 1 802 ? 17.950  5.261   -24.337 1.00 21.12 ? 802  PRO A CG    1 
ATOM   6586 C  CD    . PRO A 1 802 ? 18.702  4.850   -23.109 1.00 20.21 ? 802  PRO A CD    1 
ATOM   6587 N  N     . PHE A 1 803 ? 21.133  8.584   -24.651 1.00 16.58 ? 803  PHE A N     1 
ATOM   6588 C  CA    . PHE A 1 803 ? 21.730  9.867   -24.278 1.00 16.56 ? 803  PHE A CA    1 
ATOM   6589 C  C     . PHE A 1 803 ? 20.808  10.728  -23.415 1.00 17.39 ? 803  PHE A C     1 
ATOM   6590 O  O     . PHE A 1 803 ? 21.216  11.197  -22.353 1.00 17.43 ? 803  PHE A O     1 
ATOM   6591 C  CB    . PHE A 1 803 ? 22.130  10.632  -25.544 1.00 17.09 ? 803  PHE A CB    1 
ATOM   6592 C  CG    . PHE A 1 803 ? 23.036  11.812  -25.295 1.00 17.89 ? 803  PHE A CG    1 
ATOM   6593 C  CD1   . PHE A 1 803 ? 24.407  11.633  -25.125 1.00 16.13 ? 803  PHE A CD1   1 
ATOM   6594 C  CD2   . PHE A 1 803 ? 22.523  13.105  -25.271 1.00 17.52 ? 803  PHE A CD2   1 
ATOM   6595 C  CE1   . PHE A 1 803 ? 25.252  12.724  -24.914 1.00 17.07 ? 803  PHE A CE1   1 
ATOM   6596 C  CE2   . PHE A 1 803 ? 23.360  14.205  -25.059 1.00 19.21 ? 803  PHE A CE2   1 
ATOM   6597 C  CZ    . PHE A 1 803 ? 24.729  14.013  -24.884 1.00 16.92 ? 803  PHE A CZ    1 
ATOM   6598 N  N     . HIS A 1 804 ? 19.572  10.929  -23.869 1.00 16.52 ? 804  HIS A N     1 
ATOM   6599 C  CA    . HIS A 1 804 ? 18.622  11.778  -23.141 1.00 17.11 ? 804  HIS A CA    1 
ATOM   6600 C  C     . HIS A 1 804 ? 18.252  11.218  -21.767 1.00 17.63 ? 804  HIS A C     1 
ATOM   6601 O  O     . HIS A 1 804 ? 18.116  11.978  -20.805 1.00 18.26 ? 804  HIS A O     1 
ATOM   6602 C  CB    . HIS A 1 804 ? 17.377  12.094  -23.980 1.00 15.88 ? 804  HIS A CB    1 
ATOM   6603 C  CG    . HIS A 1 804 ? 16.595  10.889  -24.403 1.00 16.67 ? 804  HIS A CG    1 
ATOM   6604 N  ND1   . HIS A 1 804 ? 17.081  9.956   -25.295 1.00 16.15 ? 804  HIS A ND1   1 
ATOM   6605 C  CD2   . HIS A 1 804 ? 15.344  10.484  -24.080 1.00 17.06 ? 804  HIS A CD2   1 
ATOM   6606 C  CE1   . HIS A 1 804 ? 16.168  9.020   -25.490 1.00 16.71 ? 804  HIS A CE1   1 
ATOM   6607 N  NE2   . HIS A 1 804 ? 15.104  9.317   -24.766 1.00 16.43 ? 804  HIS A NE2   1 
ATOM   6608 N  N     . ILE A 1 805 ? 18.120  9.895   -21.676 1.00 15.83 ? 805  ILE A N     1 
ATOM   6609 C  CA    . ILE A 1 805 ? 17.822  9.232   -20.407 1.00 16.68 ? 805  ILE A CA    1 
ATOM   6610 C  C     . ILE A 1 805 ? 18.984  9.420   -19.425 1.00 16.80 ? 805  ILE A C     1 
ATOM   6611 O  O     . ILE A 1 805 ? 18.762  9.711   -18.247 1.00 16.49 ? 805  ILE A O     1 
ATOM   6612 C  CB    . ILE A 1 805 ? 17.466  7.723   -20.600 1.00 17.29 ? 805  ILE A CB    1 
ATOM   6613 C  CG1   . ILE A 1 805 ? 16.313  7.551   -21.605 1.00 17.59 ? 805  ILE A CG1   1 
ATOM   6614 C  CG2   . ILE A 1 805 ? 17.110  7.055   -19.269 1.00 17.11 ? 805  ILE A CG2   1 
ATOM   6615 C  CD1   . ILE A 1 805 ? 15.008  8.271   -21.229 1.00 19.03 ? 805  ILE A CD1   1 
ATOM   6616 N  N     . ARG A 1 806 ? 20.214  9.278   -19.925 1.00 14.89 ? 806  ARG A N     1 
ATOM   6617 C  CA    . ARG A 1 806 ? 21.419  9.589   -19.147 1.00 16.23 ? 806  ARG A CA    1 
ATOM   6618 C  C     . ARG A 1 806 ? 21.359  11.010  -18.581 1.00 15.91 ? 806  ARG A C     1 
ATOM   6619 O  O     . ARG A 1 806 ? 21.740  11.239  -17.435 1.00 15.03 ? 806  ARG A O     1 
ATOM   6620 C  CB    . ARG A 1 806 ? 22.682  9.402   -19.998 1.00 15.18 ? 806  ARG A CB    1 
ATOM   6621 C  CG    . ARG A 1 806 ? 23.994  9.759   -19.287 1.00 17.30 ? 806  ARG A CG    1 
ATOM   6622 C  CD    . ARG A 1 806 ? 25.195  9.628   -20.220 1.00 18.28 ? 806  ARG A CD    1 
ATOM   6623 N  NE    . ARG A 1 806 ? 25.394  8.245   -20.650 1.00 20.56 ? 806  ARG A NE    1 
ATOM   6624 C  CZ    . ARG A 1 806 ? 26.149  7.355   -20.012 1.00 21.97 ? 806  ARG A CZ    1 
ATOM   6625 N  NH1   . ARG A 1 806 ? 26.810  7.695   -18.909 1.00 18.21 ? 806  ARG A NH1   1 
ATOM   6626 N  NH2   . ARG A 1 806 ? 26.246  6.117   -20.482 1.00 21.53 ? 806  ARG A NH2   1 
ATOM   6627 N  N     . GLY A 1 807 ? 20.881  11.952  -19.395 1.00 15.99 ? 807  GLY A N     1 
ATOM   6628 C  CA    . GLY A 1 807 ? 20.677  13.335  -18.960 1.00 15.50 ? 807  GLY A CA    1 
ATOM   6629 C  C     . GLY A 1 807 ? 19.692  13.460  -17.807 1.00 15.91 ? 807  GLY A C     1 
ATOM   6630 O  O     . GLY A 1 807 ? 19.928  14.205  -16.857 1.00 15.68 ? 807  GLY A O     1 
ATOM   6631 N  N     . ILE A 1 808 ? 18.585  12.729  -17.898 1.00 16.40 ? 808  ILE A N     1 
ATOM   6632 C  CA    . ILE A 1 808 ? 17.567  12.716  -16.841 1.00 16.23 ? 808  ILE A CA    1 
ATOM   6633 C  C     . ILE A 1 808 ? 18.117  12.143  -15.534 1.00 16.32 ? 808  ILE A C     1 
ATOM   6634 O  O     . ILE A 1 808 ? 17.871  12.694  -14.457 1.00 17.24 ? 808  ILE A O     1 
ATOM   6635 C  CB    . ILE A 1 808 ? 16.310  11.939  -17.288 1.00 16.04 ? 808  ILE A CB    1 
ATOM   6636 C  CG1   . ILE A 1 808 ? 15.594  12.711  -18.397 1.00 16.70 ? 808  ILE A CG1   1 
ATOM   6637 C  CG2   . ILE A 1 808 ? 15.357  11.693  -16.110 1.00 13.68 ? 808  ILE A CG2   1 
ATOM   6638 C  CD1   . ILE A 1 808 ? 14.764  11.840  -19.310 1.00 19.72 ? 808  ILE A CD1   1 
ATOM   6639 N  N     . LEU A 1 809 ? 18.860  11.043  -15.635 1.00 16.29 ? 809  LEU A N     1 
ATOM   6640 C  CA    . LEU A 1 809 ? 19.476  10.414  -14.459 1.00 17.30 ? 809  LEU A CA    1 
ATOM   6641 C  C     . LEU A 1 809 ? 20.489  11.341  -13.795 1.00 16.80 ? 809  LEU A C     1 
ATOM   6642 O  O     . LEU A 1 809 ? 20.582  11.394  -12.572 1.00 19.64 ? 809  LEU A O     1 
ATOM   6643 C  CB    . LEU A 1 809 ? 20.122  9.075   -14.824 1.00 16.65 ? 809  LEU A CB    1 
ATOM   6644 C  CG    . LEU A 1 809 ? 19.177  8.014   -15.401 1.00 19.09 ? 809  LEU A CG    1 
ATOM   6645 C  CD1   . LEU A 1 809 ? 19.955  6.801   -15.871 1.00 20.14 ? 809  LEU A CD1   1 
ATOM   6646 C  CD2   . LEU A 1 809 ? 18.089  7.610   -14.405 1.00 20.22 ? 809  LEU A CD2   1 
ATOM   6647 N  N     . THR A 1 810 ? 21.229  12.084  -14.612 1.00 17.17 ? 810  THR A N     1 
ATOM   6648 C  CA    . THR A 1 810 ? 22.146  13.110  -14.124 1.00 16.90 ? 810  THR A CA    1 
ATOM   6649 C  C     . THR A 1 810 ? 21.365  14.179  -13.354 1.00 17.44 ? 810  THR A C     1 
ATOM   6650 O  O     . THR A 1 810 ? 21.757  14.572  -12.251 1.00 16.99 ? 810  THR A O     1 
ATOM   6651 C  CB    . THR A 1 810 ? 22.924  13.751  -15.293 1.00 16.84 ? 810  THR A CB    1 
ATOM   6652 O  OG1   . THR A 1 810 ? 23.544  12.723  -16.073 1.00 17.99 ? 810  THR A OG1   1 
ATOM   6653 C  CG2   . THR A 1 810 ? 23.995  14.700  -14.787 1.00 18.18 ? 810  THR A CG2   1 
ATOM   6654 N  N     . TYR A 1 811 ? 20.253  14.627  -13.939 1.00 16.53 ? 811  TYR A N     1 
ATOM   6655 C  CA    . TYR A 1 811 ? 19.362  15.609  -13.318 1.00 16.64 ? 811  TYR A CA    1 
ATOM   6656 C  C     . TYR A 1 811 ? 18.771  15.112  -11.992 1.00 17.06 ? 811  TYR A C     1 
ATOM   6657 O  O     . TYR A 1 811 ? 18.745  15.855  -11.005 1.00 15.40 ? 811  TYR A O     1 
ATOM   6658 C  CB    . TYR A 1 811 ? 18.248  16.004  -14.301 1.00 17.28 ? 811  TYR A CB    1 
ATOM   6659 C  CG    . TYR A 1 811 ? 17.183  16.928  -13.732 1.00 15.99 ? 811  TYR A CG    1 
ATOM   6660 C  CD1   . TYR A 1 811 ? 17.393  18.307  -13.663 1.00 16.03 ? 811  TYR A CD1   1 
ATOM   6661 C  CD2   . TYR A 1 811 ? 15.965  16.424  -13.276 1.00 16.83 ? 811  TYR A CD2   1 
ATOM   6662 C  CE1   . TYR A 1 811 ? 16.425  19.159  -13.141 1.00 17.52 ? 811  TYR A CE1   1 
ATOM   6663 C  CE2   . TYR A 1 811 ? 14.980  17.270  -12.758 1.00 16.81 ? 811  TYR A CE2   1 
ATOM   6664 C  CZ    . TYR A 1 811 ? 15.222  18.635  -12.690 1.00 17.38 ? 811  TYR A CZ    1 
ATOM   6665 O  OH    . TYR A 1 811 ? 14.266  19.482  -12.178 1.00 18.08 ? 811  TYR A OH    1 
ATOM   6666 N  N     . ASN A 1 812 ? 18.305  13.862  -11.972 1.00 18.67 ? 812  ASN A N     1 
ATOM   6667 C  CA    . ASN A 1 812 ? 17.737  13.266  -10.756 1.00 21.09 ? 812  ASN A CA    1 
ATOM   6668 C  C     . ASN A 1 812 ? 18.714  13.266  -9.578  1.00 21.88 ? 812  ASN A C     1 
ATOM   6669 O  O     . ASN A 1 812 ? 18.317  13.550  -8.445  1.00 22.76 ? 812  ASN A O     1 
ATOM   6670 C  CB    . ASN A 1 812 ? 17.216  11.846  -11.020 1.00 21.33 ? 812  ASN A CB    1 
ATOM   6671 C  CG    . ASN A 1 812 ? 16.005  11.821  -11.946 1.00 22.02 ? 812  ASN A CG    1 
ATOM   6672 O  OD1   . ASN A 1 812 ? 15.413  12.858  -12.260 1.00 21.26 ? 812  ASN A OD1   1 
ATOM   6673 N  ND2   . ASN A 1 812 ? 15.628  10.625  -12.384 1.00 20.20 ? 812  ASN A ND2   1 
ATOM   6674 N  N     . ARG A 1 813 ? 19.985  12.969  -9.859  1.00 22.54 ? 813  ARG A N     1 
ATOM   6675 C  CA    . ARG A 1 813 ? 21.044  12.981  -8.842  1.00 23.46 ? 813  ARG A CA    1 
ATOM   6676 C  C     . ARG A 1 813 ? 21.346  14.399  -8.364  1.00 23.80 ? 813  ARG A C     1 
ATOM   6677 O  O     . ARG A 1 813 ? 21.705  14.607  -7.201  1.00 22.88 ? 813  ARG A O     1 
ATOM   6678 C  CB    . ARG A 1 813 ? 22.333  12.343  -9.373  1.00 23.87 ? 813  ARG A CB    1 
ATOM   6679 C  CG    . ARG A 1 813 ? 22.247  10.848  -9.668  1.00 24.15 ? 813  ARG A CG    1 
ATOM   6680 C  CD    . ARG A 1 813 ? 23.628  10.217  -9.844  1.00 23.77 ? 813  ARG A CD    1 
ATOM   6681 N  NE    . ARG A 1 813 ? 24.466  10.938  -10.804 1.00 24.26 ? 813  ARG A NE    1 
ATOM   6682 C  CZ    . ARG A 1 813 ? 24.516  10.695  -12.113 1.00 24.22 ? 813  ARG A CZ    1 
ATOM   6683 N  NH1   . ARG A 1 813 ? 23.771  9.740   -12.661 1.00 22.94 ? 813  ARG A NH1   1 
ATOM   6684 N  NH2   . ARG A 1 813 ? 25.319  11.417  -12.883 1.00 23.27 ? 813  ARG A NH2   1 
ATOM   6685 N  N     . ALA A 1 814 ? 21.202  15.364  -9.271  1.00 23.74 ? 814  ALA A N     1 
ATOM   6686 C  CA    . ALA A 1 814 ? 21.477  16.767  -8.975  1.00 24.17 ? 814  ALA A CA    1 
ATOM   6687 C  C     . ALA A 1 814 ? 20.408  17.391  -8.080  1.00 24.65 ? 814  ALA A C     1 
ATOM   6688 O  O     . ALA A 1 814 ? 20.699  18.316  -7.324  1.00 24.49 ? 814  ALA A O     1 
ATOM   6689 C  CB    . ALA A 1 814 ? 21.615  17.564  -10.265 1.00 24.22 ? 814  ALA A CB    1 
ATOM   6690 N  N     . ILE A 1 815 ? 19.179  16.886  -8.173  1.00 25.10 ? 815  ILE A N     1 
ATOM   6691 C  CA    . ILE A 1 815 ? 18.053  17.453  -7.422  1.00 27.34 ? 815  ILE A CA    1 
ATOM   6692 C  C     . ILE A 1 815 ? 17.636  16.636  -6.193  1.00 28.75 ? 815  ILE A C     1 
ATOM   6693 O  O     . ILE A 1 815 ? 16.623  16.939  -5.556  1.00 28.87 ? 815  ILE A O     1 
ATOM   6694 C  CB    . ILE A 1 815 ? 16.812  17.710  -8.322  1.00 26.45 ? 815  ILE A CB    1 
ATOM   6695 C  CG1   . ILE A 1 815 ? 16.238  16.391  -8.862  1.00 27.21 ? 815  ILE A CG1   1 
ATOM   6696 C  CG2   . ILE A 1 815 ? 17.149  18.703  -9.437  1.00 27.34 ? 815  ILE A CG2   1 
ATOM   6697 C  CD1   . ILE A 1 815 ? 14.754  16.449  -9.213  1.00 25.54 ? 815  ILE A CD1   1 
ATOM   6698 N  N     . LYS A 1 816 ? 18.408  15.602  -5.868  1.00 31.23 ? 816  LYS A N     1 
ATOM   6699 C  CA    . LYS A 1 816 ? 18.127  14.780  -4.692  1.00 34.01 ? 816  LYS A CA    1 
ATOM   6700 C  C     . LYS A 1 816 ? 18.332  15.595  -3.415  1.00 35.41 ? 816  LYS A C     1 
ATOM   6701 O  O     . LYS A 1 816 ? 19.429  16.090  -3.152  1.00 35.41 ? 816  LYS A O     1 
ATOM   6702 C  CB    . LYS A 1 816 ? 18.988  13.508  -4.693  1.00 34.71 ? 816  LYS A CB    1 
ATOM   6703 C  CG    . LYS A 1 816 ? 18.648  12.482  -3.595  1.00 37.57 ? 816  LYS A CG    1 
ATOM   6704 C  CD    . LYS A 1 816 ? 17.173  12.038  -3.605  1.00 40.50 ? 816  LYS A CD    1 
ATOM   6705 C  CE    . LYS A 1 816 ? 16.769  11.330  -4.901  1.00 41.73 ? 816  LYS A CE    1 
ATOM   6706 N  NZ    . LYS A 1 816 ? 17.541  10.081  -5.146  1.00 43.82 ? 816  LYS A NZ    1 
ATOM   6707 N  N     . GLY A 1 817 ? 17.262  15.734  -2.638  1.00 37.48 ? 817  GLY A N     1 
ATOM   6708 C  CA    . GLY A 1 817 ? 17.263  16.590  -1.453  1.00 39.19 ? 817  GLY A CA    1 
ATOM   6709 C  C     . GLY A 1 817 ? 16.490  17.876  -1.688  1.00 40.78 ? 817  GLY A C     1 
ATOM   6710 O  O     . GLY A 1 817 ? 15.996  18.494  -0.742  1.00 41.30 ? 817  GLY A O     1 
ATOM   6711 N  N     . ASN A 1 818 ? 16.399  18.281  -2.954  1.00 42.13 ? 818  ASN A N     1 
ATOM   6712 C  CA    . ASN A 1 818 ? 15.607  19.439  -3.356  1.00 42.94 ? 818  ASN A CA    1 
ATOM   6713 C  C     . ASN A 1 818 ? 14.127  19.074  -3.322  1.00 43.79 ? 818  ASN A C     1 
ATOM   6714 O  O     . ASN A 1 818 ? 13.725  18.028  -3.838  1.00 44.21 ? 818  ASN A O     1 
ATOM   6715 C  CB    . ASN A 1 818 ? 16.013  19.897  -4.763  1.00 43.10 ? 818  ASN A CB    1 
ATOM   6716 C  CG    . ASN A 1 818 ? 15.761  21.383  -5.010  1.00 43.57 ? 818  ASN A CG    1 
ATOM   6717 O  OD1   . ASN A 1 818 ? 16.486  22.017  -5.779  1.00 43.25 ? 818  ASN A OD1   1 
ATOM   6718 N  ND2   . ASN A 1 818 ? 14.734  21.940  -4.374  1.00 44.50 ? 818  ASN A ND2   1 
ATOM   6719 N  N     . ILE A 1 819 ? 13.327  19.937  -2.704  1.00 43.99 ? 819  ILE A N     1 
ATOM   6720 C  CA    . ILE A 1 819 ? 11.890  19.714  -2.568  1.00 43.84 ? 819  ILE A CA    1 
ATOM   6721 C  C     . ILE A 1 819 ? 11.105  20.409  -3.688  1.00 43.14 ? 819  ILE A C     1 
ATOM   6722 O  O     . ILE A 1 819 ? 10.113  19.870  -4.185  1.00 43.59 ? 819  ILE A O     1 
ATOM   6723 C  CB    . ILE A 1 819 ? 11.376  20.174  -1.169  1.00 44.17 ? 819  ILE A CB    1 
ATOM   6724 C  CG1   . ILE A 1 819 ? 12.280  19.648  -0.037  1.00 45.00 ? 819  ILE A CG1   1 
ATOM   6725 C  CG2   . ILE A 1 819 ? 9.920   19.774  -0.954  1.00 44.19 ? 819  ILE A CG2   1 
ATOM   6726 C  CD1   . ILE A 1 819 ? 12.313  18.121  0.136   1.00 45.59 ? 819  ILE A CD1   1 
ATOM   6727 N  N     . ASP A 1 820 ? 11.568  21.593  -4.088  1.00 42.37 ? 820  ASP A N     1 
ATOM   6728 C  CA    . ASP A 1 820 ? 10.882  22.412  -5.094  1.00 42.07 ? 820  ASP A CA    1 
ATOM   6729 C  C     . ASP A 1 820 ? 11.248  22.078  -6.545  1.00 41.31 ? 820  ASP A C     1 
ATOM   6730 O  O     . ASP A 1 820 ? 10.635  22.602  -7.481  1.00 40.89 ? 820  ASP A O     1 
ATOM   6731 C  CB    . ASP A 1 820 ? 11.124  23.902  -4.822  1.00 42.82 ? 820  ASP A CB    1 
ATOM   6732 C  CG    . ASP A 1 820 ? 10.318  24.423  -3.642  1.00 43.44 ? 820  ASP A CG    1 
ATOM   6733 O  OD1   . ASP A 1 820 ? 9.261   23.835  -3.321  1.00 43.77 ? 820  ASP A OD1   1 
ATOM   6734 O  OD2   . ASP A 1 820 ? 10.740  25.432  -3.039  1.00 44.78 ? 820  ASP A OD2   1 
ATOM   6735 N  N     . ALA A 1 821 ? 12.244  21.213  -6.726  1.00 39.86 ? 821  ALA A N     1 
ATOM   6736 C  CA    . ALA A 1 821 ? 12.691  20.821  -8.059  1.00 38.80 ? 821  ALA A CA    1 
ATOM   6737 C  C     . ALA A 1 821 ? 11.640  19.969  -8.775  1.00 37.55 ? 821  ALA A C     1 
ATOM   6738 O  O     . ALA A 1 821 ? 11.173  18.968  -8.221  1.00 36.54 ? 821  ALA A O     1 
ATOM   6739 C  CB    . ALA A 1 821 ? 14.009  20.081  -7.975  1.00 39.07 ? 821  ALA A CB    1 
ATOM   6740 N  N     . PRO A 1 822 ? 11.257  20.372  -10.003 1.00 36.80 ? 822  PRO A N     1 
ATOM   6741 C  CA    . PRO A 1 822 ? 10.278  19.626  -10.793 1.00 36.37 ? 822  PRO A CA    1 
ATOM   6742 C  C     . PRO A 1 822 ? 10.827  18.274  -11.233 1.00 35.94 ? 822  PRO A C     1 
ATOM   6743 O  O     . PRO A 1 822 ? 11.969  18.183  -11.698 1.00 35.95 ? 822  PRO A O     1 
ATOM   6744 C  CB    . PRO A 1 822 ? 10.046  20.523  -12.016 1.00 36.32 ? 822  PRO A CB    1 
ATOM   6745 C  CG    . PRO A 1 822 ? 10.574  21.862  -11.634 1.00 36.50 ? 822  PRO A CG    1 
ATOM   6746 C  CD    . PRO A 1 822 ? 11.702  21.590  -10.703 1.00 37.01 ? 822  PRO A CD    1 
ATOM   6747 N  N     . GLN A 1 823 ? 10.018  17.233  -11.069 1.00 34.80 ? 823  GLN A N     1 
ATOM   6748 C  CA    . GLN A 1 823 ? 10.399  15.893  -11.489 1.00 33.88 ? 823  GLN A CA    1 
ATOM   6749 C  C     . GLN A 1 823 ? 10.172  15.725  -12.987 1.00 32.77 ? 823  GLN A C     1 
ATOM   6750 O  O     . GLN A 1 823 ? 9.263   16.333  -13.560 1.00 32.56 ? 823  GLN A O     1 
ATOM   6751 C  CB    . GLN A 1 823 ? 9.613   14.829  -10.712 1.00 34.04 ? 823  GLN A CB    1 
ATOM   6752 C  CG    . GLN A 1 823 ? 9.860   14.805  -9.196  1.00 36.24 ? 823  GLN A CG    1 
ATOM   6753 C  CD    . GLN A 1 823 ? 11.254  14.317  -8.805  1.00 38.79 ? 823  GLN A CD    1 
ATOM   6754 O  OE1   . GLN A 1 823 ? 11.853  14.826  -7.857  1.00 40.15 ? 823  GLN A OE1   1 
ATOM   6755 N  NE2   . GLN A 1 823 ? 11.771  13.327  -9.529  1.00 39.69 ? 823  GLN A NE2   1 
ATOM   6756 N  N     . VAL A 1 824 ? 11.015  14.910  -13.614 1.00 30.24 ? 824  VAL A N     1 
ATOM   6757 C  CA    . VAL A 1 824 ? 10.822  14.511  -15.006 1.00 29.32 ? 824  VAL A CA    1 
ATOM   6758 C  C     . VAL A 1 824 ? 9.724   13.448  -15.047 1.00 28.93 ? 824  VAL A C     1 
ATOM   6759 O  O     . VAL A 1 824 ? 9.755   12.486  -14.278 1.00 28.87 ? 824  VAL A O     1 
ATOM   6760 C  CB    . VAL A 1 824 ? 12.143  13.976  -15.633 1.00 28.55 ? 824  VAL A CB    1 
ATOM   6761 C  CG1   . VAL A 1 824 ? 11.904  13.384  -17.019 1.00 27.35 ? 824  VAL A CG1   1 
ATOM   6762 C  CG2   . VAL A 1 824 ? 13.189  15.086  -15.703 1.00 27.52 ? 824  VAL A CG2   1 
ATOM   6763 N  N     . VAL A 1 825 ? 8.752   13.639  -15.935 1.00 28.71 ? 825  VAL A N     1 
ATOM   6764 C  CA    . VAL A 1 825 ? 7.606   12.736  -16.040 1.00 29.16 ? 825  VAL A CA    1 
ATOM   6765 C  C     . VAL A 1 825 ? 7.803   11.745  -17.187 1.00 28.22 ? 825  VAL A C     1 
ATOM   6766 O  O     . VAL A 1 825 ? 8.080   12.143  -18.324 1.00 26.81 ? 825  VAL A O     1 
ATOM   6767 C  CB    . VAL A 1 825 ? 6.272   13.521  -16.220 1.00 29.84 ? 825  VAL A CB    1 
ATOM   6768 C  CG1   . VAL A 1 825 ? 5.090   12.569  -16.427 1.00 30.83 ? 825  VAL A CG1   1 
ATOM   6769 C  CG2   . VAL A 1 825 ? 6.017   14.426  -15.020 1.00 30.92 ? 825  VAL A CG2   1 
ATOM   6770 N  N     . GLU A 1 826 ? 7.661   10.458  -16.870 1.00 27.52 ? 826  GLU A N     1 
ATOM   6771 C  CA    . GLU A 1 826 ? 7.765   9.376   -17.849 1.00 28.09 ? 826  GLU A CA    1 
ATOM   6772 C  C     . GLU A 1 826 ? 6.882   9.641   -19.069 1.00 28.33 ? 826  GLU A C     1 
ATOM   6773 O  O     . GLU A 1 826 ? 5.694   9.948   -18.934 1.00 29.36 ? 826  GLU A O     1 
ATOM   6774 C  CB    . GLU A 1 826 ? 7.418   8.032   -17.186 1.00 27.88 ? 826  GLU A CB    1 
ATOM   6775 C  CG    . GLU A 1 826 ? 7.150   6.854   -18.132 1.00 28.99 ? 826  GLU A CG    1 
ATOM   6776 C  CD    . GLU A 1 826 ? 8.397   6.314   -18.827 1.00 29.54 ? 826  GLU A CD    1 
ATOM   6777 O  OE1   . GLU A 1 826 ? 8.235   5.667   -19.883 1.00 29.80 ? 826  GLU A OE1   1 
ATOM   6778 O  OE2   . GLU A 1 826 ? 9.529   6.527   -18.333 1.00 26.15 ? 826  GLU A OE2   1 
ATOM   6779 N  N     . GLY A 1 827 ? 7.487   9.551   -20.252 1.00 28.41 ? 827  GLY A N     1 
ATOM   6780 C  CA    . GLY A 1 827 ? 6.775   9.740   -21.518 1.00 28.07 ? 827  GLY A CA    1 
ATOM   6781 C  C     . GLY A 1 827 ? 6.711   11.169  -22.030 1.00 28.47 ? 827  GLY A C     1 
ATOM   6782 O  O     . GLY A 1 827 ? 6.381   11.399  -23.195 1.00 29.74 ? 827  GLY A O     1 
ATOM   6783 N  N     . GLU A 1 828 ? 7.015   12.136  -21.168 1.00 28.07 ? 828  GLU A N     1 
ATOM   6784 C  CA    . GLU A 1 828 ? 6.952   13.543  -21.562 1.00 27.72 ? 828  GLU A CA    1 
ATOM   6785 C  C     . GLU A 1 828 ? 8.290   13.987  -22.154 1.00 26.35 ? 828  GLU A C     1 
ATOM   6786 O  O     . GLU A 1 828 ? 9.216   13.183  -22.268 1.00 26.84 ? 828  GLU A O     1 
ATOM   6787 C  CB    . GLU A 1 828 ? 6.512   14.422  -20.387 1.00 28.40 ? 828  GLU A CB    1 
ATOM   6788 C  CG    . GLU A 1 828 ? 5.116   14.059  -19.874 1.00 33.85 ? 828  GLU A CG    1 
ATOM   6789 C  CD    . GLU A 1 828 ? 4.433   15.169  -19.086 1.00 38.17 ? 828  GLU A CD    1 
ATOM   6790 O  OE1   . GLU A 1 828 ? 3.204   15.067  -18.893 1.00 40.79 ? 828  GLU A OE1   1 
ATOM   6791 O  OE2   . GLU A 1 828 ? 5.107   16.131  -18.656 1.00 39.95 ? 828  GLU A OE2   1 
ATOM   6792 N  N     . LYS A 1 829 ? 8.388   15.251  -22.546 1.00 24.09 ? 829  LYS A N     1 
ATOM   6793 C  CA    . LYS A 1 829 ? 9.597   15.727  -23.219 1.00 22.25 ? 829  LYS A CA    1 
ATOM   6794 C  C     . LYS A 1 829 ? 10.531  16.493  -22.290 1.00 20.47 ? 829  LYS A C     1 
ATOM   6795 O  O     . LYS A 1 829 ? 10.087  17.089  -21.303 1.00 18.96 ? 829  LYS A O     1 
ATOM   6796 C  CB    . LYS A 1 829 ? 9.242   16.546  -24.459 1.00 23.89 ? 829  LYS A CB    1 
ATOM   6797 C  CG    . LYS A 1 829 ? 8.516   15.726  -25.525 1.00 24.74 ? 829  LYS A CG    1 
ATOM   6798 C  CD    . LYS A 1 829 ? 8.620   16.367  -26.884 1.00 27.32 ? 829  LYS A CD    1 
ATOM   6799 C  CE    . LYS A 1 829 ? 7.772   15.624  -27.902 1.00 29.06 ? 829  LYS A CE    1 
ATOM   6800 N  NZ    . LYS A 1 829 ? 7.790   16.342  -29.203 1.00 32.69 ? 829  LYS A NZ    1 
ATOM   6801 N  N     . VAL A 1 830 ? 11.825  16.444  -22.613 1.00 17.05 ? 830  VAL A N     1 
ATOM   6802 C  CA    . VAL A 1 830 ? 12.878  17.105  -21.842 1.00 15.40 ? 830  VAL A CA    1 
ATOM   6803 C  C     . VAL A 1 830 ? 13.813  17.883  -22.769 1.00 15.14 ? 830  VAL A C     1 
ATOM   6804 O  O     . VAL A 1 830 ? 14.057  17.462  -23.904 1.00 14.13 ? 830  VAL A O     1 
ATOM   6805 C  CB    . VAL A 1 830 ? 13.729  16.086  -21.012 1.00 15.29 ? 830  VAL A CB    1 
ATOM   6806 C  CG1   . VAL A 1 830 ? 12.904  15.484  -19.880 1.00 16.47 ? 830  VAL A CG1   1 
ATOM   6807 C  CG2   . VAL A 1 830 ? 14.300  14.979  -21.895 1.00 15.22 ? 830  VAL A CG2   1 
ATOM   6808 N  N     . TYR A 1 831 ? 14.319  19.016  -22.288 1.00 13.52 ? 831  TYR A N     1 
ATOM   6809 C  CA    . TYR A 1 831 ? 15.464  19.671  -22.918 1.00 14.29 ? 831  TYR A CA    1 
ATOM   6810 C  C     . TYR A 1 831 ? 16.714  18.883  -22.570 1.00 15.51 ? 831  TYR A C     1 
ATOM   6811 O  O     . TYR A 1 831 ? 16.805  18.326  -21.471 1.00 12.89 ? 831  TYR A O     1 
ATOM   6812 C  CB    . TYR A 1 831 ? 15.629  21.104  -22.412 1.00 14.60 ? 831  TYR A CB    1 
ATOM   6813 C  CG    . TYR A 1 831 ? 14.578  22.079  -22.884 1.00 17.43 ? 831  TYR A CG    1 
ATOM   6814 C  CD1   . TYR A 1 831 ? 14.264  22.197  -24.239 1.00 17.77 ? 831  TYR A CD1   1 
ATOM   6815 C  CD2   . TYR A 1 831 ? 13.909  22.900  -21.976 1.00 16.20 ? 831  TYR A CD2   1 
ATOM   6816 C  CE1   . TYR A 1 831 ? 13.301  23.097  -24.678 1.00 16.73 ? 831  TYR A CE1   1 
ATOM   6817 C  CE2   . TYR A 1 831 ? 12.947  23.806  -22.404 1.00 17.25 ? 831  TYR A CE2   1 
ATOM   6818 C  CZ    . TYR A 1 831 ? 12.647  23.895  -23.759 1.00 16.10 ? 831  TYR A CZ    1 
ATOM   6819 O  OH    . TYR A 1 831 ? 11.698  24.787  -24.200 1.00 18.95 ? 831  TYR A OH    1 
ATOM   6820 N  N     . VAL A 1 832 ? 17.673  18.832  -23.495 1.00 15.04 ? 832  VAL A N     1 
ATOM   6821 C  CA    . VAL A 1 832 ? 18.928  18.116  -23.262 1.00 14.87 ? 832  VAL A CA    1 
ATOM   6822 C  C     . VAL A 1 832 ? 20.123  19.000  -23.625 1.00 14.71 ? 832  VAL A C     1 
ATOM   6823 O  O     . VAL A 1 832 ? 20.124  19.653  -24.668 1.00 13.54 ? 832  VAL A O     1 
ATOM   6824 C  CB    . VAL A 1 832 ? 19.009  16.775  -24.063 1.00 15.58 ? 832  VAL A CB    1 
ATOM   6825 C  CG1   . VAL A 1 832 ? 20.222  15.951  -23.622 1.00 16.32 ? 832  VAL A CG1   1 
ATOM   6826 C  CG2   . VAL A 1 832 ? 17.724  15.938  -23.900 1.00 15.40 ? 832  VAL A CG2   1 
ATOM   6827 N  N     . LEU A 1 833 ? 21.133  19.014  -22.754 1.00 15.90 ? 833  LEU A N     1 
ATOM   6828 C  CA    . LEU A 1 833 ? 22.369  19.745  -23.002 1.00 16.82 ? 833  LEU A CA    1 
ATOM   6829 C  C     . LEU A 1 833 ? 23.587  18.885  -22.677 1.00 17.38 ? 833  LEU A C     1 
ATOM   6830 O  O     . LEU A 1 833 ? 23.609  18.203  -21.651 1.00 17.10 ? 833  LEU A O     1 
ATOM   6831 C  CB    . LEU A 1 833 ? 22.424  21.036  -22.176 1.00 17.58 ? 833  LEU A CB    1 
ATOM   6832 C  CG    . LEU A 1 833 ? 21.585  22.243  -22.601 1.00 15.20 ? 833  LEU A CG    1 
ATOM   6833 C  CD1   . LEU A 1 833 ? 21.715  23.353  -21.569 1.00 11.57 ? 833  LEU A CD1   1 
ATOM   6834 C  CD2   . LEU A 1 833 ? 21.976  22.753  -23.976 1.00 16.31 ? 833  LEU A CD2   1 
ATOM   6835 N  N     . PRO A 1 834 ? 24.600  18.907  -23.558 1.00 18.35 ? 834  PRO A N     1 
ATOM   6836 C  CA    . PRO A 1 834 ? 25.856  18.227  -23.270 1.00 18.96 ? 834  PRO A CA    1 
ATOM   6837 C  C     . PRO A 1 834 ? 26.695  19.009  -22.259 1.00 18.97 ? 834  PRO A C     1 
ATOM   6838 O  O     . PRO A 1 834 ? 26.634  20.239  -22.217 1.00 17.24 ? 834  PRO A O     1 
ATOM   6839 C  CB    . PRO A 1 834 ? 26.554  18.188  -24.633 1.00 18.54 ? 834  PRO A CB    1 
ATOM   6840 C  CG    . PRO A 1 834 ? 26.016  19.366  -25.364 1.00 18.21 ? 834  PRO A CG    1 
ATOM   6841 C  CD    . PRO A 1 834 ? 24.603  19.545  -24.890 1.00 18.78 ? 834  PRO A CD    1 
ATOM   6842 N  N     . LEU A 1 835 ? 27.468  18.285  -21.456 1.00 20.32 ? 835  LEU A N     1 
ATOM   6843 C  CA    . LEU A 1 835 ? 28.300  18.889  -20.419 1.00 21.27 ? 835  LEU A CA    1 
ATOM   6844 C  C     . LEU A 1 835 ? 29.769  18.588  -20.663 1.00 21.15 ? 835  LEU A C     1 
ATOM   6845 O  O     . LEU A 1 835 ? 30.118  17.486  -21.085 1.00 21.78 ? 835  LEU A O     1 
ATOM   6846 C  CB    . LEU A 1 835 ? 27.877  18.373  -19.044 1.00 20.97 ? 835  LEU A CB    1 
ATOM   6847 C  CG    . LEU A 1 835 ? 26.896  19.146  -18.145 1.00 21.62 ? 835  LEU A CG    1 
ATOM   6848 C  CD1   . LEU A 1 835 ? 26.135  20.272  -18.833 1.00 20.31 ? 835  LEU A CD1   1 
ATOM   6849 C  CD2   . LEU A 1 835 ? 25.945  18.183  -17.462 1.00 19.07 ? 835  LEU A CD2   1 
ATOM   6850 N  N     . ARG A 1 836 ? 30.623  19.573  -20.402 1.00 22.14 ? 836  ARG A N     1 
ATOM   6851 C  CA    . ARG A 1 836 ? 32.071  19.403  -20.550 1.00 23.06 ? 836  ARG A CA    1 
ATOM   6852 C  C     . ARG A 1 836 ? 32.634  18.453  -19.498 1.00 23.86 ? 836  ARG A C     1 
ATOM   6853 O  O     . ARG A 1 836 ? 32.060  18.294  -18.414 1.00 21.51 ? 836  ARG A O     1 
ATOM   6854 C  CB    . ARG A 1 836 ? 32.798  20.748  -20.483 1.00 23.41 ? 836  ARG A CB    1 
ATOM   6855 C  CG    . ARG A 1 836 ? 32.476  21.691  -21.645 1.00 24.18 ? 836  ARG A CG    1 
ATOM   6856 C  CD    . ARG A 1 836 ? 33.495  22.823  -21.758 1.00 25.37 ? 836  ARG A CD    1 
ATOM   6857 N  NE    . ARG A 1 836 ? 33.772  23.448  -20.466 1.00 25.85 ? 836  ARG A NE    1 
ATOM   6858 C  CZ    . ARG A 1 836 ? 33.003  24.367  -19.886 1.00 25.77 ? 836  ARG A CZ    1 
ATOM   6859 N  NH1   . ARG A 1 836 ? 31.892  24.790  -20.478 1.00 21.20 ? 836  ARG A NH1   1 
ATOM   6860 N  NH2   . ARG A 1 836 ? 33.352  24.866  -18.704 1.00 23.03 ? 836  ARG A NH2   1 
ATOM   6861 N  N     . GLU A 1 837 ? 33.757  17.823  -19.832 1.00 24.53 ? 837  GLU A N     1 
ATOM   6862 C  CA    . GLU A 1 837 ? 34.405  16.868  -18.944 1.00 25.78 ? 837  GLU A CA    1 
ATOM   6863 C  C     . GLU A 1 837 ? 34.829  17.560  -17.648 1.00 23.71 ? 837  GLU A C     1 
ATOM   6864 O  O     . GLU A 1 837 ? 35.200  18.734  -17.657 1.00 22.41 ? 837  GLU A O     1 
ATOM   6865 C  CB    . GLU A 1 837 ? 35.603  16.224  -19.643 1.00 27.30 ? 837  GLU A CB    1 
ATOM   6866 C  CG    . GLU A 1 837 ? 35.966  14.838  -19.116 1.00 34.12 ? 837  GLU A CG    1 
ATOM   6867 C  CD    . GLU A 1 837 ? 36.953  14.101  -20.010 1.00 38.16 ? 837  GLU A CD    1 
ATOM   6868 O  OE1   . GLU A 1 837 ? 36.776  14.122  -21.251 1.00 39.15 ? 837  GLU A OE1   1 
ATOM   6869 O  OE2   . GLU A 1 837 ? 37.904  13.494  -19.469 1.00 39.96 ? 837  GLU A OE2   1 
ATOM   6870 N  N     . GLY A 1 838 ? 34.728  16.834  -16.537 1.00 23.87 ? 838  GLY A N     1 
ATOM   6871 C  CA    . GLY A 1 838 ? 35.110  17.350  -15.222 1.00 23.25 ? 838  GLY A CA    1 
ATOM   6872 C  C     . GLY A 1 838 ? 34.025  18.146  -14.518 1.00 23.20 ? 838  GLY A C     1 
ATOM   6873 O  O     . GLY A 1 838 ? 34.265  18.715  -13.453 1.00 22.55 ? 838  GLY A O     1 
ATOM   6874 N  N     . ASN A 1 839 ? 32.832  18.191  -15.111 1.00 23.16 ? 839  ASN A N     1 
ATOM   6875 C  CA    . ASN A 1 839 ? 31.687  18.894  -14.523 1.00 22.63 ? 839  ASN A CA    1 
ATOM   6876 C  C     . ASN A 1 839 ? 31.251  18.269  -13.194 1.00 22.54 ? 839  ASN A C     1 
ATOM   6877 O  O     . ASN A 1 839 ? 31.453  17.069  -12.988 1.00 23.73 ? 839  ASN A O     1 
ATOM   6878 C  CB    . ASN A 1 839 ? 30.517  18.929  -15.517 1.00 23.09 ? 839  ASN A CB    1 
ATOM   6879 C  CG    . ASN A 1 839 ? 29.911  17.562  -15.754 1.00 22.59 ? 839  ASN A CG    1 
ATOM   6880 O  OD1   . ASN A 1 839 ? 29.079  17.101  -14.976 1.00 23.11 ? 839  ASN A OD1   1 
ATOM   6881 N  ND2   . ASN A 1 839 ? 30.322  16.908  -16.835 1.00 20.51 ? 839  ASN A ND2   1 
ATOM   6882 N  N     . PRO A 1 840 ? 30.651  19.074  -12.291 1.00 22.17 ? 840  PRO A N     1 
ATOM   6883 C  CA    . PRO A 1 840 ? 30.270  18.562  -10.969 1.00 21.16 ? 840  PRO A CA    1 
ATOM   6884 C  C     . PRO A 1 840 ? 29.027  17.666  -10.981 1.00 20.34 ? 840  PRO A C     1 
ATOM   6885 O  O     . PRO A 1 840 ? 28.670  17.111  -9.940  1.00 18.94 ? 840  PRO A O     1 
ATOM   6886 C  CB    . PRO A 1 840 ? 30.002  19.837  -10.165 1.00 21.87 ? 840  PRO A CB    1 
ATOM   6887 C  CG    . PRO A 1 840 ? 29.565  20.830  -11.184 1.00 21.62 ? 840  PRO A CG    1 
ATOM   6888 C  CD    . PRO A 1 840 ? 30.338  20.510  -12.430 1.00 21.70 ? 840  PRO A CD    1 
ATOM   6889 N  N     . PHE A 1 841 ? 28.378  17.534  -12.142 1.00 19.66 ? 841  PHE A N     1 
ATOM   6890 C  CA    . PHE A 1 841 ? 27.231  16.635  -12.295 1.00 18.94 ? 841  PHE A CA    1 
ATOM   6891 C  C     . PHE A 1 841 ? 27.682  15.186  -12.466 1.00 19.25 ? 841  PHE A C     1 
ATOM   6892 O  O     . PHE A 1 841 ? 26.905  14.257  -12.234 1.00 19.00 ? 841  PHE A O     1 
ATOM   6893 C  CB    . PHE A 1 841 ? 26.342  17.060  -13.473 1.00 18.72 ? 841  PHE A CB    1 
ATOM   6894 C  CG    . PHE A 1 841 ? 25.681  18.394  -13.284 1.00 19.99 ? 841  PHE A CG    1 
ATOM   6895 C  CD1   . PHE A 1 841 ? 24.580  18.527  -12.439 1.00 19.32 ? 841  PHE A CD1   1 
ATOM   6896 C  CD2   . PHE A 1 841 ? 26.158  19.522  -13.948 1.00 18.94 ? 841  PHE A CD2   1 
ATOM   6897 C  CE1   . PHE A 1 841 ? 23.967  19.760  -12.255 1.00 19.07 ? 841  PHE A CE1   1 
ATOM   6898 C  CE2   . PHE A 1 841 ? 25.552  20.764  -13.769 1.00 18.99 ? 841  PHE A CE2   1 
ATOM   6899 C  CZ    . PHE A 1 841 ? 24.453  20.881  -12.921 1.00 19.81 ? 841  PHE A CZ    1 
ATOM   6900 N  N     . GLY A 1 842 ? 28.934  15.006  -12.882 1.00 20.07 ? 842  GLY A N     1 
ATOM   6901 C  CA    . GLY A 1 842 ? 29.547  13.682  -12.983 1.00 20.71 ? 842  GLY A CA    1 
ATOM   6902 C  C     . GLY A 1 842 ? 29.187  12.878  -14.222 1.00 21.38 ? 842  GLY A C     1 
ATOM   6903 O  O     . GLY A 1 842 ? 29.374  11.661  -14.247 1.00 22.33 ? 842  GLY A O     1 
ATOM   6904 N  N     . ASP A 1 843 ? 28.674  13.550  -15.251 1.00 21.41 ? 843  ASP A N     1 
ATOM   6905 C  CA    . ASP A 1 843 ? 28.306  12.881  -16.503 1.00 20.38 ? 843  ASP A CA    1 
ATOM   6906 C  C     . ASP A 1 843 ? 28.292  13.848  -17.688 1.00 19.71 ? 843  ASP A C     1 
ATOM   6907 O  O     . ASP A 1 843 ? 28.373  15.066  -17.506 1.00 19.09 ? 843  ASP A O     1 
ATOM   6908 C  CB    . ASP A 1 843 ? 26.952  12.170  -16.362 1.00 20.46 ? 843  ASP A CB    1 
ATOM   6909 C  CG    . ASP A 1 843 ? 26.929  10.810  -17.047 1.00 20.44 ? 843  ASP A CG    1 
ATOM   6910 O  OD1   . ASP A 1 843 ? 27.671  10.611  -18.034 1.00 21.90 ? 843  ASP A OD1   1 
ATOM   6911 O  OD2   . ASP A 1 843 ? 26.160  9.937   -16.597 1.00 19.58 ? 843  ASP A OD2   1 
ATOM   6912 N  N     . LYS A 1 844 ? 28.172  13.293  -18.895 1.00 19.52 ? 844  LYS A N     1 
ATOM   6913 C  CA    . LYS A 1 844 ? 28.372  14.047  -20.141 1.00 19.08 ? 844  LYS A CA    1 
ATOM   6914 C  C     . LYS A 1 844 ? 27.189  14.899  -20.628 1.00 19.20 ? 844  LYS A C     1 
ATOM   6915 O  O     . LYS A 1 844 ? 27.320  15.643  -21.607 1.00 18.88 ? 844  LYS A O     1 
ATOM   6916 C  CB    . LYS A 1 844 ? 28.846  13.110  -21.260 1.00 21.16 ? 844  LYS A CB    1 
ATOM   6917 C  CG    . LYS A 1 844 ? 27.910  11.942  -21.565 1.00 22.35 ? 844  LYS A CG    1 
ATOM   6918 C  CD    . LYS A 1 844 ? 28.364  11.205  -22.816 1.00 25.09 ? 844  LYS A CD    1 
ATOM   6919 C  CE    . LYS A 1 844 ? 27.523  9.964   -23.077 1.00 24.12 ? 844  LYS A CE    1 
ATOM   6920 N  NZ    . LYS A 1 844 ? 27.769  9.438   -24.446 1.00 24.05 ? 844  LYS A NZ    1 
ATOM   6921 N  N     . CYS A 1 845 ? 26.043  14.789  -19.956 1.00 17.58 ? 845  CYS A N     1 
ATOM   6922 C  CA    . CYS A 1 845 ? 24.852  15.544  -20.350 1.00 18.33 ? 845  CYS A CA    1 
ATOM   6923 C  C     . CYS A 1 845 ? 23.862  15.692  -19.202 1.00 18.28 ? 845  CYS A C     1 
ATOM   6924 O  O     . CYS A 1 845 ? 23.934  14.964  -18.216 1.00 18.17 ? 845  CYS A O     1 
ATOM   6925 C  CB    . CYS A 1 845 ? 24.155  14.876  -21.542 1.00 16.76 ? 845  CYS A CB    1 
ATOM   6926 S  SG    . CYS A 1 845 ? 23.541  13.204  -21.202 1.00 19.42 ? 845  CYS A SG    1 
ATOM   6927 N  N     . ILE A 1 846 ? 22.938  16.640  -19.351 1.00 18.55 ? 846  ILE A N     1 
ATOM   6928 C  CA    . ILE A 1 846 ? 21.844  16.823  -18.401 1.00 17.24 ? 846  ILE A CA    1 
ATOM   6929 C  C     . ILE A 1 846 ? 20.541  17.108  -19.152 1.00 16.98 ? 846  ILE A C     1 
ATOM   6930 O  O     . ILE A 1 846 ? 20.548  17.698  -20.236 1.00 17.26 ? 846  ILE A O     1 
ATOM   6931 C  CB    . ILE A 1 846 ? 22.166  17.925  -17.332 1.00 16.60 ? 846  ILE A CB    1 
ATOM   6932 C  CG1   . ILE A 1 846 ? 21.196  17.839  -16.145 1.00 15.00 ? 846  ILE A CG1   1 
ATOM   6933 C  CG2   . ILE A 1 846 ? 22.202  19.323  -17.959 1.00 16.81 ? 846  ILE A CG2   1 
ATOM   6934 C  CD1   . ILE A 1 846 ? 21.590  18.685  -14.943 1.00 13.66 ? 846  ILE A CD1   1 
ATOM   6935 N  N     . ALA A 1 847 ? 19.429  16.661  -18.578 1.00 17.79 ? 847  ALA A N     1 
ATOM   6936 C  CA    . ALA A 1 847 ? 18.109  16.861  -19.172 1.00 17.64 ? 847  ALA A CA    1 
ATOM   6937 C  C     . ALA A 1 847 ? 17.086  17.241  -18.105 1.00 18.20 ? 847  ALA A C     1 
ATOM   6938 O  O     . ALA A 1 847 ? 17.144  16.742  -16.980 1.00 18.40 ? 847  ALA A O     1 
ATOM   6939 C  CB    . ALA A 1 847 ? 17.670  15.612  -19.917 1.00 17.83 ? 847  ALA A CB    1 
ATOM   6940 N  N     . TRP A 1 848 ? 16.154  18.128  -18.464 1.00 16.56 ? 848  TRP A N     1 
ATOM   6941 C  CA    . TRP A 1 848 ? 15.148  18.628  -17.527 1.00 16.41 ? 848  TRP A CA    1 
ATOM   6942 C  C     . TRP A 1 848 ? 13.812  18.859  -18.251 1.00 16.83 ? 848  TRP A C     1 
ATOM   6943 O  O     . TRP A 1 848 ? 13.799  18.983  -19.479 1.00 16.69 ? 848  TRP A O     1 
ATOM   6944 C  CB    . TRP A 1 848 ? 15.655  19.903  -16.827 1.00 15.82 ? 848  TRP A CB    1 
ATOM   6945 C  CG    . TRP A 1 848 ? 15.643  21.150  -17.676 1.00 17.04 ? 848  TRP A CG    1 
ATOM   6946 C  CD1   . TRP A 1 848 ? 14.679  22.120  -17.694 1.00 16.68 ? 848  TRP A CD1   1 
ATOM   6947 C  CD2   . TRP A 1 848 ? 16.651  21.567  -18.611 1.00 15.15 ? 848  TRP A CD2   1 
ATOM   6948 N  NE1   . TRP A 1 848 ? 15.021  23.110  -18.587 1.00 19.48 ? 848  TRP A NE1   1 
ATOM   6949 C  CE2   . TRP A 1 848 ? 16.223  22.795  -19.165 1.00 16.13 ? 848  TRP A CE2   1 
ATOM   6950 C  CE3   . TRP A 1 848 ? 17.872  21.020  -19.035 1.00 15.06 ? 848  TRP A CE3   1 
ATOM   6951 C  CZ2   . TRP A 1 848 ? 16.971  23.490  -20.126 1.00 15.33 ? 848  TRP A CZ2   1 
ATOM   6952 C  CZ3   . TRP A 1 848 ? 18.618  21.712  -19.996 1.00 16.55 ? 848  TRP A CZ3   1 
ATOM   6953 C  CH2   . TRP A 1 848 ? 18.161  22.935  -20.527 1.00 16.48 ? 848  TRP A CH2   1 
ATOM   6954 N  N     . PRO A 1 849 ? 12.686  18.908  -17.507 1.00 17.67 ? 849  PRO A N     1 
ATOM   6955 C  CA    . PRO A 1 849 ? 11.384  19.036  -18.179 1.00 18.02 ? 849  PRO A CA    1 
ATOM   6956 C  C     . PRO A 1 849 ? 11.361  20.155  -19.226 1.00 19.07 ? 849  PRO A C     1 
ATOM   6957 O  O     . PRO A 1 849 ? 11.706  21.299  -18.921 1.00 18.09 ? 849  PRO A O     1 
ATOM   6958 C  CB    . PRO A 1 849 ? 10.421  19.347  -17.030 1.00 17.09 ? 849  PRO A CB    1 
ATOM   6959 C  CG    . PRO A 1 849 ? 11.056  18.696  -15.833 1.00 17.69 ? 849  PRO A CG    1 
ATOM   6960 C  CD    . PRO A 1 849 ? 12.543  18.878  -16.036 1.00 18.09 ? 849  PRO A CD    1 
ATOM   6961 N  N     . SER A 1 850 ? 10.976  19.809  -20.454 1.00 19.81 ? 850  SER A N     1 
ATOM   6962 C  CA    . SER A 1 850 ? 10.923  20.771  -21.555 1.00 20.75 ? 850  SER A CA    1 
ATOM   6963 C  C     . SER A 1 850 ? 9.890   21.860  -21.293 1.00 22.95 ? 850  SER A C     1 
ATOM   6964 O  O     . SER A 1 850 ? 8.944   21.661  -20.529 1.00 22.83 ? 850  SER A O     1 
ATOM   6965 C  CB    . SER A 1 850 ? 10.612  20.067  -22.875 1.00 21.83 ? 850  SER A CB    1 
ATOM   6966 O  OG    . SER A 1 850 ? 9.260   19.643  -22.913 1.00 23.11 ? 850  SER A OG    1 
ATOM   6967 N  N     . GLY A 1 851 ? 10.083  23.011  -21.934 1.00 23.43 ? 851  GLY A N     1 
ATOM   6968 C  CA    . GLY A 1 851 ? 9.217   24.166  -21.739 1.00 25.27 ? 851  GLY A CA    1 
ATOM   6969 C  C     . GLY A 1 851 ? 9.391   24.850  -20.392 1.00 25.81 ? 851  GLY A C     1 
ATOM   6970 O  O     . GLY A 1 851 ? 8.571   25.687  -20.014 1.00 26.15 ? 851  GLY A O     1 
ATOM   6971 N  N     . THR A 1 852 ? 10.445  24.492  -19.658 1.00 25.16 ? 852  THR A N     1 
ATOM   6972 C  CA    . THR A 1 852 ? 10.719  25.124  -18.360 1.00 24.68 ? 852  THR A CA    1 
ATOM   6973 C  C     . THR A 1 852 ? 12.161  25.601  -18.248 1.00 24.97 ? 852  THR A C     1 
ATOM   6974 O  O     . THR A 1 852 ? 13.054  25.083  -18.924 1.00 24.36 ? 852  THR A O     1 
ATOM   6975 C  CB    . THR A 1 852 ? 10.405  24.194  -17.146 1.00 23.22 ? 852  THR A CB    1 
ATOM   6976 O  OG1   . THR A 1 852 ? 11.341  23.109  -17.102 1.00 23.03 ? 852  THR A OG1   1 
ATOM   6977 C  CG2   . THR A 1 852 ? 8.972   23.650  -17.199 1.00 22.89 ? 852  THR A CG2   1 
ATOM   6978 N  N     . GLU A 1 853 ? 12.368  26.610  -17.403 1.00 25.70 ? 853  GLU A N     1 
ATOM   6979 C  CA    . GLU A 1 853 ? 13.700  26.995  -16.950 1.00 26.01 ? 853  GLU A CA    1 
ATOM   6980 C  C     . GLU A 1 853 ? 14.182  25.903  -16.005 1.00 25.18 ? 853  GLU A C     1 
ATOM   6981 O  O     . GLU A 1 853 ? 13.402  25.385  -15.209 1.00 23.99 ? 853  GLU A O     1 
ATOM   6982 C  CB    . GLU A 1 853 ? 13.650  28.335  -16.203 1.00 26.96 ? 853  GLU A CB    1 
ATOM   6983 C  CG    . GLU A 1 853 ? 13.340  29.553  -17.079 1.00 29.12 ? 853  GLU A CG    1 
