data_3QEV
# 
_entry.id   3QEV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QEV         
NDB   NA0957       
RCSB  RCSB063556   
WWPDB D_1000063556 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QEI . unspecified 
PDB 3QEP . unspecified 
PDB 3QER . unspecified 
PDB 3QES . unspecified 
PDB 3QET . unspecified 
PDB 3QEX . unspecified 
PDB 3QEW . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QEV 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     'Hydrogen-Bonding Capability of Difluorotoluene Nucleoside in Replication Complexes' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Konigsberg, W.H.' 2 
primary 'Wang, J.'         3 
# 
_cell.entry_id           3QEV 
_cell.length_a           75.018 
_cell.length_b           119.553 
_cell.length_c           130.369 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QEV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                       104490.945 1   2.7.7.7 
'D222A, D327A, L561A, S565G, Y567A' ? ?              
2 polymer     syn 
;DNA (5'-D(*TP*CP*GP*TP*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5532.577   1   ?       ?                                   ? 'DNA Template' 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*(DOC))-3')
;
3951.586   1   ?       ?                                   ? 'DNA Primer'   
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                     467.157    1   ?       ? ? ?              
5 non-polymer syn 'CALCIUM ION'                                                          40.078     6   ?       ? ? ?              
6 water       nat water                                                                  18.015     902 ?       ? ? ?              
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no no  '(DT)(DC)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' TCGTGTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DOC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DT  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DOC n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Bacteriophage RB69' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PSP72 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? 32630 ? 
3 1 sample ? ? ? ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 3QEV       3QEV   2 TCGTGTAAGCAGTCCGCG ? ? 
3 PDB 3QEV       3QEV   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QEV A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 3QEV T 1 ? 18  ? 3QEV   1   ? 18  ? 1   18  
3 3 3QEV P 1 ? 13  ? 3QEV   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QEV ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 3QEV ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 3QEV ALA A 561 ? UNP Q38087 LEU 561 'ENGINEERED MUTATION' 561 3 
1 3QEV GLY A 565 ? UNP Q38087 SER 565 'ENGINEERED MUTATION' 565 4 
1 3QEV ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                            ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"       ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'   291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3QEV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   52.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'150 mM CaCl2, 15% (w/v) PEG 350 monomethyl ether (MME), and 100 mM sodium cacodylate (pH 6.5), VAPOR DIFFUSION, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2010-10-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3QEV 
_reflns.observed_criterion_sigma_I   1.2 
_reflns.observed_criterion_sigma_F   2.4 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.77 
_reflns.number_obs                   100984 
_reflns.number_all                   106517 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.77 
_reflns_shell.d_res_low              1.81 
_reflns_shell.percent_possible_all   82.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3QEV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     100984 
_refine.ls_number_reflns_all                     106517 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.50 
_refine.ls_d_res_high                            1.77 
_refine.ls_percent_reflns_obs                    92.69 
_refine.ls_R_factor_obs                          0.17492 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17309 
_refine.ls_R_factor_R_free                       0.20975 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5308 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               26.517 
_refine.aniso_B[1][1]                            -0.37 
_refine.aniso_B[2][2]                            -0.39 
_refine.aniso_B[3][3]                            0.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.119 
_refine.pdbx_overall_ESU_R_Free                  0.116 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7343 
_refine_hist.pdbx_number_atoms_nucleic_acid   629 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             902 
_refine_hist.number_atoms_total               8908 
_refine_hist.d_res_high                       1.77 
_refine_hist.d_res_low                        45.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 8346  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.085  2.061  ? 11436 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.072  5.000  ? 928   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.935 24.162 ? 382   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.200 15.000 ? 1365  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.674 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 1211  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 6189  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.163  4.000  ? 4537  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.044  6.000  ? 7369  'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.405  6.000  ? 3808  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.664  9.000  ? 4053  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.770 
_refine_ls_shell.d_res_low                        1.816 
_refine_ls_shell.number_reflns_R_work             6275 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               78.85 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             327 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3QEV 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3QEV 
_struct.title                     'RB69 DNA Polymerase (L561A/S565G/Y567A) Ternary Complex with dCTP Opposite dT' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QEV 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            'Difluorotoluene Nucleoside, dCTP/dT, Triple mutant, Transferase-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 LYS A 311 ? GLN A 339 ? LYS A 311 GLN A 339 1 ? 29 
HELX_P HELX_P14 14 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P15 15 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P16 16 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P17 17 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P18 18 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 1 ? 6  
HELX_P HELX_P33 33 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P34 34 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P35 35 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P36 36 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P37 37 PHE A 876 ? LYS A 888 ? PHE A 876 LYS A 888 1 ? 13 
HELX_P HELX_P38 38 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C DA  12  "O3'" ? ? ? 1_555 C DOC 13 P  ? ? P DA  114 P DOC 115  1_555 ? ? ? ? ? ? ?            1.484 ? 
metalc1  metalc ? ? F CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  906 A HOH 1171 1_555 ? ? ? ? ? ? ?            2.175 ? 
metalc2  metalc ? ? I CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  909 A HOH 1088 1_555 ? ? ? ? ? ? ?            2.198 ? 
metalc3  metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507 A CA  907  1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc4  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  905  1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc5  metalc ? ? D DCP .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc6  metalc ? ? D DCP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.287 ? 
metalc7  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  905  1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc8  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531 A CA  907  1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc9  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505 A CA  907  1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc10 metalc ? ? I CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  909 A HOH 1234 1_555 ? ? ? ? ? ? ?            2.351 ? 
metalc11 metalc ? ? G CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  907 A HOH 1163 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc12 metalc ? ? G CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  907 A HOH 968  1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc13 metalc ? ? H CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  908 A HOH 1398 1_555 ? ? ? ? ? ? ?            2.392 ? 
metalc14 metalc ? ? H CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  908 A HOH 1353 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc15 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc16 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411 A CA  906  1_555 ? ? ? ? ? ? ?            2.440 ? 
metalc17 metalc ? ? J CA  .   CA    ? ? ? 1_555 L HOH .  O  ? ? P CA  1   T HOH 545  1_555 ? ? ? ? ? ? ?            2.448 ? 
metalc18 metalc ? ? I CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  909 A HOH 932  1_555 ? ? ? ? ? ? ?            2.482 ? 
metalc19 metalc ? ? D DCP .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A DCP 904 A CA  906  1_555 ? ? ? ? ? ? ?            2.499 ? 
metalc20 metalc ? ? D DCP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.519 ? 
metalc21 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.563 ? 
metalc22 metalc ? ? J CA  .   CA    ? ? ? 1_555 L HOH .  O  ? ? P CA  1   T HOH 564  1_555 ? ? ? ? ? ? ?            2.564 ? 
metalc23 metalc ? ? J CA  .   CA    ? ? ? 1_555 L HOH .  O  ? ? P CA  1   T HOH 562  1_555 ? ? ? ? ? ? ?            2.570 ? 
metalc24 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            2.580 ? 
metalc25 metalc ? ? G CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  907 A HOH 1113 1_555 ? ? ? ? ? ? ?            2.583 ? 
metalc26 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623 A CA  906  1_555 ? ? ? ? ? ? ?            2.592 ? 
metalc27 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            2.593 ? 
metalc28 metalc ? ? J CA  .   CA    ? ? ? 1_555 L HOH .  O  ? ? P CA  1   T HOH 563  1_555 ? ? ? ? ? ? ?            2.593 ? 
metalc29 metalc ? ? H CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  908 A HOH 1641 1_555 ? ? ? ? ? ? ?            2.641 ? 
metalc30 metalc ? ? A GLU 716 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 716 A CA  908  1_555 ? ? ? ? ? ? ?            2.691 ? 
metalc31 metalc ? ? H CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  908 A HOH 1306 1_555 ? ? ? ? ? ? ?            2.778 ? 
metalc32 metalc ? ? F CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? A CA  906 A HOH 1462 1_555 ? ? ? ? ? ? ?            3.167 ? 
hydrog1  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DOC 13 N3 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DOC 13 O2 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DOC 13 N4 ? ? T DG  5   P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
D 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? ASN A 255 ? THR A 248 ASN A 255 
F 2 GLY A 258 ? LEU A 265 ? GLY A 258 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? GLY A 620 ? VAL A 617 GLY A 620 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ILE A 253 ? N ILE A 253 O ARG A 260 ? O ARG A 260 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N TYR A 619 ? N TYR A 619 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
J 2 3 N LEU A 833 ? N LEU A 833 O ILE A 846 ? O ILE A 846 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE DCP A 904' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 905'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 906'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 907'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 908'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 909'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA P 1'    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 23 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 23 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 23 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 23 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 23 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 23 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 23 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 23 THR A 622 ? THR A 622  . ? 1_555 ? 
10 AC1 23 ASP A 623 ? ASP A 623  . ? 1_555 ? 
11 AC1 23 CA  E .   ? CA  A 905  . ? 1_555 ? 
12 AC1 23 CA  F .   ? CA  A 906  . ? 1_555 ? 
13 AC1 23 HOH K .   ? HOH A 947  . ? 1_555 ? 
14 AC1 23 HOH K .   ? HOH A 1135 . ? 1_555 ? 
15 AC1 23 HOH K .   ? HOH A 1270 . ? 1_555 ? 
16 AC1 23 HOH K .   ? HOH A 1280 . ? 1_555 ? 
17 AC1 23 HOH K .   ? HOH A 1462 . ? 1_555 ? 
18 AC1 23 HOH K .   ? HOH A 1535 . ? 1_555 ? 
19 AC1 23 HOH K .   ? HOH A 1650 . ? 1_555 ? 
20 AC1 23 DOC C 13  ? DOC P 115  . ? 1_555 ? 
21 AC1 23 DG  B 5   ? DG  T 5    . ? 1_555 ? 
22 AC1 23 HOH L .   ? HOH T 506  . ? 1_555 ? 
23 AC1 23 HOH L .   ? HOH T 517  . ? 1_555 ? 
24 AC2 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
25 AC2 5  LEU A 412 ? LEU A 412  . ? 1_555 ? 
26 AC2 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
27 AC2 5  DCP D .   ? DCP A 904  . ? 1_555 ? 
28 AC2 5  CA  F .   ? CA  A 906  . ? 1_555 ? 
29 AC3 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
30 AC3 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
31 AC3 5  DCP D .   ? DCP A 904  . ? 1_555 ? 
32 AC3 5  CA  E .   ? CA  A 905  . ? 1_555 ? 
33 AC3 5  HOH K .   ? HOH A 1171 . ? 1_555 ? 
34 AC4 6  ASN A 505 ? ASN A 505  . ? 1_555 ? 
35 AC4 6  ASN A 507 ? ASN A 507  . ? 1_555 ? 
36 AC4 6  LYS A 531 ? LYS A 531  . ? 1_555 ? 
37 AC4 6  HOH K .   ? HOH A 968  . ? 1_555 ? 
38 AC4 6  HOH K .   ? HOH A 1113 . ? 1_555 ? 
39 AC4 6  HOH K .   ? HOH A 1163 . ? 1_555 ? 
40 AC5 5  GLU A 716 ? GLU A 716  . ? 1_555 ? 
41 AC5 5  HOH K .   ? HOH A 1306 . ? 1_555 ? 
42 AC5 5  HOH K .   ? HOH A 1353 . ? 1_555 ? 
43 AC5 5  HOH K .   ? HOH A 1398 . ? 1_555 ? 
44 AC5 5  HOH K .   ? HOH A 1641 . ? 1_555 ? 
45 AC6 4  GLU A 116 ? GLU A 116  . ? 1_555 ? 
46 AC6 4  HOH K .   ? HOH A 932  . ? 1_555 ? 
47 AC6 4  HOH K .   ? HOH A 1088 . ? 1_555 ? 
48 AC6 4  HOH K .   ? HOH A 1234 . ? 1_555 ? 
49 AC7 4  HOH L .   ? HOH T 545  . ? 1_555 ? 
50 AC7 4  HOH L .   ? HOH T 562  . ? 1_555 ? 
51 AC7 4  HOH L .   ? HOH T 563  . ? 1_555 ? 
52 AC7 4  HOH L .   ? HOH T 564  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QEV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QEV 
_atom_sites.fract_transf_matrix[1][1]   0.013330 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008364 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007671 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -38.198 -18.222 35.869 1.00 45.01 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.849 -17.742 36.289 1.00 43.27 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.693 -16.237 36.079 1.00 41.33 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.406 -15.634 35.273 1.00 39.83 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.739 -18.510 35.554 1.00 44.79 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.981 -18.731 34.059 1.00 49.00 ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -34.463 -18.936 33.097 1.00 52.99 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -33.897 -17.238 33.030 1.00 50.76 ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.766 -15.635 36.824 1.00 38.90 ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.447 -14.218 36.673 1.00 35.13 ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.656 -14.007 35.391 1.00 30.78 ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.771 -14.795 35.065 1.00 28.36 ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.648 -13.706 37.877 1.00 36.82 ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.486 -13.423 39.127 1.00 39.96 ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.253 -12.103 39.006 1.00 45.33 ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -36.958 -11.734 40.307 1.00 49.48 ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -36.015 -11.205 41.338 1.00 49.67 ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.981 -12.944 34.664 1.00 28.50 ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -34.313 -12.664 33.397 1.00 26.52 ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.872 -12.195 33.617 1.00 24.16 ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.547 -11.651 34.676 1.00 22.90 ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -35.109 -11.632 32.601 1.00 28.39 ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.572 -12.030 32.410 1.00 34.66 ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -37.260 -11.293 31.282 1.00 39.79 ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -38.361 -11.734 30.870 1.00 42.68 ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.705 -10.281 30.803 1.00 41.93 ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -32.009 -12.433 32.630 1.00 20.61 ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.650 -11.889 32.656 1.00 18.46 ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -30.148 -11.553 31.260 1.00 17.40 ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.489 -12.230 30.281 1.00 18.61 ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.666 -12.802 33.411 1.00 19.28 ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.492 -14.173 32.811 1.00 19.51 ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.406 -15.191 33.079 1.00 21.21 ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.385 -14.458 32.012 1.00 21.07 ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -30.236 -16.473 32.531 1.00 23.79 ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -28.207 -15.736 31.464 1.00 20.18 ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -29.129 -16.741 31.731 1.00 21.36 ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -29.355 -10.489 31.168 1.00 17.97 ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.816 -10.071 29.880 1.00 16.99 ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.749 -11.045 29.399 1.00 15.78 ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -27.126 -11.753 30.194 1.00 15.86 ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -28.243 -8.648  29.937 1.00 16.99 ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.999 -8.493  30.783 1.00 16.25 ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -27.101 -8.226  32.143 1.00 17.48 ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.722 -8.594  30.225 1.00 17.00 ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.976 -8.072  32.934 1.00 16.59 ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.576 -8.446  31.021 1.00 16.88 ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.726 -8.187  32.378 1.00 17.62 ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.636 -8.019  33.197 1.00 17.91 ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -27.551 -11.072 28.090 1.00 14.95 ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -26.450 -11.811 27.499 1.00 15.93 ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -25.418 -10.815 26.988 1.00 15.68 ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -24.241 -10.895 27.335 1.00 15.76 ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.957 -12.701 26.361 1.00 14.56 ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.920 -13.813 26.794 1.00 15.53 ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -28.662 -14.393 25.596 1.00 15.32 ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -27.161 -14.916 27.533 1.00 15.76 ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.881 -9.880  26.166 1.00 16.71 ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -25.047 -8.806  25.626 1.00 15.56 ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -25.846 -7.515  25.586 1.00 16.96 ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -27.088 -7.524  25.538 1.00 17.87 ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -24.557 -9.087  24.168 1.00 16.88 ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -25.679 -9.132  23.278 1.00 18.64 ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -23.759 -10.393 24.069 1.00 17.00 ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -25.134 -6.398  25.587 1.00 17.05 ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -25.775 -5.100  25.431 1.00 18.82 ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -24.868 -4.213  24.581 1.00 18.25 ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -23.637 -4.288  24.685 1.00 17.96 ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -26.112 -4.455  26.814 1.00 20.31 ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -24.847 -4.081  27.597 1.00 20.14 ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -27.019 -3.256  26.654 1.00 23.30 ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -25.481 -3.409  23.718 1.00 18.59 ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -24.746 -2.460  22.886 1.00 19.75 ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -25.539 -1.171  22.756 1.00 21.13 ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -26.775 -1.184  22.806 1.00 22.39 ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -24.482 -3.033  21.480 1.00 19.87 ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -23.736 -4.369  21.431 1.00 20.41 ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -22.241 -4.277  21.755 1.00 20.68 ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -21.725 -3.166  22.008 1.00 20.68 ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -21.576 -5.340  21.747 1.00 18.92 ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -24.824 -0.061  22.606 1.00 21.73 ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -25.427 1.179   22.131 1.00 22.69 ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -25.130 1.329   20.641 1.00 25.22 ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -23.963 1.279   20.223 1.00 26.11 ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -24.890 2.393   22.896 1.00 21.73 ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -25.507 3.724   22.424 1.00 23.64 ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -24.880 4.961   23.051 1.00 23.76 ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -24.204 4.888   24.080 1.00 25.61 ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -25.113 6.116   22.427 1.00 26.70 ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -26.187 1.484   19.847 1.00 24.76 ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -26.063 1.776   18.419 1.00 28.13 ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -26.944 2.983   18.112 1.00 28.11 ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -28.169 2.868   18.038 1.00 29.42 ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -26.452 0.561   17.527 1.00 27.15 ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -25.563 -0.654  17.842 1.00 29.10 ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -26.382 0.939   16.034 1.00 32.21 ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -26.010 -1.956  17.191 1.00 29.85 ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -26.313 4.142   17.952 1.00 29.83 ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -27.047 5.397   17.808 1.00 31.32 ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -27.883 5.664   19.044 1.00 29.83 ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -27.368 5.629   20.165 1.00 30.63 ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -29.179 5.893   18.850 1.00 28.55 ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -30.066 6.199   19.979 1.00 27.65 ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -30.800 4.974   20.513 1.00 25.51 ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -31.782 5.094   21.245 1.00 25.30 ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -31.046 7.311   19.605 1.00 28.41 ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -30.358 8.649   19.427 1.00 31.53 ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -30.750 9.399   18.507 1.00 32.82 ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -29.422 8.948   20.204 1.00 28.66 ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -30.301 3.796   20.152 1.00 25.98 ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -30.896 2.539   20.573 1.00 24.21 ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -29.930 1.715   21.413 1.00 22.07 ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -28.729 1.673   21.147 1.00 21.15 ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -31.331 1.712   19.358 1.00 27.65 ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -32.457 2.281   18.709 1.00 28.54 ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -30.478 1.075   22.437 1.00 20.73 ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -29.798 -0.019  23.110 1.00 19.14 ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -30.257 -1.302  22.415 1.00 20.59 ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -31.460 -1.538  22.267 1.00 20.35 ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -30.136 -0.065  24.626 1.00 18.39 ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -29.530 1.143   25.377 1.00 17.71 ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -29.688 -1.396  25.258 1.00 18.89 ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -27.996 1.203   25.424 1.00 18.13 ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -29.297 -2.107  21.964 1.00 20.89 ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -29.582 -3.444  21.468 1.00 20.51 ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -29.178 -4.458  22.525 1.00 19.21 ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -28.016 -4.512  22.948 1.00 18.65 ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -28.857 -3.718  20.146 1.00 22.28 ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -29.496 -3.056  18.956 1.00 25.56 ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -30.403 -3.751  18.164 1.00 28.92 ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -29.193 -1.740  18.630 1.00 26.54 ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -30.998 -3.145  17.055 1.00 32.43 ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -29.780 -1.127  17.523 1.00 31.41 ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -30.681 -1.831  16.735 1.00 30.71 ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -30.147 -5.246  22.968 1.00 18.34 ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -29.903 -6.204  24.033 1.00 18.66 ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -30.289 -7.613  23.619 1.00 19.82 ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -31.383 -7.840  23.100 1.00 22.75 ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -30.666 -5.808  25.303 1.00 18.38 ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -30.220 -6.602  26.527 1.00 20.09 ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -31.226 -6.639  27.662 1.00 21.73 ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.915 -7.313  28.660 1.00 22.84 ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -32.316 -6.023  27.573 1.00 23.53 ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -29.376 -8.552  23.841 1.00 18.30 ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -29.723 -9.964  23.791 1.00 18.34 ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -29.850 -10.409 25.231 1.00 16.32 ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -29.032 -10.033 26.065 1.00 17.14 ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -28.638 -10.771 23.080 1.00 17.12 ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -28.420 -10.339 21.637 1.00 17.62 ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -27.189 -11.008 21.049 1.00 19.58 ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -27.354 -12.449 20.890 1.00 16.63 ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -26.351 -13.298 20.672 1.00 16.18 ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -25.098 -12.855 20.587 1.00 17.32 ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -26.602 -14.590 20.539 1.00 18.68 ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.871 -11.205 25.526 1.00 17.27 ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -31.119 -11.620 26.904 1.00 17.73 ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.861 -12.944 26.964 1.00 17.94 ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -32.391 -13.419 25.964 1.00 18.92 ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.908 -10.538 27.663 1.00 16.85 ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -33.335 -10.352 27.178 1.00 19.55 ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -33.608 -9.676  25.988 1.00 20.58 ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -34.412 -10.847 27.917 1.00 19.52 ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.921 -9.495  25.547 1.00 21.74 ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.726 -10.672 27.486 1.00 21.98 ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.971 -9.996  26.301 1.00 21.73 ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -37.264 -9.825  25.867 1.00 22.25 ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.863 -13.540 28.149 1.00 18.96 ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -32.668 -14.719 28.420 1.00 19.79 ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.916 -14.243 29.149 1.00 20.54 ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.820 -13.602 30.197 1.00 20.11 ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.893 -15.766 29.271 1.00 20.97 ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -30.638 -16.260 28.530 1.00 20.60 ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.799 -16.931 29.669 1.00 21.76 ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.909 -17.044 27.230 1.00 20.82 ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -35.084 -14.549 28.585 1.00 20.93 ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -36.346 -14.101 29.172 1.00 22.62 ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.785 -14.988 30.344 1.00 23.48 ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -36.081 -15.934 30.712 1.00 23.25 ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -37.439 -13.938 28.101 1.00 23.08 ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.947 -15.263 27.538 1.00 24.40 ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.685 -16.338 28.120 1.00 23.69 ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -38.643 -15.214 26.497 1.00 25.40 ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.943 -14.675 30.926 1.00 25.80 ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.430 -15.361 32.127 1.00 28.72 ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.769 -16.833 31.900 1.00 31.25 ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.935 -17.593 32.856 1.00 31.08 ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.640 -14.624 32.714 1.00 31.13 ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.654 -14.454 31.739 1.00 32.77 ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.860 -17.229 30.634 1.00 29.97 ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -39.134 -18.617 30.273 1.00 31.75 ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.882 -19.378 29.848 1.00 30.71 ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.952 -20.540 29.430 1.00 32.49 ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -40.210 -18.668 29.191 1.00 32.37 ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -41.560 -18.238 29.712 1.00 35.60 ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.984 -18.670 30.787 1.00 37.12 ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -42.239 -17.373 28.969 1.00 34.69 ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.736 -18.716 29.964 1.00 29.25 ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -35.457 -19.327 29.624 1.00 26.50 ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -35.135 -19.313 28.142 1.00 25.96 ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -34.270 -20.059 27.693 1.00 26.58 ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -35.824 -18.464 27.384 1.00 23.74 ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -35.587 -18.343 25.946 1.00 24.29 ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -34.653 -17.182 25.629 1.00 22.63 ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -34.697 -16.145 26.296 1.00 21.57 ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -36.899 -18.113 25.200 1.00 24.80 ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -37.642 -19.371 24.820 1.00 27.85 ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -38.777 -19.679 25.767 1.00 29.97 ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -39.632 -20.721 25.202 1.00 28.66 ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -40.872 -20.536 24.759 1.00 25.67 ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -41.448 -19.340 24.826 1.00 25.38 ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -41.542 -21.562 24.249 1.00 26.44 ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -33.822 -17.354 24.602 1.00 20.75 ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -32.997 -16.251 24.125 1.00 19.36 ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -33.827 -15.312 23.256 1.00 21.25 ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -34.523 -15.752 22.332 1.00 21.04 ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -31.765 -16.738 23.351 1.00 19.34 ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -30.925 -15.567 22.831 1.00 20.45 ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -29.634 -15.976 22.151 1.00 23.77 ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -29.058 -17.026 22.515 1.00 21.45 ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -29.188 -15.220 21.258 1.00 25.78 ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -33.745 -14.021 23.567 1.00 20.58 ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -34.475 -12.980 22.853 1.00 22.47 ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -33.541 -11.823 22.489 1.00 21.92 ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -32.452 -11.690 23.045 1.00 20.99 ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -35.627 -12.442 23.714 1.00 24.34 ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -36.570 -13.495 24.298 1.00 30.84 ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -37.601 -13.978 23.289 1.00 37.05 ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -38.568 -12.942 22.925 1.00 42.73 ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -39.657 -12.629 23.628 1.00 46.54 ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -39.941 -13.256 24.767 1.00 47.03 ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -40.467 -11.673 23.193 1.00 45.76 ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -33.976 -10.997 21.546 1.00 22.54 ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -33.278 -9.763  21.225 1.00 23.44 ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -34.293 -8.638  21.182 1.00 24.67 ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -35.427 -8.825  20.728 1.00 24.71 ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -32.514 -9.853  19.885 1.00 26.39 ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -31.697 -11.030 19.878 1.00 30.46 ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -31.618 -8.634  19.683 1.00 24.92 ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -33.892 -7.474  21.681 1.00 24.51 ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -34.753 -6.303  21.638 1.00 25.73 ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -33.963 -5.029  21.381 1.00 26.36 ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -32.778 -4.933  21.720 1.00 25.01 ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -35.589 -6.181  22.922 1.00 25.67 ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -34.792 -5.986  24.198 1.00 25.70 ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -35.719 -5.894  25.394 1.00 27.29 ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -35.009 -6.158  26.642 1.00 26.54 ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -35.578 -6.632  27.746 1.00 25.80 ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.877 -6.913  27.772 1.00 24.49 ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.841 -6.842  28.825 1.00 25.95 ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -34.637 -4.061  20.770 1.00 26.93 ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -34.091 -2.731  20.555 1.00 26.47 ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -34.912 -1.758  21.387 1.00 27.21 ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -36.127 -1.656  21.206 1.00 26.73 ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -34.164 -2.358  19.072 1.00 27.95 ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -33.521 -1.013  18.741 1.00 29.98 ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -33.747 -0.560  17.305 1.00 31.45 ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -34.166 -1.383  16.466 1.00 31.45 ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -33.488 0.629   17.014 1.00 32.73 ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -34.248 -1.056  22.302 1.00 26.64 ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -34.928 -0.156  23.227 1.00 25.10 ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -34.448 1.275   23.012 1.00 25.28 ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -33.246 1.531   22.976 1.00 23.11 ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -34.699 -0.573  24.705 1.00 25.58 ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -35.514 0.307   25.654 1.00 25.88 ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -35.061 -2.044  24.914 1.00 28.53 ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -35.397 2.197   22.857 1.00 25.64 ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -35.083 3.615   22.688 1.00 26.47 ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -34.873 4.240   24.063 1.00 25.14 ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -35.688 5.033   24.545 1.00 25.27 ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -36.186 4.330   21.910 1.00 28.81 ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -36.429 3.761   20.521 1.00 32.30 ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -37.496 4.530   19.760 1.00 38.59 ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -37.237 5.691   19.378 1.00 40.37 ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -38.590 3.970   19.541 1.00 41.55 ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -33.767 3.846   24.686 1.00 23.82 ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -33.452 4.190   26.065 1.00 23.39 ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -33.175 5.677   26.228 1.00 24.12 ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -32.330 6.246   25.533 1.00 24.55 ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -32.241 3.381   26.531 1.00 22.65 ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -31.810 3.628   27.962 1.00 22.13 ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -32.634 3.279   29.031 1.00 22.11 ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -30.563 4.189   28.246 1.00 21.23 ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -32.233 3.489   30.349 1.00 19.69 ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -30.157 4.410   29.561 1.00 18.81 ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.994 4.050   30.604 1.00 20.14 ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.599 4.256   31.900 1.00 18.22 ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.901 6.294   27.151 1.00 24.76 ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.710 7.699   27.463 1.00 23.64 ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.854 7.789   28.718 1.00 20.75 ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.312 7.442   29.811 1.00 21.89 ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -35.057 8.400   27.650 1.00 24.86 ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -36.021 8.187   26.483 1.00 28.98 ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.743 9.455   26.058 1.00 37.52 ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.832 9.861   27.025 1.00 41.14 ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.951 10.575  26.335 1.00 43.89 ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.589 8.224   28.565 1.00 21.55 ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.700 8.265   29.719 1.00 20.35 ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.960 9.492   30.586 1.00 20.11 ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.522 10.487  30.107 1.00 19.35 ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.312 8.351   29.084 1.00 21.51 ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.533 9.057   27.788 1.00 22.10 ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.944 8.746   27.344 1.00 21.94 ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.558 9.408   31.850 1.00 17.85 ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.543 10.570  32.731 1.00 19.17 ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -29.127 10.913  33.135 1.00 18.59 ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.288 10.032  33.332 1.00 18.43 ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.386 10.341  33.986 1.00 19.57 ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.765 10.248  33.672 1.00 21.30 ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.866 12.211  33.235 1.00 18.61 ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.635 12.705  33.830 1.00 17.07 ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -28.023 13.784  34.831 1.00 16.56 ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.213 14.048  35.031 1.00 21.17 ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.663 13.212  32.764 1.00 17.03 ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -26.134 12.157  31.779 1.00 15.33 ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.475 12.834  30.593 1.00 20.75 ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.178 11.150  32.438 1.00 18.69 ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -27.036 14.387  35.478 1.00 16.49 ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.310 15.225  36.636 1.00 18.13 ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.467 16.485  36.632 1.00 19.44 ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.342 16.483  36.139 1.00 18.27 ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.061 14.436  37.927 1.00 17.77 ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -27.938 13.220  38.070 1.00 18.89 ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -27.615 12.027  37.421 1.00 19.39 ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -29.100 13.274  38.833 1.00 18.97 ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.436 10.911  37.533 1.00 21.12 ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -29.924 12.151  38.962 1.00 21.71 ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -29.594 10.971  38.308 1.00 20.54 ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -27.036 17.558  37.176 1.00 19.61 ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.287 18.778  37.445 1.00 20.33 ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -26.527 19.185  38.892 1.00 22.06 ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -27.584 18.890  39.456 1.00 23.25 ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -26.728 19.889  36.504 1.00 20.59 ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -25.554 19.866  39.493 1.00 21.22 ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -25.763 20.436  40.820 1.00 22.58 ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -26.887 21.467  40.774 1.00 23.53 ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -27.074 22.152  39.769 1.00 23.82 ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -24.474 21.049  41.369 1.00 21.84 ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -23.456 20.031  41.782 1.00 22.23 ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -22.185 19.991  41.253 1.00 24.28 ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -23.529 19.006  42.664 1.00 22.81 ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -21.514 18.991  41.797 1.00 22.49 ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -22.308 18.373  42.651 1.00 22.73 ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -27.654 21.548  41.853 1.00 25.54 ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -28.781 22.468  41.910 1.00 28.37 ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -28.764 23.232  43.234 1.00 30.77 ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -28.013 22.865  44.138 1.00 30.01 ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -30.099 21.711  41.710 1.00 27.97 ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -30.513 20.530  43.021 1.00 30.52 ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -29.574 24.309  43.349 1.00 34.76 ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -29.610 25.075  44.601 1.00 37.74 ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -30.099 24.247  45.789 1.00 41.49 ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -30.913 23.331  45.617 1.00 40.27 ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -30.603 26.202  44.300 1.00 37.32 ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -30.608 26.328  42.821 1.00 38.03 ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -30.398 24.940  42.299 1.00 35.10 ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -29.597 24.577  46.979 1.00 46.31 ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -29.947 23.869  48.215 1.00 51.38 ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -31.428 24.035  48.561 1.00 53.66 ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -32.012 23.195  49.250 1.00 55.04 ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -29.071 24.358  49.376 1.00 53.35 ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -28.929 23.368  50.540 1.00 56.66 ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -27.945 22.236  50.255 1.00 59.49 ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -28.302 21.063  50.504 1.00 59.47 ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -26.817 22.515  49.787 1.00 60.89 ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -32.023 25.120  48.070 1.00 55.32 ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -33.438 25.417  48.287 1.00 57.04 ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -34.358 24.563  47.409 1.00 57.26 ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -35.571 24.525  47.628 1.00 58.55 ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -33.709 26.905  48.051 1.00 57.58 ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -33.373 27.284  46.725 1.00 58.51 ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -33.777 23.883  46.420 1.00 56.35 ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -34.537 23.032  45.507 1.00 55.48 ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -34.677 21.619  46.071 1.00 54.18 ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -33.678 20.951  46.354 1.00 53.26 ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -33.880 23.005  44.124 1.00 55.50 ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -34.678 22.272  43.055 1.00 57.58 ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -34.029 22.348  41.685 1.00 59.63 ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -33.689 