ATOM   6984 C  CD    . GLU A 1 853 ? 14.574  30.154  -17.745 1.00 31.50 ? 853  GLU A CD    1 
ATOM   6985 O  OE1   . GLU A 1 853 ? 15.710  29.885  -17.295 1.00 31.33 ? 853  GLU A OE1   1 
ATOM   6986 O  OE2   . GLU A 1 853 ? 14.405  30.915  -18.720 1.00 33.45 ? 853  GLU A OE2   1 
ATOM   6987 N  N     . ILE A 1 854 ? 15.457  25.538  -16.098 1.00 25.61 ? 854  ILE A N     1 
ATOM   6988 C  CA    . ILE A 1 854 ? 16.017  24.558  -15.170 1.00 25.57 ? 854  ILE A CA    1 
ATOM   6989 C  C     . ILE A 1 854 ? 16.106  25.192  -13.776 1.00 26.35 ? 854  ILE A C     1 
ATOM   6990 O  O     . ILE A 1 854 ? 16.399  26.385  -13.652 1.00 26.87 ? 854  ILE A O     1 
ATOM   6991 C  CB    . ILE A 1 854 ? 17.372  23.975  -15.674 1.00 25.80 ? 854  ILE A CB    1 
ATOM   6992 C  CG1   . ILE A 1 854 ? 17.709  22.666  -14.947 1.00 27.34 ? 854  ILE A CG1   1 
ATOM   6993 C  CG2   . ILE A 1 854 ? 18.503  25.006  -15.584 1.00 25.56 ? 854  ILE A CG2   1 
ATOM   6994 C  CD1   . ILE A 1 854 ? 18.811  21.854  -15.610 1.00 27.07 ? 854  ILE A CD1   1 
ATOM   6995 N  N     . THR A 1 855 ? 15.815  24.405  -12.742 1.00 26.10 ? 855  THR A N     1 
ATOM   6996 C  CA    . THR A 1 855 ? 15.739  24.920  -11.368 1.00 26.92 ? 855  THR A CA    1 
ATOM   6997 C  C     . THR A 1 855 ? 16.998  25.696  -10.935 1.00 26.53 ? 855  THR A C     1 
ATOM   6998 O  O     . THR A 1 855 ? 18.125  25.334  -11.295 1.00 24.56 ? 855  THR A O     1 
ATOM   6999 C  CB    . THR A 1 855 ? 15.355  23.810  -10.346 1.00 26.46 ? 855  THR A CB    1 
ATOM   7000 O  OG1   . THR A 1 855 ? 15.183  24.391  -9.049  1.00 28.47 ? 855  THR A OG1   1 
ATOM   7001 C  CG2   . THR A 1 855 ? 16.408  22.701  -10.284 1.00 26.26 ? 855  THR A CG2   1 
ATOM   7002 N  N     . ASP A 1 856 ? 16.775  26.768  -10.171 1.00 27.19 ? 856  ASP A N     1 
ATOM   7003 C  CA    . ASP A 1 856 ? 17.810  27.752  -9.823  1.00 27.95 ? 856  ASP A CA    1 
ATOM   7004 C  C     . ASP A 1 856 ? 19.068  27.184  -9.173  1.00 27.93 ? 856  ASP A C     1 
ATOM   7005 O  O     . ASP A 1 856 ? 20.168  27.692  -9.406  1.00 29.18 ? 856  ASP A O     1 
ATOM   7006 C  CB    . ASP A 1 856 ? 17.227  28.852  -8.922  1.00 28.80 ? 856  ASP A CB    1 
ATOM   7007 C  CG    . ASP A 1 856 ? 16.488  29.929  -9.706  1.00 30.91 ? 856  ASP A CG    1 
ATOM   7008 O  OD1   . ASP A 1 856 ? 15.686  30.658  -9.084  1.00 32.64 ? 856  ASP A OD1   1 
ATOM   7009 O  OD2   . ASP A 1 856 ? 16.706  30.058  -10.934 1.00 29.44 ? 856  ASP A OD2   1 
ATOM   7010 N  N     . LEU A 1 857 ? 18.904  26.140  -8.361  1.00 26.68 ? 857  LEU A N     1 
ATOM   7011 C  CA    . LEU A 1 857 ? 20.024  25.565  -7.618  1.00 26.56 ? 857  LEU A CA    1 
ATOM   7012 C  C     . LEU A 1 857 ? 21.077  24.898  -8.500  1.00 25.84 ? 857  LEU A C     1 
ATOM   7013 O  O     . LEU A 1 857 ? 22.231  24.759  -8.093  1.00 26.40 ? 857  LEU A O     1 
ATOM   7014 C  CB    . LEU A 1 857 ? 19.531  24.597  -6.536  1.00 27.07 ? 857  LEU A CB    1 
ATOM   7015 C  CG    . LEU A 1 857 ? 19.009  25.212  -5.229  1.00 28.19 ? 857  LEU A CG    1 
ATOM   7016 C  CD1   . LEU A 1 857 ? 18.682  24.120  -4.222  1.00 28.28 ? 857  LEU A CD1   1 
ATOM   7017 C  CD2   . LEU A 1 857 ? 20.001  26.207  -4.621  1.00 30.20 ? 857  LEU A CD2   1 
ATOM   7018 N  N     . ILE A 1 858 ? 20.685  24.497  -9.708  1.00 24.40 ? 858  ILE A N     1 
ATOM   7019 C  CA    . ILE A 1 858 ? 21.627  23.884  -10.648 1.00 23.84 ? 858  ILE A CA    1 
ATOM   7020 C  C     . ILE A 1 858 ? 21.770  24.661  -11.963 1.00 23.03 ? 858  ILE A C     1 
ATOM   7021 O  O     . ILE A 1 858 ? 22.615  24.320  -12.795 1.00 23.67 ? 858  ILE A O     1 
ATOM   7022 C  CB    . ILE A 1 858 ? 21.302  22.388  -10.921 1.00 24.41 ? 858  ILE A CB    1 
ATOM   7023 C  CG1   . ILE A 1 858 ? 19.885  22.226  -11.481 1.00 23.71 ? 858  ILE A CG1   1 
ATOM   7024 C  CG2   . ILE A 1 858 ? 21.514  21.551  -9.652  1.00 23.71 ? 858  ILE A CG2   1 
ATOM   7025 C  CD1   . ILE A 1 858 ? 19.614  20.868  -12.086 1.00 27.65 ? 858  ILE A CD1   1 
ATOM   7026 N  N     . LYS A 1 859 ? 20.959  25.705  -12.133 1.00 22.55 ? 859  LYS A N     1 
ATOM   7027 C  CA    . LYS A 1 859 ? 20.973  26.519  -13.356 1.00 21.52 ? 859  LYS A CA    1 
ATOM   7028 C  C     . LYS A 1 859 ? 22.338  27.143  -13.638 1.00 21.14 ? 859  LYS A C     1 
ATOM   7029 O  O     . LYS A 1 859 ? 22.823  27.089  -14.766 1.00 20.50 ? 859  LYS A O     1 
ATOM   7030 C  CB    . LYS A 1 859 ? 19.890  27.608  -13.321 1.00 22.13 ? 859  LYS A CB    1 
ATOM   7031 C  CG    . LYS A 1 859 ? 19.801  28.421  -14.615 1.00 21.33 ? 859  LYS A CG    1 
ATOM   7032 C  CD    . LYS A 1 859 ? 18.669  29.434  -14.594 1.00 23.09 ? 859  LYS A CD    1 
ATOM   7033 C  CE    . LYS A 1 859 ? 18.708  30.302  -15.845 1.00 25.43 ? 859  LYS A CE    1 
ATOM   7034 N  NZ    . LYS A 1 859 ? 17.621  31.322  -15.868 1.00 26.92 ? 859  LYS A NZ    1 
ATOM   7035 N  N     . ASP A 1 860 ? 22.950  27.736  -12.615 1.00 21.69 ? 860  ASP A N     1 
ATOM   7036 C  CA    . ASP A 1 860 ? 24.249  28.387  -12.779 1.00 22.73 ? 860  ASP A CA    1 
ATOM   7037 C  C     . ASP A 1 860 ? 25.362  27.397  -13.139 1.00 21.93 ? 860  ASP A C     1 
ATOM   7038 O  O     . ASP A 1 860 ? 26.251  27.729  -13.922 1.00 21.55 ? 860  ASP A O     1 
ATOM   7039 C  CB    . ASP A 1 860 ? 24.607  29.230  -11.542 1.00 24.86 ? 860  ASP A CB    1 
ATOM   7040 C  CG    . ASP A 1 860 ? 23.708  30.460  -11.388 1.00 28.50 ? 860  ASP A CG    1 
ATOM   7041 O  OD1   . ASP A 1 860 ? 23.072  30.883  -12.383 1.00 33.56 ? 860  ASP A OD1   1 
ATOM   7042 O  OD2   . ASP A 1 860 ? 23.636  31.009  -10.270 1.00 32.65 ? 860  ASP A OD2   1 
ATOM   7043 N  N     . ASP A 1 861 ? 25.296  26.186  -12.586 1.00 21.69 ? 861  ASP A N     1 
ATOM   7044 C  CA    . ASP A 1 861 ? 26.248  25.118  -12.919 1.00 21.38 ? 861  ASP A CA    1 
ATOM   7045 C  C     . ASP A 1 861 ? 26.098  24.635  -14.364 1.00 21.09 ? 861  ASP A C     1 
ATOM   7046 O  O     . ASP A 1 861 ? 27.097  24.432  -15.062 1.00 21.60 ? 861  ASP A O     1 
ATOM   7047 C  CB    . ASP A 1 861 ? 26.091  23.924  -11.972 1.00 21.95 ? 861  ASP A CB    1 
ATOM   7048 C  CG    . ASP A 1 861 ? 26.529  24.230  -10.550 1.00 21.71 ? 861  ASP A CG    1 
ATOM   7049 O  OD1   . ASP A 1 861 ? 25.764  23.891  -9.628  1.00 23.38 ? 861  ASP A OD1   1 
ATOM   7050 O  OD2   . ASP A 1 861 ? 27.631  24.789  -10.348 1.00 18.33 ? 861  ASP A OD2   1 
ATOM   7051 N  N     . VAL A 1 862 ? 24.853  24.436  -14.798 1.00 20.53 ? 862  VAL A N     1 
ATOM   7052 C  CA    . VAL A 1 862 ? 24.573  24.031  -16.180 1.00 19.80 ? 862  VAL A CA    1 
ATOM   7053 C  C     . VAL A 1 862 ? 25.147  25.057  -17.158 1.00 19.52 ? 862  VAL A C     1 
ATOM   7054 O  O     . VAL A 1 862 ? 25.866  24.690  -18.085 1.00 18.67 ? 862  VAL A O     1 
ATOM   7055 C  CB    . VAL A 1 862 ? 23.060  23.800  -16.443 1.00 19.92 ? 862  VAL A CB    1 
ATOM   7056 C  CG1   . VAL A 1 862 ? 22.810  23.457  -17.905 1.00 19.27 ? 862  VAL A CG1   1 
ATOM   7057 C  CG2   . VAL A 1 862 ? 22.525  22.684  -15.561 1.00 20.58 ? 862  VAL A CG2   1 
ATOM   7058 N  N     . LEU A 1 863 ? 24.854  26.337  -16.926 1.00 19.89 ? 863  LEU A N     1 
ATOM   7059 C  CA    . LEU A 1 863 ? 25.372  27.419  -17.768 1.00 20.07 ? 863  LEU A CA    1 
ATOM   7060 C  C     . LEU A 1 863 ? 26.899  27.444  -17.798 1.00 20.85 ? 863  LEU A C     1 
ATOM   7061 O  O     . LEU A 1 863 ? 27.492  27.674  -18.847 1.00 20.54 ? 863  LEU A O     1 
ATOM   7062 C  CB    . LEU A 1 863 ? 24.834  28.781  -17.315 1.00 20.12 ? 863  LEU A CB    1 
ATOM   7063 C  CG    . LEU A 1 863 ? 23.335  29.057  -17.476 1.00 21.43 ? 863  LEU A CG    1 
ATOM   7064 C  CD1   . LEU A 1 863 ? 22.964  30.375  -16.810 1.00 22.27 ? 863  LEU A CD1   1 
ATOM   7065 C  CD2   . LEU A 1 863 ? 22.919  29.056  -18.939 1.00 22.31 ? 863  LEU A CD2   1 
ATOM   7066 N  N     . HIS A 1 864 ? 27.525  27.195  -16.649 1.00 20.70 ? 864  HIS A N     1 
ATOM   7067 C  CA    . HIS A 1 864 ? 28.981  27.208  -16.553 1.00 22.73 ? 864  HIS A CA    1 
ATOM   7068 C  C     . HIS A 1 864 ? 29.623  26.027  -17.288 1.00 22.61 ? 864  HIS A C     1 
ATOM   7069 O  O     . HIS A 1 864 ? 30.718  26.155  -17.845 1.00 22.67 ? 864  HIS A O     1 
ATOM   7070 C  CB    . HIS A 1 864 ? 29.424  27.209  -15.086 1.00 23.99 ? 864  HIS A CB    1 
ATOM   7071 C  CG    . HIS A 1 864 ? 30.662  28.012  -14.829 1.00 28.22 ? 864  HIS A CG    1 
ATOM   7072 N  ND1   . HIS A 1 864 ? 31.840  27.811  -15.516 1.00 31.34 ? 864  HIS A ND1   1 
ATOM   7073 C  CD2   . HIS A 1 864 ? 30.906  29.012  -13.950 1.00 31.73 ? 864  HIS A CD2   1 
ATOM   7074 C  CE1   . HIS A 1 864 ? 32.754  28.659  -15.079 1.00 31.03 ? 864  HIS A CE1   1 
ATOM   7075 N  NE2   . HIS A 1 864 ? 32.214  29.397  -14.125 1.00 32.25 ? 864  HIS A NE2   1 
ATOM   7076 N  N     . TRP A 1 865 ? 28.937  24.885  -17.292 1.00 21.19 ? 865  TRP A N     1 
ATOM   7077 C  CA    . TRP A 1 865 ? 29.523  23.643  -17.800 1.00 21.05 ? 865  TRP A CA    1 
ATOM   7078 C  C     . TRP A 1 865 ? 28.983  23.155  -19.147 1.00 20.84 ? 865  TRP A C     1 
ATOM   7079 O  O     . TRP A 1 865 ? 29.470  22.147  -19.678 1.00 20.85 ? 865  TRP A O     1 
ATOM   7080 C  CB    . TRP A 1 865 ? 29.434  22.542  -16.740 1.00 21.82 ? 865  TRP A CB    1 
ATOM   7081 C  CG    . TRP A 1 865 ? 30.409  22.762  -15.626 1.00 21.07 ? 865  TRP A CG    1 
ATOM   7082 C  CD1   . TRP A 1 865 ? 30.171  23.407  -14.448 1.00 22.08 ? 865  TRP A CD1   1 
ATOM   7083 C  CD2   . TRP A 1 865 ? 31.785  22.360  -15.597 1.00 23.10 ? 865  TRP A CD2   1 
ATOM   7084 N  NE1   . TRP A 1 865 ? 31.314  23.426  -13.679 1.00 23.03 ? 865  TRP A NE1   1 
ATOM   7085 C  CE2   . TRP A 1 865 ? 32.318  22.788  -14.359 1.00 23.21 ? 865  TRP A CE2   1 
ATOM   7086 C  CE3   . TRP A 1 865 ? 32.619  21.677  -16.493 1.00 23.11 ? 865  TRP A CE3   1 
ATOM   7087 C  CZ2   . TRP A 1 865 ? 33.649  22.552  -13.993 1.00 23.75 ? 865  TRP A CZ2   1 
ATOM   7088 C  CZ3   . TRP A 1 865 ? 33.942  21.440  -16.127 1.00 24.05 ? 865  TRP A CZ3   1 
ATOM   7089 C  CH2   . TRP A 1 865 ? 34.443  21.880  -14.888 1.00 24.02 ? 865  TRP A CH2   1 
ATOM   7090 N  N     . MET A 1 866 ? 27.997  23.872  -19.692 1.00 18.92 ? 866  MET A N     1 
ATOM   7091 C  CA    . MET A 1 866 ? 27.455  23.590  -21.024 1.00 20.48 ? 866  MET A CA    1 
ATOM   7092 C  C     . MET A 1 866 ? 28.573  23.418  -22.033 1.00 19.06 ? 866  MET A C     1 
ATOM   7093 O  O     . MET A 1 866 ? 29.485  24.241  -22.095 1.00 19.73 ? 866  MET A O     1 
ATOM   7094 C  CB    . MET A 1 866 ? 26.627  24.770  -21.521 1.00 19.87 ? 866  MET A CB    1 
ATOM   7095 C  CG    . MET A 1 866 ? 25.248  24.890  -20.992 1.00 22.02 ? 866  MET A CG    1 
ATOM   7096 S  SD    . MET A 1 866 ? 24.602  26.479  -21.519 1.00 22.15 ? 866  MET A SD    1 
ATOM   7097 C  CE    . MET A 1 866 ? 24.386  26.183  -23.279 1.00 21.56 ? 866  MET A CE    1 
ATOM   7098 N  N     . ASP A 1 867 ? 28.494  22.370  -22.843 1.00 17.78 ? 867  ASP A N     1 
ATOM   7099 C  CA    . ASP A 1 867 ? 29.478  22.192  -23.895 1.00 17.42 ? 867  ASP A CA    1 
ATOM   7100 C  C     . ASP A 1 867 ? 28.987  22.809  -25.207 1.00 18.56 ? 867  ASP A C     1 
ATOM   7101 O  O     . ASP A 1 867 ? 28.300  22.152  -25.997 1.00 17.95 ? 867  ASP A O     1 
ATOM   7102 C  CB    . ASP A 1 867 ? 29.848  20.717  -24.061 1.00 16.23 ? 867  ASP A CB    1 
ATOM   7103 C  CG    . ASP A 1 867 ? 31.129  20.525  -24.856 1.00 17.16 ? 867  ASP A CG    1 
ATOM   7104 O  OD1   . ASP A 1 867 ? 31.461  21.392  -25.691 1.00 16.27 ? 867  ASP A OD1   1 
ATOM   7105 O  OD2   . ASP A 1 867 ? 31.807  19.502  -24.647 1.00 17.52 ? 867  ASP A OD2   1 
ATOM   7106 N  N     . TYR A 1 868 ? 29.343  24.075  -25.420 1.00 18.47 ? 868  TYR A N     1 
ATOM   7107 C  CA    . TYR A 1 868 ? 28.971  24.810  -26.635 1.00 19.24 ? 868  TYR A CA    1 
ATOM   7108 C  C     . TYR A 1 868 ? 29.565  24.211  -27.910 1.00 19.39 ? 868  TYR A C     1 
ATOM   7109 O  O     . TYR A 1 868 ? 28.911  24.196  -28.952 1.00 20.88 ? 868  TYR A O     1 
ATOM   7110 C  CB    . TYR A 1 868 ? 29.396  26.277  -26.539 1.00 18.91 ? 868  TYR A CB    1 
ATOM   7111 C  CG    . TYR A 1 868 ? 28.567  27.132  -25.603 1.00 19.46 ? 868  TYR A CG    1 
ATOM   7112 C  CD1   . TYR A 1 868 ? 27.365  27.702  -26.025 1.00 18.85 ? 868  TYR A CD1   1 
ATOM   7113 C  CD2   . TYR A 1 868 ? 29.004  27.397  -24.302 1.00 20.55 ? 868  TYR A CD2   1 
ATOM   7114 C  CE1   . TYR A 1 868 ? 26.607  28.505  -25.168 1.00 18.91 ? 868  TYR A CE1   1 
ATOM   7115 C  CE2   . TYR A 1 868 ? 28.256  28.197  -23.439 1.00 21.72 ? 868  TYR A CE2   1 
ATOM   7116 C  CZ    . TYR A 1 868 ? 27.062  28.749  -23.879 1.00 20.34 ? 868  TYR A CZ    1 
ATOM   7117 O  OH    . TYR A 1 868 ? 26.324  29.540  -23.025 1.00 21.11 ? 868  TYR A OH    1 
ATOM   7118 N  N     . THR A 1 869 ? 30.803  23.731  -27.825 1.00 19.53 ? 869  THR A N     1 
ATOM   7119 C  CA    . THR A 1 869 ? 31.493  23.145  -28.977 1.00 20.39 ? 869  THR A CA    1 
ATOM   7120 C  C     . THR A 1 869 ? 30.756  21.913  -29.486 1.00 19.08 ? 869  THR A C     1 
ATOM   7121 O  O     . THR A 1 869 ? 30.474  21.800  -30.680 1.00 18.45 ? 869  THR A O     1 
ATOM   7122 C  CB    . THR A 1 869 ? 32.957  22.777  -28.631 1.00 21.13 ? 869  THR A CB    1 
ATOM   7123 O  OG1   . THR A 1 869 ? 33.604  23.916  -28.058 1.00 23.40 ? 869  THR A OG1   1 
ATOM   7124 C  CG2   . THR A 1 869 ? 33.731  22.337  -29.881 1.00 20.34 ? 869  THR A CG2   1 
ATOM   7125 N  N     . VAL A 1 870 ? 30.443  20.998  -28.573 1.00 19.38 ? 870  VAL A N     1 
ATOM   7126 C  CA    . VAL A 1 870 ? 29.683  19.789  -28.904 1.00 20.10 ? 870  VAL A CA    1 
ATOM   7127 C  C     . VAL A 1 870 ? 28.294  20.139  -29.446 1.00 20.32 ? 870  VAL A C     1 
ATOM   7128 O  O     . VAL A 1 870 ? 27.842  19.579  -30.449 1.00 18.92 ? 870  VAL A O     1 
ATOM   7129 C  CB    . VAL A 1 870 ? 29.579  18.840  -27.678 1.00 19.77 ? 870  VAL A CB    1 
ATOM   7130 C  CG1   . VAL A 1 870 ? 28.405  17.883  -27.814 1.00 18.56 ? 870  VAL A CG1   1 
ATOM   7131 C  CG2   . VAL A 1 870 ? 30.877  18.062  -27.504 1.00 21.02 ? 870  VAL A CG2   1 
ATOM   7132 N  N     . LEU A 1 871 ? 27.640  21.084  -28.783 1.00 21.02 ? 871  LEU A N     1 
ATOM   7133 C  CA    . LEU A 1 871 ? 26.304  21.525  -29.146 1.00 21.48 ? 871  LEU A CA    1 
ATOM   7134 C  C     . LEU A 1 871 ? 26.263  22.037  -30.585 1.00 21.07 ? 871  LEU A C     1 
ATOM   7135 O  O     . LEU A 1 871 ? 25.405  21.630  -31.376 1.00 20.33 ? 871  LEU A O     1 
ATOM   7136 C  CB    . LEU A 1 871 ? 25.871  22.630  -28.186 1.00 24.23 ? 871  LEU A CB    1 
ATOM   7137 C  CG    . LEU A 1 871 ? 24.412  22.779  -27.776 1.00 25.48 ? 871  LEU A CG    1 
ATOM   7138 C  CD1   . LEU A 1 871 ? 24.353  23.759  -26.628 1.00 26.53 ? 871  LEU A CD1   1 
ATOM   7139 C  CD2   . LEU A 1 871 ? 23.565  23.266  -28.935 1.00 34.12 ? 871  LEU A CD2   1 
ATOM   7140 N  N     . LEU A 1 872 ? 27.200  22.922  -30.915 1.00 19.61 ? 872  LEU A N     1 
ATOM   7141 C  CA    . LEU A 1 872 ? 27.292  23.493  -32.255 1.00 20.12 ? 872  LEU A CA    1 
ATOM   7142 C  C     . LEU A 1 872 ? 27.569  22.429  -33.321 1.00 19.69 ? 872  LEU A C     1 
ATOM   7143 O  O     . LEU A 1 872 ? 26.899  22.404  -34.354 1.00 18.39 ? 872  LEU A O     1 
ATOM   7144 C  CB    . LEU A 1 872 ? 28.358  24.594  -32.306 1.00 19.92 ? 872  LEU A CB    1 
ATOM   7145 C  CG    . LEU A 1 872 ? 28.588  25.320  -33.639 1.00 21.87 ? 872  LEU A CG    1 
ATOM   7146 C  CD1   . LEU A 1 872 ? 27.387  26.167  -34.045 1.00 23.17 ? 872  LEU A CD1   1 
ATOM   7147 C  CD2   . LEU A 1 872 ? 29.837  26.174  -33.557 1.00 22.68 ? 872  LEU A CD2   1 
ATOM   7148 N  N     . GLU A 1 873 ? 28.542  21.553  -33.063 1.00 21.63 ? 873  GLU A N     1 
ATOM   7149 C  CA    . GLU A 1 873 ? 28.893  20.492  -34.017 1.00 23.41 ? 873  GLU A CA    1 
ATOM   7150 C  C     . GLU A 1 873 ? 27.742  19.534  -34.311 1.00 21.36 ? 873  GLU A C     1 
ATOM   7151 O  O     . GLU A 1 873 ? 27.428  19.277  -35.470 1.00 22.25 ? 873  GLU A O     1 
ATOM   7152 C  CB    . GLU A 1 873 ? 30.134  19.711  -33.568 1.00 24.07 ? 873  GLU A CB    1 
ATOM   7153 C  CG    . GLU A 1 873 ? 31.375  19.978  -34.422 1.00 33.37 ? 873  GLU A CG    1 
ATOM   7154 C  CD    . GLU A 1 873 ? 31.362  19.268  -35.777 1.00 35.16 ? 873  GLU A CD    1 
ATOM   7155 O  OE1   . GLU A 1 873 ? 32.217  19.610  -36.625 1.00 38.55 ? 873  GLU A OE1   1 
ATOM   7156 O  OE2   . GLU A 1 873 ? 30.517  18.367  -35.997 1.00 35.74 ? 873  GLU A OE2   1 
ATOM   7157 N  N     . LYS A 1 874 ? 27.117  19.017  -33.260 1.00 22.12 ? 874  LYS A N     1 
ATOM   7158 C  CA    . LYS A 1 874 ? 26.069  18.004  -33.389 1.00 22.43 ? 874  LYS A CA    1 
ATOM   7159 C  C     . LYS A 1 874 ? 24.754  18.524  -33.972 1.00 20.27 ? 874  LYS A C     1 
ATOM   7160 O  O     . LYS A 1 874 ? 24.143  17.865  -34.822 1.00 18.58 ? 874  LYS A O     1 
ATOM   7161 C  CB    . LYS A 1 874 ? 25.817  17.332  -32.033 1.00 24.65 ? 874  LYS A CB    1 
ATOM   7162 C  CG    . LYS A 1 874 ? 26.761  16.164  -31.744 1.00 29.50 ? 874  LYS A CG    1 
ATOM   7163 C  CD    . LYS A 1 874 ? 26.892  15.833  -30.251 1.00 32.88 ? 874  LYS A CD    1 
ATOM   7164 C  CE    . LYS A 1 874 ? 25.558  15.822  -29.517 1.00 34.89 ? 874  LYS A CE    1 
ATOM   7165 N  NZ    . LYS A 1 874 ? 25.663  15.153  -28.187 1.00 34.49 ? 874  LYS A NZ    1 
ATOM   7166 N  N     . THR A 1 875 ? 24.316  19.699  -33.524 1.00 18.24 ? 875  THR A N     1 
ATOM   7167 C  CA    . THR A 1 875 ? 22.978  20.176  -33.872 1.00 18.55 ? 875  THR A CA    1 
ATOM   7168 C  C     . THR A 1 875 ? 22.975  21.081  -35.095 1.00 16.78 ? 875  THR A C     1 
ATOM   7169 O  O     . THR A 1 875 ? 21.985  21.134  -35.823 1.00 19.57 ? 875  THR A O     1 
ATOM   7170 C  CB    . THR A 1 875 ? 22.284  20.928  -32.697 1.00 18.55 ? 875  THR A CB    1 
ATOM   7171 O  OG1   . THR A 1 875 ? 23.023  22.115  -32.384 1.00 19.23 ? 875  THR A OG1   1 
ATOM   7172 C  CG2   . THR A 1 875 ? 22.170  20.040  -31.451 1.00 19.79 ? 875  THR A CG2   1 
ATOM   7173 N  N     . PHE A 1 876 ? 24.069  21.803  -35.311 1.00 16.23 ? 876  PHE A N     1 
ATOM   7174 C  CA    . PHE A 1 876 ? 24.129  22.789  -36.396 1.00 14.18 ? 876  PHE A CA    1 
ATOM   7175 C  C     . PHE A 1 876 ? 25.092  22.409  -37.525 1.00 14.52 ? 876  PHE A C     1 
ATOM   7176 O  O     . PHE A 1 876 ? 24.686  22.322  -38.686 1.00 13.69 ? 876  PHE A O     1 
ATOM   7177 C  CB    . PHE A 1 876 ? 24.455  24.186  -35.848 1.00 12.61 ? 876  PHE A CB    1 
ATOM   7178 C  CG    . PHE A 1 876 ? 24.495  25.256  -36.903 1.00 15.16 ? 876  PHE A CG    1 
ATOM   7179 C  CD1   . PHE A 1 876 ? 23.319  25.691  -37.515 1.00 15.54 ? 876  PHE A CD1   1 
ATOM   7180 C  CD2   . PHE A 1 876 ? 25.707  25.830  -37.286 1.00 15.09 ? 876  PHE A CD2   1 
ATOM   7181 C  CE1   . PHE A 1 876 ? 23.346  26.680  -38.502 1.00 15.06 ? 876  PHE A CE1   1 
ATOM   7182 C  CE2   . PHE A 1 876 ? 25.745  26.821  -38.260 1.00 16.08 ? 876  PHE A CE2   1 
ATOM   7183 C  CZ    . PHE A 1 876 ? 24.562  27.249  -38.873 1.00 16.28 ? 876  PHE A CZ    1 
ATOM   7184 N  N     . ILE A 1 877 ? 26.359  22.177  -37.189 1.00 14.43 ? 877  ILE A N     1 
ATOM   7185 C  CA    . ILE A 1 877 ? 27.369  21.932  -38.219 1.00 15.75 ? 877  ILE A CA    1 
ATOM   7186 C  C     . ILE A 1 877 ? 27.126  20.629  -38.975 1.00 15.48 ? 877  ILE A C     1 
ATOM   7187 O  O     . ILE A 1 877 ? 27.129  20.629  -40.202 1.00 14.05 ? 877  ILE A O     1 
ATOM   7188 C  CB    . ILE A 1 877 ? 28.811  22.003  -37.676 1.00 15.93 ? 877  ILE A CB    1 
ATOM   7189 C  CG1   . ILE A 1 877 ? 29.179  23.458  -37.342 1.00 17.67 ? 877  ILE A CG1   1 
ATOM   7190 C  CG2   . ILE A 1 877 ? 29.807  21.444  -38.701 1.00 18.19 ? 877  ILE A CG2   1 
ATOM   7191 C  CD1   . ILE A 1 877 ? 30.448  23.600  -36.527 1.00 15.58 ? 877  ILE A CD1   1 
ATOM   7192 N  N     . LYS A 1 878 ? 26.901  19.533  -38.253 1.00 15.11 ? 878  LYS A N     1 
ATOM   7193 C  CA    . LYS A 1 878 ? 26.709  18.238  -38.906 1.00 16.78 ? 878  LYS A CA    1 
ATOM   7194 C  C     . LYS A 1 878 ? 25.489  18.216  -39.847 1.00 14.64 ? 878  LYS A C     1 
ATOM   7195 O  O     . LYS A 1 878 ? 25.615  17.754  -40.973 1.00 14.30 ? 878  LYS A O     1 
ATOM   7196 C  CB    . LYS A 1 878 ? 26.668  17.084  -37.901 1.00 19.51 ? 878  LYS A CB    1 
ATOM   7197 C  CG    . LYS A 1 878 ? 27.233  15.776  -38.465 1.00 27.00 ? 878  LYS A CG    1 
ATOM   7198 C  CD    . LYS A 1 878 ? 27.235  14.632  -37.440 1.00 33.03 ? 878  LYS A CD    1 
ATOM   7199 C  CE    . LYS A 1 878 ? 28.116  14.929  -36.222 1.00 36.64 ? 878  LYS A CE    1 
ATOM   7200 N  NZ    . LYS A 1 878 ? 29.574  15.075  -36.549 1.00 39.08 ? 878  LYS A NZ    1 
ATOM   7201 N  N     . PRO A 1 879 ? 24.317  18.731  -39.408 1.00 13.98 ? 879  PRO A N     1 
ATOM   7202 C  CA    . PRO A 1 879 ? 23.219  18.805  -40.388 1.00 13.83 ? 879  PRO A CA    1 
ATOM   7203 C  C     . PRO A 1 879 ? 23.526  19.714  -41.585 1.00 13.76 ? 879  PRO A C     1 
ATOM   7204 O  O     . PRO A 1 879 ? 23.226  19.343  -42.727 1.00 14.99 ? 879  PRO A O     1 
ATOM   7205 C  CB    . PRO A 1 879 ? 22.057  19.366  -39.566 1.00 14.30 ? 879  PRO A CB    1 
ATOM   7206 C  CG    . PRO A 1 879 ? 22.355  18.912  -38.173 1.00 14.60 ? 879  PRO A CG    1 
ATOM   7207 C  CD    . PRO A 1 879 ? 23.847  19.077  -38.054 1.00 15.30 ? 879  PRO A CD    1 
ATOM   7208 N  N     . LEU A 1 880 ? 24.118  20.882  -41.327 1.00 13.65 ? 880  LEU A N     1 
ATOM   7209 C  CA    . LEU A 1 880 ? 24.468  21.811  -42.402 1.00 14.65 ? 880  LEU A CA    1 
ATOM   7210 C  C     . LEU A 1 880 ? 25.452  21.182  -43.390 1.00 15.46 ? 880  LEU A C     1 
ATOM   7211 O  O     . LEU A 1 880 ? 25.327  21.378  -44.600 1.00 16.16 ? 880  LEU A O     1 
ATOM   7212 C  CB    . LEU A 1 880 ? 25.020  23.131  -41.856 1.00 12.75 ? 880  LEU A CB    1 
ATOM   7213 C  CG    . LEU A 1 880 ? 25.259  24.229  -42.905 1.00 15.08 ? 880  LEU A CG    1 
ATOM   7214 C  CD1   . LEU A 1 880 ? 23.958  24.649  -43.640 1.00 13.39 ? 880  LEU A CD1   1 
ATOM   7215 C  CD2   . LEU A 1 880 ? 25.928  25.425  -42.263 1.00 15.02 ? 880  LEU A CD2   1 
ATOM   7216 N  N     . GLU A 1 881 ? 26.428  20.439  -42.870 1.00 14.16 ? 881  GLU A N     1 
ATOM   7217 C  CA    . GLU A 1 881 ? 27.348  19.672  -43.717 1.00 16.79 ? 881  GLU A CA    1 
ATOM   7218 C  C     . GLU A 1 881 ? 26.598  18.721  -44.668 1.00 14.72 ? 881  GLU A C     1 
ATOM   7219 O  O     . GLU A 1 881 ? 26.966  18.586  -45.830 1.00 13.96 ? 881  GLU A O     1 
ATOM   7220 C  CB    . GLU A 1 881 ? 28.365  18.904  -42.859 1.00 18.14 ? 881  GLU A CB    1 
ATOM   7221 C  CG    . GLU A 1 881 ? 29.119  17.772  -43.582 1.00 23.75 ? 881  GLU A CG    1 
ATOM   7222 C  CD    . GLU A 1 881 ? 30.007  18.262  -44.724 1.00 31.39 ? 881  GLU A CD    1 
ATOM   7223 O  OE1   . GLU A 1 881 ? 30.214  17.485  -45.681 1.00 32.12 ? 881  GLU A OE1   1 
ATOM   7224 O  OE2   . GLU A 1 881 ? 30.496  19.415  -44.669 1.00 33.56 ? 881  GLU A OE2   1 
ATOM   7225 N  N     . GLY A 1 882 ? 25.563  18.061  -44.156 1.00 13.52 ? 882  GLY A N     1 
ATOM   7226 C  CA    . GLY A 1 882 ? 24.701  17.211  -44.974 1.00 12.31 ? 882  GLY A CA    1 
ATOM   7227 C  C     . GLY A 1 882 ? 23.989  17.977  -46.079 1.00 11.40 ? 882  GLY A C     1 
ATOM   7228 O  O     . GLY A 1 882 ? 23.954  17.516  -47.210 1.00 11.04 ? 882  GLY A O     1 
ATOM   7229 N  N     . PHE A 1 883 ? 23.437  19.151  -45.762 1.00 10.02 ? 883  PHE A N     1 
ATOM   7230 C  CA    . PHE A 1 883 ? 22.735  19.959  -46.768 1.00 12.29 ? 883  PHE A CA    1 
ATOM   7231 C  C     . PHE A 1 883 ? 23.685  20.400  -47.881 1.00 12.45 ? 883  PHE A C     1 
ATOM   7232 O  O     . PHE A 1 883 ? 23.378  20.275  -49.070 1.00 10.48 ? 883  PHE A O     1 
ATOM   7233 C  CB    . PHE A 1 883 ? 22.083  21.223  -46.161 1.00 10.29 ? 883  PHE A CB    1 
ATOM   7234 C  CG    . PHE A 1 883 ? 21.181  20.967  -44.968 1.00 14.41 ? 883  PHE A CG    1 
ATOM   7235 C  CD1   . PHE A 1 883 ? 20.688  19.691  -44.674 1.00 12.29 ? 883  PHE A CD1   1 
ATOM   7236 C  CD2   . PHE A 1 883 ? 20.805  22.031  -44.150 1.00 14.69 ? 883  PHE A CD2   1 
ATOM   7237 C  CE1   . PHE A 1 883 ? 19.857  19.482  -43.569 1.00 13.00 ? 883  PHE A CE1   1 
ATOM   7238 C  CE2   . PHE A 1 883 ? 19.969  21.828  -43.043 1.00 13.56 ? 883  PHE A CE2   1 
ATOM   7239 C  CZ    . PHE A 1 883 ? 19.504  20.555  -42.755 1.00 11.89 ? 883  PHE A CZ    1 
ATOM   7240 N  N     . THR A 1 884 ? 24.843  20.917  -47.482 1.00 11.29 ? 884  THR A N     1 
ATOM   7241 C  CA    . THR A 1 884 ? 25.755  21.539  -48.432 1.00 12.25 ? 884  THR A CA    1 
ATOM   7242 C  C     . THR A 1 884 ? 26.511  20.521  -49.287 1.00 13.67 ? 884  THR A C     1 
ATOM   7243 O  O     . THR A 1 884 ? 26.738  20.758  -50.479 1.00 14.48 ? 884  THR A O     1 
ATOM   7244 C  CB    . THR A 1 884 ? 26.736  22.494  -47.726 1.00 13.37 ? 884  THR A CB    1 
ATOM   7245 O  OG1   . THR A 1 884 ? 27.490  21.774  -46.745 1.00 12.52 ? 884  THR A OG1   1 
ATOM   7246 C  CG2   . THR A 1 884 ? 25.979  23.626  -47.057 1.00 13.09 ? 884  THR A CG2   1 
ATOM   7247 N  N     . SER A 1 885 ? 26.895  19.388  -48.698 1.00 13.79 ? 885  SER A N     1 
ATOM   7248 C  CA    . SER A 1 885 ? 27.546  18.340  -49.486 1.00 14.63 ? 885  SER A CA    1 
ATOM   7249 C  C     . SER A 1 885 ? 26.579  17.795  -50.550 1.00 13.85 ? 885  SER A C     1 
ATOM   7250 O  O     . SER A 1 885 ? 26.958  17.584  -51.705 1.00 14.09 ? 885  SER A O     1 
ATOM   7251 C  CB    . SER A 1 885 ? 28.098  17.223  -48.593 1.00 16.11 ? 885  SER A CB    1 
ATOM   7252 O  OG    . SER A 1 885 ? 27.062  16.558  -47.893 1.00 19.66 ? 885  SER A OG    1 
ATOM   7253 N  N     . ALA A 1 886 ? 25.324  17.596  -50.164 1.00 10.99 ? 886  ALA A N     1 
ATOM   7254 C  CA    . ALA A 1 886 ? 24.300  17.203  -51.125 1.00 12.94 ? 886  ALA A CA    1 
ATOM   7255 C  C     . ALA A 1 886 ? 24.163  18.255  -52.230 1.00 11.09 ? 886  ALA A C     1 
ATOM   7256 O  O     . ALA A 1 886 ? 24.099  17.924  -53.410 1.00 11.59 ? 886  ALA A O     1 
ATOM   7257 C  CB    . ALA A 1 886 ? 22.966  16.971  -50.418 1.00 10.77 ? 886  ALA A CB    1 
ATOM   7258 N  N     . ALA A 1 887 ? 24.142  19.525  -51.841 1.00 12.41 ? 887  ALA A N     1 
ATOM   7259 C  CA    . ALA A 1 887 ? 23.911  20.614  -52.788 1.00 12.93 ? 887  ALA A CA    1 
ATOM   7260 C  C     . ALA A 1 887 ? 25.164  21.028  -53.563 1.00 13.42 ? 887  ALA A C     1 
ATOM   7261 O  O     . ALA A 1 887 ? 25.084  21.877  -54.451 1.00 13.09 ? 887  ALA A O     1 
ATOM   7262 C  CB    . ALA A 1 887 ? 23.315  21.816  -52.065 1.00 13.27 ? 887  ALA A CB    1 
ATOM   7263 N  N     . LYS A 1 888 ? 26.304  20.420  -53.228 1.00 13.33 ? 888  LYS A N     1 
ATOM   7264 C  CA    . LYS A 1 888 ? 27.616  20.729  -53.833 1.00 15.83 ? 888  LYS A CA    1 
ATOM   7265 C  C     . LYS A 1 888 ? 28.029  22.186  -53.596 1.00 16.06 ? 888  LYS A C     1 
ATOM   7266 O  O     . LYS A 1 888 ? 28.497  22.877  -54.509 1.00 14.75 ? 888  LYS A O     1 
ATOM   7267 C  CB    . LYS A 1 888 ? 27.662  20.387  -55.332 1.00 15.92 ? 888  LYS A CB    1 
ATOM   7268 C  CG    . LYS A 1 888 ? 26.863  19.165  -55.761 1.00 19.38 ? 888  LYS A CG    1 
ATOM   7269 C  CD    . LYS A 1 888 ? 27.688  17.909  -55.808 1.00 25.48 ? 888  LYS A CD    1 
ATOM   7270 C  CE    . LYS A 1 888 ? 27.174  16.985  -56.905 1.00 26.35 ? 888  LYS A CE    1 
ATOM   7271 N  NZ    . LYS A 1 888 ? 27.315  15.561  -56.505 1.00 28.88 ? 888  LYS A NZ    1 
ATOM   7272 N  N     . LEU A 1 889 ? 27.829  22.631  -52.359 1.00 16.95 ? 889  LEU A N     1 
ATOM   7273 C  CA    . LEU A 1 889 ? 28.167  23.975  -51.896 1.00 20.39 ? 889  LEU A CA    1 
ATOM   7274 C  C     . LEU A 1 889 ? 29.049  23.815  -50.667 1.00 17.64 ? 889  LEU A C     1 
ATOM   7275 O  O     . LEU A 1 889 ? 29.056  22.757  -50.043 1.00 16.54 ? 889  LEU A O     1 
ATOM   7276 C  CB    . LEU A 1 889 ? 26.894  24.731  -51.464 1.00 23.38 ? 889  LEU A CB    1 
ATOM   7277 C  CG    . LEU A 1 889 ? 26.017  25.488  -52.463 1.00 28.49 ? 889  LEU A CG    1 
ATOM   7278 C  CD1   . LEU A 1 889 ? 24.904  24.617  -52.940 1.00 33.75 ? 889  LEU A CD1   1 
ATOM   7279 C  CD2   . LEU A 1 889 ? 25.414  26.710  -51.805 1.00 34.41 ? 889  LEU A CD2   1 
ATOM   7280 N  N     . ASP A 1 890 ? 29.766  24.874  -50.307 1.00 17.54 ? 890  ASP A N     1 
ATOM   7281 C  CA    . ASP A 1 890 ? 30.508  24.913  -49.052 1.00 16.91 ? 890  ASP A CA    1 
ATOM   7282 C  C     . ASP A 1 890 ? 29.949  26.021  -48.173 1.00 17.47 ? 890  ASP A C     1 
ATOM   7283 O  O     . ASP A 1 890 ? 29.657  27.112  -48.666 1.00 19.02 ? 890  ASP A O     1 
ATOM   7284 C  CB    . ASP A 1 890 ? 32.000  25.156  -49.308 1.00 18.72 ? 890  ASP A CB    1 
ATOM   7285 C  CG    . ASP A 1 890 ? 32.697  23.953  -49.927 1.00 20.83 ? 890  ASP A CG    1 
ATOM   7286 O  OD1   . ASP A 1 890 ? 32.611  22.848  -49.353 1.00 22.66 ? 890  ASP A OD1   1 
ATOM   7287 O  OD2   . ASP A 1 890 ? 33.344  24.121  -50.982 1.00 23.53 ? 890  ASP A OD2   1 
ATOM   7288 N  N     . TYR A 1 891 ? 29.782  25.734  -46.881 1.00 16.19 ? 891  TYR A N     1 
ATOM   7289 C  CA    . TYR A 1 891 ? 29.358  26.753  -45.913 1.00 17.57 ? 891  TYR A CA    1 
ATOM   7290 C  C     . TYR A 1 891 ? 30.543  27.580  -45.401 1.00 17.54 ? 891  TYR A C     1 
ATOM   7291 O  O     . TYR A 1 891 ? 30.351  28.645  -44.805 1.00 16.01 ? 891  TYR A O     1 
ATOM   7292 C  CB    . TYR A 1 891 ? 28.589  26.128  -44.740 1.00 15.82 ? 891  TYR A CB    1 
ATOM   7293 C  CG    . TYR A 1 891 ? 29.360  25.086  -43.972 1.00 17.55 ? 891  TYR A CG    1 
ATOM   7294 C  CD1   . TYR A 1 891 ? 29.293  23.739  -44.323 1.00 18.20 ? 891  TYR A CD1   1 
ATOM   7295 C  CD2   . TYR A 1 891 ? 30.167  25.449  -42.893 1.00 17.39 ? 891  TYR A CD2   1 
ATOM   7296 C  CE1   . TYR A 1 891 ? 30.016  22.777  -43.618 1.00 19.80 ? 891  TYR A CE1   1 
ATOM   7297 C  CE2   . TYR A 1 891 ? 30.892  24.503  -42.186 1.00 19.84 ? 891  TYR A CE2   1 
ATOM   7298 C  CZ    . TYR A 1 891 ? 30.810  23.172  -42.550 1.00 20.39 ? 891  TYR A CZ    1 
ATOM   7299 O  OH    . TYR A 1 891 ? 31.526  22.244  -41.839 1.00 19.32 ? 891  TYR A OH    1 
ATOM   7300 N  N     . GLU A 1 892 ? 31.754  27.065  -45.624 1.00 17.40 ? 892  GLU A N     1 
ATOM   7301 C  CA    . GLU A 1 892 ? 33.006  27.774  -45.336 1.00 19.55 ? 892  GLU A CA    1 
ATOM   7302 C  C     . GLU A 1 892 ? 33.879  27.832  -46.585 1.00 20.39 ? 892  GLU A C     1 
ATOM   7303 O  O     . GLU A 1 892 ? 34.038  26.829  -47.282 1.00 20.02 ? 892  GLU A O     1 
ATOM   7304 C  CB    . GLU A 1 892 ? 33.804  27.052  -44.253 1.00 20.46 ? 892  GLU A CB    1 
ATOM   7305 C  CG    . GLU A 1 892 ? 33.280  27.215  -42.852 1.00 24.77 ? 892  GLU A CG    1 
ATOM   7306 C  CD    . GLU A 1 892 ? 34.198  26.577  -41.835 1.00 26.11 ? 892  GLU A CD    1 
ATOM   7307 O  OE1   . GLU A 1 892 ? 34.637  27.297  -40.919 1.00 30.78 ? 892  GLU A OE1   1 
ATOM   7308 O  OE2   . GLU A 1 892 ? 34.495  25.366  -41.963 1.00 27.19 ? 892  GLU A OE2   1 
ATOM   7309 N  N     . LYS A 1 893 ? 34.461  28.996  -46.848 1.00 20.60 ? 893  LYS A N     1 
ATOM   7310 C  CA    . LYS A 1 893 ? 35.328  29.171  -48.008 1.00 23.22 ? 893  LYS A CA    1 
ATOM   7311 C  C     . LYS A 1 893 ? 36.527  28.236  -47.880 1.00 21.93 ? 893  LYS A C     1 
ATOM   7312 O  O     . LYS A 1 893 ? 37.238  28.260  -46.876 1.00 19.65 ? 893  LYS A O     1 
ATOM   7313 C  CB    . LYS A 1 893 ? 35.780  30.631  -48.116 1.00 26.02 ? 893  LYS A CB    1 
ATOM   7314 C  CG    . LYS A 1 893 ? 36.271  31.042  -49.495 1.00 31.75 ? 893  LYS A CG    1 
ATOM   7315 C  CD    . LYS A 1 893 ? 36.367  32.557  -49.603 1.00 37.51 ? 893  LYS A CD    1 
ATOM   7316 C  CE    . LYS A 1 893 ? 36.797  32.989  -50.998 1.00 40.90 ? 893  LYS A CE    1 
ATOM   7317 N  NZ    . LYS A 1 893 ? 36.942  34.473  -51.096 1.00 43.01 ? 893  LYS A NZ    1 
ATOM   7318 N  N     . LYS A 1 894 ? 36.715  27.376  -48.875 1.00 22.69 ? 894  LYS A N     1 
ATOM   7319 C  CA    . LYS A 1 894 ? 37.831  26.436  -48.853 1.00 24.39 ? 894  LYS A CA    1 
ATOM   7320 C  C     . LYS A 1 894 ? 39.131  27.117  -49.278 1.00 23.57 ? 894  LYS A C     1 
ATOM   7321 O  O     . LYS A 1 894 ? 39.109  28.115  -50.011 1.00 22.72 ? 894  LYS A O     1 
ATOM   7322 C  CB    . LYS A 1 894 ? 37.535  25.187  -49.700 1.00 27.11 ? 894  LYS A CB    1 
ATOM   7323 C  CG    . LYS A 1 894 ? 36.996  25.448  -51.103 1.00 32.88 ? 894  LYS A CG    1 
ATOM   7324 C  CD    . LYS A 1 894 ? 38.121  25.556  -52.123 1.00 37.97 ? 894  LYS A CD    1 
ATOM   7325 C  CE    . LYS A 1 894 ? 37.603  25.935  -53.502 1.00 40.17 ? 894  LYS A CE    1 
ATOM   7326 N  NZ    . LYS A 1 894 ? 38.730  26.207  -54.443 1.00 41.04 ? 894  LYS A NZ    1 
ATOM   7327 N  N     . ALA A 1 895 ? 40.251  26.584  -48.793 1.00 21.63 ? 895  ALA A N     1 
ATOM   7328 C  CA    . ALA A 1 895 ? 41.568  27.074  -49.162 1.00 20.86 ? 895  ALA A CA    1 
ATOM   7329 C  C     . ALA A 1 895 ? 41.813  26.878  -50.655 1.00 19.99 ? 895  ALA A C     1 
ATOM   7330 O  O     . ALA A 1 895 ? 41.383  25.882  -51.241 1.00 19.22 ? 895  ALA A O     1 
ATOM   7331 C  CB    . ALA A 1 895 ? 42.654  26.376  -48.343 1.00 21.48 ? 895  ALA A CB    1 
ATOM   7332 N  N     . SER A 1 896 ? 42.485  27.849  -51.264 1.00 18.90 ? 896  SER A N     1 
ATOM   7333 C  CA    . SER A 1 896 ? 42.860  27.775  -52.672 1.00 17.27 ? 896  SER A CA    1 
ATOM   7334 C  C     . SER A 1 896 ? 44.135  28.568  -52.914 1.00 16.97 ? 896  SER A C     1 
ATOM   7335 O  O     . SER A 1 896 ? 44.614  29.273  -52.026 1.00 15.79 ? 896  SER A O     1 
ATOM   7336 C  CB    . SER A 1 896 ? 41.742  28.337  -53.548 1.00 17.13 ? 896  SER A CB    1 
ATOM   7337 O  OG    . SER A 1 896 ? 41.701  29.750  -53.454 1.00 16.85 ? 896  SER A OG    1 
ATOM   7338 N  N     . LEU A 1 897 ? 44.661  28.456  -54.133 1.00 16.92 ? 897  LEU A N     1 
ATOM   7339 C  CA    . LEU A 1 897 ? 45.825  29.217  -54.585 1.00 17.36 ? 897  LEU A CA    1 
ATOM   7340 C  C     . LEU A 1 897 ? 45.663  30.727  -54.373 1.00 16.76 ? 897  LEU A C     1 
ATOM   7341 O  O     . LEU A 1 897 ? 46.649  31.444  -54.226 1.00 16.07 ? 897  LEU A O     1 
ATOM   7342 C  CB    . LEU A 1 897 ? 46.089  28.922  -56.069 1.00 17.29 ? 897  LEU A CB    1 
ATOM   7343 C  CG    . LEU A 1 897 ? 46.960  27.744  -56.541 1.00 20.90 ? 897  LEU A CG    1 
ATOM   7344 C  CD1   . LEU A 1 897 ? 46.984  26.542  -55.594 1.00 22.26 ? 897  LEU A CD1   1 
ATOM   7345 C  CD2   . LEU A 1 897 ? 46.545  27.316  -57.950 1.00 20.37 ? 897  LEU A CD2   1 
ATOM   7346 N  N     . PHE A 1 898 ? 44.416  31.194  -54.347 1.00 16.93 ? 898  PHE A N     1 
ATOM   7347 C  CA    . PHE A 1 898 ? 44.109  32.619  -54.177 1.00 18.71 ? 898  PHE A CA    1 
ATOM   7348 C  C     . PHE A 1 898 ? 44.488  33.181  -52.806 1.00 18.24 ? 898  PHE A C     1 
ATOM   7349 O  O     . PHE A 1 898 ? 44.686  34.389  -52.662 1.00 18.10 ? 898  PHE A O     1 
ATOM   7350 C  CB    . PHE A 1 898 ? 42.635  32.891  -54.496 1.00 19.41 ? 898  PHE A CB    1 
ATOM   7351 C  CG    . PHE A 1 898 ? 42.300  32.709  -55.947 1.00 23.92 ? 898  PHE A CG    1 
ATOM   7352 C  CD1   . PHE A 1 898 ? 42.437  33.768  -56.841 1.00 25.45 ? 898  PHE A CD1   1 
ATOM   7353 C  CD2   . PHE A 1 898 ? 41.881  31.473  -56.427 1.00 25.05 ? 898  PHE A CD2   1 
ATOM   7354 C  CE1   . PHE A 1 898 ? 42.142  33.603  -58.192 1.00 27.00 ? 898  PHE A CE1   1 
ATOM   7355 C  CE2   . PHE A 1 898 ? 41.587  31.296  -57.775 1.00 26.85 ? 898  PHE A CE2   1 
ATOM   7356 C  CZ    . PHE A 1 898 ? 41.719  32.365  -58.660 1.00 27.91 ? 898  PHE A CZ    1 
ATOM   7357 N  N     . ASP A 1 899 ? 44.610  32.296  -51.817 1.00 18.70 ? 899  ASP A N     1 
ATOM   7358 C  CA    . ASP A 1 899 ? 45.012  32.671  -50.458 1.00 18.84 ? 899  ASP A CA    1 
ATOM   7359 C  C     . ASP A 1 899 ? 46.412  33.273  -50.384 1.00 18.73 ? 899  ASP A C     1 
ATOM   7360 O  O     . ASP A 1 899 ? 46.759  33.905  -49.388 1.00 19.59 ? 899  ASP A O     1 
ATOM   7361 C  CB    . ASP A 1 899 ? 44.905  31.467  -49.509 1.00 18.78 ? 899  ASP A CB    1 
ATOM   7362 C  CG    . ASP A 1 899 ? 43.492  30.911  -49.420 1.00 20.22 ? 899  ASP A CG    1 
ATOM   7363 O  OD1   . ASP A 1 899 ? 42.523  31.670  -49.632 1.00 18.43 ? 899  ASP A OD1   1 
ATOM   7364 O  OD2   . ASP A 1 899 ? 43.351  29.705  -49.140 1.00 22.17 ? 899  ASP A OD2   1 
ATOM   7365 N  N     . MET A 1 900 ? 47.205  33.087  -51.441 1.00 18.63 ? 900  MET A N     1 
ATOM   7366 C  CA    . MET A 1 900 ? 48.546  33.660  -51.531 1.00 18.44 ? 900  MET A CA    1 
ATOM   7367 C  C     . MET A 1 900 ? 48.519  35.173  -51.762 1.00 17.87 ? 900  MET A C     1 
ATOM   7368 O  O     . MET A 1 900 ? 49.535  35.848  -51.589 1.00 15.40 ? 900  MET A O     1 
ATOM   7369 C  CB    . MET A 1 900 ? 49.354  32.981  -52.645 1.00 20.24 ? 900  MET A CB    1 
ATOM   7370 C  CG    . MET A 1 900 ? 49.551  31.471  -52.478 1.00 22.79 ? 900  MET A CG    1 
ATOM   7371 S  SD    . MET A 1 900 ? 50.579  31.003  -51.068 1.00 27.25 ? 900  MET A SD    1 
ATOM   7372 C  CE    . MET A 1 900 ? 52.211  31.484  -51.635 1.00 23.72 ? 900  MET A CE    1 
ATOM   7373 N  N     . PHE A 1 901 ? 47.356  35.696  -52.146 1.00 17.25 ? 901  PHE A N     1 
ATOM   7374 C  CA    . PHE A 1 901 ? 47.200  37.118  -52.462 1.00 19.21 ? 901  PHE A CA    1 
ATOM   7375 C  C     . PHE A 1 901 ? 46.524  37.884  -51.326 1.00 23.83 ? 901  PHE A C     1 
ATOM   7376 O  O     . PHE A 1 901 ? 45.856  37.290  -50.478 1.00 23.61 ? 901  PHE A O     1 
ATOM   7377 C  CB    . PHE A 1 901 ? 46.399  37.289  -53.761 1.00 14.99 ? 901  PHE A CB    1 
ATOM   7378 C  CG    . PHE A 1 901 ? 47.070  36.693  -54.970 1.00 11.16 ? 901  PHE A CG    1 
ATOM   7379 C  CD1   . PHE A 1 901 ? 47.963  37.445  -55.726 1.00 7.89  ? 901  PHE A CD1   1 
ATOM   7380 C  CD2   . PHE A 1 901 ? 46.814  35.378  -55.345 1.00 8.53  ? 901  PHE A CD2   1 
ATOM   7381 C  CE1   . PHE A 1 901 ? 48.595  36.896  -56.843 1.00 10.04 ? 901  PHE A CE1   1 
ATOM   7382 C  CE2   . PHE A 1 901 ? 47.439  34.818  -56.456 1.00 10.17 ? 901  PHE A CE2   1 
ATOM   7383 C  CZ    . PHE A 1 901 ? 48.333  35.578  -57.206 1.00 7.21  ? 901  PHE A CZ    1 
ATOM   7384 N  N     . ASP A 1 902 ? 46.701  39.203  -51.328 1.00 30.06 ? 902  ASP A N     1 
ATOM   7385 C  CA    . ASP A 1 902 ? 46.067  40.089  -50.348 1.00 35.94 ? 902  ASP A CA    1 
ATOM   7386 C  C     . ASP A 1 902 ? 44.815  40.735  -50.943 1.00 37.49 ? 902  ASP A C     1 
ATOM   7387 O  O     . ASP A 1 902 ? 44.892  41.765  -51.620 1.00 37.63 ? 902  ASP A O     1 
ATOM   7388 C  CB    . ASP A 1 902 ? 47.062  41.154  -49.865 1.00 38.18 ? 902  ASP A CB    1 
ATOM   7389 C  CG    . ASP A 1 902 ? 46.477  42.084  -48.799 1.00 43.98 ? 902  ASP A CG    1 
ATOM   7390 O  OD1   . ASP A 1 902 ? 47.194  43.028  -48.394 1.00 47.31 ? 902  ASP A OD1   1 
ATOM   7391 O  OD2   . ASP A 1 902 ? 45.317  41.885  -48.365 1.00 44.58 ? 902  ASP A OD2   1 
ATOM   7392 N  N     . PHE A 1 903 ? 43.664  40.115  -50.693 1.00 39.08 ? 903  PHE A N     1 
ATOM   7393 C  CA    . PHE A 1 903 ? 42.388  40.669  -51.134 1.00 41.99 ? 903  PHE A CA    1 
ATOM   7394 C  C     . PHE A 1 903 ? 41.688  41.362  -49.967 1.00 44.18 ? 903  PHE A C     1 
ATOM   7395 O  O     . PHE A 1 903 ? 40.851  42.244  -50.165 1.00 46.27 ? 903  PHE A O     1 
ATOM   7396 C  CB    . PHE A 1 903 ? 41.482  39.580  -51.722 1.00 41.76 ? 903  PHE A CB    1 
ATOM   7397 C  CG    . PHE A 1 903 ? 42.067  38.863  -52.915 1.00 41.07 ? 903  PHE A CG    1 
ATOM   7398 C  CD1   . PHE A 1 903 ? 42.394  39.560  -54.080 1.00 41.21 ? 903  PHE A CD1   1 
ATOM   7399 C  CD2   . PHE A 1 903 ? 42.264  37.485  -52.881 1.00 39.22 ? 903  PHE A CD2   1 
ATOM   7400 C  CE1   . PHE A 1 903 ? 42.928  38.894  -55.186 1.00 40.71 ? 903  PHE A CE1   1 
ATOM   7401 C  CE2   . PHE A 1 903 ? 42.791  36.808  -53.982 1.00 38.90 ? 903  PHE A CE2   1 
ATOM   7402 C  CZ    . PHE A 1 903 ? 43.125  37.513  -55.136 1.00 40.67 ? 903  PHE A CZ    1 
ATOM   7403 P  P     . DT  B 2 1   ? -18.268 -5.042  -26.720 1.00 92.10 ? 1    DT  T P     1 
ATOM   7404 O  OP1   . DT  B 2 1   ? -18.679 -4.009  -25.740 1.00 91.93 ? 1    DT  T OP1   1 
ATOM   7405 O  OP2   . DT  B 2 1   ? -18.369 -4.762  -28.169 1.00 92.74 ? 1    DT  T OP2   1 
ATOM   7406 O  "O5'" . DT  B 2 1   ? -16.764 -5.507  -26.434 1.00 91.75 ? 1    DT  T "O5'" 1 
ATOM   7407 C  "C5'" . DT  B 2 1   ? -16.353 -5.867  -25.121 1.00 91.50 ? 1    DT  T "C5'" 1 
ATOM   7408 C  "C4'" . DT  B 2 1   ? -15.702 -4.698  -24.397 1.00 90.97 ? 1    DT  T "C4'" 1 
ATOM   7409 O  "O4'" . DT  B 2 1   ? -15.185 -5.181  -23.129 1.00 91.88 ? 1    DT  T "O4'" 1 
ATOM   7410 C  "C3'" . DT  B 2 1   ? -14.523 -4.050  -25.121 1.00 89.88 ? 1    DT  T "C3'" 1 
ATOM   7411 O  "O3'" . DT  B 2 1   ? -14.951 -2.896  -25.861 1.00 86.23 ? 1    DT  T "O3'" 1 
ATOM   7412 C  "C2'" . DT  B 2 1   ? -13.572 -3.678  -23.984 1.00 91.24 ? 1    DT  T "C2'" 1 
ATOM   7413 C  "C1'" . DT  B 2 1   ? -13.847 -4.755  -22.936 1.00 92.37 ? 1    DT  T "C1'" 1 
ATOM   7414 N  N1    . DT  B 2 1   ? -12.895 -5.934  -22.981 1.00 93.84 ? 1    DT  T N1    1 
ATOM   7415 C  C2    . DT  B 2 1   ? -11.680 -5.852  -22.316 1.00 94.67 ? 1    DT  T C2    1 
ATOM   7416 O  O2    . DT  B 2 1   ? -11.313 -4.874  -21.683 1.00 95.06 ? 1    DT  T O2    1 
ATOM   7417 N  N3    . DT  B 2 1   ? -10.891 -6.976  -22.418 1.00 94.96 ? 1    DT  T N3    1 
ATOM   7418 C  C4    . DT  B 2 1   ? -11.179 -8.150  -23.099 1.00 94.78 ? 1    DT  T C4    1 
ATOM   7419 O  O4    . DT  B 2 1   ? -10.394 -9.095  -23.123 1.00 94.74 ? 1    DT  T O4    1 
ATOM   7420 C  C5    . DT  B 2 1   ? -12.461 -8.175  -23.772 1.00 94.59 ? 1    DT  T C5    1 
ATOM   7421 C  C7    . DT  B 2 1   ? -12.906 -9.382  -24.549 1.00 94.40 ? 1    DT  T C7    1 
ATOM   7422 C  C6    . DT  B 2 1   ? -13.239 -7.085  -23.678 1.00 94.27 ? 1    DT  T C6    1 
ATOM   7423 P  P     . DC  B 2 2   ? -14.328 -2.528  -27.296 1.00 82.36 ? 2    DC  T P     1 
ATOM   7424 O  OP1   . DC  B 2 2   ? -14.561 -1.083  -27.528 1.00 82.31 ? 2    DC  T OP1   1 
ATOM   7425 O  OP2   . DC  B 2 2   ? -14.831 -3.514  -28.278 1.00 82.50 ? 2    DC  T OP2   1 
ATOM   7426 O  "O5'" . DC  B 2 2   ? -12.762 -2.803  -27.107 1.00 78.93 ? 2    DC  T "O5'" 1 
ATOM   7427 C  "C5'" . DC  B 2 2   ? -11.807 -1.788  -27.361 1.00 73.51 ? 2    DC  T "C5'" 1 
ATOM   7428 C  "C4'" . DC  B 2 2   ? -11.331 -1.155  -26.070 1.00 69.15 ? 2    DC  T "C4'" 1 
ATOM   7429 O  "O4'" . DC  B 2 2   ? -10.702 -2.136  -25.217 1.00 69.69 ? 2    DC  T "O4'" 1 
ATOM   7430 C  "C3'" . DC  B 2 2   ? -10.253 -0.105  -26.260 1.00 65.27 ? 2    DC  T "C3'" 1 
ATOM   7431 O  "O3'" . DC  B 2 2   ? -10.903 1.116   -26.567 1.00 58.11 ? 2    DC  T "O3'" 1 
ATOM   7432 C  "C2'" . DC  B 2 2   ? -9.565  -0.074  -24.895 1.00 67.64 ? 2    DC  T "C2'" 1 
ATOM   7433 C  "C1'" . DC  B 2 2   ? -9.913  -1.434  -24.277 1.00 69.42 ? 2    DC  T "C1'" 1 
ATOM   7434 N  N1    . DC  B 2 2   ? -8.726  -2.279  -23.894 1.00 70.56 ? 2    DC  T N1    1 
ATOM   7435 C  C2    . DC  B 2 2   ? -8.485  -2.587  -22.539 1.00 71.41 ? 2    DC  T C2    1 
ATOM   7436 O  O2    . DC  B 2 2   ? -9.247  -2.164  -21.657 1.00 71.74 ? 2    DC  T O2    1 
ATOM   7437 N  N3    . DC  B 2 2   ? -7.406  -3.354  -22.222 1.00 71.70 ? 2    DC  T N3    1 
ATOM   7438 C  C4    . DC  B 2 2   ? -6.591  -3.804  -23.184 1.00 71.59 ? 2    DC  T C4    1 
ATOM   7439 N  N4    . DC  B 2 2   ? -5.544  -4.553  -22.821 1.00 71.19 ? 2    DC  T N4    1 
ATOM   7440 C  C5    . DC  B 2 2   ? -6.817  -3.504  -24.563 1.00 71.29 ? 2    DC  T C5    1 
ATOM   7441 C  C6    . DC  B 2 2   ? -7.883  -2.750  -24.867 1.00 70.98 ? 2    DC  T C6    1 
ATOM   7442 P  P     . DG  B 2 3   ? -10.205 2.280   -27.414 1.00 51.58 ? 3    DG  T P     1 
ATOM   7443 O  OP1   . DG  B 2 3   ? -9.187  2.921   -26.547 1.00 51.61 ? 3    DG  T OP1   1 
ATOM   7444 O  OP2   . DG  B 2 3   ? -11.305 3.088   -27.984 1.00 52.39 ? 3    DG  T OP2   1 
ATOM   7445 O  "O5'" . DG  B 2 3   ? -9.451  1.534   -28.615 1.00 47.10 ? 3    DG  T "O5'" 1 
ATOM   7446 C  "C5'" . DG  B 2 3   ? -8.171  1.984   -29.060 1.00 38.34 ? 3    DG  T "C5'" 1 
ATOM   7447 C  "C4'" . DG  B 2 3   ? -7.590  1.022   -30.078 1.00 32.35 ? 3    DG  T "C4'" 1 
ATOM   7448 O  "O4'" . DG  B 2 3   ? -7.634  -0.317  -29.517 1.00 32.09 ? 3    DG  T "O4'" 1 
ATOM   7449 C  "C3'" . DG  B 2 3   ? -8.346  0.988   -31.410 1.00 27.69 ? 3    DG  T "C3'" 1 
ATOM   7450 O  "O3'" . DG  B 2 3   ? -7.527  1.478   -32.511 1.00 19.20 ? 3    DG  T "O3'" 1 
ATOM   7451 C  "C2'" . DG  B 2 3   ? -8.785  -0.475  -31.560 1.00 28.97 ? 3    DG  T "C2'" 1 
ATOM   7452 C  "C1'" . DG  B 2 3   ? -7.933  -1.239  -30.541 1.00 30.40 ? 3    DG  T "C1'" 1 
ATOM   7453 N  N9    . DG  B 2 3   ? -8.566  -2.408  -29.916 1.00 30.09 ? 3    DG  T N9    1 
ATOM   7454 C  C8    . DG  B 2 3   ? -9.879  -2.812  -30.018 1.00 30.37 ? 3    DG  T C8    1 
ATOM   7455 N  N7    . DG  B 2 3   ? -10.151 -3.901  -29.347 1.00 31.03 ? 3    DG  T N7    1 
ATOM   7456 C  C5    . DG  B 2 3   ? -8.942  -4.246  -28.757 1.00 29.99 ? 3    DG  T C5    1 
ATOM   7457 C  C6    . DG  B 2 3   ? -8.614  -5.338  -27.906 1.00 31.45 ? 3    DG  T C6    1 
ATOM   7458 O  O6    . DG  B 2 3   ? -9.351  -6.245  -27.496 1.00 32.65 ? 3    DG  T O6    1 
ATOM   7459 N  N1    . DG  B 2 3   ? -7.271  -5.329  -27.527 1.00 29.78 ? 3    DG  T N1    1 
ATOM   7460 C  C2    . DG  B 2 3   ? -6.357  -4.378  -27.919 1.00 29.03 ? 3    DG  T C2    1 
ATOM   7461 N  N2    . DG  B 2 3   ? -5.109  -4.537  -27.453 1.00 27.43 ? 3    DG  T N2    1 
ATOM   7462 N  N3    . DG  B 2 3   ? -6.650  -3.350  -28.714 1.00 29.23 ? 3    DG  T N3    1 
ATOM   7463 C  C4    . DG  B 2 3   ? -7.958  -3.340  -29.095 1.00 29.11 ? 3    DG  T C4    1 
HETATM 7464 P  P     . DFT B 2 4   ? -7.645  2.916   -33.074 1.00 11.71 ? 4    DFT T P     1 
HETATM 7465 O  OP1   . DFT B 2 4   ? -6.510  3.653   -31.869 1.00 13.69 ? 4    DFT T OP1   1 
HETATM 7466 O  OP2   . DFT B 2 4   ? -9.427  3.085   -32.914 1.00 11.51 ? 4    DFT T OP2   1 
HETATM 7467 O  "O5'" . DFT B 2 4   ? -7.057  2.384   -34.582 1.00 11.91 ? 4    DFT T "O5'" 1 
HETATM 7468 C  "C5'" . DFT B 2 4   ? -5.699  2.569   -34.913 1.00 7.01  ? 4    DFT T "C5'" 1 
HETATM 7469 C  "C4'" . DFT B 2 4   ? -5.699  2.154   -36.364 1.00 4.83  ? 4    DFT T "C4'" 1 
HETATM 7470 O  "O4'" . DFT B 2 4   ? -6.337  3.161   -37.158 1.00 6.82  ? 4    DFT T "O4'" 1 
HETATM 7471 C  "C3'" . DFT B 2 4   ? -4.298  2.020   -36.893 1.00 6.39  ? 4    DFT T "C3'" 1 
HETATM 7472 O  "O3'" . DFT B 2 4   ? -3.781  0.721   -36.586 1.00 5.21  ? 4    DFT T "O3'" 1 
HETATM 7473 C  "C2'" . DFT B 2 4   ? -4.533  2.283   -38.365 1.00 5.42  ? 4    DFT T "C2'" 1 
HETATM 7474 C  "C1'" . DFT B 2 4   ? -5.587  3.383   -38.349 1.00 8.90  ? 4    DFT T "C1'" 1 
HETATM 7475 C  C2    . DFT B 2 4   ? -4.118  5.161   -39.462 1.00 9.66  ? 4    DFT T C2    1 
HETATM 7476 C  C4    . DFT B 2 4   ? -3.539  7.181   -38.297 1.00 14.81 ? 4    DFT T C4    1 
HETATM 7477 C  C5    . DFT B 2 4   ? -4.315  6.733   -37.115 1.00 11.71 ? 4    DFT T C5    1 
HETATM 7478 C  C5M   . DFT B 2 4   ? -4.383  7.623   -35.902 1.00 13.71 ? 4    DFT T C5M   1 
HETATM 7479 C  C6    . DFT B 2 4   ? -4.976  5.508   -37.149 1.00 10.40 ? 4    DFT T C6    1 
HETATM 7480 F  F4    . DFT B 2 4   ? -2.907  8.361   -38.267 1.00 19.50 ? 4    DFT T F4    1 
HETATM 7481 C  C3    . DFT B 2 4   ? -3.462  6.383   -39.429 1.00 11.70 ? 4    DFT T C3    1 
HETATM 7482 F  F2    . DFT B 2 4   ? -4.033  4.398   -40.559 1.00 10.92 ? 4    DFT T F2    1 
HETATM 7483 C  C1    . DFT B 2 4   ? -4.908  4.702   -38.290 1.00 9.18  ? 4    DFT T C1    1 
ATOM   7484 P  P     . DG  B 2 5   ? -2.264  0.484   -36.441 1.00 7.21  ? 5    DG  T P     1 
ATOM   7485 O  OP1   . DG  B 2 5   ? -2.103  -0.890  -35.955 1.00 5.81  ? 5    DG  T OP1   1 
ATOM   7486 O  OP2   . DG  B 2 5   ? -1.622  1.601   -35.725 1.00 3.69  ? 5    DG  T OP2   1 
ATOM   7487 O  "O5'" . DG  B 2 5   ? -1.770  0.563   -37.962 1.00 6.68  ? 5    DG  T "O5'" 1 
ATOM   7488 C  "C5'" . DG  B 2 5   ? -2.208  -0.421  -38.899 1.00 7.13  ? 5    DG  T "C5'" 1 
ATOM   7489 C  "C4'" . DG  B 2 5   ? -1.719  -0.063  -40.288 1.00 4.32  ? 5    DG  T "C4'" 1 
ATOM   7490 O  "O4'" . DG  B 2 5   ? -2.206  1.253   -40.648 1.00 3.95  ? 5    DG  T "O4'" 1 
ATOM   7491 C  "C3'" . DG  B 2 5   ? -0.210  0.040   -40.420 1.00 4.22  ? 5    DG  T "C3'" 1 
ATOM   7492 O  "O3'" . DG  B 2 5   ? 0.358   -1.286  -40.516 1.00 3.06  ? 5    DG  T "O3'" 1 
ATOM   7493 C  "C2'" . DG  B 2 5   ? -0.114  0.867   -41.702 1.00 2.77  ? 5    DG  T "C2'" 1 
ATOM   7494 C  "C1'" . DG  B 2 5   ? -1.272  1.855   -41.527 1.00 4.09  ? 5    DG  T "C1'" 1 
ATOM   7495 N  N9    . DG  B 2 5   ? -0.851  3.145   -40.982 1.00 6.54  ? 5    DG  T N9    1 
ATOM   7496 C  C8    . DG  B 2 5   ? -1.014  3.595   -39.687 1.00 7.76  ? 5    DG  T C8    1 
ATOM   7497 N  N7    . DG  B 2 5   ? -0.525  4.790   -39.492 1.00 8.39  ? 5    DG  T N7    1 
ATOM   7498 C  C5    . DG  B 2 5   ? -0.017  5.165   -40.730 1.00 6.16  ? 5    DG  T C5    1 
ATOM   7499 C  C6    . DG  B 2 5   ? 0.634   6.364   -41.128 1.00 8.01  ? 5    DG  T C6    1 
ATOM   7500 O  O6    . DG  B 2 5   ? 0.894   7.366   -40.438 1.00 8.58  ? 5    DG  T O6    1 
ATOM   7501 N  N1    . DG  B 2 5   ? 1.008   6.337   -42.476 1.00 5.25  ? 5    DG  T N1    1 
ATOM   7502 C  C2    . DG  B 2 5   ? 0.780   5.277   -43.334 1.00 5.13  ? 5    DG  T C2    1 
ATOM   7503 N  N2    . DG  B 2 5   ? 1.204   5.429   -44.602 1.00 2.00  ? 5    DG  T N2    1 
ATOM   7504 N  N3    . DG  B 2 5   ? 0.161   4.156   -42.968 1.00 4.29  ? 5    DG  T N3    1 
ATOM   7505 C  C4    . DG  B 2 5   ? -0.203  4.160   -41.657 1.00 4.80  ? 5    DG  T C4    1 
ATOM   7506 P  P     . DT  B 2 6   ? 1.921   -1.552  -40.393 1.00 5.81  ? 6    DT  T P     1 
ATOM   7507 O  OP1   . DT  B 2 6   ? 2.126   -3.014  -40.399 1.00 3.54  ? 6    DT  T OP1   1 
ATOM   7508 O  OP2   . DT  B 2 6   ? 2.465   -0.706  -39.308 1.00 6.29  ? 6    DT  T OP2   1 
ATOM   7509 O  "O5'" . DT  B 2 6   ? 2.528   -0.934  -41.728 1.00 5.99  ? 6    DT  T "O5'" 1 
ATOM   7510 C  "C5'" . DT  B 2 6   ? 2.252   -1.442  -43.025 1.00 3.89  ? 6    DT  T "C5'" 1 
ATOM   7511 C  "C4'" . DT  B 2 6   ? 3.143   -0.706  -44.015 1.00 2.61  ? 6    DT  T "C4'" 1 
ATOM   7512 O  "O4'" . DT  B 2 6   ? 2.960   0.729   -43.899 1.00 5.43  ? 6    DT  T "O4'" 1 
ATOM   7513 C  "C3'" . DT  B 2 6   ? 4.640   -0.936  -43.864 1.00 2.94  ? 6    DT  T "C3'" 1 
ATOM   7514 O  "O3'" . DT  B 2 6   ? 5.187   -0.914  -45.173 1.00 3.01  ? 6    DT  T "O3'" 1 
ATOM   7515 C  "C2'" . DT  B 2 6   ? 5.098   0.270   -43.050 1.00 2.00  ? 6    DT  T "C2'" 1 
ATOM   7516 C  "C1'" . DT  B 2 6   ? 4.201   1.358   -43.623 1.00 4.03  ? 6    DT  T "C1'" 1 
ATOM   7517 N  N1    . DT  B 2 6   ? 4.012   2.488   -42.662 1.00 3.85  ? 6    DT  T N1    1 
ATOM   7518 C  C2    . DT  B 2 6   ? 4.431   3.758   -43.023 1.00 4.96  ? 6    DT  T C2    1 
ATOM   7519 O  O2    . DT  B 2 6   ? 4.955   4.022   -44.096 1.00 2.68  ? 6    DT  T O2    1 
ATOM   7520 N  N3    . DT  B 2 6   ? 4.226   4.728   -42.065 1.00 2.96  ? 6    DT  T N3    1 
ATOM   7521 C  C4    . DT  B 2 6   ? 3.659   4.556   -40.816 1.00 5.60  ? 6    DT  T C4    1 
ATOM   7522 O  O4    . DT  B 2 6   ? 3.524   5.505   -40.049 1.00 5.34  ? 6    DT  T O4    1 
ATOM   7523 C  C5    . DT  B 2 6   ? 3.236   3.204   -40.497 1.00 5.74  ? 6    DT  T C5    1 
ATOM   7524 C  C7    . DT  B 2 6   ? 2.596   2.898   -39.168 1.00 7.10  ? 6    DT  T C7    1 
ATOM   7525 C  C6    . DT  B 2 6   ? 3.434   2.244   -41.418 1.00 5.60  ? 6    DT  T C6    1 
ATOM   7526 P  P     . DA  B 2 7   ? 6.733   -1.068  -45.502 1.00 5.09  ? 7    DA  T P     1 
ATOM   7527 O  OP1   . DA  B 2 7   ? 6.756   -1.723  -46.830 1.00 5.45  ? 7    DA  T OP1   1 
ATOM   7528 O  OP2   . DA  B 2 7   ? 7.412   -1.726  -44.362 1.00 3.87  ? 7    DA  T OP2   1 
ATOM   7529 O  "O5'" . DA  B 2 7   ? 7.281   0.424   -45.637 1.00 4.07  ? 7    DA  T "O5'" 1 
ATOM   7530 C  "C5'" . DA  B 2 7   ? 6.867   1.276   -46.714 1.00 4.71  ? 7    DA  T "C5'" 1 
ATOM   7531 C  "C4'" . DA  B 2 7   ? 7.846   2.418   -46.993 1.00 5.19  ? 7    DA  T "C4'" 1 
ATOM   7532 O  "O4'" . DA  B 2 7   ? 7.707   3.517   -46.049 1.00 7.55  ? 7    DA  T "O4'" 1 
ATOM   7533 C  "C3'" . DA  B 2 7   ? 9.321   2.060   -46.942 1.00 5.82  ? 7    DA  T "C3'" 1 
ATOM   7534 O  "O3'" . DA  B 2 7   ? 10.003  2.845   -47.938 1.00 4.88  ? 7    DA  T "O3'" 1 
ATOM   7535 C  "C2'" . DA  B 2 7   ? 9.715   2.407   -45.498 1.00 3.91  ? 7    DA  T "C2'" 1 
ATOM   7536 C  "C1'" . DA  B 2 7   ? 8.856   3.638   -45.220 1.00 3.93  ? 7    DA  T "C1'" 1 
ATOM   7537 N  N9    . DA  B 2 7   ? 8.368   3.783   -43.840 1.00 5.97  ? 7    DA  T N9    1 
ATOM   7538 C  C8    . DA  B 2 7   ? 7.795   2.808   -43.060 1.00 5.34  ? 7    DA  T C8    1 
ATOM   7539 N  N7    . DA  B 2 7   ? 7.428   3.220   -41.871 1.00 6.29  ? 7    DA  T N7    1 
ATOM   7540 C  C5    . DA  B 2 7   ? 7.781   4.564   -41.863 1.00 6.41  ? 7    DA  T C5    1 
ATOM   7541 C  C6    . DA  B 2 7   ? 7.661   5.581   -40.886 1.00 5.22  ? 7    DA  T C6    1 
ATOM   7542 N  N6    . DA  B 2 7   ? 7.122   5.392   -39.673 1.00 4.89  ? 7    DA  T N6    1 
ATOM   7543 N  N1    . DA  B 2 7   ? 8.121   6.813   -41.196 1.00 5.90  ? 7    DA  T N1    1 
ATOM   7544 C  C2    . DA  B 2 7   ? 8.668   7.018   -42.403 1.00 4.87  ? 7    DA  T C2    1 
ATOM   7545 N  N3    . DA  B 2 7   ? 8.823   6.145   -43.402 1.00 5.73  ? 7    DA  T N3    1 
ATOM   7546 C  C4    . DA  B 2 7   ? 8.363   4.924   -43.069 1.00 5.44  ? 7    DA  T C4    1 
ATOM   7547 P  P     . DA  B 2 8   ? 11.577  2.707   -48.151 1.00 6.34  ? 8    DA  T P     1 
ATOM   7548 O  OP1   . DA  B 2 8   ? 11.910  3.244   -49.490 1.00 4.32  ? 8    DA  T OP1   1 
ATOM   7549 O  OP2   . DA  B 2 8   ? 11.983  1.343   -47.780 1.00 5.59  ? 8    DA  T OP2   1 
ATOM   7550 O  "O5'" . DA  B 2 8   ? 12.154  3.695   -47.048 1.00 4.96  ? 8    DA  T "O5'" 1 
ATOM   7551 C  "C5'" . DA  B 2 8   ? 11.993  5.100   -47.192 1.00 6.39  ? 8    DA  T "C5'" 1 
ATOM   7552 C  "C4'" . DA  B 2 8   ? 12.707  5.802   -46.058 1.00 7.28  ? 8    DA  T "C4'" 1 
ATOM   7553 O  "O4'" . DA  B 2 8   ? 11.889  5.680   -44.867 1.00 8.40  ? 8    DA  T "O4'" 1 
ATOM   7554 C  "C3'" . DA  B 2 8   ? 14.081  5.219   -45.711 1.00 7.77  ? 8    DA  T "C3'" 1 
ATOM   7555 O  "O3'" . DA  B 2 8   ? 15.013  6.268   -45.568 1.00 9.08  ? 8    DA  T "O3'" 1 
ATOM   7556 C  "C2'" . DA  B 2 8   ? 13.845  4.541   -44.369 1.00 8.67  ? 8    DA  T "C2'" 1 
ATOM   7557 C  "C1'" . DA  B 2 8   ? 12.787  5.481   -43.798 1.00 9.08  ? 8    DA  T "C1'" 1 
ATOM   7558 N  N9    . DA  B 2 8   ? 12.110  4.950   -42.626 1.00 6.78  ? 8    DA  T N9    1 
ATOM   7559 C  C8    . DA  B 2 8   ? 11.730  3.651   -42.410 1.00 8.60  ? 8    DA  T C8    1 
ATOM   7560 N  N7    . DA  B 2 8   ? 11.152  3.466   -41.253 1.00 7.68  ? 8    DA  T N7    1 
ATOM   7561 C  C5    . DA  B 2 8   ? 11.164  4.716   -40.672 1.00 7.32  ? 8    DA  T C5    1 
ATOM   7562 C  C6    . DA  B 2 8   ? 10.701  5.186   -39.432 1.00 8.79  ? 8    DA  T C6    1 
ATOM   7563 N  N6    . DA  B 2 8   ? 10.118  4.395   -38.526 1.00 12.20 ? 8    DA  T N6    1 
ATOM   7564 N  N1    . DA  B 2 8   ? 10.861  6.498   -39.161 1.00 7.41  ? 8    DA  T N1    1 
ATOM   7565 C  C2    . DA  B 2 8   ? 11.455  7.296   -40.061 1.00 6.49  ? 8    DA  T C2    1 
ATOM   7566 N  N3    . DA  B 2 8   ? 11.935  6.963   -41.255 1.00 7.24  ? 8    DA  T N3    1 
ATOM   7567 C  C4    . DA  B 2 8   ? 11.757  5.649   -41.501 1.00 6.65  ? 8    DA  T C4    1 
ATOM   7568 P  P     . DG  B 2 9   ? 16.570  6.091   -45.905 1.00 8.08  ? 9    DG  T P     1 
ATOM   7569 O  OP1   . DG  B 2 9   ? 16.765  6.212   -47.365 1.00 6.41  ? 9    DG  T OP1   1 
ATOM   7570 O  OP2   . DG  B 2 9   ? 17.089  4.907   -45.189 1.00 7.14  ? 9    DG  T OP2   1 
ATOM   7571 O  "O5'" . DG  B 2 9   ? 17.159  7.409   -45.255 1.00 8.48  ? 9    DG  T "O5'" 1 
ATOM   7572 C  "C5'" . DG  B 2 9   ? 16.576  8.687   -45.553 1.00 7.24  ? 9    DG  T "C5'" 1 
ATOM   7573 C  "C4'" . DG  B 2 9   ? 16.661  9.552   -44.311 1.00 11.41 ? 9    DG  T "C4'" 1 
ATOM   7574 O  "O4'" . DG  B 2 9   ? 15.700  9.066   -43.337 1.00 9.30  ? 9    DG  T "O4'" 1 
ATOM   7575 C  "C3'" . DG  B 2 9   ? 18.043  9.445   -43.675 1.00 14.02 ? 9    DG  T "C3'" 1 
ATOM   7576 O  "O3'" . DG  B 2 9   ? 18.664  10.703  -43.549 1.00 19.17 ? 9    DG  T "O3'" 1 
ATOM   7577 C  "C2'" . DG  B 2 9   ? 17.810  8.799   -42.312 1.00 14.73 ? 9    DG  T "C2'" 1 
ATOM   7578 C  "C1'" . DG  B 2 9   ? 16.318  8.943   -42.071 1.00 13.54 ? 9    DG  T "C1'" 1 
ATOM   7579 N  N9    . DG  B 2 9   ? 15.789  7.771   -41.374 1.00 13.73 ? 9    DG  T N9    1 
ATOM   7580 C  C8    . DG  B 2 9   ? 15.672  6.491   -41.862 1.00 13.03 ? 9    DG  T C8    1 
ATOM   7581 N  N7    . DG  B 2 9   ? 15.166  5.655   -41.002 1.00 13.30 ? 9    DG  T N7    1 
ATOM   7582 C  C5    . DG  B 2 9   ? 14.950  6.422   -39.868 1.00 11.71 ? 9    DG  T C5    1 
ATOM   7583 C  C6    . DG  B 2 9   ? 14.418  6.063   -38.608 1.00 12.84 ? 9    DG  T C6    1 
ATOM   7584 O  O6    . DG  B 2 9   ? 14.028  4.953   -38.241 1.00 13.46 ? 9    DG  T O6    1 
ATOM   7585 N  N1    . DG  B 2 9   ? 14.360  7.143   -37.725 1.00 13.12 ? 9    DG  T N1    1 
ATOM   7586 C  C2    . DG  B 2 9   ? 14.773  8.419   -38.029 1.00 13.26 ? 9    DG  T C2    1 
ATOM   7587 N  N2    . DG  B 2 9   ? 14.647  9.334   -37.061 1.00 14.59 ? 9    DG  T N2    1 
ATOM   7588 N  N3    . DG  B 2 9   ? 15.272  8.771   -39.207 1.00 12.85 ? 9    DG  T N3    1 
ATOM   7589 C  C4    . DG  B 2 9   ? 15.334  7.726   -40.076 1.00 12.91 ? 9    DG  T C4    1 
ATOM   7590 P  P     . DC  B 2 10  ? 20.224  10.795  -43.175 1.00 22.49 ? 10   DC  T P     1 
ATOM   7591 O  OP1   . DC  B 2 10  ? 20.789  11.978  -43.857 1.00 18.49 ? 10   DC  T OP1   1 
ATOM   7592 O  OP2   . DC  B 2 10  ? 20.877  9.477   -43.361 1.00 20.64 ? 10   DC  T OP2   1 
ATOM   7593 O  "O5'" . DC  B 2 10  ? 20.137  11.013  -41.594 1.00 17.08 ? 10   DC  T "O5'" 1 
ATOM   7594 C  "C5'" . DC  B 2 10  ? 19.536  12.149  -41.011 1.00 18.37 ? 10   DC  T "C5'" 1 
ATOM   7595 C  "C4'" . DC  B 2 10  ? 19.721  12.076  -39.506 1.00 15.87 ? 10   DC  T "C4'" 1 
ATOM   7596 O  "O4'" . DC  B 2 10  ? 18.945  10.978  -38.977 1.00 15.94 ? 10   DC  T "O4'" 1 
ATOM   7597 C  "C3'" . DC  B 2 10  ? 21.154  11.848  -39.026 1.00 18.06 ? 10   DC  T "C3'" 1 
ATOM   7598 O  "O3'" . DC  B 2 10  ? 21.386  12.812  -38.017 1.00 17.56 ? 10   DC  T "O3'" 1 
ATOM   7599 C  "C2'" . DC  B 2 10  ? 21.180  10.404  -38.511 1.00 17.09 ? 10   DC  T "C2'" 1 
ATOM   7600 C  "C1'" . DC  B 2 10  ? 19.725  10.187  -38.100 1.00 15.41 ? 10   DC  T "C1'" 1 
ATOM   7601 N  N1    . DC  B 2 10  ? 19.187  8.790   -38.201 1.00 15.13 ? 10   DC  T N1    1 
ATOM   7602 C  C2    . DC  B 2 10  ? 18.423  8.263   -37.145 1.00 15.87 ? 10   DC  T C2    1 
ATOM   7603 O  O2    . DC  B 2 10  ? 18.229  8.943   -36.132 1.00 16.68 ? 10   DC  T O2    1 
ATOM   7604 N  N3    . DC  B 2 10  ? 17.922  7.006   -37.252 1.00 14.94 ? 10   DC  T N3    1 
ATOM   7605 C  C4    . DC  B 2 10  ? 18.148  6.281   -38.351 1.00 15.75 ? 10   DC  T C4    1 
ATOM   7606 N  N4    . DC  B 2 10  ? 17.633  5.046   -38.402 1.00 13.40 ? 10   DC  T N4    1 
ATOM   7607 C  C5    . DC  B 2 10  ? 18.914  6.793   -39.443 1.00 15.40 ? 10   DC  T C5    1 
ATOM   7608 C  C6    . DC  B 2 10  ? 19.404  8.038   -39.328 1.00 17.11 ? 10   DC  T C6    1 
ATOM   7609 P  P     . DA  B 2 11  ? 22.718  12.916  -37.137 1.00 17.58 ? 11   DA  T P     1 
ATOM   7610 O  OP1   . DA  B 2 11  ? 22.945  14.373  -37.004 1.00 19.30 ? 11   DA  T OP1   1 
ATOM   7611 O  OP2   . DA  B 2 11  ? 23.787  12.048  -37.668 1.00 18.29 ? 11   DA  T OP2   1 
ATOM   7612 O  "O5'" . DA  B 2 11  ? 22.251  12.281  -35.742 1.00 15.51 ? 11   DA  T "O5'" 1 
ATOM   7613 C  "C5'" . DA  B 2 11  ? 21.386  12.977  -34.845 1.00 16.73 ? 11   DA  T "C5'" 1 
ATOM   7614 C  "C4'" . DA  B 2 11  ? 21.388  12.312  -33.476 1.00 20.04 ? 11   DA  T "C4'" 1 
ATOM   7615 O  "O4'" . DA  B 2 11  ? 20.807  10.990  -33.580 1.00 18.28 ? 11   DA  T "O4'" 1 
ATOM   7616 C  "C3'" . DA  B 2 11  ? 22.759  12.122  -32.819 1.00 22.72 ? 11   DA  T "C3'" 1 
ATOM   7617 O  "O3'" . DA  B 2 11  ? 22.657  12.444  -31.426 1.00 25.73 ? 11   DA  T "O3'" 1 
ATOM   7618 C  "C2'" . DA  B 2 11  ? 23.098  10.652  -33.072 1.00 20.98 ? 11   DA  T "C2'" 1 
ATOM   7619 C  "C1'" . DA  B 2 11  ? 21.716  9.999   -33.157 1.00 20.97 ? 11   DA  T "C1'" 1 
ATOM   7620 N  N9    . DA  B 2 11  ? 21.588  8.886   -34.103 1.00 21.08 ? 11   DA  T N9    1 
ATOM   7621 C  C8    . DA  B 2 11  ? 22.059  8.811   -35.389 1.00 21.11 ? 11   DA  T C8    1 
ATOM   7622 N  N7    . DA  B 2 11  ? 21.779  7.678   -35.994 1.00 18.88 ? 11   DA  T N7    1 
ATOM   7623 C  C5    . DA  B 2 11  ? 21.071  6.962   -35.043 1.00 20.78 ? 11   DA  T C5    1 
ATOM   7624 C  C6    . DA  B 2 11  ? 20.485  5.676   -35.053 1.00 21.11 ? 11   DA  T C6    1 
ATOM   7625 N  N6    . DA  B 2 11  ? 20.523  4.855   -36.107 1.00 22.48 ? 11   DA  T N6    1 
ATOM   7626 N  N1    . DA  B 2 11  ? 19.856  5.260   -33.933 1.00 24.19 ? 11   DA  T N1    1 
ATOM   7627 C  C2    . DA  B 2 11  ? 19.811  6.073   -32.865 1.00 24.44 ? 11   DA  T C2    1 
ATOM   7628 N  N3    . DA  B 2 11  ? 20.317  7.302   -32.738 1.00 22.51 ? 11   DA  T N3    1 
ATOM   7629 C  C4    . DA  B 2 11  ? 20.942  7.690   -33.871 1.00 20.94 ? 11   DA  T C4    1 
ATOM   7630 P  P     . DG  B 2 12  ? 23.948  12.542  -30.479 1.00 29.60 ? 12   DG  T P     1 
ATOM   7631 O  OP1   . DG  B 2 12  ? 23.595  13.504  -29.408 1.00 27.27 ? 12   DG  T OP1   1 
ATOM   7632 O  OP2   . DG  B 2 12  ? 25.181  12.702  -31.296 1.00 23.79 ? 12   DG  T OP2   1 
ATOM   7633 O  "O5'" . DG  B 2 12  ? 24.021  11.075  -29.837 1.00 27.16 ? 12   DG  T "O5'" 1 
ATOM   7634 C  "C5'" . DG  B 2 12  ? 22.932  10.605  -29.051 1.00 22.61 ? 12   DG  T "C5'" 1 
ATOM   7635 C  "C4'" . DG  B 2 12  ? 23.007  9.104   -28.881 1.00 20.73 ? 12   DG  T "C4'" 1 
ATOM   7636 O  "O4'" . DG  B 2 12  ? 22.671  8.479   -30.143 1.00 20.54 ? 12   DG  T "O4'" 1 
ATOM   7637 C  "C3'" . DG  B 2 12  ? 24.376  8.563   -28.465 1.00 21.78 ? 12   DG  T "C3'" 1 
ATOM   7638 O  "O3'" . DG  B 2 12  ? 24.374  8.089   -27.113 1.00 18.19 ? 12   DG  T "O3'" 1 
ATOM   7639 C  "C2'" . DG  B 2 12  ? 24.639  7.427   -29.448 1.00 22.85 ? 12   DG  T "C2'" 1 
ATOM   7640 C  "C1'" . DG  B 2 12  ? 23.304  7.220   -30.146 1.00 23.21 ? 12   DG  T "C1'" 1 
ATOM   7641 N  N9    . DG  B 2 12  ? 23.489  6.727   -31.508 1.00 20.91 ? 12   DG  T N9    1 
ATOM   7642 C  C8    . DG  B 2 12  ? 24.074  7.384   -32.564 1.00 20.30 ? 12   DG  T C8    1 
ATOM   7643 N  N7    . DG  B 2 12  ? 24.107  6.679   -33.659 1.00 18.99 ? 12   DG  T N7    1 
ATOM   7644 C  C5    . DG  B 2 12  ? 23.522  5.469   -33.307 1.00 18.74 ? 12   DG  T C5    1 
ATOM   7645 C  C6    . DG  B 2 12  ? 23.281  4.306   -34.080 1.00 17.81 ? 12   DG  T C6    1 
ATOM   7646 O  O6    . DG  B 2 12  ? 23.545  4.113   -35.274 1.00 20.53 ? 12   DG  T O6    1 
ATOM   7647 N  N1    . DG  B 2 12  ? 22.664  3.300   -33.341 1.00 15.28 ? 12   DG  T N1    1 
ATOM   7648 C  C2    . DG  B 2 12  ? 22.315  3.410   -32.015 1.00 17.41 ? 12   DG  T C2    1 
ATOM   7649 N  N2    . DG  B 2 12  ? 21.726  2.345   -31.464 1.00 17.58 ? 12   DG  T N2    1 
ATOM   7650 N  N3    . DG  B 2 12  ? 22.531  4.493   -31.277 1.00 18.01 ? 12   DG  T N3    1 
ATOM   7651 C  C4    . DG  B 2 12  ? 23.134  5.483   -31.984 1.00 19.72 ? 12   DG  T C4    1 
ATOM   7652 P  P     . DT  B 2 13  ? 25.680  7.452   -26.414 1.00 19.17 ? 13   DT  T P     1 
ATOM   7653 O  OP1   . DT  B 2 13  ? 25.625  7.823   -24.983 1.00 18.14 ? 13   DT  T OP1   1 
ATOM   7654 O  OP2   . DT  B 2 13  ? 26.895  7.758   -27.201 1.00 17.26 ? 13   DT  T OP2   1 
ATOM   7655 O  "O5'" . DT  B 2 13  ? 25.419  5.884   -26.547 1.00 15.85 ? 13   DT  T "O5'" 1 
ATOM   7656 C  "C5'" . DT  B 2 13  ? 24.257  5.286   -25.957 1.00 13.62 ? 13   DT  T "C5'" 1 
ATOM   7657 C  "C4'" . DT  B 2 13  ? 24.400  3.772   -25.974 1.00 15.94 ? 13   DT  T "C4'" 1 
ATOM   7658 O  "O4'" . DT  B 2 13  ? 24.293  3.296   -27.342 1.00 15.41 ? 13   DT  T "O4'" 1 
ATOM   7659 C  "C3'" . DT  B 2 13  ? 25.735  3.240   -25.444 1.00 16.52 ? 13   DT  T "C3'" 1 
ATOM   7660 O  "O3'" . DT  B 2 13  ? 25.506  2.080   -24.628 1.00 19.45 ? 13   DT  T "O3'" 1 
ATOM   7661 C  "C2'" . DT  B 2 13  ? 26.553  2.950   -26.708 1.00 16.22 ? 13   DT  T "C2'" 1 
ATOM   7662 C  "C1'" . DT  B 2 13  ? 25.467  2.588   -27.716 1.00 14.62 ? 13   DT  T "C1'" 1 
ATOM   7663 N  N1    . DT  B 2 13  ? 25.719  2.882   -29.171 1.00 15.92 ? 13   DT  T N1    1 
ATOM   7664 C  C2    . DT  B 2 13  ? 25.393  1.904   -30.097 1.00 16.19 ? 13   DT  T C2    1 
ATOM   7665 O  O2    . DT  B 2 13  ? 24.935  0.814   -29.804 1.00 15.65 ? 13   DT  T O2    1 
ATOM   7666 N  N3    . DT  B 2 13  ? 25.625  2.243   -31.410 1.00 16.91 ? 13   DT  T N3    1 
ATOM   7667 C  C4    . DT  B 2 13  ? 26.134  3.434   -31.885 1.00 15.82 ? 13   DT  T C4    1 
ATOM   7668 O  O4    . DT  B 2 13  ? 26.301  3.622   -33.085 1.00 18.13 ? 13   DT  T O4    1 
ATOM   7669 C  C5    . DT  B 2 13  ? 26.455  4.422   -30.879 1.00 17.32 ? 13   DT  T C5    1 
ATOM   7670 C  C7    . DT  B 2 13  ? 27.026  5.750   -31.296 1.00 17.72 ? 13   DT  T C7    1 
ATOM   7671 C  C6    . DT  B 2 13  ? 26.231  4.107   -29.586 1.00 16.64 ? 13   DT  T C6    1 
ATOM   7672 P  P     . DC  B 2 14  ? 26.695  1.300   -23.872 1.00 18.46 ? 14   DC  T P     1 
ATOM   7673 O  OP1   . DC  B 2 14  ? 26.099  0.633   -22.696 1.00 19.79 ? 14   DC  T OP1   1 
ATOM   7674 O  OP2   . DC  B 2 14  ? 27.844  2.212   -23.692 1.00 19.35 ? 14   DC  T OP2   1 
ATOM   7675 O  "O5'" . DC  B 2 14  ? 27.103  0.189   -24.947 1.00 20.87 ? 14   DC  T "O5'" 1 
ATOM   7676 C  "C5'" . DC  B 2 14  ? 26.140  -0.781  -25.383 1.00 20.45 ? 14   DC  T "C5'" 1 
ATOM   7677 C  "C4'" . DC  B 2 14  ? 26.755  -1.763  -26.369 1.00 23.07 ? 14   DC  T "C4'" 1 
ATOM   7678 O  "O4'" . DC  B 2 14  ? 26.924  -1.124  -27.658 1.00 22.18 ? 14   DC  T "O4'" 1 
ATOM   7679 C  "C3'" . DC  B 2 14  ? 28.127  -2.311  -25.985 1.00 24.38 ? 14   DC  T "C3'" 1 
ATOM   7680 O  "O3'" . DC  B 2 14  ? 28.110  -3.728  -26.156 1.00 27.84 ? 14   DC  T "O3'" 1 
ATOM   7681 C  "C2'" . DC  B 2 14  ? 29.104  -1.601  -26.929 1.00 23.76 ? 14   DC  T "C2'" 1 
ATOM   7682 C  "C1'" . DC  B 2 14  ? 28.229  -1.347  -28.154 1.00 22.22 ? 14   DC  T "C1'" 1 
ATOM   7683 N  N1    . DC  B 2 14  ? 28.574  -0.164  -29.021 1.00 18.44 ? 14   DC  T N1    1 
ATOM   7684 C  C2    . DC  B 2 14  ? 28.468  -0.281  -30.421 1.00 18.42 ? 14   DC  T C2    1 
ATOM   7685 O  O2    . DC  B 2 14  ? 28.114  -1.355  -30.930 1.00 20.57 ? 14   DC  T O2    1 
ATOM   7686 N  N3    . DC  B 2 14  ? 28.767  0.797   -31.196 1.00 16.28 ? 14   DC  T N3    1 
ATOM   7687 C  C4    . DC  B 2 14  ? 29.139  1.949   -30.630 1.00 15.05 ? 14   DC  T C4    1 
ATOM   7688 N  N4    . DC  B 2 14  ? 29.418  2.970   -31.443 1.00 17.60 ? 14   DC  T N4    1 
ATOM   7689 C  C5    . DC  B 2 14  ? 29.246  2.097   -29.212 1.00 16.12 ? 14   DC  T C5    1 
ATOM   7690 C  C6    . DC  B 2 14  ? 28.953  1.027   -28.457 1.00 17.08 ? 14   DC  T C6    1 
ATOM   7691 P  P     . DC  B 2 15  ? 29.330  -4.664  -25.702 1.00 29.46 ? 15   DC  T P     1 
ATOM   7692 O  OP1   . DC  B 2 15  ? 28.744  -5.977  -25.354 1.00 30.21 ? 15   DC  T OP1   1 
ATOM   7693 O  OP2   . DC  B 2 15  ? 30.170  -3.944  -24.716 1.00 28.88 ? 15   DC  T OP2   1 
ATOM   7694 O  "O5'" . DC  B 2 15  ? 30.190  -4.809  -27.047 1.00 28.29 ? 15   DC  T "O5'" 1 
ATOM   7695 C  "C5'" . DC  B 2 15  ? 29.591  -5.371  -28.218 1.00 28.20 ? 15   DC  T "C5'" 1 
ATOM   7696 C  "C4'" . DC  B 2 15  ? 30.535  -5.335  -29.408 1.00 28.43 ? 15   DC  T "C4'" 1 
ATOM   7697 O  "O4'" . DC  B 2 15  ? 30.533  -4.016  -30.008 1.00 28.50 ? 15   DC  T "O4'" 1 
ATOM   7698 C  "C3'" . DC  B 2 15  ? 31.993  -5.672  -29.100 1.00 29.64 ? 15   DC  T "C3'" 1 
ATOM   7699 O  "O3'" . DC  B 2 15  ? 32.381  -6.715  -29.969 1.00 30.43 ? 15   DC  T "O3'" 1 
ATOM   7700 C  "C2'" . DC  B 2 15  ? 32.762  -4.384  -29.384 1.00 29.37 ? 15   DC  T "C2'" 1 
ATOM   7701 C  "C1'" . DC  B 2 15  ? 31.851  -3.678  -30.383 1.00 27.60 ? 15   DC  T "C1'" 1 
ATOM   7702 N  N1    . DC  B 2 15  ? 31.984  -2.186  -30.403 1.00 25.61 ? 15   DC  T N1    1 
ATOM   7703 C  C2    . DC  B 2 15  ? 32.033  -1.508  -31.636 1.00 24.68 ? 15   DC  T C2    1 
ATOM   7704 O  O2    . DC  B 2 15  ? 31.970  -2.148  -32.697 1.00 25.02 ? 15   DC  T O2    1 
ATOM   7705 N  N3    . DC  B 2 15  ? 32.155  -0.153  -31.630 1.00 24.11 ? 15   DC  T N3    1 
ATOM   7706 C  C4    . DC  B 2 15  ? 32.228  0.512   -30.470 1.00 23.91 ? 15   DC  T C4    1 
ATOM   7707 N  N4    . DC  B 2 15  ? 32.349  1.841   -30.519 1.00 23.17 ? 15   DC  T N4    1 
ATOM   7708 C  C5    . DC  B 2 15  ? 32.181  -0.158  -29.209 1.00 23.89 ? 15   DC  T C5    1 
ATOM   7709 C  C6    . DC  B 2 15  ? 32.056  -1.491  -29.223 1.00 24.23 ? 15   DC  T C6    1 
ATOM   7710 P  P     . DG  B 2 16  ? 33.765  -7.494  -29.812 1.00 32.20 ? 16   DG  T P     1 
ATOM   7711 O  OP1   . DG  B 2 16  ? 33.452  -8.939  -29.890 1.00 34.46 ? 16   DG  T OP1   1 
ATOM   7712 O  OP2   . DG  B 2 16  ? 34.545  -6.959  -28.667 1.00 31.77 ? 16   DG  T OP2   1 
ATOM   7713 O  "O5'" . DG  B 2 16  ? 34.513  -7.054  -31.149 1.00 28.69 ? 16   DG  T "O5'" 1 
ATOM   7714 C  "C5'" . DG  B 2 16  ? 33.914  -7.274  -32.421 1.00 23.91 ? 16   DG  T "C5'" 1 
ATOM   7715 C  "C4'" . DG  B 2 16  ? 34.706  -6.548  -33.492 1.00 22.05 ? 16   DG  T "C4'" 1 
ATOM   7716 O  "O4'" . DG  B 2 16  ? 34.551  -5.114  -33.337 1.00 20.54 ? 16   DG  T "O4'" 1 
ATOM   7717 C  "C3'" . DG  B 2 16  ? 36.208  -6.816  -33.468 1.00 20.49 ? 16   DG  T "C3'" 1 
ATOM   7718 O  "O3'" . DG  B 2 16  ? 36.630  -7.017  -34.809 1.00 20.35 ? 16   DG  T "O3'" 1 
ATOM   7719 C  "C2'" . DG  B 2 16  ? 36.799  -5.550  -32.838 1.00 20.33 ? 16   DG  T "C2'" 1 
ATOM   7720 C  "C1'" . DG  B 2 16  ? 35.820  -4.492  -33.341 1.00 21.92 ? 16   DG  T "C1'" 1 
ATOM   7721 N  N9    . DG  B 2 16  ? 35.716  -3.274  -32.538 1.00 22.73 ? 16   DG  T N9    1 
ATOM   7722 C  C8    . DG  B 2 16  ? 35.650  -3.175  -31.168 1.00 22.01 ? 16   DG  T C8    1 
ATOM   7723 N  N7    . DG  B 2 16  ? 35.549  -1.947  -30.741 1.00 22.94 ? 16   DG  T N7    1 
ATOM   7724 C  C5    . DG  B 2 16  ? 35.542  -1.179  -31.897 1.00 22.83 ? 16   DG  T C5    1 
ATOM   7725 C  C6    . DG  B 2 16  ? 35.452  0.227   -32.062 1.00 24.46 ? 16   DG  T C6    1 
ATOM   7726 O  O6    . DG  B 2 16  ? 35.357  1.093   -31.180 1.00 24.72 ? 16   DG  T O6    1 
ATOM   7727 N  N1    . DG  B 2 16  ? 35.476  0.604   -33.408 1.00 24.02 ? 16   DG  T N1    1 
ATOM   7728 C  C2    . DG  B 2 16  ? 35.579  -0.277  -34.465 1.00 24.26 ? 16   DG  T C2    1 
ATOM   7729 N  N2    . DG  B 2 16  ? 35.589  0.259   -35.695 1.00 25.02 ? 16   DG  T N2    1 
ATOM   7730 N  N3    . DG  B 2 16  ? 35.664  -1.598  -34.321 1.00 23.31 ? 16   DG  T N3    1 
ATOM   7731 C  C4    . DG  B 2 16  ? 35.642  -1.981  -33.015 1.00 23.28 ? 16   DG  T C4    1 
ATOM   7732 P  P     . DC  B 2 17  ? 38.073  -7.607  -35.151 1.00 21.38 ? 17   DC  T P     1 
ATOM   7733 O  OP1   . DC  B 2 17  ? 38.002  -8.195  -36.508 1.00 20.82 ? 17   DC  T OP1   1 
ATOM   7734 O  OP2   . DC  B 2 17  ? 38.524  -8.416  -33.996 1.00 16.26 ? 17   DC  T OP2   1 
ATOM   7735 O  "O5'" . DC  B 2 17  ? 38.974  -6.288  -35.217 1.00 19.32 ? 17   DC  T "O5'" 1 
ATOM   7736 C  "C5'" . DC  B 2 17  ? 38.774  -5.337  -36.255 1.00 19.56 ? 17   DC  T "C5'" 1 
ATOM   7737 C  "C4'" . DC  B 2 17  ? 39.640  -4.117  -36.014 1.00 19.10 ? 17   DC  T "C4'" 1 
ATOM   7738 O  "O4'" . DC  B 2 17  ? 39.068  -3.314  -34.954 1.00 19.46 ? 17   DC  T "O4'" 1 
ATOM   7739 C  "C3'" . DC  B 2 17  ? 41.077  -4.421  -35.581 1.00 18.43 ? 17   DC  T "C3'" 1 
ATOM   7740 O  "O3'" . DC  B 2 17  ? 41.948  -3.627  -36.364 1.00 17.35 ? 17   DC  T "O3'" 1 
ATOM   7741 C  "C2'" . DC  B 2 17  ? 41.118  -3.985  -34.119 1.00 18.22 ? 17   DC  T "C2'" 1 
ATOM   7742 C  "C1'" . DC  B 2 17  ? 40.145  -2.813  -34.196 1.00 20.29 ? 17   DC  T "C1'" 1 
ATOM   7743 N  N1    . DC  B 2 17  ? 39.639  -2.265  -32.895 1.00 23.28 ? 17   DC  T N1    1 
ATOM   7744 C  C2    . DC  B 2 17  ? 39.132  -0.953  -32.864 1.00 24.70 ? 17   DC  T C2    1 
ATOM   7745 O  O2    . DC  B 2 17  ? 39.101  -0.283  -33.907 1.00 23.97 ? 17   DC  T O2    1 
ATOM   7746 N  N3    . DC  B 2 17  ? 38.682  -0.452  -31.682 1.00 26.08 ? 17   DC  T N3    1 
ATOM   7747 C  C4    . DC  B 2 17  ? 38.721  -1.203  -30.574 1.00 27.67 ? 17   DC  T C4    1 
ATOM   7748 N  N4    . DC  B 2 17  ? 38.262  -0.667  -29.437 1.00 28.14 ? 17   DC  T N4    1 
ATOM   7749 C  C5    . DC  B 2 17  ? 39.234  -2.539  -30.583 1.00 27.18 ? 17   DC  T C5    1 
ATOM   7750 C  C6    . DC  B 2 17  ? 39.676  -3.022  -31.754 1.00 23.96 ? 17   DC  T C6    1 
ATOM   7751 P  P     . DG  B 2 18  ? 43.279  -4.211  -37.004 1.00 14.26 ? 18   DG  T P     1 
ATOM   7752 O  OP1   . DG  B 2 18  ? 44.098  -3.050  -37.424 1.00 18.02 ? 18   DG  T OP1   1 
ATOM   7753 O  OP2   . DG  B 2 18  ? 42.906  -5.247  -37.988 1.00 16.79 ? 18   DG  T OP2   1 
ATOM   7754 O  "O5'" . DG  B 2 18  ? 43.966  -4.954  -35.763 1.00 13.59 ? 18   DG  T "O5'" 1 
ATOM   7755 C  "C5'" . DG  B 2 18  ? 45.334  -5.315  -35.782 1.00 8.65  ? 18   DG  T "C5'" 1 
ATOM   7756 C  "C4'" . DG  B 2 18  ? 45.901  -5.097  -34.389 1.00 6.73  ? 18   DG  T "C4'" 1 
ATOM   7757 O  "O4'" . DG  B 2 18  ? 47.202  -5.712  -34.307 1.00 3.43  ? 18   DG  T "O4'" 1 
ATOM   7758 C  "C3'" . DG  B 2 18  ? 46.099  -3.635  -33.993 1.00 7.17  ? 18   DG  T "C3'" 1 
ATOM   7759 O  "O3'" . DG  B 2 18  ? 45.759  -3.448  -32.621 1.00 3.65  ? 18   DG  T "O3'" 1 
ATOM   7760 C  "C2'" . DG  B 2 18  ? 47.588  -3.395  -34.249 1.00 2.52  ? 18   DG  T "C2'" 1 
ATOM   7761 C  "C1'" . DG  B 2 18  ? 48.177  -4.763  -33.917 1.00 3.58  ? 18   DG  T "C1'" 1 
ATOM   7762 N  N9    . DG  B 2 18  ? 49.430  -5.104  -34.585 1.00 2.02  ? 18   DG  T N9    1 
ATOM   7763 C  C8    . DG  B 2 18  ? 50.609  -5.421  -33.957 1.00 2.00  ? 18   DG  T C8    1 
ATOM   7764 N  N7    . DG  B 2 18  ? 51.577  -5.699  -34.776 1.00 3.24  ? 18   DG  T N7    1 
ATOM   7765 C  C5    . DG  B 2 18  ? 51.001  -5.554  -36.030 1.00 2.00  ? 18   DG  T C5    1 
ATOM   7766 C  C6    . DG  B 2 18  ? 51.580  -5.725  -37.309 1.00 2.00  ? 18   DG  T C6    1 
ATOM   7767 O  O6    . DG  B 2 18  ? 52.738  -6.048  -37.564 1.00 2.00  ? 18   DG  T O6    1 
ATOM   7768 N  N1    . DG  B 2 18  ? 50.676  -5.491  -38.344 1.00 2.00  ? 18   DG  T N1    1 
ATOM   7769 C  C2    . DG  B 2 18  ? 49.366  -5.139  -38.164 1.00 3.36  ? 18   DG  T C2    1 
ATOM   7770 N  N2    . DG  B 2 18  ? 48.648  -4.957  -39.287 1.00 4.47  ? 18   DG  T N2    1 
ATOM   7771 N  N3    . DG  B 2 18  ? 48.804  -4.968  -36.963 1.00 3.80  ? 18   DG  T N3    1 
ATOM   7772 C  C4    . DG  B 2 18  ? 49.680  -5.191  -35.940 1.00 2.00  ? 18   DG  T C4    1 
ATOM   7773 O  "O5'" . DG  C 3 1   ? 38.254  10.337  -31.082 1.00 80.93 ? 103  DG  P "O5'" 1 
ATOM   7774 C  "C5'" . DG  C 3 1   ? 39.042  10.867  -32.145 1.00 81.36 ? 103  DG  P "C5'" 1 
ATOM   7775 C  "C4'" . DG  C 3 1   ? 39.243  9.843   -33.256 1.00 81.30 ? 103  DG  P "C4'" 1 
ATOM   7776 O  "O4'" . DG  C 3 1   ? 39.543  8.537   -32.694 1.00 80.29 ? 103  DG  P "O4'" 1 
ATOM   7777 C  "C3'" . DG  C 3 1   ? 38.053  9.638   -34.192 1.00 81.66 ? 103  DG  P "C3'" 1 
ATOM   7778 O  "O3'" . DG  C 3 1   ? 38.524  9.521   -35.534 1.00 83.19 ? 103  DG  P "O3'" 1 
ATOM   7779 C  "C2'" . DG  C 3 1   ? 37.438  8.329   -33.700 1.00 80.37 ? 103  DG  P "C2'" 1 
ATOM   7780 C  "C1'" . DG  C 3 1   ? 38.684  7.567   -33.264 1.00 78.59 ? 103  DG  P "C1'" 1 
ATOM   7781 N  N9    . DG  C 3 1   ? 38.449  6.507   -32.283 1.00 75.92 ? 103  DG  P N9    1 