23.431  41.201 1.00 60.37 ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -33.861 21.195  41.047 1.00 59.98 ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -35.926 21.182  46.230 1.00 53.16 ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -36.236 19.859  46.770 1.00 50.98 ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -35.886 18.757  45.773 1.00 48.56 ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -36.364 18.753  44.635 1.00 48.94 ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -37.708 19.775  47.171 1.00 52.66 ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -35.035 17.833  46.210 1.00 44.50 ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -34.615 16.709  45.381 1.00 40.51 ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -34.336 15.474  46.237 1.00 37.91 ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -34.120 15.580  47.448 1.00 36.90 ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -33.366 17.062  44.519 1.00 39.77 ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -33.044 15.965  43.651 1.00 37.77 ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -32.158 17.385  45.398 1.00 39.34 ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -34.357 14.305  45.605 1.00 33.77 ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -33.955 13.079  46.282 1.00 32.66 ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -32.567 12.610  45.827 1.00 29.60 ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -32.027 11.636  46.364 1.00 27.72 ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -35.008 11.976  46.108 1.00 33.92 ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -35.116 11.384  44.711 1.00 33.87 ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -36.174 10.287  44.675 1.00 36.68 ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.293 9.674   43.296 1.00 37.96 ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -37.435 8.723   43.212 1.00 38.60 ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -31.994 13.308  44.845 1.00 25.92 ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -30.668 12.953  44.325 1.00 24.78 ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -29.572 13.832  44.917 1.00 23.90 ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -29.670 15.059  44.919 1.00 24.10 ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -30.633 13.026  42.794 1.00 23.55 ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -31.756 12.276  42.107 1.00 22.39 ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -32.839 12.966  41.555 1.00 24.24 ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -31.737 10.884  42.004 1.00 22.64 ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -33.867 12.291  40.914 1.00 25.66 ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -32.773 10.194  41.365 1.00 24.93 ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -33.831 10.908  40.824 1.00 26.63 ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -34.862 10.248  40.192 1.00 32.84 ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -28.525 13.185  45.420 1.00 22.41 ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -27.383 13.887  45.998 1.00 23.04 ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -26.094 13.282  45.461 1.00 21.04 ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -26.030 12.072  45.218 1.00 22.02 ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -27.421 13.798  47.526 1.00 24.31 ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -28.623 14.468  48.143 1.00 27.31 ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -29.826 13.781  48.286 1.00 30.11 ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -28.552 15.789  48.573 1.00 28.41 ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -30.946 14.405  48.850 1.00 31.23 ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -29.661 16.421  49.141 1.00 30.71 ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -30.859 15.726  49.280 1.00 30.53 ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -25.077 14.116  45.260 1.00 20.75 ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -23.768 13.605  44.867 1.00 19.58 ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -23.105 12.932  46.074 1.00 20.59 ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -23.674 12.930  47.171 1.00 21.22 ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -22.897 14.683  44.176 1.00 20.80 ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -22.272 15.695  45.138 1.00 23.17 ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -22.343 15.553  46.378 1.00 22.28 ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -21.678 16.662  44.617 1.00 26.19 ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -21.925 12.350  45.882 1.00 19.40 ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -21.326 11.533  46.944 1.00 20.80 ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -20.899 12.356  48.159 1.00 22.16 ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -20.676 11.810  49.239 1.00 22.99 ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -20.158 10.647  46.428 1.00 20.54 ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -19.007 11.497  45.879 1.00 19.62 ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -20.673 9.672   45.359 1.00 20.35 ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -17.741 10.686  45.536 1.00 22.24 ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -20.807 13.670  47.968 1.00 21.87 ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -20.443 14.607  49.035 1.00 22.85 ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -21.664 15.219  49.722 1.00 25.01 ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -21.527 16.078  50.599 1.00 24.63 ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -19.550 15.710  48.468 1.00 24.92 ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -18.403 15.155  47.666 1.00 25.13 ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -18.415 15.197  46.270 1.00 25.21 ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -17.320 14.550  48.302 1.00 24.56 ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -17.362 14.670  45.529 1.00 26.19 ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -16.265 14.020  47.574 1.00 25.42 ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -16.293 14.083  46.189 1.00 24.88 ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -15.250 13.556  45.470 1.00 26.32 ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -22.850 14.769  49.324 1.00 24.36 ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -24.100 15.240  49.916 1.00 24.25 ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -24.659 16.521  49.320 1.00 24.89 ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -25.591 17.105  49.876 1.00 25.99 ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -24.099 16.972  48.200 1.00 22.56 ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -24.617 18.171  47.531 1.00 24.04 ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -25.784 17.798  46.611 1.00 22.71 ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -25.705 16.798  45.888 1.00 21.99 ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -23.511 18.904  46.768 1.00 26.59 ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -22.223 19.086  47.583 1.00 32.43 ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -21.681 20.501  47.511 1.00 40.44 ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -22.251 21.367  48.628 1.00 43.68 ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -21.515 22.656  48.764 1.00 47.14 ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -26.879 18.587  46.648 1.00 22.38 ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -28.086 18.216  45.904 1.00 22.15 ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -27.913 18.332  44.393 1.00 22.06 ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -27.158 19.185  43.916 1.00 21.19 ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -29.138 19.210  46.408 1.00 22.81 ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -28.369 20.377  46.880 1.00 23.57 ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -27.054 19.851  47.388 1.00 23.66 ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -28.608 17.465  43.664 1.00 21.22 ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -28.520 17.420  42.213 1.00 22.39 ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -29.898 17.371  41.586 1.00 22.95 ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -30.826 16.798  42.153 1.00 23.90 ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -27.750 16.183  41.750 1.00 23.79 ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -25.986 16.204  42.077 1.00 26.03 ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -30.021 17.954  40.398 1.00 21.30 ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -31.241 17.809  39.623 1.00 23.30 ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -31.031 16.777  38.518 1.00 22.33 ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -29.969 16.734  37.891 1.00 20.32 ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -31.745 19.162  39.055 1.00 26.39 ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -32.956 18.945  38.320 1.00 31.85 ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -30.711 19.812  38.149 1.00 27.59 ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -32.033 15.928  38.306 1.00 21.07 ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -31.956 14.916  37.252 1.00 21.89 ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.421 15.504  35.933 1.00 23.18 ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.463 16.168  35.871 1.00 23.96 ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -32.787 13.677  37.608 1.00 22.34 ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -32.647 12.528  36.594 1.00 22.74 ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -33.140 11.198  37.152 1.00 23.95 ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -34.582 11.201  37.398 1.00 25.37 ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.509 10.863  36.504 1.00 26.29 ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -35.165 10.482  35.283 1.00 22.82 ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -36.790 10.904  36.842 1.00 28.67 ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -31.643 15.259  34.883 1.00 23.07 ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -31.993 15.698  33.541 1.00 26.58 ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.271 14.491  32.668 1.00 27.00 ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.395 13.650  32.461 1.00 24.44 ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -30.875 16.550  32.946 1.00 27.35 ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.690 17.875  33.676 1.00 33.90 ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -29.777 18.813  32.918 1.00 38.91 ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -29.497 20.067  33.731 1.00 43.76 ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -30.675 20.988  33.808 1.00 46.13 ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.502 14.406  32.170 1.00 28.20 ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -33.912 13.287  31.326 1.00 30.60 ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.847 13.720  29.869 1.00 29.47 ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.430 14.732  29.490 1.00 30.83 ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.321 12.808  31.711 1.00 32.39 ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -35.920 11.487  31.191 1.00 36.72 ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -36.808 11.706  29.970 1.00 40.42 ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -34.876 10.384  30.937 1.00 34.17 ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -33.124 12.955  29.059 1.00 27.14 ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.905 13.321  27.666 1.00 27.00 ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.808 12.551  26.718 1.00 27.50 ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -34.180 11.415  26.997 1.00 28.22 ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.433 13.139  27.309 1.00 25.58 ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.525 14.025  28.102 1.00 24.22 ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -29.967 13.579  29.295 1.00 22.81 ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -30.256 15.323  27.679 1.00 24.73 ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -29.136 14.401  30.043 1.00 23.16 ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.422 16.156  28.430 1.00 23.44 ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -28.870 15.691  29.615 1.00 23.05 ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -34.159 13.182  25.601 1.00 27.38 ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -35.007 12.555  24.588 1.00 27.86 ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -34.334 11.326  23.984 1.00 27.76 ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -35.010 10.413  23.511 1.00 28.10 ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -35.360 13.557  23.496 1.00 28.18 ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -33.003 11.318  24.007 1.00 26.76 ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -32.200 10.237  23.440 1.00 25.94 ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -30.743 10.319  23.892 1.00 25.27 ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -30.322 11.313  24.502 1.00 25.66 ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -32.295 10.235  21.906 1.00 26.83 ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -31.978 11.591  21.300 1.00 27.87 ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -30.850 12.079  21.392 1.00 26.52 ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -32.974 12.203  20.671 1.00 30.87 ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.978 9.279   23.581 1.00 23.48 ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -28.602 9.166   24.054 1.00 23.95 ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -27.658 10.178  23.416 1.00 24.48 ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -26.729 10.664  24.072 1.00 26.24 ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -28.092 7.736   23.892 1.00 24.14 ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -28.724 6.781   24.902 1.00 22.62 ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -28.107 5.098   24.825 1.00 23.70 ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -29.003 4.486   23.397 1.00 23.88 ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -27.909 10.518  22.155 1.00 26.47 ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -27.106 11.541  21.487 1.00 28.96 ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -27.270 12.908  22.153 1.00 26.86 ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -26.285 13.612  22.354 1.00 24.73 ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -27.400 11.599  19.987 1.00 32.19 ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -26.651 10.525  19.198 1.00 39.75 ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -27.347 10.210  17.882 1.00 46.67 ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -26.647 9.177   17.119 1.00 50.72 ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -27.134 8.583   16.032 1.00 52.47 ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -28.337 8.906   15.570 1.00 53.85 ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -26.418 7.659   15.406 1.00 53.86 ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -28.503 13.253  22.527 1.00 26.84 ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.776 14.496  23.259 1.00 26.74 ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.994 14.556  24.569 1.00 25.32 ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.414 15.591  24.896 1.00 23.24 ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -30.272 14.656  23.545 1.00 28.04 ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -31.049 15.191  22.356 1.00 32.81 ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -30.460 15.403  21.276 1.00 33.60 ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -32.268 15.406  22.510 1.00 33.57 ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.978 13.444  25.308 1.00 23.17 ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -27.240 13.359  26.568 1.00 22.74 ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.742 13.555  26.346 1.00 21.93 ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -25.093 14.298  27.087 1.00 19.28 ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.506 12.030  27.267 1.00 22.07 ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -25.207 12.893  25.320 1.00 24.23 ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.802 13.042  24.950 1.00 25.53 ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -23.452 14.482  24.565 1.00 26.24 ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -22.396 14.988  24.969 1.00 26.91 ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -23.428 12.063  23.830 1.00 26.93 ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -23.273 10.761  24.371 1.00 31.21 ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -24.346 15.134  23.816 1.00 26.60 ? 70   GLN A N     1 
ATOM   576  C  CA    A GLN A 1 70  ? -24.189 16.536  23.406 0.50 27.18 ? 70   GLN A CA    1 
ATOM   577  C  CA    B GLN A 1 70  ? -24.126 16.521  23.418 0.50 26.97 ? 70   GLN A CA    1 
ATOM   578  C  C     . GLN A 1 70  ? -24.190 17.467  24.614 1.00 26.27 ? 70   GLN A C     1 
ATOM   579  O  O     . GLN A 1 70  ? -23.467 18.461  24.650 1.00 25.64 ? 70   GLN A O     1 
ATOM   580  C  CB    A GLN A 1 70  ? -25.316 16.962  22.453 0.50 28.33 ? 70   GLN A CB    1 
ATOM   581  C  CB    B GLN A 1 70  ? -25.099 16.953  22.316 0.50 27.82 ? 70   GLN A CB    1 
ATOM   582  C  CG    A GLN A 1 70  ? -25.282 16.340  21.061 0.50 32.18 ? 70   GLN A CG    1 
ATOM   583  C  CG    B GLN A 1 70  ? -24.828 16.295  20.967 0.50 30.78 ? 70   GLN A CG    1 
ATOM   584  C  CD    A GLN A 1 70  ? -26.524 16.673  20.247 0.50 34.65 ? 70   GLN A CD    1 
ATOM   585  C  CD    B GLN A 1 70  ? -23.393 16.482  20.498 0.50 31.55 ? 70   GLN A CD    1 
ATOM   586  O  OE1   A GLN A 1 70  ? -26.862 15.975  19.290 0.50 38.84 ? 70   GLN A OE1   1 
ATOM   587  O  OE1   B GLN A 1 70  ? -22.873 17.598  20.472 0.50 32.76 ? 70   GLN A OE1   1 
ATOM   588  N  NE2   A GLN A 1 70  ? -27.213 17.742  20.629 0.50 36.04 ? 70   GLN A NE2   1 
ATOM   589  N  NE2   B GLN A 1 70  ? -22.749 15.386  20.118 0.50 31.74 ? 70   GLN A NE2   1 
ATOM   590  N  N     . TRP A 1 71  ? -25.032 17.144  25.595 1.00 25.02 ? 71   TRP A N     1 
ATOM   591  C  CA    . TRP A 1 71  ? -25.156 17.962  26.803 1.00 23.74 ? 71   TRP A CA    1 
ATOM   592  C  C     . TRP A 1 71  ? -23.866 17.928  27.621 1.00 23.28 ? 71   TRP A C     1 
ATOM   593  O  O     . TRP A 1 71  ? -23.426 18.959  28.128 1.00 22.58 ? 71   TRP A O     1 
ATOM   594  C  CB    . TRP A 1 71  ? -26.349 17.513  27.649 1.00 24.35 ? 71   TRP A CB    1 
ATOM   595  C  CG    . TRP A 1 71  ? -26.511 18.291  28.928 1.00 21.36 ? 71   TRP A CG    1 
ATOM   596  C  CD1   . TRP A 1 71  ? -27.037 19.544  29.065 1.00 23.63 ? 71   TRP A CD1   1 
ATOM   597  C  CD2   . TRP A 1 71  ? -26.144 17.864  30.247 1.00 21.99 ? 71   TRP A CD2   1 
ATOM   598  N  NE1   . TRP A 1 71  ? -27.022 19.924  30.389 1.00 23.93 ? 71   TRP A NE1   1 
ATOM   599  C  CE2   . TRP A 1 71  ? -26.478 18.911  31.134 1.00 22.26 ? 71   TRP A CE2   1 
ATOM   600  C  CE3   . TRP A 1 71  ? -25.567 16.696  30.765 1.00 22.07 ? 71   TRP A CE3   1 
ATOM   601  C  CZ2   . TRP A 1 71  ? -26.250 18.827  32.513 1.00 20.79 ? 71   TRP A CZ2   1 
ATOM   602  C  CZ3   . TRP A 1 71  ? -25.345 16.613  32.137 1.00 21.26 ? 71   TRP A CZ3   1 
ATOM   603  C  CH2   . TRP A 1 71  ? -25.686 17.673  32.993 1.00 21.54 ? 71   TRP A CH2   1 
ATOM   604  N  N     . ILE A 1 72  ? -23.266 16.743  27.730 1.00 21.81 ? 72   ILE A N     1 
ATOM   605  C  CA    . ILE A 1 72  ? -21.968 16.573  28.390 1.00 22.43 ? 72   ILE A CA    1 
ATOM   606  C  C     . ILE A 1 72  ? -20.926 17.507  27.768 1.00 22.85 ? 72   ILE A C     1 
ATOM   607  O  O     . ILE A 1 72  ? -20.232 18.224  28.490 1.00 23.38 ? 72   ILE A O     1 
ATOM   608  C  CB    . ILE A 1 72  ? -21.485 15.104  28.335 1.00 22.34 ? 72   ILE A CB    1 
ATOM   609  C  CG1   . ILE A 1 72  ? -22.350 14.226  29.248 1.00 20.82 ? 72   ILE A CG1   1 
ATOM   610  C  CG2   . ILE A 1 72  ? -20.009 14.988  28.732 1.00 25.13 ? 72   ILE A CG2   1 
ATOM   611  C  CD1   . ILE A 1 72  ? -22.073 12.727  29.113 1.00 24.45 ? 72   ILE A CD1   1 
ATOM   612  N  N     . LYS A 1 73  ? -20.840 17.501  26.437 1.00 25.70 ? 73   LYS A N     1 
ATOM   613  C  CA    . LYS A 1 73  ? -19.932 18.394  25.697 1.00 28.48 ? 73   LYS A CA    1 
ATOM   614  C  C     . LYS A 1 73  ? -20.159 19.874  26.016 1.00 27.29 ? 73   LYS A C     1 
ATOM   615  O  O     . LYS A 1 73  ? -19.204 20.606  26.301 1.00 28.54 ? 73   LYS A O     1 
ATOM   616  C  CB    . LYS A 1 73  ? -20.054 18.175  24.186 1.00 30.13 ? 73   LYS A CB    1 
ATOM   617  C  CG    . LYS A 1 73  ? -19.531 16.840  23.689 1.00 35.31 ? 73   LYS A CG    1 
ATOM   618  C  CD    . LYS A 1 73  ? -19.774 16.699  22.189 1.00 41.42 ? 73   LYS A CD    1 
ATOM   619  C  CE    . LYS A 1 73  ? -19.658 15.250  21.733 1.00 43.39 ? 73   LYS A CE    1 
ATOM   620  N  NZ    . LYS A 1 73  ? -18.256 14.751  21.786 1.00 46.66 ? 73   LYS A NZ    1 
ATOM   621  N  N     . ARG A 1 74  ? -21.416 20.313  25.961 1.00 26.79 ? 74   ARG A N     1 
ATOM   622  C  CA    . ARG A 1 74  ? -21.746 21.700  26.286 1.00 27.38 ? 74   ARG A CA    1 
ATOM   623  C  C     . ARG A 1 74  ? -21.408 22.045  27.734 1.00 25.35 ? 74   ARG A C     1 
ATOM   624  O  O     . ARG A 1 74  ? -20.930 23.140  28.017 1.00 24.79 ? 74   ARG A O     1 
ATOM   625  C  CB    . ARG A 1 74  ? -23.205 22.027  25.949 1.00 28.17 ? 74   ARG A CB    1 
ATOM   626  C  CG    . ARG A 1 74  ? -23.461 22.193  24.450 1.00 33.99 ? 74   ARG A CG    1 
ATOM   627  C  CD    . ARG A 1 74  ? -24.847 22.759  24.166 1.00 38.74 ? 74   ARG A CD    1 
ATOM   628  N  NE    . ARG A 1 74  ? -25.899 21.984  24.825 1.00 41.95 ? 74   ARG A NE    1 
ATOM   629  C  CZ    . ARG A 1 74  ? -26.584 20.992  24.259 1.00 42.78 ? 74   ARG A CZ    1 
ATOM   630  N  NH1   . ARG A 1 74  ? -26.356 20.638  22.999 1.00 43.22 ? 74   ARG A NH1   1 
ATOM   631  N  NH2   . ARG A 1 74  ? -27.512 20.356  24.964 1.00 41.33 ? 74   ARG A NH2   1 
ATOM   632  N  N     . MET A 1 75  ? -21.623 21.103  28.650 1.00 22.95 ? 75   MET A N     1 
ATOM   633  C  CA    . MET A 1 75  ? -21.239 21.323  30.045 1.00 23.27 ? 75   MET A CA    1 
ATOM   634  C  C     . MET A 1 75  ? -19.731 21.556  30.199 1.00 25.50 ? 75   MET A C     1 
ATOM   635  O  O     . MET A 1 75  ? -19.311 22.412  30.983 1.00 26.55 ? 75   MET A O     1 
ATOM   636  C  CB    . MET A 1 75  ? -21.729 20.182  30.936 1.00 22.01 ? 75   MET A CB    1 
ATOM   637  C  CG    . MET A 1 75  ? -23.249 20.179  31.103 1.00 20.57 ? 75   MET A CG    1 
ATOM   638  S  SD    . MET A 1 75  ? -23.870 21.590  32.044 1.00 24.77 ? 75   MET A SD    1 
ATOM   639  C  CE    . MET A 1 75  ? -23.543 21.051  33.720 1.00 25.93 ? 75   MET A CE    1 
ATOM   640  N  N     . GLU A 1 76  ? -18.929 20.812  29.437 1.00 28.18 ? 76   GLU A N     1 
ATOM   641  C  CA    . GLU A 1 76  ? -17.483 21.055  29.367 1.00 30.52 ? 76   GLU A CA    1 
ATOM   642  C  C     . GLU A 1 76  ? -17.185 22.449  28.799 1.00 30.60 ? 76   GLU A C     1 
ATOM   643  O  O     . GLU A 1 76  ? -16.351 23.182  29.347 1.00 31.43 ? 76   GLU A O     1 
ATOM   644  C  CB    . GLU A 1 76  ? -16.777 19.973  28.539 1.00 32.50 ? 76   GLU A CB    1 
ATOM   645  C  CG    . GLU A 1 76  ? -15.248 20.123  28.495 1.00 38.95 ? 76   GLU A CG    1 
ATOM   646  C  CD    . GLU A 1 76  ? -14.568 19.134  27.560 1.00 44.27 ? 76   GLU A CD    1 
ATOM   647  O  OE1   . GLU A 1 76  ? -13.566 19.517  26.917 1.00 46.94 ? 76   GLU A OE1   1 
ATOM   648  O  OE2   . GLU A 1 76  ? -15.026 17.975  27.466 1.00 46.90 ? 76   GLU A OE2   1 
ATOM   649  N  N     . ASP A 1 77  ? -17.872 22.805  27.711 1.00 29.53 ? 77   ASP A N     1 
ATOM   650  C  CA    . ASP A 1 77  ? -17.763 24.140  27.106 1.00 31.23 ? 77   ASP A CA    1 
ATOM   651  C  C     . ASP A 1 77  ? -18.048 25.251  28.125 1.00 30.81 ? 77   ASP A C     1 
ATOM   652  O  O     . ASP A 1 77  ? -17.362 26.272  28.141 1.00 31.78 ? 77   ASP A O     1 
ATOM   653  C  CB    . ASP A 1 77  ? -18.717 24.292  25.909 1.00 31.47 ? 77   ASP A CB    1 
ATOM   654  C  CG    . ASP A 1 77  ? -18.345 23.411  24.720 1.00 33.49 ? 77   ASP A CG    1 
ATOM   655  O  OD1   . ASP A 1 77  ? -17.226 22.857  24.683 1.00 33.48 ? 77   ASP A OD1   1 
ATOM   656  O  OD2   . ASP A 1 77  ? -19.189 23.281  23.803 1.00 35.04 ? 77   ASP A OD2   1 
ATOM   657  N  N     . ILE A 1 78  ? -19.061 25.043  28.967 1.00 26.55 ? 78   ILE A N     1 
ATOM   658  C  CA    . ILE A 1 78  ? -19.447 26.021  29.988 1.00 26.23 ? 78   ILE A CA    1 
ATOM   659  C  C     . ILE A 1 78  ? -18.475 26.003  31.176 1.00 26.73 ? 78   ILE A C     1 
ATOM   660  O  O     . ILE A 1 78  ? -18.162 27.052  31.752 1.00 28.11 ? 78   ILE A O     1 
ATOM   661  C  CB    . ILE A 1 78  ? -20.912 25.804  30.464 1.00 25.05 ? 78   ILE A CB    1 
ATOM   662  C  CG1   . ILE A 1 78  ? -21.889 26.020  29.299 1.00 27.76 ? 78   ILE A CG1   1 
ATOM   663  C  CG2   . ILE A 1 78  ? -21.262 26.753  31.618 1.00 23.81 ? 78   ILE A CG2   1 
ATOM   664  C  CD1   . ILE A 1 78  ? -23.287 25.449  29.510 1.00 27.48 ? 78   ILE A CD1   1 
ATOM   665  N  N     . GLY A 1 79  ? -17.996 24.814  31.528 1.00 26.04 ? 79   GLY A N     1 
ATOM   666  C  CA    . GLY A 1 79  ? -17.058 24.648  32.638 1.00 26.07 ? 79   GLY A CA    1 
ATOM   667  C  C     . GLY A 1 79  ? -17.740 24.130  33.887 1.00 26.29 ? 79   GLY A C     1 
ATOM   668  O  O     . GLY A 1 79  ? -17.352 24.471  35.005 1.00 25.16 ? 79   GLY A O     1 
ATOM   669  N  N     . LEU A 1 80  ? -18.761 23.302  33.688 1.00 23.86 ? 80   LEU A N     1 
ATOM   670  C  CA    . LEU A 1 80  ? -19.539 22.746  34.788 1.00 23.79 ? 80   LEU A CA    1 
ATOM   671  C  C     . LEU A 1 80  ? -19.537 21.228  34.753 1.00 23.20 ? 80   LEU A C     1 
ATOM   672  O  O     . LEU A 1 80  ? -19.534 20.626  33.675 1.00 24.46 ? 80   LEU A O     1 
ATOM   673  C  CB    . LEU A 1 80  ? -20.978 23.256  34.726 1.00 23.25 ? 80   LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 80  ? -21.210 24.744  35.007 1.00 24.16 ? 80   LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 80  ? -22.626 25.129  34.605 1.00 25.31 ? 80   LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 80  ? -20.962 25.051  36.475 1.00 23.24 ? 80   LEU A CD2   1 
ATOM   677  N  N     . GLU A 1 81  ? -19.554 20.622  35.938 1.00 23.41 ? 81   GLU A N     1 
ATOM   678  C  CA    . GLU A 1 81  ? -19.557 19.170  36.076 1.00 23.43 ? 81   GLU A CA    1 
ATOM   679  C  C     . GLU A 1 81  ? -20.861 18.589  35.543 1.00 23.33 ? 81   GLU A C     1 
ATOM   680  O  O     . GLU A 1 81  ? -21.951 19.049  35.909 1.00 24.46 ? 81   GLU A O     1 
ATOM   681  C  CB    . GLU A 1 81  ? -19.350 18.764  37.543 1.00 24.08 ? 81   GLU A CB    1 
ATOM   682  C  CG    . GLU A 1 81  ? -19.115 17.263  37.759 1.00 25.14 ? 81   GLU A CG    1 
ATOM   683  C  CD    . GLU A 1 81  ? -18.824 16.887  39.207 1.00 26.99 ? 81   GLU A CD    1 
ATOM   684  O  OE1   . GLU A 1 81  ? -18.835 17.778  40.088 1.00 28.32 ? 81   GLU A OE1   1 
ATOM   685  O  OE2   . GLU A 1 81  ? -18.587 15.688  39.465 1.00 23.27 ? 81   GLU A OE2   1 
ATOM   686  N  N     . ALA A 1 82  ? -20.730 17.601  34.658 1.00 21.50 ? 82   ALA A N     1 
ATOM   687  C  CA    . ALA A 1 82  ? -21.858 16.801  34.192 1.00 20.37 ? 82   ALA A CA    1 
ATOM   688  C  C     . ALA A 1 82  ? -21.796 15.455  34.908 1.00 19.68 ? 82   ALA A C     1 
ATOM   689  O  O     . ALA A 1 82  ? -20.973 14.600  34.569 1.00 21.05 ? 82   ALA A O     1 
ATOM   690  C  CB    . ALA A 1 82  ? -21.794 16.619  32.683 1.00 21.34 ? 82   ALA A CB    1 
ATOM   691  N  N     . LEU A 1 83  ? -22.656 15.279  35.908 1.00 18.33 ? 83   LEU A N     1 
ATOM   692  C  CA    . LEU A 1 83  ? -22.630 14.092  36.769 1.00 18.03 ? 83   LEU A CA    1 
ATOM   693  C  C     . LEU A 1 83  ? -23.466 12.935  36.224 1.00 18.16 ? 83   LEU A C     1 
ATOM   694  O  O     . LEU A 1 83  ? -24.361 13.136  35.400 1.00 18.53 ? 83   LEU A O     1 
ATOM   695  C  CB    . LEU A 1 83  ? -23.080 14.441  38.194 1.00 18.47 ? 83   LEU A CB    1 
ATOM   696  C  CG    . LEU A 1 83  ? -22.233 15.455  38.967 1.00 19.22 ? 83   LEU A CG    1 
ATOM   697  C  CD1   . LEU A 1 83  ? -22.757 16.863  38.740 1.00 21.53 ? 83   LEU A CD1   1 
ATOM   698  C  CD2   . LEU A 1 83  ? -22.239 15.112  40.454 1.00 17.45 ? 83   LEU A CD2   1 
ATOM   699  N  N     . GLY A 1 84  ? -23.162 11.724  36.691 1.00 18.15 ? 84   GLY A N     1 
ATOM   700  C  CA    . GLY A 1 84  ? -23.912 10.536  36.302 1.00 17.01 ? 84   GLY A CA    1 
ATOM   701  C  C     . GLY A 1 84  ? -23.145 9.589   35.402 1.00 17.68 ? 84   GLY A C     1 
ATOM   702  O  O     . GLY A 1 84  ? -22.030 9.893   34.947 1.00 19.02 ? 84   GLY A O     1 
ATOM   703  N  N     . MET A 1 85  ? -23.757 8.437   35.148 1.00 17.85 ? 85   MET A N     1 
ATOM   704  C  CA    . MET A 1 85  ? -23.148 7.375   34.353 1.00 17.45 ? 85   MET A CA    1 
ATOM   705  C  C     . MET A 1 85  ? -23.218 7.717   32.867 1.00 18.28 ? 85   MET A C     1 
ATOM   706  O  O     . MET A 1 85  ? -24.287 7.677   32.254 1.00 20.82 ? 85   MET A O     1 
ATOM   707  C  CB    . MET A 1 85  ? -23.811 6.023   34.656 1.00 17.43 ? 85   MET A CB    1 
ATOM   708  C  CG    . MET A 1 85  ? -23.303 4.846   33.799 1.00 16.92 ? 85   MET A CG    1 
ATOM   709  S  SD    . MET A 1 85  ? -21.499 4.692   33.698 1.00 19.77 ? 85   MET A SD    1 
ATOM   710  C  CE    . MET A 1 85  ? -21.097 4.107   35.349 1.00 19.77 ? 85   MET A CE    1 
ATOM   711  N  N     . ASP A 1 86  ? -22.059 8.059   32.309 1.00 18.70 ? 86   ASP A N     1 
ATOM   712  C  CA    . ASP A 1 86  ? -21.946 8.510   30.926 1.00 21.22 ? 86   ASP A CA    1 
ATOM   713  C  C     . ASP A 1 86  ? -21.870 7.349   29.936 1.00 20.73 ? 86   ASP A C     1 
ATOM   714  O  O     . ASP A 1 86  ? -22.066 7.540   28.740 1.00 22.07 ? 86   ASP A O     1 
ATOM   715  C  CB    . ASP A 1 86  ? -20.743 9.454   30.761 1.00 22.22 ? 86   ASP A CB    1 
ATOM   716  C  CG    . ASP A 1 86  ? -19.434 8.858   31.284 1.00 26.96 ? 86   ASP A CG    1 
ATOM   717  O  OD1   . ASP A 1 86  ? -18.390 9.115   30.657 1.00 33.48 ? 86   ASP A OD1   1 
ATOM   718  O  OD2   . ASP A 1 86  ? -19.434 8.152   32.319 1.00 25.89 ? 86   ASP A OD2   1 
ATOM   719  N  N     . ASP A 1 87  ? -21.569 6.155   30.441 1.00 20.04 ? 87   ASP A N     1 
ATOM   720  C  CA    . ASP A 1 87  ? -21.673 4.934   29.646 1.00 20.27 ? 87   ASP A CA    1 
ATOM   721  C  C     . ASP A 1 87  ? -23.107 4.431   29.746 1.00 19.30 ? 87   ASP A C     1 
ATOM   722  O  O     . ASP A 1 87  ? -23.462 3.711   30.680 1.00 19.28 ? 87   ASP A O     1 
ATOM   723  C  CB    . ASP A 1 87  ? -20.688 3.869   30.133 1.00 20.07 ? 87   ASP A CB    1 
ATOM   724  C  CG    . ASP A 1 87  ? -20.651 2.646   29.220 1.00 23.90 ? 87   ASP A CG    1 
ATOM   725  O  OD1   . ASP A 1 87  ? -21.527 2.527   28.336 1.00 24.17 ? 87   ASP A OD1   1 
ATOM   726  O  OD2   . ASP A 1 87  ? -19.747 1.804   29.384 1.00 23.43 ? 87   ASP A OD2   1 
ATOM   727  N  N     . PHE A 1 88  ? -23.931 4.820   28.779 1.00 18.10 ? 88   PHE A N     1 
ATOM   728  C  CA    . PHE A 1 88  ? -25.378 4.627   28.891 1.00 20.12 ? 88   PHE A CA    1 
ATOM   729  C  C     . PHE A 1 88  ? -25.820 3.173   28.946 1.00 20.76 ? 88   PHE A C     1 
ATOM   730  O  O     . PHE A 1 88  ? -26.850 2.864   29.540 1.00 21.05 ? 88   PHE A O     1 
ATOM   731  C  CB    . PHE A 1 88  ? -26.124 5.377   27.784 1.00 19.92 ? 88   PHE A CB    1 
ATOM   732  C  CG    . PHE A 1 88  ? -25.762 6.832   27.698 1.00 20.13 ? 88   PHE A CG    1 
ATOM   733  C  CD1   . PHE A 1 88  ? -25.870 7.658   28.820 1.00 20.86 ? 88   PHE A CD1   1 
ATOM   734  C  CD2   . PHE A 1 88  ? -25.311 7.377   26.500 1.00 22.90 ? 88   PHE A CD2   1 
ATOM   735  C  CE1   . PHE A 1 88  ? -25.525 9.008   28.745 1.00 20.34 ? 88   PHE A CE1   1 
ATOM   736  C  CE2   . PHE A 1 88  ? -24.968 8.725   26.415 1.00 22.91 ? 88   PHE A CE2   1 
ATOM   737  C  CZ    . PHE A 1 88  ? -25.075 9.539   27.539 1.00 22.26 ? 88   PHE A CZ    1 
ATOM   738  N  N     . LYS A 1 89  ? -25.053 2.273   28.343 1.00 21.42 ? 89   LYS A N     1 
ATOM   739  C  CA    . LYS A 1 89  ? -25.430 0.864   28.436 1.00 22.04 ? 89   LYS A CA    1 
ATOM   740  C  C     . LYS A 1 89  ? -25.280 0.306   29.853 1.00 19.68 ? 89   LYS A C     1 
ATOM   741  O  O     . LYS A 1 89  ? -26.061 -0.560  30.248 1.00 19.08 ? 89   LYS A O     1 
ATOM   742  C  CB    . LYS A 1 89  ? -24.751 -0.010  27.371 1.00 22.84 ? 89   LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 89  ? -23.257 -0.075  27.409 1.00 25.61 ? 89   LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 89  ? -22.753 -0.541  26.038 1.00 27.98 ? 89   LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 89  ? -21.245 -0.421  25.915 1.00 30.83 ? 89   LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 89  ? -20.780 0.985   26.033 1.00 29.32 ? 89   LYS A NZ    1 
ATOM   747  N  N     . LEU A 1 90  ? -24.320 0.825   30.627 1.00 18.00 ? 90   LEU A N     1 
ATOM   748  C  CA    . LEU A 1 90  ? -24.227 0.462   32.049 1.00 17.80 ? 90   LEU A CA    1 
ATOM   749  C  C     . LEU A 1 90  ? -25.433 0.980   32.832 1.00 17.71 ? 90   LEU A C     1 
ATOM   750  O  O     . LEU A 1 90  ? -25.919 0.307   33.746 1.00 16.68 ? 90   LEU A O     1 
ATOM   751  C  CB    . LEU A 1 90  ? -22.919 0.950   32.694 1.00 19.63 ? 90   LEU A CB    1 
ATOM   752  C  CG    . LEU A 1 90  ? -21.594 0.328   32.233 1.00 22.00 ? 90   LEU A CG    1 
ATOM   753  C  CD1   . LEU A 1 90  ? -20.431 0.909   33.033 1.00 22.55 ? 90   LEU A CD1   1 
ATOM   754  C  CD2   . LEU A 1 90  ? -21.617 -1.192  32.359 1.00 23.77 ? 90   LEU A CD2   1 
ATOM   755  N  N     . ALA A 1 91  ? -25.906 2.176   32.478 1.00 17.72 ? 91   ALA A N     1 
ATOM   756  C  CA    . ALA A 1 91  ? -27.114 2.733   33.096 1.00 18.57 ? 91   ALA A CA    1 
ATOM   757  C  C     . ALA A 1 91  ? -28.345 1.925   32.691 1.00 17.13 ? 91   ALA A C     1 
ATOM   758  O  O     . ALA A 1 91  ? -29.220 1.649   33.519 1.00 17.33 ? 91   ALA A O     1 
ATOM   759  C  CB    . ALA A 1 91  ? -27.282 4.206   32.731 1.00 19.06 ? 91   ALA A CB    1 
ATOM   760  N  N     . TYR A 1 92  ? -28.406 1.538   31.420 1.00 16.74 ? 92   TYR A N     1 
ATOM   761  C  CA    . TYR A 1 92  ? -29.488 0.673   30.944 1.00 17.56 ? 92   TYR A CA    1 
ATOM   762  C  C     . TYR A 1 92  ? -29.533 -0.644  31.727 1.00 17.25 ? 92   TYR A C     1 
ATOM   763  O  O     . TYR A 1 92  ? -30.598 -1.063  32.174 1.00 17.26 ? 92   TYR A O     1 
ATOM   764  C  CB    . TYR A 1 92  ? -29.364 0.395   29.446 1.00 17.48 ? 92   TYR A CB    1 
ATOM   765  C  CG    . TYR A 1 92  ? -30.332 -0.659  28.960 1.00 20.58 ? 92   TYR A CG    1 
ATOM   766  C  CD1   . TYR A 1 92  ? -29.952 -1.999  28.870 1.00 18.98 ? 92   TYR A CD1   1 
ATOM   767  C  CD2   . TYR A 1 92  ? -31.639 -0.317  28.609 1.00 20.72 ? 92   TYR A CD2   1 
ATOM   768  C  CE1   . TYR A 1 92  ? -30.853 -2.976  28.436 1.00 19.84 ? 92   TYR A CE1   1 
ATOM   769  C  CE2   . TYR A 1 92  ? -32.544 -1.281  28.173 1.00 22.89 ? 92   TYR A CE2   1 
ATOM   770  C  CZ    . TYR A 1 92  ? -32.142 -2.603  28.081 1.00 20.65 ? 92   TYR A CZ    1 
ATOM   771  O  OH    . TYR A 1 92  ? -33.045 -3.553  27.663 1.00 20.55 ? 92   TYR A OH    1 
ATOM   772  N  N     . LEU A 1 93  ? -28.384 -1.296  31.887 1.00 16.52 ? 93   LEU A N     1 
ATOM   773  C  CA    . LEU A 1 93  ? -28.332 -2.560  32.634 1.00 16.88 ? 93   LEU A CA    1 
ATOM   774  C  C     . LEU A 1 93  ? -28.762 -2.367  34.083 1.00 17.85 ? 93   LEU A C     1 
ATOM   775  O  O     . LEU A 1 93  ? -29.447 -3.220  34.654 1.00 18.10 ? 93   LEU A O     1 
ATOM   776  C  CB    . LEU A 1 93  ? -26.935 -3.185  32.580 1.00 16.33 ? 93   LEU A CB    1 
ATOM   777  C  CG    . LEU A 1 93  ? -26.481 -3.805  31.254 1.00 16.63 ? 93   LEU A CG    1 
ATOM   778  C  CD1   . LEU A 1 93  ? -25.098 -4.405  31.432 1.00 16.79 ? 93   LEU A CD1   1 
ATOM   779  C  CD2   . LEU A 1 93  ? -27.471 -4.865  30.752 1.00 16.80 ? 93   LEU A CD2   1 
ATOM   780  N  N     . SER A 1 94  ? -28.362 -1.240  34.669 1.00 16.37 ? 94   SER A N     1 
ATOM   781  C  CA    . SER A 1 94  ? -28.693 -0.945  36.054 1.00 19.86 ? 94   SER A CA    1 
ATOM   782  C  C     . SER A 1 94  ? -30.199 -0.764  36.258 1.00 18.98 ? 94   SER A C     1 
ATOM   783  O  O     . SER A 1 94  ? -30.745 -1.207  37.270 1.00 19.07 ? 94   SER A O     1 
ATOM   784  C  CB    . SER A 1 94  ? -27.938 0.297   36.531 1.00 20.27 ? 94   SER A CB    1 
ATOM   785  O  OG    . SER A 1 94  ? -28.126 0.470   37.923 1.00 24.12 ? 94   SER A OG    1 
ATOM   786  N  N     . ASP A 1 95  ? -30.852 -0.120  35.289 1.00 19.12 ? 95   ASP A N     1 
ATOM   787  C  CA    . ASP A 1 95  ? -32.304 0.080   35.295 1.00 20.71 ? 95   ASP A CA    1 
ATOM   788  C  C     . ASP A 1 95  ? -33.086 -1.198  35.006 1.00 21.66 ? 95   ASP A C     1 
ATOM   789  O  O     . ASP A 1 95  ? -34.152 -1.425  35.584 1.00 21.35 ? 95   ASP A O     1 
ATOM   790  C  CB    . ASP A 1 95  ? -32.697 1.120   34.243 1.00 21.34 ? 95   ASP A CB    1 
ATOM   791  C  CG    . ASP A 1 95  ? -32.404 2.545   34.676 1.00 22.43 ? 95   ASP A CG    1 
ATOM   792  O  OD1   . ASP A 1 95  ? -32.277 3.409   33.783 1.00 23.83 ? 95   ASP A OD1   1 
ATOM   793  O  OD2   . ASP A 1 95  ? -32.326 2.808   35.893 1.00 24.00 ? 95   ASP A OD2   1 
ATOM   794  N  N     . THR A 1 96  ? -32.564 -2.009  34.090 1.00 20.06 ? 96   THR A N     1 
ATOM   795  C  CA    . THR A 1 96  ? -33.281 -3.187  33.593 1.00 21.05 ? 96   THR A CA    1 
ATOM   796  C  C     . THR A 1 96  ? -33.108 -4.393  34.527 1.00 21.07 ? 96   THR A C     1 
ATOM   797  O  O     . THR A 1 96  ? -33.999 -5.243  34.633 1.00 22.09 ? 96   THR A O     1 
ATOM   798  C  CB    . THR A 1 96  ? -32.831 -3.520  32.143 1.00 20.44 ? 96   THR A CB    1 
ATOM   799  O  OG1   . THR A 1 96  ? -32.982 -2.351  31.323 1.00 22.17 ? 96   THR A OG1   1 
ATOM   800  C  CG2   . THR A 1 96  ? -33.659 -4.657  31.541 1.00 21.68 ? 96   THR A CG2   1 
ATOM   801  N  N     . TYR A 1 97  ? -31.961 -4.458  35.197 1.00 21.01 ? 97   TYR A N     1 
ATOM   802  C  CA    . TYR A 1 97  ? -31.642 -5.552  36.121 1.00 22.67 ? 97   TYR A CA    1 
ATOM   803  C  C     . TYR A 1 97  ? -31.331 -5.000  37.501 1.00 25.10 ? 97   TYR A C     1 
ATOM   804  O  O     . TYR A 1 97  ? -30.204 -5.092  37.985 1.00 26.50 ? 97   TYR A O     1 
ATOM   805  C  CB    . TYR A 1 97  ? -30.487 -6.407  35.573 1.00 21.24 ? 97   TYR A CB    1 
ATOM   806  C  CG    . TYR A 1 97  ? -30.844 -6.982  34.234 1.00 19.09 ? 97   TYR A CG    1 
ATOM   807  C  CD1   . TYR A 1 97  ? -30.475 -6.332  33.058 1.00 19.79 ? 97   TYR A CD1   1 
ATOM   808  C  CD2   . TYR A 1 97  ? -31.621 -8.137  34.139 1.00 20.22 ? 97   TYR A CD2   1 
ATOM   809  C  CE1   . TYR A 1 97  ? -30.845 -6.829  31.825 1.00 18.74 ? 97   TYR A CE1   1 
ATOM   810  C  CE2   . TYR A 1 97  ? -31.992 -8.647  32.906 1.00 20.42 ? 97   TYR A CE2   1 
ATOM   811  C  CZ    . TYR A 1 97  ? -31.604 -7.990  31.755 1.00 21.02 ? 97   TYR A CZ    1 
ATOM   812  O  OH    . TYR A 1 97  ? -31.973 -8.489  30.528 1.00 22.10 ? 97   TYR A OH    1 
ATOM   813  N  N     . ASN A 1 98  ? -32.351 -4.423  38.125 1.00 28.25 ? 98   ASN A N     1 
ATOM   814  C  CA    . ASN A 1 98  ? -32.206 -3.816  39.445 1.00 31.50 ? 98   ASN A CA    1 
ATOM   815  C  C     . ASN A 1 98  ? -32.357 -4.848  40.567 1.00 32.48 ? 98   ASN A C     1 
ATOM   816  O  O     . ASN A 1 98  ? -33.200 -4.717  41.460 1.00 33.54 ? 98   ASN A O     1 
ATOM   817  C  CB    . ASN A 1 98  ? -33.183 -2.645  39.612 1.00 32.06 ? 98   ASN A CB    1 
ATOM   818  C  CG    . ASN A 1 98  ? -32.826 -1.754  40.787 1.00 35.62 ? 98   ASN A CG    1 
ATOM   819  O  OD1   . ASN A 1 98  ? -31.673 -1.705  41.214 1.00 34.53 ? 98   ASN A OD1   1 
ATOM   820  N  ND2   . ASN A 1 98  ? -33.819 -1.046  41.320 1.00 36.81 ? 98   ASN A ND2   1 
ATOM   821  N  N     . TYR A 1 99  ? -31.525 -5.882  40.491 1.00 31.62 ? 99   TYR A N     1 
ATOM   822  C  CA    . TYR A 1 99  ? -31.461 -6.958  41.477 1.00 32.78 ? 99   TYR A CA    1 
ATOM   823  C  C     . TYR A 1 99  ? -30.146 -7.702  41.284 1.00 32.25 ? 99   TYR A C     1 
ATOM   824  O  O     . TYR A 1 99  ? -29.467 -7.513  40.270 1.00 31.07 ? 99   TYR A O     1 
ATOM   825  C  CB    . TYR A 1 99  ? -32.650 -7.927  41.341 1.00 34.66 ? 99   TYR A CB    1 
ATOM   826  C  CG    . TYR A 1 99  ? -32.939 -8.411  39.928 1.00 39.28 ? 99   TYR A CG    1 
ATOM   827  C  CD1   . TYR A 1 99  ? -33.804 -7.700  39.090 1.00 41.27 ? 99   TYR A CD1   1 
ATOM   828  C  CD2   . TYR A 1 99  ? -32.364 -9.587  39.435 1.00 40.65 ? 99   TYR A CD2   1 
ATOM   829  C  CE1   . TYR A 1 99  ? -34.078 -8.139  37.795 1.00 42.47 ? 99   TYR A CE1   1 
ATOM   830  C  CE2   . TYR A 1 99  ? -32.633 -10.037 38.137 1.00 40.27 ? 99   TYR A CE2   1 
ATOM   831  C  CZ    . TYR A 1 99  ? -33.490 -9.309  37.326 1.00 42.01 ? 99   TYR A CZ    1 
ATOM   832  O  OH    . TYR A 1 99  ? -33.769 -9.744  36.049 1.00 39.27 ? 99   TYR A OH    1 
ATOM   833  N  N     . GLU A 1 100 ? -29.781 -8.533  42.256 1.00 32.76 ? 100  GLU A N     1 
ATOM   834  C  CA    . GLU A 1 100 ? -28.619 -9.401  42.112 1.00 33.26 ? 100  GLU A CA    1 
ATOM   835  C  C     . GLU A 1 100 ? -28.911 -10.399 40.997 1.00 31.17 ? 100  GLU A C     1 
ATOM   836  O  O     . GLU A 1 100 ? -29.861 -11.184 41.087 1.00 32.46 ? 100  GLU A O     1 
ATOM   837  C  CB    . GLU A 1 100 ? -28.318 -10.127 43.426 1.00 35.97 ? 100  GLU A CB    1 
ATOM   838  C  CG    . GLU A 1 100 ? -27.092 -11.038 43.381 1.00 41.91 ? 100  GLU A CG    1 
ATOM   839  C  CD    . GLU A 1 100 ? -26.657 -11.516 44.760 1.00 49.07 ? 100  GLU A CD    1 
ATOM   840  O  OE1   . GLU A 1 100 ? -25.432 -11.569 45.006 1.00 52.03 ? 100  GLU A OE1   1 
ATOM   841  O  OE2   . GLU A 1 100 ? -27.532 -11.831 45.599 1.00 51.66 ? 100  GLU A OE2   1 
ATOM   842  N  N     . ILE A 1 101 ? -28.107 -10.356 39.942 1.00 28.39 ? 101  ILE A N     1 
ATOM   843  C  CA    . ILE A 1 101 ? -28.327 -11.246 38.805 1.00 27.04 ? 101  ILE A CA    1 
ATOM   844  C  C     . ILE A 1 101 ? -27.997 -12.691 39.166 1.00 28.11 ? 101  ILE A C     1 
ATOM   845  O  O     . ILE A 1 101 ? -26.916 -12.994 39.683 1.00 27.04 ? 101  ILE A O     1 
ATOM   846  C  CB    . ILE A 1 101 ? -27.553 -10.796 37.546 1.00 25.63 ? 101  ILE A CB    1 
ATOM   847  C  CG1   . ILE A 1 101 ? -28.175 -9.516  36.987 1.00 27.25 ? 101  ILE A CG1   1 
ATOM   848  C  CG2   . ILE A 1 101 ? -27.554 -11.901 36.471 1.00 26.63 ? 101  ILE A CG2   1 
ATOM   849  C  CD1   . ILE A 1 101 ? -27.285 -8.769  36.036 1.00 26.41 ? 101  ILE A CD1   1 
ATOM   850  N  N     . LYS A 1 102 ? -28.971 -13.559 38.924 1.00 27.50 ? 102  LYS A N     1 
ATOM   851  C  CA    . LYS A 1 102 ? -28.787 -14.994 38.969 1.00 30.87 ? 102  LYS A CA    1 
ATOM   852  C  C     . LYS A 1 102 ? -28.810 -15.457 37.514 1.00 29.91 ? 102  LYS A C     1 
ATOM   853  O  O     . LYS A 1 102 ? -29.824 -15.324 36.823 1.00 30.93 ? 102  LYS A O     1 
ATOM   854  C  CB    . LYS A 1 102 ? -29.906 -15.642 39.801 1.00 34.44 ? 102  LYS A CB    1 
ATOM   855  C  CG    . LYS A 1 102 ? -30.163 -17.130 39.555 1.00 40.59 ? 102  LYS A CG    1 
ATOM   856  C  CD    . LYS A 1 102 ? -29.104 -18.032 40.181 1.00 45.85 ? 102  LYS A CD    1 
ATOM   857  C  CE    . LYS A 1 102 ? -29.354 -19.491 39.810 1.00 48.64 ? 102  LYS A CE    1 
ATOM   858  N  NZ    . LYS A 1 102 ? -28.255 -20.385 40.268 1.00 51.17 ? 102  LYS A NZ    1 
ATOM   859  N  N     . TYR A 1 103 ? -27.674 -15.949 37.034 1.00 27.66 ? 103  TYR A N     1 
ATOM   860  C  CA    . TYR A 1 103 ? -27.598 -16.420 35.656 1.00 26.48 ? 103  TYR A CA    1 
ATOM   861  C  C     . TYR A 1 103 ? -27.546 -17.943 35.593 1.00 26.43 ? 103  TYR A C     1 
ATOM   862  O  O     . TYR A 1 103 ? -27.186 -18.606 36.567 1.00 25.71 ? 103  TYR A O     1 
ATOM   863  C  CB    . TYR A 1 103 ? -26.425 -15.772 34.913 1.00 25.83 ? 103  TYR A CB    1 
ATOM   864  C  CG    . TYR A 1 103 ? -25.050 -16.267 35.309 1.00 23.83 ? 103  TYR A CG    1 
ATOM   865  C  CD1   . TYR A 1 103 ? -24.350 -15.689 36.374 1.00 26.34 ? 103  TYR A CD1   1 
ATOM   866  C  CD2   . TYR A 1 103 ? -24.438 -17.299 34.602 1.00 25.04 ? 103  TYR A CD2   1 
ATOM   867  C  CE1   . TYR A 1 103 ? -23.067 -16.146 36.728 1.00 26.01 ? 103  TYR A CE1   1 
ATOM   868  C  CE2   . TYR A 1 103 ? -23.171 -17.764 34.948 1.00 25.42 ? 103  TYR A CE2   1 
ATOM   869  C  CZ    . TYR A 1 103 ? -22.492 -17.184 36.003 1.00 26.99 ? 103  TYR A CZ    1 
ATOM   870  O  OH    . TYR A 1 103 ? -21.239 -17.659 36.315 1.00 27.33 ? 103  TYR A OH    1 
ATOM   871  N  N     . ASP A 1 104 ? -27.939 -18.479 34.445 1.00 26.11 ? 104  ASP A N     1 
ATOM   872  C  CA    . ASP A 1 104 ? -27.923 -19.907 34.188 1.00 26.43 ? 104  ASP A CA    1 
ATOM   873  C  C     . ASP A 1 104 ? -26.987 -20.121 33.012 1.00 24.07 ? 104  ASP A C     1 
ATOM   874  O  O     . ASP A 1 104 ? -27.349 -19.835 31.870 1.00 23.46 ? 104  ASP A O     1 
ATOM   875  C  CB    . ASP A 1 104 ? -29.343 -20.399 33.865 1.00 26.53 ? 104  ASP A CB    1 
ATOM   876  C  CG    . ASP A 1 104 ? -29.407 -21.894 33.530 1.00 27.83 ? 104  ASP A CG    1 
ATOM   877  O  OD1   . ASP A 1 104 ? -28.358 -22.561 33.413 1.00 24.31 ? 104  ASP A OD1   1 
ATOM   878  O  OD2   . ASP A 1 104 ? -30.537 -22.409 33.382 1.00 28.88 ? 104  ASP A OD2   1 
ATOM   879  N  N     . HIS A 1 105 ? -25.783 -20.618 33.296 1.00 23.30 ? 105  HIS A N     1 
ATOM   880  C  CA    . HIS A 1 105 ? -24.764 -20.807 32.263 1.00 22.49 ? 105  HIS A CA    1 
ATOM   881  C  C     . HIS A 1 105 ? -25.196 -21.742 31.123 1.00 21.80 ? 105  HIS A C     1 
ATOM   882  O  O     . HIS A 1 105 ? -24.717 -21.604 29.998 1.00 21.85 ? 105  HIS A O     1 
ATOM   883  C  CB    . HIS A 1 105 ? -23.431 -21.268 32.877 1.00 23.07 ? 105  HIS A CB    1 
ATOM   884  C  CG    . HIS A 1 105 ? -23.396 -22.720 33.240 1.00 29.62 ? 105  HIS A CG    1 
ATOM   885  N  ND1   . HIS A 1 105 ? -22.959 -23.695 32.368 1.00 32.90 ? 105  HIS A ND1   1 
ATOM   886  C  CD2   . HIS A 1 105 ? -23.740 -23.364 34.382 1.00 31.79 ? 105  HIS A CD2   1 
ATOM   887  C  CE1   . HIS A 1 105 ? -23.039 -24.876 32.955 1.00 34.42 ? 105  HIS A CE1   1 
ATOM   888  N  NE2   . HIS A 1 105 ? -23.510 -24.703 34.177 1.00 33.09 ? 105  HIS A NE2   1 
ATOM   889  N  N     . THR A 1 106 ? -26.108 -22.671 31.410 1.00 22.18 ? 106  THR A N     1 
ATOM   890  C  CA    . THR A 1 106 ? -26.577 -23.632 30.403 1.00 22.80 ? 106  THR A CA    1 
ATOM   891  C  C     . THR A 1 106 ? -27.376 -22.973 29.273 1.00 20.65 ? 106  THR A C     1 
ATOM   892  O  O     . THR A 1 106 ? -27.529 -23.559 28.196 1.00 22.22 ? 106  THR A O     1 
ATOM   893  C  CB    . THR A 1 106 ? -27.402 -24.806 31.019 1.00 23.91 ? 106  THR A CB    1 
ATOM   894  O  OG1   . THR A 1 106 ? -28.695 -24.345 31.427 1.00 24.15 ? 106  THR A OG1   1 
ATOM   895  C  CG2   . THR A 1 106 ? -26.671 -25.432 32.217 1.00 25.98 ? 106  THR A CG2   1 
ATOM   896  N  N     . LYS A 1 107 ? -27.869 -21.759 29.520 1.00 18.78 ? 107  LYS A N     1 
ATOM   897  C  CA    . LYS A 1 107 ? -28.627 -20.990 28.520 1.00 18.53 ? 107  LYS A CA    1 
ATOM   898  C  C     . LYS A 1 107 ? -27.733 -20.046 27.721 1.00 18.42 ? 107  LYS A C     1 
ATOM   899  O  O     . LYS A 1 107 ? -28.188 -19.424 26.753 1.00 18.90 ? 107  LYS A O     1 
ATOM   900  C  CB    . LYS A 1 107 ? -29.715 -20.145 29.190 1.00 20.27 ? 107  LYS A CB    1 
ATOM   901  C  CG    . LYS A 1 107 ? -30.590 -20.881 30.194 1.00 27.26 ? 107  LYS A CG    1 
ATOM   902  C  CD    . LYS A 1 107 ? -31.633 -21.719 29.507 1.00 31.68 ? 107  LYS A CD    1 
ATOM   903  C  CE    . LYS A 1 107 ? -32.778 -22.023 30.456 1.00 33.27 ? 107  LYS A CE    1 
ATOM   904  N  NZ    . LYS A 1 107 ? -33.908 -22.645 29.728 1.00 39.29 ? 107  LYS A NZ    1 
ATOM   905  N  N     . ILE A 1 108 ? -26.478 -19.916 28.142 1.00 15.97 ? 108  ILE A N     1 