ATOM   7782 C  C8    . DG  C 3 1   ? 38.247  6.657   -30.930 1.00 75.14 ? 103  DG  P C8    1 
ATOM   7783 N  N7    . DG  C 3 1   ? 38.071  5.529   -30.298 1.00 73.91 ? 103  DG  P N7    1 
ATOM   7784 C  C5    . DG  C 3 1   ? 38.165  4.565   -31.295 1.00 72.84 ? 103  DG  P C5    1 
ATOM   7785 C  C6    . DG  C 3 1   ? 38.057  3.153   -31.213 1.00 71.24 ? 103  DG  P C6    1 
ATOM   7786 O  O6    . DG  C 3 1   ? 37.851  2.461   -30.206 1.00 69.81 ? 103  DG  P O6    1 
ATOM   7787 N  N1    . DG  C 3 1   ? 38.212  2.543   -32.460 1.00 70.56 ? 103  DG  P N1    1 
ATOM   7788 C  C2    . DG  C 3 1   ? 38.444  3.217   -33.640 1.00 70.68 ? 103  DG  P C2    1 
ATOM   7789 N  N2    . DG  C 3 1   ? 38.568  2.468   -34.745 1.00 69.71 ? 103  DG  P N2    1 
ATOM   7790 N  N3    . DG  C 3 1   ? 38.547  4.540   -33.730 1.00 71.68 ? 103  DG  P N3    1 
ATOM   7791 C  C4    . DG  C 3 1   ? 38.398  5.151   -32.524 1.00 73.49 ? 103  DG  P C4    1 
ATOM   7792 P  P     . DC  C 3 2   ? 37.754  10.191  -36.769 1.00 84.72 ? 104  DC  P P     1 
ATOM   7793 O  OP1   . DC  C 3 2   ? 38.727  10.279  -37.883 1.00 85.22 ? 104  DC  P OP1   1 
ATOM   7794 O  OP2   . DC  C 3 2   ? 37.071  11.418  -36.296 1.00 85.04 ? 104  DC  P OP2   1 
ATOM   7795 O  "O5'" . DC  C 3 2   ? 36.629  9.107   -37.125 1.00 82.74 ? 104  DC  P "O5'" 1 
ATOM   7796 C  "C5'" . DC  C 3 2   ? 36.238  8.860   -38.476 1.00 79.77 ? 104  DC  P "C5'" 1 
ATOM   7797 C  "C4'" . DC  C 3 2   ? 36.107  7.367   -38.743 1.00 77.91 ? 104  DC  P "C4'" 1 
ATOM   7798 O  "O4'" . DC  C 3 2   ? 36.343  6.609   -37.522 1.00 76.99 ? 104  DC  P "O4'" 1 
ATOM   7799 C  "C3'" . DC  C 3 2   ? 34.746  6.910   -39.266 1.00 77.41 ? 104  DC  P "C3'" 1 
ATOM   7800 O  "O3'" . DC  C 3 2   ? 34.942  5.903   -40.262 1.00 77.99 ? 104  DC  P "O3'" 1 
ATOM   7801 C  "C2'" . DC  C 3 2   ? 34.083  6.349   -38.009 1.00 76.27 ? 104  DC  P "C2'" 1 
ATOM   7802 C  "C1'" . DC  C 3 2   ? 35.285  5.687   -37.345 1.00 75.19 ? 104  DC  P "C1'" 1 
ATOM   7803 N  N1    . DC  C 3 2   ? 35.121  5.324   -35.888 1.00 72.76 ? 104  DC  P N1    1 
ATOM   7804 C  C2    . DC  C 3 2   ? 35.337  3.995   -35.471 1.00 71.41 ? 104  DC  P C2    1 
ATOM   7805 O  O2    . DC  C 3 2   ? 35.660  3.129   -36.296 1.00 70.61 ? 104  DC  P O2    1 
ATOM   7806 N  N3    . DC  C 3 2   ? 35.186  3.684   -34.157 1.00 70.13 ? 104  DC  P N3    1 
ATOM   7807 C  C4    . DC  C 3 2   ? 34.837  4.626   -33.276 1.00 69.64 ? 104  DC  P C4    1 
ATOM   7808 N  N4    . DC  C 3 2   ? 34.703  4.261   -31.997 1.00 68.53 ? 104  DC  P N4    1 
ATOM   7809 C  C5    . DC  C 3 2   ? 34.611  5.980   -33.674 1.00 70.34 ? 104  DC  P C5    1 
ATOM   7810 C  C6    . DC  C 3 2   ? 34.762  6.280   -34.973 1.00 71.51 ? 104  DC  P C6    1 
ATOM   7811 P  P     . DG  C 3 3   ? 33.825  5.479   -41.336 1.00 78.87 ? 105  DG  P P     1 
ATOM   7812 O  OP1   . DG  C 3 3   ? 33.976  6.357   -42.517 1.00 78.69 ? 105  DG  P OP1   1 
ATOM   7813 O  OP2   . DG  C 3 3   ? 32.505  5.361   -40.672 1.00 78.30 ? 105  DG  P OP2   1 
ATOM   7814 O  "O5'" . DG  C 3 3   ? 34.314  4.001   -41.718 1.00 76.86 ? 105  DG  P "O5'" 1 
ATOM   7815 C  "C5'" . DG  C 3 3   ? 33.580  3.192   -42.634 1.00 73.52 ? 105  DG  P "C5'" 1 
ATOM   7816 C  "C4'" . DG  C 3 3   ? 32.756  2.130   -41.925 1.00 70.94 ? 105  DG  P "C4'" 1 
ATOM   7817 O  "O4'" . DG  C 3 3   ? 33.046  2.120   -40.504 1.00 69.63 ? 105  DG  P "O4'" 1 
ATOM   7818 C  "C3'" . DG  C 3 3   ? 31.249  2.329   -42.060 1.00 70.16 ? 105  DG  P "C3'" 1 
ATOM   7819 O  "O3'" . DG  C 3 3   ? 30.714  1.312   -42.949 1.00 70.22 ? 105  DG  P "O3'" 1 
ATOM   7820 C  "C2'" . DG  C 3 3   ? 30.722  2.332   -40.619 1.00 69.24 ? 105  DG  P "C2'" 1 
ATOM   7821 C  "C1'" . DG  C 3 3   ? 31.879  1.765   -39.797 1.00 67.95 ? 105  DG  P "C1'" 1 
ATOM   7822 N  N9    . DG  C 3 3   ? 31.964  2.281   -38.424 1.00 65.66 ? 105  DG  P N9    1 
ATOM   7823 C  C8    . DG  C 3 3   ? 31.949  3.602   -38.037 1.00 64.70 ? 105  DG  P C8    1 
ATOM   7824 N  N7    . DG  C 3 3   ? 32.038  3.783   -36.748 1.00 62.77 ? 105  DG  P N7    1 
ATOM   7825 C  C5    . DG  C 3 3   ? 32.117  2.496   -36.234 1.00 62.30 ? 105  DG  P C5    1 
ATOM   7826 C  C6    . DG  C 3 3   ? 32.231  2.059   -34.888 1.00 60.56 ? 105  DG  P C6    1 
ATOM   7827 O  O6    . DG  C 3 3   ? 32.283  2.751   -33.862 1.00 58.90 ? 105  DG  P O6    1 
ATOM   7828 N  N1    . DG  C 3 3   ? 32.283  0.667   -34.788 1.00 59.78 ? 105  DG  P N1    1 
ATOM   7829 C  C2    . DG  C 3 3   ? 32.231  -0.195  -35.863 1.00 60.71 ? 105  DG  P C2    1 
ATOM   7830 N  N2    . DG  C 3 3   ? 32.293  -1.504  -35.577 1.00 59.71 ? 105  DG  P N2    1 
ATOM   7831 N  N3    . DG  C 3 3   ? 32.124  0.203   -37.130 1.00 61.97 ? 105  DG  P N3    1 
ATOM   7832 C  C4    . DG  C 3 3   ? 32.074  1.558   -37.250 1.00 63.48 ? 105  DG  P C4    1 
ATOM   7833 P  P     . DG  C 3 4   ? 29.694  0.128   -42.565 1.00 70.25 ? 106  DG  P P     1 
ATOM   7834 O  OP1   . DG  C 3 4   ? 29.509  -0.703  -43.778 1.00 70.20 ? 106  DG  P OP1   1 
ATOM   7835 O  OP2   . DG  C 3 4   ? 28.496  0.730   -41.934 1.00 71.00 ? 106  DG  P OP2   1 
ATOM   7836 O  "O5'" . DG  C 3 4   ? 30.499  -0.719  -41.466 1.00 67.01 ? 106  DG  P "O5'" 1 
ATOM   7837 C  "C5'" . DG  C 3 4   ? 30.556  -2.142  -41.518 1.00 62.32 ? 106  DG  P "C5'" 1 
ATOM   7838 C  "C4'" . DG  C 3 4   ? 29.678  -2.760  -40.443 1.00 58.83 ? 106  DG  P "C4'" 1 
ATOM   7839 O  "O4'" . DG  C 3 4   ? 29.832  -2.043  -39.189 1.00 56.05 ? 106  DG  P "O4'" 1 
ATOM   7840 C  "C3'" . DG  C 3 4   ? 28.185  -2.760  -40.753 1.00 57.59 ? 106  DG  P "C3'" 1 
ATOM   7841 O  "O3'" . DG  C 3 4   ? 27.643  -4.017  -40.393 1.00 59.14 ? 106  DG  P "O3'" 1 
ATOM   7842 C  "C2'" . DG  C 3 4   ? 27.629  -1.650  -39.865 1.00 55.72 ? 106  DG  P "C2'" 1 
ATOM   7843 C  "C1'" . DG  C 3 4   ? 28.557  -1.735  -38.659 1.00 52.92 ? 106  DG  P "C1'" 1 
ATOM   7844 N  N9    . DG  C 3 4   ? 28.668  -0.512  -37.862 1.00 48.15 ? 106  DG  P N9    1 
ATOM   7845 C  C8    . DG  C 3 4   ? 28.733  0.783   -38.320 1.00 47.26 ? 106  DG  P C8    1 
ATOM   7846 N  N7    . DG  C 3 4   ? 28.837  1.674   -37.373 1.00 45.07 ? 106  DG  P N7    1 
ATOM   7847 C  C5    . DG  C 3 4   ? 28.842  0.924   -36.205 1.00 42.32 ? 106  DG  P C5    1 
ATOM   7848 C  C6    . DG  C 3 4   ? 28.932  1.339   -34.852 1.00 39.06 ? 106  DG  P C6    1 
ATOM   7849 O  O6    . DG  C 3 4   ? 29.031  2.494   -34.416 1.00 35.65 ? 106  DG  P O6    1 
ATOM   7850 N  N1    . DG  C 3 4   ? 28.900  0.258   -33.969 1.00 38.23 ? 106  DG  P N1    1 
ATOM   7851 C  C2    . DG  C 3 4   ? 28.795  -1.063  -34.351 1.00 39.05 ? 106  DG  P C2    1 
ATOM   7852 N  N2    . DG  C 3 4   ? 28.779  -1.976  -33.371 1.00 38.60 ? 106  DG  P N2    1 
ATOM   7853 N  N3    . DG  C 3 4   ? 28.710  -1.464  -35.614 1.00 40.54 ? 106  DG  P N3    1 
ATOM   7854 C  C4    . DG  C 3 4   ? 28.739  -0.424  -36.488 1.00 43.89 ? 106  DG  P C4    1 
ATOM   7855 P  P     . DA  C 3 5   ? 26.340  -4.602  -41.115 1.00 61.39 ? 107  DA  P P     1 
ATOM   7856 O  OP1   . DA  C 3 5   ? 26.758  -5.802  -41.878 1.00 61.66 ? 107  DA  P OP1   1 
ATOM   7857 O  OP2   . DA  C 3 5   ? 25.631  -3.501  -41.807 1.00 62.04 ? 107  DA  P OP2   1 
ATOM   7858 O  "O5'" . DA  C 3 5   ? 25.431  -5.055  -39.879 1.00 59.01 ? 107  DA  P "O5'" 1 
ATOM   7859 C  "C5'" . DA  C 3 5   ? 25.900  -6.041  -38.966 1.00 55.90 ? 107  DA  P "C5'" 1 
ATOM   7860 C  "C4'" . DA  C 3 5   ? 25.339  -5.796  -37.580 1.00 53.19 ? 107  DA  P "C4'" 1 
ATOM   7861 O  "O4'" . DA  C 3 5   ? 25.810  -4.520  -37.080 1.00 51.02 ? 107  DA  P "O4'" 1 
ATOM   7862 C  "C3'" . DA  C 3 5   ? 23.816  -5.764  -37.511 1.00 52.73 ? 107  DA  P "C3'" 1 
ATOM   7863 O  "O3'" . DA  C 3 5   ? 23.408  -6.850  -36.675 1.00 54.66 ? 107  DA  P "O3'" 1 
ATOM   7864 C  "C2'" . DA  C 3 5   ? 23.483  -4.373  -36.960 1.00 50.29 ? 107  DA  P "C2'" 1 
ATOM   7865 C  "C1'" . DA  C 3 5   ? 24.786  -3.923  -36.312 1.00 47.67 ? 107  DA  P "C1'" 1 
ATOM   7866 N  N9    . DA  C 3 5   ? 25.015  -2.476  -36.310 1.00 43.42 ? 107  DA  P N9    1 
ATOM   7867 C  C8    . DA  C 3 5   ? 25.174  -1.670  -37.406 1.00 41.59 ? 107  DA  P C8    1 
ATOM   7868 N  N7    . DA  C 3 5   ? 25.377  -0.405  -37.121 1.00 39.22 ? 107  DA  P N7    1 
ATOM   7869 C  C5    . DA  C 3 5   ? 25.355  -0.373  -35.737 1.00 36.61 ? 107  DA  P C5    1 
ATOM   7870 C  C6    . DA  C 3 5   ? 25.510  0.680   -34.808 1.00 33.37 ? 107  DA  P C6    1 
ATOM   7871 N  N6    . DA  C 3 5   ? 25.726  1.946   -35.174 1.00 28.69 ? 107  DA  P N6    1 
ATOM   7872 N  N1    . DA  C 3 5   ? 25.434  0.382   -33.490 1.00 32.79 ? 107  DA  P N1    1 
ATOM   7873 C  C2    . DA  C 3 5   ? 25.217  -0.892  -33.126 1.00 33.16 ? 107  DA  P C2    1 
ATOM   7874 N  N3    . DA  C 3 5   ? 25.054  -1.963  -33.908 1.00 35.36 ? 107  DA  P N3    1 
ATOM   7875 C  C4    . DA  C 3 5   ? 25.134  -1.639  -35.216 1.00 38.70 ? 107  DA  P C4    1 
ATOM   7876 P  P     . DC  C 3 6   ? 21.933  -7.028  -36.068 1.00 57.34 ? 108  DC  P P     1 
ATOM   7877 O  OP1   . DC  C 3 6   ? 21.722  -8.479  -35.852 1.00 56.41 ? 108  DC  P OP1   1 
ATOM   7878 O  OP2   . DC  C 3 6   ? 20.955  -6.249  -36.869 1.00 56.00 ? 108  DC  P OP2   1 
ATOM   7879 O  "O5'" . DC  C 3 6   ? 22.096  -6.335  -34.634 1.00 55.67 ? 108  DC  P "O5'" 1 
ATOM   7880 C  "C5'" . DC  C 3 6   ? 21.000  -6.271  -33.734 1.00 52.19 ? 108  DC  P "C5'" 1 
ATOM   7881 C  "C4'" . DC  C 3 6   ? 20.900  -4.900  -33.088 1.00 49.09 ? 108  DC  P "C4'" 1 
ATOM   7882 O  "O4'" . DC  C 3 6   ? 21.720  -3.917  -33.771 1.00 46.39 ? 108  DC  P "O4'" 1 
ATOM   7883 C  "C3'" . DC  C 3 6   ? 19.510  -4.285  -33.126 1.00 47.64 ? 108  DC  P "C3'" 1 
ATOM   7884 O  "O3'" . DC  C 3 6   ? 18.726  -4.765  -32.033 1.00 48.67 ? 108  DC  P "O3'" 1 
ATOM   7885 C  "C2'" . DC  C 3 6   ? 19.796  -2.789  -32.996 1.00 45.77 ? 108  DC  P "C2'" 1 
ATOM   7886 C  "C1'" . DC  C 3 6   ? 21.291  -2.662  -33.280 1.00 43.35 ? 108  DC  P "C1'" 1 
ATOM   7887 N  N1    . DC  C 3 6   ? 21.589  -1.537  -34.227 1.00 38.87 ? 108  DC  P N1    1 
ATOM   7888 C  C2    . DC  C 3 6   ? 21.872  -0.267  -33.696 1.00 35.89 ? 108  DC  P C2    1 
ATOM   7889 O  O2    . DC  C 3 6   ? 21.882  -0.108  -32.470 1.00 34.60 ? 108  DC  P O2    1 
ATOM   7890 N  N3    . DC  C 3 6   ? 22.139  0.760   -34.542 1.00 33.05 ? 108  DC  P N3    1 
ATOM   7891 C  C4    . DC  C 3 6   ? 22.122  0.561   -35.860 1.00 32.02 ? 108  DC  P C4    1 
ATOM   7892 N  N4    . DC  C 3 6   ? 22.394  1.608   -36.642 1.00 30.56 ? 108  DC  P N4    1 
ATOM   7893 C  C5    . DC  C 3 6   ? 21.834  -0.720  -36.427 1.00 34.07 ? 108  DC  P C5    1 
ATOM   7894 C  C6    . DC  C 3 6   ? 21.570  -1.728  -35.584 1.00 36.45 ? 108  DC  P C6    1 
ATOM   7895 P  P     . DT  C 3 7   ? 17.178  -4.356  -31.878 1.00 48.88 ? 109  DT  P P     1 
ATOM   7896 O  OP1   . DT  C 3 7   ? 16.525  -5.407  -31.062 1.00 50.21 ? 109  DT  P OP1   1 
ATOM   7897 O  OP2   . DT  C 3 7   ? 16.647  -4.031  -33.222 1.00 47.77 ? 109  DT  P OP2   1 
ATOM   7898 O  "O5'" . DT  C 3 7   ? 17.219  -2.994  -31.034 1.00 46.92 ? 109  DT  P "O5'" 1 
ATOM   7899 C  "C5'" . DT  C 3 7   ? 17.695  -2.961  -29.683 1.00 43.83 ? 109  DT  P "C5'" 1 
ATOM   7900 C  "C4'" . DT  C 3 7   ? 17.735  -1.532  -29.161 1.00 41.53 ? 109  DT  P "C4'" 1 
ATOM   7901 O  "O4'" . DT  C 3 7   ? 18.470  -0.703  -30.100 1.00 39.71 ? 109  DT  P "O4'" 1 
ATOM   7902 C  "C3'" . DT  C 3 7   ? 16.364  -0.877  -28.966 1.00 41.34 ? 109  DT  P "C3'" 1 
ATOM   7903 O  "O3'" . DT  C 3 7   ? 16.248  -0.330  -27.637 1.00 40.69 ? 109  DT  P "O3'" 1 
ATOM   7904 C  "C2'" . DT  C 3 7   ? 16.295  0.190   -30.063 1.00 39.89 ? 109  DT  P "C2'" 1 
ATOM   7905 C  "C1'" . DT  C 3 7   ? 17.764  0.502   -30.332 1.00 38.78 ? 109  DT  P "C1'" 1 
ATOM   7906 N  N1    . DT  C 3 7   ? 18.054  1.032   -31.725 1.00 35.99 ? 109  DT  P N1    1 
ATOM   7907 C  C2    . DT  C 3 7   ? 18.500  2.340   -31.878 1.00 34.74 ? 109  DT  P C2    1 
ATOM   7908 O  O2    . DT  C 3 7   ? 18.683  3.112   -30.947 1.00 33.92 ? 109  DT  P O2    1 
ATOM   7909 N  N3    . DT  C 3 7   ? 18.733  2.723   -33.183 1.00 30.50 ? 109  DT  P N3    1 
ATOM   7910 C  C4    . DT  C 3 7   ? 18.568  1.958   -34.327 1.00 29.35 ? 109  DT  P C4    1 
ATOM   7911 O  O4    . DT  C 3 7   ? 18.807  2.403   -35.448 1.00 25.97 ? 109  DT  P O4    1 
ATOM   7912 C  C5    . DT  C 3 7   ? 18.099  0.607   -34.101 1.00 30.73 ? 109  DT  P C5    1 
ATOM   7913 C  C7    . DT  C 3 7   ? 17.881  -0.324  -35.256 1.00 30.95 ? 109  DT  P C7    1 
ATOM   7914 C  C6    . DT  C 3 7   ? 17.869  0.216   -32.834 1.00 33.46 ? 109  DT  P C6    1 
ATOM   7915 P  P     . DG  C 3 8   ? 14.869  0.303   -27.104 1.00 41.52 ? 110  DG  P P     1 
ATOM   7916 O  OP1   . DG  C 3 8   ? 14.962  0.467   -25.634 1.00 40.46 ? 110  DG  P OP1   1 
ATOM   7917 O  OP2   . DG  C 3 8   ? 13.741  -0.468  -27.680 1.00 40.40 ? 110  DG  P OP2   1 
ATOM   7918 O  "O5'" . DG  C 3 8   ? 14.876  1.752   -27.787 1.00 38.13 ? 110  DG  P "O5'" 1 
ATOM   7919 C  "C5'" . DG  C 3 8   ? 15.762  2.760   -27.308 1.00 34.80 ? 110  DG  P "C5'" 1 
ATOM   7920 C  "C4'" . DG  C 3 8   ? 15.526  4.069   -28.034 1.00 31.04 ? 110  DG  P "C4'" 1 
ATOM   7921 O  "O4'" . DG  C 3 8   ? 15.872  3.912   -29.428 1.00 30.75 ? 110  DG  P "O4'" 1 
ATOM   7922 C  "C3'" . DG  C 3 8   ? 14.085  4.579   -28.005 1.00 29.40 ? 110  DG  P "C3'" 1 
ATOM   7923 O  "O3'" . DG  C 3 8   ? 14.063  5.725   -27.139 1.00 27.90 ? 110  DG  P "O3'" 1 
ATOM   7924 C  "C2'" . DG  C 3 8   ? 13.733  4.859   -29.475 1.00 28.74 ? 110  DG  P "C2'" 1 
ATOM   7925 C  "C1'" . DG  C 3 8   ? 15.091  4.811   -30.180 1.00 28.15 ? 110  DG  P "C1'" 1 
ATOM   7926 N  N9    . DG  C 3 8   ? 15.163  4.337   -31.567 1.00 27.39 ? 110  DG  P N9    1 
ATOM   7927 C  C8    . DG  C 3 8   ? 14.752  3.130   -32.088 1.00 25.42 ? 110  DG  P C8    1 
ATOM   7928 N  N7    . DG  C 3 8   ? 14.986  3.007   -33.372 1.00 24.74 ? 110  DG  P N7    1 
ATOM   7929 C  C5    . DG  C 3 8   ? 15.605  4.203   -33.728 1.00 23.12 ? 110  DG  P C5    1 
ATOM   7930 C  C6    . DG  C 3 8   ? 16.098  4.663   -34.983 1.00 20.48 ? 110  DG  P C6    1 
ATOM   7931 O  O6    . DG  C 3 8   ? 16.096  4.089   -36.079 1.00 18.71 ? 110  DG  P O6    1 
ATOM   7932 N  N1    . DG  C 3 8   ? 16.648  5.941   -34.897 1.00 19.12 ? 110  DG  P N1    1 
ATOM   7933 C  C2    . DG  C 3 8   ? 16.718  6.684   -33.741 1.00 22.18 ? 110  DG  P C2    1 
ATOM   7934 N  N2    . DG  C 3 8   ? 17.284  7.892   -33.843 1.00 20.75 ? 110  DG  P N2    1 
ATOM   7935 N  N3    . DG  C 3 8   ? 16.271  6.269   -32.559 1.00 24.21 ? 110  DG  P N3    1 
ATOM   7936 C  C4    . DG  C 3 8   ? 15.724  5.026   -32.625 1.00 25.43 ? 110  DG  P C4    1 
ATOM   7937 P  P     . DC  C 3 9   ? 12.723  6.539   -26.791 1.00 28.47 ? 111  DC  P P     1 
ATOM   7938 O  OP1   . DC  C 3 9   ? 12.943  7.219   -25.491 1.00 28.28 ? 111  DC  P OP1   1 
ATOM   7939 O  OP2   . DC  C 3 9   ? 11.565  5.632   -26.987 1.00 23.10 ? 111  DC  P OP2   1 
ATOM   7940 O  "O5'" . DC  C 3 9   ? 12.664  7.651   -27.943 1.00 25.87 ? 111  DC  P "O5'" 1 
ATOM   7941 C  "C5'" . DC  C 3 9   ? 13.802  8.428   -28.308 1.00 23.54 ? 111  DC  P "C5'" 1 
ATOM   7942 C  "C4'" . DC  C 3 9   ? 13.591  9.044   -29.680 1.00 20.38 ? 111  DC  P "C4'" 1 
ATOM   7943 O  "O4'" . DC  C 3 9   ? 13.701  8.040   -30.712 1.00 16.82 ? 111  DC  P "O4'" 1 
ATOM   7944 C  "C3'" . DC  C 3 9   ? 12.211  9.664   -29.886 1.00 20.94 ? 111  DC  P "C3'" 1 
ATOM   7945 O  "O3'" . DC  C 3 9   ? 12.346  11.073  -29.878 1.00 23.35 ? 111  DC  P "O3'" 1 
ATOM   7946 C  "C2'" . DC  C 3 9   ? 11.720  9.125   -31.235 1.00 19.47 ? 111  DC  P "C2'" 1 
ATOM   7947 C  "C1'" . DC  C 3 9   ? 13.012  8.568   -31.822 1.00 18.21 ? 111  DC  P "C1'" 1 
ATOM   7948 N  N1    . DC  C 3 9   ? 12.859  7.500   -32.853 1.00 17.35 ? 111  DC  P N1    1 
ATOM   7949 C  C2    . DC  C 3 9   ? 13.407  7.716   -34.129 1.00 17.08 ? 111  DC  P C2    1 
ATOM   7950 O  O2    . DC  C 3 9   ? 13.989  8.781   -34.372 1.00 16.80 ? 111  DC  P O2    1 
ATOM   7951 N  N3    . DC  C 3 9   ? 13.282  6.747   -35.072 1.00 14.10 ? 111  DC  P N3    1 
ATOM   7952 C  C4    . DC  C 3 9   ? 12.651  5.605   -34.781 1.00 16.20 ? 111  DC  P C4    1 
ATOM   7953 N  N4    . DC  C 3 9   ? 12.557  4.683   -35.750 1.00 14.12 ? 111  DC  P N4    1 
ATOM   7954 C  C5    . DC  C 3 9   ? 12.089  5.360   -33.484 1.00 16.49 ? 111  DC  P C5    1 
ATOM   7955 C  C6    . DC  C 3 9   ? 12.218  6.324   -32.559 1.00 16.41 ? 111  DC  P C6    1 
ATOM   7956 P  P     . DT  C 3 10  ? 11.052  12.013  -29.924 1.00 25.40 ? 112  DT  P P     1 
ATOM   7957 O  OP1   . DT  C 3 10  ? 11.407  13.264  -29.219 1.00 26.10 ? 112  DT  P OP1   1 
ATOM   7958 O  OP2   . DT  C 3 10  ? 9.847   11.244  -29.531 1.00 23.70 ? 112  DT  P OP2   1 
ATOM   7959 O  "O5'" . DT  C 3 10  ? 10.892  12.289  -31.499 1.00 22.50 ? 112  DT  P "O5'" 1 
ATOM   7960 C  "C5'" . DT  C 3 10  ? 11.941  12.817  -32.299 1.00 16.90 ? 112  DT  P "C5'" 1 
ATOM   7961 C  "C4'" . DT  C 3 10  ? 11.597  12.675  -33.772 1.00 15.97 ? 112  DT  P "C4'" 1 
ATOM   7962 O  "O4'" . DT  C 3 10  ? 11.648  11.283  -34.169 1.00 15.22 ? 112  DT  P "O4'" 1 
ATOM   7963 C  "C3'" . DT  C 3 10  ? 10.190  13.146  -34.131 1.00 15.73 ? 112  DT  P "C3'" 1 
ATOM   7964 O  "O3'" . DT  C 3 10  ? 10.273  14.422  -34.747 1.00 12.88 ? 112  DT  P "O3'" 1 
ATOM   7965 C  "C2'" . DT  C 3 10  ? 9.646   12.069  -35.070 1.00 17.96 ? 112  DT  P "C2'" 1 
ATOM   7966 C  "C1'" . DT  C 3 10  ? 10.845  11.166  -35.324 1.00 17.13 ? 112  DT  P "C1'" 1 
ATOM   7967 N  N1    . DT  C 3 10  ? 10.466  9.728   -35.555 1.00 16.21 ? 112  DT  P N1    1 
ATOM   7968 C  C2    . DT  C 3 10  ? 10.795  9.110   -36.752 1.00 15.18 ? 112  DT  P C2    1 
ATOM   7969 O  O2    . DT  C 3 10  ? 11.389  9.656   -37.665 1.00 16.29 ? 112  DT  P O2    1 
ATOM   7970 N  N3    . DT  C 3 10  ? 10.397  7.801   -36.852 1.00 12.69 ? 112  DT  P N3    1 
ATOM   7971 C  C4    . DT  C 3 10  ? 9.719   7.059   -35.898 1.00 13.04 ? 112  DT  P C4    1 
ATOM   7972 O  O4    . DT  C 3 10  ? 9.416   5.890   -36.101 1.00 11.51 ? 112  DT  P O4    1 
ATOM   7973 C  C5    . DT  C 3 10  ? 9.403   7.757   -34.671 1.00 14.12 ? 112  DT  P C5    1 
ATOM   7974 C  C7    . DT  C 3 10  ? 8.666   7.074   -33.549 1.00 16.80 ? 112  DT  P C7    1 
ATOM   7975 C  C6    . DT  C 3 10  ? 9.787   9.038   -34.563 1.00 15.51 ? 112  DT  P C6    1 
ATOM   7976 P  P     . DT  C 3 11  ? 8.991   15.232  -35.225 1.00 16.51 ? 113  DT  P P     1 
ATOM   7977 O  OP1   . DT  C 3 11  ? 9.229   16.665  -34.957 1.00 15.77 ? 113  DT  P OP1   1 
ATOM   7978 O  OP2   . DT  C 3 11  ? 7.761   14.585  -34.724 1.00 20.06 ? 113  DT  P OP2   1 
ATOM   7979 O  "O5'" . DT  C 3 11  ? 8.970   15.007  -36.800 1.00 20.86 ? 113  DT  P "O5'" 1 
ATOM   7980 C  "C5'" . DT  C 3 11  ? 10.094  15.280  -37.593 1.00 18.97 ? 113  DT  P "C5'" 1 
ATOM   7981 C  "C4'" . DT  C 3 11  ? 9.958   14.531  -38.901 1.00 14.71 ? 113  DT  P "C4'" 1 
ATOM   7982 O  "O4'" . DT  C 3 11  ? 9.860   13.110  -38.647 1.00 13.73 ? 113  DT  P "O4'" 1 
ATOM   7983 C  "C3'" . DT  C 3 11  ? 8.737   14.913  -39.727 1.00 14.22 ? 113  DT  P "C3'" 1 
ATOM   7984 O  "O3'" . DT  C 3 11  ? 9.208   15.547  -40.914 1.00 9.62  ? 113  DT  P "O3'" 1 
ATOM   7985 C  "C2'" . DT  C 3 11  ? 8.034   13.583  -40.014 1.00 14.46 ? 113  DT  P "C2'" 1 
ATOM   7986 C  "C1'" . DT  C 3 11  ? 9.108   12.545  -39.693 1.00 12.64 ? 113  DT  P "C1'" 1 
ATOM   7987 N  N1    . DT  C 3 11  ? 8.518   11.252  -39.224 1.00 9.32  ? 113  DT  P N1    1 
ATOM   7988 C  C2    . DT  C 3 11  ? 8.685   10.123  -40.001 1.00 9.71  ? 113  DT  P C2    1 
ATOM   7989 O  O2    . DT  C 3 11  ? 9.307   10.114  -41.052 1.00 9.13  ? 113  DT  P O2    1 
ATOM   7990 N  N3    . DT  C 3 11  ? 8.108   8.989   -39.483 1.00 6.55  ? 113  DT  P N3    1 
ATOM   7991 C  C4    . DT  C 3 11  ? 7.391   8.884   -38.304 1.00 8.35  ? 113  DT  P C4    1 
ATOM   7992 O  O4    . DT  C 3 11  ? 6.911   7.815   -37.948 1.00 7.38  ? 113  DT  P O4    1 
ATOM   7993 C  C5    . DT  C 3 11  ? 7.252   10.103  -37.536 1.00 10.09 ? 113  DT  P C5    1 
ATOM   7994 C  C7    . DT  C 3 11  ? 6.495   10.123  -36.232 1.00 10.66 ? 113  DT  P C7    1 
ATOM   7995 C  C6    . DT  C 3 11  ? 7.810   11.215  -38.033 1.00 7.86  ? 113  DT  P C6    1 
ATOM   7996 P  P     . DA  C 3 12  ? 8.219   16.063  -42.046 1.00 10.34 ? 114  DA  P P     1 
ATOM   7997 O  OP1   . DA  C 3 12  ? 8.930   17.150  -42.762 1.00 9.52  ? 114  DA  P OP1   1 
ATOM   7998 O  OP2   . DA  C 3 12  ? 6.889   16.302  -41.451 1.00 11.29 ? 114  DA  P OP2   1 
ATOM   7999 O  "O5'" . DA  C 3 12  ? 8.071   14.793  -42.993 1.00 8.17  ? 114  DA  P "O5'" 1 
ATOM   8000 C  "C5'" . DA  C 3 12  ? 9.187   14.305  -43.726 1.00 8.33  ? 114  DA  P "C5'" 1 
ATOM   8001 C  "C4'" . DA  C 3 12  ? 8.683   13.415  -44.848 1.00 8.70  ? 114  DA  P "C4'" 1 
ATOM   8002 O  "O4'" . DA  C 3 12  ? 8.307   12.127  -44.293 1.00 10.03 ? 114  DA  P "O4'" 1 
ATOM   8003 C  "C3'" . DA  C 3 12  ? 7.463   13.953  -45.595 1.00 6.57  ? 114  DA  P "C3'" 1 
ATOM   8004 O  "O3'" . DA  C 3 12  ? 7.692   13.789  -47.003 1.00 6.68  ? 114  DA  P "O3'" 1 
ATOM   8005 C  "C2'" . DA  C 3 12  ? 6.299   13.128  -45.028 1.00 6.16  ? 114  DA  P "C2'" 1 
ATOM   8006 C  "C1'" . DA  C 3 12  ? 6.969   11.811  -44.623 1.00 7.55  ? 114  DA  P "C1'" 1 
ATOM   8007 N  N9    . DA  C 3 12  ? 6.362   11.145  -43.462 1.00 7.19  ? 114  DA  P N9    1 
ATOM   8008 C  C8    . DA  C 3 12  ? 5.990   11.713  -42.267 1.00 6.93  ? 114  DA  P C8    1 
ATOM   8009 N  N7    . DA  C 3 12  ? 5.473   10.860  -41.405 1.00 6.09  ? 114  DA  P N7    1 
ATOM   8010 C  C5    . DA  C 3 12  ? 5.510   9.647   -42.085 1.00 7.14  ? 114  DA  P C5    1 
ATOM   8011 C  C6    . DA  C 3 12  ? 5.102   8.338   -41.738 1.00 5.29  ? 114  DA  P C6    1 
ATOM   8012 N  N6    . DA  C 3 12  ? 4.562   8.033   -40.554 1.00 6.57  ? 114  DA  P N6    1 
ATOM   8013 N  N1    . DA  C 3 12  ? 5.278   7.349   -42.649 1.00 4.39  ? 114  DA  P N1    1 
ATOM   8014 C  C2    . DA  C 3 12  ? 5.821   7.646   -43.836 1.00 4.46  ? 114  DA  P C2    1 
ATOM   8015 N  N3    . DA  C 3 12  ? 6.247   8.837   -44.273 1.00 4.42  ? 114  DA  P N3    1 
ATOM   8016 C  C4    . DA  C 3 12  ? 6.052   9.804   -43.350 1.00 5.03  ? 114  DA  P C4    1 
HETATM 8017 N  N1    . DOC C 3 13  ? 3.227   9.809   -45.381 1.00 7.56  ? 115  DOC P N1    1 
HETATM 8018 C  C2    . DOC C 3 13  ? 2.743   8.661   -44.719 1.00 5.33  ? 115  DOC P C2    1 
HETATM 8019 N  N3    . DOC C 3 13  ? 2.261   8.757   -43.453 1.00 7.15  ? 115  DOC P N3    1 
HETATM 8020 C  C4    . DOC C 3 13  ? 2.237   9.949   -42.808 1.00 7.79  ? 115  DOC P C4    1 
HETATM 8021 C  C5    . DOC C 3 13  ? 2.712   11.099  -43.446 1.00 6.01  ? 115  DOC P C5    1 
HETATM 8022 C  C6    . DOC C 3 13  ? 3.209   11.004  -44.750 1.00 7.77  ? 115  DOC P C6    1 
HETATM 8023 O  O2    . DOC C 3 13  ? 2.764   7.555   -45.306 1.00 8.07  ? 115  DOC P O2    1 
HETATM 8024 N  N4    . DOC C 3 13  ? 1.750   10.015  -41.540 1.00 5.26  ? 115  DOC P N4    1 
HETATM 8025 C  "C1'" . DOC C 3 13  ? 3.764   9.675   -46.743 1.00 6.38  ? 115  DOC P "C1'" 1 
HETATM 8026 C  "C2'" . DOC C 3 13  ? 2.652   9.670   -47.788 1.00 3.61  ? 115  DOC P "C2'" 1 
HETATM 8027 C  "C3'" . DOC C 3 13  ? 2.798   10.989  -48.511 1.00 3.69  ? 115  DOC P "C3'" 1 
HETATM 8028 C  "C4'" . DOC C 3 13  ? 4.258   11.332  -48.295 1.00 3.65  ? 115  DOC P "C4'" 1 
HETATM 8029 O  "O4'" . DOC C 3 13  ? 4.629   10.777  -47.035 1.00 6.24  ? 115  DOC P "O4'" 1 
HETATM 8030 C  "C5'" . DOC C 3 13  ? 4.469   12.829  -48.256 1.00 11.65 ? 115  DOC P "C5'" 1 
HETATM 8031 O  "O5'" . DOC C 3 13  ? 5.876   12.920  -48.353 1.00 9.15  ? 115  DOC P "O5'" 1 
HETATM 8032 P  P     . DOC C 3 13  ? 6.729   14.249  -48.118 1.00 9.17  ? 115  DOC P P     1 
HETATM 8033 O  OP1   . DOC C 3 13  ? 7.601   14.419  -49.341 1.00 8.55  ? 115  DOC P OP1   1 
HETATM 8034 O  OP2   . DOC C 3 13  ? 5.856   15.377  -47.640 1.00 8.07  ? 115  DOC P OP2   1 
HETATM 8035 P  PG    . DTP D 4 .   ? -4.210  14.854  -50.479 1.00 6.52  ? 904  DTP A PG    1 
HETATM 8036 O  O1G   . DTP D 4 .   ? -2.933  14.654  -51.261 1.00 4.65  ? 904  DTP A O1G   1 
HETATM 8037 O  O2G   . DTP D 4 .   ? -5.448  14.947  -51.329 1.00 2.00  ? 904  DTP A O2G   1 
HETATM 8038 O  O3G   . DTP D 4 .   ? -4.136  15.948  -49.443 1.00 5.11  ? 904  DTP A O3G   1 
HETATM 8039 P  PB    . DTP D 4 .   ? -3.652  12.148  -49.552 1.00 4.54  ? 904  DTP A PB    1 
HETATM 8040 O  O1B   . DTP D 4 .   ? -4.483  11.176  -48.747 1.00 4.97  ? 904  DTP A O1B   1 
HETATM 8041 O  O2B   . DTP D 4 .   ? -3.232  11.762  -50.946 1.00 3.00  ? 904  DTP A O2B   1 
HETATM 8042 O  O3B   . DTP D 4 .   ? -4.477  13.535  -49.578 1.00 4.69  ? 904  DTP A O3B   1 
HETATM 8043 P  PA    . DTP D 4 .   ? -0.815  12.387  -48.889 1.00 5.77  ? 904  DTP A PA    1 
HETATM 8044 O  O1A   . DTP D 4 .   ? -0.223  13.105  -47.706 1.00 4.59  ? 904  DTP A O1A   1 
HETATM 8045 O  O2A   . DTP D 4 .   ? -0.455  12.798  -50.293 1.00 4.86  ? 904  DTP A O2A   1 
HETATM 8046 O  O3A   . DTP D 4 .   ? -2.396  12.572  -48.637 1.00 6.10  ? 904  DTP A O3A   1 
HETATM 8047 O  "O5'" . DTP D 4 .   ? -0.500  10.828  -48.684 1.00 6.14  ? 904  DTP A "O5'" 1 
HETATM 8048 C  "C5'" . DTP D 4 .   ? -0.768  9.861   -49.701 1.00 4.33  ? 904  DTP A "C5'" 1 
HETATM 8049 C  "C4'" . DTP D 4 .   ? -1.222  8.569   -49.029 1.00 2.95  ? 904  DTP A "C4'" 1 
HETATM 8050 O  "O4'" . DTP D 4 .   ? -0.329  8.178   -47.975 1.00 5.59  ? 904  DTP A "O4'" 1 
HETATM 8051 C  "C3'" . DTP D 4 .   ? -2.564  8.708   -48.347 1.00 2.00  ? 904  DTP A "C3'" 1 
HETATM 8052 O  "O3'" . DTP D 4 .   ? -3.677  8.639   -49.252 1.00 4.13  ? 904  DTP A "O3'" 1 
HETATM 8053 C  "C2'" . DTP D 4 .   ? -2.517  7.565   -47.360 1.00 2.79  ? 904  DTP A "C2'" 1 
HETATM 8054 C  "C1'" . DTP D 4 .   ? -1.051  7.571   -46.907 1.00 3.35  ? 904  DTP A "C1'" 1 
HETATM 8055 N  N9    . DTP D 4 .   ? -0.981  8.447   -45.706 1.00 2.92  ? 904  DTP A N9    1 
HETATM 8056 C  C8    . DTP D 4 .   ? -0.493  9.705   -45.660 1.00 4.00  ? 904  DTP A C8    1 
HETATM 8057 N  N7    . DTP D 4 .   ? -0.611  10.231  -44.416 1.00 6.99  ? 904  DTP A N7    1 
HETATM 8058 C  C5    . DTP D 4 .   ? -1.208  9.307   -43.647 1.00 5.77  ? 904  DTP A C5    1 
HETATM 8059 C  C6    . DTP D 4 .   ? -1.628  9.219   -42.235 1.00 6.83  ? 904  DTP A C6    1 
HETATM 8060 N  N6    . DTP D 4 .   ? -1.417  10.268  -41.406 1.00 3.28  ? 904  DTP A N6    1 
HETATM 8061 N  N1    . DTP D 4 .   ? -2.220  8.067   -41.821 1.00 4.76  ? 904  DTP A N1    1 
HETATM 8062 C  C2    . DTP D 4 .   ? -2.429  7.025   -42.658 1.00 3.61  ? 904  DTP A C2    1 
HETATM 8063 N  N3    . DTP D 4 .   ? -2.063  7.039   -43.957 1.00 4.18  ? 904  DTP A N3    1 
HETATM 8064 C  C4    . DTP D 4 .   ? -1.462  8.133   -44.500 1.00 5.16  ? 904  DTP A C4    1 
HETATM 8065 CA CA    . CA  E 5 .   ? -1.746  12.982  -52.242 1.00 21.84 ? 905  CA  A CA    1 
HETATM 8066 CA CA    . CA  F 5 .   ? 1.744   13.166  -51.407 1.00 43.16 ? 906  CA  A CA    1 
HETATM 8067 CA CA    . CA  G 5 .   ? -3.822  50.673  -51.899 1.00 43.10 ? 907  CA  A CA    1 
HETATM 8068 CA CA    . CA  H 5 .   ? -2.049  26.341  -12.470 1.00 43.27 ? 908  CA  A CA    1 
HETATM 8069 O  O     . HOH I 6 .   ? -19.233 41.466  -21.292 1.00 43.95 ? 909  HOH A O     1 
HETATM 8070 O  O     . HOH I 6 .   ? -17.952 -9.729  -28.381 1.00 29.24 ? 910  HOH A O     1 
HETATM 8071 O  O     . HOH I 6 .   ? 14.571  3.889   -56.378 1.00 9.04  ? 911  HOH A O     1 
HETATM 8072 O  O     . HOH I 6 .   ? -29.343 -4.623  -30.689 1.00 15.59 ? 912  HOH A O     1 
HETATM 8073 O  O     . HOH I 6 .   ? -9.708  17.063  -51.856 1.00 9.32  ? 913  HOH A O     1 
HETATM 8074 O  O     . HOH I 6 .   ? -21.596 -9.974  -42.246 1.00 18.95 ? 914  HOH A O     1 
HETATM 8075 O  O     . HOH I 6 .   ? -7.095  11.071  -48.028 1.00 12.83 ? 915  HOH A O     1 
HETATM 8076 O  O     . HOH I 6 .   ? -18.758 5.004   -28.771 1.00 12.96 ? 916  HOH A O     1 
HETATM 8077 O  O     . HOH I 6 .   ? -14.864 24.250  -31.447 1.00 11.29 ? 917  HOH A O     1 
HETATM 8078 O  O     . HOH I 6 .   ? 1.233   2.630   -51.901 1.00 11.99 ? 918  HOH A O     1 
HETATM 8079 O  O     . HOH I 6 .   ? -19.454 7.865   -44.199 1.00 12.35 ? 919  HOH A O     1 
HETATM 8080 O  O     . HOH I 6 .   ? 17.130  11.682  -58.645 1.00 16.20 ? 920  HOH A O     1 
HETATM 8081 O  O     A HOH I 6 .   ? -11.177 -12.776 -64.471 0.50 2.00  ? 921  HOH A O     1 
HETATM 8082 O  O     B HOH I 6 .   ? -8.646  -13.309 -64.174 0.50 2.00  ? 921  HOH A O     1 
HETATM 8083 O  O     . HOH I 6 .   ? 3.376   3.914   -53.347 1.00 14.59 ? 922  HOH A O     1 
HETATM 8084 O  O     . HOH I 6 .   ? 25.566  34.198  -52.802 1.00 14.85 ? 923  HOH A O     1 
HETATM 8085 O  O     . HOH I 6 .   ? -14.218 -2.725  -35.732 1.00 21.00 ? 924  HOH A O     1 
HETATM 8086 O  O     . HOH I 6 .   ? -6.719  5.426   -63.239 1.00 14.20 ? 925  HOH A O     1 
HETATM 8087 O  O     . HOH I 6 .   ? 9.292   12.244  -49.128 1.00 11.43 ? 926  HOH A O     1 
HETATM 8088 O  O     . HOH I 6 .   ? 20.681  24.834  -58.852 1.00 11.97 ? 927  HOH A O     1 
HETATM 8089 O  O     . HOH I 6 .   ? 15.733  20.397  -61.425 1.00 13.24 ? 928  HOH A O     1 
HETATM 8090 O  O     . HOH I 6 .   ? -24.984 23.104  -33.917 1.00 23.23 ? 929  HOH A O     1 
HETATM 8091 O  O     . HOH I 6 .   ? -3.576  38.064  0.351   1.00 11.28 ? 930  HOH A O     1 
HETATM 8092 O  O     . HOH I 6 .   ? -21.410 7.406   -51.183 1.00 9.59  ? 931  HOH A O     1 
HETATM 8093 O  O     . HOH I 6 .   ? 20.873  14.870  -60.117 1.00 12.97 ? 932  HOH A O     1 
HETATM 8094 O  O     . HOH I 6 .   ? 0.927   28.467  -3.944  1.00 22.04 ? 933  HOH A O     1 
HETATM 8095 O  O     . HOH I 6 .   ? -35.189 -2.221  -26.047 1.00 27.05 ? 934  HOH A O     1 
HETATM 8096 O  O     . HOH I 6 .   ? -21.282 9.156   -24.233 1.00 13.38 ? 935  HOH A O     1 
HETATM 8097 O  O     . HOH I 6 .   ? -22.808 14.550  -11.915 1.00 20.76 ? 936  HOH A O     1 
HETATM 8098 O  O     . HOH I 6 .   ? -4.865  49.281  -50.126 1.00 19.61 ? 937  HOH A O     1 
HETATM 8099 O  O     A HOH I 6 .   ? -15.250 23.948  -51.543 0.50 5.59  ? 938  HOH A O     1 
HETATM 8100 O  O     B HOH I 6 .   ? -14.612 22.226  -53.027 0.50 21.07 ? 938  HOH A O     1 
HETATM 8101 O  O     . HOH I 6 .   ? -0.187  24.049  -62.862 1.00 16.85 ? 939  HOH A O     1 
HETATM 8102 O  O     . HOH I 6 .   ? -25.162 8.741   -20.297 1.00 13.39 ? 940  HOH A O     1 
HETATM 8103 O  O     . HOH I 6 .   ? -16.698 25.481  -22.601 1.00 14.40 ? 941  HOH A O     1 
HETATM 8104 O  O     . HOH I 6 .   ? -26.304 19.822  -22.373 1.00 12.93 ? 942  HOH A O     1 
HETATM 8105 O  O     . HOH I 6 .   ? 15.169  16.858  -73.006 1.00 17.28 ? 943  HOH A O     1 
HETATM 8106 O  O     . HOH I 6 .   ? -9.799  11.135  -56.677 1.00 11.81 ? 944  HOH A O     1 
HETATM 8107 O  O     . HOH I 6 .   ? 0.631   23.563  -18.333 1.00 15.70 ? 945  HOH A O     1 
HETATM 8108 O  O     . HOH I 6 .   ? -13.996 28.600  -27.449 1.00 15.39 ? 946  HOH A O     1 
HETATM 8109 O  O     . HOH I 6 .   ? -3.754  4.925   -44.951 1.00 11.02 ? 947  HOH A O     1 
HETATM 8110 O  O     . HOH I 6 .   ? 25.413  15.860  -54.302 1.00 20.37 ? 948  HOH A O     1 
HETATM 8111 O  O     . HOH I 6 .   ? -11.233 9.753   -52.783 1.00 15.75 ? 949  HOH A O     1 
HETATM 8112 O  O     . HOH I 6 .   ? -1.334  14.722  -3.279  1.00 16.27 ? 950  HOH A O     1 
HETATM 8113 O  O     . HOH I 6 .   ? 5.025   19.273  -53.512 1.00 17.87 ? 951  HOH A O     1 
HETATM 8114 O  O     . HOH I 6 .   ? -20.813 23.093  -16.341 1.00 12.63 ? 952  HOH A O     1 
HETATM 8115 O  O     . HOH I 6 .   ? -4.761  35.164  -22.717 1.00 27.92 ? 953  HOH A O     1 
HETATM 8116 O  O     . HOH I 6 .   ? -22.295 -19.734 -38.700 1.00 17.69 ? 954  HOH A O     1 
HETATM 8117 O  O     . HOH I 6 .   ? -9.239  12.882  -23.387 1.00 22.42 ? 955  HOH A O     1 
HETATM 8118 O  O     . HOH I 6 .   ? -23.435 6.705   -38.488 1.00 17.26 ? 956  HOH A O     1 
HETATM 8119 O  O     . HOH I 6 .   ? -18.434 15.063  -40.008 1.00 29.73 ? 957  HOH A O     1 
HETATM 8120 O  O     . HOH I 6 .   ? -6.040  17.541  -63.323 1.00 24.80 ? 958  HOH A O     1 
HETATM 8121 O  O     . HOH I 6 .   ? 1.810   1.745   -70.959 1.00 10.50 ? 959  HOH A O     1 
HETATM 8122 O  O     . HOH I 6 .   ? 5.069   33.690  -56.058 1.00 12.61 ? 960  HOH A O     1 
HETATM 8123 O  O     . HOH I 6 .   ? 12.804  9.052   -63.304 1.00 11.35 ? 961  HOH A O     1 
HETATM 8124 O  O     . HOH I 6 .   ? -11.902 1.172   -30.493 1.00 30.77 ? 962  HOH A O     1 
HETATM 8125 O  O     . HOH I 6 .   ? -6.644  30.508  -2.980  1.00 14.38 ? 963  HOH A O     1 
HETATM 8126 O  O     . HOH I 6 .   ? -8.888  34.597  -54.265 1.00 13.19 ? 964  HOH A O     1 
HETATM 8127 O  O     . HOH I 6 .   ? 1.342   3.033   -46.914 1.00 12.20 ? 965  HOH A O     1 
HETATM 8128 O  O     . HOH I 6 .   ? -26.222 19.911  -17.913 1.00 15.23 ? 966  HOH A O     1 
HETATM 8129 O  O     . HOH I 6 .   ? 6.075   14.036  -51.663 1.00 22.49 ? 967  HOH A O     1 
HETATM 8130 O  O     . HOH I 6 .   ? 9.457   30.430  -45.784 1.00 8.59  ? 968  HOH A O     1 
HETATM 8131 O  O     . HOH I 6 .   ? 15.497  24.518  -27.872 1.00 10.57 ? 969  HOH A O     1 
HETATM 8132 O  O     . HOH I 6 .   ? -3.796  24.605  -12.609 1.00 24.36 ? 970  HOH A O     1 
HETATM 8133 O  O     . HOH I 6 .   ? 3.936   6.134   -47.354 1.00 11.51 ? 971  HOH A O     1 
HETATM 8134 O  O     . HOH I 6 .   ? -12.767 -1.247  -30.933 1.00 28.49 ? 972  HOH A O     1 
HETATM 8135 O  O     . HOH I 6 .   ? 0.901   44.691  -21.276 1.00 38.65 ? 973  HOH A O     1 
HETATM 8136 O  O     . HOH I 6 .   ? 32.217  24.967  -24.220 1.00 13.34 ? 974  HOH A O     1 
HETATM 8137 O  O     . HOH I 6 .   ? -2.844  53.041  -52.177 1.00 26.51 ? 975  HOH A O     1 
HETATM 8138 O  O     . HOH I 6 .   ? -3.996  11.376  -43.225 1.00 18.16 ? 976  HOH A O     1 
HETATM 8139 O  O     . HOH I 6 .   ? -13.376 24.020  -38.499 1.00 11.87 ? 977  HOH A O     1 
HETATM 8140 O  O     . HOH I 6 .   ? -14.055 22.117  -36.791 1.00 12.13 ? 978  HOH A O     1 
HETATM 8141 O  O     . HOH I 6 .   ? 8.422   38.486  -60.586 1.00 14.82 ? 979  HOH A O     1 
HETATM 8142 O  O     . HOH I 6 .   ? -20.893 -9.877  -33.126 1.00 18.51 ? 980  HOH A O     1 
HETATM 8143 O  O     . HOH I 6 .   ? -27.149 26.864  -17.011 1.00 18.09 ? 981  HOH A O     1 
HETATM 8144 O  O     . HOH I 6 .   ? 5.425   18.770  -22.261 1.00 23.28 ? 982  HOH A O     1 
HETATM 8145 O  O     . HOH I 6 .   ? -2.253  15.513  -35.301 1.00 15.21 ? 983  HOH A O     1 
HETATM 8146 O  O     . HOH I 6 .   ? 15.113  32.223  -42.752 1.00 16.67 ? 984  HOH A O     1 
HETATM 8147 O  O     . HOH I 6 .   ? 14.510  18.898  -66.996 1.00 13.63 ? 985  HOH A O     1 
HETATM 8148 O  O     . HOH I 6 .   ? -26.943 -5.659  -30.635 1.00 16.41 ? 986  HOH A O     1 
HETATM 8149 O  O     . HOH I 6 .   ? 19.307  31.540  -34.804 1.00 18.33 ? 987  HOH A O     1 
HETATM 8150 O  O     . HOH I 6 .   ? -23.896 -18.486 -36.944 1.00 17.80 ? 988  HOH A O     1 
HETATM 8151 O  O     . HOH I 6 .   ? 20.526  7.717   -27.392 1.00 17.85 ? 989  HOH A O     1 
HETATM 8152 O  O     . HOH I 6 .   ? 0.659   44.185  -7.739  1.00 15.12 ? 990  HOH A O     1 
HETATM 8153 O  O     A HOH I 6 .   ? -21.116 38.344  -24.968 0.50 24.75 ? 991  HOH A O     1 
HETATM 8154 O  O     B HOH I 6 .   ? -19.267 38.030  -25.705 0.50 14.98 ? 991  HOH A O     1 
HETATM 8155 O  O     . HOH I 6 .   ? 0.778   18.096  -31.125 1.00 16.85 ? 992  HOH A O     1 
HETATM 8156 O  O     . HOH I 6 .   ? -14.426 -10.383 -46.778 1.00 17.98 ? 993  HOH A O     1 
HETATM 8157 O  O     . HOH I 6 .   ? -0.371  7.211   -72.000 1.00 15.32 ? 994  HOH A O     1 
HETATM 8158 O  O     . HOH I 6 .   ? -4.833  27.479  -53.986 1.00 13.19 ? 995  HOH A O     1 
HETATM 8159 O  O     . HOH I 6 .   ? -2.248  33.064  -47.811 1.00 17.64 ? 996  HOH A O     1 
HETATM 8160 O  O     . HOH I 6 .   ? 19.615  9.486   -11.091 1.00 15.85 ? 997  HOH A O     1 
HETATM 8161 O  O     . HOH I 6 .   ? -15.259 20.283  -38.552 1.00 14.51 ? 998  HOH A O     1 
HETATM 8162 O  O     . HOH I 6 .   ? 15.294  31.705  -61.993 1.00 14.81 ? 999  HOH A O     1 
HETATM 8163 O  O     . HOH I 6 .   ? -12.124 -5.977  -45.547 1.00 12.92 ? 1000 HOH A O     1 
HETATM 8164 O  O     . HOH I 6 .   ? -4.416  12.162  -63.248 1.00 17.88 ? 1001 HOH A O     1 
HETATM 8165 O  O     . HOH I 6 .   ? -19.750 9.004   -21.863 1.00 13.71 ? 1002 HOH A O     1 
HETATM 8166 O  O     . HOH I 6 .   ? 27.511  33.054  -54.432 1.00 14.73 ? 1003 HOH A O     1 
HETATM 8167 O  O     . HOH I 6 .   ? -12.689 -8.765  -45.610 1.00 14.20 ? 1004 HOH A O     1 
HETATM 8168 O  O     . HOH I 6 .   ? -7.644  -6.270  -65.434 1.00 12.29 ? 1005 HOH A O     1 
HETATM 8169 O  O     . HOH I 6 .   ? 20.323  19.173  -60.804 1.00 15.15 ? 1006 HOH A O     1 
HETATM 8170 O  O     . HOH I 6 .   ? 17.841  36.499  -54.316 1.00 17.28 ? 1007 HOH A O     1 
HETATM 8171 O  O     . HOH I 6 .   ? -16.241 37.325  -53.731 1.00 25.75 ? 1008 HOH A O     1 
HETATM 8172 O  O     . HOH I 6 .   ? -27.749 18.168  -13.884 1.00 17.85 ? 1009 HOH A O     1 
HETATM 8173 O  O     . HOH I 6 .   ? -30.640 -5.004  -21.050 1.00 20.63 ? 1010 HOH A O     1 
HETATM 8174 O  O     . HOH I 6 .   ? -4.371  12.411  -28.799 1.00 18.16 ? 1011 HOH A O     1 
HETATM 8175 O  O     . HOH I 6 .   ? -35.210 -13.500 -38.068 1.00 15.83 ? 1012 HOH A O     1 
HETATM 8176 O  O     . HOH I 6 .   ? 2.432   -7.407  -58.555 1.00 21.33 ? 1013 HOH A O     1 
HETATM 8177 O  O     . HOH I 6 .   ? -8.440  -15.100 -62.154 1.00 18.14 ? 1014 HOH A O     1 
HETATM 8178 O  O     . HOH I 6 .   ? -4.113  49.591  -16.062 1.00 20.80 ? 1015 HOH A O     1 
HETATM 8179 O  O     . HOH I 6 .   ? -17.253 26.146  -43.515 1.00 14.81 ? 1016 HOH A O     1 
HETATM 8180 O  O     . HOH I 6 .   ? -19.492 10.056  0.908   1.00 14.92 ? 1017 HOH A O     1 
HETATM 8181 O  O     . HOH I 6 .   ? 8.862   3.831   -63.029 1.00 20.67 ? 1018 HOH A O     1 
HETATM 8182 O  O     . HOH I 6 .   ? 1.532   29.383  -1.358  1.00 16.11 ? 1019 HOH A O     1 
HETATM 8183 O  O     . HOH I 6 .   ? 4.019   12.486  -51.351 1.00 22.96 ? 1020 HOH A O     1 
HETATM 8184 O  O     . HOH I 6 .   ? -4.301  34.888  -54.561 1.00 12.93 ? 1021 HOH A O     1 
HETATM 8185 O  O     . HOH I 6 .   ? -6.028  23.462  -37.797 1.00 11.48 ? 1022 HOH A O     1 
HETATM 8186 O  O     . HOH I 6 .   ? -22.783 25.300  -25.572 1.00 14.66 ? 1023 HOH A O     1 
HETATM 8187 O  O     . HOH I 6 .   ? -21.146 11.482  -25.752 1.00 13.82 ? 1024 HOH A O     1 
HETATM 8188 O  O     . HOH I 6 .   ? 3.552   4.131   -72.542 1.00 13.50 ? 1025 HOH A O     1 
HETATM 8189 O  O     . HOH I 6 .   ? 12.773  22.271  -30.682 1.00 9.18  ? 1026 HOH A O     1 
HETATM 8190 O  O     . HOH I 6 .   ? -32.356 -4.003  -39.459 1.00 18.83 ? 1027 HOH A O     1 
HETATM 8191 O  O     . HOH I 6 .   ? 13.443  2.761   -53.570 1.00 22.64 ? 1028 HOH A O     1 
HETATM 8192 O  O     . HOH I 6 .   ? 5.662   28.468  -27.846 1.00 23.52 ? 1029 HOH A O     1 
HETATM 8193 O  O     . HOH I 6 .   ? 5.948   32.428  -5.773  1.00 21.23 ? 1030 HOH A O     1 
HETATM 8194 O  O     . HOH I 6 .   ? -17.103 7.043   -56.100 1.00 17.50 ? 1031 HOH A O     1 
HETATM 8195 O  O     . HOH I 6 .   ? -5.048  -13.077 -65.076 1.00 16.42 ? 1032 HOH A O     1 
HETATM 8196 O  O     . HOH I 6 .   ? -24.778 14.097  -38.171 1.00 19.23 ? 1033 HOH A O     1 
HETATM 8197 O  O     . HOH I 6 .   ? 20.016  19.436  -35.275 1.00 17.84 ? 1034 HOH A O     1 
HETATM 8198 O  O     . HOH I 6 .   ? -22.761 0.260   -49.921 1.00 25.05 ? 1035 HOH A O     1 
HETATM 8199 O  O     . HOH I 6 .   ? -13.181 40.955  -6.726  1.00 24.34 ? 1036 HOH A O     1 
HETATM 8200 O  O     . HOH I 6 .   ? 0.806   17.543  -75.492 1.00 16.14 ? 1037 HOH A O     1 
HETATM 8201 O  O     . HOH I 6 .   ? -19.453 -2.465  -38.377 1.00 14.23 ? 1038 HOH A O     1 
HETATM 8202 O  O     . HOH I 6 .   ? 13.872  23.828  -57.176 1.00 21.38 ? 1039 HOH A O     1 
HETATM 8203 O  O     . HOH I 6 .   ? 1.134   19.124  -20.659 1.00 34.35 ? 1040 HOH A O     1 
HETATM 8204 O  O     . HOH I 6 .   ? -5.090  20.830  -37.994 1.00 13.63 ? 1041 HOH A O     1 
HETATM 8205 O  O     . HOH I 6 .   ? -11.925 9.001   -35.317 1.00 15.92 ? 1042 HOH A O     1 
HETATM 8206 O  O     . HOH I 6 .   ? 13.782  8.452   -69.438 1.00 18.82 ? 1043 HOH A O     1 
HETATM 8207 O  O     . HOH I 6 .   ? -14.633 25.090  -43.126 1.00 18.56 ? 1044 HOH A O     1 
HETATM 8208 O  O     . HOH I 6 .   ? 2.633   -2.487  -51.348 1.00 16.65 ? 1045 HOH A O     1 
HETATM 8209 O  O     . HOH I 6 .   ? -1.305  25.826  -51.096 1.00 17.18 ? 1046 HOH A O     1 
HETATM 8210 O  O     . HOH I 6 .   ? -22.491 15.543  -37.508 1.00 17.88 ? 1047 HOH A O     1 
HETATM 8211 O  O     . HOH I 6 .   ? 15.711  21.497  -73.441 1.00 14.30 ? 1048 HOH A O     1 
HETATM 8212 O  O     . HOH I 6 .   ? -9.502  11.163  -15.193 1.00 20.41 ? 1049 HOH A O     1 
HETATM 8213 O  O     . HOH I 6 .   ? 5.477   16.331  -23.194 1.00 22.32 ? 1050 HOH A O     1 
HETATM 8214 O  O     . HOH I 6 .   ? -10.063 36.209  -56.403 1.00 15.48 ? 1051 HOH A O     1 
HETATM 8215 O  O     . HOH I 6 .   ? -16.285 2.406   -55.836 1.00 15.92 ? 1052 HOH A O     1 
HETATM 8216 O  O     . HOH I 6 .   ? 11.057  6.034   -66.944 1.00 15.94 ? 1053 HOH A O     1 
HETATM 8217 O  O     . HOH I 6 .   ? -0.952  10.406  -8.866  1.00 22.76 ? 1054 HOH A O     1 
HETATM 8218 O  O     . HOH I 6 .   ? 9.448   3.939   -71.027 1.00 14.78 ? 1055 HOH A O     1 
HETATM 8219 O  O     . HOH I 6 .   ? -3.903  18.867  -46.540 1.00 30.36 ? 1056 HOH A O     1 
HETATM 8220 O  O     . HOH I 6 .   ? 3.388   35.594  -49.180 1.00 17.32 ? 1057 HOH A O     1 
HETATM 8221 O  O     . HOH I 6 .   ? 21.596  31.286  -21.261 1.00 13.22 ? 1058 HOH A O     1 
HETATM 8222 O  O     . HOH I 6 .   ? -2.690  22.936  -61.958 1.00 22.99 ? 1059 HOH A O     1 
HETATM 8223 O  O     . HOH I 6 .   ? 18.829  21.212  -61.588 1.00 17.02 ? 1060 HOH A O     1 
HETATM 8224 O  O     . HOH I 6 .   ? 29.699  26.472  -20.713 1.00 28.15 ? 1061 HOH A O     1 
HETATM 8225 O  O     . HOH I 6 .   ? -9.886  12.374  -37.677 1.00 13.31 ? 1062 HOH A O     1 
HETATM 8226 O  O     . HOH I 6 .   ? -5.275  33.063  -45.333 1.00 17.93 ? 1063 HOH A O     1 
HETATM 8227 O  O     . HOH I 6 .   ? 8.869   -6.171  -59.624 1.00 21.33 ? 1064 HOH A O     1 
HETATM 8228 O  O     . HOH I 6 .   ? -24.363 3.691   -33.652 1.00 16.37 ? 1065 HOH A O     1 
HETATM 8229 O  O     . HOH I 6 .   ? -7.477  13.251  -36.928 1.00 13.32 ? 1066 HOH A O     1 
HETATM 8230 O  O     . HOH I 6 .   ? -6.271  10.380  -57.016 1.00 15.55 ? 1067 HOH A O     1 
HETATM 8231 O  O     . HOH I 6 .   ? -29.101 14.921  -18.427 1.00 20.67 ? 1068 HOH A O     1 
HETATM 8232 O  O     . HOH I 6 .   ? -27.211 2.399   -46.183 1.00 23.38 ? 1069 HOH A O     1 
HETATM 8233 O  O     . HOH I 6 .   ? 3.140   9.573   -71.506 1.00 13.27 ? 1070 HOH A O     1 
HETATM 8234 O  O     . HOH I 6 .   ? 13.054  12.585  -42.948 1.00 17.84 ? 1071 HOH A O     1 
HETATM 8235 O  O     . HOH I 6 .   ? 12.857  23.579  -28.207 1.00 12.20 ? 1072 HOH A O     1 
HETATM 8236 O  O     . HOH I 6 .   ? -6.647  34.710  -55.866 1.00 15.25 ? 1073 HOH A O     1 
HETATM 8237 O  O     . HOH I 6 .   ? -8.774  32.671  -30.526 1.00 17.90 ? 1074 HOH A O     1 
HETATM 8238 O  O     . HOH I 6 .   ? -28.687 21.552  -19.818 1.00 18.33 ? 1075 HOH A O     1 
HETATM 8239 O  O     . HOH I 6 .   ? 0.006   12.909  -44.868 1.00 24.63 ? 1076 HOH A O     1 
HETATM 8240 O  O     . HOH I 6 .   ? 22.105  35.841  -55.561 1.00 15.41 ? 1077 HOH A O     1 
HETATM 8241 O  O     . HOH I 6 .   ? 21.515  23.161  -60.858 1.00 14.85 ? 1078 HOH A O     1 
HETATM 8242 O  O     . HOH I 6 .   ? -18.823 2.627   -27.585 1.00 26.79 ? 1079 HOH A O     1 
HETATM 8243 O  O     . HOH I 6 .   ? -2.848  20.989  -39.622 1.00 18.92 ? 1080 HOH A O     1 
HETATM 8244 O  O     . HOH I 6 .   ? -14.200 30.323  -54.421 1.00 19.46 ? 1081 HOH A O     1 
HETATM 8245 O  O     . HOH I 6 .   ? -15.261 24.772  -40.448 1.00 16.59 ? 1082 HOH A O     1 
HETATM 8246 O  O     . HOH I 6 .   ? -1.339  41.894  -9.436  1.00 19.39 ? 1083 HOH A O     1 
HETATM 8247 O  O     . HOH I 6 .   ? -20.729 2.456   -20.744 1.00 21.14 ? 1084 HOH A O     1 
HETATM 8248 O  O     . HOH I 6 .   ? -4.688  12.090  -21.571 1.00 42.93 ? 1085 HOH A O     1 
HETATM 8249 O  O     . HOH I 6 .   ? -21.202 -15.850 -44.518 1.00 27.28 ? 1086 HOH A O     1 
HETATM 8250 O  O     . HOH I 6 .   ? 16.902  16.975  -34.446 1.00 15.09 ? 1087 HOH A O     1 
HETATM 8251 O  O     . HOH I 6 .   ? 12.946  13.770  -11.944 1.00 20.11 ? 1088 HOH A O     1 
HETATM 8252 O  O     . HOH I 6 .   ? -16.995 4.816   -54.544 1.00 25.59 ? 1089 HOH A O     1 
HETATM 8253 O  O     . HOH I 6 .   ? -11.540 -15.368 -33.002 1.00 27.86 ? 1090 HOH A O     1 
HETATM 8254 O  O     . HOH I 6 .   ? 19.750  9.218   -52.107 1.00 16.61 ? 1091 HOH A O     1 
HETATM 8255 O  O     . HOH I 6 .   ? -18.344 -9.053  -32.622 1.00 18.60 ? 1092 HOH A O     1 
HETATM 8256 O  O     . HOH I 6 .   ? -14.550 26.035  -26.671 1.00 27.85 ? 1093 HOH A O     1 
HETATM 8257 O  O     . HOH I 6 .   ? 7.732   18.424  -20.919 1.00 27.21 ? 1094 HOH A O     1 
HETATM 8258 O  O     . HOH I 6 .   ? 15.385  12.701  -41.910 1.00 30.98 ? 1095 HOH A O     1 
HETATM 8259 O  O     . HOH I 6 .   ? 40.475  30.431  -51.185 1.00 19.98 ? 1096 HOH A O     1 
HETATM 8260 O  O     . HOH I 6 .   ? -1.187  -5.024  -38.258 1.00 25.12 ? 1097 HOH A O     1 
HETATM 8261 O  O     . HOH I 6 .   ? 15.122  31.555  -39.977 1.00 14.92 ? 1098 HOH A O     1 
HETATM 8262 O  O     . HOH I 6 .   ? 6.489   -8.165  -57.396 1.00 26.90 ? 1099 HOH A O     1 
HETATM 8263 O  O     . HOH I 6 .   ? -6.495  17.110  -52.394 1.00 25.15 ? 1100 HOH A O     1 
HETATM 8264 O  O     . HOH I 6 .   ? 23.546  39.652  -44.609 1.00 18.99 ? 1101 HOH A O     1 
HETATM 8265 O  O     . HOH I 6 .   ? 8.721   0.252   -50.406 1.00 19.53 ? 1102 HOH A O     1 
HETATM 8266 O  O     . HOH I 6 .   ? -3.737  25.727  0.016   1.00 17.72 ? 1103 HOH A O     1 
HETATM 8267 O  O     . HOH I 6 .   ? 22.951  20.982  -61.219 1.00 25.49 ? 1104 HOH A O     1 
HETATM 8268 O  O     . HOH I 6 .   ? -17.143 -1.643  -31.955 1.00 27.29 ? 1105 HOH A O     1 
HETATM 8269 O  O     . HOH I 6 .   ? -18.252 -17.359 -32.252 1.00 21.28 ? 1106 HOH A O     1 
HETATM 8270 O  O     . HOH I 6 .   ? -2.801  34.249  -45.614 1.00 27.22 ? 1107 HOH A O     1 
HETATM 8271 O  O     . HOH I 6 .   ? -1.442  -7.411  -39.331 1.00 11.29 ? 1108 HOH A O     1 
HETATM 8272 O  O     . HOH I 6 .   ? -13.519 27.586  -43.347 1.00 18.76 ? 1109 HOH A O     1 
HETATM 8273 O  O     . HOH I 6 .   ? -3.732  26.015  -44.245 1.00 18.06 ? 1110 HOH A O     1 
HETATM 8274 O  O     . HOH I 6 .   ? -4.444  13.995  -42.351 1.00 13.46 ? 1111 HOH A O     1 
HETATM 8275 O  O     . HOH I 6 .   ? -18.879 6.188   0.726   1.00 15.94 ? 1112 HOH A O     1 
HETATM 8276 O  O     . HOH I 6 .   ? 20.171  37.461  -54.848 1.00 22.51 ? 1113 HOH A O     1 
HETATM 8277 O  O     . HOH I 6 .   ? -32.660 -13.516 -23.333 1.00 17.50 ? 1114 HOH A O     1 
HETATM 8278 O  O     . HOH I 6 .   ? -26.275 -9.115  -47.963 1.00 24.51 ? 1115 HOH A O     1 
HETATM 8279 O  O     . HOH I 6 .   ? -3.245  48.206  -52.185 1.00 23.23 ? 1116 HOH A O     1 
HETATM 8280 O  O     . HOH I 6 .   ? -14.315 10.748  5.866   1.00 30.83 ? 1117 HOH A O     1 
HETATM 8281 O  O     . HOH I 6 .   ? -18.398 41.446  -54.702 1.00 14.92 ? 1118 HOH A O     1 
HETATM 8282 O  O     . HOH I 6 .   ? -5.687  19.931  -15.205 1.00 20.26 ? 1119 HOH A O     1 
HETATM 8283 O  O     . HOH I 6 .   ? 7.530   19.019  -38.924 1.00 25.15 ? 1120 HOH A O     1 
HETATM 8284 O  O     . HOH I 6 .   ? -18.254 37.303  -49.930 1.00 20.54 ? 1121 HOH A O     1 
HETATM 8285 O  O     . HOH I 6 .   ? 31.751  23.731  -46.329 1.00 24.52 ? 1122 HOH A O     1 
HETATM 8286 O  O     . HOH I 6 .   ? -19.301 3.274   -9.324  1.00 17.46 ? 1123 HOH A O     1 
HETATM 8287 O  O     . HOH I 6 .   ? 5.269   38.648  -64.902 1.00 27.47 ? 1124 HOH A O     1 
HETATM 8288 O  O     . HOH I 6 .   ? -15.184 6.196   0.915   1.00 24.10 ? 1125 HOH A O     1 
HETATM 8289 O  O     . HOH I 6 .   ? -18.423 45.719  -61.352 1.00 46.19 ? 1126 HOH A O     1 
HETATM 8290 O  O     . HOH I 6 .   ? -37.563 10.759  -26.862 1.00 20.82 ? 1127 HOH A O     1 
HETATM 8291 O  O     . HOH I 6 .   ? -14.397 28.401  -52.392 1.00 16.13 ? 1128 HOH A O     1 
HETATM 8292 O  O     . HOH I 6 .   ? -9.673  9.796   -36.882 1.00 15.38 ? 1129 HOH A O     1 
HETATM 8293 O  O     . HOH I 6 .   ? 24.773  4.670   -22.424 1.00 18.10 ? 1130 HOH A O     1 
HETATM 8294 O  O     . HOH I 6 .   ? -4.091  44.229  -21.944 1.00 37.81 ? 1131 HOH A O     1 
HETATM 8295 O  O     . HOH I 6 .   ? 3.949   7.707   -73.280 1.00 21.44 ? 1132 HOH A O     1 
HETATM 8296 O  O     . HOH I 6 .   ? -1.027  -10.633 -64.822 1.00 19.06 ? 1133 HOH A O     1 
HETATM 8297 O  O     . HOH I 6 .   ? -0.786  16.172  -50.333 1.00 26.29 ? 1134 HOH A O     1 
HETATM 8298 O  O     . HOH I 6 .   ? 0.429   9.495   -71.005 1.00 17.00 ? 1135 HOH A O     1 
HETATM 8299 O  O     . HOH I 6 .   ? 16.212  18.918  -74.255 1.00 17.54 ? 1136 HOH A O     1 
HETATM 8300 O  O     . HOH I 6 .   ? -19.647 -12.194 -24.567 1.00 32.07 ? 1137 HOH A O     1 
HETATM 8301 O  O     . HOH I 6 .   ? -3.179  23.377  -0.921  1.00 14.70 ? 1138 HOH A O     1 
HETATM 8302 O  O     . HOH I 6 .   ? -13.116 -8.798  -42.948 1.00 23.75 ? 1139 HOH A O     1 
HETATM 8303 O  O     . HOH I 6 .   ? -17.716 3.838   -58.355 1.00 30.67 ? 1140 HOH A O     1 
HETATM 8304 O  O     . HOH I 6 .   ? -16.908 26.138  -25.333 1.00 24.44 ? 1141 HOH A O     1 
HETATM 8305 O  O     . HOH I 6 .   ? 18.725  18.007  -73.732 1.00 19.57 ? 1142 HOH A O     1 
HETATM 8306 O  O     . HOH I 6 .   ? 12.493  38.799  -61.338 1.00 23.18 ? 1143 HOH A O     1 
HETATM 8307 O  O     . HOH I 6 .   ? -5.818  -11.097 -43.571 1.00 15.83 ? 1144 HOH A O     1 
HETATM 8308 O  O     . HOH I 6 .   ? -21.676 10.146  -51.588 1.00 29.83 ? 1145 HOH A O     1 
HETATM 8309 O  O     . HOH I 6 .   ? -2.258  -5.764  -31.113 1.00 31.66 ? 1146 HOH A O     1 
HETATM 8310 O  O     . HOH I 6 .   ? -11.059 26.563  -53.530 1.00 23.66 ? 1147 HOH A O     1 
HETATM 8311 O  O     . HOH I 6 .   ? -5.514  6.868   -72.013 1.00 18.34 ? 1148 HOH A O     1 
HETATM 8312 O  O     . HOH I 6 .   ? 28.884  35.082  -55.196 1.00 29.89 ? 1149 HOH A O     1 
HETATM 8313 O  O     . HOH I 6 .   ? -18.656 24.056  -31.649 1.00 52.11 ? 1150 HOH A O     1 
HETATM 8314 O  O     . HOH I 6 .   ? -22.740 14.502  -0.493  1.00 21.23 ? 1151 HOH A O     1 
HETATM 8315 O  O     . HOH I 6 .   ? 17.369  18.022  -65.233 1.00 23.46 ? 1152 HOH A O     1 
HETATM 8316 O  O     . HOH I 6 .   ? -2.437  39.100  -3.019  1.00 18.20 ? 1153 HOH A O     1 
HETATM 8317 O  O     . HOH I 6 .   ? -5.592  -13.548 -39.446 1.00 35.86 ? 1154 HOH A O     1 
HETATM 8318 O  O     . HOH I 6 .   ? -6.399  8.552   -32.921 1.00 20.36 ? 1155 HOH A O     1 
HETATM 8319 O  O     . HOH I 6 .   ? -7.761  7.794   -0.875  1.00 31.85 ? 1156 HOH A O     1 
HETATM 8320 O  O     . HOH I 6 .   ? -27.607 -1.028  -13.883 1.00 27.36 ? 1157 HOH A O     1 
HETATM 8321 O  O     . HOH I 6 .   ? -10.334 29.880  -36.878 1.00 17.71 ? 1158 HOH A O     1 
HETATM 8322 O  O     . HOH I 6 .   ? 9.894   -1.220  -57.222 1.00 39.97 ? 1159 HOH A O     1 
HETATM 8323 O  O     . HOH I 6 .   ? 24.989  19.970  -59.378 1.00 20.13 ? 1160 HOH A O     1 
HETATM 8324 O  O     . HOH I 6 .   ? -1.782  -4.278  -33.243 1.00 23.69 ? 1161 HOH A O     1 
HETATM 8325 O  O     . HOH I 6 .   ? 21.360  9.929   -49.844 1.00 19.07 ? 1162 HOH A O     1 
HETATM 8326 O  O     . HOH I 6 .   ? 12.136  37.401  -57.961 1.00 22.19 ? 1163 HOH A O     1 
HETATM 8327 O  O     . HOH I 6 .   ? -0.584  29.833  -20.042 1.00 35.22 ? 1164 HOH A O     1 
HETATM 8328 O  O     . HOH I 6 .   ? 43.299  26.713  -55.996 1.00 14.98 ? 1165 HOH A O     1 
HETATM 8329 O  O     . HOH I 6 .   ? -0.997  36.805  -1.140  1.00 14.51 ? 1166 HOH A O     1 
HETATM 8330 O  O     . HOH I 6 .   ? 10.521  4.031   -65.346 1.00 22.45 ? 1167 HOH A O     1 
HETATM 8331 O  O     . HOH I 6 .   ? 14.278  21.825  -13.598 1.00 15.56 ? 1168 HOH A O     1 
HETATM 8332 O  O     . HOH I 6 .   ? 3.889   48.141  -12.146 1.00 20.98 ? 1169 HOH A O     1 
HETATM 8333 O  O     . HOH I 6 .   ? -20.644 13.692  -48.313 1.00 25.22 ? 1170 HOH A O     1 
HETATM 8334 O  O     . HOH I 6 .   ? 9.905   22.886  -36.976 1.00 20.46 ? 1171 HOH A O     1 
HETATM 8335 O  O     . HOH I 6 .   ? -6.297  25.715  -17.951 1.00 31.63 ? 1172 HOH A O     1 
HETATM 8336 O  O     A HOH I 6 .   ? -11.974 21.165  -53.544 0.50 15.06 ? 1173 HOH A O     1 
HETATM 8337 O  O     B HOH I 6 .   ? -10.963 20.354  -52.375 0.50 13.80 ? 1173 HOH A O     1 
HETATM 8338 O  O     . HOH I 6 .   ? -2.320  37.400  -54.694 1.00 37.10 ? 1174 HOH A O     1 
HETATM 8339 O  O     . HOH I 6 .   ? -13.883 -12.883 -47.751 1.00 24.98 ? 1175 HOH A O     1 
HETATM 8340 O  O     . HOH I 6 .   ? 12.124  8.403   -73.753 1.00 19.69 ? 1176 HOH A O     1 
HETATM 8341 O  O     . HOH I 6 .   ? -2.366  -12.982 -64.464 1.00 13.08 ? 1177 HOH A O     1 
HETATM 8342 O  O     . HOH I 6 .   ? 1.797   26.610  -18.680 1.00 27.54 ? 1178 HOH A O     1 
HETATM 8343 O  O     . HOH I 6 .   ? 18.314  28.935  -70.939 1.00 26.24 ? 1179 HOH A O     1 
HETATM 8344 O  O     . HOH I 6 .   ? -4.629  -0.916  -32.025 1.00 33.56 ? 1180 HOH A O     1 
HETATM 8345 O  O     . HOH I 6 .   ? 13.653  6.539   -67.334 1.00 30.59 ? 1181 HOH A O     1 
HETATM 8346 O  O     . HOH I 6 .   ? -4.829  -15.488 -63.400 1.00 16.75 ? 1182 HOH A O     1 
HETATM 8347 O  O     A HOH I 6 .   ? -12.495 34.636  -39.641 0.50 16.93 ? 1183 HOH A O     1 
HETATM 8348 O  O     B HOH I 6 .   ? -13.251 32.869  -38.599 0.50 20.74 ? 1183 HOH A O     1 
HETATM 8349 O  O     . HOH I 6 .   ? -15.208 47.671  -56.501 1.00 26.91 ? 1184 HOH A O     1 
HETATM 8350 O  O     . HOH I 6 .   ? -1.965  0.441   -44.902 1.00 21.54 ? 1185 HOH A O     1 
HETATM 8351 O  O     . HOH I 6 .   ? -4.698  -14.589 -33.386 1.00 35.36 ? 1186 HOH A O     1 
HETATM 8352 O  O     . HOH I 6 .   ? -3.561  33.231  -34.145 1.00 39.01 ? 1187 HOH A O     1 
HETATM 8353 O  O     . HOH I 6 .   ? -38.315 -6.320  -31.690 1.00 27.65 ? 1188 HOH A O     1 
HETATM 8354 O  O     . HOH I 6 .   ? -1.792  31.089  -45.767 1.00 25.90 ? 1189 HOH A O     1 
HETATM 8355 O  O     . HOH I 6 .   ? 21.440  15.451  -40.488 1.00 25.57 ? 1190 HOH A O     1 
HETATM 8356 O  O     . HOH I 6 .   ? 30.704  39.994  -37.524 1.00 34.14 ? 1191 HOH A O     1 
HETATM 8357 O  O     . HOH I 6 .   ? 4.889   25.720  -50.149 1.00 30.85 ? 1192 HOH A O     1 
HETATM 8358 O  O     . HOH I 6 .   ? 11.440  7.952   -70.923 1.00 17.38 ? 1193 HOH A O     1 
HETATM 8359 O  O     . HOH I 6 .   ? -24.237 -19.359 -43.488 1.00 42.45 ? 1194 HOH A O     1 
HETATM 8360 O  O     . HOH I 6 .   ? -4.120  25.251  -39.029 1.00 12.32 ? 1195 HOH A O     1 
HETATM 8361 O  O     . HOH I 6 .   ? -14.914 29.174  -41.614 1.00 17.30 ? 1196 HOH A O     1 
HETATM 8362 O  O     . HOH I 6 .   ? -2.857  26.699  -37.133 1.00 22.44 ? 1197 HOH A O     1 
HETATM 8363 O  O     . HOH I 6 .   ? 31.495  30.798  -43.752 1.00 18.72 ? 1198 HOH A O     1 
HETATM 8364 O  O     . HOH I 6 .   ? 13.826  28.967  -27.195 1.00 22.01 ? 1199 HOH A O     1 
HETATM 8365 O  O     . HOH I 6 .   ? -20.318 18.768  -41.078 1.00 35.48 ? 1200 HOH A O     1 
HETATM 8366 O  O     . HOH I 6 .   ? 12.721  28.050  -37.543 1.00 20.98 ? 1201 HOH A O     1 
HETATM 8367 O  O     . HOH I 6 .   ? -11.743 14.980  -56.628 1.00 19.03 ? 1202 HOH A O     1 
HETATM 8368 O  O     . HOH I 6 .   ? -11.432 2.544   -66.903 1.00 37.11 ? 1203 HOH A O     1 
HETATM 8369 O  O     . HOH I 6 .   ? -3.210  32.884  -55.750 1.00 24.57 ? 1204 HOH A O     1 
HETATM 8370 O  O     . HOH I 6 .   ? -0.813  16.833  -73.272 1.00 22.30 ? 1205 HOH A O     1 
HETATM 8371 O  O     . HOH I 6 .   ? -23.485 7.152   -43.111 1.00 39.40 ? 1206 HOH A O     1 
HETATM 8372 O  O     . HOH I 6 .   ? -0.763  41.615  -6.939  1.00 23.46 ? 1207 HOH A O     1 
HETATM 8373 O  O     . HOH I 6 .   ? -1.572  24.925  -8.439  1.00 35.01 ? 1208 HOH A O     1 
HETATM 8374 O  O     . HOH I 6 .   ? -20.521 22.316  -33.415 1.00 21.98 ? 1209 HOH A O     1 
HETATM 8375 O  O     . HOH I 6 .   ? -26.050 5.293   -41.963 1.00 26.07 ? 1210 HOH A O     1 
HETATM 8376 O  O     . HOH I 6 .   ? 9.414   21.158  -34.938 1.00 31.08 ? 1211 HOH A O     1 
HETATM 8377 O  O     . HOH I 6 .   ? -9.575  6.871   -6.579  1.00 19.23 ? 1212 HOH A O     1 
HETATM 8378 O  O     . HOH I 6 .   ? 20.322  30.817  -59.893 1.00 25.36 ? 1213 HOH A O     1 
HETATM 8379 O  O     . HOH I 6 .   ? -10.637 4.890   -15.869 1.00 33.06 ? 1214 HOH A O     1 
HETATM 8380 O  O     . HOH I 6 .   ? -19.846 -19.923 -38.094 1.00 20.64 ? 1215 HOH A O     1 
HETATM 8381 O  O     . HOH I 6 .   ? -26.192 19.143  -36.932 1.00 30.84 ? 1216 HOH A O     1 
HETATM 8382 O  O     . HOH I 6 .   ? -8.366  44.060  -18.632 1.00 23.61 ? 1217 HOH A O     1 
HETATM 8383 O  O     . HOH I 6 .   ? 2.160   24.186  -5.339  1.00 22.72 ? 1218 HOH A O     1 
HETATM 8384 O  O     . HOH I 6 .   ? 18.603  32.349  -37.387 1.00 22.16 ? 1219 HOH A O     1 
HETATM 8385 O  O     . HOH I 6 .   ? 21.084  38.215  -47.681 1.00 24.87 ? 1220 HOH A O     1 
HETATM 8386 O  O     . HOH I 6 .   ? 1.292   14.322  -3.276  1.00 25.06 ? 1221 HOH A O     1 
HETATM 8387 O  O     . HOH I 6 .   ? -14.692 10.099  -17.839 1.00 20.21 ? 1222 HOH A O     1 
HETATM 8388 O  O     . HOH I 6 .   ? -21.218 -8.047  -26.081 1.00 31.82 ? 1223 HOH A O     1 
HETATM 8389 O  O     . HOH I 6 .   ? 6.486   6.319   -21.834 1.00 33.27 ? 1224 HOH A O     1 
HETATM 8390 O  O     . HOH I 6 .   ? -4.094  42.686  -53.977 1.00 25.49 ? 1225 HOH A O     1 
HETATM 8391 O  O     . HOH I 6 .   ? -18.066 29.713  6.280   1.00 33.90 ? 1226 HOH A O     1 
HETATM 8392 O  O     . HOH I 6 .   ? 32.833  32.906  -37.743 1.00 22.52 ? 1227 HOH A O     1 
HETATM 8393 O  O     . HOH I 6 .   ? 8.168   23.154  -44.918 1.00 21.16 ? 1228 HOH A O     1 
HETATM 8394 O  O     . HOH I 6 .   ? -4.261  15.789  -63.865 1.00 32.18 ? 1229 HOH A O     1 
HETATM 8395 O  O     . HOH I 6 .   ? 3.583   15.805  -51.706 1.00 32.28 ? 1230 HOH A O     1 
HETATM 8396 O  O     . HOH I 6 .   ? -26.141 6.896   -39.351 1.00 28.34 ? 1231 HOH A O     1 
HETATM 8397 O  O     . HOH I 6 .   ? 2.248   42.043  -47.244 1.00 21.05 ? 1232 HOH A O     1 
HETATM 8398 O  O     . HOH I 6 .   ? -14.707 11.927  -57.192 1.00 24.62 ? 1233 HOH A O     1 
HETATM 8399 O  O     . HOH I 6 .   ? -23.171 8.567   -4.985  1.00 15.74 ? 1234 HOH A O     1 
HETATM 8400 O  O     . HOH I 6 .   ? -16.720 -10.960 -50.985 1.00 30.95 ? 1235 HOH A O     1 
HETATM 8401 O  O     . HOH I 6 .   ? 14.850  13.533  -33.864 1.00 37.41 ? 1236 HOH A O     1 
HETATM 8402 O  O     . HOH I 6 .   ? -25.806 11.262  -37.735 1.00 23.76 ? 1237 HOH A O     1 
HETATM 8403 O  O     . HOH I 6 .   ? 11.523  4.673   -59.684 1.00 23.30 ? 1238 HOH A O     1 
HETATM 8404 O  O     . HOH I 6 .   ? 21.859  16.856  -43.174 1.00 27.76 ? 1239 HOH A O     1 
HETATM 8405 O  O     . HOH I 6 .   ? -21.392 12.692  -50.641 1.00 23.02 ? 1240 HOH A O     1 
HETATM 8406 O  O     . HOH I 6 .   ? -17.659 39.993  -13.326 1.00 22.68 ? 1241 HOH A O     1 
HETATM 8407 O  O     . HOH I 6 .   ? -12.303 10.471  -22.216 1.00 36.98 ? 1242 HOH A O     1 
HETATM 8408 O  O     . HOH I 6 .   ? 23.767  9.953   -15.477 1.00 28.82 ? 1243 HOH A O     1 
HETATM 8409 O  O     . HOH I 6 .   ? 17.536  4.339   -49.054 1.00 22.89 ? 1244 HOH A O     1 
HETATM 8410 O  O     . HOH I 6 .   ? -13.362 1.722   -9.945  1.00 37.03 ? 1245 HOH A O     1 
HETATM 8411 O  O     . HOH I 6 .   ? -29.029 8.665   -13.857 1.00 18.34 ? 1246 HOH A O     1 
HETATM 8412 O  O     . HOH I 6 .   ? -18.993 32.326  -1.992  1.00 28.58 ? 1247 HOH A O     1 
HETATM 8413 O  O     . HOH I 6 .   ? -16.269 41.792  -20.100 1.00 25.69 ? 1248 HOH A O     1 
HETATM 8414 O  O     . HOH I 6 .   ? -17.869 32.526  1.510   1.00 23.81 ? 1249 HOH A O     1 
HETATM 8415 O  O     . HOH I 6 .   ? 1.634   14.879  -48.530 1.00 21.69 ? 1250 HOH A O     1 
HETATM 8416 O  O     . HOH I 6 .   ? -9.125  25.196  -54.944 1.00 35.35 ? 1251 HOH A O     1 
HETATM 8417 O  O     . HOH I 6 .   ? 22.729  26.581  -59.157 1.00 24.72 ? 1252 HOH A O     1 
HETATM 8418 O  O     . HOH I 6 .   ? -6.218  6.990   -4.866  1.00 27.99 ? 1253 HOH A O     1 
HETATM 8419 O  O     . HOH I 6 .   ? -26.736 -18.715 -43.497 1.00 30.50 ? 1254 HOH A O     1 
HETATM 8420 O  O     . HOH I 6 .   ? 19.349  19.810  -65.376 1.00 29.36 ? 1255 HOH A O     1 
HETATM 8421 O  O     . HOH I 6 .   ? -12.146 22.290  5.445   1.00 17.14 ? 1256 HOH A O     1 
HETATM 8422 O  O     . HOH I 6 .   ? 11.323  25.199  -26.819 1.00 17.15 ? 1257 HOH A O     1 
HETATM 8423 O  O     . HOH I 6 .   ? -9.212  52.716  -40.960 1.00 29.17 ? 1258 HOH A O     1 
HETATM 8424 O  O     . HOH I 6 .   ? 0.314   3.813   -74.578 1.00 30.80 ? 1259 HOH A O     1 
HETATM 8425 O  O     . HOH I 6 .   ? 4.382   40.221  -48.464 1.00 38.13 ? 1260 HOH A O     1 
HETATM 8426 O  O     . HOH I 6 .   ? 32.854  33.762  -48.412 1.00 26.67 ? 1261 HOH A O     1 
HETATM 8427 O  O     . HOH I 6 .   ? -17.240 0.533   -64.301 1.00 18.56 ? 1262 HOH A O     1 
HETATM 8428 O  O     . HOH I 6 .   ? -5.484  11.363  -36.607 1.00 21.49 ? 1263 HOH A O     1 
HETATM 8429 O  O     . HOH I 6 .   ? 18.326  32.019  -72.829 1.00 27.90 ? 1264 HOH A O     1 
HETATM 8430 O  O     . HOH I 6 .   ? -41.931 19.571  -29.156 1.00 25.22 ? 1265 HOH A O     1 
HETATM 8431 O  O     . HOH I 6 .   ? 7.455   24.130  -40.815 1.00 36.09 ? 1266 HOH A O     1 
HETATM 8432 O  O     . HOH I 6 .   ? -11.783 -9.424  -37.395 1.00 20.86 ? 1267 HOH A O     1 
HETATM 8433 O  O     . HOH I 6 .   ? -15.318 11.820  -59.697 1.00 29.12 ? 1268 HOH A O     1 
HETATM 8434 O  O     . HOH I 6 .   ? 11.326  33.557  -48.584 1.00 17.94 ? 1269 HOH A O     1 
HETATM 8435 O  O     . HOH I 6 .   ? -21.788 -3.706  -25.125 1.00 45.80 ? 1270 HOH A O     1 
HETATM 8436 O  O     . HOH I 6 .   ? 17.573  25.474  -66.361 1.00 24.30 ? 1271 HOH A O     1 
HETATM 8437 O  O     . HOH I 6 .   ? -16.384 31.101  7.782   1.00 41.94 ? 1272 HOH A O     1 
HETATM 8438 O  O     . HOH I 6 .   ? 25.155  12.941  -56.123 1.00 28.63 ? 1273 HOH A O     1 
HETATM 8439 O  O     . HOH I 6 .   ? -12.528 45.012  -13.006 1.00 23.81 ? 1274 HOH A O     1 
HETATM 8440 O  O     . HOH I 6 .   ? -11.570 31.977  -35.517 1.00 33.97 ? 1275 HOH A O     1 
HETATM 8441 O  O     . HOH I 6 .   ? -4.427  52.521  -41.251 1.00 23.66 ? 1276 HOH A O     1 
HETATM 8442 O  O     . HOH I 6 .   ? 30.193  31.581  -30.603 1.00 30.19 ? 1277 HOH A O     1 
HETATM 8443 O  O     . HOH I 6 .   ? -8.335  -14.774 -51.544 1.00 25.31 ? 1278 HOH A O     1 
HETATM 8444 O  O     A HOH I 6 .   ? -4.215  -10.368 -31.973 0.50 13.95 ? 1279 HOH A O     1 
HETATM 8445 O  O     B HOH I 6 .   ? -2.509  -9.442  -31.312 0.50 18.09 ? 1279 HOH A O     1 
HETATM 8446 O  O     . HOH I 6 .   ? -10.595 43.799  -59.776 1.00 30.36 ? 1280 HOH A O     1 
HETATM 8447 O  O     . HOH I 6 .   ? -3.734  10.854  -38.641 1.00 29.14 ? 1281 HOH A O     1 
HETATM 8448 O  O     . HOH I 6 .   ? -2.923  12.073  -26.685 1.00 24.84 ? 1282 HOH A O     1 
HETATM 8449 O  O     . HOH I 6 .   ? 4.925   33.115  -48.422 1.00 30.52 ? 1283 HOH A O     1 
HETATM 8450 O  O     . HOH I 6 .   ? -11.816 37.684  -59.034 1.00 41.66 ? 1284 HOH A O     1 
HETATM 8451 O  O     . HOH I 6 .   ? -7.189  47.930  -18.325 1.00 40.33 ? 1285 HOH A O     1 
HETATM 8452 O  O     . HOH I 6 .   ? -6.741  -0.182  -12.093 1.00 41.63 ? 1286 HOH A O     1 
HETATM 8453 O  O     . HOH I 6 .   ? 43.424  35.903  -50.000 1.00 20.65 ? 1287 HOH A O     1 
HETATM 8454 O  O     . HOH I 6 .   ? -5.366  18.858  4.071   1.00 30.44 ? 1288 HOH A O     1 
HETATM 8455 O  O     . HOH I 6 .   ? 7.572   13.092  -30.530 1.00 24.37 ? 1289 HOH A O     1 
HETATM 8456 O  O     . HOH I 6 .   ? -2.748  -4.851  -35.792 1.00 14.08 ? 1290 HOH A O     1 
HETATM 8457 O  O     . HOH I 6 .   ? -3.026  -11.678 -39.479 1.00 17.71 ? 1291 HOH A O     1 
HETATM 8458 O  O     . HOH I 6 .   ? 11.739  32.494  -46.294 1.00 28.18 ? 1292 HOH A O     1 
HETATM 8459 O  O     . HOH I 6 .   ? -0.691  28.936  0.245   1.00 28.44 ? 1293 HOH A O     1 
HETATM 8460 O  O     . HOH I 6 .   ? 12.489  27.824  -34.646 1.00 31.79 ? 1294 HOH A O     1 
HETATM 8461 O  O     . HOH I 6 .   ? 24.258  14.905  -47.556 1.00 20.09 ? 1295 HOH A O     1 
HETATM 8462 O  O     . HOH I 6 .   ? 15.617  29.132  -12.918 1.00 15.81 ? 1296 HOH A O     1 
HETATM 8463 O  O     . HOH I 6 .   ? 2.099   14.986  -34.209 1.00 36.57 ? 1297 HOH A O     1 
HETATM 8464 O  O     . HOH I 6 .   ? -1.081  10.647  -38.495 1.00 18.51 ? 1298 HOH A O     1 
HETATM 8465 O  O     . HOH I 6 .   ? -11.032 10.638  -19.822 1.00 44.95 ? 1299 HOH A O     1 
HETATM 8466 O  O     . HOH I 6 .   ? 26.647  22.348  -59.171 1.00 27.09 ? 1300 HOH A O     1 
HETATM 8467 O  O     . HOH I 6 .   ? -28.363 -15.923 -23.007 1.00 23.16 ? 1301 HOH A O     1 
HETATM 8468 O  O     . HOH I 6 .   ? 2.081   15.891  -37.758 1.00 28.81 ? 1302 HOH A O     1 
HETATM 8469 O  O     . HOH I 6 .   ? 0.419   15.610  -32.296 1.00 28.64 ? 1303 HOH A O     1 
HETATM 8470 O  O     . HOH I 6 .   ? -0.018  29.392  -34.730 1.00 25.40 ? 1304 HOH A O     1 
HETATM 8471 O  O     . HOH I 6 .   ? 7.334   33.415  -3.765  1.00 32.12 ? 1305 HOH A O     1 
HETATM 8472 O  O     . HOH I 6 .   ? -19.058 4.484   -53.613 1.00 26.42 ? 1306 HOH A O     1 
HETATM 8473 O  O     . HOH I 6 .   ? -15.356 36.322  -51.279 1.00 20.36 ? 1307 HOH A O     1 
HETATM 8474 O  O     . HOH I 6 .   ? -36.689 0.274   -20.266 1.00 22.93 ? 1308 HOH A O     1 
HETATM 8475 O  O     . HOH I 6 .   ? 33.829  31.251  -45.369 1.00 26.42 ? 1309 HOH A O     1 
HETATM 8476 O  O     . HOH I 6 .   ? -3.734  4.422   -6.778  1.00 31.35 ? 1310 HOH A O     1 
HETATM 8477 O  O     . HOH I 6 .   ? -31.271 15.238  -34.418 1.00 28.70 ? 1311 HOH A O     1 
HETATM 8478 O  O     . HOH I 6 .   ? -24.353 14.538  -40.826 1.00 31.75 ? 1312 HOH A O     1 
HETATM 8479 O  O     . HOH I 6 .   ? -35.165 9.846   -31.012 1.00 20.94 ? 1313 HOH A O     1 
HETATM 8480 O  O     . HOH I 6 .   ? -13.834 4.458   -27.994 1.00 26.09 ? 1314 HOH A O     1 
HETATM 8481 O  O     . HOH I 6 .   ? -7.171  -9.601  -32.953 1.00 31.56 ? 1315 HOH A O     1 
HETATM 8482 O  O     . HOH I 6 .   ? -21.335 25.614  -27.745 1.00 29.90 ? 1316 HOH A O     1 
HETATM 8483 O  O     . HOH I 6 .   ? 0.060   11.602  -73.655 1.00 44.98 ? 1317 HOH A O     1 
HETATM 8484 O  O     . HOH I 6 .   ? -20.460 16.110  -40.873 1.00 54.04 ? 1318 HOH A O     1 
HETATM 8485 O  O     . HOH I 6 .   ? 10.908  25.370  -41.815 1.00 28.45 ? 1319 HOH A O     1 
HETATM 8486 O  O     . HOH I 6 .   ? 18.065  12.209  -76.809 1.00 25.36 ? 1320 HOH A O     1 
HETATM 8487 O  O     . HOH I 6 .   ? 4.688   40.074  -54.418 1.00 34.14 ? 1321 HOH A O     1 
HETATM 8488 O  O     . HOH I 6 .   ? -15.191 -20.372 -31.712 1.00 28.70 ? 1322 HOH A O     1 
HETATM 8489 O  O     . HOH I 6 .   ? 40.019  24.573  -46.851 1.00 31.71 ? 1323 HOH A O     1 
HETATM 8490 O  O     . HOH I 6 .   ? 19.770  24.284  -65.042 1.00 39.84 ? 1324 HOH A O     1 
HETATM 8491 O  O     A HOH I 6 .   ? -7.755  26.411  7.077   0.50 8.92  ? 1325 HOH A O     1 
HETATM 8492 O  O     B HOH I 6 .   ? -9.962  25.873  6.829   0.50 14.64 ? 1325 HOH A O     1 
HETATM 8493 O  O     . HOH I 6 .   ? -19.335 -17.926 -40.024 1.00 23.72 ? 1326 HOH A O     1 
HETATM 8494 O  O     . HOH I 6 .   ? 16.807  35.588  -76.083 1.00 33.79 ? 1327 HOH A O     1 
HETATM 8495 O  O     . HOH I 6 .   ? 11.336  27.845  -26.847 1.00 27.62 ? 1328 HOH A O     1 
HETATM 8496 O  O     . HOH I 6 .   ? -2.360  22.871  -59.260 1.00 28.80 ? 1329 HOH A O     1 
HETATM 8497 O  O     . HOH I 6 .   ? 15.973  34.026  -39.162 1.00 36.95 ? 1330 HOH A O     1 
HETATM 8498 O  O     . HOH I 6 .   ? 33.071  23.036  -39.973 1.00 24.43 ? 1331 HOH A O     1 
HETATM 8499 O  O     . HOH I 6 .   ? -14.211 40.952  -42.861 1.00 21.72 ? 1332 HOH A O     1 
HETATM 8500 O  O     . HOH I 6 .   ? -22.710 15.739  -26.602 1.00 19.00 ? 1333 HOH A O     1 
HETATM 8501 O  O     . HOH I 6 .   ? -27.460 21.230  -6.934  1.00 27.24 ? 1334 HOH A O     1 
HETATM 8502 O  O     . HOH I 6 .   ? -3.943  -0.084  -46.706 1.00 21.11 ? 1335 HOH A O     1 
HETATM 8503 O  O     . HOH I 6 .   ? -17.057 40.476  -61.721 1.00 27.05 ? 1336 HOH A O     1 
HETATM 8504 O  O     . HOH I 6 .   ? 9.555   9.323   -75.142 1.00 20.67 ? 1337 HOH A O     1 
HETATM 8505 O  O     . HOH I 6 .   ? -24.687 24.807  -2.348  1.00 35.37 ? 1338 HOH A O     1 
HETATM 8506 O  O     . HOH I 6 .   ? -5.313  -16.756 -58.404 1.00 23.99 ? 1339 HOH A O     1 
HETATM 8507 O  O     . HOH I 6 .   ? -6.337  28.441  8.009   1.00 25.71 ? 1340 HOH A O     1 
HETATM 8508 O  O     . HOH I 6 .   ? -14.391 6.070   -65.024 1.00 26.43 ? 1341 HOH A O     1 
HETATM 8509 O  O     . HOH I 6 .   ? -18.628 37.918  -9.161  1.00 21.12 ? 1342 HOH A O     1 
HETATM 8510 O  O     . HOH I 6 .   ? -23.315 -7.543  -21.230 1.00 29.46 ? 1343 HOH A O     1 
HETATM 8511 O  O     . HOH I 6 .   ? -27.444 20.229  -15.329 1.00 25.77 ? 1344 HOH A O     1 
HETATM 8512 O  O     . HOH I 6 .   ? 26.740  15.617  -41.779 1.00 34.78 ? 1345 HOH A O     1 
HETATM 8513 O  O     . HOH I 6 .   ? 27.697  42.549  -44.865 1.00 27.73 ? 1346 HOH A O     1 
HETATM 8514 O  O     . HOH I 6 .   ? -8.765  9.258   -2.717  1.00 43.95 ? 1347 HOH A O     1 
HETATM 8515 O  O     A HOH I 6 .   ? -14.794 -10.141 -28.507 0.50 18.78 ? 1348 HOH A O     1 
HETATM 8516 O  O     B HOH I 6 .   ? -14.453 -10.072 -30.449 0.50 22.51 ? 1348 HOH A O     1 
HETATM 8517 O  O     . HOH I 6 .   ? 5.908   25.486  -47.455 1.00 36.33 ? 1349 HOH A O     1 
HETATM 8518 O  O     . HOH I 6 .   ? -16.253 -11.604 -42.074 1.00 35.37 ? 1350 HOH A O     1 
HETATM 8519 O  O     . HOH I 6 .   ? -6.252  13.715  -70.996 1.00 31.89 ? 1351 HOH A O     1 
HETATM 8520 O  O     . HOH I 6 .   ? 31.474  15.284  -20.326 1.00 25.06 ? 1352 HOH A O     1 
HETATM 8521 O  O     . HOH I 6 .   ? -20.895 6.271   -53.465 1.00 22.39 ? 1353 HOH A O     1 
HETATM 8522 O  O     . HOH I 6 .   ? -5.657  41.967  -4.286  1.00 25.48 ? 1354 HOH A O     1 
HETATM 8523 O  O     . HOH I 6 .   ? -25.524 5.359   -48.659 1.00 32.39 ? 1355 HOH A O     1 
HETATM 8524 O  O     . HOH I 6 .   ? -18.273 40.523  -41.713 1.00 30.36 ? 1356 HOH A O     1 
HETATM 8525 O  O     . HOH I 6 .   ? -35.074 5.207   -25.887 1.00 31.10 ? 1357 HOH A O     1 
HETATM 8526 O  O     . HOH I 6 .   ? -13.171 40.897  -3.503  1.00 31.83 ? 1358 HOH A O     1 
HETATM 8527 O  O     . HOH I 6 .   ? 14.302  38.018  -59.482 1.00 28.05 ? 1359 HOH A O     1 
HETATM 8528 O  O     . HOH I 6 .   ? 29.718  40.105  -44.514 1.00 31.24 ? 1360 HOH A O     1 
HETATM 8529 O  O     . HOH I 6 .   ? 1.435   41.210  -9.290  1.00 27.26 ? 1361 HOH A O     1 
HETATM 8530 O  O     . HOH I 6 .   ? 0.335   14.511  -36.069 1.00 29.25 ? 1362 HOH A O     1 
HETATM 8531 O  O     . HOH I 6 .   ? -31.418 -2.924  -15.952 1.00 27.77 ? 1363 HOH A O     1 
HETATM 8532 O  O     . HOH I 6 .   ? 12.808  13.805  -40.394 1.00 25.50 ? 1364 HOH A O     1 
HETATM 8533 O  O     . HOH I 6 .   ? -8.227  24.454  -18.604 1.00 26.79 ? 1365 HOH A O     1 
HETATM 8534 O  O     . HOH I 6 .   ? 12.099  25.814  -38.967 1.00 23.27 ? 1366 HOH A O     1 
HETATM 8535 O  O     . HOH I 6 .   ? -9.792  25.069  4.426   1.00 24.63 ? 1367 HOH A O     1 
HETATM 8536 O  O     . HOH I 6 .   ? -10.776 -8.023  -35.519 1.00 31.11 ? 1368 HOH A O     1 
HETATM 8537 O  O     . HOH I 6 .   ? -0.005  -11.174 -32.731 1.00 27.35 ? 1369 HOH A O     1 
HETATM 8538 O  O     . HOH I 6 .   ? -12.177 12.259  -56.446 1.00 24.67 ? 1370 HOH A O     1 
HETATM 8539 O  O     . HOH I 6 .   ? 14.143  27.629  -9.672  1.00 28.01 ? 1371 HOH A O     1 
HETATM 8540 O  O     . HOH I 6 .   ? -16.793 -14.273 -58.211 1.00 40.93 ? 1372 HOH A O     1 
HETATM 8541 O  O     . HOH I 6 .   ? -22.369 -1.041  -24.754 1.00 34.15 ? 1373 HOH A O     1 
HETATM 8542 O  O     . HOH I 6 .   ? -34.358 10.810  -28.410 1.00 22.42 ? 1374 HOH A O     1 
HETATM 8543 O  O     . HOH I 6 .   ? 29.451  17.721  -52.339 1.00 29.22 ? 1375 HOH A O     1 
HETATM 8544 O  O     . HOH I 6 .   ? 6.549   12.624  -25.663 1.00 25.30 ? 1376 HOH A O     1 
HETATM 8545 O  O     . HOH I 6 .   ? -5.982  42.062  -57.091 1.00 39.38 ? 1377 HOH A O     1 
HETATM 8546 O  O     . HOH I 6 .   ? 12.523  30.251  -33.413 1.00 36.10 ? 1378 HOH A O     1 
HETATM 8547 O  O     . HOH I 6 .   ? -13.013 43.427  -3.291  1.00 32.15 ? 1379 HOH A O     1 
HETATM 8548 O  O     . HOH I 6 .   ? 9.873   28.915  -28.936 1.00 38.86 ? 1380 HOH A O     1 
HETATM 8549 O  O     . HOH I 6 .   ? 15.093  31.036  -31.569 1.00 25.82 ? 1381 HOH A O     1 
HETATM 8550 O  O     . HOH I 6 .   ? 14.230  34.571  -32.764 1.00 43.60 ? 1382 HOH A O     1 
HETATM 8551 O  O     . HOH I 6 .   ? -4.631  9.223   -40.640 1.00 31.52 ? 1383 HOH A O     1 
HETATM 8552 O  O     . HOH I 6 .   ? 47.467  37.423  -47.639 1.00 45.31 ? 1384 HOH A O     1 
HETATM 8553 O  O     A HOH I 6 .   ? -10.637 39.720  2.049   0.50 10.64 ? 1385 HOH A O     1 
HETATM 8554 O  O     B HOH I 6 .   ? -11.702 41.430  0.990   0.50 16.77 ? 1385 HOH A O     1 
HETATM 8555 O  O     A HOH I 6 .   ? -25.138 35.199  -14.916 0.50 19.82 ? 1386 HOH A O     1 
HETATM 8556 O  O     B HOH I 6 .   ? -26.049 33.548  -15.590 0.50 22.95 ? 1386 HOH A O     1 
HETATM 8557 O  O     . HOH I 6 .   ? 41.981  43.436  -47.683 1.00 56.82 ? 1387 HOH A O     1 
HETATM 8558 O  O     . HOH I 6 .   ? -22.665 19.443  -1.619  1.00 34.84 ? 1388 HOH A O     1 
HETATM 8559 O  O     . HOH I 6 .   ? -1.439  29.980  -59.662 1.00 25.65 ? 1389 HOH A O     1 
HETATM 8560 O  O     . HOH I 6 .   ? -3.128  10.213  -10.677 1.00 38.02 ? 1390 HOH A O     1 
HETATM 8561 O  O     . HOH I 6 .   ? 9.893   14.256  -80.215 1.00 33.04 ? 1391 HOH A O     1 
HETATM 8562 O  O     . HOH I 6 .   ? -2.218  30.133  -10.567 1.00 26.08 ? 1392 HOH A O     1 
HETATM 8563 O  O     . HOH I 6 .   ? -15.311 38.745  -60.190 1.00 21.35 ? 1393 HOH A O     1 
HETATM 8564 O  O     . HOH I 6 .   ? -13.329 2.633   -18.125 1.00 33.54 ? 1394 HOH A O     1 
HETATM 8565 O  O     . HOH I 6 .   ? -16.626 -14.855 -28.301 1.00 29.91 ? 1395 HOH A O     1 
HETATM 8566 O  O     . HOH I 6 .   ? -15.358 33.734  -43.971 1.00 20.66 ? 1396 HOH A O     1 
HETATM 8567 O  O     . HOH I 6 .   ? 16.225  14.278  -62.642 1.00 30.09 ? 1397 HOH A O     1 
HETATM 8568 O  O     . HOH I 6 .   ? 6.583   34.456  -23.243 1.00 44.29 ? 1398 HOH A O     1 
HETATM 8569 O  O     . HOH I 6 .   ? 2.432   -16.177 -59.560 1.00 27.92 ? 1399 HOH A O     1 
HETATM 8570 O  O     . HOH I 6 .   ? -2.256  30.211  -37.475 1.00 36.31 ? 1400 HOH A O     1 
HETATM 8571 O  O     . HOH I 6 .   ? 34.727  26.597  -38.393 1.00 45.75 ? 1401 HOH A O     1 
HETATM 8572 O  O     . HOH I 6 .   ? 41.629  34.146  -50.812 1.00 34.59 ? 1402 HOH A O     1 
HETATM 8573 O  O     . HOH I 6 .   ? -20.480 -12.474 -41.920 1.00 24.34 ? 1403 HOH A O     1 
HETATM 8574 O  O     . HOH I 6 .   ? -23.471 37.325  -14.111 1.00 38.79 ? 1404 HOH A O     1 
HETATM 8575 O  O     . HOH I 6 .   ? -16.369 37.648  -25.244 1.00 45.70 ? 1405 HOH A O     1 
HETATM 8576 O  O     . HOH I 6 .   ? -11.835 11.177  -17.191 1.00 33.62 ? 1406 HOH A O     1 
HETATM 8577 O  O     . HOH I 6 .   ? -10.714 -16.507 -58.179 1.00 21.40 ? 1407 HOH A O     1 
HETATM 8578 O  O     . HOH I 6 .   ? -17.526 17.965  -52.070 1.00 28.04 ? 1408 HOH A O     1 
HETATM 8579 O  O     . HOH I 6 .   ? 0.988   36.611  -41.845 1.00 28.55 ? 1409 HOH A O     1 