ATOM   906  C  CA    . ILE A 1 108 ? -25.542 -19.001 27.499 1.00 16.63 ? 108  ILE A CA    1 
ATOM   907  C  C     . ILE A 1 108 ? -24.763 -19.739 26.413 1.00 16.45 ? 108  ILE A C     1 
ATOM   908  O  O     . ILE A 1 108 ? -24.068 -20.718 26.694 1.00 18.30 ? 108  ILE A O     1 
ATOM   909  C  CB    . ILE A 1 108 ? -24.580 -18.356 28.535 1.00 15.77 ? 108  ILE A CB    1 
ATOM   910  C  CG1   . ILE A 1 108 ? -25.384 -17.611 29.602 1.00 16.39 ? 108  ILE A CG1   1 
ATOM   911  C  CG2   . ILE A 1 108 ? -23.578 -17.427 27.842 1.00 16.77 ? 108  ILE A CG2   1 
ATOM   912  C  CD1   . ILE A 1 108 ? -24.552 -17.089 30.788 1.00 15.75 ? 108  ILE A CD1   1 
ATOM   913  N  N     . ARG A 1 109 ? -24.890 -19.283 25.170 1.00 15.47 ? 109  ARG A N     1 
ATOM   914  C  CA    . ARG A 1 109 ? -24.170 -19.933 24.073 1.00 16.89 ? 109  ARG A CA    1 
ATOM   915  C  C     . ARG A 1 109 ? -22.701 -19.527 24.053 1.00 16.78 ? 109  ARG A C     1 
ATOM   916  O  O     . ARG A 1 109 ? -22.355 -18.409 23.670 1.00 17.34 ? 109  ARG A O     1 
ATOM   917  C  CB    . ARG A 1 109 ? -24.832 -19.642 22.722 1.00 16.83 ? 109  ARG A CB    1 
ATOM   918  C  CG    . ARG A 1 109 ? -24.393 -20.612 21.623 1.00 17.61 ? 109  ARG A CG    1 
ATOM   919  C  CD    . ARG A 1 109 ? -25.156 -20.357 20.329 1.00 17.20 ? 109  ARG A CD    1 
ATOM   920  N  NE    . ARG A 1 109 ? -26.603 -20.521 20.494 1.00 20.14 ? 109  ARG A NE    1 
ATOM   921  C  CZ    . ARG A 1 109 ? -27.261 -21.675 20.390 1.00 22.85 ? 109  ARG A CZ    1 
ATOM   922  N  NH1   . ARG A 1 109 ? -26.615 -22.808 20.126 1.00 20.58 ? 109  ARG A NH1   1 
ATOM   923  N  NH2   . ARG A 1 109 ? -28.577 -21.701 20.568 1.00 22.32 ? 109  ARG A NH2   1 
ATOM   924  N  N     . VAL A 1 110 ? -21.843 -20.448 24.477 1.00 15.25 ? 110  VAL A N     1 
ATOM   925  C  CA    . VAL A 1 110 ? -20.404 -20.226 24.463 1.00 16.20 ? 110  VAL A CA    1 
ATOM   926  C  C     . VAL A 1 110 ? -19.827 -20.976 23.276 1.00 16.25 ? 110  VAL A C     1 
ATOM   927  O  O     . VAL A 1 110 ? -19.935 -22.205 23.190 1.00 18.32 ? 110  VAL A O     1 
ATOM   928  C  CB    . VAL A 1 110 ? -19.723 -20.692 25.777 1.00 15.96 ? 110  VAL A CB    1 
ATOM   929  C  CG1   . VAL A 1 110 ? -18.231 -20.358 25.744 1.00 16.93 ? 110  VAL A CG1   1 
ATOM   930  C  CG2   . VAL A 1 110 ? -20.385 -20.040 26.990 1.00 16.82 ? 110  VAL A CG2   1 
ATOM   931  N  N     . ALA A 1 111 ? -19.232 -20.229 22.349 1.00 15.46 ? 111  ALA A N     1 
ATOM   932  C  CA    . ALA A 1 111 ? -18.636 -20.816 21.163 1.00 16.17 ? 111  ALA A CA    1 
ATOM   933  C  C     . ALA A 1 111 ? -17.116 -20.750 21.204 1.00 16.25 ? 111  ALA A C     1 
ATOM   934  O  O     . ALA A 1 111 ? -16.531 -19.705 21.525 1.00 15.18 ? 111  ALA A O     1 
ATOM   935  C  CB    . ALA A 1 111 ? -19.168 -20.145 19.905 1.00 15.84 ? 111  ALA A CB    1 
ATOM   936  N  N     . ASN A 1 112 ? -16.512 -21.892 20.879 1.00 17.12 ? 112  ASN A N     1 
ATOM   937  C  CA    A ASN A 1 112 ? -15.061 -22.064 20.819 0.50 18.22 ? 112  ASN A CA    1 
ATOM   938  C  CA    B ASN A 1 112 ? -15.069 -22.052 20.820 0.50 17.73 ? 112  ASN A CA    1 
ATOM   939  C  C     . ASN A 1 112 ? -14.717 -22.445 19.390 1.00 17.54 ? 112  ASN A C     1 
ATOM   940  O  O     . ASN A 1 112 ? -15.159 -23.488 18.911 1.00 18.30 ? 112  ASN A O     1 
ATOM   941  C  CB    A ASN A 1 112 ? -14.606 -23.210 21.743 0.50 19.90 ? 112  ASN A CB    1 
ATOM   942  C  CB    B ASN A 1 112 ? -14.658 -23.159 21.800 0.50 18.63 ? 112  ASN A CB    1 
ATOM   943  C  CG    A ASN A 1 112 ? -14.461 -22.792 23.195 0.50 22.18 ? 112  ASN A CG    1 
ATOM   944  C  CG    B ASN A 1 112 ? -13.179 -23.149 22.123 0.50 19.91 ? 112  ASN A CG    1 
ATOM   945  O  OD1   A ASN A 1 112 ? -13.368 -22.854 23.764 0.50 24.01 ? 112  ASN A OD1   1 
ATOM   946  O  OD1   B ASN A 1 112 ? -12.327 -23.261 21.240 0.50 19.18 ? 112  ASN A OD1   1 
ATOM   947  N  ND2   A ASN A 1 112 ? -15.559 -22.382 23.806 0.50 23.31 ? 112  ASN A ND2   1 
ATOM   948  N  ND2   B ASN A 1 112 ? -12.866 -23.043 23.411 0.50 19.96 ? 112  ASN A ND2   1 
ATOM   949  N  N     . PHE A 1 113 ? -13.948 -21.609 18.693 1.00 16.92 ? 113  PHE A N     1 
ATOM   950  C  CA    . PHE A 1 113 ? -13.591 -21.941 17.305 1.00 17.70 ? 113  PHE A CA    1 
ATOM   951  C  C     . PHE A 1 113 ? -12.123 -21.746 16.936 1.00 17.59 ? 113  PHE A C     1 
ATOM   952  O  O     . PHE A 1 113 ? -11.373 -21.069 17.645 1.00 15.91 ? 113  PHE A O     1 
ATOM   953  C  CB    . PHE A 1 113 ? -14.547 -21.289 16.277 1.00 16.47 ? 113  PHE A CB    1 
ATOM   954  C  CG    . PHE A 1 113 ? -14.165 -19.892 15.850 1.00 18.59 ? 113  PHE A CG    1 
ATOM   955  C  CD1   . PHE A 1 113 ? -14.120 -18.849 16.768 1.00 19.65 ? 113  PHE A CD1   1 
ATOM   956  C  CD2   . PHE A 1 113 ? -13.882 -19.615 14.512 1.00 18.53 ? 113  PHE A CD2   1 
ATOM   957  C  CE1   . PHE A 1 113 ? -13.776 -17.553 16.364 1.00 22.52 ? 113  PHE A CE1   1 
ATOM   958  C  CE2   . PHE A 1 113 ? -13.537 -18.318 14.094 1.00 21.61 ? 113  PHE A CE2   1 
ATOM   959  C  CZ    . PHE A 1 113 ? -13.493 -17.285 15.024 1.00 20.32 ? 113  PHE A CZ    1 
ATOM   960  N  N     . ASP A 1 114 ? -11.735 -22.364 15.825 1.00 17.68 ? 114  ASP A N     1 
ATOM   961  C  CA    . ASP A 1 114 ? -10.386 -22.260 15.280 1.00 18.71 ? 114  ASP A CA    1 
ATOM   962  C  C     . ASP A 1 114 ? -10.460 -22.434 13.772 1.00 18.84 ? 114  ASP A C     1 
ATOM   963  O  O     . ASP A 1 114 ? -11.235 -23.261 13.272 1.00 18.80 ? 114  ASP A O     1 
ATOM   964  C  CB    . ASP A 1 114 ? -9.497  -23.346 15.887 1.00 20.51 ? 114  ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 114 ? -8.043  -23.208 15.491 1.00 26.11 ? 114  ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 114 ? -7.415  -22.199 15.866 1.00 27.35 ? 114  ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 114 ? -7.532  -24.124 14.815 1.00 31.83 ? 114  ASP A OD2   1 
ATOM   968  N  N     . ILE A 1 115 ? -9.676  -21.642 13.044 1.00 17.91 ? 115  ILE A N     1 
ATOM   969  C  CA    . ILE A 1 115 ? -9.640  -21.760 11.589 1.00 17.07 ? 115  ILE A CA    1 
ATOM   970  C  C     . ILE A 1 115 ? -8.262  -22.207 11.094 1.00 17.96 ? 115  ILE A C     1 
ATOM   971  O  O     . ILE A 1 115 ? -7.254  -22.040 11.790 1.00 17.74 ? 115  ILE A O     1 
ATOM   972  C  CB    . ILE A 1 115 ? -10.086 -20.449 10.874 1.00 18.18 ? 115  ILE A CB    1 
ATOM   973  C  CG1   . ILE A 1 115 ? -9.006  -19.359 10.952 1.00 18.83 ? 115  ILE A CG1   1 
ATOM   974  C  CG2   . ILE A 1 115 ? -11.426 -19.945 11.441 1.00 18.25 ? 115  ILE A CG2   1 
ATOM   975  C  CD1   . ILE A 1 115 ? -9.272  -18.161 10.014 1.00 19.74 ? 115  ILE A CD1   1 
ATOM   976  N  N     . GLU A 1 116 ? -8.233  -22.785 9.898  1.00 16.35 ? 116  GLU A N     1 
ATOM   977  C  CA    . GLU A 1 116 ? -6.980  -23.076 9.210  1.00 18.93 ? 116  GLU A CA    1 
ATOM   978  C  C     . GLU A 1 116 ? -6.954  -22.311 7.902  1.00 19.17 ? 116  GLU A C     1 
ATOM   979  O  O     . GLU A 1 116 ? -7.982  -22.172 7.236  1.00 19.00 ? 116  GLU A O     1 
ATOM   980  C  CB    . GLU A 1 116 ? -6.828  -24.568 8.913  1.00 19.28 ? 116  GLU A CB    1 
ATOM   981  C  CG    . GLU A 1 116 ? -6.852  -25.499 10.130 1.00 20.22 ? 116  GLU A CG    1 
ATOM   982  C  CD    . GLU A 1 116 ? -5.757  -25.216 11.143 1.00 26.22 ? 116  GLU A CD    1 
ATOM   983  O  OE1   . GLU A 1 116 ? -4.694  -24.656 10.782 1.00 26.27 ? 116  GLU A OE1   1 
ATOM   984  O  OE2   . GLU A 1 116 ? -5.958  -25.569 12.322 1.00 26.27 ? 116  GLU A OE2   1 
ATOM   985  N  N     . VAL A 1 117 ? -5.771  -21.817 7.549  1.00 19.42 ? 117  VAL A N     1 
ATOM   986  C  CA    . VAL A 1 117 ? -5.561  -21.059 6.320  1.00 18.37 ? 117  VAL A CA    1 
ATOM   987  C  C     . VAL A 1 117 ? -4.205  -21.463 5.739  1.00 21.59 ? 117  VAL A C     1 
ATOM   988  O  O     . VAL A 1 117 ? -3.162  -21.130 6.302  1.00 21.81 ? 117  VAL A O     1 
ATOM   989  C  CB    . VAL A 1 117 ? -5.527  -19.526 6.586  1.00 19.18 ? 117  VAL A CB    1 
ATOM   990  C  CG1   . VAL A 1 117 ? -5.207  -18.766 5.304  1.00 18.67 ? 117  VAL A CG1   1 
ATOM   991  C  CG2   . VAL A 1 117 ? -6.835  -19.023 7.205  1.00 16.74 ? 117  VAL A CG2   1 
ATOM   992  N  N     . THR A 1 118 ? -4.218  -22.193 4.626  1.00 22.68 ? 118  THR A N     1 
ATOM   993  C  CA    . THR A 1 118 ? -2.972  -22.560 3.947  1.00 24.49 ? 118  THR A CA    1 
ATOM   994  C  C     . THR A 1 118 ? -2.376  -21.323 3.272  1.00 25.17 ? 118  THR A C     1 
ATOM   995  O  O     . THR A 1 118 ? -3.070  -20.616 2.538  1.00 24.22 ? 118  THR A O     1 
ATOM   996  C  CB    . THR A 1 118 ? -3.197  -23.706 2.923  1.00 23.14 ? 118  THR A CB    1 
ATOM   997  O  OG1   . THR A 1 118 ? -3.619  -24.886 3.618  1.00 24.56 ? 118  THR A OG1   1 
ATOM   998  C  CG2   . THR A 1 118 ? -1.921  -24.021 2.142  1.00 26.73 ? 118  THR A CG2   1 
ATOM   999  N  N     . SER A 1 119 ? -1.100  -21.057 3.543  1.00 26.50 ? 119  SER A N     1 
ATOM   1000 C  CA    . SER A 1 119 ? -0.405  -19.912 2.950  1.00 32.06 ? 119  SER A CA    1 
ATOM   1001 C  C     . SER A 1 119 ? 1.026   -20.264 2.533  1.00 34.95 ? 119  SER A C     1 
ATOM   1002 O  O     . SER A 1 119 ? 1.868   -20.546 3.386  1.00 36.09 ? 119  SER A O     1 
ATOM   1003 C  CB    . SER A 1 119 ? -0.388  -18.726 3.917  1.00 32.85 ? 119  SER A CB    1 
ATOM   1004 O  OG    . SER A 1 119 ? 0.429   -17.684 3.407  1.00 37.57 ? 119  SER A OG    1 
ATOM   1005 N  N     . PRO A 1 120 ? 1.306   -20.230 1.218  1.00 37.70 ? 120  PRO A N     1 
ATOM   1006 C  CA    . PRO A 1 120 ? 2.650   -20.543 0.726  1.00 40.59 ? 120  PRO A CA    1 
ATOM   1007 C  C     . PRO A 1 120 ? 3.673   -19.418 0.938  1.00 43.27 ? 120  PRO A C     1 
ATOM   1008 O  O     . PRO A 1 120 ? 4.871   -19.695 1.015  1.00 45.46 ? 120  PRO A O     1 
ATOM   1009 C  CB    . PRO A 1 120 ? 2.429   -20.782 -0.771 1.00 40.79 ? 120  PRO A CB    1 
ATOM   1010 C  CG    . PRO A 1 120 ? 1.235   -19.966 -1.116 1.00 39.29 ? 120  PRO A CG    1 
ATOM   1011 C  CD    . PRO A 1 120 ? 0.366   -19.931 0.119  1.00 38.36 ? 120  PRO A CD    1 
ATOM   1012 N  N     . ASP A 1 121 ? 3.207   -18.173 1.037  1.00 43.31 ? 121  ASP A N     1 
ATOM   1013 C  CA    . ASP A 1 121 ? 4.107   -17.012 1.084  1.00 44.24 ? 121  ASP A CA    1 
ATOM   1014 C  C     . ASP A 1 121 ? 4.217   -16.339 2.461  1.00 43.50 ? 121  ASP A C     1 
ATOM   1015 O  O     . ASP A 1 121 ? 4.276   -15.107 2.563  1.00 43.83 ? 121  ASP A O     1 
ATOM   1016 C  CB    . ASP A 1 121 ? 3.740   -15.991 -0.006 1.00 45.60 ? 121  ASP A CB    1 
ATOM   1017 C  CG    . ASP A 1 121 ? 2.279   -15.564 0.045  1.00 46.49 ? 121  ASP A CG    1 
ATOM   1018 O  OD1   . ASP A 1 121 ? 1.773   -15.068 -0.983 1.00 49.40 ? 121  ASP A OD1   1 
ATOM   1019 O  OD2   . ASP A 1 121 ? 1.633   -15.723 1.102  1.00 46.65 ? 121  ASP A OD2   1 
ATOM   1020 N  N     . GLY A 1 122 ? 4.256   -17.155 3.509  1.00 41.24 ? 122  GLY A N     1 
ATOM   1021 C  CA    . GLY A 1 122 ? 4.455   -16.662 4.866  1.00 39.87 ? 122  GLY A CA    1 
ATOM   1022 C  C     . GLY A 1 122 ? 3.172   -16.592 5.668  1.00 38.54 ? 122  GLY A C     1 
ATOM   1023 O  O     . GLY A 1 122 ? 2.163   -17.200 5.298  1.00 36.71 ? 122  GLY A O     1 
ATOM   1024 N  N     . PHE A 1 123 ? 3.217   -15.846 6.769  1.00 37.46 ? 123  PHE A N     1 
ATOM   1025 C  CA    . PHE A 1 123 ? 2.073   -15.713 7.666  1.00 37.08 ? 123  PHE A CA    1 
ATOM   1026 C  C     . PHE A 1 123 ? 0.896   -15.039 6.955  1.00 34.29 ? 123  PHE A C     1 
ATOM   1027 O  O     . PHE A 1 123 ? 1.061   -13.964 6.371  1.00 35.70 ? 123  PHE A O     1 
ATOM   1028 C  CB    . PHE A 1 123 ? 2.463   -14.928 8.927  1.00 37.95 ? 123  PHE A CB    1 
ATOM   1029 C  CG    . PHE A 1 123 ? 1.375   -14.867 9.962  1.00 39.36 ? 123  PHE A CG    1 
ATOM   1030 C  CD1   . PHE A 1 123 ? 1.221   -15.895 10.888 1.00 41.27 ? 123  PHE A CD1   1 
ATOM   1031 C  CD2   . PHE A 1 123 ? 0.501   -13.782 10.010 1.00 41.25 ? 123  PHE A CD2   1 
ATOM   1032 C  CE1   . PHE A 1 123 ? 0.210   -15.846 11.848 1.00 42.69 ? 123  PHE A CE1   1 
ATOM   1033 C  CE2   . PHE A 1 123 ? -0.514  -13.722 10.965 1.00 40.87 ? 123  PHE A CE2   1 
ATOM   1034 C  CZ    . PHE A 1 123 ? -0.659  -14.757 11.885 1.00 41.20 ? 123  PHE A CZ    1 
ATOM   1035 N  N     . PRO A 1 124 ? -0.290  -15.678 6.990  1.00 32.19 ? 124  PRO A N     1 
ATOM   1036 C  CA    . PRO A 1 124 ? -1.478  -15.091 6.364  1.00 30.80 ? 124  PRO A CA    1 
ATOM   1037 C  C     . PRO A 1 124 ? -2.037  -13.933 7.194  1.00 30.86 ? 124  PRO A C     1 
ATOM   1038 O  O     . PRO A 1 124 ? -2.688  -14.157 8.223  1.00 31.30 ? 124  PRO A O     1 
ATOM   1039 C  CB    . PRO A 1 124 ? -2.462  -16.261 6.303  1.00 28.72 ? 124  PRO A CB    1 
ATOM   1040 C  CG    . PRO A 1 124 ? -2.046  -17.176 7.405  1.00 29.62 ? 124  PRO A CG    1 
ATOM   1041 C  CD    . PRO A 1 124 ? -0.559  -17.015 7.557  1.00 31.07 ? 124  PRO A CD    1 
ATOM   1042 N  N     . GLU A 1 125 ? -1.767  -12.708 6.751  1.00 30.33 ? 125  GLU A N     1 
ATOM   1043 C  CA    . GLU A 1 125 ? -2.182  -11.507 7.481  1.00 29.78 ? 125  GLU A CA    1 
ATOM   1044 C  C     . GLU A 1 125 ? -3.697  -11.343 7.455  1.00 27.35 ? 125  GLU A C     1 
ATOM   1045 O  O     . GLU A 1 125 ? -4.289  -11.299 6.376  1.00 25.19 ? 125  GLU A O     1 
ATOM   1046 C  CB    . GLU A 1 125 ? -1.509  -10.251 6.912  1.00 31.92 ? 125  GLU A CB    1 
ATOM   1047 C  CG    . GLU A 1 125 ? -0.009  -10.141 7.211  1.00 36.88 ? 125  GLU A CG    1 
ATOM   1048 C  CD    . GLU A 1 125 ? 0.314   -9.974  8.698  1.00 41.62 ? 125  GLU A CD    1 
ATOM   1049 O  OE1   . GLU A 1 125 ? -0.609  -9.771  9.519  1.00 38.76 ? 125  GLU A OE1   1 
ATOM   1050 O  OE2   . GLU A 1 125 ? 1.513   -10.046 9.044  1.00 45.21 ? 125  GLU A OE2   1 
ATOM   1051 N  N     . PRO A 1 126 ? -4.321  -11.262 8.647  1.00 27.94 ? 126  PRO A N     1 
ATOM   1052 C  CA    . PRO A 1 126 ? -5.778  -11.127 8.778  1.00 28.86 ? 126  PRO A CA    1 
ATOM   1053 C  C     . PRO A 1 126 ? -6.353  -9.865  8.137  1.00 30.37 ? 126  PRO A C     1 
ATOM   1054 O  O     . PRO A 1 126 ? -7.501  -9.888  7.697  1.00 30.61 ? 126  PRO A O     1 
ATOM   1055 C  CB    . PRO A 1 126 ? -6.007  -11.119 10.297 1.00 28.30 ? 126  PRO A CB    1 
ATOM   1056 C  CG    . PRO A 1 126 ? -4.652  -10.885 10.910 1.00 30.35 ? 126  PRO A CG    1 
ATOM   1057 C  CD    . PRO A 1 126 ? -3.676  -11.481 9.953  1.00 27.55 ? 126  PRO A CD    1 
ATOM   1058 N  N     . SER A 1 127 ? -5.571  -8.786  8.067  1.00 28.81 ? 127  SER A N     1 
ATOM   1059 C  CA    . SER A 1 127 ? -6.060  -7.541  7.462  0.50 28.57 ? 127  SER A CA    1 
ATOM   1060 C  C     . SER A 1 127 ? -6.123  -7.635  5.938  1.00 30.77 ? 127  SER A C     1 
ATOM   1061 O  O     . SER A 1 127 ? -6.876  -6.898  5.295  1.00 32.54 ? 127  SER A O     1 
ATOM   1062 C  CB    . SER A 1 127 ? -5.220  -6.336  7.899  0.50 28.57 ? 127  SER A CB    1 
ATOM   1063 O  OG    . SER A 1 127 ? -3.911  -6.402  7.369  0.50 27.12 ? 127  SER A OG    1 
ATOM   1064 N  N     . GLN A 1 128 ? -5.338  -8.552  5.375  1.00 29.77 ? 128  GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 128 ? -5.307  -8.791  3.935  1.00 30.67 ? 128  GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 128 ? -6.252  -9.923  3.528  1.00 28.46 ? 128  GLN A C     1 
ATOM   1067 O  O     . GLN A 1 128 ? -6.935  -9.831  2.503  1.00 25.73 ? 128  GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 128 ? -3.881  -9.127  3.487  1.00 33.95 ? 128  GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 128 ? -2.855  -8.030  3.766  1.00 39.89 ? 128  GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 128 ? -3.092  -6.782  2.935  1.00 45.13 ? 128  GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 128 ? -3.515  -5.747  3.454  1.00 48.39 ? 128  GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 128 ? -2.828  -6.877  1.636  1.00 48.45 ? 128  GLN A NE2   1 
ATOM   1073 N  N     . ALA A 1 129 ? -6.267  -10.988 4.333  1.00 25.14 ? 129  ALA A N     1 
ATOM   1074 C  CA    . ALA A 1 129 ? -7.055  -12.203 4.067  1.00 23.98 ? 129  ALA A CA    1 
ATOM   1075 C  C     . ALA A 1 129 ? -7.038  -12.668 2.598  1.00 24.66 ? 129  ALA A C     1 
ATOM   1076 O  O     . ALA A 1 129 ? -8.086  -12.878 1.977  1.00 22.90 ? 129  ALA A O     1 
ATOM   1077 C  CB    . ALA A 1 129 ? -8.489  -12.034 4.587  1.00 21.26 ? 129  ALA A CB    1 
ATOM   1078 N  N     . LYS A 1 130 ? -5.841  -12.839 2.049  1.00 26.20 ? 130  LYS A N     1 
ATOM   1079 C  CA    . LYS A 1 130 ? -5.703  -13.153 0.628  1.00 26.74 ? 130  LYS A CA    1 
ATOM   1080 C  C     . LYS A 1 130 ? -5.713  -14.650 0.308  1.00 25.01 ? 130  LYS A C     1 
ATOM   1081 O  O     . LYS A 1 130 ? -5.704  -15.037 -0.862 1.00 23.89 ? 130  LYS A O     1 
ATOM   1082 C  CB    . LYS A 1 130 ? -4.471  -12.459 0.026  1.00 30.49 ? 130  LYS A CB    1 
ATOM   1083 C  CG    . LYS A 1 130 ? -3.130  -12.853 0.626  1.00 33.27 ? 130  LYS A CG    1 
ATOM   1084 C  CD    . LYS A 1 130 ? -1.995  -12.092 -0.071 1.00 37.37 ? 130  LYS A CD    1 
ATOM   1085 C  CE    . LYS A 1 130 ? -0.626  -12.585 0.377  1.00 40.72 ? 130  LYS A CE    1 
ATOM   1086 N  NZ    . LYS A 1 130 ? 0.482   -11.746 -0.172 1.00 43.74 ? 130  LYS A NZ    1 
ATOM   1087 N  N     . HIS A 1 131 ? -5.756  -15.484 1.344  1.00 23.54 ? 131  HIS A N     1 
ATOM   1088 C  CA    . HIS A 1 131 ? -5.750  -16.934 1.164  1.00 23.80 ? 131  HIS A CA    1 
ATOM   1089 C  C     . HIS A 1 131 ? -7.056  -17.572 1.634  1.00 21.55 ? 131  HIS A C     1 
ATOM   1090 O  O     . HIS A 1 131 ? -7.676  -17.083 2.583  1.00 21.64 ? 131  HIS A O     1 
ATOM   1091 C  CB    . HIS A 1 131 ? -4.553  -17.552 1.893  1.00 24.93 ? 131  HIS A CB    1 
ATOM   1092 C  CG    . HIS A 1 131 ? -3.237  -17.007 1.440  1.00 26.00 ? 131  HIS A CG    1 
ATOM   1093 N  ND1   . HIS A 1 131 ? -2.446  -16.211 2.238  1.00 31.20 ? 131  HIS A ND1   1 
ATOM   1094 C  CD2   . HIS A 1 131 ? -2.593  -17.109 0.254  1.00 27.45 ? 131  HIS A CD2   1 
ATOM   1095 C  CE1   . HIS A 1 131 ? -1.360  -15.864 1.571  1.00 28.50 ? 131  HIS A CE1   1 
ATOM   1096 N  NE2   . HIS A 1 131 ? -1.423  -16.399 0.365  1.00 32.32 ? 131  HIS A NE2   1 
ATOM   1097 N  N     . PRO A 1 132 ? -7.479  -18.662 0.968  1.00 21.09 ? 132  PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 132 ? -8.713  -19.352 1.351  1.00 20.58 ? 132  PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 132 ? -8.709  -19.868 2.785  1.00 19.98 ? 132  PRO A C     1 
ATOM   1100 O  O     . PRO A 1 132 ? -7.685  -20.340 3.280  1.00 19.89 ? 132  PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 132 ? -8.768  -20.543 0.395  1.00 20.87 ? 132  PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 132 ? -7.983  -20.105 -0.803 1.00 20.62 ? 132  PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 132 ? -6.902  -19.206 -0.279 1.00 22.59 ? 132  PRO A CD    1 
ATOM   1104 N  N     . ILE A 1 133 ? -9.853  -19.757 3.443  1.00 19.37 ? 133  ILE A N     1 
ATOM   1105 C  CA    . ILE A 1 133 ? -10.075 -20.446 4.708  1.00 17.75 ? 133  ILE A CA    1 
ATOM   1106 C  C     . ILE A 1 133 ? -10.429 -21.889 4.339  1.00 18.85 ? 133  ILE A C     1 
ATOM   1107 O  O     . ILE A 1 133 ? -11.448 -22.132 3.692  1.00 19.92 ? 133  ILE A O     1 
ATOM   1108 C  CB    . ILE A 1 133 ? -11.195 -19.774 5.523  1.00 17.88 ? 133  ILE A CB    1 
ATOM   1109 C  CG1   . ILE A 1 133 ? -10.766 -18.359 5.934  1.00 17.23 ? 133  ILE A CG1   1 
ATOM   1110 C  CG2   . ILE A 1 133 ? -11.537 -20.608 6.770  1.00 19.86 ? 133  ILE A CG2   1 
ATOM   1111 C  CD1   . ILE A 1 133 ? -11.885 -17.476 6.462  1.00 17.92 ? 133  ILE A CD1   1 
ATOM   1112 N  N     . ASP A 1 134 ? -9.584  -22.843 4.735  1.00 19.20 ? 134  ASP A N     1 
ATOM   1113 C  CA    . ASP A 1 134 ? -9.782  -24.240 4.319  1.00 17.75 ? 134  ASP A CA    1 
ATOM   1114 C  C     . ASP A 1 134 ? -10.257 -25.208 5.411  1.00 17.82 ? 134  ASP A C     1 
ATOM   1115 O  O     . ASP A 1 134 ? -10.481 -26.386 5.140  1.00 20.17 ? 134  ASP A O     1 
ATOM   1116 C  CB    . ASP A 1 134 ? -8.558  -24.788 3.560  1.00 19.77 ? 134  ASP A CB    1 
ATOM   1117 C  CG    . ASP A 1 134 ? -7.247  -24.583 4.298  1.00 20.39 ? 134  ASP A CG    1 
ATOM   1118 O  OD1   . ASP A 1 134 ? -7.218  -24.612 5.546  1.00 22.83 ? 134  ASP A OD1   1 
ATOM   1119 O  OD2   . ASP A 1 134 ? -6.221  -24.420 3.607  1.00 19.82 ? 134  ASP A OD2   1 
ATOM   1120 N  N     . ALA A 1 135 ? -10.422 -24.705 6.632  1.00 16.59 ? 135  ALA A N     1 
ATOM   1121 C  CA    . ALA A 1 135 ? -11.024 -25.475 7.725  1.00 17.05 ? 135  ALA A CA    1 
ATOM   1122 C  C     . ALA A 1 135 ? -11.534 -24.550 8.813  1.00 16.33 ? 135  ALA A C     1 
ATOM   1123 O  O     . ALA A 1 135 ? -10.855 -23.593 9.177  1.00 17.71 ? 135  ALA A O     1 
ATOM   1124 C  CB    . ALA A 1 135 ? -10.020 -26.467 8.322  1.00 17.83 ? 135  ALA A CB    1 
ATOM   1125 N  N     . ILE A 1 136 ? -12.739 -24.827 9.310  1.00 16.78 ? 136  ILE A N     1 
ATOM   1126 C  CA    . ILE A 1 136 ? -13.224 -24.224 10.555 1.00 16.74 ? 136  ILE A CA    1 
ATOM   1127 C  C     . ILE A 1 136 ? -13.792 -25.319 11.453 1.00 15.56 ? 136  ILE A C     1 
ATOM   1128 O  O     . ILE A 1 136 ? -14.616 -26.126 11.013 1.00 16.04 ? 136  ILE A O     1 
ATOM   1129 C  CB    . ILE A 1 136 ? -14.323 -23.142 10.331 1.00 16.50 ? 136  ILE A CB    1 
ATOM   1130 C  CG1   . ILE A 1 136 ? -13.864 -22.082 9.323  1.00 16.46 ? 136  ILE A CG1   1 
ATOM   1131 C  CG2   . ILE A 1 136 ? -14.691 -22.472 11.670 1.00 17.76 ? 136  ILE A CG2   1 
ATOM   1132 C  CD1   . ILE A 1 136 ? -14.973 -21.119 8.891  1.00 19.45 ? 136  ILE A CD1   1 
ATOM   1133 N  N     . THR A 1 137 ? -13.339 -25.358 12.704 1.00 16.23 ? 137  THR A N     1 
ATOM   1134 C  CA    . THR A 1 137 ? -14.018 -26.154 13.717 1.00 15.42 ? 137  THR A CA    1 
ATOM   1135 C  C     . THR A 1 137 ? -14.613 -25.210 14.756 1.00 15.83 ? 137  THR A C     1 
ATOM   1136 O  O     . THR A 1 137 ? -13.916 -24.366 15.321 1.00 15.90 ? 137  THR A O     1 
ATOM   1137 C  CB    . THR A 1 137 ? -13.099 -27.217 14.376 1.00 16.54 ? 137  THR A CB    1 
ATOM   1138 O  OG1   . THR A 1 137 ? -12.704 -28.178 13.392 1.00 17.60 ? 137  THR A OG1   1 
ATOM   1139 C  CG2   . THR A 1 137 ? -13.838 -27.952 15.493 1.00 16.48 ? 137  THR A CG2   1 
ATOM   1140 N  N     . HIS A 1 138 ? -15.912 -25.364 14.982 1.00 15.59 ? 138  HIS A N     1 
ATOM   1141 C  CA    . HIS A 1 138 ? -16.688 -24.456 15.811 1.00 15.28 ? 138  HIS A CA    1 
ATOM   1142 C  C     . HIS A 1 138 ? -17.458 -25.310 16.808 1.00 15.15 ? 138  HIS A C     1 
ATOM   1143 O  O     . HIS A 1 138 ? -18.384 -26.041 16.434 1.00 16.54 ? 138  HIS A O     1 
ATOM   1144 C  CB    . HIS A 1 138 ? -17.631 -23.639 14.906 1.00 16.53 ? 138  HIS A CB    1 
ATOM   1145 C  CG    . HIS A 1 138 ? -18.500 -22.656 15.637 1.00 17.10 ? 138  HIS A CG    1 
ATOM   1146 N  ND1   . HIS A 1 138 ? -18.457 -21.300 15.390 1.00 17.54 ? 138  HIS A ND1   1 
ATOM   1147 C  CD2   . HIS A 1 138 ? -19.448 -22.835 16.589 1.00 16.45 ? 138  HIS A CD2   1 
ATOM   1148 C  CE1   . HIS A 1 138 ? -19.336 -20.686 16.164 1.00 16.68 ? 138  HIS A CE1   1 
ATOM   1149 N  NE2   . HIS A 1 138 ? -19.952 -21.595 16.899 1.00 17.17 ? 138  HIS A NE2   1 
ATOM   1150 N  N     . TYR A 1 139 ? -17.050 -25.240 18.074 1.00 14.00 ? 139  TYR A N     1 
ATOM   1151 C  CA    . TYR A 1 139 ? -17.746 -25.954 19.138 1.00 15.17 ? 139  TYR A CA    1 
ATOM   1152 C  C     . TYR A 1 139 ? -18.808 -25.061 19.765 1.00 15.30 ? 139  TYR A C     1 
ATOM   1153 O  O     . TYR A 1 139 ? -18.537 -23.899 20.107 1.00 16.69 ? 139  TYR A O     1 
ATOM   1154 C  CB    . TYR A 1 139 ? -16.769 -26.438 20.217 1.00 14.44 ? 139  TYR A CB    1 
ATOM   1155 C  CG    . TYR A 1 139 ? -17.469 -27.042 21.421 1.00 15.60 ? 139  TYR A CG    1 
ATOM   1156 C  CD1   . TYR A 1 139 ? -17.731 -26.272 22.557 1.00 16.78 ? 139  TYR A CD1   1 
ATOM   1157 C  CD2   . TYR A 1 139 ? -17.880 -28.378 21.422 1.00 17.54 ? 139  TYR A CD2   1 
ATOM   1158 C  CE1   . TYR A 1 139 ? -18.377 -26.814 23.669 1.00 16.52 ? 139  TYR A CE1   1 
ATOM   1159 C  CE2   . TYR A 1 139 ? -18.530 -28.930 22.532 1.00 18.46 ? 139  TYR A CE2   1 
ATOM   1160 C  CZ    . TYR A 1 139 ? -18.775 -28.139 23.646 1.00 19.13 ? 139  TYR A CZ    1 
ATOM   1161 O  OH    . TYR A 1 139 ? -19.410 -28.682 24.745 1.00 22.27 ? 139  TYR A OH    1 