HETATM 8580 O  O     . HOH I 6 .   ? -29.096 22.439  -22.523 1.00 19.07 ? 1410 HOH A O     1 
HETATM 8581 O  O     . HOH I 6 .   ? 7.904   -1.549  -55.719 1.00 35.77 ? 1411 HOH A O     1 
HETATM 8582 O  O     . HOH I 6 .   ? 21.403  28.221  -66.726 1.00 30.73 ? 1412 HOH A O     1 
HETATM 8583 O  O     . HOH I 6 .   ? 3.058   16.106  -2.762  1.00 35.25 ? 1413 HOH A O     1 
HETATM 8584 O  O     . HOH I 6 .   ? 3.791   -2.131  -15.791 1.00 33.22 ? 1414 HOH A O     1 
HETATM 8585 O  O     . HOH I 6 .   ? 3.449   35.665  -45.175 1.00 40.64 ? 1415 HOH A O     1 
HETATM 8586 O  O     . HOH I 6 .   ? -19.941 -22.013 -22.423 1.00 27.58 ? 1416 HOH A O     1 
HETATM 8587 O  O     . HOH I 6 .   ? 6.575   21.677  -3.601  1.00 35.57 ? 1417 HOH A O     1 
HETATM 8588 O  O     . HOH I 6 .   ? 17.379  12.325  -61.347 1.00 25.46 ? 1418 HOH A O     1 
HETATM 8589 O  O     . HOH I 6 .   ? -6.296  17.585  -65.816 1.00 35.33 ? 1419 HOH A O     1 
HETATM 8590 O  O     . HOH I 6 .   ? 2.441   15.696  -22.996 1.00 32.61 ? 1420 HOH A O     1 
HETATM 8591 O  O     . HOH I 6 .   ? 26.893  29.473  -20.518 1.00 28.77 ? 1421 HOH A O     1 
HETATM 8592 O  O     . HOH I 6 .   ? -11.422 45.115  -61.939 1.00 30.62 ? 1422 HOH A O     1 
HETATM 8593 O  O     . HOH I 6 .   ? 25.801  29.502  -55.388 1.00 28.41 ? 1423 HOH A O     1 
HETATM 8594 O  O     . HOH I 6 .   ? 22.436  12.516  -5.623  1.00 14.37 ? 1424 HOH A O     1 
HETATM 8595 O  O     . HOH I 6 .   ? -24.356 27.463  -25.471 1.00 36.63 ? 1425 HOH A O     1 
HETATM 8596 O  O     . HOH I 6 .   ? 30.515  35.469  -47.973 1.00 29.97 ? 1426 HOH A O     1 
HETATM 8597 O  O     . HOH I 6 .   ? 31.677  22.878  -32.885 1.00 34.68 ? 1427 HOH A O     1 
HETATM 8598 O  O     . HOH I 6 .   ? -4.509  54.918  -12.878 1.00 13.47 ? 1428 HOH A O     1 
HETATM 8599 O  O     . HOH I 6 .   ? -3.365  -14.246 -56.302 1.00 22.88 ? 1429 HOH A O     1 
HETATM 8600 O  O     . HOH I 6 .   ? 19.071  33.911  -27.497 1.00 32.30 ? 1430 HOH A O     1 
HETATM 8601 O  O     . HOH I 6 .   ? -28.558 5.313   -40.945 1.00 41.05 ? 1431 HOH A O     1 
HETATM 8602 O  O     . HOH I 6 .   ? -12.007 -9.328  -40.640 1.00 31.98 ? 1432 HOH A O     1 
HETATM 8603 O  O     . HOH I 6 .   ? -0.571  23.611  -37.288 1.00 34.86 ? 1433 HOH A O     1 
HETATM 8604 O  O     . HOH I 6 .   ? -8.396  16.306  -57.710 1.00 30.45 ? 1434 HOH A O     1 
HETATM 8605 O  O     . HOH I 6 .   ? -3.393  18.406  -49.646 1.00 33.53 ? 1435 HOH A O     1 
HETATM 8606 O  O     . HOH I 6 .   ? -9.762  46.101  -5.096  1.00 24.67 ? 1436 HOH A O     1 
HETATM 8607 O  O     . HOH I 6 .   ? 27.702  26.951  -56.105 1.00 32.23 ? 1437 HOH A O     1 
HETATM 8608 O  O     . HOH I 6 .   ? -16.405 13.193  -55.631 1.00 33.18 ? 1438 HOH A O     1 
HETATM 8609 O  O     . HOH I 6 .   ? -22.287 -9.095  -59.717 1.00 40.75 ? 1439 HOH A O     1 
HETATM 8610 O  O     . HOH I 6 .   ? -25.228 32.354  -13.292 1.00 37.41 ? 1440 HOH A O     1 
HETATM 8611 O  O     . HOH I 6 .   ? 19.692  -1.498  -19.016 1.00 29.85 ? 1441 HOH A O     1 
HETATM 8612 O  O     . HOH I 6 .   ? 8.806   41.408  -10.255 1.00 27.46 ? 1442 HOH A O     1 
HETATM 8613 O  O     . HOH I 6 .   ? -0.892  14.428  -12.578 1.00 32.78 ? 1443 HOH A O     1 
HETATM 8614 O  O     . HOH I 6 .   ? -2.723  52.903  -43.909 1.00 32.40 ? 1444 HOH A O     1 
HETATM 8615 O  O     . HOH I 6 .   ? -25.799 -5.819  -59.758 1.00 35.61 ? 1445 HOH A O     1 
HETATM 8616 O  O     . HOH I 6 .   ? -13.605 44.075  -24.089 1.00 37.28 ? 1446 HOH A O     1 
HETATM 8617 O  O     . HOH I 6 .   ? 0.012   30.813  -66.344 1.00 26.35 ? 1447 HOH A O     1 
HETATM 8618 O  O     . HOH I 6 .   ? -23.479 5.331   -41.255 1.00 29.08 ? 1448 HOH A O     1 
HETATM 8619 O  O     . HOH I 6 .   ? 10.882  2.288   -59.580 1.00 26.43 ? 1449 HOH A O     1 
HETATM 8620 O  O     . HOH I 6 .   ? 25.284  2.540   -20.707 1.00 24.73 ? 1450 HOH A O     1 
HETATM 8621 O  O     . HOH I 6 .   ? -29.901 25.320  -22.897 1.00 30.81 ? 1451 HOH A O     1 
HETATM 8622 O  O     . HOH I 6 .   ? -10.922 20.243  4.157   1.00 26.03 ? 1452 HOH A O     1 
HETATM 8623 O  O     . HOH I 6 .   ? 2.967   -17.571 -61.657 1.00 25.17 ? 1453 HOH A O     1 
HETATM 8624 O  O     . HOH I 6 .   ? -29.412 -10.566 -16.742 1.00 41.55 ? 1454 HOH A O     1 
HETATM 8625 O  O     . HOH I 6 .   ? 6.419   26.853  -21.064 1.00 27.80 ? 1455 HOH A O     1 
HETATM 8626 O  O     . HOH I 6 .   ? -4.978  53.903  -10.517 1.00 21.30 ? 1456 HOH A O     1 
HETATM 8627 O  O     . HOH I 6 .   ? -19.414 12.632  4.202   1.00 24.51 ? 1457 HOH A O     1 
HETATM 8628 O  O     . HOH I 6 .   ? 3.762   16.590  -54.157 1.00 36.83 ? 1458 HOH A O     1 
HETATM 8629 O  O     . HOH I 6 .   ? -8.276  22.866  3.642   1.00 24.28 ? 1459 HOH A O     1 
HETATM 8630 O  O     . HOH I 6 .   ? -11.926 7.761   -25.983 1.00 34.05 ? 1460 HOH A O     1 
HETATM 8631 O  O     . HOH I 6 .   ? 18.372  2.923   -52.789 1.00 31.25 ? 1461 HOH A O     1 
HETATM 8632 O  O     . HOH I 6 .   ? 7.427   -3.449  -51.226 1.00 34.00 ? 1462 HOH A O     1 
HETATM 8633 O  O     . HOH I 6 .   ? 18.568  27.533  -73.505 1.00 26.81 ? 1463 HOH A O     1 
HETATM 8634 O  O     . HOH I 6 .   ? 17.418  15.103  -28.835 1.00 35.81 ? 1464 HOH A O     1 
HETATM 8635 O  O     . HOH I 6 .   ? 2.625   -14.656 -63.026 1.00 29.40 ? 1465 HOH A O     1 
HETATM 8636 O  O     . HOH I 6 .   ? -14.585 45.215  -61.037 1.00 34.03 ? 1466 HOH A O     1 
HETATM 8637 O  O     . HOH I 6 .   ? -4.036  10.815  -19.325 1.00 53.27 ? 1467 HOH A O     1 
HETATM 8638 O  O     . HOH I 6 .   ? 33.320  25.746  -14.552 1.00 34.61 ? 1468 HOH A O     1 
HETATM 8639 O  O     . HOH I 6 .   ? 0.686   12.417  -11.884 1.00 33.05 ? 1469 HOH A O     1 
HETATM 8640 O  O     . HOH I 6 .   ? -5.265  20.355  -66.521 1.00 28.39 ? 1470 HOH A O     1 
HETATM 8641 O  O     . HOH I 6 .   ? -9.447  48.168  -12.900 1.00 21.00 ? 1471 HOH A O     1 
HETATM 8642 O  O     . HOH I 6 .   ? -18.323 45.707  -46.310 1.00 32.40 ? 1472 HOH A O     1 
HETATM 8643 O  O     . HOH I 6 .   ? -29.459 4.608   -37.295 1.00 31.00 ? 1473 HOH A O     1 
HETATM 8644 O  O     . HOH I 6 .   ? 35.315  24.118  -46.808 1.00 31.87 ? 1474 HOH A O     1 
HETATM 8645 O  O     . HOH I 6 .   ? -2.316  24.323  -47.762 1.00 26.33 ? 1475 HOH A O     1 
HETATM 8646 O  O     . HOH I 6 .   ? -26.265 8.648   -46.579 1.00 35.70 ? 1476 HOH A O     1 
HETATM 8647 O  O     . HOH I 6 .   ? -4.641  32.322  -37.668 1.00 34.78 ? 1477 HOH A O     1 
HETATM 8648 O  O     . HOH I 6 .   ? -15.238 10.456  -21.139 1.00 31.73 ? 1478 HOH A O     1 
HETATM 8649 O  O     . HOH I 6 .   ? 27.483  31.179  -56.266 1.00 28.98 ? 1479 HOH A O     1 
HETATM 8650 O  O     . HOH I 6 .   ? -35.677 6.675   -17.058 1.00 23.72 ? 1480 HOH A O     1 
HETATM 8651 O  O     . HOH I 6 .   ? -36.558 11.021  -19.656 1.00 29.69 ? 1481 HOH A O     1 
HETATM 8652 O  O     . HOH I 6 .   ? -16.964 46.070  -15.856 1.00 42.57 ? 1482 HOH A O     1 
HETATM 8653 O  O     . HOH I 6 .   ? 10.003  1.554   -62.041 1.00 23.60 ? 1483 HOH A O     1 
HETATM 8654 O  O     . HOH I 6 .   ? -7.433  9.239   -72.481 1.00 36.24 ? 1484 HOH A O     1 
HETATM 8655 O  O     . HOH I 6 .   ? -18.107 28.828  -25.469 1.00 41.16 ? 1485 HOH A O     1 
HETATM 8656 O  O     . HOH I 6 .   ? 13.746  5.879   -12.686 1.00 31.21 ? 1486 HOH A O     1 
HETATM 8657 O  O     . HOH I 6 .   ? -26.706 30.107  -12.291 1.00 33.81 ? 1487 HOH A O     1 
HETATM 8658 O  O     . HOH I 6 .   ? -3.560  22.307  -16.561 1.00 25.21 ? 1488 HOH A O     1 
HETATM 8659 O  O     . HOH I 6 .   ? 14.957  15.232  -81.949 1.00 40.73 ? 1489 HOH A O     1 
HETATM 8660 O  O     . HOH I 6 .   ? -2.223  29.781  -14.839 1.00 30.82 ? 1490 HOH A O     1 
HETATM 8661 O  O     . HOH I 6 .   ? 15.504  25.120  -77.775 1.00 33.42 ? 1491 HOH A O     1 
HETATM 8662 O  O     . HOH I 6 .   ? -7.595  16.409  -61.857 1.00 31.39 ? 1492 HOH A O     1 
HETATM 8663 O  O     . HOH I 6 .   ? -22.525 20.412  -37.643 1.00 36.74 ? 1493 HOH A O     1 
HETATM 8664 O  O     . HOH I 6 .   ? -8.161  43.264  -22.553 1.00 31.78 ? 1494 HOH A O     1 
HETATM 8665 O  O     . HOH I 6 .   ? 2.028   32.138  -23.325 1.00 34.62 ? 1495 HOH A O     1 
HETATM 8666 O  O     . HOH I 6 .   ? 37.944  29.023  -52.300 1.00 37.46 ? 1496 HOH A O     1 
HETATM 8667 O  O     . HOH I 6 .   ? -8.970  49.864  -56.870 1.00 32.02 ? 1497 HOH A O     1 
HETATM 8668 O  O     . HOH I 6 .   ? 7.589   33.323  -47.308 1.00 37.86 ? 1498 HOH A O     1 
HETATM 8669 O  O     . HOH I 6 .   ? -10.434 42.816  -2.632  1.00 35.36 ? 1499 HOH A O     1 
HETATM 8670 O  O     . HOH I 6 .   ? 16.202  16.479  -66.933 1.00 31.84 ? 1500 HOH A O     1 
HETATM 8671 O  O     . HOH I 6 .   ? -12.428 -11.856 -39.892 1.00 40.24 ? 1501 HOH A O     1 
HETATM 8672 O  O     . HOH I 6 .   ? -30.959 -19.638 -52.271 1.00 44.14 ? 1502 HOH A O     1 
HETATM 8673 O  O     . HOH I 6 .   ? 24.161  15.038  -10.982 1.00 14.79 ? 1503 HOH A O     1 
HETATM 8674 O  O     . HOH I 6 .   ? 18.947  10.668  -27.239 1.00 26.68 ? 1504 HOH A O     1 
HETATM 8675 O  O     . HOH I 6 .   ? 12.019  22.603  -14.689 1.00 27.97 ? 1505 HOH A O     1 
HETATM 8676 O  O     . HOH I 6 .   ? 41.964  45.710  -49.106 1.00 62.51 ? 1506 HOH A O     1 
HETATM 8677 O  O     . HOH I 6 .   ? -29.614 22.533  -35.406 1.00 40.36 ? 1507 HOH A O     1 
HETATM 8678 O  O     . HOH I 6 .   ? 30.307  17.279  -23.731 1.00 28.25 ? 1508 HOH A O     1 
HETATM 8679 O  O     . HOH I 6 .   ? -3.298  52.233  -9.290  1.00 23.97 ? 1509 HOH A O     1 
HETATM 8680 O  O     . HOH I 6 .   ? 9.235   23.157  -0.654  1.00 38.31 ? 1510 HOH A O     1 
HETATM 8681 O  O     . HOH I 6 .   ? -7.884  39.291  -25.154 1.00 31.80 ? 1511 HOH A O     1 
HETATM 8682 O  O     . HOH I 6 .   ? -5.681  7.818   -2.356  1.00 24.84 ? 1512 HOH A O     1 
HETATM 8683 O  O     . HOH I 6 .   ? -24.273 10.435  -43.082 1.00 37.50 ? 1513 HOH A O     1 
HETATM 8684 O  O     . HOH I 6 .   ? -23.550 5.212   -1.869  1.00 16.45 ? 1514 HOH A O     1 
HETATM 8685 O  O     . HOH I 6 .   ? 33.870  20.038  -32.849 1.00 30.37 ? 1515 HOH A O     1 
HETATM 8686 O  O     . HOH I 6 .   ? -16.697 20.194  -53.050 1.00 25.81 ? 1516 HOH A O     1 
HETATM 8687 O  O     . HOH I 6 .   ? 12.830  39.857  -71.420 1.00 52.83 ? 1517 HOH A O     1 
HETATM 8688 O  O     . HOH I 6 .   ? 32.533  18.609  -30.970 1.00 28.05 ? 1518 HOH A O     1 
HETATM 8689 O  O     . HOH I 6 .   ? 19.222  14.056  -26.975 1.00 33.70 ? 1519 HOH A O     1 
HETATM 8690 O  O     . HOH I 6 .   ? -25.871 10.729  -44.955 1.00 30.51 ? 1520 HOH A O     1 
HETATM 8691 O  O     . HOH I 6 .   ? -24.056 18.205  -38.147 1.00 40.18 ? 1521 HOH A O     1 
HETATM 8692 O  O     . HOH I 6 .   ? -26.986 8.815   -43.161 1.00 39.69 ? 1522 HOH A O     1 
HETATM 8693 O  O     . HOH I 6 .   ? 30.433  16.649  -31.154 1.00 36.12 ? 1523 HOH A O     1 
HETATM 8694 O  O     . HOH I 6 .   ? -2.110  17.261  -52.844 1.00 34.39 ? 1524 HOH A O     1 
HETATM 8695 O  O     . HOH I 6 .   ? -2.707  20.431  -56.529 1.00 28.37 ? 1525 HOH A O     1 
HETATM 8696 O  O     . HOH I 6 .   ? 5.078   44.456  -16.557 1.00 23.31 ? 1526 HOH A O     1 
HETATM 8697 O  O     . HOH I 6 .   ? -18.528 14.228  6.112   1.00 27.06 ? 1527 HOH A O     1 
HETATM 8698 O  O     . HOH I 6 .   ? -17.442 38.515  -0.515  1.00 42.45 ? 1528 HOH A O     1 
HETATM 8699 O  O     . HOH I 6 .   ? -32.012 18.944  -33.462 1.00 35.87 ? 1529 HOH A O     1 
HETATM 8700 O  O     . HOH I 6 .   ? -11.538 50.878  -37.958 1.00 34.00 ? 1530 HOH A O     1 
HETATM 8701 O  O     . HOH I 6 .   ? -30.247 27.532  -27.154 1.00 35.05 ? 1531 HOH A O     1 
HETATM 8702 O  O     . HOH I 6 .   ? 19.326  10.110  -8.339  1.00 20.19 ? 1532 HOH A O     1 
HETATM 8703 O  O     . HOH I 6 .   ? 19.665  21.638  -71.796 1.00 27.19 ? 1533 HOH A O     1 
HETATM 8704 O  O     . HOH I 6 .   ? 15.513  36.303  -68.370 1.00 37.29 ? 1534 HOH A O     1 
HETATM 8705 O  O     . HOH I 6 .   ? -12.499 8.388   2.098   1.00 34.24 ? 1535 HOH A O     1 
HETATM 8706 O  O     . HOH I 6 .   ? -1.367  28.697  -12.471 1.00 49.79 ? 1536 HOH A O     1 
HETATM 8707 O  O     . HOH I 6 .   ? -29.603 24.118  -14.504 1.00 29.17 ? 1537 HOH A O     1 
HETATM 8708 O  O     . HOH I 6 .   ? -35.134 -3.555  -28.778 1.00 29.56 ? 1538 HOH A O     1 
HETATM 8709 O  O     . HOH I 6 .   ? -6.829  36.337  -58.055 1.00 32.61 ? 1539 HOH A O     1 
HETATM 8710 O  O     . HOH I 6 .   ? 7.106   24.928  -6.433  1.00 39.56 ? 1540 HOH A O     1 
HETATM 8711 O  O     . HOH I 6 .   ? -35.243 7.075   -34.629 1.00 32.39 ? 1541 HOH A O     1 
HETATM 8712 O  O     . HOH I 6 .   ? -23.397 8.931   -41.369 1.00 33.32 ? 1542 HOH A O     1 
HETATM 8713 O  O     . HOH I 6 .   ? -22.569 36.261  -22.164 1.00 33.94 ? 1543 HOH A O     1 
HETATM 8714 O  O     A HOH I 6 .   ? 29.964  38.768  -28.399 0.50 21.38 ? 1544 HOH A O     1 
HETATM 8715 O  O     B HOH I 6 .   ? 31.344  37.566  -27.451 0.50 20.61 ? 1544 HOH A O     1 
HETATM 8716 O  O     . HOH I 6 .   ? -5.159  38.387  -2.419  1.00 36.14 ? 1545 HOH A O     1 
HETATM 8717 O  O     . HOH I 6 .   ? -21.542 -5.799  -22.647 1.00 33.83 ? 1546 HOH A O     1 
HETATM 8718 O  O     . HOH I 6 .   ? -32.197 11.661  -41.877 1.00 28.51 ? 1547 HOH A O     1 
HETATM 8719 O  O     . HOH I 6 .   ? -20.768 37.754  -14.582 1.00 24.91 ? 1548 HOH A O     1 
HETATM 8720 O  O     . HOH I 6 .   ? -7.100  4.751   -72.010 1.00 34.74 ? 1549 HOH A O     1 
HETATM 8721 O  O     . HOH I 6 .   ? -14.401 35.756  -25.311 1.00 52.26 ? 1550 HOH A O     1 
HETATM 8722 O  O     . HOH I 6 .   ? -27.268 26.368  -33.096 1.00 41.43 ? 1551 HOH A O     1 
HETATM 8723 O  O     . HOH I 6 .   ? 24.875  31.941  -23.827 1.00 32.60 ? 1552 HOH A O     1 
HETATM 8724 O  O     . HOH I 6 .   ? -17.429 -7.502  -62.705 1.00 38.67 ? 1553 HOH A O     1 
HETATM 8725 O  O     . HOH I 6 .   ? -24.658 -2.754  -61.998 1.00 38.37 ? 1554 HOH A O     1 
HETATM 8726 O  O     A HOH I 6 .   ? 30.382  20.497  -50.305 0.50 12.34 ? 1555 HOH A O     1 
HETATM 8727 O  O     B HOH I 6 .   ? 31.950  20.396  -49.045 0.50 21.46 ? 1555 HOH A O     1 
HETATM 8728 O  O     . HOH I 6 .   ? -14.894 49.354  -45.922 1.00 30.37 ? 1556 HOH A O     1 
HETATM 8729 O  O     . HOH I 6 .   ? -13.257 9.716   -63.826 1.00 27.36 ? 1557 HOH A O     1 
HETATM 8730 O  O     . HOH I 6 .   ? -5.896  23.954  -56.283 1.00 31.02 ? 1558 HOH A O     1 
HETATM 8731 O  O     . HOH I 6 .   ? -31.549 21.658  -33.687 1.00 41.78 ? 1559 HOH A O     1 
HETATM 8732 O  O     . HOH I 6 .   ? -4.914  21.644  -58.078 1.00 37.92 ? 1560 HOH A O     1 
HETATM 8733 O  O     . HOH I 6 .   ? -1.246  -12.886 -41.285 1.00 29.85 ? 1561 HOH A O     1 
HETATM 8734 O  O     . HOH I 6 .   ? -35.122 13.696  -17.471 1.00 15.84 ? 1562 HOH A O     1 
HETATM 8735 O  O     . HOH I 6 .   ? -1.522  18.527  -55.595 1.00 45.42 ? 1563 HOH A O     1 
HETATM 8736 O  O     . HOH I 6 .   ? -1.065  18.738  -50.973 1.00 43.16 ? 1564 HOH A O     1 
HETATM 8737 O  O     . HOH I 6 .   ? -9.810  46.864  -37.938 1.00 23.40 ? 1565 HOH A O     1 
HETATM 8738 O  O     . HOH I 6 .   ? 4.590   37.250  -8.581  1.00 33.98 ? 1566 HOH A O     1 
HETATM 8739 O  O     . HOH I 6 .   ? 2.050   33.155  -32.798 1.00 52.45 ? 1567 HOH A O     1 
HETATM 8740 O  O     . HOH I 6 .   ? -32.417 23.641  -32.121 1.00 35.58 ? 1568 HOH A O     1 
HETATM 8741 O  O     . HOH I 6 .   ? -37.353 -10.833 -36.077 1.00 36.80 ? 1569 HOH A O     1 
HETATM 8742 O  O     . HOH I 6 .   ? -13.657 5.255   -6.340  1.00 23.36 ? 1570 HOH A O     1 
HETATM 8743 O  O     . HOH I 6 .   ? 31.726  19.524  -41.544 1.00 33.10 ? 1571 HOH A O     1 
HETATM 8744 O  O     . HOH I 6 .   ? -2.688  27.822  -60.789 1.00 35.09 ? 1572 HOH A O     1 
HETATM 8745 O  O     . HOH I 6 .   ? 15.748  6.073   -58.365 1.00 31.04 ? 1573 HOH A O     1 
HETATM 8746 O  O     . HOH I 6 .   ? -28.886 2.528   -39.294 1.00 25.36 ? 1574 HOH A O     1 
HETATM 8747 O  O     . HOH I 6 .   ? 32.803  25.771  -52.896 1.00 43.89 ? 1575 HOH A O     1 
HETATM 8748 O  O     . HOH I 6 .   ? 28.393  15.347  -24.133 1.00 24.67 ? 1576 HOH A O     1 
HETATM 8749 O  O     . HOH I 6 .   ? -10.420 4.847   -68.170 1.00 34.28 ? 1577 HOH A O     1 
HETATM 8750 O  O     . HOH I 6 .   ? 0.134   17.479  -48.358 1.00 47.30 ? 1578 HOH A O     1 
HETATM 8751 O  O     . HOH I 6 .   ? 10.419  1.497   -66.666 1.00 26.12 ? 1579 HOH A O     1 
HETATM 8752 O  O     . HOH I 6 .   ? 29.455  25.770  -11.667 1.00 25.19 ? 1580 HOH A O     1 
HETATM 8753 O  O     . HOH I 6 .   ? 19.559  6.996   -57.096 1.00 35.18 ? 1581 HOH A O     1 
HETATM 8754 O  O     . HOH I 6 .   ? -8.349  12.235  -65.385 1.00 36.85 ? 1582 HOH A O     1 
HETATM 8755 O  O     . HOH I 6 .   ? 6.169   30.403  -31.212 1.00 41.73 ? 1583 HOH A O     1 
HETATM 8756 O  O     . HOH I 6 .   ? -28.058 26.321  -14.506 1.00 31.52 ? 1584 HOH A O     1 
HETATM 8757 O  O     . HOH I 6 .   ? -10.967 58.284  -45.081 1.00 29.36 ? 1585 HOH A O     1 
HETATM 8758 O  O     . HOH I 6 .   ? -7.560  15.420  -69.087 1.00 34.26 ? 1586 HOH A O     1 
HETATM 8759 O  O     . HOH I 6 .   ? 24.412  17.441  -61.813 1.00 37.60 ? 1587 HOH A O     1 
HETATM 8760 O  O     . HOH I 6 .   ? 18.289  32.163  -62.006 1.00 36.36 ? 1588 HOH A O     1 
HETATM 8761 O  O     . HOH I 6 .   ? -20.278 4.528   -57.865 1.00 43.42 ? 1589 HOH A O     1 
HETATM 8762 O  O     . HOH I 6 .   ? 9.598   25.222  -35.604 1.00 42.15 ? 1590 HOH A O     1 
HETATM 8763 O  O     . HOH I 6 .   ? 3.778   37.489  -56.245 1.00 30.80 ? 1591 HOH A O     1 
HETATM 8764 O  O     . HOH I 6 .   ? -22.004 13.382  -46.006 1.00 33.36 ? 1592 HOH A O     1 
HETATM 8765 O  O     . HOH I 6 .   ? -44.235 19.142  -25.706 1.00 21.35 ? 1593 HOH A O     1 
HETATM 8766 O  O     . HOH I 6 .   ? -3.408  26.890  -14.262 1.00 32.99 ? 1594 HOH A O     1 
HETATM 8767 O  O     . HOH I 6 .   ? -7.085  -12.363 -45.474 1.00 26.37 ? 1595 HOH A O     1 
HETATM 8768 O  O     . HOH I 6 .   ? 17.108  37.685  -51.461 1.00 31.26 ? 1596 HOH A O     1 
HETATM 8769 O  O     . HOH I 6 .   ? -3.244  10.911  -13.296 1.00 35.64 ? 1597 HOH A O     1 
HETATM 8770 O  O     . HOH I 6 .   ? -17.733 7.752   -19.481 1.00 28.44 ? 1598 HOH A O     1 
HETATM 8771 O  O     . HOH I 6 .   ? 17.905  38.406  -58.664 1.00 41.51 ? 1599 HOH A O     1 
HETATM 8772 O  O     . HOH I 6 .   ? -0.445  33.475  -44.105 1.00 40.81 ? 1600 HOH A O     1 
HETATM 8773 O  O     . HOH I 6 .   ? 33.212  30.748  -39.160 1.00 39.59 ? 1601 HOH A O     1 
HETATM 8774 O  O     . HOH I 6 .   ? -33.126 -18.258 -46.299 1.00 48.63 ? 1602 HOH A O     1 
HETATM 8775 O  O     . HOH I 6 .   ? 30.671  37.721  -39.585 1.00 31.25 ? 1603 HOH A O     1 
HETATM 8776 O  O     . HOH I 6 .   ? -8.924  55.023  -49.630 1.00 24.06 ? 1604 HOH A O     1 
HETATM 8777 O  O     . HOH I 6 .   ? -35.902 -13.706 -31.147 1.00 33.08 ? 1605 HOH A O     1 
HETATM 8778 O  O     . HOH I 6 .   ? -3.660  12.184  -35.038 1.00 35.42 ? 1606 HOH A O     1 
HETATM 8779 O  O     . HOH I 6 .   ? 0.120   46.899  -53.813 1.00 38.28 ? 1607 HOH A O     1 
HETATM 8780 O  O     . HOH I 6 .   ? -18.949 18.800  -43.426 1.00 40.69 ? 1608 HOH A O     1 
HETATM 8781 O  O     . HOH I 6 .   ? 21.087  35.261  -24.751 1.00 30.43 ? 1609 HOH A O     1 
HETATM 8782 O  O     . HOH I 6 .   ? 15.170  13.236  -29.988 1.00 35.73 ? 1610 HOH A O     1 
HETATM 8783 O  O     . HOH I 6 .   ? 14.296  4.910   -24.179 1.00 30.30 ? 1611 HOH A O     1 
HETATM 8784 O  O     . HOH I 6 .   ? -21.554 28.394  0.263   1.00 34.39 ? 1612 HOH A O     1 
HETATM 8785 O  O     . HOH I 6 .   ? -32.593 -26.573 -44.543 1.00 45.23 ? 1613 HOH A O     1 
HETATM 8786 O  O     . HOH I 6 .   ? -32.990 21.916  -19.812 1.00 27.86 ? 1614 HOH A O     1 
HETATM 8787 O  O     . HOH I 6 .   ? -5.591  29.118  -60.917 1.00 43.29 ? 1615 HOH A O     1 
HETATM 8788 O  O     . HOH I 6 .   ? -3.625  17.166  -74.569 1.00 29.49 ? 1616 HOH A O     1 
HETATM 8789 O  O     A HOH I 6 .   ? 9.994   1.473   -70.073 0.50 18.00 ? 1617 HOH A O     1 
HETATM 8790 O  O     B HOH I 6 .   ? 9.253   -0.452  -70.479 0.50 11.51 ? 1617 HOH A O     1 
HETATM 8791 O  O     . HOH I 6 .   ? -30.891 21.814  -18.259 1.00 27.49 ? 1618 HOH A O     1 
HETATM 8792 O  O     . HOH I 6 .   ? -0.540  25.333  -14.263 1.00 33.52 ? 1619 HOH A O     1 
HETATM 8793 O  O     . HOH I 6 .   ? -2.344  47.363  -54.710 1.00 26.87 ? 1620 HOH A O     1 
HETATM 8794 O  O     . HOH I 6 .   ? -14.977 -6.319  -33.975 1.00 30.47 ? 1621 HOH A O     1 
HETATM 8795 O  O     . HOH I 6 .   ? -11.943 -8.593  -31.515 1.00 29.02 ? 1622 HOH A O     1 
HETATM 8796 O  O     . HOH I 6 .   ? -13.514 33.513  -27.240 1.00 33.07 ? 1623 HOH A O     1 
HETATM 8797 O  O     . HOH I 6 .   ? -14.694 32.785  -25.030 1.00 34.64 ? 1624 HOH A O     1 
HETATM 8798 O  O     . HOH I 6 .   ? -15.998 34.676  -23.373 1.00 34.43 ? 1625 HOH A O     1 
HETATM 8799 O  O     . HOH I 6 .   ? 24.886  25.503  -8.164  1.00 11.83 ? 1626 HOH A O     1 
HETATM 8800 O  O     . HOH I 6 .   ? 23.609  26.722  -9.831  1.00 31.03 ? 1627 HOH A O     1 
HETATM 8801 O  O     . HOH I 6 .   ? -13.620 -13.270 -44.046 1.00 41.21 ? 1628 HOH A O     1 
HETATM 8802 O  O     . HOH I 6 .   ? -11.265 -12.304 -43.837 1.00 35.62 ? 1629 HOH A O     1 
HETATM 8803 O  O     . HOH I 6 .   ? -1.272  -2.586  -71.740 1.00 28.13 ? 1630 HOH A O     1 
HETATM 8804 O  O     . HOH I 6 .   ? -4.798  -0.335  -70.947 1.00 19.00 ? 1631 HOH A O     1 
HETATM 8805 O  O     . HOH I 6 .   ? -5.826  -2.937  -70.967 1.00 19.72 ? 1632 HOH A O     1 
HETATM 8806 O  O     . HOH I 6 .   ? -8.163  -3.202  -72.341 1.00 22.35 ? 1633 HOH A O     1 
HETATM 8807 O  O     . HOH I 6 .   ? -0.179  -6.091  -71.826 1.00 35.54 ? 1634 HOH A O     1 
HETATM 8808 O  O     . HOH I 6 .   ? -3.425  -9.254  -71.717 1.00 24.75 ? 1635 HOH A O     1 
HETATM 8809 O  O     . HOH I 6 .   ? 1.529   -12.175 -66.951 1.00 20.84 ? 1636 HOH A O     1 
HETATM 8810 O  O     . HOH I 6 .   ? 4.696   -10.909 -66.753 1.00 23.85 ? 1637 HOH A O     1 
HETATM 8811 O  O     . HOH I 6 .   ? -9.909  -12.462 -67.872 1.00 32.62 ? 1638 HOH A O     1 
HETATM 8812 O  O     . HOH I 6 .   ? -13.031 -6.022  -70.241 1.00 27.39 ? 1639 HOH A O     1 
HETATM 8813 O  O     . HOH I 6 .   ? -11.487 -6.186  -72.853 1.00 23.43 ? 1640 HOH A O     1 
HETATM 8814 O  O     . HOH I 6 .   ? 19.213  13.575  -74.871 1.00 15.96 ? 1641 HOH A O     1 
HETATM 8815 O  O     . HOH I 6 .   ? 20.919  11.898  -73.658 1.00 29.08 ? 1642 HOH A O     1 
HETATM 8816 O  O     . HOH I 6 .   ? 12.984  31.580  -44.450 1.00 31.21 ? 1643 HOH A O     1 
HETATM 8817 O  O     . HOH I 6 .   ? -4.114  26.627  -41.388 1.00 27.95 ? 1644 HOH A O     1 
HETATM 8818 O  O     . HOH I 6 .   ? -12.665 46.292  -37.439 1.00 37.42 ? 1645 HOH A O     1 
HETATM 8819 O  O     . HOH I 6 .   ? -2.069  23.565  -39.468 1.00 23.34 ? 1646 HOH A O     1 
HETATM 8820 O  O     . HOH I 6 .   ? -0.294  24.945  -41.407 1.00 30.86 ? 1647 HOH A O     1 
HETATM 8821 O  O     . HOH I 6 .   ? -2.428  28.830  -41.481 1.00 28.75 ? 1648 HOH A O     1 
HETATM 8822 O  O     . HOH I 6 .   ? 4.295   37.607  -47.567 1.00 27.57 ? 1649 HOH A O     1 
HETATM 8823 O  O     . HOH I 6 .   ? 22.405  13.123  -61.813 1.00 25.76 ? 1650 HOH A O     1 
HETATM 8824 O  O     . HOH I 6 .   ? 20.152  16.684  -62.047 1.00 21.48 ? 1651 HOH A O     1 
HETATM 8825 O  O     . HOH I 6 .   ? 17.895  16.182  -63.287 1.00 36.22 ? 1652 HOH A O     1 
HETATM 8826 O  O     . HOH I 6 .   ? 25.914  13.727  -58.804 1.00 37.21 ? 1653 HOH A O     1 
HETATM 8827 O  O     . HOH I 6 .   ? 12.708  30.888  -39.021 1.00 28.91 ? 1654 HOH A O     1 
HETATM 8828 O  O     A HOH I 6 .   ? -14.807 -0.153  -67.037 0.50 12.62 ? 1655 HOH A O     1 
HETATM 8829 O  O     B HOH I 6 .   ? -12.687 -0.014  -66.550 0.50 12.98 ? 1655 HOH A O     1 
HETATM 8830 O  O     . HOH I 6 .   ? 35.670  35.322  -34.734 1.00 27.84 ? 1656 HOH A O     1 
HETATM 8831 O  O     . HOH I 6 .   ? 10.198  6.110   -69.469 1.00 37.05 ? 1657 HOH A O     1 
HETATM 8832 O  O     . HOH I 6 .   ? -31.025 -15.601 -23.841 1.00 24.49 ? 1658 HOH A O     1 
HETATM 8833 O  O     . HOH I 6 .   ? 6.492   41.362  -55.742 1.00 34.19 ? 1659 HOH A O     1 
HETATM 8834 O  O     . HOH I 6 .   ? -15.230 -13.071 -50.087 1.00 29.08 ? 1660 HOH A O     1 
HETATM 8835 O  O     . HOH I 6 .   ? 2.730   0.299   -73.051 1.00 24.95 ? 1661 HOH A O     1 
HETATM 8836 O  O     . HOH I 6 .   ? 19.715  32.002  -8.807  1.00 25.17 ? 1662 HOH A O     1 
HETATM 8837 O  O     A HOH I 6 .   ? 6.645   -6.409  -45.142 0.50 13.79 ? 1663 HOH A O     1 
HETATM 8838 O  O     B HOH I 6 .   ? 6.283   -8.122  -45.153 0.50 16.40 ? 1663 HOH A O     1 
HETATM 8839 O  O     . HOH I 6 .   ? -2.143  32.759  -60.187 1.00 28.44 ? 1664 HOH A O     1 
HETATM 8840 O  O     . HOH I 6 .   ? -7.126  32.803  -57.754 1.00 33.67 ? 1665 HOH A O     1 
HETATM 8841 O  O     . HOH I 6 .   ? -9.103  29.976  -58.135 1.00 38.69 ? 1666 HOH A O     1 
HETATM 8842 O  O     . HOH I 6 .   ? 22.962  37.969  -51.574 1.00 43.17 ? 1667 HOH A O     1 
HETATM 8843 O  O     . HOH I 6 .   ? 25.610  36.989  -52.565 1.00 30.92 ? 1668 HOH A O     1 
HETATM 8844 O  O     . HOH I 6 .   ? 25.388  38.450  -49.221 1.00 42.35 ? 1669 HOH A O     1 
HETATM 8845 O  O     . HOH I 6 .   ? -0.863  20.094  -41.347 1.00 35.53 ? 1670 HOH A O     1 
HETATM 8846 O  O     . HOH I 6 .   ? -24.975 -4.224  -54.683 1.00 37.01 ? 1671 HOH A O     1 
HETATM 8847 O  O     . HOH I 6 .   ? -22.485 0.339   -59.555 1.00 41.98 ? 1672 HOH A O     1 
HETATM 8848 O  O     . HOH I 6 .   ? -17.282 -13.726 -25.384 1.00 30.46 ? 1673 HOH A O     1 
HETATM 8849 O  O     . HOH I 6 .   ? 17.194  32.674  -31.908 1.00 26.08 ? 1674 HOH A O     1 
HETATM 8850 O  O     . HOH I 6 .   ? -2.611  11.732  -30.970 1.00 32.64 ? 1675 HOH A O     1 
HETATM 8851 O  O     . HOH I 6 .   ? 28.777  4.771   -11.300 1.00 37.85 ? 1676 HOH A O     1 
HETATM 8852 O  O     . HOH I 6 .   ? 18.301  15.008  -35.669 1.00 23.99 ? 1677 HOH A O     1 
HETATM 8853 O  O     . HOH I 6 .   ? -20.765 16.245  -48.986 1.00 41.32 ? 1678 HOH A O     1 
HETATM 8854 O  O     . HOH I 6 .   ? -20.174 18.659  -50.702 1.00 56.33 ? 1679 HOH A O     1 
HETATM 8855 O  O     . HOH I 6 .   ? -6.736  9.698   -26.273 1.00 46.52 ? 1680 HOH A O     1 
HETATM 8856 O  O     . HOH I 6 .   ? -4.043  16.225  -56.757 1.00 39.43 ? 1681 HOH A O     1 
HETATM 8857 O  O     . HOH I 6 .   ? 0.140   32.423  -40.313 1.00 41.71 ? 1682 HOH A O     1 
HETATM 8858 O  O     . HOH I 6 .   ? 33.652  43.608  -35.965 1.00 47.79 ? 1683 HOH A O     1 
HETATM 8859 O  O     . HOH I 6 .   ? 32.200  42.632  -38.028 1.00 36.69 ? 1684 HOH A O     1 
HETATM 8860 O  O     . HOH I 6 .   ? -22.366 27.901  -47.675 1.00 33.87 ? 1685 HOH A O     1 
HETATM 8861 O  O     . HOH I 6 .   ? -14.073 14.830  -60.208 1.00 41.67 ? 1686 HOH A O     1 
HETATM 8862 O  O     . HOH I 6 .   ? -11.658 15.397  -61.988 1.00 39.98 ? 1687 HOH A O     1 
HETATM 8863 O  O     . HOH I 6 .   ? -42.147 -18.353 -45.397 1.00 32.24 ? 1688 HOH A O     1 
HETATM 8864 O  O     . HOH I 6 .   ? -6.341  42.663  0.039   1.00 29.26 ? 1689 HOH A O     1 
HETATM 8865 O  O     . HOH I 6 .   ? 28.676  25.533  -59.184 1.00 35.93 ? 1690 HOH A O     1 
HETATM 8866 O  O     . HOH I 6 .   ? 29.038  23.228  -57.712 1.00 35.41 ? 1691 HOH A O     1 
HETATM 8867 O  O     . HOH I 6 .   ? 26.832  18.530  -60.546 1.00 38.55 ? 1692 HOH A O     1 
HETATM 8868 O  O     . HOH I 6 .   ? -25.668 15.152  -11.880 1.00 25.39 ? 1693 HOH A O     1 
HETATM 8869 O  O     . HOH I 6 .   ? -20.570 38.103  -46.099 1.00 40.57 ? 1694 HOH A O     1 
HETATM 8870 O  O     . HOH I 6 .   ? 7.639   37.036  -57.902 1.00 25.76 ? 1695 HOH A O     1 
HETATM 8871 O  O     . HOH I 6 .   ? -30.444 26.613  -20.496 1.00 34.94 ? 1696 HOH A O     1 
HETATM 8872 O  O     . HOH I 6 .   ? 45.534  25.665  -51.463 1.00 35.15 ? 1697 HOH A O     1 
HETATM 8873 O  O     . HOH I 6 .   ? -18.894 41.977  -12.562 1.00 25.90 ? 1698 HOH A O     1 
HETATM 8874 O  O     . HOH I 6 .   ? -6.717  43.288  -54.907 1.00 30.48 ? 1699 HOH A O     1 
HETATM 8875 O  O     . HOH I 6 .   ? 3.938   24.118  -44.443 1.00 47.03 ? 1700 HOH A O     1 
HETATM 8876 O  O     . HOH I 6 .   ? -10.329 17.192  -54.975 1.00 28.98 ? 1701 HOH A O     1 
HETATM 8877 O  O     . HOH I 6 .   ? -25.608 39.376  -20.420 1.00 50.43 ? 1702 HOH A O     1 
HETATM 8878 O  O     . HOH I 6 .   ? -8.368  -14.453 -66.636 1.00 32.44 ? 1703 HOH A O     1 
HETATM 8879 O  O     . HOH I 6 .   ? 2.669   43.178  -12.909 1.00 31.06 ? 1704 HOH A O     1 
HETATM 8880 O  O     . HOH I 6 .   ? -18.454 24.714  -27.391 1.00 41.36 ? 1705 HOH A O     1 
HETATM 8881 O  O     . HOH I 6 .   ? -13.955 24.407  -24.804 1.00 33.68 ? 1706 HOH A O     1 
HETATM 8882 O  O     . HOH I 6 .   ? -15.855 40.132  -8.155  1.00 31.36 ? 1707 HOH A O     1 
HETATM 8883 O  O     . HOH I 6 .   ? 19.694  11.974  -63.157 1.00 33.64 ? 1708 HOH A O     1 
HETATM 8884 O  O     . HOH I 6 .   ? -19.213 24.302  -42.937 1.00 28.54 ? 1709 HOH A O     1 
HETATM 8885 O  O     . HOH I 6 .   ? 29.934  20.927  -47.443 1.00 30.93 ? 1710 HOH A O     1 
HETATM 8886 O  O     . HOH I 6 .   ? -16.365 30.883  -55.880 1.00 27.84 ? 1711 HOH A O     1 
HETATM 8887 O  O     . HOH I 6 .   ? 34.608  26.415  -54.939 1.00 38.39 ? 1712 HOH A O     1 
HETATM 8888 O  O     . HOH I 6 .   ? -16.271 39.112  -42.919 1.00 22.10 ? 1713 HOH A O     1 
HETATM 8889 O  O     . HOH I 6 .   ? -28.960 7.135   -11.729 1.00 24.11 ? 1714 HOH A O     1 
HETATM 8890 O  O     . HOH I 6 .   ? -8.370  -8.622  -71.027 1.00 33.92 ? 1715 HOH A O     1 
HETATM 8891 O  O     . HOH I 6 .   ? -7.093  21.283  5.349   1.00 32.13 ? 1716 HOH A O     1 
HETATM 8892 O  O     . HOH I 6 .   ? -30.165 19.360  -13.632 1.00 35.13 ? 1717 HOH A O     1 
HETATM 8893 O  O     . HOH I 6 .   ? 20.226  20.732  -67.828 1.00 32.79 ? 1718 HOH A O     1 
HETATM 8894 O  O     . HOH I 6 .   ? -3.704  -16.602 -54.928 1.00 36.20 ? 1719 HOH A O     1 
HETATM 8895 O  O     . HOH I 6 .   ? 34.091  28.285  -51.096 1.00 30.16 ? 1720 HOH A O     1 
HETATM 8896 O  O     . HOH I 6 .   ? -23.402 28.025  -7.551  1.00 39.57 ? 1721 HOH A O     1 
HETATM 8897 O  O     . HOH I 6 .   ? 18.179  13.928  -78.997 1.00 28.65 ? 1722 HOH A O     1 
HETATM 8898 O  O     . HOH I 6 .   ? 3.797   28.658  -14.906 1.00 43.43 ? 1723 HOH A O     1 
HETATM 8899 O  O     A HOH I 6 .   ? -0.300  21.568  -10.399 0.50 22.27 ? 1724 HOH A O     1 
HETATM 8900 O  O     B HOH I 6 .   ? -0.585  21.231  -12.460 0.50 25.31 ? 1724 HOH A O     1 
HETATM 8901 O  O     . HOH I 6 .   ? 25.826  38.707  -28.716 1.00 18.67 ? 1725 HOH A O     1 
HETATM 8902 O  O     . HOH I 6 .   ? -3.104  50.594  -54.081 1.00 26.26 ? 1726 HOH A O     1 
HETATM 8903 O  O     . HOH I 6 .   ? 21.578  5.872   -49.518 1.00 53.91 ? 1727 HOH A O     1 
HETATM 8904 O  O     . HOH I 6 .   ? -19.069 -9.883  -26.002 1.00 30.99 ? 1728 HOH A O     1 
HETATM 8905 O  O     . HOH I 6 .   ? -5.897  37.607  -24.745 1.00 38.72 ? 1729 HOH A O     1 
HETATM 8906 O  O     . HOH I 6 .   ? 7.380   7.830   -76.276 1.00 35.49 ? 1730 HOH A O     1 
HETATM 8907 O  O     . HOH I 6 .   ? 7.713   36.672  -3.869  1.00 32.47 ? 1731 HOH A O     1 
HETATM 8908 O  O     . HOH I 6 .   ? 28.181  4.963   -17.889 1.00 29.25 ? 1732 HOH A O     1 
HETATM 8909 O  O     . HOH I 6 .   ? -17.046 22.237  -39.845 1.00 41.37 ? 1733 HOH A O     1 
HETATM 8910 O  O     . HOH I 6 .   ? -4.077  9.572   -32.543 1.00 30.24 ? 1734 HOH A O     1 
HETATM 8911 O  O     . HOH I 6 .   ? -1.374  28.463  -39.069 1.00 40.32 ? 1735 HOH A O     1 
HETATM 8912 O  O     . HOH I 6 .   ? 5.216   21.551  -35.358 1.00 40.16 ? 1736 HOH A O     1 
HETATM 8913 O  O     . HOH I 6 .   ? -17.959 37.444  -4.422  1.00 35.53 ? 1737 HOH A O     1 
HETATM 8914 O  O     . HOH I 6 .   ? -29.548 29.965  -28.585 1.00 37.62 ? 1738 HOH A O     1 
HETATM 8915 O  O     . HOH I 6 .   ? -13.087 -15.984 -60.870 1.00 46.12 ? 1739 HOH A O     1 
HETATM 8916 O  O     . HOH I 6 .   ? 10.899  15.859  -29.628 1.00 34.35 ? 1740 HOH A O     1 
HETATM 8917 O  O     . HOH J 6 .   ? 4.018   3.617   -46.542 1.00 12.65 ? 19   HOH T O     1 
HETATM 8918 O  O     . HOH J 6 .   ? 6.691   5.833   -46.933 1.00 13.18 ? 20   HOH T O     1 
HETATM 8919 O  O     . HOH J 6 .   ? 17.809  7.975   -48.836 1.00 12.03 ? 26   HOH T O     1 
HETATM 8920 O  O     . HOH J 6 .   ? 23.858  7.685   -22.920 1.00 19.04 ? 58   HOH T O     1 
HETATM 8921 O  O     . HOH J 6 .   ? 4.449   -3.813  -41.337 1.00 17.49 ? 61   HOH T O     1 
HETATM 8922 O  O     . HOH J 6 .   ? 45.038  -5.510  -30.595 1.00 2.00  ? 75   HOH T O     1 
HETATM 8923 O  O     . HOH J 6 .   ? 10.423  2.051   -51.557 1.00 13.54 ? 90   HOH T O     1 
HETATM 8924 O  O     . HOH J 6 .   ? 6.212   2.516   -39.012 1.00 14.69 ? 96   HOH T O     1 
HETATM 8925 O  O     . HOH J 6 .   ? 6.718   -3.569  -42.598 1.00 26.32 ? 108  HOH T O     1 
HETATM 8926 O  O     . HOH J 6 .   ? 0.259   8.310   -38.084 1.00 18.34 ? 109  HOH T O     1 
HETATM 8927 O  O     . HOH J 6 .   ? 13.624  2.467   -39.060 1.00 18.58 ? 118  HOH T O     1 
HETATM 8928 O  O     . HOH J 6 .   ? 4.922   0.101   -38.950 1.00 4.04  ? 129  HOH T O     1 
HETATM 8929 O  O     . HOH J 6 .   ? 0.026   -2.421  -36.341 1.00 10.87 ? 134  HOH T O     1 
HETATM 8930 O  O     . HOH J 6 .   ? 15.119  2.969   -41.251 1.00 12.68 ? 177  HOH T O     1 
HETATM 8931 O  O     . HOH J 6 .   ? -4.540  -1.728  -29.531 1.00 36.15 ? 178  HOH T O     1 
HETATM 8932 O  O     . HOH J 6 .   ? 19.822  12.018  -46.452 1.00 24.76 ? 185  HOH T O     1 
HETATM 8933 O  O     . HOH J 6 .   ? 12.157  0.523   -52.787 1.00 18.37 ? 203  HOH T O     1 
HETATM 8934 O  O     . HOH J 6 .   ? 16.523  2.305   -45.613 1.00 17.22 ? 239  HOH T O     1 
HETATM 8935 O  O     . HOH J 6 .   ? 24.185  15.310  -35.008 1.00 19.54 ? 241  HOH T O     1 
HETATM 8936 O  O     . HOH J 6 .   ? 1.985   -0.333  -36.724 1.00 9.03  ? 247  HOH T O     1 
HETATM 8937 O  O     . HOH J 6 .   ? -0.561  5.915   -36.984 1.00 17.42 ? 252  HOH T O     1 
HETATM 8938 O  O     . HOH J 6 .   ? 0.949   2.257   -35.932 1.00 23.19 ? 258  HOH T O     1 
HETATM 8939 O  O     . HOH J 6 .   ? -17.305 -4.058  -30.576 1.00 23.72 ? 271  HOH T O     1 
HETATM 8940 O  O     . HOH J 6 .   ? -7.360  5.191   -30.240 1.00 24.44 ? 290  HOH T O     1 
HETATM 8941 O  O     . HOH J 6 .   ? 0.599   0.908   -45.484 1.00 26.72 ? 299  HOH T O     1 
HETATM 8942 O  O     . HOH J 6 .   ? 3.418   5.797   -37.341 1.00 21.60 ? 307  HOH T O     1 
HETATM 8943 O  O     . HOH J 6 .   ? 5.743   -4.150  -38.909 1.00 21.87 ? 312  HOH T O     1 
HETATM 8944 O  O     . HOH J 6 .   ? -5.634  5.681   -33.439 1.00 26.06 ? 320  HOH T O     1 
HETATM 8945 O  O     . HOH J 6 .   ? 16.154  11.316  -39.171 1.00 20.94 ? 371  HOH T O     1 
HETATM 8946 O  O     . HOH J 6 .   ? -2.096  2.879   -44.600 1.00 26.14 ? 395  HOH T O     1 
HETATM 8947 O  O     . HOH J 6 .   ? 12.914  8.790   -43.091 1.00 28.30 ? 396  HOH T O     1 
HETATM 8948 O  O     . HOH J 6 .   ? -4.604  2.013   -31.497 1.00 25.25 ? 420  HOH T O     1 
HETATM 8949 O  O     . HOH J 6 .   ? 1.385   -4.875  -38.861 1.00 27.21 ? 431  HOH T O     1 
HETATM 8950 O  O     . HOH J 6 .   ? 8.706   -1.668  -48.641 1.00 18.39 ? 437  HOH T O     1 
HETATM 8951 O  O     . HOH J 6 .   ? 25.998  13.655  -33.821 1.00 29.20 ? 438  HOH T O     1 
HETATM 8952 O  O     . HOH J 6 .   ? 3.462   -5.018  -37.161 1.00 29.76 ? 457  HOH T O     1 
HETATM 8953 O  O     . HOH J 6 .   ? -1.921  4.510   -35.470 1.00 33.24 ? 476  HOH T O     1 
HETATM 8954 O  O     . HOH J 6 .   ? 18.809  4.979   -43.241 1.00 23.69 ? 493  HOH T O     1 
HETATM 8955 O  O     . HOH J 6 .   ? 41.291  3.559   -30.849 1.00 22.95 ? 505  HOH T O     1 
HETATM 8956 O  O     . HOH J 6 .   ? -2.932  5.543   -33.298 1.00 22.53 ? 520  HOH T O     1 
HETATM 8957 O  O     . HOH J 6 .   ? 30.221  5.391   -29.905 1.00 26.19 ? 559  HOH T O     1 
HETATM 8958 O  O     . HOH J 6 .   ? 27.983  9.476   -28.843 1.00 26.63 ? 567  HOH T O     1 
HETATM 8959 O  O     . HOH J 6 .   ? 17.462  11.560  -35.526 1.00 32.93 ? 588  HOH T O     1 
HETATM 8960 O  O     . HOH J 6 .   ? 21.320  7.944   -45.394 1.00 22.65 ? 615  HOH T O     1 
HETATM 8961 O  O     . HOH J 6 .   ? 23.745  15.434  -39.216 1.00 28.24 ? 620  HOH T O     1 
HETATM 8962 O  O     . HOH J 6 .   ? 19.916  9.348   -47.389 1.00 19.43 ? 667  HOH T O     1 
HETATM 8963 O  O     . HOH J 6 .   ? 27.166  6.574   -36.793 1.00 45.15 ? 668  HOH T O     1 
HETATM 8964 O  O     . HOH J 6 .   ? -11.968 -6.030  -27.588 1.00 23.38 ? 687  HOH T O     1 
HETATM 8965 O  O     . HOH J 6 .   ? 35.451  -1.651  -28.148 1.00 38.54 ? 713  HOH T O     1 
HETATM 8966 O  O     . HOH J 6 .   ? 28.600  5.780   -27.853 1.00 26.65 ? 759  HOH T O     1 
HETATM 8967 O  O     . HOH J 6 .   ? 41.899  0.681   -32.343 1.00 29.77 ? 773  HOH T O     1 
HETATM 8968 O  O     . HOH J 6 .   ? 9.356   -0.457  -38.923 1.00 45.72 ? 820  HOH T O     1 
HETATM 8969 O  O     . HOH J 6 .   ? 1.420   4.815   -35.813 1.00 21.07 ? 821  HOH T O     1 
HETATM 8970 O  O     . HOH J 6 .   ? -5.363  4.397   -28.871 1.00 39.45 ? 822  HOH T O     1 
HETATM 8971 O  O     . HOH J 6 .   ? 8.812   -7.978  -42.127 1.00 30.81 ? 827  HOH T O     1 
HETATM 8972 O  O     . HOH J 6 .   ? -4.478  -0.081  -27.428 1.00 32.74 ? 885  HOH T O     1 
HETATM 8973 O  O     . HOH J 6 .   ? 8.397   -5.231  -41.642 1.00 33.29 ? 886  HOH T O     1 
HETATM 8974 O  O     . HOH J 6 .   ? 30.978  -4.507  -34.288 1.00 38.38 ? 888  HOH T O     1 
HETATM 8975 O  O     . HOH J 6 .   ? -14.682 -4.844  -30.668 1.00 28.77 ? 911  HOH T O     1 
HETATM 8976 O  O     . HOH K 6 .   ? 13.422  -0.641  -31.058 1.00 31.60 ? 53   HOH P O     1 
HETATM 8977 O  O     . HOH K 6 .   ? 7.866   19.559  -42.478 1.00 19.43 ? 77   HOH P O     1 
HETATM 8978 O  O     . HOH K 6 .   ? 0.494   12.771  -40.930 1.00 13.58 ? 116  HOH P O     1 