ATOM   1162 N  N     . ASP A 1 140 ? -20.004 -25.617 19.940 1.00 15.11 ? 140  ASP A N     1 
ATOM   1163 C  CA    . ASP A 1 140 ? -21.130 -24.895 20.518 1.00 15.49 ? 140  ASP A CA    1 
ATOM   1164 C  C     . ASP A 1 140 ? -21.502 -25.531 21.855 1.00 15.74 ? 140  ASP A C     1 
ATOM   1165 O  O     . ASP A 1 140 ? -21.803 -26.716 21.904 1.00 17.10 ? 140  ASP A O     1 
ATOM   1166 C  CB    . ASP A 1 140 ? -22.314 -24.950 19.556 1.00 16.28 ? 140  ASP A CB    1 
ATOM   1167 C  CG    . ASP A 1 140 ? -23.519 -24.196 20.067 1.00 17.67 ? 140  ASP A CG    1 
ATOM   1168 O  OD1   . ASP A 1 140 ? -24.188 -24.685 21.005 1.00 19.28 ? 140  ASP A OD1   1 
ATOM   1169 O  OD2   . ASP A 1 140 ? -23.814 -23.124 19.505 1.00 19.61 ? 140  ASP A OD2   1 
ATOM   1170 N  N     . SER A 1 141 ? -21.488 -24.741 22.926 1.00 16.02 ? 141  SER A N     1 
ATOM   1171 C  CA    . SER A 1 141 ? -21.678 -25.280 24.278 1.00 17.32 ? 141  SER A CA    1 
ATOM   1172 C  C     . SER A 1 141 ? -23.108 -25.741 24.571 1.00 18.36 ? 141  SER A C     1 
ATOM   1173 O  O     . SER A 1 141 ? -23.324 -26.564 25.466 1.00 19.90 ? 141  SER A O     1 
ATOM   1174 C  CB    . SER A 1 141 ? -21.245 -24.259 25.335 1.00 18.67 ? 141  SER A CB    1 
ATOM   1175 O  OG    . SER A 1 141 ? -22.161 -23.174 25.378 1.00 18.12 ? 141  SER A OG    1 
ATOM   1176 N  N     . ILE A 1 142 ? -24.080 -25.205 23.837 1.00 18.38 ? 142  ILE A N     1 
ATOM   1177 C  CA    . ILE A 1 142 ? -25.480 -25.598 24.029 1.00 19.58 ? 142  ILE A CA    1 
ATOM   1178 C  C     . ILE A 1 142 ? -25.770 -26.941 23.348 1.00 20.49 ? 142  ILE A C     1 
ATOM   1179 O  O     . ILE A 1 142 ? -26.370 -27.836 23.954 1.00 20.54 ? 142  ILE A O     1 
ATOM   1180 C  CB    . ILE A 1 142 ? -26.467 -24.481 23.607 1.00 20.27 ? 142  ILE A CB    1 
ATOM   1181 C  CG1   . ILE A 1 142 ? -26.331 -23.282 24.561 1.00 21.05 ? 142  ILE A CG1   1 
ATOM   1182 C  CG2   . ILE A 1 142 ? -27.921 -24.990 23.607 1.00 21.74 ? 142  ILE A CG2   1 
ATOM   1183 C  CD1   . ILE A 1 142 ? -27.169 -22.091 24.179 1.00 18.69 ? 142  ILE A CD1   1 
ATOM   1184 N  N     . ASP A 1 143 ? -25.308 -27.091 22.110 1.00 20.04 ? 143  ASP A N     1 
ATOM   1185 C  CA    . ASP A 1 143 ? -25.423 -28.363 21.400 1.00 21.67 ? 143  ASP A CA    1 
ATOM   1186 C  C     . ASP A 1 143 ? -24.450 -29.409 21.926 1.00 21.72 ? 143  ASP A C     1 
ATOM   1187 O  O     . ASP A 1 143 ? -24.711 -30.613 21.816 1.00 21.23 ? 143  ASP A O     1 
ATOM   1188 C  CB    . ASP A 1 143 ? -25.169 -28.161 19.913 1.00 24.21 ? 143  ASP A CB    1 
ATOM   1189 C  CG    . ASP A 1 143 ? -26.198 -27.265 19.265 1.00 26.99 ? 143  ASP A CG    1 
ATOM   1190 O  OD1   . ASP A 1 143 ? -27.263 -27.034 19.876 1.00 26.31 ? 143  ASP A OD1   1 
ATOM   1191 O  OD2   . ASP A 1 143 ? -25.933 -26.792 18.143 1.00 28.88 ? 143  ASP A OD2   1 
ATOM   1192 N  N     . ASP A 1 144 ? -23.331 -28.941 22.489 1.00 18.87 ? 144  ASP A N     1 
ATOM   1193 C  CA    . ASP A 1 144 ? -22.211 -29.802 22.866 1.00 19.23 ? 144  ASP A CA    1 
ATOM   1194 C  C     . ASP A 1 144 ? -21.732 -30.587 21.640 1.00 20.13 ? 144  ASP A C     1 
ATOM   1195 O  O     . ASP A 1 144 ? -21.541 -31.808 21.694 1.00 21.18 ? 144  ASP A O     1 
ATOM   1196 C  CB    . ASP A 1 144 ? -22.612 -30.737 24.019 1.00 19.84 ? 144  ASP A CB    1 
ATOM   1197 C  CG    . ASP A 1 144 ? -21.438 -31.495 24.606 1.00 20.86 ? 144  ASP A CG    1 
ATOM   1198 O  OD1   . ASP A 1 144 ? -20.291 -31.003 24.552 1.00 23.58 ? 144  ASP A OD1   1 
ATOM   1199 O  OD2   . ASP A 1 144 ? -21.675 -32.601 25.138 1.00 22.89 ? 144  ASP A OD2   1 
ATOM   1200 N  N     . ARG A 1 145 ? -21.554 -29.875 20.527 1.00 18.14 ? 145  ARG A N     1 
ATOM   1201 C  CA    . ARG A 1 145 ? -21.091 -30.490 19.283 1.00 18.29 ? 145  ARG A CA    1 
ATOM   1202 C  C     . ARG A 1 145 ? -19.964 -29.686 18.656 1.00 18.40 ? 145  ARG A C     1 
ATOM   1203 O  O     . ARG A 1 145 ? -19.918 -28.463 18.801 1.00 18.69 ? 145  ARG A O     1 
ATOM   1204 C  CB    . ARG A 1 145 ? -22.244 -30.638 18.280 1.00 19.00 ? 145  ARG A CB    1 
ATOM   1205 C  CG    . ARG A 1 145 ? -23.376 -31.570 18.736 1.00 17.88 ? 145  ARG A CG    1 
ATOM   1206 C  CD    . ARG A 1 145 ? -22.947 -33.032 18.760 1.00 22.54 ? 145  ARG A CD    1 
ATOM   1207 N  NE    . ARG A 1 145 ? -24.041 -33.926 19.149 1.00 23.56 ? 145  ARG A NE    1 
ATOM   1208 C  CZ    . ARG A 1 145 ? -24.318 -34.282 20.401 1.00 27.30 ? 145  ARG A CZ    1 
ATOM   1209 N  NH1   . ARG A 1 145 ? -23.594 -33.817 21.415 1.00 24.33 ? 145  ARG A NH1   1 
ATOM   1210 N  NH2   . ARG A 1 145 ? -25.330 -35.108 20.646 1.00 30.19 ? 145  ARG A NH2   1 
ATOM   1211 N  N     . PHE A 1 146 ? -19.057 -30.392 17.979 1.00 16.25 ? 146  PHE A N     1 
ATOM   1212 C  CA    . PHE A 1 146 ? -17.975 -29.783 17.206 1.00 16.35 ? 146  PHE A CA    1 
ATOM   1213 C  C     . PHE A 1 146 ? -18.412 -29.786 15.753 1.00 16.86 ? 146  PHE A C     1 
ATOM   1214 O  O     . PHE A 1 146 ? -18.545 -30.848 15.144 1.00 18.70 ? 146  PHE A O     1 
ATOM   1215 C  CB    . PHE A 1 146 ? -16.688 -30.607 17.327 1.00 14.92 ? 146  PHE A CB    1 
ATOM   1216 C  CG    . PHE A 1 146 ? -16.119 -30.661 18.713 1.00 17.14 ? 146  PHE A CG    1 
ATOM   1217 C  CD1   . PHE A 1 146 ? -16.633 -31.541 19.658 1.00 18.10 ? 146  PHE A CD1   1 
ATOM   1218 C  CD2   . PHE A 1 146 ? -15.052 -29.840 19.067 1.00 16.95 ? 146  PHE A CD2   1 
ATOM   1219 C  CE1   . PHE A 1 146 ? -16.103 -31.598 20.938 1.00 17.69 ? 146  PHE A CE1   1 
ATOM   1220 C  CE2   . PHE A 1 146 ? -14.515 -29.883 20.351 1.00 19.00 ? 146  PHE A CE2   1 
ATOM   1221 C  CZ    . PHE A 1 146 ? -15.035 -30.766 21.285 1.00 18.05 ? 146  PHE A CZ    1 
ATOM   1222 N  N     . TYR A 1 147 ? -18.663 -28.596 15.219 1.00 16.56 ? 147  TYR A N     1 
ATOM   1223 C  CA    . TYR A 1 147 ? -19.080 -28.432 13.837 1.00 18.33 ? 147  TYR A CA    1 
ATOM   1224 C  C     . TYR A 1 147 ? -17.852 -28.179 12.984 1.00 18.08 ? 147  TYR A C     1 
ATOM   1225 O  O     . TYR A 1 147 ? -17.174 -27.163 13.140 1.00 19.12 ? 147  TYR A O     1 
ATOM   1226 C  CB    . TYR A 1 147 ? -20.094 -27.289 13.713 1.00 19.26 ? 147  TYR A CB    1 
ATOM   1227 C  CG    . TYR A 1 147 ? -21.411 -27.589 14.400 1.00 17.57 ? 147  TYR A CG    1 
ATOM   1228 C  CD1   . TYR A 1 147 ? -21.623 -27.252 15.743 1.00 17.99 ? 147  TYR A CD1   1 
ATOM   1229 C  CD2   . TYR A 1 147 ? -22.441 -28.231 13.712 1.00 20.20 ? 147  TYR A CD2   1 
ATOM   1230 C  CE1   . TYR A 1 147 ? -22.844 -27.544 16.378 1.00 16.94 ? 147  TYR A CE1   1 
ATOM   1231 C  CE2   . TYR A 1 147 ? -23.654 -28.524 14.338 1.00 20.76 ? 147  TYR A CE2   1 
ATOM   1232 C  CZ    . TYR A 1 147 ? -23.849 -28.180 15.660 1.00 19.34 ? 147  TYR A CZ    1 
ATOM   1233 O  OH    . TYR A 1 147 ? -25.059 -28.478 16.262 1.00 19.57 ? 147  TYR A OH    1 
ATOM   1234 N  N     . VAL A 1 148 ? -17.566 -29.120 12.090 1.00 17.88 ? 148  VAL A N     1 
ATOM   1235 C  CA    . VAL A 1 148 ? -16.343 -29.086 11.292 1.00 17.00 ? 148  VAL A CA    1 
ATOM   1236 C  C     . VAL A 1 148 ? -16.679 -28.747 9.848  1.00 18.03 ? 148  VAL A C     1 
ATOM   1237 O  O     . VAL A 1 148 ? -17.421 -29.481 9.190  1.00 19.98 ? 148  VAL A O     1 
ATOM   1238 C  CB    . VAL A 1 148 ? -15.574 -30.431 11.367 1.00 18.73 ? 148  VAL A CB    1 
ATOM   1239 C  CG1   . VAL A 1 148 ? -14.308 -30.392 10.491 1.00 18.02 ? 148  VAL A CG1   1 
ATOM   1240 C  CG2   . VAL A 1 148 ? -15.214 -30.755 12.817 1.00 18.35 ? 148  VAL A CG2   1 
ATOM   1241 N  N     . PHE A 1 149 ? -16.134 -27.628 9.374  1.00 17.32 ? 149  PHE A N     1 
ATOM   1242 C  CA    . PHE A 1 149 ? -16.322 -27.166 7.999  1.00 18.61 ? 149  PHE A CA    1 
ATOM   1243 C  C     . PHE A 1 149 ? -15.010 -27.347 7.243  1.00 18.32 ? 149  PHE A C     1 
ATOM   1244 O  O     . PHE A 1 149 ? -14.015 -26.688 7.542  1.00 18.13 ? 149  PHE A O     1 
ATOM   1245 C  CB    . PHE A 1 149 ? -16.739 -25.683 7.970  1.00 19.25 ? 149  PHE A CB    1 
ATOM   1246 C  CG    . PHE A 1 149 ? -18.000 -25.375 8.743  1.00 18.31 ? 149  PHE A CG    1 
ATOM   1247 C  CD1   . PHE A 1 149 ? -17.989 -25.304 10.135 1.00 18.42 ? 149  PHE A CD1   1 
ATOM   1248 C  CD2   . PHE A 1 149 ? -19.190 -25.109 8.067  1.00 21.95 ? 149  PHE A CD2   1 
ATOM   1249 C  CE1   . PHE A 1 149 ? -19.148 -25.010 10.850 1.00 19.32 ? 149  PHE A CE1   1 
ATOM   1250 C  CE2   . PHE A 1 149 ? -20.360 -24.809 8.768  1.00 21.38 ? 149  PHE A CE2   1 
ATOM   1251 C  CZ    . PHE A 1 149 ? -20.341 -24.765 10.163 1.00 21.26 ? 149  PHE A CZ    1 
ATOM   1252 N  N     . ASP A 1 150 ? -15.018 -28.237 6.254  1.00 18.10 ? 150  ASP A N     1 
ATOM   1253 C  CA    . ASP A 1 150 ? -13.790 -28.719 5.617  1.00 18.28 ? 150  ASP A CA    1 
ATOM   1254 C  C     . ASP A 1 150 ? -13.785 -28.413 4.122  1.00 19.34 ? 150  ASP A C     1 
ATOM   1255 O  O     . ASP A 1 150 ? -14.640 -28.902 3.380  1.00 21.46 ? 150  ASP A O     1 
ATOM   1256 C  CB    . ASP A 1 150 ? -13.672 -30.235 5.868  1.00 17.42 ? 150  ASP A CB    1 
ATOM   1257 C  CG    . ASP A 1 150 ? -12.414 -30.857 5.268  1.00 19.69 ? 150  ASP A CG    1 
ATOM   1258 O  OD1   . ASP A 1 150 ? -11.500 -30.128 4.818  1.00 20.91 ? 150  ASP A OD1   1 
ATOM   1259 O  OD2   . ASP A 1 150 ? -12.344 -32.107 5.266  1.00 19.76 ? 150  ASP A OD2   1 
ATOM   1260 N  N     . LEU A 1 151 ? -12.824 -27.602 3.682  1.00 17.97 ? 151  LEU A N     1 
ATOM   1261 C  CA    . LEU A 1 151 ? -12.719 -27.253 2.265  1.00 18.72 ? 151  LEU A CA    1 
ATOM   1262 C  C     . LEU A 1 151 ? -11.939 -28.320 1.505  1.00 20.90 ? 151  LEU A C     1 
ATOM   1263 O  O     . LEU A 1 151 ? -10.739 -28.507 1.728  1.00 21.92 ? 151  LEU A O     1 
ATOM   1264 C  CB    . LEU A 1 151 ? -12.071 -25.875 2.076  1.00 19.19 ? 151  LEU A CB    1 
ATOM   1265 C  CG    . LEU A 1 151 ? -11.897 -25.407 0.627  1.00 20.15 ? 151  LEU A CG    1 
ATOM   1266 C  CD1   . LEU A 1 151 ? -13.249 -25.277 -0.038 1.00 21.38 ? 151  LEU A CD1   1 
ATOM   1267 C  CD2   . LEU A 1 151 ? -11.133 -24.087 0.542  1.00 20.55 ? 151  LEU A CD2   1 
ATOM   1268 N  N     . LEU A 1 152 ? -12.629 -29.010 0.603  1.00 20.17 ? 152  LEU A N     1 
ATOM   1269 C  CA    . LEU A 1 152 ? -12.007 -30.091 -0.183 1.00 24.51 ? 152  LEU A CA    1 
ATOM   1270 C  C     . LEU A 1 152 ? -11.304 -29.611 -1.458 1.00 24.36 ? 152  LEU A C     1 
ATOM   1271 O  O     . LEU A 1 152 ? -10.382 -30.267 -1.942 1.00 23.96 ? 152  LEU A O     1 
ATOM   1272 C  CB    . LEU A 1 152 ? -13.026 -31.188 -0.522 1.00 24.83 ? 152  LEU A CB    1 
ATOM   1273 C  CG    . LEU A 1 152 ? -13.804 -31.898 0.591  1.00 24.14 ? 152  LEU A CG    1 
ATOM   1274 C  CD1   . LEU A 1 152 ? -14.587 -33.057 0.004  1.00 29.30 ? 152  LEU A CD1   1 
ATOM   1275 C  CD2   . LEU A 1 152 ? -12.914 -32.396 1.740  1.00 26.87 ? 152  LEU A CD2   1 
ATOM   1276 N  N     . ASN A 1 153 ? -11.742 -28.475 -1.997 1.00 24.48 ? 153  ASN A N     1 
ATOM   1277 C  CA    . ASN A 1 153 ? -11.143 -27.914 -3.207 1.00 26.32 ? 153  ASN A CA    1 
ATOM   1278 C  C     . ASN A 1 153 ? -10.630 -26.491 -3.028 1.00 26.12 ? 153  ASN A C     1 
ATOM   1279 O  O     . ASN A 1 153 ? -11.377 -25.590 -2.641 1.00 25.61 ? 153  ASN A O     1 
ATOM   1280 C  CB    . ASN A 1 153 ? -12.127 -27.973 -4.377 1.00 28.60 ? 153  ASN A CB    1 
ATOM   1281 C  CG    . ASN A 1 153 ? -12.575 -29.385 -4.686 1.00 34.07 ? 153  ASN A CG    1 
ATOM   1282 O  OD1   . ASN A 1 153 ? -11.772 -30.234 -5.075 1.00 38.45 ? 153  ASN A OD1   1 
ATOM   1283 N  ND2   . ASN A 1 153 ? -13.861 -29.647 -4.509 1.00 36.47 ? 153  ASN A ND2   1 
ATOM   1284 N  N     . SER A 1 154 ? -9.351  -26.304 -3.342 1.00 26.03 ? 154  SER A N     1 
ATOM   1285 C  CA    . SER A 1 154 ? -8.642  -25.054 -3.115 1.00 27.37 ? 154  SER A CA    1 
ATOM   1286 C  C     . SER A 1 154 ? -7.614  -24.826 -4.223 1.00 28.06 ? 154  SER A C     1 
ATOM   1287 O  O     . SER A 1 154 ? -7.167  -25.787 -4.849 1.00 29.60 ? 154  SER A O     1 
ATOM   1288 C  CB    . SER A 1 154 ? -7.925  -25.122 -1.763 1.00 27.26 ? 154  SER A CB    1 
ATOM   1289 O  OG    . SER A 1 154 ? -7.001  -24.061 -1.606 1.00 27.90 ? 154  SER A OG    1 
ATOM   1290 N  N     . PRO A 1 155 ? -7.226  -23.555 -4.468 1.00 29.30 ? 155  PRO A N     1 
ATOM   1291 C  CA    . PRO A 1 155 ? -6.100  -23.311 -5.384 1.00 30.04 ? 155  PRO A CA    1 
ATOM   1292 C  C     . PRO A 1 155 ? -4.782  -23.916 -4.880 1.00 30.54 ? 155  PRO A C     1 
ATOM   1293 O  O     . PRO A 1 155 ? -3.844  -24.086 -5.661 1.00 30.51 ? 155  PRO A O     1 
ATOM   1294 C  CB    . PRO A 1 155 ? -6.008  -21.776 -5.437 1.00 31.20 ? 155  PRO A CB    1 
ATOM   1295 C  CG    . PRO A 1 155 ? -6.764  -21.295 -4.232 1.00 30.10 ? 155  PRO A CG    1 
ATOM   1296 C  CD    . PRO A 1 155 ? -7.856  -22.293 -4.035 1.00 28.28 ? 155  PRO A CD    1 
ATOM   1297 N  N     . TYR A 1 156 ? -4.718  -24.247 -3.590 1.00 29.43 ? 156  TYR A N     1 
ATOM   1298 C  CA    . TYR A 1 156 ? -3.528  -24.876 -3.019 1.00 29.94 ? 156  TYR A CA    1 
ATOM   1299 C  C     . TYR A 1 156 ? -3.663  -26.398 -2.917 1.00 30.56 ? 156  TYR A C     1 
ATOM   1300 O  O     . TYR A 1 156 ? -2.873  -27.060 -2.231 1.00 30.27 ? 156  TYR A O     1 
ATOM   1301 C  CB    . TYR A 1 156 ? -3.177  -24.247 -1.663 1.00 29.94 ? 156  TYR A CB    1 
ATOM   1302 C  CG    . TYR A 1 156 ? -3.009  -22.746 -1.734 1.00 31.94 ? 156  TYR A CG    1 
ATOM   1303 C  CD1   . TYR A 1 156 ? -2.302  -22.155 -2.785 1.00 34.82 ? 156  TYR A CD1   1 
ATOM   1304 C  CD2   . TYR A 1 156 ? -3.555  -21.916 -0.761 1.00 29.96 ? 156  TYR A CD2   1 
ATOM   1305 C  CE1   . TYR A 1 156 ? -2.151  -20.780 -2.866 1.00 36.22 ? 156  TYR A CE1   1 
ATOM   1306 C  CE2   . TYR A 1 156 ? -3.402  -20.536 -0.828 1.00 32.61 ? 156  TYR A CE2   1 
ATOM   1307 C  CZ    . TYR A 1 156 ? -2.702  -19.979 -1.886 1.00 34.95 ? 156  TYR A CZ    1 
ATOM   1308 O  OH    . TYR A 1 156 ? -2.546  -18.619 -1.970 1.00 36.16 ? 156  TYR A OH    1 
ATOM   1309 N  N     . GLY A 1 157 ? -4.666  -26.944 -3.605 1.00 29.74 ? 157  GLY A N     1 
ATOM   1310 C  CA    . GLY A 1 157 ? -4.813  -28.390 -3.728 1.00 31.49 ? 157  GLY A CA    1 
ATOM   1311 C  C     . GLY A 1 157 ? -6.203  -28.922 -3.450 1.00 30.73 ? 157  GLY A C     1 
ATOM   1312 O  O     . GLY A 1 157 ? -6.931  -28.393 -2.604 1.00 30.14 ? 157  GLY A O     1 
ATOM   1313 N  N     . ASN A 1 158 ? -6.565  -29.971 -4.182 1.00 30.29 ? 158  ASN A N     1 
ATOM   1314 C  CA    . ASN A 1 158 ? -7.808  -30.697 -3.958 1.00 29.19 ? 158  ASN A CA    1 
ATOM   1315 C  C     . ASN A 1 158 ? -7.547  -31.953 -3.146 1.00 28.44 ? 158  ASN A C     1 
ATOM   1316 O  O     . ASN A 1 158 ? -6.611  -32.706 -3.437 1.00 29.78 ? 158  ASN A O     1 
ATOM   1317 C  CB    . ASN A 1 158 ? -8.465  -31.055 -5.294 1.00 29.02 ? 158  ASN A CB    1 
ATOM   1318 C  CG    . ASN A 1 158 ? -8.820  -29.834 -6.109 1.00 29.95 ? 158  ASN A CG    1 
ATOM   1319 O  OD1   . ASN A 1 158 ? -8.945  -28.730 -5.578 1.00 28.97 ? 158  ASN A OD1   1 
ATOM   1320 N  ND2   . ASN A 1 158 ? -8.980  -30.023 -7.414 1.00 34.71 ? 158  ASN A ND2   1 
ATOM   1321 N  N     . VAL A 1 159 ? -8.377  -32.175 -2.130 1.00 26.11 ? 159  VAL A N     1 
ATOM   1322 C  CA    . VAL A 1 159 ? -8.168  -33.278 -1.190 1.00 25.24 ? 159  VAL A CA    1 
ATOM   1323 C  C     . VAL A 1 159 ? -9.404  -34.154 -1.013 1.00 26.26 ? 159  VAL A C     1 
ATOM   1324 O  O     . VAL A 1 159 ? -10.503 -33.782 -1.419 1.00 26.78 ? 159  VAL A O     1 
ATOM   1325 C  CB    . VAL A 1 159 ? -7.709  -32.759 0.200  1.00 23.85 ? 159  VAL A CB    1 
ATOM   1326 C  CG1   . VAL A 1 159 ? -6.359  -32.058 0.091  1.00 23.16 ? 159  VAL A CG1   1 
ATOM   1327 C  CG2   . VAL A 1 159 ? -8.766  -31.837 0.813  1.00 21.60 ? 159  VAL A CG2   1 
ATOM   1328 N  N     . GLU A 1 160 ? -9.209  -35.316 -0.394 1.00 26.63 ? 160  GLU A N     1 
ATOM   1329 C  CA    . GLU A 1 160 ? -10.305 -36.223 -0.082 1.00 28.20 ? 160  GLU A CA    1 
ATOM   1330 C  C     . GLU A 1 160 ? -10.921 -35.878 1.268  1.00 25.94 ? 160  GLU A C     1 
ATOM   1331 O  O     . GLU A 1 160 ? -10.308 -35.171 2.067  1.00 25.34 ? 160  GLU A O     1 
ATOM   1332 C  CB    . GLU A 1 160 ? -9.817  -37.674 -0.089 1.00 29.61 ? 160  GLU A CB    1 
ATOM   1333 C  CG    . GLU A 1 160 ? -9.370  -38.177 -1.469 1.00 36.15 ? 160  GLU A CG    1 
ATOM   1334 C  CD    . GLU A 1 160 ? -10.424 -37.971 -2.554 1.00 41.54 ? 160  GLU A CD    1 
ATOM   1335 O  OE1   . GLU A 1 160 ? -11.613 -38.285 -2.318 1.00 43.48 ? 160  GLU A OE1   1 
ATOM   1336 O  OE2   . GLU A 1 160 ? -10.060 -37.497 -3.650 1.00 44.33 ? 160  GLU A OE2   1 
ATOM   1337 N  N     . GLU A 1 161 ? -12.130 -36.378 1.513  1.00 25.34 ? 161  GLU A N     1 
ATOM   1338 C  CA    . GLU A 1 161 ? -12.825 -36.160 2.782  1.00 25.12 ? 161  GLU A CA    1 
ATOM   1339 C  C     . GLU A 1 161 ? -12.028 -36.690 3.969  1.00 24.08 ? 161  GLU A C     1 
ATOM   1340 O  O     . GLU A 1 161 ? -11.334 -37.701 3.869  1.00 24.41 ? 161  GLU A O     1 
ATOM   1341 C  CB    . GLU A 1 161 ? -14.196 -36.837 2.772  1.00 27.38 ? 161  GLU A CB    1 
ATOM   1342 C  CG    . GLU A 1 161 ? -15.299 -36.018 2.132  1.00 30.28 ? 161  GLU A CG    1 
ATOM   1343 C  CD    . GLU A 1 161 ? -16.674 -36.657 2.279  1.00 34.32 ? 161  GLU A CD    1 
ATOM   1344 O  OE1   . GLU A 1 161 ? -16.938 -37.318 3.309  1.00 36.76 ? 161  GLU A OE1   1 
ATOM   1345 O  OE2   . GLU A 1 161 ? -17.498 -36.492 1.358  1.00 37.07 ? 161  GLU A OE2   1 
ATOM   1346 N  N     . TRP A 1 162 ? -12.130 -35.981 5.085  1.00 22.62 ? 162  TRP A N     1 
ATOM   1347 C  CA    . TRP A 1 162 ? -11.583 -36.434 6.355  1.00 22.22 ? 162  TRP A CA    1 
ATOM   1348 C  C     . TRP A 1 162 ? -12.339 -37.669 6.840  1.00 23.70 ? 162  TRP A C     1 
ATOM   1349 O  O     . TRP A 1 162 ? -13.558 -37.771 6.664  1.00 24.92 ? 162  TRP A O     1 
ATOM   1350 C  CB    . TRP A 1 162 ? -11.686 -35.293 7.363  1.00 20.58 ? 162  TRP A CB    1 
ATOM   1351 C  CG    . TRP A 1 162 ? -11.390 -35.628 8.788  1.00 21.64 ? 162  TRP A CG    1 
ATOM   1352 C  CD1   . TRP A 1 162 ? -10.162 -35.704 9.376  1.00 20.27 ? 162  TRP A CD1   1 
ATOM   1353 C  CD2   . TRP A 1 162 ? -12.349 -35.862 9.821  1.00 20.66 ? 162  TRP A CD2   1 
ATOM   1354 N  NE1   . TRP A 1 162 ? -10.295 -35.996 10.716 1.00 19.25 ? 162  TRP A NE1   1 
ATOM   1355 C  CE2   . TRP A 1 162 ? -11.629 -36.101 11.014 1.00 20.11 ? 162  TRP A CE2   1 
ATOM   1356 C  CE3   . TRP A 1 162 ? -13.752 -35.909 9.853  1.00 21.57 ? 162  TRP A CE3   1 
ATOM   1357 C  CZ2   . TRP A 1 162 ? -12.263 -36.375 12.230 1.00 19.36 ? 162  TRP A CZ2   1 
ATOM   1358 C  CZ3   . TRP A 1 162 ? -14.382 -36.186 11.058 1.00 21.58 ? 162  TRP A CZ3   1 
ATOM   1359 C  CH2   . TRP A 1 162 ? -13.636 -36.411 12.236 1.00 19.45 ? 162  TRP A CH2   1 
ATOM   1360 N  N     . SER A 1 163 ? -11.605 -38.602 7.443  1.00 23.19 ? 163  SER A N     1 
ATOM   1361 C  CA    . SER A 1 163 ? -12.165 -39.866 7.913  1.00 24.08 ? 163  SER A CA    1 
ATOM   1362 C  C     . SER A 1 163 ? -12.210 -39.895 9.432  1.00 24.50 ? 163  SER A C     1 
ATOM   1363 O  O     . SER A 1 163 ? -11.168 -39.907 10.087 1.00 23.32 ? 163  SER A O     1 
ATOM   1364 C  CB    . SER A 1 163 ? -11.333 -41.043 7.395  1.00 24.40 ? 163  SER A CB    1 
ATOM   1365 O  OG    . SER A 1 163 ? -11.643 -42.245 8.087  1.00 27.19 ? 163  SER A OG    1 
ATOM   1366 N  N     . ILE A 1 164 ? -13.419 -39.910 9.987  1.00 24.89 ? 164  ILE A N     1 
ATOM   1367 C  CA    . ILE A 1 164 ? -13.589 -40.016 11.442 1.00 24.88 ? 164  ILE A CA    1 
ATOM   1368 C  C     . ILE A 1 164 ? -13.031 -41.341 11.997 1.00 26.69 ? 164  ILE A C     1 
ATOM   1369 O  O     . ILE A 1 164 ? -12.586 -41.411 13.147 1.00 25.53 ? 164  ILE A O     1 
ATOM   1370 C  CB    . ILE A 1 164 ? -15.069 -39.778 11.874 1.00 25.40 ? 164  ILE A CB    1 
ATOM   1371 C  CG1   . ILE A 1 164 ? -15.143 -39.437 13.370 1.00 26.39 ? 164  ILE A CG1   1 
ATOM   1372 C  CG2   . ILE A 1 164 ? -15.976 -40.971 11.486 1.00 26.05 ? 164  ILE A CG2   1 
ATOM   1373 C  CD1   . ILE A 1 164 ? -16.404 -38.713 13.790 1.00 30.53 ? 164  ILE A CD1   1 
ATOM   1374 N  N     . GLU A 1 165 ? -13.037 -42.377 11.161 1.00 27.18 ? 165  GLU A N     1 
ATOM   1375 C  CA    . GLU A 1 165 ? -12.545 -43.690 11.548 1.00 27.52 ? 165  GLU A CA    1 
ATOM   1376 C  C     . GLU A 1 165 ? -11.030 -43.673 11.769 1.00 25.50 ? 165  GLU A C     1 
ATOM   1377 O  O     . GLU A 1 165 ? -10.538 -44.168 12.787 1.00 24.13 ? 165  GLU A O     1 
ATOM   1378 C  CB    . GLU A 1 165 ? -12.946 -44.747 10.503 1.00 30.50 ? 165  GLU A CB    1 
ATOM   1379 C  CG    . GLU A 1 165 ? -14.466 -44.903 10.307 1.00 35.81 ? 165  GLU A CG    1 
ATOM   1380 C  CD    . GLU A 1 165 ? -15.066 -43.931 9.285  1.00 40.95 ? 165  GLU A CD    1 
ATOM   1381 O  OE1   . GLU A 1 165 ? -14.347 -43.046 8.767  1.00 41.63 ? 165  GLU A OE1   1 
ATOM   1382 O  OE2   . GLU A 1 165 ? -16.276 -44.056 8.994  1.00 44.57 ? 165  GLU A OE2   1 
ATOM   1383 N  N     . ILE A 1 166 ? -10.298 -43.085 10.824 1.00 24.96 ? 166  ILE A N     1 
ATOM   1384 C  CA    . ILE A 1 166 ? -8.846  -42.929 10.954 1.00 23.91 ? 166  ILE A CA    1 
ATOM   1385 C  C     . ILE A 1 166 ? -8.500  -41.945 12.081 1.00 23.38 ? 166  ILE A C     1 
ATOM   1386 O  O     . ILE A 1 166 ? -7.543  -42.157 12.835 1.00 22.26 ? 166  ILE A O     1 
ATOM   1387 C  CB    . ILE A 1 166 ? -8.191  -42.522 9.602  1.00 23.44 ? 166  ILE A CB    1 
ATOM   1388 C  CG1   . ILE A 1 166 ? -8.309  -43.673 8.593  1.00 25.00 ? 166  ILE A CG1   1 
ATOM   1389 C  CG2   . ILE A 1 166 ? -6.725  -42.119 9.800  1.00 24.67 ? 166  ILE A CG2   1 
ATOM   1390 C  CD1   . ILE A 1 166 ? -7.876  -43.317 7.173  1.00 25.01 ? 166  ILE A CD1   1 
ATOM   1391 N  N     . ALA A 1 167 ? -9.303  -40.892 12.210 1.00 22.07 ? 167  ALA A N     1 
ATOM   1392 C  CA    . ALA A 1 167 ? -9.112  -39.889 13.258 1.00 21.57 ? 167  ALA A CA    1 
ATOM   1393 C  C     . ALA A 1 167 ? -9.095  -40.497 14.663 1.00 22.72 ? 167  ALA A C     1 
ATOM   1394 O  O     . ALA A 1 167 ? -8.280  -40.106 15.504 1.00 21.32 ? 167  ALA A O     1 
ATOM   1395 C  CB    . ALA A 1 167 ? -10.180 -38.822 13.159 1.00 22.32 ? 167  ALA A CB    1 
ATOM   1396 N  N     . ALA A 1 168 ? -9.989  -41.458 14.888 1.00 22.71 ? 168  ALA A N     1 
ATOM   1397 C  CA    . ALA A 1 168 ? -10.158 -42.115 16.185 1.00 26.03 ? 168  ALA A CA    1 
ATOM   1398 C  C     . ALA A 1 168 ? -9.007  -43.049 16.556 1.00 26.91 ? 168  ALA A C     1 
ATOM   1399 O  O     . ALA A 1 168 ? -8.717  -43.240 17.740 1.00 25.74 ? 168  ALA A O     1 
ATOM   1400 C  CB    . ALA A 1 168 ? -11.484 -42.873 16.217 1.00 25.15 ? 168  ALA A CB    1 
ATOM   1401 N  N     . LYS A 1 169 ? -8.362  -43.630 15.547 1.00 27.88 ? 169  LYS A N     1 
ATOM   1402 C  CA    . LYS A 1 169 ? -7.306  -44.623 15.763 1.00 27.95 ? 169  LYS A CA    1 
ATOM   1403 C  C     . LYS A 1 169 ? -6.083  -44.038 16.468 1.00 26.59 ? 169  LYS A C     1 
ATOM   1404 O  O     . LYS A 1 169 ? -5.806  -42.843 16.353 1.00 26.58 ? 169  LYS A O     1 
ATOM   1405 C  CB    . LYS A 1 169 ? -6.878  -45.242 14.431 1.00 30.00 ? 169  LYS A CB    1 
ATOM   1406 C  CG    . LYS A 1 169 ? -7.859  -46.249 13.851 1.00 34.74 ? 169  LYS A CG    1 
ATOM   1407 C  CD    . LYS A 1 169 ? -7.316  -46.867 12.565 1.00 41.01 ? 169  LYS A CD    1 
ATOM   1408 C  CE    . LYS A 1 169 ? -7.932  -48.236 12.289 1.00 45.17 ? 169  LYS A CE    1 
ATOM   1409 N  NZ    . LYS A 1 169 ? -9.415  -48.182 12.126 1.00 47.18 ? 169  LYS A NZ    1 
ATOM   1410 N  N     . LEU A 1 170 ? -5.356  -44.891 17.188 1.00 24.81 ? 170  LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 170 ? -4.087  -44.520 17.811 0.50 23.80 ? 170  LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 170 ? -3.101  -44.010 16.765 1.00 25.09 ? 170  LEU A C     1 
ATOM   1413 O  O     . LEU A 1 170 ? -3.133  -44.453 15.617 1.00 25.26 ? 170  LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 170 ? -3.477  -45.728 18.526 0.50 24.46 ? 170  LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 170 ? -4.227  -46.292 19.730 0.50 23.53 ? 170  LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 170 ? -3.618  -47.621 20.161 0.50 26.01 ? 170  LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 170 ? -4.213  -45.289 20.866 0.50 24.77 ? 170  LEU A CD2   1 
ATOM   1418 N  N     . GLN A 1 171 ? -2.214  -43.098 17.156 1.00 25.88 ? 171  GLN A N     1 
ATOM   1419 C  CA    . GLN A 1 171 ? -1.167  -42.649 16.239 1.00 27.89 ? 171  GLN A CA    1 
ATOM   1420 C  C     . GLN A 1 171 ? -0.309  -43.836 15.788 1.00 28.88 ? 171  GLN A C     1 
ATOM   1421 O  O     . GLN A 1 171 ? 0.257   -43.822 14.701 1.00 27.00 ? 171  GLN A O     1 
ATOM   1422 C  CB    . GLN A 1 171 ? -0.321  -41.525 16.844 1.00 30.14 ? 171  GLN A CB    1 
ATOM   1423 C  CG    . GLN A 1 171 ? -1.136  -40.270 17.186 1.00 34.29 ? 171  GLN A CG    1 
ATOM   1424 C  CD    . GLN A 1 171 ? -0.483  -38.964 16.745 1.00 40.01 ? 171  GLN A CD    1 
ATOM   1425 O  OE1   . GLN A 1 171 ? 0.743   -38.842 16.695 1.00 44.09 ? 171  GLN A OE1   1 
ATOM   1426 N  NE2   . GLN A 1 171 ? -1.314  -37.972 16.428 1.00 40.55 ? 171  GLN A NE2   1 
ATOM   1427 N  N     . GLU A 1 172 ? -0.266  -44.874 16.624 1.00 29.50 ? 172  GLU A N     1 
ATOM   1428 C  CA    . GLU A 1 172 ? 0.448   -46.115 16.324 1.00 31.03 ? 172  GLU A CA    1 
ATOM   1429 C  C     . GLU A 1 172 ? -0.296  -47.020 15.329 1.00 31.71 ? 172  GLU A C     1 
ATOM   1430 O  O     . GLU A 1 172 ? 0.261   -48.003 14.830 1.00 35.10 ? 172  GLU A O     1 
ATOM   1431 C  CB    . GLU A 1 172 ? 0.753   -46.865 17.631 1.00 31.14 ? 172  GLU A CB    1 
ATOM   1432 C  CG    . GLU A 1 172 ? 1.648   -46.092 18.607 1.00 32.55 ? 172  GLU A CG    1 
ATOM   1433 C  CD    . GLU A 1 172 ? 0.884   -45.230 19.610 1.00 36.84 ? 172  GLU A CD    1 
ATOM   1434 O  OE1   . GLU A 1 172 ? 1.494   -44.822 20.619 1.00 39.90 ? 172  GLU A OE1   1 
ATOM   1435 O  OE2   . GLU A 1 172 ? -0.318  -44.955 19.405 1.00 37.19 ? 172  GLU A OE2   1 
ATOM   1436 N  N     . GLN A 1 173 ? -1.555  -46.688 15.054 1.00 30.95 ? 173  GLN A N     1 
ATOM   1437 C  CA    . GLN A 1 173 ? -2.337  -47.332 13.998 1.00 32.69 ? 173  GLN A CA    1 
ATOM   1438 C  C     . GLN A 1 173 ? -2.374  -46.454 12.751 1.00 29.69 ? 173  GLN A C     1 
ATOM   1439 O  O     . GLN A 1 173 ? -3.096  -46.749 11.796 1.00 31.21 ? 173  GLN A O     1 
ATOM   1440 C  CB    . GLN A 1 173 ? -3.777  -47.552 14.459 1.00 34.52 ? 173  GLN A CB    1 
ATOM   1441 C  CG    . GLN A 1 173 ? -3.996  -48.694 15.426 1.00 35.72 ? 173  GLN A CG    1 
ATOM   1442 C  CD    . GLN A 1 173 ? -5.433  -48.747 15.892 1.00 37.67 ? 173  GLN A CD    1 
ATOM   1443 O  OE1   . GLN A 1 173 ? -5.863  -47.928 16.711 1.00 33.00 ? 173  GLN A OE1   1 
ATOM   1444 N  NE2   . GLN A 1 173 ? -6.192  -49.703 15.363 1.00 39.74 ? 173  GLN A NE2   1 
ATOM   1445 N  N     . GLY A 1 174 ? -1.603  -45.369 12.760 1.00 28.18 ? 174  GLY A N     1 
ATOM   1446 C  CA    . GLY A 1 174 ? -1.639  -44.395 11.667 1.00 26.23 ? 174  GLY A CA    1 
ATOM   1447 C  C     . GLY A 1 174 ? -2.756  -43.376 11.830 1.00 25.14 ? 174  GLY A C     1 
ATOM   1448 O  O     . GLY A 1 174 ? -3.029  -42.586 10.920 1.00 25.73 ? 174  GLY A O     1 
ATOM   1449 N  N     . GLY A 1 175 ? -3.394  -43.388 12.998 1.00 25.04 ? 175  GLY A N     1 
ATOM   1450 C  CA    . GLY A 1 175 ? -4.487  -42.466 13.305 1.00 23.95 ? 175  GLY A CA    1 
ATOM   1451 C  C     . GLY A 1 175 ? -4.045  -41.128 13.868 1.00 23.78 ? 175  GLY A C     1 
ATOM   1452 O  O     . GLY A 1 175 ? -2.849  -40.835 13.949 1.00 22.78 ? 175  GLY A O     1 
ATOM   1453 N  N     . ASP A 1 176 ? -5.021  -40.308 14.256 1.00 22.68 ? 176  ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 176 ? -4.742  -38.971 14.764 1.00 24.55 ? 176  ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 176 ? -5.027  -38.849 16.253 1.00 24.14 ? 176  ASP A C     1 
ATOM   1456 O  O     . ASP A 1 176 ? -4.770  -37.803 16.851 1.00 26.29 ? 176  ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 176 ? -5.559  -37.933 13.995 1.00 24.05 ? 176  ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 176 ? -5.371  -38.040 12.494 1.00 25.79 ? 176  ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 176 ? -4.206  -38.104 12.039 1.00 28.89 ? 176  ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 176 ? -6.390  -38.057 11.768 1.00 24.98 ? 176  ASP A OD2   1 
ATOM   1461 N  N     . GLU A 1 177 ? -5.559  -39.922 16.836 1.00 25.72 ? 177  GLU A N     1 
ATOM   1462 C  CA    . GLU A 1 177 ? -5.906  -39.977 18.258 1.00 29.20 ? 177  GLU A CA    1 
ATOM   1463 C  C     . GLU A 1 177 ? -6.831  -38.851 18.707 1.00 28.40 ? 177  GLU A C     1 
ATOM   1464 O  O     . GLU A 1 177 ? -6.623  -38.261 19.767 1.00 28.10 ? 177  GLU A O     1 
ATOM   1465 C  CB    . GLU A 1 177 ? -4.650  -40.007 19.135 1.00 31.65 ? 177  GLU A CB    1 
ATOM   1466 C  CG    . GLU A 1 177 ? -4.220  -41.389 19.560 1.00 37.17 ? 177  GLU A CG    1 
ATOM   1467 C  CD    . GLU A 1 177 ? -2.842  -41.399 20.203 1.00 39.98 ? 177  GLU A CD    1 
ATOM   1468 O  OE1   . GLU A 1 177 ? -2.564  -40.526 21.059 1.00 41.53 ? 177  GLU A OE1   1 
ATOM   1469 O  OE2   . GLU A 1 177 ? -2.037  -42.284 19.847 1.00 39.14 ? 177  GLU A OE2   1 
ATOM   1470 N  N     . VAL A 1 178 ? -7.837  -38.542 17.894 1.00 26.78 ? 178  VAL A N     1 
ATOM   1471 C  CA    . VAL A 1 178 ? -8.906  -37.649 18.334 1.00 25.01 ? 178  VAL A CA    1 
ATOM   1472 C  C     . VAL A 1 178 ? -9.586  -38.355 19.513 1.00 25.48 ? 178  VAL A C     1 
ATOM   1473 O  O     . VAL A 1 178 ? -10.051 -39.492 19.366 1.00 25.69 ? 178  VAL A O     1 
ATOM   1474 C  CB    . VAL A 1 178 ? -9.912  -37.329 17.201 1.00 24.44 ? 178  VAL A CB    1 
ATOM   1475 C  CG1   . VAL A 1 178 ? -11.103 -36.526 17.739 1.00 23.14 ? 178  VAL A CG1   1 
ATOM   1476 C  CG2   . VAL A 1 178 ? -9.224  -36.553 16.089 1.00 22.13 ? 178  VAL A CG2   1 
ATOM   1477 N  N     . PRO A 1 179 ? -9.608  -37.696 20.691 1.00 25.75 ? 179  PRO A N     1 
ATOM   1478 C  CA    . PRO A 1 179 ? -10.084 -38.315 21.927 1.00 26.40 ? 179  PRO A CA    1 
ATOM   1479 C  C     . PRO A 1 179 ? -11.447 -38.970 21.758 1.00 26.84 ? 179  PRO A C     1 
ATOM   1480 O  O     . PRO A 1 179 ? -12.377 -38.352 21.243 1.00 26.02 ? 179  PRO A O     1 
ATOM   1481 C  CB    . PRO A 1 179 ? -10.166 -37.133 22.891 1.00 25.98 ? 179  PRO A CB    1 
ATOM   1482 C  CG    . PRO A 1 179 ? -9.089  -36.229 22.434 1.00 25.74 ? 179  PRO A CG    1 
ATOM   1483 C  CD    . PRO A 1 179 ? -9.126  -36.322 20.930 1.00 25.16 ? 179  PRO A CD    1 
ATOM   1484 N  N     . SER A 1 180 ? -11.550 -40.223 22.197 1.00 27.26 ? 180  SER A N     1 
ATOM   1485 C  CA    . SER A 1 180 ? -12.773 -41.010 22.046 1.00 26.85 ? 180  SER A CA    1 
ATOM   1486 C  C     . SER A 1 180 ? -14.023 -40.317 22.592 1.00 27.20 ? 180  SER A C     1 
ATOM   1487 O  O     . SER A 1 180 ? -15.112 -40.495 22.047 1.00 28.51 ? 180  SER A O     1 
ATOM   1488 C  CB    . SER A 1 180 ? -12.608 -42.391 22.690 1.00 28.19 ? 180  SER A CB    1 
ATOM   1489 O  OG    . SER A 1 180 ? -12.156 -42.267 24.023 1.00 31.37 ? 180  SER A OG    1 
ATOM   1490 N  N     . GLU A 1 181 ? -13.859 -39.521 23.649 1.00 24.78 ? 181  GLU A N     1 
ATOM   1491 C  CA    . GLU A 1 181 ? -14.988 -38.839 24.288 1.00 26.23 ? 181  GLU A CA    1 
ATOM   1492 C  C     . GLU A 1 181 ? -15.626 -37.704 23.464 1.00 23.85 ? 181  GLU A C     1 
ATOM   1493 O  O     . GLU A 1 181 ? -16.707 -37.224 23.818 1.00 24.01 ? 181  GLU A O     1 
ATOM   1494 C  CB    . GLU A 1 181 ? -14.606 -38.339 25.689 1.00 27.24 ? 181  GLU A CB    1 
ATOM   1495 C  CG    . GLU A 1 181 ? -13.637 -37.159 25.705 1.00 28.57 ? 181  GLU A CG    1 
ATOM   1496 C  CD    . GLU A 1 181 ? -12.178 -37.572 25.824 1.00 31.75 ? 181  GLU A CD    1 
ATOM   1497 O  OE1   . GLU A 1 181 ? -11.846 -38.752 25.564 1.00 28.86 ? 181  GLU A OE1   1 
ATOM   1498 O  OE2   . GLU A 1 181 ? -11.356 -36.700 26.191 1.00 33.08 ? 181  GLU A OE2   1 
ATOM   1499 N  N     . ILE A 1 182 ? -14.972 -37.277 22.383 1.00 21.55 ? 182  ILE A N     1 
ATOM   1500 C  CA    . ILE A 1 182 ? -15.570 -36.271 21.486 1.00 21.73 ? 182  ILE A CA    1 
ATOM   1501 C  C     . ILE A 1 182 ? -15.932 -36.810 20.094 1.00 21.90 ? 182  ILE A C     1 
ATOM   1502 O  O     . ILE A 1 182 ? -16.578 -36.116 19.307 1.00 21.28 ? 182  ILE A O     1 
ATOM   1503 C  CB    . ILE A 1 182 ? -14.700 -34.981 21.347 1.00 20.82 ? 182  ILE A CB    1 
ATOM   1504 C  CG1   . ILE A 1 182 ? -13.451 -35.243 20.495 1.00 21.41 ? 182  ILE A CG1   1 
ATOM   1505 C  CG2   . ILE A 1 182 ? -14.369 -34.385 22.722 1.00 20.42 ? 182  ILE A CG2   1 
ATOM   1506 C  CD1   . ILE A 1 182 ? -12.738 -33.972 20.045 1.00 17.51 ? 182  ILE A CD1   1 
ATOM   1507 N  N     . ILE A 1 183 ? -15.511 -38.039 19.797 1.00 22.43 ? 183  ILE A N     1 
ATOM   1508 C  CA    . ILE A 1 183 ? -15.770 -38.662 18.495 1.00 23.75 ? 183  ILE A CA    1 
ATOM   1509 C  C     . ILE A 1 183 ? -17.250 -38.587 18.095 1.00 24.40 ? 183  ILE A C     1 
ATOM   1510 O  O     . ILE A 1 183 ? -17.576 -38.146 16.993 1.00 24.45 ? 183  ILE A O     1 
ATOM   1511 C  CB    . ILE A 1 183 ? -15.245 -40.126 18.448 1.00 25.45 ? 183  ILE A CB    1 
ATOM   1512 C  CG1   . ILE A 1 183 ? -13.711 -40.144 18.419 1.00 25.57 ? 183  ILE A CG1   1 
ATOM   1513 C  CG2   . ILE A 1 183 ? -15.815 -40.886 17.240 1.00 26.66 ? 183  ILE A CG2   1 
ATOM   1514 C  CD1   . ILE A 1 183 ? -13.083 -39.540 17.147 1.00 28.07 ? 183  ILE A CD1   1 
ATOM   1515 N  N     . ASP A 1 184 ? -18.133 -39.002 19.003 1.00 24.61 ? 184  ASP A N     1 
ATOM   1516 C  CA    . ASP A 1 184 ? -19.577 -38.991 18.760 1.00 26.35 ? 184  ASP A CA    1 
ATOM   1517 C  C     . ASP A 1 184 ? -20.181 -37.583 18.743 1.00 24.40 ? 184  ASP A C     1 
ATOM   1518 O  O     . ASP A 1 184 ? -21.364 -37.421 18.438 1.00 25.14 ? 184  ASP A O     1 
ATOM   1519 C  CB    . ASP A 1 184 ? -20.308 -39.851 19.806 1.00 29.43 ? 184  ASP A CB    1 
ATOM   1520 C  CG    . ASP A 1 184 ? -19.980 -41.334 19.692 1.00 36.38 ? 184  ASP A CG    1 
ATOM   1521 O  OD1   . ASP A 1 184 ? -19.443 -41.771 18.649 1.00 39.87 ? 184  ASP A OD1   1 
ATOM   1522 O  OD2   . ASP A 1 184 ? -20.273 -42.069 20.657 1.00 40.97 ? 184  ASP A OD2   1 
ATOM   1523 N  N     . LYS A 1 185 ? -19.370 -36.573 19.062 1.00 22.38 ? 185  LYS A N     1 
ATOM   1524 C  CA    . LYS A 1 185 ? -19.843 -35.188 19.125 1.00 21.07 ? 185  LYS A CA    1 
ATOM   1525 C  C     . LYS A 1 185 ? -19.414 -34.346 17.918 1.00 20.07 ? 185  LYS A C     1 
ATOM   1526 O  O     . LYS A 1 185 ? -19.653 -33.140 17.884 1.00 19.33 ? 185  LYS A O     1 
ATOM   1527 C  CB    . LYS A 1 185 ? -19.393 -34.516 20.429 1.00 19.51 ? 185  LYS A CB    1 
ATOM   1528 C  CG    . LYS A 1 185 ? -19.859 -35.227 21.699 1.00 21.12 ? 185  LYS A CG    1 
ATOM   1529 C  CD    . LYS A 1 185 ? -19.454 -34.453 22.942 1.00 19.10 ? 185  LYS A CD    1 
ATOM   1530 C  CE    . LYS A 1 185 ? -19.855 -35.194 24.217 1.00 25.57 ? 185  LYS A CE    1 
ATOM   1531 N  NZ    . LYS A 1 185 ? -19.585 -34.376 25.439 1.00 25.06 ? 185  LYS A NZ    1 
ATOM   1532 N  N     . ILE A 1 186 ? -18.784 -34.981 16.934 1.00 19.50 ? 186  ILE A N     1 
ATOM   1533 C  CA    . ILE A 1 186 ? -18.350 -34.276 15.730 1.00 20.17 ? 186  ILE A CA    1 
ATOM   1534 C  C     . ILE A 1 186 ? -19.415 -34.337 14.639 1.00 21.73 ? 186  ILE A C     1 
ATOM   1535 O  O     . ILE A 1 186 ? -19.926 -35.416 14.314 1.00 21.75 ? 186  ILE A O     1 
ATOM   1536 C  CB    . ILE A 1 186 ? -16.999 -34.829 15.201 1.00 20.10 ? 186  ILE A CB    1 
ATOM   1537 C  CG1   . ILE A 1 186 ? -15.893 -34.578 16.234 1.00 20.69 ? 186  ILE A CG1   1 
ATOM   1538 C  CG2   . ILE A 1 186 ? -16.648 -34.202 13.835 1.00 19.93 ? 186  ILE A CG2   1 
ATOM   1539 C  CD1   . ILE A 1 186 ? -14.663 -35.446 16.052 1.00 20.54 ? 186  ILE A CD1   1 
ATOM   1540 N  N     . ILE A 1 187 ? -19.739 -33.169 14.084 1.00 19.12 ? 187  ILE A N     1 
ATOM   1541 C  CA    . ILE A 1 187 ? -20.625 -33.056 12.931 1.00 20.56 ? 187  ILE A CA    1 
ATOM   1542 C  C     . ILE A 1 187 ? -19.775 -32.526 11.782 1.00 20.01 ? 187  ILE A C     1 
ATOM   1543 O  O     . ILE A 1 187 ? -19.326 -31.375 11.800 1.00 20.19 ? 187  ILE A O     1 
ATOM   1544 C  CB    . ILE A 1 187 ? -21.841 -32.145 13.239 1.00 20.24 ? 187  ILE A CB    1 
ATOM   1545 C  CG1   . ILE A 1 187 ? -22.729 -32.823 14.295 1.00 22.44 ? 187  ILE A CG1   1 
ATOM   1546 C  CG2   . ILE A 1 187 ? -22.626 -31.831 11.963 1.00 23.03 ? 187  ILE A CG2   1 
ATOM   1547 C  CD1   . ILE A 1 187 ? -23.763 -31.922 14.935 1.00 25.12 ? 187  ILE A CD1   1 
ATOM   1548 N  N     . TYR A 1 188 ? -19.526 -33.397 10.808 1.00 19.26 ? 188  TYR A N     1 
ATOM   1549 C  CA    . TYR A 1 188 ? -18.555 -33.129 9.755  1.00 20.76 ? 188  TYR A CA    1 
ATOM   1550 C  C     . TYR A 1 188 ? -19.227 -32.723 8.450  1.00 20.98 ? 188  TYR A C     1 
ATOM   1551 O  O     . TYR A 1 188 ? -20.102 -33.435 7.941  1.00 22.06 ? 188  TYR A O     1 
ATOM   1552 C  CB    . TYR A 1 188 ? -17.661 -34.359 9.540  1.00 21.63 ? 188  TYR A CB    1 
ATOM   1553 C  CG    . TYR A 1 188 ? -16.722 -34.233 8.367  1.00 21.42 ? 188  TYR A CG    1 
ATOM   1554 C  CD1   . TYR A 1 188 ? -15.618 -33.384 8.420  1.00 20.53 ? 188  TYR A CD1   1 
ATOM   1555 C  CD2   . TYR A 1 188 ? -16.939 -34.963 7.192  1.00 21.63 ? 188  TYR A CD2   1 
ATOM   1556 C  CE1   . TYR A 1 188 ? -14.753 -33.261 7.331  1.00 21.85 ? 188  TYR A CE1   1 
ATOM   1557 C  CE2   . TYR A 1 188 ? -16.074 -34.851 6.099  1.00 23.57 ? 188  TYR A CE2   1 
ATOM   1558 C  CZ    . TYR A 1 188 ? -14.987 -33.997 6.177  1.00 20.64 ? 188  TYR A CZ    1 
ATOM   1559 O  OH    . TYR A 1 188 ? -14.133 -33.877 5.105  1.00 19.05 ? 188  TYR A OH    1 
ATOM   1560 N  N     . MET A 1 189 ? -18.800 -31.583 7.909  1.00 19.32 ? 189  MET A N     1 
ATOM   1561 C  CA    . MET A 1 189 ? -19.390 -31.015 6.699  1.00 21.33 ? 189  MET A CA    1 
ATOM   1562 C  C     . MET A 1 189 ? -18.312 -30.657 5.681  1.00 20.75 ? 189  MET A C     1 
ATOM   1563 O  O     . MET A 1 189 ? -17.605 -29.654 5.843  1.00 19.71 ? 189  MET A O     1 
ATOM   1564 C  CB    . MET A 1 189 ? -20.231 -29.777 7.044  1.00 21.35 ? 189  MET A CB    1 
ATOM   1565 C  CG    . MET A 1 189 ? -21.443 -30.084 7.918  1.00 26.60 ? 189  MET A CG    1 
ATOM   1566 S  SD    . MET A 1 189 ? -22.093 -28.637 8.774  1.00 29.44 ? 189  MET A SD    1 
ATOM   1567 C  CE    . MET A 1 189 ? -20.833 -28.383 10.027 1.00 22.28 ? 189  MET A CE    1 
ATOM   1568 N  N     . PRO A 1 190 ? -18.165 -31.486 4.631  1.00 21.14 ? 190  PRO A N     1 
ATOM   1569 C  CA    . PRO A 1 190 ? -17.197 -31.148 3.595  1.00 20.97 ? 190  PRO A CA    1 
ATOM   1570 C  C     . PRO A 1 190 ? -17.793 -30.213 2.537  1.00 22.17 ? 190  PRO A C     1 
ATOM   1571 O  O     . PRO A 1 190 ? -19.000 -30.251 2.290  1.00 22.89 ? 190  PRO A O     1 
ATOM   1572 C  CB    . PRO A 1 190 ? -16.838 -32.510 2.993  1.00 21.44 ? 190  PRO A CB    1 
ATOM   1573 C  CG    . PRO A 1 190 ? -18.041 -33.366 3.222  1.00 22.81 ? 190  PRO A CG    1 
ATOM   1574 C  CD    . PRO A 1 190 ? -18.799 -32.800 4.401  1.00 22.27 ? 190  PRO A CD    1 
ATOM   1575 N  N     . PHE A 1 191 ? -16.946 -29.385 1.931  1.00 21.90 ? 191  PHE A N     1 
ATOM   1576 C  CA    . PHE A 1 191 ? -17.391 -28.412 0.938  1.00 23.07 ? 191  PHE A CA    1 
ATOM   1577 C  C     . PHE A 1 191 ? -16.580 -28.458 -0.340 1.00 24.93 ? 191  PHE A C     1 
ATOM   1578 O  O     . PHE A 1 191 ? -15.356 -28.615 -0.310 1.00 23.31 ? 191  PHE A O     1 
ATOM   1579 C  CB    . PHE A 1 191 ? -17.380 -26.999 1.525  1.00 23.06 ? 191  PHE A CB    1 
ATOM   1580 C  CG    . PHE A 1 191 ? -18.401 -26.798 2.593  1.00 22.88 ? 191  PHE A CG    1 
ATOM   1581 C  CD1   . PHE A 1 191 ? -18.073 -26.985 3.931  1.00 22.55 ? 191  PHE A CD1   1 
ATOM   1582 C  CD2   . PHE A 1 191 ? -19.708 -26.456 2.261  1.00 24.78 ? 191  PHE A CD2   1 
ATOM   1583 C  CE1   . PHE A 1 191 ? -19.025 -26.817 4.928  1.00 25.00 ? 191  PHE A CE1   1 
ATOM   1584 C  CE2   . PHE A 1 191 ? -20.670 -26.285 3.252  1.00 25.85 ? 191  PHE A CE2   1 
ATOM   1585 C  CZ    . PHE A 1 191 ? -20.331 -26.464 4.584  1.00 24.04 ? 191  PHE A CZ    1 
ATOM   1586 N  N     . ASP A 1 192 ? -17.296 -28.315 -1.454 1.00 26.46 ? 192  ASP A N     1 
ATOM   1587 C  CA    . ASP A 1 192 ? -16.741 -28.319 -2.798 1.00 29.42 ? 192  ASP A CA    1 
ATOM   1588 C  C     . ASP A 1 192 ? -16.005 -27.018 -3.137 1.00 27.06 ? 192  ASP A C     1 
ATOM   1589 O  O     . ASP A 1 192 ? -15.174 -26.984 -4.050 1.00 27.77 ? 192  ASP A O     1 
ATOM   1590 C  CB    . ASP A 1 192 ? -17.885 -28.523 -3.799 1.00 32.18 ? 192  ASP A CB    1 
ATOM   1591 C  CG    . ASP A 1 192 ? -17.408 -29.028 -5.136 1.00 40.44 ? 192  ASP A CG    1 
ATOM   1592 O  OD1   . ASP A 1 192 ? -16.889 -30.166 -5.193 1.00 46.10 ? 192  ASP A OD1   1 
ATOM   1593 O  OD2   . ASP A 1 192 ? -17.568 -28.292 -6.134 1.00 43.59 ? 192  ASP A OD2   1 
ATOM   1594 N  N     . ASN A 1 193 ? -16.333 -25.944 -2.426 1.00 23.11 ? 193  ASN A N     1 
ATOM   1595 C  CA    . ASN A 1 193 ? -15.716 -24.647 -2.676 1.00 22.80 ? 193  ASN A CA    1 
ATOM   1596 C  C     . ASN A 1 193 ? -15.855 -23.720 -1.471 1.00 20.40 ? 193  ASN A C     1 
ATOM   1597 O  O     . ASN A 1 193 ? -16.740 -23.904 -0.636 1.00 21.34 ? 193  ASN A O     1 
ATOM   1598 C  CB    . ASN A 1 193 ? -16.286 -24.009 -3.950 1.00 24.22 ? 193  ASN A CB    1 
ATOM   1599 C  CG    . ASN A 1 193 ? -17.759 -23.676 -3.830 1.00 27.93 ? 193  ASN A CG    1 
ATOM   1600 O  OD1   . ASN A 1 193 ? -18.132 -22.687 -3.207 1.00 25.19 ? 193  ASN A OD1   1 
ATOM   1601 N  ND2   . ASN A 1 193 ? -18.603 -24.496 -4.443 1.00 31.79 ? 193  ASN A ND2   1 
ATOM   1602 N  N     . GLU A 1 194 ? -14.966 -22.737 -1.385 1.00 19.07 ? 194  GLU A N     1 
ATOM   1603 C  CA    . GLU A 1 194 ? -14.880 -21.856 -0.225 1.00 19.44 ? 194  GLU A CA    1 
ATOM   1604 C  C     . GLU A 1 194 ? -16.104 -20.954 -0.066 1.00 19.21 ? 194  GLU A C     1 
ATOM   1605 O  O     . GLU A 1 194 ? -16.519 -20.665 1.057  1.00 18.37 ? 194  GLU A O     1 
ATOM   1606 C  CB    . GLU A 1 194 ? -13.607 -21.012 -0.309 1.00 20.60 ? 194  GLU A CB    1 
ATOM   1607 C  CG    . GLU A 1 194 ? -13.275 -20.242 0.963  1.00 20.57 ? 194  GLU A CG    1 
ATOM   1608 C  CD    . GLU A 1 194 ? -12.285 -19.119 0.726  1.00 21.65 ? 194  GLU A CD    1 
ATOM   1609 O  OE1   . GLU A 1 194 ? -11.886 -18.476 1.718  1.00 17.38 ? 194  GLU A OE1   1 
ATOM   1610 O  OE2   . GLU A 1 194 ? -11.911 -18.874 -0.450 1.00 23.28 ? 194  GLU A OE2   1 
ATOM   1611 N  N     . LYS A 1 195 ? -16.672 -20.501 -1.184 1.00 19.47 ? 195  LYS A N     1 
ATOM   1612 C  CA    . LYS A 1 195 ? -17.873 -19.663 -1.128 1.00 19.71 ? 195  LYS A CA    1 
ATOM   1613 C  C     . LYS A 1 195 ? -19.022 -20.401 -0.437 1.00 20.02 ? 195  LYS A C     1 
ATOM   1614 O  O     . LYS A 1 195 ? -19.691 -19.843 0.437  1.00 19.95 ? 195  LYS A O     1 
ATOM   1615 C  CB    . LYS A 1 195 ? -18.286 -19.188 -2.524 1.00 21.29 ? 195  LYS A CB    1 
ATOM   1616 C  CG    . LYS A 1 195 ? -17.479 -18.006 -3.017 1.00 24.11 ? 195  LYS A CG    1 
ATOM   1617 C  CD    . LYS A 1 195 ? -17.763 -17.700 -4.482 1.00 29.09 ? 195  LYS A CD    1 
ATOM   1618 C  CE    . LYS A 1 195 ? -16.661 -16.839 -5.078 1.00 32.92 ? 195  LYS A CE    1 
ATOM   1619 N  NZ    . LYS A 1 195 ? -16.538 -17.046 -6.547 1.00 34.61 ? 195  LYS A NZ    1 
ATOM   1620 N  N     . GLU A 1 196 ? -19.231 -21.658 -0.826 1.00 19.95 ? 196  GLU A N     1 
ATOM   1621 C  CA    . GLU A 1 196 ? -20.248 -22.501 -0.197 1.00 22.22 ? 196  GLU A CA    1 
ATOM   1622 C  C     . GLU A 1 196 ? -19.969 -22.700 1.294  1.00 20.73 ? 196  GLU A C     1 
ATOM   1623 O  O     . GLU A 1 196 ? -20.886 -22.617 2.120  1.00 18.88 ? 196  GLU A O     1 
ATOM   1624 C  CB    . GLU A 1 196 ? -20.330 -23.860 -0.901 1.00 25.72 ? 196  GLU A CB    1 
ATOM   1625 C  CG    . GLU A 1 196 ? -21.470 -24.745 -0.424 1.00 35.71 ? 196  GLU A CG    1 
ATOM   1626 C  CD    . GLU A 1 196 ? -22.760 -24.521 -1.190 1.00 44.43 ? 196  GLU A CD    1 
ATOM   1627 O  OE1   . GLU A 1 196 ? -23.385 -25.530 -1.588 1.00 48.49 ? 196  GLU A OE1   1 
ATOM   1628 O  OE2   . GLU A 1 196 ? -23.151 -23.348 -1.396 1.00 46.46 ? 196  GLU A OE2   1 
ATOM   1629 N  N     . LEU A 1 197 ? -18.709 -22.973 1.625  1.00 18.99 ? 197  LEU A N     1 
ATOM   1630 C  CA    . LEU A 1 197 ? -18.298 -23.171 3.018  1.00 18.51 ? 197  LEU A CA    1 
ATOM   1631 C  C     . LEU A 1 197 ? -18.666 -21.951 3.875  1.00 18.18 ? 197  LEU A C     1 
ATOM   1632 O  O     . LEU A 1 197 ? -19.280 -22.083 4.943  1.00 17.40 ? 197  LEU A O     1 
ATOM   1633 C  CB    . LEU A 1 197 ? -16.787 -23.462 3.100  1.00 18.26 ? 197  LEU A CB    1 
ATOM   1634 C  CG    . LEU A 1 197 ? -16.194 -23.845 4.471  1.00 17.20 ? 197  LEU A CG    1 
ATOM   1635 C  CD1   . LEU A 1 197 ? -14.903 -24.651 4.326  1.00 16.59 ? 197  LEU A CD1   1 
ATOM   1636 C  CD2   . LEU A 1 197 ? -15.933 -22.622 5.362  1.00 20.90 ? 197  LEU A CD2   1 
ATOM   1637 N  N     . LEU A 1 198 ? -18.290 -20.766 3.399  1.00 17.40 ? 198  LEU A N     1 
ATOM   1638 C  CA    . LEU A 1 198 ? -18.481 -19.541 4.182  1.00 18.62 ? 198  LEU A CA    1 
ATOM   1639 C  C     . LEU A 1 198 ? -19.948 -19.127 4.273  1.00 17.84 ? 198  LEU A C     1 
ATOM   1640 O  O     . LEU A 1 198 ? -20.389 -18.623 5.306  1.00 18.86 ? 198  LEU A O     1 
ATOM   1641 C  CB    . LEU A 1 198 ? -17.606 -18.409 3.637  1.00 18.48 ? 198  LEU A CB    1 
ATOM   1642 C  CG    . LEU A 1 198 ? -16.094 -18.609 3.827  1.00 20.69 ? 198  LEU A CG    1 
ATOM   1643 C  CD1   . LEU A 1 198 ? -15.293 -17.652 2.946  1.00 19.90 ? 198  LEU A CD1   1 
ATOM   1644 C  CD2   . LEU A 1 198 ? -15.685 -18.481 5.309  1.00 20.43 ? 198  LEU A CD2   1 
ATOM   1645 N  N     . MET A 1 199 ? -20.703 -19.357 3.201  1.00 18.60 ? 199  MET A N     1 
ATOM   1646 C  CA    . MET A 1 199 ? -22.138 -19.054 3.199  1.00 18.16 ? 199  MET A CA    1 
ATOM   1647 C  C     . MET A 1 199 ? -22.875 -19.958 4.179  1.00 20.31 ? 199  MET A C     1 
ATOM   1648 O  O     . MET A 1 199 ? -23.748 -19.494 4.918  1.00 18.31 ? 199  MET A O     1 
ATOM   1649 C  CB    . MET A 1 199 ? -22.727 -19.169 1.793  1.00 21.70 ? 199  MET A CB    1 
ATOM   1650 C  CG    . MET A 1 199 ? -22.413 -17.968 0.916  1.00 21.76 ? 199  MET A CG    1 
ATOM   1651 S  SD    . MET A 1 199 ? -23.217 -18.027 -0.696 1.00 27.58 ? 199  MET A SD    1 
ATOM   1652 C  CE    . MET A 1 199 ? -22.425 -19.445 -1.449 1.00 27.17 ? 199  MET A CE    1 
ATOM   1653 N  N     . GLU A 1 200 ? -22.502 -21.239 4.197  1.00 19.82 ? 200  GLU A N     1 
ATOM   1654 C  CA    . GLU A 1 200 ? -23.055 -22.174 5.173  1.00 21.42 ? 200  GLU A CA    1 
ATOM   1655 C  C     . GLU A 1 200 ? -22.622 -21.832 6.591  1.00 18.52 ? 200  GLU A C     1 
ATOM   1656 O  O     . GLU A 1 200 ? -23.425 -21.928 7.516  1.00 19.28 ? 200  GLU A O     1 
ATOM   1657 C  CB    . GLU A 1 200 ? -22.701 -23.627 4.844  1.00 23.97 ? 200  GLU A CB    1 
ATOM   1658 C  CG    . GLU A 1 200 ? -23.608 -24.254 3.789  1.00 32.51 ? 200  GLU A CG    1 
ATOM   1659 C  CD    . GLU A 1 200 ? -25.090 -24.015 4.062  1.00 40.17 ? 200  GLU A CD    1 
ATOM   1660 O  OE1   . GLU A 1 200 ? -25.751 -23.359 3.226  1.00 44.58 ? 200  GLU A OE1   1 
ATOM   1661 O  OE2   . GLU A 1 200 ? -25.587 -24.464 5.118  1.00 42.80 ? 200  GLU A OE2   1 
ATOM   1662 N  N     . TYR A 1 201 ? -21.367 -21.419 6.760  1.00 18.01 ? 201  TYR A N     1 
ATOM   1663 C  CA    . TYR A 1 201 ? -20.891 -20.993 8.083  1.00 18.34 ? 201  TYR A CA    1 
ATOM   1664 C  C     . TYR A 1 201 ? -21.693 -19.807 8.634  1.00 17.83 ? 201  TYR A C     1 
ATOM   1665 O  O     . TYR A 1 201 ? -22.053 -19.784 9.808  1.00 17.35 ? 201  TYR A O     1 
ATOM   1666 C  CB    . TYR A 1 201 ? -19.384 -20.680 8.078  1.00 17.97 ? 201  TYR A CB    1 
ATOM   1667 C  CG    . TYR A 1 201 ? -18.826 -20.427 9.469  1.00 17.01 ? 201  TYR A CG    1 
ATOM   1668 C  CD1   . TYR A 1 201 ? -18.811 -21.446 10.426 1.00 18.10 ? 201  TYR A CD1   1 
ATOM   1669 C  CD2   . TYR A 1 201 ? -18.310 -19.179 9.827  1.00 17.35 ? 201  TYR A CD2   1 
ATOM   1670 C  CE1   . TYR A 1 201 ? -18.311 -21.230 11.701 1.00 17.63 ? 201  TYR A CE1   1 
ATOM   1671 C  CE2   . TYR A 1 201 ? -17.793 -18.954 11.109 1.00 17.70 ? 201  TYR A CE2   1 
ATOM   1672 C  CZ    . TYR A 1 201 ? -17.804 -19.991 12.038 1.00 17.61 ? 201  TYR A CZ    1 
ATOM   1673 O  OH    . TYR A 1 201 ? -17.303 -19.804 13.306 1.00 18.17 ? 201  TYR A OH    1 
ATOM   1674 N  N     . LEU A 1 202 ? -21.991 -18.831 7.780  1.00 18.18 ? 202  LEU A N     1 
ATOM   1675 C  CA    . LEU A 1 202 ? -22.767 -17.672 8.216  1.00 16.55 ? 202  LEU A CA    1 