HETATM 8979 O  O     . HOH K 6 .   ? 3.049   9.353   -37.874 1.00 25.25 ? 232  HOH P O     1 
HETATM 8980 O  O     . HOH K 6 .   ? 11.425  10.644  -42.320 1.00 25.43 ? 272  HOH P O     1 
HETATM 8981 O  O     . HOH K 6 .   ? 4.697   16.990  -49.385 1.00 26.90 ? 286  HOH P O     1 
HETATM 8982 O  O     . HOH K 6 .   ? 5.361   20.466  -42.920 1.00 26.43 ? 304  HOH P O     1 
HETATM 8983 O  O     . HOH K 6 .   ? 5.443   6.682   -36.198 1.00 19.40 ? 339  HOH P O     1 
HETATM 8984 O  O     . HOH K 6 .   ? 8.115   18.885  -35.797 1.00 25.41 ? 344  HOH P O     1 
HETATM 8985 O  O     . HOH K 6 .   ? 12.661  11.446  -39.080 1.00 20.63 ? 460  HOH P O     1 
HETATM 8986 O  O     . HOH K 6 .   ? 4.737   7.446   -33.859 1.00 23.32 ? 497  HOH P O     1 
HETATM 8987 O  O     . HOH K 6 .   ? 35.069  3.067   -39.296 1.00 37.94 ? 516  HOH P O     1 
HETATM 8988 O  O     . HOH K 6 .   ? 13.183  2.672   -24.413 1.00 35.77 ? 549  HOH P O     1 
HETATM 8989 O  O     . HOH K 6 .   ? 3.898   15.913  -45.812 1.00 29.26 ? 581  HOH P O     1 
HETATM 8990 O  O     . HOH K 6 .   ? 15.092  11.015  -33.786 1.00 29.07 ? 646  HOH P O     1 
HETATM 8991 O  O     . HOH K 6 .   ? 3.996   11.344  -39.075 1.00 26.66 ? 647  HOH P O     1 
HETATM 8992 O  O     . HOH K 6 .   ? 5.577   13.705  -36.878 1.00 34.38 ? 651  HOH P O     1 
HETATM 8993 O  O     . HOH K 6 .   ? 2.382   14.289  -44.569 1.00 22.36 ? 672  HOH P O     1 
HETATM 8994 O  O     . HOH K 6 .   ? 8.556   3.800   -34.782 1.00 33.15 ? 706  HOH P O     1 
HETATM 8995 O  O     . HOH K 6 .   ? 29.253  -5.056  -36.894 1.00 37.26 ? 889  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 TRP 205 205 205 TRP TRP A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 LYS 208 208 208 LYS LYS A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 PHE 221 221 221 PHE PHE A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 ARG 241 241 241 ARG ARG A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 ARG 249 249 249 ARG ARG A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 MET 256 256 256 MET MET A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 TYR 277 277 277 TYR TYR A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PHE 282 282 282 PHE PHE A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 ASN 284 284 284 ASN ASN A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 ASP 291 291 291 ASP ASP A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 SER 294 294 294 SER SER A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 PHE 296 296 296 PHE PHE A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 LYS 302 302 302 LYS LYS A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 TYR 305 305 305 TYR TYR A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 PRO 308 308 308 PRO PRO A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 SER 315 315 315 SER SER A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 HIS 317 317 317 HIS HIS A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ARG 319 319 319 ARG ARG A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 TYR 329 329 329 TYR TYR A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 GLN 333 333 333 GLN GLN A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 ASP 335 335 335 ASP ASP A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LYS 337 337 337 LYS LYS A . n 
A 1 338 ARG 338 338 338 ARG ARG A . n 
A 1 339 GLN 339 339 339 GLN GLN A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 TYR 349 349 349 TYR TYR A . n 
A 1 350 TYR 350 350 350 TYR TYR A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 LYS 352 352 352 LYS LYS A . n 
A 1 353 ILE 353 353 353 ILE ILE A . n 
A 1 354 GLN 354 354 354 GLN GLN A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 GLN 356 356 356 GLN GLN A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 ILE 362 362 362 ILE ILE A . n 
A 1 363 LYS 363 363 363 LYS LYS A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 PHE 370 370 370 PHE PHE A . n 
A 1 371 ASN 371 371 371 ASN ASN A . n 
A 1 372 SER 372 372 372 SER SER A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 GLN 376 376 376 GLN GLN A . n 
A 1 377 ASN 377 377 377 ASN ASN A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 PRO 381 381 381 PRO PRO A . n 
A 1 382 GLN 382 382 382 GLN GLN A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 ARG 384 384 384 ARG ARG A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 HIS 386 386 386 HIS HIS A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 GLN 389 389 389 GLN GLN A . n 
A 1 390 PRO 390 390 390 PRO PRO A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLY 393 393 393 GLY GLY A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 PHE 395 395 395 PHE PHE A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 LYS 397 397 397 LYS LYS A . n 
A 1 398 GLU 398 398 398 GLU GLU A . n 
A 1 399 PRO 399 399 399 PRO PRO A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 ASN 402 402 402 ASN ASN A . n 
A 1 403 ARG 403 403 403 ARG ARG A . n 
A 1 404 TYR 404 404 404 TYR TYR A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 TYR 406 406 406 TYR TYR A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 MET 408 408 408 MET MET A . n 
A 1 409 SER 409 409 409 SER SER A . n 
A 1 410 PHE 410 410 410 PHE PHE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 LEU 412 412 412 LEU LEU A . n 
A 1 413 THR 413 413 413 THR THR A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 ILE 419 419 419 ILE ILE A . n 
A 1 420 ILE 420 420 420 ILE ILE A . n 
A 1 421 ARG 421 421 421 ARG ARG A . n 
A 1 422 GLN 422 422 422 GLN GLN A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ILE 425 425 425 ILE ILE A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 GLU 428 428 428 GLU GLU A . n 
A 1 429 THR 429 429 429 THR THR A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 THR 433 433 433 THR THR A . n 
A 1 434 PHE 434 434 434 PHE PHE A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 PRO 438 438 438 PRO PRO A . n 
A 1 439 LEU 439 439 439 LEU LEU A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 ASP 441 441 441 ASP ASP A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 ILE 443 443 443 ILE ILE A . n 
A 1 444 ASN 444 444 444 ASN ASN A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 VAL 446 446 446 VAL VAL A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 GLU 448 448 448 GLU GLU A . n 
A 1 449 ARG 449 449 449 ARG ARG A . n 
A 1 450 PRO 450 450 450 PRO PRO A . n 
A 1 451 SER 451 451 451 SER SER A . n 
A 1 452 ASP 452 452 452 ASP ASP A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 TYR 454 454 454 TYR TYR A . n 
A 1 455 SER 455 455 455 SER SER A . n 
A 1 456 CYS 456 456 456 CYS CYS A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 ASN 459 459 459 ASN ASN A . n 
A 1 460 GLY 460 460 460 GLY GLY A . n 
A 1 461 MET 461 461 461 MET MET A . n 
A 1 462 MET 462 462 462 MET MET A . n 
A 1 463 TYR 463 463 463 TYR TYR A . n 
A 1 464 TYR 464 464 464 TYR TYR A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 ASP 466 466 466 ASP ASP A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 GLY 469 469 469 GLY GLY A . n 
A 1 470 VAL 470 470 470 VAL VAL A . n 
A 1 471 VAL 471 471 471 VAL VAL A . n 
A 1 472 PRO 472 472 472 PRO PRO A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 ILE 475 475 475 ILE ILE A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 PHE 479 479 479 PHE PHE A . n 
A 1 480 ASN 480 480 480 ASN ASN A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 LYS 483 483 483 LYS LYS A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 HIS 485 485 485 HIS HIS A . n 
A 1 486 LYS 486 486 486 LYS LYS A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 MET 489 489 489 MET MET A . n 
A 1 490 LEU 490 490 490 LEU LEU A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 ALA 492 492 492 ALA ALA A . n 
A 1 493 GLN 493 493 493 GLN GLN A . n 
A 1 494 ARG 494 494 494 ARG ARG A . n 
A 1 495 ASN 495 495 495 ASN ASN A . n 
A 1 496 GLY 496 496 496 GLY GLY A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 ILE 498 498 498 ILE ILE A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 LYS 500 500 500 LYS LYS A . n 
A 1 501 GLU 501 501 501 GLU GLU A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 HIS 504 504 504 HIS HIS A . n 
A 1 505 ASN 505 505 505 ASN ASN A . n 
A 1 506 PRO 506 506 506 PRO PRO A . n 
A 1 507 ASN 507 507 507 ASN ASN A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 SER 509 509 509 SER SER A . n 
A 1 510 VAL 510 510 510 VAL VAL A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLU 512 512 512 GLU GLU A . n 
A 1 513 PRO 513 513 513 PRO PRO A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 TYR 518 518 518 TYR TYR A . n 
A 1 519 ARG 519 519 519 ARG ARG A . n 
A 1 520 PHE 520 520 520 PHE PHE A . n 
A 1 521 ASP 521 521 521 ASP ASP A . n 
A 1 522 PHE 522 522 522 PHE PHE A . n 
A 1 523 SER 523 523 523 SER SER A . n 
A 1 524 ASP 524 524 524 ASP ASP A . n 
A 1 525 GLU 525 525 525 GLU GLU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 LYS 529 529 529 LYS LYS A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 LYS 531 531 531 LYS LYS A . n 
A 1 532 LYS 532 532 532 LYS LYS A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 SER 534 534 534 SER SER A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LYS 536 536 536 LYS LYS A . n 
A 1 537 SER 537 537 537 SER SER A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 ASN 539 539 539 ASN ASN A . n 
A 1 540 GLU 540 540 540 GLU GLU A . n 
A 1 541 MET 541 541 541 MET MET A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 PHE 543 543 543 PHE PHE A . n 
A 1 544 ARG 544 544 544 ARG ARG A . n 
A 1 545 ALA 545 545 545 ALA ALA A . n 
A 1 546 GLN 546 546 546 GLN GLN A . n 
A 1 547 ARG 547 547 547 ARG ARG A . n 
A 1 548 THR 548 548 548 THR THR A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 VAL 550 550 550 VAL VAL A . n 
A 1 551 ALA 551 551 551 ALA ALA A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 MET 553 553 553 MET MET A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 GLN 556 556 556 GLN GLN A . n 
A 1 557 ILE 557 557 557 ILE ILE A . n 
A 1 558 ASN 558 558 558 ASN ASN A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 LYS 560 560 560 LYS LYS A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 LEU 562 562 562 LEU LEU A . n 
A 1 563 ILE 563 563 563 ILE ILE A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 GLY 565 565 565 GLY GLY A . n 
A 1 566 LEU 566 566 566 LEU LEU A . n 
A 1 567 ALA 567 567 567 ALA ALA A . n 
A 1 568 GLY 568 568 568 GLY GLY A . n 
A 1 569 ALA 569 569 569 ALA ALA A . n 
A 1 570 LEU 570 570 570 LEU LEU A . n 
A 1 571 GLY 571 571 571 GLY GLY A . n 
A 1 572 ASN 572 572 572 ASN ASN A . n 
A 1 573 VAL 573 573 573 VAL VAL A . n 
A 1 574 TRP 574 574 574 TRP TRP A . n 
A 1 575 PHE 575 575 575 PHE PHE A . n 
A 1 576 ARG 576 576 576 ARG ARG A . n 
A 1 577 TYR 577 577 577 TYR TYR A . n 
A 1 578 TYR 578 578 578 TYR TYR A . n 
A 1 579 ASP 579 579 579 ASP ASP A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 ARG 581 581 581 ARG ARG A . n 
A 1 582 ASN 582 582 582 ASN ASN A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 THR 584 584 584 THR THR A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 ILE 586 586 586 ILE ILE A . n 
A 1 587 THR 587 587 587 THR THR A . n 
A 1 588 THR 588 588 588 THR THR A . n 
A 1 589 PHE 589 589 589 PHE PHE A . n 
A 1 590 GLY 590 590 590 GLY GLY A . n 
A 1 591 GLN 591 591 591 GLN GLN A . n 
A 1 592 MET 592 592 592 MET MET A . n 
A 1 593 ALA 593 593 593 ALA ALA A . n 
A 1 594 LEU 594 594 594 LEU LEU A . n 
A 1 595 GLN 595 595 595 GLN GLN A . n 
A 1 596 TRP 596 596 596 TRP TRP A . n 
A 1 597 ILE 597 597 597 ILE ILE A . n 
A 1 598 GLU 598 598 598 GLU GLU A . n 
A 1 599 ARG 599 599 599 ARG ARG A . n 
A 1 600 LYS 600 600 600 LYS LYS A . n 
A 1 601 VAL 601 601 601 VAL VAL A . n 
A 1 602 ASN 602 602 602 ASN ASN A . n 
A 1 603 GLU 603 603 603 GLU GLU A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 LEU 605 605 605 LEU LEU A . n 
A 1 606 ASN 606 606 606 ASN ASN A . n 
A 1 607 GLU 607 607 607 GLU GLU A . n 
A 1 608 VAL 608 608 608 VAL VAL A . n 
A 1 609 CYS 609 609 609 CYS CYS A . n 
A 1 610 GLY 610 610 610 GLY GLY A . n 
A 1 611 THR 611 611 611 THR THR A . n 
A 1 612 GLU 612 612 612 GLU GLU A . n 
A 1 613 GLY 613 613 613 GLY GLY A . n 
A 1 614 GLU 614 614 614 GLU GLU A . n 
A 1 615 ALA 615 615 615 ALA ALA A . n 
A 1 616 PHE 616 616 616 PHE PHE A . n 
A 1 617 VAL 617 617 617 VAL VAL A . n 
A 1 618 LEU 618 618 618 LEU LEU A . n 
A 1 619 TYR 619 619 619 TYR TYR A . n 
A 1 620 GLY 620 620 620 GLY GLY A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 ASP 623 623 623 ASP ASP A . n 
A 1 624 SER 624 624 624 SER SER A . n 
A 1 625 ILE 625 625 625 ILE ILE A . n 
A 1 626 TYR 626 626 626 TYR TYR A . n 
A 1 627 VAL 627 627 627 VAL VAL A . n 
A 1 628 SER 628 628 628 SER SER A . n 
A 1 629 ALA 629 629 629 ALA ALA A . n 
A 1 630 ASP 630 630 630 ASP ASP A . n 
A 1 631 LYS 631 631 631 LYS LYS A . n 
A 1 632 ILE 632 632 632 ILE ILE A . n 
A 1 633 ILE 633 633 633 ILE ILE A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 LYS 635 635 635 LYS LYS A . n 
A 1 636 VAL 636 636 636 VAL VAL A . n 
A 1 637 GLY 637 637 637 GLY GLY A . n 
A 1 638 GLU 638 638 638 GLU GLU A . n 
A 1 639 SER 639 639 639 SER SER A . n 
A 1 640 LYS 640 640 640 LYS LYS A . n 
A 1 641 PHE 641 641 641 PHE PHE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ASP 643 643 643 ASP ASP A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 ASN 645 645 645 ASN ASN A . n 
A 1 646 HIS 646 646 646 HIS HIS A . n 
A 1 647 TRP 647 647 647 TRP TRP A . n 
A 1 648 VAL 648 648 648 VAL VAL A . n 
A 1 649 ASP 649 649 649 ASP ASP A . n 
A 1 650 PHE 650 650 650 PHE PHE A . n 
A 1 651 LEU 651 651 651 LEU LEU A . n 
A 1 652 ASP 652 652 652 ASP ASP A . n 
A 1 653 LYS 653 653 653 LYS LYS A . n 
A 1 654 PHE 654 654 654 PHE PHE A . n 
A 1 655 ALA 655 655 655 ALA ALA A . n 
A 1 656 ARG 656 656 656 ARG ARG A . n 
A 1 657 GLU 657 657 657 GLU GLU A . n 
A 1 658 ARG 658 658 658 ARG ARG A . n 
A 1 659 MET 659 659 659 MET MET A . n 
A 1 660 GLU 660 660 660 GLU GLU A . n 
A 1 661 PRO 661 661 661 PRO PRO A . n 
A 1 662 ALA 662 662 662 ALA ALA A . n 
A 1 663 ILE 663 663 663 ILE ILE A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 ARG 665 665 665 ARG ARG A . n 
A 1 666 GLY 666 666 666 GLY GLY A . n 
A 1 667 PHE 667 667 667 PHE PHE A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 MET 670 670 670 MET MET A . n 
A 1 671 CYS 671 671 671 CYS CYS A . n 
A 1 672 GLU 672 672 672 GLU GLU A . n 
A 1 673 TYR 673 673 673 TYR TYR A . n 
A 1 674 MET 674 674 674 MET MET A . n 
A 1 675 ASN 675 675 675 ASN ASN A . n 
A 1 676 ASN 676 676 676 ASN ASN A . n 
A 1 677 LYS 677 677 677 LYS LYS A . n 
A 1 678 GLN 678 678 678 GLN GLN A . n 
A 1 679 HIS 679 679 679 HIS HIS A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 MET 681 681 681 MET MET A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 MET 683 683 683 MET MET A . n 
A 1 684 ASP 684 684 684 ASP ASP A . n 
A 1 685 ARG 685 685 685 ARG ARG A . n 
A 1 686 GLU 686 686 686 GLU GLU A . n 
A 1 687 ALA 687 687 687 ALA ALA A . n 
A 1 688 ILE 688 688 688 ILE ILE A . n 
A 1 689 ALA 689 689 689 ALA ALA A . n 
A 1 690 GLY 690 690 690 GLY GLY A . n 
A 1 691 PRO 691 691 691 PRO PRO A . n 
A 1 692 PRO 692 692 692 PRO PRO A . n 
A 1 693 LEU 693 693 693 LEU LEU A . n 
A 1 694 GLY 694 694 694 GLY GLY A . n 
A 1 695 SER 695 695 695 SER SER A . n 
A 1 696 LYS 696 696 696 LYS LYS A . n 
A 1 697 GLY 697 697 697 GLY GLY A . n 
A 1 698 ILE 698 698 698 ILE ILE A . n 
A 1 699 GLY 699 699 699 GLY GLY A . n 
A 1 700 GLY 700 700 700 GLY GLY A . n 
A 1 701 PHE 701 701 701 PHE PHE A . n 
A 1 702 TRP 702 702 702 TRP TRP A . n 
A 1 703 THR 703 703 703 THR THR A . n 
A 1 704 GLY 704 704 704 GLY GLY A . n 
A 1 705 LYS 705 705 705 LYS LYS A . n 
A 1 706 LYS 706 706 706 LYS LYS A . n 
A 1 707 ARG 707 707 707 ARG ARG A . n 
A 1 708 TYR 708 708 708 TYR TYR A . n 
A 1 709 ALA 709 709 709 ALA ALA A . n 
A 1 710 LEU 710 710 710 LEU LEU A . n 
A 1 711 ASN 711 711 711 ASN ASN A . n 
A 1 712 VAL 712 712 712 VAL VAL A . n 
A 1 713 TRP 713 713 713 TRP TRP A . n 
A 1 714 ASP 714 714 714 ASP ASP A . n 
A 1 715 MET 715 715 715 MET MET A . n 
A 1 716 GLU 716 716 716 GLU GLU A . n 
A 1 717 GLY 717 717 717 GLY GLY A . n 
A 1 718 THR 718 718 718 THR THR A . n 
A 1 719 ARG 719 719 719 ARG ARG A . n 
A 1 720 TYR 720 720 720 TYR TYR A . n 
A 1 721 ALA 721 721 721 ALA ALA A . n 
A 1 722 GLU 722 722 722 GLU GLU A . n 
A 1 723 PRO 723 723 723 PRO PRO A . n 
A 1 724 LYS 724 724 724 LYS LYS A . n 
A 1 725 LEU 725 725 725 LEU LEU A . n 
A 1 726 LYS 726 726 726 LYS LYS A . n 
A 1 727 ILE 727 727 727 ILE ILE A . n 
A 1 728 MET 728 728 728 MET MET A . n 
A 1 729 GLY 729 729 729 GLY GLY A . n 
A 1 730 LEU 730 730 730 LEU LEU A . n 
A 1 731 GLU 731 731 731 GLU GLU A . n 
A 1 732 THR 732 732 732 THR THR A . n 
A 1 733 GLN 733 733 733 GLN GLN A . n 
A 1 734 LYS 734 734 734 LYS LYS A . n 
A 1 735 SER 735 735 735 SER SER A . n 
A 1 736 SER 736 736 736 SER SER A . n 
A 1 737 THR 737 737 737 THR THR A . n 
A 1 738 PRO 738 738 738 PRO PRO A . n 
A 1 739 LYS 739 739 739 LYS LYS A . n 
A 1 740 ALA 740 740 740 ALA ALA A . n 
A 1 741 VAL 741 741 741 VAL VAL A . n 
A 1 742 GLN 742 742 742 GLN GLN A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 ALA 744 744 744 ALA ALA A . n 
A 1 745 LEU 745 745 745 LEU LEU A . n 
A 1 746 LYS 746 746 746 LYS LYS A . n 
A 1 747 GLU 747 747 747 GLU GLU A . n 
A 1 748 CYS 748 748 748 CYS CYS A . n 
A 1 749 ILE 749 749 749 ILE ILE A . n 
A 1 750 ARG 750 750 750 ARG ARG A . n 
A 1 751 ARG 751 751 751 ARG ARG A . n 
A 1 752 MET 752 752 752 MET MET A . n 
A 1 753 LEU 753 753 753 LEU LEU A . n 
A 1 754 GLN 754 754 754 GLN GLN A . n 
A 1 755 GLU 755 755 755 GLU GLU A . n 
A 1 756 GLY 756 756 756 GLY GLY A . n 
A 1 757 GLU 757 757 757 GLU GLU A . n 
A 1 758 GLU 758 758 758 GLU GLU A . n 
A 1 759 SER 759 759 759 SER SER A . n 
A 1 760 LEU 760 760 760 LEU LEU A . n 
A 1 761 GLN 761 761 761 GLN GLN A . n 
A 1 762 GLU 762 762 762 GLU GLU A . n 
A 1 763 TYR 763 763 763 TYR TYR A . n 
A 1 764 PHE 764 764 764 PHE PHE A . n 
A 1 765 LYS 765 765 765 LYS LYS A . n 
A 1 766 GLU 766 766 766 GLU GLU A . n 
A 1 767 PHE 767 767 767 PHE PHE A . n 
A 1 768 GLU 768 768 768 GLU GLU A . n 
A 1 769 LYS 769 769 769 LYS LYS A . n 
A 1 770 GLU 770 770 770 GLU GLU A . n 
A 1 771 PHE 771 771 771 PHE PHE A . n 
A 1 772 ARG 772 772 772 ARG ARG A . n 
A 1 773 GLN 773 773 773 GLN GLN A . n 
A 1 774 LEU 774 774 774 LEU LEU A . n 
A 1 775 ASN 775 775 775 ASN ASN A . n 
A 1 776 TYR 776 776 776 TYR TYR A . n 
A 1 777 ILE 777 777 777 ILE ILE A . n 
A 1 778 SER 778 778 778 SER SER A . n 
A 1 779 ILE 779 779 779 ILE ILE A . n 
A 1 780 ALA 780 780 780 ALA ALA A . n 
A 1 781 SER 781 781 781 SER SER A . n 
A 1 782 VAL 782 782 782 VAL VAL A . n 
A 1 783 SER 783 783 783 SER SER A . n 
A 1 784 SER 784 784 784 SER SER A . n 
A 1 785 ALA 785 785 785 ALA ALA A . n 
A 1 786 ASN 786 786 786 ASN ASN A . n 
A 1 787 ASN 787 787 787 ASN ASN A . n 
A 1 788 ILE 788 788 788 ILE ILE A . n 
A 1 789 ALA 789 789 789 ALA ALA A . n 
A 1 790 LYS 790 790 790 LYS LYS A . n 
A 1 791 TYR 791 791 791 TYR TYR A . n 
A 1 792 ASP 792 792 792 ASP ASP A . n 
A 1 793 VAL 793 793 793 VAL VAL A . n 
A 1 794 GLY 794 794 794 GLY GLY A . n 
A 1 795 GLY 795 795 795 GLY GLY A . n 
A 1 796 PHE 796 796 796 PHE PHE A . n 
A 1 797 PRO 797 797 797 PRO PRO A . n 
A 1 798 GLY 798 798 798 GLY GLY A . n 
A 1 799 PRO 799 799 799 PRO PRO A . n 
A 1 800 LYS 800 800 800 LYS LYS A . n 
A 1 801 CYS 801 801 801 CYS CYS A . n 
A 1 802 PRO 802 802 802 PRO PRO A . n 
A 1 803 PHE 803 803 803 PHE PHE A . n 
A 1 804 HIS 804 804 804 HIS HIS A . n 
A 1 805 ILE 805 805 805 ILE ILE A . n 
A 1 806 ARG 806 806 806 ARG ARG A . n 
A 1 807 GLY 807 807 807 GLY GLY A . n 
A 1 808 ILE 808 808 808 ILE ILE A . n 
A 1 809 LEU 809 809 809 LEU LEU A . n 
A 1 810 THR 810 810 810 THR THR A . n 
A 1 811 TYR 811 811 811 TYR TYR A . n 
A 1 812 ASN 812 812 812 ASN ASN A . n 
A 1 813 ARG 813 813 813 ARG ARG A . n 
A 1 814 ALA 814 814 814 ALA ALA A . n 
A 1 815 ILE 815 815 815 ILE ILE A . n 
A 1 816 LYS 816 816 816 LYS LYS A . n 
A 1 817 GLY 817 817 817 GLY GLY A . n 
A 1 818 ASN 818 818 818 ASN ASN A . n 
A 1 819 ILE 819 819 819 ILE ILE A . n 
A 1 820 ASP 820 820 820 ASP ASP A . n 
A 1 821 ALA 821 821 821 ALA ALA A . n 
A 1 822 PRO 822 822 822 PRO PRO A . n 
A 1 823 GLN 823 823 823 GLN GLN A . n 
A 1 824 VAL 824 824 824 VAL VAL A . n 
A 1 825 VAL 825 825 825 VAL VAL A . n 
A 1 826 GLU 826 826 826 GLU GLU A . n 
A 1 827 GLY 827 827 827 GLY GLY A . n 
A 1 828 GLU 828 828 828 GLU GLU A . n 
A 1 829 LYS 829 829 829 LYS LYS A . n 
A 1 830 VAL 830 830 830 VAL VAL A . n 
A 1 831 TYR 831 831 831 TYR TYR A . n 
A 1 832 VAL 832 832 832 VAL VAL A . n 
A 1 833 LEU 833 833 833 LEU LEU A . n 
A 1 834 PRO 834 834 834 PRO PRO A . n 
A 1 835 LEU 835 835 835 LEU LEU A . n 
A 1 836 ARG 836 836 836 ARG ARG A . n 
A 1 837 GLU 837 837 837 GLU GLU A . n 
A 1 838 GLY 838 838 838 GLY GLY A . n 
A 1 839 ASN 839 839 839 ASN ASN A . n 
A 1 840 PRO 840 840 840 PRO PRO A . n 
A 1 841 PHE 841 841 841 PHE PHE A . n 
A 1 842 GLY 842 842 842 GLY GLY A . n 
A 1 843 ASP 843 843 843 ASP ASP A . n 
A 1 844 LYS 844 844 844 LYS LYS A . n 
A 1 845 CYS 845 845 845 CYS CYS A . n 
A 1 846 ILE 846 846 846 ILE ILE A . n 
A 1 847 ALA 847 847 847 ALA ALA A . n 
A 1 848 TRP 848 848 848 TRP TRP A . n 
A 1 849 PRO 849 849 849 PRO PRO A . n 
A 1 850 SER 850 850 850 SER SER A . n 
A 1 851 GLY 851 851 851 GLY GLY A . n 
A 1 852 THR 852 852 852 THR THR A . n 
A 1 853 GLU 853 853 853 GLU GLU A . n 
A 1 854 ILE 854 854 854 ILE ILE A . n 
A 1 855 THR 855 855 855 THR THR A . n 
A 1 856 ASP 856 856 856 ASP ASP A . n 
A 1 857 LEU 857 857 857 LEU LEU A . n 
A 1 858 ILE 858 858 858 ILE ILE A . n 
A 1 859 LYS 859 859 859 LYS LYS A . n 
A 1 860 ASP 860 860 860 ASP ASP A . n 
A 1 861 ASP 861 861 861 ASP ASP A . n 
A 1 862 VAL 862 862 862 VAL VAL A . n 
A 1 863 LEU 863 863 863 LEU LEU A . n 
A 1 864 HIS 864 864 864 HIS HIS A . n 
A 1 865 TRP 865 865 865 TRP TRP A . n 
A 1 866 MET 866 866 866 MET MET A . n 
A 1 867 ASP 867 867 867 ASP ASP A . n 
A 1 868 TYR 868 868 868 TYR TYR A . n 
A 1 869 THR 869 869 869 THR THR A . n 
A 1 870 VAL 870 870 870 VAL VAL A . n 
A 1 871 LEU 871 871 871 LEU LEU A . n 
A 1 872 LEU 872 872 872 LEU LEU A . n 
A 1 873 GLU 873 873 873 GLU GLU A . n 
A 1 874 LYS 874 874 874 LYS LYS A . n 
A 1 875 THR 875 875 875 THR THR A . n 
A 1 876 PHE 876 876 876 PHE PHE A . n 
A 1 877 ILE 877 877 877 ILE ILE A . n 
A 1 878 LYS 878 878 878 LYS LYS A . n 
A 1 879 PRO 879 879 879 PRO PRO A . n 
A 1 880 LEU 880 880 880 LEU LEU A . n 
A 1 881 GLU 881 881 881 GLU GLU A . n 
A 1 882 GLY 882 882 882 GLY GLY A . n 
A 1 883 PHE 883 883 883 PHE PHE A . n 
A 1 884 THR 884 884 884 THR THR A . n 
A 1 885 SER 885 885 885 SER SER A . n 
A 1 886 ALA 886 886 886 ALA ALA A . n 
A 1 887 ALA 887 887 887 ALA ALA A . n 
A 1 888 LYS 888 888 888 LYS LYS A . n 
A 1 889 LEU 889 889 889 LEU LEU A . n 
A 1 890 ASP 890 890 890 ASP ASP A . n 
A 1 891 TYR 891 891 891 TYR TYR A . n 
A 1 892 GLU 892 892 892 GLU GLU A . n 
A 1 893 LYS 893 893 893 LYS LYS A . n 
A 1 894 LYS 894 894 894 LYS LYS A . n 
A 1 895 ALA 895 895 895 ALA ALA A . n 
A 1 896 SER 896 896 896 SER SER A . n 
A 1 897 LEU 897 897 897 LEU LEU A . n 
A 1 898 PHE 898 898 898 PHE PHE A . n 
A 1 899 ASP 899 899 899 ASP ASP A . n 
A 1 900 MET 900 900 900 MET MET A . n 
A 1 901 PHE 901 901 901 PHE PHE A . n 
A 1 902 ASP 902 902 902 ASP ASP A . n 
A 1 903 PHE 903 903 903 PHE PHE A . n 
B 2 1   DT  1   1   1   DT  T   T . n 
B 2 2   DC  2   2   2   DC  C   T . n 
B 2 3   DG  3   3   3   DG  G   T . n 
B 2 4   DFT 4   4   4   DFT DFT T . n 
B 2 5   DG  5   5   5   DG  G   T . n 
B 2 6   DT  6   6   6   DT  T   T . n 
B 2 7   DA  7   7   7   DA  A   T . n 
B 2 8   DA  8   8   8   DA  A   T . n 
B 2 9   DG  9   9   9   DG  G   T . n 
B 2 10  DC  10  10  10  DC  C   T . n 
B 2 11  DA  11  11  11  DA  A   T . n 
B 2 12  DG  12  12  12  DG  G   T . n 
B 2 13  DT  13  13  13  DT  T   T . n 
B 2 14  DC  14  14  14  DC  C   T . n 
B 2 15  DC  15  15  15  DC  C   T . n 
B 2 16  DG  16  16  16  DG  G   T . n 
B 2 17  DC  17  17  17  DC  C   T . n 
B 2 18  DG  18  18  18  DG  G   T . n 
C 3 1   DG  1   103 103 DG  G   P . n 
C 3 2   DC  2   104 104 DC  C   P . n 
C 3 3   DG  3   105 105 DG  G   P . n 
C 3 4   DG  4   106 106 DG  G   P . n 
C 3 5   DA  5   107 107 DA  A   P . n 
C 3 6   DC  6   108 108 DC  C   P . n 
C 3 7   DT  7   109 109 DT  T   P . n 
C 3 8   DG  8   110 110 DG  G   P . n 
C 3 9   DC  9   111 111 DC  C   P . n 
C 3 10  DT  10  112 112 DT  T   P . n 
C 3 11  DT  11  113 113 DT  T   P . n 
C 3 12  DA  12  114 114 DA  A   P . n 
C 3 13  DOC 13  115 115 DOC DOC P . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    C 
_pdbx_struct_mod_residue.label_comp_id    DOC 
_pdbx_struct_mod_residue.label_seq_id     13 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     DOC 
_pdbx_struct_mod_residue.auth_seq_id      115 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6920  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  43350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O1G ? D DTP .   ? A DTP 904  ? 1_555 169.1 ? 
2  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2B ? D DTP .   ? A DTP 904  ? 1_555 90.1  ? 
3  O1G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2B ? D DTP .   ? A DTP 904  ? 1_555 79.1  ? 
4  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 87.4  ? 
5  O1G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 89.2  ? 
6  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 81.2  ? 
7  OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 84.4  ? 
8  O1G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 97.1  ? 
9  O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 88.9  ? 
10 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 O   ? A LEU 412 ? A LEU 412  ? 1_555 167.1 ? 
11 OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 116.8 ? 
12 O1G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 74.1  ? 
13 O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 150.0 ? 
14 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 111.2 ? 
15 O   ? A LEU 412 ? A LEU 412  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 81.5  ? 
16 OD1 ? A ASP 623 ? A ASP 623  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 76.6  ? 
17 O1G ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 113.3 ? 
18 O2B ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 160.2 ? 
19 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 83.6  ? 
20 O   ? A LEU 412 ? A LEU 412  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 104.1 ? 
21 OD1 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? E CA . ? A CA 905 ? 1_555 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 48.8  ? 
22 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? A ASN 505 ? A ASN 505  ? 1_555 169.9 ? 
23 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1726 ? 1_555 83.6  ? 
24 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1726 ? 1_555 100.9 ? 
25 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 78.4  ? 
26 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 104.1 ? 
27 O   ? I HOH .   ? A HOH 1726 ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 134.9 ? 
28 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 937  ? 1_555 82.3  ? 
29 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 937  ? 1_555 88.7  ? 
30 O   ? I HOH .   ? A HOH 1726 ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 937  ? 1_555 142.1 ? 
31 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 937  ? 1_555 75.6  ? 
32 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1116 ? 1_555 94.4  ? 
33 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1116 ? 1_555 77.8  ? 
34 O   ? I HOH .   ? A HOH 1726 ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1116 ? 1_555 77.9  ? 
35 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1116 ? 1_555 144.0 ? 
36 O   ? I HOH .   ? A HOH 937  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 1116 ? 1_555 68.5  ? 
37 O   ? A LYS 531 ? A LYS 531  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 112.2 ? 
38 O   ? A ASN 505 ? A ASN 505  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 77.7  ? 
39 O   ? I HOH .   ? A HOH 1726 ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 79.1  ? 
40 OD1 ? A ASN 507 ? A ASN 507  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 70.4  ? 
41 O   ? I HOH .   ? A HOH 937  ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 138.7 ? 
42 O   ? I HOH .   ? A HOH 1116 ? 1_555 CA ? G CA . ? A CA 907 ? 1_555 O   ? I HOH .   ? A HOH 975  ? 1_555 142.3 ? 
43 O   ? I HOH .   ? A HOH 1594 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 1536 ? 1_555 86.3  ? 
44 O   ? I HOH .   ? A HOH 1594 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 970  ? 1_555 73.0  ? 
45 O   ? I HOH .   ? A HOH 1536 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 970  ? 1_555 150.8 ? 
46 O   ? I HOH .   ? A HOH 1594 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 1619 ? 1_555 84.1  ? 
47 O   ? I HOH .   ? A HOH 1536 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 1619 ? 1_555 102.4 ? 
48 O   ? I HOH .   ? A HOH 970  ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 O   ? I HOH .   ? A HOH 1619 ? 1_555 95.8  ? 
49 O   ? I HOH .   ? A HOH 1594 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 72.3  ? 
50 O   ? I HOH .   ? A HOH 1536 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 79.9  ? 
51 O   ? I HOH .   ? A HOH 970  ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 74.4  ? 
52 O   ? I HOH .   ? A HOH 1619 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 156.2 ? 
53 O   ? I HOH .   ? A HOH 1594 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 122.4 ? 
54 O   ? I HOH .   ? A HOH 1536 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 89.0  ? 
55 O   ? I HOH .   ? A HOH 970  ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 85.2  ? 
56 O   ? I HOH .   ? A HOH 1619 ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 152.1 ? 
57 OE2 ? A GLU 116 ? A GLU 116  ? 1_555 CA ? H CA . ? A CA 908 ? 1_555 OE1 ? A GLU 116 ? A GLU 116  ? 1_555 50.4  ? 
58 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O   ? I HOH .   ? A HOH 1020 ? 1_555 124.3 ? 
59 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 89.2  ? 
60 O   ? I HOH .   ? A HOH 1020 ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 O2A ? D DTP .   ? A DTP 904  ? 1_555 142.4 ? 
61 OD2 ? A ASP 411 ? A ASP 411  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 79.6  ? 
62 O   ? I HOH .   ? A HOH 1020 ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 84.3  ? 
63 O2A ? D DTP .   ? A DTP 904  ? 1_555 CA ? F CA . ? A CA 906 ? 1_555 OD2 ? A ASP 623 ? A ASP 623  ? 1_555 85.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-25 
2 'Structure model' 1 1 2012-02-22 
3 'Structure model' 1 2 2012-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 15.9560  3.3960  -35.9370 0.1182 0.2978 0.2630 0.0624  0.0118  0.0526  2.3668 0.3788 -0.0478 
0.1653 -0.0655 0.0953  -0.1692 -0.3576 -0.3261 0.0091  0.1069  -0.1146 0.0214  0.0249  0.0623  
'X-RAY DIFFRACTION' 2 ? refined -24.8310 -0.0910 -32.0650 0.0256 0.1305 0.1465 -0.0190 0.0166  0.0071  0.3898 1.7441 0.3556  
0.3665 0.1258  0.4609  0.0502  -0.0394 0.0042  0.1318  -0.0684 0.2196  0.0675  -0.0836 0.0182  
'X-RAY DIFFRACTION' 3 ? refined -8.6220  24.0510 -13.6410 0.0637 0.1251 0.0816 -0.0173 0.0322  0.0089  0.5254 0.9673 0.9081  
0.3146 0.0218  -0.0621 0.0417  -0.0740 -0.0324 0.1834  -0.0771 0.0186  -0.0319 0.0401  0.0354  
'X-RAY DIFFRACTION' 4 ? refined 2.2890   9.2590  -60.4790 0.0470 0.1568 0.0608 0.0003  -0.0118 -0.0193 0.6177 0.8367 0.6482  
0.3156 -0.0145 -0.2304 -0.0519 0.1827  -0.0195 -0.1511 0.0577  0.0315  0.0413  0.0381  -0.0058 
'X-RAY DIFFRACTION' 5 ? refined -9.9230  28.5340 -46.5830 0.0395 0.1228 0.1168 0.0189  0.0009  0.0063  0.6085 3.2823 0.7277  
0.3745 -0.0363 -0.7903 0.0064  0.0544  0.1658  0.1196  0.0094  0.1738  -0.1679 -0.0504 -0.0158 
'X-RAY DIFFRACTION' 6 ? refined 9.1740   24.3550 -47.4860 0.0722 0.1627 0.1167 -0.0088 -0.0113 0.0036  1.0667 0.2012 0.3730  
0.2390 0.0357  0.3585  -0.0294 -0.0020 0.0330  -0.0248 0.0351  0.0067  -0.0567 0.0207  -0.0056 
'X-RAY DIFFRACTION' 7 ? refined 22.9450  21.6550 -28.7530 0.0435 0.2258 0.0797 -0.0017 -0.0420 -0.0029 1.6709 1.2420 1.3951  
0.2540 -0.5596 -0.6905 0.0005  -0.3417 -0.0385 0.2057  -0.0427 -0.1120 -0.0846 0.2727  0.0422  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1 T 1   ? ? T 18  ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 P 103 ? ? P 115 ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 A 1   ? ? A 904 ? ? ? ? 
'X-RAY DIFFRACTION' 4  2 A 1   ? ? A 105 ? ? ? ? 
'X-RAY DIFFRACTION' 5  2 A 340 ? ? A 389 ? ? ? ? 
'X-RAY DIFFRACTION' 6  3 A 106 ? ? A 339 ? ? ? ? 
'X-RAY DIFFRACTION' 7  4 A 390 ? ? A 468 ? ? ? ? 
'X-RAY DIFFRACTION' 8  4 A 576 ? ? A 706 ? ? ? ? 
'X-RAY DIFFRACTION' 9  5 A 469 ? ? A 575 ? ? ? ? 
'X-RAY DIFFRACTION' 10 6 A 707 ? ? A 737 ? ? ? ? 
'X-RAY DIFFRACTION' 11 7 A 738 ? ? A 901 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
AMoRE    phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    360 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OP2 
_pdbx_validate_close_contact.auth_asym_id_2   T 
_pdbx_validate_close_contact.auth_comp_id_2   DFT 
_pdbx_validate_close_contact.auth_seq_id_2    4 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" T DT 1   ? ? "C1'" T DT  1   ? ? N1    T DT  1   ? ? 110.79 108.30 2.49   0.30 N 
2  1 "O3'" T DG 3   ? ? P     T DFT 4   ? ? "O5'" T DFT 4   ? ? 90.32  104.00 -13.68 1.90 Y 
3  1 "O4'" T DT 6   ? ? "C1'" T DT  6   ? ? N1    T DT  6   ? ? 110.46 108.30 2.16   0.30 N 
4  1 "O4'" T DA 8   ? ? "C1'" T DA  8   ? ? N9    T DA  8   ? ? 111.47 108.30 3.17   0.30 N 
5  1 "O4'" T DG 12  ? ? "C1'" T DG  12  ? ? N9    T DG  12  ? ? 111.13 108.30 2.83   0.30 N 
6  1 "O4'" P DC 104 ? ? "C1'" P DC  104 ? ? N1    P DC  104 ? ? 111.01 108.30 2.71   0.30 N 
7  1 "C3'" P DG 105 ? ? "O3'" P DG  105 ? ? P     P DG  106 ? ? 127.04 119.70 7.34   1.20 Y 
8  1 "O4'" P DC 108 ? ? "C1'" P DC  108 ? ? N1    P DC  108 ? ? 112.70 108.30 4.40   0.30 N 
9  1 "O4'" P DT 109 ? ? "C1'" P DT  109 ? ? N1    P DT  109 ? ? 110.62 108.30 2.32   0.30 N 
10 1 "O4'" P DT 112 ? ? "C1'" P DT  112 ? ? N1    P DT  112 ? ? 110.37 108.30 2.07   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 221 ? ? -123.00 -71.93 
2  1 GLU A 254 ? ? 47.98   85.52  
3  1 ASN A 255 ? ? -173.20 103.39 
4  1 ASN A 316 ? ? -150.96 66.41  
5  1 SER A 414 ? ? 32.23   66.21  
6  1 ASN A 424 ? ? 77.11   53.56  
7  1 PRO A 458 ? ? -65.31  2.39   
8  1 ASP A 579 ? ? -168.89 110.32 
9  1 THR A 622 ? ? 73.03   -62.36 
10 1 ASP A 623 ? ? -148.92 17.39  
11 1 GLU A 686 ? ? -107.35 -77.81 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     ASN 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      564 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OD1 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    ASN 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     564 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OD1 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3QER 'double helix'        
3QER 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 5  1_555 C DOC 13 1_555 -0.343 -0.123 -0.110 -6.641 -12.678 1.767  1  T_DG5:DOC115_P T 5  ? P 115 ? 19 1 
1 B DT 6  1_555 C DA  12 1_555 -0.053 -0.123 -0.246 -0.595 0.752   -5.629 2  T_DT6:DA114_P  T 6  ? P 114 ? 20 1 
1 B DA 7  1_555 C DT  11 1_555 0.024  -0.156 -0.261 -5.484 -6.227  2.842  3  T_DA7:DT113_P  T 7  ? P 113 ? 20 1 
1 B DA 8  1_555 C DT  10 1_555 0.215  -0.237 -0.094 3.583  -4.473  2.979  4  T_DA8:DT112_P  T 8  ? P 112 ? 20 1 
1 B DG 9  1_555 C DC  9  1_555 -0.031 -0.112 0.118  0.034  -11.105 -1.001 5  T_DG9:DC111_P  T 9  ? P 111 ? 19 1 
1 B DC 10 1_555 C DG  8  1_555 0.210  -0.099 -0.095 9.357  -8.470  1.947  6  T_DC10:DG110_P T 10 ? P 110 ? 19 1 
1 B DA 11 1_555 C DT  7  1_555 0.508  -0.048 0.226  9.270  -13.735 0.621  7  T_DA11:DT109_P T 11 ? P 109 ? 20 1 
1 B DG 12 1_555 C DC  6  1_555 -0.166 -0.103 0.136  3.874  -15.852 4.256  8  T_DG12:DC108_P T 12 ? P 108 ? 19 1 
1 B DT 13 1_555 C DA  5  1_555 -0.326 -0.174 -0.232 5.587  -11.258 -4.804 9  T_DT13:DA107_P T 13 ? P 107 ? 20 1 
1 B DC 14 1_555 C DG  4  1_555 0.258  -0.155 -0.213 -0.148 -13.042 5.303  10 T_DC14:DG106_P T 14 ? P 106 ? 19 1 
1 B DC 15 1_555 C DG  3  1_555 0.877  0.143  -0.090 -6.998 -3.718  4.554  11 T_DC15:DG105_P T 15 ? P 105 ? 19 1 
1 B DG 16 1_555 C DC  2  1_555 -0.253 0.206  -0.041 -4.740 -9.626  3.144  12 T_DG16:DC104_P T 16 ? P 104 ? 19 1 
1 B DC 17 1_555 C DG  1  1_555 1.028  -0.034 -0.181 24.373 -1.681  2.548  13 T_DC17:DG103_P T 17 ? P 103 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 5  1_555 C DOC 13 1_555 B DT 6  1_555 C DA 12 1_555 -0.917 -1.058 3.231 3.975  6.054  29.721 -3.133 2.478  2.822 11.586 
-7.607 30.572 1  TT_DG5DT6:DA114DOC115_PP  T 5  ? P 115 ? T 6  ? P 114 ? 
1 B DT 6  1_555 C DA  12 1_555 B DA 7  1_555 C DT 11 1_555 0.156  -0.586 3.487 -1.909 3.648  39.460 -1.313 -0.465 3.411 5.386  
2.817  39.666 2  TT_DT6DA7:DT113DA114_PP   T 6  ? P 114 ? T 7  ? P 113 ? 
1 B DA 7  1_555 C DT  11 1_555 B DA 8  1_555 C DT 10 1_555 0.283  -0.483 3.213 -1.925 -0.354 28.151 -0.909 -1.019 3.192 -0.727 
3.951  28.217 3  TT_DA7DA8:DT112DT113_PP   T 7  ? P 113 ? T 8  ? P 112 ? 
1 B DA 8  1_555 C DT  10 1_555 B DG 9  1_555 C DC 9  1_555 -1.188 -0.288 3.423 -5.850 2.298  33.475 -0.886 1.027  3.547 3.946  
10.046 34.043 4  TT_DA8DG9:DC111DT112_PP   T 8  ? P 112 ? T 9  ? P 111 ? 
1 B DG 9  1_555 C DC  9  1_555 B DC 10 1_555 C DG 8  1_555 -0.416 -0.315 3.123 1.722  4.359  31.749 -1.311 1.044  3.027 7.914  
-3.126 32.084 5  TT_DG9DC10:DG110DC111_PP  T 9  ? P 111 ? T 10 ? P 110 ? 
1 B DC 10 1_555 C DG  8  1_555 B DA 11 1_555 C DT 7  1_555 -0.797 -0.151 3.385 -5.235 3.903  37.177 -0.763 0.522  3.429 6.064  
8.133  37.726 6  TT_DC10DA11:DT109DG110_PP T 10 ? P 110 ? T 11 ? P 109 ? 
1 B DA 11 1_555 C DT  7  1_555 B DG 12 1_555 C DC 6  1_555 0.612  -0.646 3.430 -3.740 3.804  30.394 -1.973 -1.897 3.230 7.186  
7.064  30.848 7  TT_DA11DG12:DC108DT109_PP T 11 ? P 109 ? T 12 ? P 108 ? 
1 B DG 12 1_555 C DC  6  1_555 B DT 13 1_555 C DA 5  1_555 -1.015 -0.583 3.191 1.658  5.930  34.113 -1.849 1.948  2.999 10.008 
-2.798 34.648 8  TT_DG12DT13:DA107DC108_PP T 12 ? P 108 ? T 13 ? P 107 ? 
1 B DT 13 1_555 C DA  5  1_555 B DC 14 1_555 C DG 4  1_555 0.783  0.276  3.380 3.007  6.635  38.607 -0.419 -0.789 3.429 9.928  
-4.500 39.262 9  TT_DT13DC14:DG106DA107_PP T 13 ? P 107 ? T 14 ? P 106 ? 
1 B DC 14 1_555 C DG  4  1_555 B DC 15 1_555 C DG 3  1_555 0.451  -0.124 3.399 2.389  8.302  34.729 -1.447 -0.376 3.305 13.648 
-3.927 35.755 10 TT_DC14DC15:DG105DG106_PP T 14 ? P 106 ? T 15 ? P 105 ? 
1 B DC 15 1_555 C DG  3  1_555 B DG 16 1_555 C DC 2  1_555 0.561  0.229  3.109 2.425  12.435 32.594 -1.449 -0.578 3.026 21.184 
-4.131 34.907 11 TT_DC15DG16:DC104DG105_PP T 15 ? P 105 ? T 16 ? P 104 ? 
1 B DG 16 1_555 C DC  2  1_555 B DC 17 1_555 C DG 1  1_555 1.082  0.372  2.687 -0.121 4.817  33.405 -0.007 -1.880 2.709 8.326  
0.209  33.741 12 TT_DG16DC17:DG103DC104_PP T 16 ? P 104 ? T 17 ? P 103 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DTP 1   904  1   DTP DTP A . 
E 5 CA  1   905  1   CA  CA  A . 
F 5 CA  1   906  1   CA  CA  A . 
G 5 CA  1   907  1   CA  CA  A . 
H 5 CA  1   908  1   CA  CA  A . 
I 6 HOH 1   909  909 HOH HOH A . 
I 6 HOH 2   910  910 HOH HOH A . 
I 6 HOH 3   911  1   HOH HOH A . 
I 6 HOH 4   912  2   HOH HOH A . 
I 6 HOH 5   913  3   HOH HOH A . 
I 6 HOH 6   914  4   HOH HOH A . 
I 6 HOH 7   915  5   HOH HOH A . 
I 6 HOH 8   916  8   HOH HOH A . 
I 6 HOH 9   917  9   HOH HOH A . 
I 6 HOH 10  918  10  HOH HOH A . 
I 6 HOH 11  919  11  HOH HOH A . 
I 6 HOH 12  920  12  HOH HOH A . 
I 6 HOH 13  921  13  HOH HOH A . 
I 6 HOH 14  922  14  HOH HOH A . 
I 6 HOH 15  923  15  HOH HOH A . 
I 6 HOH 16  924  16  HOH HOH A . 
I 6 HOH 17  925  17  HOH HOH A . 
I 6 HOH 18  926  18  HOH HOH A . 
I 6 HOH 19  927  19  HOH HOH A . 
I 6 HOH 20  928  20  HOH HOH A . 
I 6 HOH 21  929  21  HOH HOH A . 
I 6 HOH 22  930  22  HOH HOH A . 
I 6 HOH 23  931  23  HOH HOH A . 
I 6 HOH 24  932  24  HOH HOH A . 
I 6 HOH 25  933  25  HOH HOH A . 
I 6 HOH 26  934  27  HOH HOH A . 
I 6 HOH 27  935  28  HOH HOH A . 
I 6 HOH 28  936  29  HOH HOH A . 
I 6 HOH 29  937  30  HOH HOH A . 
I 6 HOH 30  938  31  HOH HOH A . 
I 6 HOH 31  939  32  HOH HOH A . 
I 6 HOH 32  940  33  HOH HOH A . 
I 6 HOH 33  941  34  HOH HOH A . 
I 6 HOH 34  942  35  HOH HOH A . 
I 6 HOH 35  943  36  HOH HOH A . 
I 6 HOH 36  944  37  HOH HOH A . 
I 6 HOH 37  945  38  HOH HOH A . 
I 6 HOH 38  946  39  HOH HOH A . 
I 6 HOH 39  947  40  HOH HOH A . 
I 6 HOH 40  948  41  HOH HOH A . 
I 6 HOH 41  949  42  HOH HOH A . 
I 6 HOH 42  950  43  HOH HOH A . 
I 6 HOH 43  951  44  HOH HOH A . 
I 6 HOH 44  952  45  HOH HOH A . 
I 6 HOH 45  953  46  HOH HOH A . 
I 6 HOH 46  954  47  HOH HOH A . 
I 6 HOH 47  955  48  HOH HOH A . 
I 6 HOH 48  956  49  HOH HOH A . 
I 6 HOH 49  957  50  HOH HOH A . 
I 6 HOH 50  958  51  HOH HOH A . 
I 6 HOH 51  959  52  HOH HOH A . 
I 6 HOH 52  960  54  HOH HOH A . 
I 6 HOH 53  961  55  HOH HOH A . 
I 6 HOH 54  962  56  HOH HOH A . 
I 6 HOH 55  963  57  HOH HOH A . 
I 6 HOH 56  964  59  HOH HOH A . 
I 6 HOH 57  965  60  HOH HOH A . 
I 6 HOH 58  966  62  HOH HOH A . 
I 6 HOH 59  967  63  HOH HOH A . 
I 6 HOH 60  968  64  HOH HOH A . 
I 6 HOH 61  969  65  HOH HOH A . 
I 6 HOH 62  970  66  HOH HOH A . 
I 6 HOH 63  971  67  HOH HOH A . 
I 6 HOH 64  972  68  HOH HOH A . 
I 6 HOH 65  973  69  HOH HOH A . 
I 6 HOH 66  974  70  HOH HOH A . 
I 6 HOH 67  975  71  HOH HOH A . 
I 6 HOH 68  976  72  HOH HOH A . 
I 6 HOH 69  977  73  HOH HOH A . 
I 6 HOH 70  978  74  HOH HOH A . 
I 6 HOH 71  979  76  HOH HOH A . 
I 6 HOH 72  980  78  HOH HOH A . 
I 6 HOH 73  981  79  HOH HOH A . 
I 6 HOH 74  982  80  HOH HOH A . 
I 6 HOH 75  983  81  HOH HOH A . 
I 6 HOH 76  984  82  HOH HOH A . 
I 6 HOH 77  985  83  HOH HOH A . 
I 6 HOH 78  986  84  HOH HOH A . 
I 6 HOH 79  987  85  HOH HOH A . 
I 6 HOH 80  988  86  HOH HOH A . 
I 6 HOH 81  989  87  HOH HOH A . 
I 6 HOH 82  990  88  HOH HOH A . 
I 6 HOH 83  991  89  HOH HOH A . 
I 6 HOH 84  992  91  HOH HOH A . 
I 6 HOH 85  993  92  HOH HOH A . 
I 6 HOH 86  994  93  HOH HOH A . 
I 6 HOH 87  995  94  HOH HOH A . 
I 6 HOH 88  996  95  HOH HOH A . 
I 6 HOH 89  997  97  HOH HOH A . 
I 6 HOH 90  998  98  HOH HOH A . 
I 6 HOH 91  999  99  HOH HOH A . 
I 6 HOH 92  1000 100 HOH HOH A . 
I 6 HOH 93  1001 101 HOH HOH A . 
I 6 HOH 94  1002 102 HOH HOH A . 
I 6 HOH 95  1003 103 HOH HOH A . 
I 6 HOH 96  1004 104 HOH HOH A . 
I 6 HOH 97  1005 105 HOH HOH A . 
I 6 HOH 98  1006 106 HOH HOH A . 
I 6 HOH 99  1007 107 HOH HOH A . 
I 6 HOH 100 1008 110 HOH HOH A . 
I 6 HOH 101 1009 111 HOH HOH A . 
I 6 HOH 102 1010 113 HOH HOH A . 
I 6 HOH 103 1011 114 HOH HOH A . 
I 6 HOH 104 1012 115 HOH HOH A . 
I 6 HOH 105 1013 116 HOH HOH A . 
I 6 HOH 106 1014 117 HOH HOH A . 
I 6 HOH 107 1015 119 HOH HOH A . 
I 6 HOH 108 1016 120 HOH HOH A . 
I 6 HOH 109 1017 121 HOH HOH A . 
I 6 HOH 110 1018 122 HOH HOH A . 
I 6 HOH 111 1019 123 HOH HOH A . 
I 6 HOH 112 1020 124 HOH HOH A . 
I 6 HOH 113 1021 125 HOH HOH A . 
I 6 HOH 114 1022 126 HOH HOH A . 
I 6 HOH 115 1023 127 HOH HOH A . 
I 6 HOH 116 1024 128 HOH HOH A . 
I 6 HOH 117 1025 130 HOH HOH A . 
I 6 HOH 118 1026 131 HOH HOH A . 
I 6 HOH 119 1027 132 HOH HOH A . 
I 6 HOH 120 1028 133 HOH HOH A . 
I 6 HOH 121 1029 135 HOH HOH A . 
I 6 HOH 122 1030 136 HOH HOH A . 
I 6 HOH 123 1031 137 HOH HOH A . 
I 6 HOH 124 1032 138 HOH HOH A . 
I 6 HOH 125 1033 139 HOH HOH A . 
I 6 HOH 126 1034 140 HOH HOH A . 
I 6 HOH 127 1035 141 HOH HOH A . 
I 6 HOH 128 1036 142 HOH HOH A . 
I 6 HOH 129 1037 143 HOH HOH A . 
I 6 HOH 130 1038 144 HOH HOH A . 
I 6 HOH 131 1039 145 HOH HOH A . 
I 6 HOH 132 1040 146 HOH HOH A . 
I 6 HOH 133 1041 147 HOH HOH A . 
I 6 HOH 134 1042 148 HOH HOH A . 
I 6 HOH 135 1043 149 HOH HOH A . 
I 6 HOH 136 1044 150 HOH HOH A . 
I 6 HOH 137 1045 151 HOH HOH A . 
I 6 HOH 138 1046 152 HOH HOH A . 
I 6 HOH 139 1047 153 HOH HOH A . 
I 6 HOH 140 1048 154 HOH HOH A . 
I 6 HOH 141 1049 155 HOH HOH A . 
I 6 HOH 142 1050 156 HOH HOH A . 
I 6 HOH 143 1051 157 HOH HOH A . 
I 6 HOH 144 1052 158 HOH HOH A . 
I 6 HOH 145 1053 159 HOH HOH A . 
I 6 HOH 146 1054 160 HOH HOH A . 
I 6 HOH 147 1055 161 HOH HOH A . 
I 6 HOH 148 1056 162 HOH HOH A . 
I 6 HOH 149 1057 163 HOH HOH A . 
I 6 HOH 150 1058 164 HOH HOH A . 
I 6 HOH 151 1059 165 HOH HOH A . 
I 6 HOH 152 1060 166 HOH HOH A . 
I 6 HOH 153 1061 167 HOH HOH A . 
I 6 HOH 154 1062 168 HOH HOH A . 
I 6 HOH 155 1063 169 HOH HOH A . 
I 6 HOH 156 1064 170 HOH HOH A . 
I 6 HOH 157 1065 171 HOH HOH A . 
I 6 HOH 158 1066 172 HOH HOH A . 
I 6 HOH 159 1067 173 HOH HOH A . 
I 6 HOH 160 1068 174 HOH HOH A . 
I 6 HOH 161 1069 175 HOH HOH A . 
I 6 HOH 162 1070 176 HOH HOH A . 
I 6 HOH 163 1071 179 HOH HOH A . 
I 6 HOH 164 1072 180 HOH HOH A . 
I 6 HOH 165 1073 181 HOH HOH A . 
I 6 HOH 166 1074 182 HOH HOH A . 
I 6 HOH 167 1075 183 HOH HOH A . 
I 6 HOH 168 1076 184 HOH HOH A . 
I 6 HOH 169 1077 186 HOH HOH A . 
I 6 HOH 170 1078 187 HOH HOH A . 
I 6 HOH 171 1079 188 HOH HOH A . 
I 6 HOH 172 1080 189 HOH HOH A . 
I 6 HOH 173 1081 190 HOH HOH A . 
I 6 HOH 174 1082 191 HOH HOH A . 
I 6 HOH 175 1083 192 HOH HOH A . 
I 6 HOH 176 1084 193 HOH HOH A . 
I 6 HOH 177 1085 194 HOH HOH A . 
I 6 HOH 178 1086 195 HOH HOH A . 
I 6 HOH 179 1087 196 HOH HOH A . 
I 6 HOH 180 1088 197 HOH HOH A . 
I 6 HOH 181 1089 198 HOH HOH A . 
I 6 HOH 182 1090 199 HOH HOH A . 
I 6 HOH 183 1091 200 HOH HOH A . 
I 6 HOH 184 1092 201 HOH HOH A . 
I 6 HOH 185 1093 202 HOH HOH A . 
I 6 HOH 186 1094 204 HOH HOH A . 
I 6 HOH 187 1095 205 HOH HOH A . 
I 6 HOH 188 1096 206 HOH HOH A . 
I 6 HOH 189 1097 207 HOH HOH A . 
I 6 HOH 190 1098 208 HOH HOH A . 
I 6 HOH 191 1099 209 HOH HOH A . 
I 6 HOH 192 1100 210 HOH HOH A . 
I 6 HOH 193 1101 211 HOH HOH A . 
I 6 HOH 194 1102 212 HOH HOH A . 
I 6 HOH 195 1103 213 HOH HOH A . 
I 6 HOH 196 1104 214 HOH HOH A . 
I 6 HOH 197 1105 215 HOH HOH A . 
I 6 HOH 198 1106 216 HOH HOH A . 
I 6 HOH 199 1107 217 HOH HOH A . 
I 6 HOH 200 1108 218 HOH HOH A . 
I 6 HOH 201 1109 219 HOH HOH A . 
I 6 HOH 202 1110 220 HOH HOH A . 
I 6 HOH 203 1111 221 HOH HOH A . 
I 6 HOH 204 1112 222 HOH HOH A . 
I 6 HOH 205 1113 223 HOH HOH A . 
I 6 HOH 206 1114 224 HOH HOH A . 
I 6 HOH 207 1115 225 HOH HOH A . 
I 6 HOH 208 1116 226 HOH HOH A . 
I 6 HOH 209 1117 227 HOH HOH A . 
I 6 HOH 210 1118 228 HOH HOH A . 
I 6 HOH 211 1119 229 HOH HOH A . 
I 6 HOH 212 1120 230 HOH HOH A . 
I 6 HOH 213 1121 231 HOH HOH A . 
I 6 HOH 214 1122 233 HOH HOH A . 
I 6 HOH 215 1123 234 HOH HOH A . 
I 6 HOH 216 1124 235 HOH HOH A . 
I 6 HOH 217 1125 236 HOH HOH A . 
I 6 HOH 218 1126 237 HOH HOH A . 
I 6 HOH 219 1127 238 HOH HOH A . 
I 6 HOH 220 1128 240 HOH HOH A . 
I 6 HOH 221 1129 242 HOH HOH A . 
I 6 HOH 222 1130 243 HOH HOH A . 
I 6 HOH 223 1131 244 HOH HOH A . 
I 6 HOH 224 1132 245 HOH HOH A . 
I 6 HOH 225 1133 246 HOH HOH A . 
I 6 HOH 226 1134 248 HOH HOH A . 
I 6 HOH 227 1135 249 HOH HOH A . 
I 6 HOH 228 1136 250 HOH HOH A . 
I 6 HOH 229 1137 251 HOH HOH A . 
I 6 HOH 230 1138 253 HOH HOH A . 
I 6 HOH 231 1139 254 HOH HOH A . 
I 6 HOH 232 1140 255 HOH HOH A . 
I 6 HOH 233 1141 256 HOH HOH A . 
I 6 HOH 234 1142 257 HOH HOH A . 
I 6 HOH 235 1143 259 HOH HOH A . 
I 6 HOH 236 1144 260 HOH HOH A . 
I 6 HOH 237 1145 261 HOH HOH A . 
I 6 HOH 238 1146 262 HOH HOH A . 
I 6 HOH 239 1147 263 HOH HOH A . 
I 6 HOH 240 1148 264 HOH HOH A . 
I 6 HOH 241 1149 265 HOH HOH A . 
I 6 HOH 242 1150 266 HOH HOH A . 
I 6 HOH 243 1151 267 HOH HOH A . 
I 6 HOH 244 1152 268 HOH HOH A . 
I 6 HOH 245 1153 269 HOH HOH A . 
I 6 HOH 246 1154 270 HOH HOH A . 
I 6 HOH 247 1155 273 HOH HOH A . 
I 6 HOH 248 1156 274 HOH HOH A . 
I 6 HOH 249 1157 275 HOH HOH A . 
I 6 HOH 250 1158 276 HOH HOH A . 
I 6 HOH 251 1159 277 HOH HOH A . 
I 6 HOH 252 1160 278 HOH HOH A . 
I 6 HOH 253 1161 279 HOH HOH A . 
I 6 HOH 254 1162 280 HOH HOH A . 
I 6 HOH 255 1163 281 HOH HOH A . 
I 6 HOH 256 1164 282 HOH HOH A . 
I 6 HOH 257 1165 283 HOH HOH A . 
I 6 HOH 258 1166 284 HOH HOH A . 
I 6 HOH 259 1167 285 HOH HOH A . 
I 6 HOH 260 1168 287 HOH HOH A . 
I 6 HOH 261 1169 288 HOH HOH A . 
I 6 HOH 262 1170 289 HOH HOH A . 
I 6 HOH 263 1171 291 HOH HOH A . 
I 6 HOH 264 1172 292 HOH HOH A . 
I 6 HOH 265 1173 293 HOH HOH A . 
I 6 HOH 266 1174 294 HOH HOH A . 
I 6 HOH 267 1175 295 HOH HOH A . 
I 6 HOH 268 1176 296 HOH HOH A . 
I 6 HOH 269 1177 297 HOH HOH A . 
I 6 HOH 270 1178 298 HOH HOH A . 
I 6 HOH 271 1179 300 HOH HOH A . 
I 6 HOH 272 1180 301 HOH HOH A . 
I 6 HOH 273 1181 302 HOH HOH A . 
I 6 HOH 274 1182 303 HOH HOH A . 
I 6 HOH 275 1183 305 HOH HOH A . 
I 6 HOH 276 1184 306 HOH HOH A . 
I 6 HOH 277 1185 308 HOH HOH A . 
I 6 HOH 278 1186 309 HOH HOH A . 
I 6 HOH 279 1187 310 HOH HOH A . 
I 6 HOH 280 1188 311 HOH HOH A . 
I 6 HOH 281 1189 313 HOH HOH A . 
I 6 HOH 282 1190 314 HOH HOH A . 
I 6 HOH 283 1191 315 HOH HOH A . 
I 6 HOH 284 1192 316 HOH HOH A . 
I 6 HOH 285 1193 317 HOH HOH A . 
I 6 HOH 286 1194 318 HOH HOH A . 
I 6 HOH 287 1195 319 HOH HOH A . 
I 6 HOH 288 1196 321 HOH HOH A . 
I 6 HOH 289 1197 322 HOH HOH A . 
I 6 HOH 290 1198 323 HOH HOH A . 
I 6 HOH 291 1199 324 HOH HOH A . 
I 6 HOH 292 1200 325 HOH HOH A . 
I 6 HOH 293 1201 326 HOH HOH A . 
I 6 HOH 294 1202 327 HOH HOH A . 
I 6 HOH 295 1203 328 HOH HOH A . 
I 6 HOH 296 1204 329 HOH HOH A . 
I 6 HOH 297 1205 330 HOH HOH A . 
I 6 HOH 298 1206 331 HOH HOH A . 
I 6 HOH 299 1207 332 HOH HOH A . 
I 6 HOH 300 1208 333 HOH HOH A . 
I 6 HOH 301 1209 334 HOH HOH A . 
I 6 HOH 302 1210 335 HOH HOH A . 
I 6 HOH 303 1211 336 HOH HOH A . 
I 6 HOH 304 1212 337 HOH HOH A . 
I 6 HOH 305 1213 338 HOH HOH A . 
I 6 HOH 306 1214 340 HOH HOH A . 
I 6 HOH 307 1215 341 HOH HOH A . 
I 6 HOH 308 1216 342 HOH HOH A . 
I 6 HOH 309 1217 343 HOH HOH A . 
I 6 HOH 310 1218 345 HOH HOH A . 
I 6 HOH 311 1219 346 HOH HOH A . 
I 6 HOH 312 1220 347 HOH HOH A . 
I 6 HOH 313 1221 348 HOH HOH A . 
I 6 HOH 314 1222 349 HOH HOH A . 
I 6 HOH 315 1223 350 HOH HOH A . 
I 6 HOH 316 1224 351 HOH HOH A . 
I 6 HOH 317 1225 352 HOH HOH A . 
I 6 HOH 318 1226 353 HOH HOH A . 
I 6 HOH 319 1227 354 HOH HOH A . 
I 6 HOH 320 1228 355 HOH HOH A . 
I 6 HOH 321 1229 356 HOH HOH A . 
I 6 HOH 322 1230 357 HOH HOH A . 
I 6 HOH 323 1231 358 HOH HOH A . 
I 6 HOH 324 1232 359 HOH HOH A . 
I 6 HOH 325 1233 360 HOH HOH A . 
I 6 HOH 326 1234 361 HOH HOH A . 
I 6 HOH 327 1235 362 HOH HOH A . 
I 6 HOH 328 1236 363 HOH HOH A . 
I 6 HOH 329 1237 364 HOH HOH A . 
I 6 HOH 330 1238 365 HOH HOH A . 
I 6 HOH 331 1239 366 HOH HOH A . 
I 6 HOH 332 1240 367 HOH HOH A . 
I 6 HOH 333 1241 368 HOH HOH A . 
I 6 HOH 334 1242 369 HOH HOH A . 
I 6 HOH 335 1243 370 HOH HOH A . 
I 6 HOH 336 1244 372 HOH HOH A . 
I 6 HOH 337 1245 373 HOH HOH A . 
I 6 HOH 338 1246 374 HOH HOH A . 
I 6 HOH 339 1247 375 HOH HOH A . 
I 6 HOH 340 1248 376 HOH HOH A . 
I 6 HOH 341 1249 377 HOH HOH A . 
I 6 HOH 342 1250 378 HOH HOH A . 
I 6 HOH 343 1251 379 HOH HOH A . 
I 6 HOH 344 1252 380 HOH HOH A . 
I 6 HOH 345 1253 381 HOH HOH A . 
I 6 HOH 346 1254 382 HOH HOH A . 
I 6 HOH 347 1255 383 HOH HOH A . 
I 6 HOH 348 1256 384 HOH HOH A . 
I 6 HOH 349 1257 385 HOH HOH A . 
I 6 HOH 350 1258 386 HOH HOH A . 
I 6 HOH 351 1259 387 HOH HOH A . 
I 6 HOH 352 1260 388 HOH HOH A . 
I 6 HOH 353 1261 389 HOH HOH A . 
I 6 HOH 354 1262 390 HOH HOH A . 
I 6 HOH 355 1263 391 HOH HOH A . 
I 6 HOH 356 1264 392 HOH HOH A . 
I 6 HOH 357 1265 393 HOH HOH A . 
I 6 HOH 358 1266 394 HOH HOH A . 
I 6 HOH 359 1267 397 HOH HOH A . 
I 6 HOH 360 1268 398 HOH HOH A . 
I 6 HOH 361 1269 399 HOH HOH A . 
I 6 HOH 362 1270 400 HOH HOH A . 
I 6 HOH 363 1271 401 HOH HOH A . 
I 6 HOH 364 1272 402 HOH HOH A . 
I 6 HOH 365 1273 403 HOH HOH A . 
I 6 HOH 366 1274 404 HOH HOH A . 
I 6 HOH 367 1275 405 HOH HOH A . 
I 6 HOH 368 1276 406 HOH HOH A . 
I 6 HOH 369 1277 407 HOH HOH A . 
I 6 HOH 370 1278 408 HOH HOH A . 
I 6 HOH 371 1279 409 HOH HOH A . 
I 6 HOH 372 1280 410 HOH HOH A . 
I 6 HOH 373 1281 411 HOH HOH A . 
I 6 HOH 374 1282 412 HOH HOH A . 
I 6 HOH 375 1283 413 HOH HOH A . 
I 6 HOH 376 1284 414 HOH HOH A . 
I 6 HOH 377 1285 415 HOH HOH A . 
I 6 HOH 378 1286 416 HOH HOH A . 
I 6 HOH 379 1287 417 HOH HOH A . 
I 6 HOH 380 1288 418 HOH HOH A . 
I 6 HOH 381 1289 419 HOH HOH A . 
I 6 HOH 382 1290 421 HOH HOH A . 
I 6 HOH 383 1291 422 HOH HOH A . 
I 6 HOH 384 1292 423 HOH HOH A . 
I 6 HOH 385 1293 424 HOH HOH A . 
I 6 HOH 386 1294 425 HOH HOH A . 
I 6 HOH 387 1295 426 HOH HOH A . 
I 6 HOH 388 1296 427 HOH HOH A . 
I 6 HOH 389 1297 428 HOH HOH A . 
I 6 HOH 390 1298 429 HOH HOH A . 
I 6 HOH 391 1299 430 HOH HOH A . 
I 6 HOH 392 1300 432 HOH HOH A . 
I 6 HOH 393 1301 433 HOH HOH A . 
I 6 HOH 394 1302 434 HOH HOH A . 
I 6 HOH 395 1303 435 HOH HOH A . 
I 6 HOH 396 1304 436 HOH HOH A . 
I 6 HOH 397 1305 439 HOH HOH A . 
I 6 HOH 398 1306 440 HOH HOH A . 
I 6 HOH 399 1307 441 HOH HOH A . 
I 6 HOH 400 1308 442 HOH HOH A . 
I 6 HOH 401 1309 443 HOH HOH A . 
I 6 HOH 402 1310 444 HOH HOH A . 
I 6 HOH 403 1311 445 HOH HOH A . 
I 6 HOH 404 1312 446 HOH HOH A . 
I 6 HOH 405 1313 447 HOH HOH A . 
I 6 HOH 406 1314 448 HOH HOH A . 
I 6 HOH 407 1315 449 HOH HOH A . 
I 6 HOH 408 1316 450 HOH HOH A . 
I 6 HOH 409 1317 451 HOH HOH A . 
I 6 HOH 410 1318 452 HOH HOH A . 
I 6 HOH 411 1319 453 HOH HOH A . 
I 6 HOH 412 1320 454 HOH HOH A . 
I 6 HOH 413 1321 455 HOH HOH A . 
I 6 HOH 414 1322 458 HOH HOH A . 
I 6 HOH 415 1323 459 HOH HOH A . 
I 6 HOH 416 1324 461 HOH HOH A . 
I 6 HOH 417 1325 462 HOH HOH A . 
I 6 HOH 418 1326 463 HOH HOH A . 
I 6 HOH 419 1327 464 HOH HOH A . 
I 6 HOH 420 1328 465 HOH HOH A . 
I 6 HOH 421 1329 466 HOH HOH A . 
I 6 HOH 422 1330 467 HOH HOH A . 
I 6 HOH 423 1331 468 HOH HOH A . 
I 6 HOH 424 1332 469 HOH HOH A . 
I 6 HOH 425 1333 470 HOH HOH A . 
I 6 HOH 426 1334 471 HOH HOH A . 
I 6 HOH 427 1335 472 HOH HOH A . 
I 6 HOH 428 1336 473 HOH HOH A . 
I 6 HOH 429 1337 474 HOH HOH A . 
I 6 HOH 430 1338 475 HOH HOH A . 
I 6 HOH 431 1339 477 HOH HOH A . 
I 6 HOH 432 1340 478 HOH HOH A . 
I 6 HOH 433 1341 479 HOH HOH A . 
I 6 HOH 434 1342 480 HOH HOH A . 
I 6 HOH 435 1343 481 HOH HOH A . 
I 6 HOH 436 1344 482 HOH HOH A . 
I 6 HOH 437 1345 483 HOH HOH A . 
I 6 HOH 438 1346 484 HOH HOH A . 
I 6 HOH 439 1347 485 HOH HOH A . 
I 6 HOH 440 1348 486 HOH HOH A . 
I 6 HOH 441 1349 487 HOH HOH A . 
I 6 HOH 442 1350 488 HOH HOH A . 
I 6 HOH 443 1351 489 HOH HOH A . 
I 6 HOH 444 1352 490 HOH HOH A . 
I 6 HOH 445 1353 491 HOH HOH A . 
I 6 HOH 446 1354 492 HOH HOH A . 
I 6 HOH 447 1355 494 HOH HOH A . 
I 6 HOH 448 1356 495 HOH HOH A . 
I 6 HOH 449 1357 496 HOH HOH A . 
I 6 HOH 450 1358 498 HOH HOH A . 
I 6 HOH 451 1359 499 HOH HOH A . 
I 6 HOH 452 1360 500 HOH HOH A . 
I 6 HOH 453 1361 501 HOH HOH A . 
I 6 HOH 454 1362 502 HOH HOH A . 
I 6 HOH 455 1363 503 HOH HOH A . 
I 6 HOH 456 1364 504 HOH HOH A . 
I 6 HOH 457 1365 506 HOH HOH A . 
I 6 HOH 458 1366 507 HOH HOH A . 
I 6 HOH 459 1367 508 HOH HOH A . 
I 6 HOH 460 1368 509 HOH HOH A . 
I 6 HOH 461 1369 510 HOH HOH A . 
I 6 HOH 462 1370 511 HOH HOH A . 
I 6 HOH 463 1371 512 HOH HOH A . 
I 6 HOH 464 1372 513 HOH HOH A . 
I 6 HOH 465 1373 514 HOH HOH A . 
I 6 HOH 466 1374 515 HOH HOH A . 
I 6 HOH 467 1375 517 HOH HOH A . 
I 6 HOH 468 1376 518 HOH HOH A . 
I 6 HOH 469 1377 519 HOH HOH A . 
I 6 HOH 470 1378 521 HOH HOH A . 
I 6 HOH 471 1379 522 HOH HOH A . 
I 6 HOH 472 1380 523 HOH HOH A . 
I 6 HOH 473 1381 524 HOH HOH A . 
I 6 HOH 474 1382 525 HOH HOH A . 
I 6 HOH 475 1383 526 HOH HOH A . 
I 6 HOH 476 1384 527 HOH HOH A . 
I 6 HOH 477 1385 528 HOH HOH A . 
I 6 HOH 478 1386 529 HOH HOH A . 
I 6 HOH 479 1387 530 HOH HOH A . 
I 6 HOH 480 1388 531 HOH HOH A . 
I 6 HOH 481 1389 532 HOH HOH A . 
I 6 HOH 482 1390 533 HOH HOH A . 
I 6 HOH 483 1391 534 HOH HOH A . 
I 6 HOH 484 1392 535 HOH HOH A . 
I 6 HOH 485 1393 536 HOH HOH A . 
I 6 HOH 486 1394 537 HOH HOH A . 
I 6 HOH 487 1395 538 HOH HOH A . 
I 6 HOH 488 1396 539 HOH HOH A . 
I 6 HOH 489 1397 540 HOH HOH A . 
I 6 HOH 490 1398 541 HOH HOH A . 
I 6 HOH 491 1399 542 HOH HOH A . 
I 6 HOH 492 1400 543 HOH HOH A . 
I 6 HOH 493 1401 544 HOH HOH A . 
I 6 HOH 494 1402 545 HOH HOH A . 
I 6 HOH 495 1403 546 HOH HOH A . 
I 6 HOH 496 1404 547 HOH HOH A . 
I 6 HOH 497 1405 548 HOH HOH A . 
I 6 HOH 498 1406 550 HOH HOH A . 
I 6 HOH 499 1407 551 HOH HOH A . 
I 6 HOH 500 1408 552 HOH HOH A . 
I 6 HOH 501 1409 553 HOH HOH A . 
I 6 HOH 502 1410 554 HOH HOH A . 
I 6 HOH 503 1411 555 HOH HOH A . 
I 6 HOH 504 1412 556 HOH HOH A . 
I 6 HOH 505 1413 557 HOH HOH A . 
I 6 HOH 506 1414 558 HOH HOH A . 
I 6 HOH 507 1415 560 HOH HOH A . 
I 6 HOH 508 1416 561 HOH HOH A . 
I 6 HOH 509 1417 562 HOH HOH A . 
I 6 HOH 510 1418 563 HOH HOH A . 
I 6 HOH 511 1419 564 HOH HOH A . 
I 6 HOH 512 1420 565 HOH HOH A . 
I 6 HOH 513 1421 566 HOH HOH A . 
I 6 HOH 514 1422 568 HOH HOH A . 
I 6 HOH 515 1423 569 HOH HOH A . 
I 6 HOH 516 1424 570 HOH HOH A . 
I 6 HOH 517 1425 571 HOH HOH A . 
I 6 HOH 518 1426 572 HOH HOH A . 
I 6 HOH 519 1427 573 HOH HOH A . 
I 6 HOH 520 1428 574 HOH HOH A . 
I 6 HOH 521 1429 575 HOH HOH A . 
I 6 HOH 522 1430 576 HOH HOH A . 
I 6 HOH 523 1431 577 HOH HOH A . 
I 6 HOH 524 1432 578 HOH HOH A . 
I 6 HOH 525 1433 579 HOH HOH A . 
I 6 HOH 526 1434 580 HOH HOH A . 
I 6 HOH 527 1435 582 HOH HOH A . 
I 6 HOH 528 1436 583 HOH HOH A . 
I 6 HOH 529 1437 584 HOH HOH A . 
I 6 HOH 530 1438 585 HOH HOH A . 
I 6 HOH 531 1439 586 HOH HOH A . 
I 6 HOH 532 1440 587 HOH HOH A . 
I 6 HOH 533 1441 589 HOH HOH A . 
I 6 HOH 534 1442 590 HOH HOH A . 
I 6 HOH 535 1443 591 HOH HOH A . 
I 6 HOH 536 1444 592 HOH HOH A . 
I 6 HOH 537 1445 593 HOH HOH A . 
I 6 HOH 538 1446 594 HOH HOH A . 
I 6 HOH 539 1447 595 HOH HOH A . 
I 6 HOH 540 1448 596 HOH HOH A . 
I 6 HOH 541 1449 597 HOH HOH A . 
I 6 HOH 542 1450 598 HOH HOH A . 
I 6 HOH 543 1451 599 HOH HOH A . 
I 6 HOH 544 1452 600 HOH HOH A . 
I 6 HOH 545 1453 601 HOH HOH A . 
I 6 HOH 546 1454 602 HOH HOH A . 
I 6 HOH 547 1455 603 HOH HOH A . 
I 6 HOH 548 1456 604 HOH HOH A . 
I 6 HOH 549 1457 605 HOH HOH A . 
I 6 HOH 550 1458 606 HOH HOH A . 
I 6 HOH 551 1459 607 HOH HOH A . 
I 6 HOH 552 1460 608 HOH HOH A . 
I 6 HOH 553 1461 609 HOH HOH A . 
I 6 HOH 554 1462 610 HOH HOH A . 
I 6 HOH 555 1463 611 HOH HOH A . 
I 6 HOH 556 1464 612 HOH HOH A . 
I 6 HOH 557 1465 613 HOH HOH A . 
I 6 HOH 558 1466 614 HOH HOH A . 
I 6 HOH 559 1467 616 HOH HOH A . 
I 6 HOH 560 1468 617 HOH HOH A . 
I 6 HOH 561 1469 618 HOH HOH A . 
I 6 HOH 562 1470 619 HOH HOH A . 
I 6 HOH 563 1471 621 HOH HOH A . 
I 6 HOH 564 1472 622 HOH HOH A . 
I 6 HOH 565 1473 623 HOH HOH A . 
I 6 HOH 566 1474 624 HOH HOH A . 
I 6 HOH 567 1475 625 HOH HOH A . 
I 6 HOH 568 1476 626 HOH HOH A . 
I 6 HOH 569 1477 627 HOH HOH A . 
I 6 HOH 570 1478 628 HOH HOH A . 
I 6 HOH 571 1479 629 HOH HOH A . 
I 6 HOH 572 1480 630 HOH HOH A . 
I 6 HOH 573 1481 631 HOH HOH A . 
I 6 HOH 574 1482 632 HOH HOH A . 
I 6 HOH 575 1483 633 HOH HOH A . 
I 6 HOH 576 1484 634 HOH HOH A . 
I 6 HOH 577 1485 635 HOH HOH A . 
I 6 HOH 578 1486 636 HOH HOH A . 
I 6 HOH 579 1487 637 HOH HOH A . 
I 6 HOH 580 1488 638 HOH HOH A . 
I 6 HOH 581 1489 639 HOH HOH A . 
I 6 HOH 582 1490 640 HOH HOH A . 
I 6 HOH 583 1491 641 HOH HOH A . 
I 6 HOH 584 1492 642 HOH HOH A . 
I 6 HOH 585 1493 643 HOH HOH A . 
I 6 HOH 586 1494 644 HOH HOH A . 
I 6 HOH 587 1495 645 HOH HOH A . 
I 6 HOH 588 1496 648 HOH HOH A . 
I 6 HOH 589 1497 649 HOH HOH A . 
I 6 HOH 590 1498 650 HOH HOH A . 
I 6 HOH 591 1499 652 HOH HOH A . 
I 6 HOH 592 1500 653 HOH HOH A . 
I 6 HOH 593 1501 654 HOH HOH A . 
I 6 HOH 594 1502 655 HOH HOH A . 
I 6 HOH 595 1503 656 HOH HOH A . 
I 6 HOH 596 1504 657 HOH HOH A . 
I 6 HOH 597 1505 658 HOH HOH A . 
I 6 HOH 598 1506 659 HOH HOH A . 
I 6 HOH 599 1507 660 HOH HOH A . 
I 6 HOH 600 1508 661 HOH HOH A . 
I 6 HOH 601 1509 662 HOH HOH A . 
I 6 HOH 602 1510 663 HOH HOH A . 
I 6 HOH 603 1511 664 HOH HOH A . 
I 6 HOH 604 1512 665 HOH HOH A . 
I 6 HOH 605 1513 666 HOH HOH A . 
I 6 HOH 606 1514 669 HOH HOH A . 
I 6 HOH 607 1515 670 HOH HOH A . 
I 6 HOH 608 1516 671 HOH HOH A . 
I 6 HOH 609 1517 673 HOH HOH A . 
I 6 HOH 610 1518 674 HOH HOH A . 
I 6 HOH 611 1519 675 HOH HOH A . 
I 6 HOH 612 1520 676 HOH HOH A . 
I 6 HOH 613 1521 677 HOH HOH A . 
I 6 HOH 614 1522 678 HOH HOH A . 
I 6 HOH 615 1523 679 HOH HOH A . 
I 6 HOH 616 1524 680 HOH HOH A . 
I 6 HOH 617 1525 681 HOH HOH A . 
I 6 HOH 618 1526 682 HOH HOH A . 
I 6 HOH 619 1527 683 HOH HOH A . 
I 6 HOH 620 1528 684 HOH HOH A . 
I 6 HOH 621 1529 685 HOH HOH A . 
I 6 HOH 622 1530 686 HOH HOH A . 
I 6 HOH 623 1531 688 HOH HOH A . 
I 6 HOH 624 1532 689 HOH HOH A . 
I 6 HOH 625 1533 690 HOH HOH A . 
I 6 HOH 626 1534 691 HOH HOH A . 
I 6 HOH 627 1535 692 HOH HOH A . 
I 6 HOH 628 1536 693 HOH HOH A . 
I 6 HOH 629 1537 694 HOH HOH A . 
I 6 HOH 630 1538 695 HOH HOH A . 
I 6 HOH 631 1539 696 HOH HOH A . 
I 6 HOH 632 1540 697 HOH HOH A . 
I 6 HOH 633 1541 698 HOH HOH A . 
I 6 HOH 634 1542 699 HOH HOH A . 
I 6 HOH 635 1543 700 HOH HOH A . 
I 6 HOH 636 1544 701 HOH HOH A . 
I 6 HOH 637 1545 702 HOH HOH A . 
I 6 HOH 638 1546 703 HOH HOH A . 
I 6 HOH 639 1547 704 HOH HOH A . 
I 6 HOH 640 1548 705 HOH HOH A . 
I 6 HOH 641 1549 707 HOH HOH A . 
I 6 HOH 642 1550 708 HOH HOH A . 
I 6 HOH 643 1551 709 HOH HOH A . 
I 6 HOH 644 1552 710 HOH HOH A . 
I 6 HOH 645 1553 711 HOH HOH A . 
I 6 HOH 646 1554 712 HOH HOH A . 
I 6 HOH 647 1555 714 HOH HOH A . 
I 6 HOH 648 1556 715 HOH HOH A . 
I 6 HOH 649 1557 716 HOH HOH A . 
I 6 HOH 650 1558 717 HOH HOH A . 
I 6 HOH 651 1559 718 HOH HOH A . 
I 6 HOH 652 1560 719 HOH HOH A . 
I 6 HOH 653 1561 720 HOH HOH A . 
I 6 HOH 654 1562 721 HOH HOH A . 
I 6 HOH 655 1563 722 HOH HOH A . 
I 6 HOH 656 1564 723 HOH HOH A . 
I 6 HOH 657 1565 724 HOH HOH A . 
I 6 HOH 658 1566 725 HOH HOH A . 
I 6 HOH 659 1567 726 HOH HOH A . 
I 6 HOH 660 1568 727 HOH HOH A . 
I 6 HOH 661 1569 728 HOH HOH A . 
I 6 HOH 662 1570 729 HOH HOH A . 
I 6 HOH 663 1571 730 HOH HOH A . 
I 6 HOH 664 1572 731 HOH HOH A . 
I 6 HOH 665 1573 732 HOH HOH A . 
I 6 HOH 666 1574 733 HOH HOH A . 
I 6 HOH 667 1575 734 HOH HOH A . 
I 6 HOH 668 1576 735 HOH HOH A . 
I 6 HOH 669 1577 736 HOH HOH A . 
I 6 HOH 670 1578 737 HOH HOH A . 
I 6 HOH 671 1579 738 HOH HOH A . 
I 6 HOH 672 1580 739 HOH HOH A . 
I 6 HOH 673 1581 740 HOH HOH A . 
I 6 HOH 674 1582 741 HOH HOH A . 
I 6 HOH 675 1583 742 HOH HOH A . 
I 6 HOH 676 1584 743 HOH HOH A . 
I 6 HOH 677 1585 744 HOH HOH A . 
I 6 HOH 678 1586 745 HOH HOH A . 
I 6 HOH 679 1587 746 HOH HOH A . 
I 6 HOH 680 1588 747 HOH HOH A . 
I 6 HOH 681 1589 748 HOH HOH A . 
I 6 HOH 682 1590 749 HOH HOH A . 
I 6 HOH 683 1591 750 HOH HOH A . 
I 6 HOH 684 1592 751 HOH HOH A . 
I 6 HOH 685 1593 752 HOH HOH A . 
I 6 HOH 686 1594 753 HOH HOH A . 
I 6 HOH 687 1595 754 HOH HOH A . 
I 6 HOH 688 1596 755 HOH HOH A . 
I 6 HOH 689 1597 756 HOH HOH A . 
I 6 HOH 690 1598 757 HOH HOH A . 
I 6 HOH 691 1599 758 HOH HOH A . 
I 6 HOH 692 1600 760 HOH HOH A . 
I 6 HOH 693 1601 761 HOH HOH A . 
I 6 HOH 694 1602 762 HOH HOH A . 
I 6 HOH 695 1603 763 HOH HOH A . 
I 6 HOH 696 1604 764 HOH HOH A . 
I 6 HOH 697 1605 765 HOH HOH A . 
I 6 HOH 698 1606 766 HOH HOH A . 
I 6 HOH 699 1607 767 HOH HOH A . 
I 6 HOH 700 1608 768 HOH HOH A . 
I 6 HOH 701 1609 769 HOH HOH A . 
I 6 HOH 702 1610 770 HOH HOH A . 
I 6 HOH 703 1611 771 HOH HOH A . 
I 6 HOH 704 1612 772 HOH HOH A . 
I 6 HOH 705 1613 774 HOH HOH A . 
I 6 HOH 706 1614 775 HOH HOH A . 
I 6 HOH 707 1615 776 HOH HOH A . 
I 6 HOH 708 1616 777 HOH HOH A . 
I 6 HOH 709 1617 778 HOH HOH A . 
I 6 HOH 710 1618 779 HOH HOH A . 
I 6 HOH 711 1619 780 HOH HOH A . 
I 6 HOH 712 1620 781 HOH HOH A . 
I 6 HOH 713 1621 782 HOH HOH A . 
I 6 HOH 714 1622 783 HOH HOH A . 
I 6 HOH 715 1623 784 HOH HOH A . 
I 6 HOH 716 1624 785 HOH HOH A . 
I 6 HOH 717 1625 786 HOH HOH A . 
I 6 HOH 718 1626 787 HOH HOH A . 
I 6 HOH 719 1627 788 HOH HOH A . 
I 6 HOH 720 1628 789 HOH HOH A . 
I 6 HOH 721 1629 790 HOH HOH A . 
I 6 HOH 722 1630 791 HOH HOH A . 
I 6 HOH 723 1631 792 HOH HOH A . 
I 6 HOH 724 1632 793 HOH HOH A . 
I 6 HOH 725 1633 794 HOH HOH A . 
I 6 HOH 726 1634 795 HOH HOH A . 
I 6 HOH 727 1635 796 HOH HOH A . 
I 6 HOH 728 1636 797 HOH HOH A . 
I 6 HOH 729 1637 798 HOH HOH A . 
I 6 HOH 730 1638 799 HOH HOH A . 
I 6 HOH 731 1639 800 HOH HOH A . 
I 6 HOH 732 1640 801 HOH HOH A . 
I 6 HOH 733 1641 802 HOH HOH A . 
I 6 HOH 734 1642 803 HOH HOH A . 
I 6 HOH 735 1643 804 HOH HOH A . 
I 6 HOH 736 1644 805 HOH HOH A . 
I 6 HOH 737 1645 806 HOH HOH A . 
I 6 HOH 738 1646 807 HOH HOH A . 
I 6 HOH 739 1647 808 HOH HOH A . 
I 6 HOH 740 1648 809 HOH HOH A . 
I 6 HOH 741 1649 810 HOH HOH A . 
I 6 HOH 742 1650 811 HOH HOH A . 
I 6 HOH 743 1651 812 HOH HOH A . 
I 6 HOH 744 1652 813 HOH HOH A . 
I 6 HOH 745 1653 814 HOH HOH A . 
I 6 HOH 746 1654 815 HOH HOH A . 
I 6 HOH 747 1655 816 HOH HOH A . 
I 6 HOH 748 1656 817 HOH HOH A . 
I 6 HOH 749 1657 818 HOH HOH A . 
I 6 HOH 750 1658 819 HOH HOH A . 
I 6 HOH 751 1659 823 HOH HOH A . 
I 6 HOH 752 1660 824 HOH HOH A . 
I 6 HOH 753 1661 825 HOH HOH A . 
I 6 HOH 754 1662 826 HOH HOH A . 
I 6 HOH 755 1663 828 HOH HOH A . 
I 6 HOH 756 1664 829 HOH HOH A . 
I 6 HOH 757 1665 830 HOH HOH A . 
I 6 HOH 758 1666 831 HOH HOH A . 
I 6 HOH 759 1667 832 HOH HOH A . 
I 6 HOH 760 1668 833 HOH HOH A . 
I 6 HOH 761 1669 834 HOH HOH A . 
I 6 HOH 762 1670 835 HOH HOH A . 
I 6 HOH 763 1671 836 HOH HOH A . 
I 6 HOH 764 1672 837 HOH HOH A . 
I 6 HOH 765 1673 838 HOH HOH A . 
I 6 HOH 766 1674 839 HOH HOH A . 
I 6 HOH 767 1675 840 HOH HOH A . 
I 6 HOH 768 1676 841 HOH HOH A . 
I 6 HOH 769 1677 842 HOH HOH A . 
I 6 HOH 770 1678 843 HOH HOH A . 
I 6 HOH 771 1679 844 HOH HOH A . 
I 6 HOH 772 1680 845 HOH HOH A . 
I 6 HOH 773 1681 846 HOH HOH A . 
I 6 HOH 774 1682 847 HOH HOH A . 
I 6 HOH 775 1683 848 HOH HOH A . 
I 6 HOH 776 1684 849 HOH HOH A . 
I 6 HOH 777 1685 850 HOH HOH A . 
I 6 HOH 778 1686 851 HOH HOH A . 
I 6 HOH 779 1687 852 HOH HOH A . 
I 6 HOH 780 1688 853 HOH HOH A . 
I 6 HOH 781 1689 854 HOH HOH A . 
I 6 HOH 782 1690 855 HOH HOH A . 
I 6 HOH 783 1691 856 HOH HOH A . 
I 6 HOH 784 1692 857 HOH HOH A . 
I 6 HOH 785 1693 858 HOH HOH A . 
I 6 HOH 786 1694 859 HOH HOH A . 
I 6 HOH 787 1695 860 HOH HOH A . 
I 6 HOH 788 1696 861 HOH HOH A . 
I 6 HOH 789 1697 862 HOH HOH A . 
I 6 HOH 790 1698 863 HOH HOH A . 
I 6 HOH 791 1699 864 HOH HOH A . 
I 6 HOH 792 1700 865 HOH HOH A . 
I 6 HOH 793 1701 866 HOH HOH A . 
I 6 HOH 794 1702 867 HOH HOH A . 
I 6 HOH 795 1703 868 HOH HOH A . 
I 6 HOH 796 1704 869 HOH HOH A . 
I 6 HOH 797 1705 870 HOH HOH A . 
I 6 HOH 798 1706 871 HOH HOH A . 
I 6 HOH 799 1707 872 HOH HOH A . 
I 6 HOH 800 1708 873 HOH HOH A . 
I 6 HOH 801 1709 874 HOH HOH A . 
I 6 HOH 802 1710 875 HOH HOH A . 
I 6 HOH 803 1711 876 HOH HOH A . 
I 6 HOH 804 1712 877 HOH HOH A . 
I 6 HOH 805 1713 878 HOH HOH A . 
I 6 HOH 806 1714 879 HOH HOH A . 
I 6 HOH 807 1715 880 HOH HOH A . 
I 6 HOH 808 1716 881 HOH HOH A . 
I 6 HOH 809 1717 882 HOH HOH A . 
I 6 HOH 810 1718 883 HOH HOH A . 
I 6 HOH 811 1719 884 HOH HOH A . 
I 6 HOH 812 1720 887 HOH HOH A . 
I 6 HOH 813 1721 890 HOH HOH A . 
I 6 HOH 814 1722 891 HOH HOH A . 
I 6 HOH 815 1723 892 HOH HOH A . 
I 6 HOH 816 1724 893 HOH HOH A . 
I 6 HOH 817 1725 894 HOH HOH A . 
I 6 HOH 818 1726 895 HOH HOH A . 
I 6 HOH 819 1727 896 HOH HOH A . 
I 6 HOH 820 1728 897 HOH HOH A . 
I 6 HOH 821 1729 898 HOH HOH A . 
I 6 HOH 822 1730 899 HOH HOH A . 
I 6 HOH 823 1731 900 HOH HOH A . 
I 6 HOH 824 1732 901 HOH HOH A . 
I 6 HOH 825 1733 902 HOH HOH A . 
I 6 HOH 826 1734 903 HOH HOH A . 
I 6 HOH 827 1735 904 HOH HOH A . 
I 6 HOH 828 1736 905 HOH HOH A . 
I 6 HOH 829 1737 906 HOH HOH A . 
I 6 HOH 830 1738 907 HOH HOH A . 
I 6 HOH 831 1739 908 HOH HOH A . 
I 6 HOH 832 1740 456 HOH HOH A . 
J 6 HOH 1   19   6   HOH HOH T . 
J 6 HOH 2   20   7   HOH HOH T . 
J 6 HOH 3   26   26  HOH HOH T . 
J 6 HOH 4   58   58  HOH HOH T . 
J 6 HOH 5   61   61  HOH HOH T . 
J 6 HOH 6   75   75  HOH HOH T . 
J 6 HOH 7   90   90  HOH HOH T . 
J 6 HOH 8   96   96  HOH HOH T . 
J 6 HOH 9   108  108 HOH HOH T . 
J 6 HOH 10  109  109 HOH HOH T . 
J 6 HOH 11  118  118 HOH HOH T . 
J 6 HOH 12  129  129 HOH HOH T . 
J 6 HOH 13  134  134 HOH HOH T . 
J 6 HOH 14  177  177 HOH HOH T . 
J 6 HOH 15  178  178 HOH HOH T . 
J 6 HOH 16  185  185 HOH HOH T . 
J 6 HOH 17  203  203 HOH HOH T . 
J 6 HOH 18  239  239 HOH HOH T . 
J 6 HOH 19  241  241 HOH HOH T . 
J 6 HOH 20  247  247 HOH HOH T . 
J 6 HOH 21  252  252 HOH HOH T . 
J 6 HOH 22  258  258 HOH HOH T . 
J 6 HOH 23  271  271 HOH HOH T . 
J 6 HOH 24  290  290 HOH HOH T . 
J 6 HOH 25  299  299 HOH HOH T . 
J 6 HOH 26  307  307 HOH HOH T . 
J 6 HOH 27  312  312 HOH HOH T . 
J 6 HOH 28  320  320 HOH HOH T . 
J 6 HOH 29  371  371 HOH HOH T . 
J 6 HOH 30  395  395 HOH HOH T . 
J 6 HOH 31  396  396 HOH HOH T . 
J 6 HOH 32  420  420 HOH HOH T . 
J 6 HOH 33  431  431 HOH HOH T . 
J 6 HOH 34  437  437 HOH HOH T . 
J 6 HOH 35  438  438 HOH HOH T . 
J 6 HOH 36  457  457 HOH HOH T . 
J 6 HOH 37  476  476 HOH HOH T . 
J 6 HOH 38  493  493 HOH HOH T . 
J 6 HOH 39  505  505 HOH HOH T . 
J 6 HOH 40  520  520 HOH HOH T . 
J 6 HOH 41  559  559 HOH HOH T . 
J 6 HOH 42  567  567 HOH HOH T . 
J 6 HOH 43  588  588 HOH HOH T . 
J 6 HOH 44  615  615 HOH HOH T . 
J 6 HOH 45  620  620 HOH HOH T . 
J 6 HOH 46  667  667 HOH HOH T . 
J 6 HOH 47  668  668 HOH HOH T . 
J 6 HOH 48  687  687 HOH HOH T . 
J 6 HOH 49  713  713 HOH HOH T . 
J 6 HOH 50  759  759 HOH HOH T . 
J 6 HOH 51  773  773 HOH HOH T . 
J 6 HOH 52  820  820 HOH HOH T . 
J 6 HOH 53  821  821 HOH HOH T . 
J 6 HOH 54  822  822 HOH HOH T . 
J 6 HOH 55  827  827 HOH HOH T . 
J 6 HOH 56  885  885 HOH HOH T . 
J 6 HOH 57  886  886 HOH HOH T . 
J 6 HOH 58  888  888 HOH HOH T . 
J 6 HOH 59  911  911 HOH HOH T . 
K 6 HOH 1   53   53  HOH HOH P . 
K 6 HOH 2   77   77  HOH HOH P . 
K 6 HOH 3   116  112 HOH HOH P . 
K 6 HOH 4   232  232 HOH HOH P . 
K 6 HOH 5   272  272 HOH HOH P . 
K 6 HOH 6   286  286 HOH HOH P . 
K 6 HOH 7   304  304 HOH HOH P . 
K 6 HOH 8   339  339 HOH HOH P . 
K 6 HOH 9   344  344 HOH HOH P . 
K 6 HOH 10  460  460 HOH HOH P . 
K 6 HOH 11  497  497 HOH HOH P . 
K 6 HOH 12  516  516 HOH HOH P . 
K 6 HOH 13  549  549 HOH HOH P . 
K 6 HOH 14  581  581 HOH HOH P . 
K 6 HOH 15  646  646 HOH HOH P . 
K 6 HOH 16  647  647 HOH HOH P . 
K 6 HOH 17  651  651 HOH HOH P . 
K 6 HOH 18  672  672 HOH HOH P . 
K 6 HOH 19  706  706 HOH HOH P . 
K 6 HOH 20  889  889 HOH HOH P . 
#