ATOM   1676 C  C     . LEU A 1 202 ? -24.216 -18.037 8.545  1.00 17.65 ? 202  LEU A C     1 
ATOM   1677 O  O     . LEU A 1 202 ? -24.792 -17.509 9.500  1.00 17.97 ? 202  LEU A O     1 
ATOM   1678 C  CB    . LEU A 1 202 ? -22.707 -16.550 7.170  1.00 19.10 ? 202  LEU A CB    1 
ATOM   1679 C  CG    . LEU A 1 202 ? -21.352 -15.843 7.040  1.00 20.38 ? 202  LEU A CG    1 
ATOM   1680 C  CD1   . LEU A 1 202 ? -21.348 -14.967 5.817  1.00 19.28 ? 202  LEU A CD1   1 
ATOM   1681 C  CD2   . LEU A 1 202 ? -21.019 -15.017 8.278  1.00 21.07 ? 202  LEU A CD2   1 
ATOM   1682 N  N     . ASN A 1 203 ? -24.807 -18.941 7.762  1.00 18.25 ? 203  ASN A N     1 
ATOM   1683 C  CA    . ASN A 1 203 ? -26.162 -19.423 8.055  1.00 18.08 ? 203  ASN A CA    1 
ATOM   1684 C  C     . ASN A 1 203 ? -26.205 -20.161 9.393  1.00 18.26 ? 203  ASN A C     1 
ATOM   1685 O  O     . ASN A 1 203 ? -27.148 -20.020 10.174 1.00 17.73 ? 203  ASN A O     1 
ATOM   1686 C  CB    . ASN A 1 203 ? -26.675 -20.325 6.928  1.00 19.70 ? 203  ASN A CB    1 
ATOM   1687 C  CG    . ASN A 1 203 ? -27.004 -19.553 5.662  1.00 23.44 ? 203  ASN A CG    1 
ATOM   1688 O  OD1   . ASN A 1 203 ? -26.975 -20.102 4.552  1.00 26.64 ? 203  ASN A OD1   1 
ATOM   1689 N  ND2   . ASN A 1 203 ? -27.339 -18.285 5.820  1.00 19.74 ? 203  ASN A ND2   1 
ATOM   1690 N  N     . PHE A 1 204 ? -25.166 -20.951 9.635  1.00 17.33 ? 204  PHE A N     1 
ATOM   1691 C  CA    . PHE A 1 204 ? -24.980 -21.670 10.890 1.00 18.06 ? 204  PHE A CA    1 
ATOM   1692 C  C     . PHE A 1 204 ? -24.836 -20.678 12.050 1.00 17.89 ? 204  PHE A C     1 
ATOM   1693 O  O     . PHE A 1 204 ? -25.521 -20.805 13.081 1.00 17.19 ? 204  PHE A O     1 
ATOM   1694 C  CB    . PHE A 1 204 ? -23.764 -22.592 10.732 1.00 18.87 ? 204  PHE A CB    1 
ATOM   1695 C  CG    . PHE A 1 204 ? -23.167 -23.072 12.021 1.00 17.79 ? 204  PHE A CG    1 
ATOM   1696 C  CD1   . PHE A 1 204 ? -23.698 -24.178 12.678 1.00 20.64 ? 204  PHE A CD1   1 
ATOM   1697 C  CD2   . PHE A 1 204 ? -22.045 -22.437 12.562 1.00 19.58 ? 204  PHE A CD2   1 
ATOM   1698 C  CE1   . PHE A 1 204 ? -23.128 -24.640 13.860 1.00 18.93 ? 204  PHE A CE1   1 
ATOM   1699 C  CE2   . PHE A 1 204 ? -21.474 -22.886 13.749 1.00 18.65 ? 204  PHE A CE2   1 
ATOM   1700 C  CZ    . PHE A 1 204 ? -22.018 -23.988 14.401 1.00 21.24 ? 204  PHE A CZ    1 
ATOM   1701 N  N     . TRP A 1 205 ? -23.971 -19.677 11.862 1.00 16.33 ? 205  TRP A N     1 
ATOM   1702 C  CA    . TRP A 1 205 ? -23.734 -18.612 12.848 1.00 17.20 ? 205  TRP A CA    1 
ATOM   1703 C  C     . TRP A 1 205 ? -25.026 -17.873 13.195 1.00 17.91 ? 205  TRP A C     1 
ATOM   1704 O  O     . TRP A 1 205 ? -25.274 -17.556 14.357 1.00 17.13 ? 205  TRP A O     1 
ATOM   1705 C  CB    . TRP A 1 205 ? -22.701 -17.636 12.284 1.00 15.93 ? 205  TRP A CB    1 
ATOM   1706 C  CG    . TRP A 1 205 ? -22.160 -16.575 13.209 1.00 18.07 ? 205  TRP A CG    1 
ATOM   1707 C  CD1   . TRP A 1 205 ? -22.764 -15.406 13.561 1.00 19.94 ? 205  TRP A CD1   1 
ATOM   1708 C  CD2   . TRP A 1 205 ? -20.869 -16.560 13.833 1.00 18.45 ? 205  TRP A CD2   1 
ATOM   1709 N  NE1   . TRP A 1 205 ? -21.942 -14.671 14.382 1.00 18.06 ? 205  TRP A NE1   1 
ATOM   1710 C  CE2   . TRP A 1 205 ? -20.775 -15.359 14.571 1.00 17.99 ? 205  TRP A CE2   1 
ATOM   1711 C  CE3   . TRP A 1 205 ? -19.789 -17.453 13.852 1.00 17.75 ? 205  TRP A CE3   1 
ATOM   1712 C  CZ2   . TRP A 1 205 ? -19.638 -15.022 15.313 1.00 17.51 ? 205  TRP A CZ2   1 
ATOM   1713 C  CZ3   . TRP A 1 205 ? -18.655 -17.117 14.594 1.00 18.75 ? 205  TRP A CZ3   1 
ATOM   1714 C  CH2   . TRP A 1 205 ? -18.594 -15.914 15.317 1.00 17.42 ? 205  TRP A CH2   1 
ATOM   1715 N  N     . GLN A 1 206 ? -25.847 -17.599 12.182 1.00 17.91 ? 206  GLN A N     1 
ATOM   1716 C  CA    . GLN A 1 206 ? -27.132 -16.938 12.402 0.50 19.16 ? 206  GLN A CA    1 
ATOM   1717 C  C     . GLN A 1 206 ? -28.074 -17.798 13.239 1.00 20.89 ? 206  GLN A C     1 
ATOM   1718 O  O     . GLN A 1 206 ? -28.789 -17.280 14.101 1.00 21.96 ? 206  GLN A O     1 
ATOM   1719 C  CB    . GLN A 1 206 ? -27.771 -16.513 11.075 0.50 19.02 ? 206  GLN A CB    1 
ATOM   1720 C  CG    . GLN A 1 206 ? -26.996 -15.402 10.399 0.50 25.16 ? 206  GLN A CG    1 
ATOM   1721 C  CD    . GLN A 1 206 ? -27.810 -14.616 9.399  0.50 26.70 ? 206  GLN A CD    1 
ATOM   1722 O  OE1   . GLN A 1 206 ? -27.380 -13.561 8.943  0.50 26.94 ? 206  GLN A OE1   1 
ATOM   1723 N  NE2   . GLN A 1 206 ? -28.994 -15.119 9.055  0.50 30.53 ? 206  GLN A NE2   1 
ATOM   1724 N  N     . GLN A 1 207 ? -28.054 -19.108 13.003 1.00 20.50 ? 207  GLN A N     1 
ATOM   1725 C  CA    . GLN A 1 207 ? -28.868 -20.048 13.769 1.00 23.16 ? 207  GLN A CA    1 
ATOM   1726 C  C     . GLN A 1 207 ? -28.361 -20.223 15.193 1.00 22.00 ? 207  GLN A C     1 
ATOM   1727 O  O     . GLN A 1 207 ? -29.158 -20.363 16.123 1.00 22.75 ? 207  GLN A O     1 
ATOM   1728 C  CB    . GLN A 1 207 ? -28.933 -21.414 13.075 1.00 24.68 ? 207  GLN A CB    1 
ATOM   1729 C  CG    . GLN A 1 207 ? -29.900 -21.478 11.895 1.00 33.68 ? 207  GLN A CG    1 
ATOM   1730 C  CD    . GLN A 1 207 ? -31.325 -21.082 12.269 1.00 40.90 ? 207  GLN A CD    1 
ATOM   1731 O  OE1   . GLN A 1 207 ? -31.865 -21.531 13.284 1.00 43.70 ? 207  GLN A OE1   1 
ATOM   1732 N  NE2   . GLN A 1 207 ? -31.937 -20.235 11.446 1.00 42.59 ? 207  GLN A NE2   1 
ATOM   1733 N  N     . LYS A 1 208 ? -27.039 -20.207 15.359 1.00 20.78 ? 208  LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 208 ? -26.409 -20.490 16.650 1.00 20.25 ? 208  LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 208 ? -25.422 -19.385 16.990 1.00 18.61 ? 208  LYS A C     1 
ATOM   1736 O  O     . LYS A 1 208 ? -24.215 -19.615 17.042 1.00 17.71 ? 208  LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 208 ? -25.699 -21.845 16.610 1.00 20.08 ? 208  LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 208 ? -26.626 -23.027 16.293 1.00 21.99 ? 208  LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 208 ? -25.838 -24.291 16.004 1.00 23.52 ? 208  LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 208 ? -26.714 -25.336 15.310 1.00 27.17 ? 208  LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 208 ? -27.791 -25.844 16.210 1.00 24.49 ? 208  LYS A NZ    1 
ATOM   1742 N  N     . THR A 1 209 ? -25.947 -18.184 17.212 1.00 17.92 ? 209  THR A N     1 
ATOM   1743 C  CA    . THR A 1 209 ? -25.109 -16.994 17.359 1.00 18.28 ? 209  THR A CA    1 
ATOM   1744 C  C     . THR A 1 209 ? -24.410 -16.969 18.710 1.00 16.61 ? 209  THR A C     1 
ATOM   1745 O  O     . THR A 1 209 ? -25.081 -16.944 19.746 1.00 18.48 ? 209  THR A O     1 
ATOM   1746 C  CB    . THR A 1 209 ? -25.937 -15.700 17.154 1.00 20.30 ? 209  THR A CB    1 
ATOM   1747 O  OG1   . THR A 1 209 ? -26.666 -15.805 15.923 1.00 20.81 ? 209  THR A OG1   1 
ATOM   1748 C  CG2   . THR A 1 209 ? -25.024 -14.480 17.096 1.00 19.78 ? 209  THR A CG2   1 
ATOM   1749 N  N     . PRO A 1 210 ? -23.060 -16.978 18.705 1.00 17.15 ? 210  PRO A N     1 
ATOM   1750 C  CA    . PRO A 1 210 ? -22.317 -16.968 19.963 1.00 15.96 ? 210  PRO A CA    1 
ATOM   1751 C  C     . PRO A 1 210 ? -22.703 -15.774 20.827 1.00 14.80 ? 210  PRO A C     1 
ATOM   1752 O  O     . PRO A 1 210 ? -22.943 -14.679 20.311 1.00 16.61 ? 210  PRO A O     1 
ATOM   1753 C  CB    . PRO A 1 210 ? -20.859 -16.832 19.511 1.00 16.10 ? 210  PRO A CB    1 
ATOM   1754 C  CG    . PRO A 1 210 ? -20.849 -17.434 18.125 1.00 17.85 ? 210  PRO A CG    1 
ATOM   1755 C  CD    . PRO A 1 210 ? -22.157 -17.008 17.534 1.00 16.32 ? 210  PRO A CD    1 
ATOM   1756 N  N     . VAL A 1 211 ? -22.787 -16.008 22.128 1.00 16.78 ? 211  VAL A N     1 
ATOM   1757 C  CA    . VAL A 1 211 ? -22.865 -14.924 23.097 1.00 15.71 ? 211  VAL A CA    1 
ATOM   1758 C  C     . VAL A 1 211 ? -21.434 -14.646 23.565 1.00 17.00 ? 211  VAL A C     1 
ATOM   1759 O  O     . VAL A 1 211 ? -20.930 -13.529 23.412 1.00 17.27 ? 211  VAL A O     1 
ATOM   1760 C  CB    . VAL A 1 211 ? -23.787 -15.276 24.270 1.00 17.28 ? 211  VAL A CB    1 
ATOM   1761 C  CG1   . VAL A 1 211 ? -23.629 -14.257 25.406 1.00 18.95 ? 211  VAL A CG1   1 
ATOM   1762 C  CG2   . VAL A 1 211 ? -25.250 -15.332 23.802 1.00 15.60 ? 211  VAL A CG2   1 
ATOM   1763 N  N     . ILE A 1 212 ? -20.800 -15.673 24.138 1.00 16.25 ? 212  ILE A N     1 
ATOM   1764 C  CA    . ILE A 1 212 ? -19.374 -15.653 24.452 1.00 16.97 ? 212  ILE A CA    1 
ATOM   1765 C  C     . ILE A 1 212 ? -18.633 -16.332 23.310 1.00 17.54 ? 212  ILE A C     1 
ATOM   1766 O  O     . ILE A 1 212 ? -18.951 -17.470 22.936 1.00 18.20 ? 212  ILE A O     1 
ATOM   1767 C  CB    . ILE A 1 212 ? -19.062 -16.389 25.783 1.00 17.01 ? 212  ILE A CB    1 
ATOM   1768 C  CG1   . ILE A 1 212 ? -19.923 -15.835 26.933 1.00 19.66 ? 212  ILE A CG1   1 
ATOM   1769 C  CG2   . ILE A 1 212 ? -17.562 -16.338 26.104 1.00 17.97 ? 212  ILE A CG2   1 
ATOM   1770 C  CD1   . ILE A 1 212 ? -19.737 -14.332 27.216 1.00 18.33 ? 212  ILE A CD1   1 
ATOM   1771 N  N     . LEU A 1 213 ? -17.655 -15.634 22.754 1.00 14.23 ? 213  LEU A N     1 
ATOM   1772 C  CA    . LEU A 1 213 ? -16.862 -16.190 21.669 1.00 16.10 ? 213  LEU A CA    1 
ATOM   1773 C  C     . LEU A 1 213 ? -15.417 -16.293 22.108 1.00 16.27 ? 213  LEU A C     1 
ATOM   1774 O  O     . LEU A 1 213 ? -14.806 -15.300 22.506 1.00 16.17 ? 213  LEU A O     1 
ATOM   1775 C  CB    . LEU A 1 213 ? -16.999 -15.322 20.407 1.00 15.99 ? 213  LEU A CB    1 
ATOM   1776 C  CG    . LEU A 1 213 ? -16.276 -15.790 19.139 1.00 17.02 ? 213  LEU A CG    1 
ATOM   1777 C  CD1   . LEU A 1 213 ? -16.717 -17.192 18.729 1.00 17.00 ? 213  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU A 1 213 ? -16.502 -14.786 17.994 1.00 19.91 ? 213  LEU A CD2   1 
ATOM   1779 N  N     . THR A 1 214 ? -14.871 -17.502 22.049 1.00 16.91 ? 214  THR A N     1 
ATOM   1780 C  CA    . THR A 1 214 ? -13.517 -17.733 22.528 1.00 16.33 ? 214  THR A CA    1 
ATOM   1781 C  C     . THR A 1 214 ? -12.751 -18.682 21.603 1.00 16.28 ? 214  THR A C     1 
ATOM   1782 O  O     . THR A 1 214 ? -13.245 -19.066 20.538 1.00 15.14 ? 214  THR A O     1 
ATOM   1783 C  CB    . THR A 1 214 ? -13.516 -18.213 24.022 1.00 17.28 ? 214  THR A CB    1 
ATOM   1784 O  OG1   . THR A 1 214 ? -12.179 -18.208 24.535 1.00 17.35 ? 214  THR A OG1   1 
ATOM   1785 C  CG2   . THR A 1 214 ? -14.090 -19.603 24.158 1.00 21.21 ? 214  THR A CG2   1 
ATOM   1786 N  N     . GLY A 1 215 ? -11.542 -19.045 22.015 1.00 17.36 ? 215  GLY A N     1 
ATOM   1787 C  CA    . GLY A 1 215 ? -10.638 -19.855 21.205 1.00 16.64 ? 215  GLY A CA    1 
ATOM   1788 C  C     . GLY A 1 215 ? -9.244  -19.351 21.508 1.00 19.00 ? 215  GLY A C     1 
ATOM   1789 O  O     . GLY A 1 215 ? -9.045  -18.675 22.509 1.00 20.29 ? 215  GLY A O     1 
ATOM   1790 N  N     . TRP A 1 216 ? -8.280  -19.666 20.651 1.00 18.09 ? 216  TRP A N     1 
ATOM   1791 C  CA    . TRP A 1 216 ? -6.896  -19.274 20.913 1.00 18.93 ? 216  TRP A CA    1 
ATOM   1792 C  C     . TRP A 1 216 ? -6.422  -18.300 19.840 1.00 19.58 ? 216  TRP A C     1 
ATOM   1793 O  O     . TRP A 1 216 ? -6.317  -18.658 18.663 1.00 20.95 ? 216  TRP A O     1 
ATOM   1794 C  CB    . TRP A 1 216 ? -5.992  -20.510 21.012 1.00 21.28 ? 216  TRP A CB    1 
ATOM   1795 C  CG    . TRP A 1 216 ? -4.707  -20.268 21.758 1.00 20.42 ? 216  TRP A CG    1 
ATOM   1796 C  CD1   . TRP A 1 216 ? -3.476  -20.023 21.213 1.00 22.43 ? 216  TRP A CD1   1 
ATOM   1797 C  CD2   . TRP A 1 216 ? -4.525  -20.264 23.179 1.00 20.10 ? 216  TRP A CD2   1 
ATOM   1798 N  NE1   . TRP A 1 216 ? -2.542  -19.857 22.207 1.00 22.97 ? 216  TRP A NE1   1 
ATOM   1799 C  CE2   . TRP A 1 216 ? -3.156  -19.993 23.424 1.00 23.45 ? 216  TRP A CE2   1 
ATOM   1800 C  CE3   . TRP A 1 216 ? -5.384  -20.451 24.269 1.00 21.32 ? 216  TRP A CE3   1 
ATOM   1801 C  CZ2   . TRP A 1 216 ? -2.624  -19.912 24.717 1.00 23.03 ? 216  TRP A CZ2   1 
ATOM   1802 C  CZ3   . TRP A 1 216 ? -4.852  -20.371 25.563 1.00 24.46 ? 216  TRP A CZ3   1 
ATOM   1803 C  CH2   . TRP A 1 216 ? -3.482  -20.102 25.771 1.00 22.80 ? 216  TRP A CH2   1 
ATOM   1804 N  N     . ASN A 1 217 ? -6.157  -17.059 20.257 1.00 18.94 ? 217  ASN A N     1 
ATOM   1805 C  CA    . ASN A 1 217 ? -5.854  -15.946 19.345 1.00 18.92 ? 217  ASN A CA    1 
ATOM   1806 C  C     . ASN A 1 217 ? -7.012  -15.586 18.413 1.00 18.40 ? 217  ASN A C     1 
ATOM   1807 O  O     . ASN A 1 217 ? -6.791  -15.065 17.320 1.00 20.76 ? 217  ASN A O     1 
ATOM   1808 C  CB    . ASN A 1 217 ? -4.577  -16.201 18.526 1.00 21.56 ? 217  ASN A CB    1 
ATOM   1809 C  CG    . ASN A 1 217 ? -3.322  -16.010 19.332 1.00 25.57 ? 217  ASN A CG    1 
ATOM   1810 O  OD1   . ASN A 1 217 ? -3.149  -14.994 20.003 1.00 26.98 ? 217  ASN A OD1   1 
ATOM   1811 N  ND2   . ASN A 1 217 ? -2.425  -16.989 19.267 1.00 27.22 ? 217  ASN A ND2   1 
ATOM   1812 N  N     . VAL A 1 218 ? -8.246  -15.859 18.839 1.00 17.74 ? 218  VAL A N     1 
ATOM   1813 C  CA    . VAL A 1 218 ? -9.410  -15.524 18.006 1.00 17.73 ? 218  VAL A CA    1 
ATOM   1814 C  C     . VAL A 1 218 ? -9.585  -14.024 17.761 1.00 19.32 ? 218  VAL A C     1 
ATOM   1815 O  O     . VAL A 1 218 ? -9.941  -13.624 16.656 1.00 18.99 ? 218  VAL A O     1 
ATOM   1816 C  CB    . VAL A 1 218 ? -10.735 -16.167 18.509 1.00 19.04 ? 218  VAL A CB    1 
ATOM   1817 C  CG1   . VAL A 1 218 ? -10.676 -17.678 18.339 1.00 18.74 ? 218  VAL A CG1   1 
ATOM   1818 C  CG2   . VAL A 1 218 ? -11.043 -15.778 19.956 1.00 19.00 ? 218  VAL A CG2   1 
ATOM   1819 N  N     . GLU A 1 219 ? -9.307  -13.196 18.771 1.00 19.54 ? 219  GLU A N     1 
ATOM   1820 C  CA    . GLU A 1 219 ? -9.470  -11.747 18.626 1.00 19.58 ? 219  GLU A CA    1 
ATOM   1821 C  C     . GLU A 1 219 ? -8.427  -11.143 17.684 1.00 20.80 ? 219  GLU A C     1 
ATOM   1822 O  O     . GLU A 1 219 ? -8.726  -10.217 16.925 1.00 19.64 ? 219  GLU A O     1 
ATOM   1823 C  CB    . GLU A 1 219 ? -9.455  -11.032 19.988 1.00 22.71 ? 219  GLU A CB    1 
ATOM   1824 C  CG    . GLU A 1 219 ? -9.978  -9.591  19.923 1.00 22.43 ? 219  GLU A CG    1 
ATOM   1825 C  CD    . GLU A 1 219 ? -9.950  -8.877  21.263 1.00 28.08 ? 219  GLU A CD    1 
ATOM   1826 O  OE1   . GLU A 1 219 ? -11.043 -8.545  21.773 1.00 29.05 ? 219  GLU A OE1   1 
ATOM   1827 O  OE2   . GLU A 1 219 ? -8.843  -8.646  21.802 1.00 26.46 ? 219  GLU A OE2   1 
ATOM   1828 N  N     . SER A 1 220 ? -7.209  -11.673 17.731 1.00 21.11 ? 220  SER A N     1 
ATOM   1829 C  CA    . SER A 1 220 ? -6.112  -11.143 16.919 1.00 21.20 ? 220  SER A CA    1 
ATOM   1830 C  C     . SER A 1 220 ? -5.969  -11.811 15.552 1.00 22.97 ? 220  SER A C     1 
ATOM   1831 O  O     . SER A 1 220 ? -5.444  -11.196 14.623 1.00 24.40 ? 220  SER A O     1 
ATOM   1832 C  CB    . SER A 1 220 ? -4.789  -11.213 17.685 1.00 22.06 ? 220  SER A CB    1 
ATOM   1833 O  OG    . SER A 1 220 ? -4.466  -12.556 18.010 1.00 25.87 ? 220  SER A OG    1 
ATOM   1834 N  N     . PHE A 1 221 ? -6.426  -13.057 15.425 1.00 20.36 ? 221  PHE A N     1 
ATOM   1835 C  CA    . PHE A 1 221 ? -6.324  -13.775 14.149 1.00 20.27 ? 221  PHE A CA    1 
ATOM   1836 C  C     . PHE A 1 221 ? -7.651  -14.264 13.567 1.00 19.80 ? 221  PHE A C     1 
ATOM   1837 O  O     . PHE A 1 221 ? -8.079  -13.769 12.528 1.00 18.44 ? 221  PHE A O     1 
ATOM   1838 C  CB    . PHE A 1 221 ? -5.311  -14.931 14.195 1.00 21.30 ? 221  PHE A CB    1 
ATOM   1839 C  CG    . PHE A 1 221 ? -5.173  -15.653 12.875 1.00 23.26 ? 221  PHE A CG    1 
ATOM   1840 C  CD1   . PHE A 1 221 ? -5.775  -16.895 12.677 1.00 24.04 ? 221  PHE A CD1   1 
ATOM   1841 C  CD2   . PHE A 1 221 ? -4.474  -15.070 11.816 1.00 24.04 ? 221  PHE A CD2   1 
ATOM   1842 C  CE1   . PHE A 1 221 ? -5.668  -17.557 11.448 1.00 24.39 ? 221  PHE A CE1   1 
ATOM   1843 C  CE2   . PHE A 1 221 ? -4.360  -15.727 10.581 1.00 23.50 ? 221  PHE A CE2   1 
ATOM   1844 C  CZ    . PHE A 1 221 ? -4.956  -16.968 10.401 1.00 24.12 ? 221  PHE A CZ    1 
ATOM   1845 N  N     . ALA A 1 222 ? -8.276  -15.248 14.213 1.00 17.77 ? 222  ALA A N     1 
ATOM   1846 C  CA    . ALA A 1 222 ? -9.427  -15.939 13.614 1.00 18.55 ? 222  ALA A CA    1 
ATOM   1847 C  C     . ALA A 1 222 ? -10.568 -14.998 13.225 1.00 17.10 ? 222  ALA A C     1 
ATOM   1848 O  O     . ALA A 1 222 ? -11.060 -15.064 12.101 1.00 17.58 ? 222  ALA A O     1 
ATOM   1849 C  CB    . ALA A 1 222 ? -9.932  -17.068 14.515 1.00 18.64 ? 222  ALA A CB    1 
ATOM   1850 N  N     . ILE A 1 223 ? -10.975 -14.122 14.139 1.00 16.54 ? 223  ILE A N     1 
ATOM   1851 C  CA    . ILE A 1 223 ? -12.101 -13.224 13.875 1.00 17.10 ? 223  ILE A CA    1 
ATOM   1852 C  C     . ILE A 1 223 ? -11.785 -12.222 12.753 1.00 15.97 ? 223  ILE A C     1 
ATOM   1853 O  O     . ILE A 1 223 ? -12.562 -12.124 11.797 1.00 17.33 ? 223  ILE A O     1 
ATOM   1854 C  CB    . ILE A 1 223 ? -12.627 -12.528 15.157 1.00 16.72 ? 223  ILE A CB    1 
ATOM   1855 C  CG1   . ILE A 1 223 ? -13.159 -13.594 16.134 1.00 17.21 ? 223  ILE A CG1   1 
ATOM   1856 C  CG2   . ILE A 1 223 ? -13.718 -11.508 14.807 1.00 18.88 ? 223  ILE A CG2   1 
ATOM   1857 C  CD1   . ILE A 1 223 ? -13.310 -13.120 17.568 1.00 17.77 ? 223  ILE A CD1   1 
ATOM   1858 N  N     . PRO A 1 224 ? -10.649 -11.495 12.849 1.00 17.38 ? 224  PRO A N     1 
ATOM   1859 C  CA    . PRO A 1 224 ? -10.352 -10.587 11.743 1.00 18.17 ? 224  PRO A CA    1 
ATOM   1860 C  C     . PRO A 1 224 ? -10.160 -11.317 10.421 1.00 16.63 ? 224  PRO A C     1 
ATOM   1861 O  O     . PRO A 1 224 ? -10.555 -10.785 9.381  1.00 17.15 ? 224  PRO A O     1 
ATOM   1862 C  CB    . PRO A 1 224 ? -9.048  -9.891  12.169 1.00 19.40 ? 224  PRO A CB    1 
ATOM   1863 C  CG    . PRO A 1 224 ? -8.552  -10.630 13.344 1.00 23.25 ? 224  PRO A CG    1 
ATOM   1864 C  CD    . PRO A 1 224 ? -9.735  -11.278 13.985 1.00 18.29 ? 224  PRO A CD    1 
ATOM   1865 N  N     . TYR A 1 225 ? -9.581  -12.520 10.451 1.00 16.36 ? 225  TYR A N     1 
ATOM   1866 C  CA    . TYR A 1 225 ? -9.373  -13.247 9.194  1.00 16.79 ? 225  TYR A CA    1 
ATOM   1867 C  C     . TYR A 1 225 ? -10.702 -13.611 8.539  1.00 17.53 ? 225  TYR A C     1 
ATOM   1868 O  O     . TYR A 1 225 ? -10.896 -13.369 7.345  1.00 18.18 ? 225  TYR A O     1 
ATOM   1869 C  CB    . TYR A 1 225 ? -8.490  -14.496 9.343  1.00 15.83 ? 225  TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1 225 ? -7.865  -14.860 8.013  1.00 18.49 ? 225  TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1 225 ? -8.584  -15.569 7.052  1.00 19.11 ? 225  TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1 225 ? -6.571  -14.447 7.697  1.00 20.01 ? 225  TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1 225 ? -8.026  -15.869 5.807  1.00 18.28 ? 225  TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1 225 ? -6.001  -14.741 6.466  1.00 19.85 ? 225  TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1 225 ? -6.736  -15.448 5.526  1.00 19.56 ? 225  TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1 225 ? -6.180  -15.743 4.308  1.00 21.28 ? 225  TYR A OH    1 
ATOM   1877 N  N     . VAL A 1 226 ? -11.601 -14.201 9.323  1.00 16.83 ? 226  VAL A N     1 
ATOM   1878 C  CA    . VAL A 1 226 ? -12.918 -14.608 8.820  1.00 16.02 ? 226  VAL A CA    1 
ATOM   1879 C  C     . VAL A 1 226 ? -13.676 -13.388 8.299  1.00 16.35 ? 226  VAL A C     1 
ATOM   1880 O  O     . VAL A 1 226 ? -14.182 -13.401 7.171  1.00 14.94 ? 226  VAL A O     1 
ATOM   1881 C  CB    . VAL A 1 226 ? -13.748 -15.351 9.900  1.00 15.95 ? 226  VAL A CB    1 
ATOM   1882 C  CG1   . VAL A 1 226 ? -15.168 -15.618 9.404  1.00 19.16 ? 226  VAL A CG1   1 
ATOM   1883 C  CG2   . VAL A 1 226 ? -13.078 -16.681 10.289 1.00 17.38 ? 226  VAL A CG2   1 
ATOM   1884 N  N     . TYR A 1 227 ? -13.723 -12.330 9.110  1.00 15.52 ? 227  TYR A N     1 
ATOM   1885 C  CA    . TYR A 1 227 ? -14.400 -11.094 8.724  1.00 15.96 ? 227  TYR A CA    1 
ATOM   1886 C  C     . TYR A 1 227 ? -13.851 -10.530 7.408  1.00 16.90 ? 227  TYR A C     1 
ATOM   1887 O  O     . TYR A 1 227 ? -14.613 -10.247 6.482  1.00 17.03 ? 227  TYR A O     1 
ATOM   1888 C  CB    . TYR A 1 227 ? -14.303 -10.046 9.837  1.00 15.04 ? 227  TYR A CB    1 
ATOM   1889 C  CG    . TYR A 1 227 ? -15.035 -8.766  9.511  1.00 17.85 ? 227  TYR A CG    1 
ATOM   1890 C  CD1   . TYR A 1 227 ? -16.407 -8.658  9.722  1.00 19.76 ? 227  TYR A CD1   1 
ATOM   1891 C  CD2   . TYR A 1 227 ? -14.358 -7.666  8.979  1.00 21.45 ? 227  TYR A CD2   1 
ATOM   1892 C  CE1   . TYR A 1 227 ? -17.093 -7.488  9.414  1.00 20.37 ? 227  TYR A CE1   1 
ATOM   1893 C  CE2   . TYR A 1 227 ? -15.037 -6.489  8.661  1.00 24.91 ? 227  TYR A CE2   1 
ATOM   1894 C  CZ    . TYR A 1 227 ? -16.405 -6.412  8.882  1.00 25.64 ? 227  TYR A CZ    1 
ATOM   1895 O  OH    . TYR A 1 227 ? -17.088 -5.255  8.583  1.00 28.22 ? 227  TYR A OH    1 
ATOM   1896 N  N     . ASN A 1 228 ? -12.530 -10.384 7.326  1.00 17.19 ? 228  ASN A N     1 
ATOM   1897 C  CA    . ASN A 1 228 ? -11.899 -9.822  6.132  1.00 18.54 ? 228  ASN A CA    1 
ATOM   1898 C  C     . ASN A 1 228 ? -11.973 -10.721 4.904  1.00 19.18 ? 228  ASN A C     1 
ATOM   1899 O  O     . ASN A 1 228 ? -12.107 -10.230 3.786  1.00 17.43 ? 228  ASN A O     1 
ATOM   1900 C  CB    . ASN A 1 228 ? -10.464 -9.376  6.429  1.00 19.26 ? 228  ASN A CB    1 
ATOM   1901 C  CG    . ASN A 1 228 ? -10.420 -8.059  7.186  1.00 22.88 ? 228  ASN A CG    1 
ATOM   1902 O  OD1   . ASN A 1 228 ? -11.118 -7.107  6.829  1.00 25.31 ? 228  ASN A OD1   1 
ATOM   1903 N  ND2   . ASN A 1 228 ? -9.614  -8.000  8.243  1.00 21.04 ? 228  ASN A ND2   1 
ATOM   1904 N  N     . ARG A 1 229 ? -11.909 -12.035 5.111  1.00 18.77 ? 229  ARG A N     1 
ATOM   1905 C  CA    . ARG A 1 229 ? -12.027 -12.975 3.998  1.00 18.03 ? 229  ARG A CA    1 
ATOM   1906 C  C     . ARG A 1 229 ? -13.431 -12.929 3.392  1.00 18.59 ? 229  ARG A C     1 
ATOM   1907 O  O     . ARG A 1 229 ? -13.588 -12.885 2.163  1.00 19.18 ? 229  ARG A O     1 
ATOM   1908 C  CB    . ARG A 1 229 ? -11.681 -14.400 4.439  1.00 17.96 ? 229  ARG A CB    1 
ATOM   1909 C  CG    . ARG A 1 229 ? -11.667 -15.419 3.300  1.00 19.41 ? 229  ARG A CG    1 
ATOM   1910 C  CD    . ARG A 1 229 ? -10.516 -15.152 2.328  1.00 19.51 ? 229  ARG A CD    1 
ATOM   1911 N  NE    . ARG A 1 229 ? -10.556 -16.070 1.191  1.00 19.51 ? 229  ARG A NE    1 
ATOM   1912 C  CZ    . ARG A 1 229 ? -9.848  -15.923 0.072  1.00 22.33 ? 229  ARG A CZ    1 
ATOM   1913 N  NH1   . ARG A 1 229 ? -9.028  -14.887 -0.084 1.00 21.39 ? 229  ARG A NH1   1 
ATOM   1914 N  NH2   . ARG A 1 229 ? -9.967  -16.819 -0.902 1.00 19.89 ? 229  ARG A NH2   1 
ATOM   1915 N  N     . ILE A 1 230 ? -14.445 -12.936 4.257  1.00 17.17 ? 230  ILE A N     1 
ATOM   1916 C  CA    . ILE A 1 230 ? -15.838 -12.823 3.808  1.00 17.52 ? 230  ILE A CA    1 
ATOM   1917 C  C     . ILE A 1 230 ? -16.044 -11.462 3.136  1.00 18.68 ? 230  ILE A C     1 
ATOM   1918 O  O     . ILE A 1 230 ? -16.658 -11.376 2.069  1.00 19.14 ? 230  ILE A O     1 
ATOM   1919 C  CB    . ILE A 1 230 ? -16.850 -13.056 4.960  1.00 16.72 ? 230  ILE A CB    1 
ATOM   1920 C  CG1   . ILE A 1 230 ? -16.780 -14.510 5.441  1.00 16.46 ? 230  ILE A CG1   1 
ATOM   1921 C  CG2   . ILE A 1 230 ? -18.283 -12.770 4.492  1.00 17.06 ? 230  ILE A CG2   1 
ATOM   1922 C  CD1   . ILE A 1 230 ? -17.591 -14.784 6.717  1.00 16.88 ? 230  ILE A CD1   1 
ATOM   1923 N  N     . LYS A 1 231 ? -15.490 -10.408 3.736  1.00 16.97 ? 231  LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 231 ? -15.552 -9.077  3.122  1.00 19.23 ? 231  LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 231 ? -14.950 -9.057  1.717  1.00 19.85 ? 231  LYS A C     1 
ATOM   1926 O  O     . LYS A 1 231 ? -15.526 -8.459  0.802  1.00 20.07 ? 231  LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 231 ? -14.867 -8.033  4.005  1.00 19.47 ? 231  LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 231 ? -15.094 -6.597  3.529  1.00 24.99 ? 231  LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 231 ? -14.768 -5.606  4.636  1.00 30.23 ? 231  LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 231 ? -13.364 -5.060  4.502  1.00 34.40 ? 231  LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 231 ? -13.329 -3.963  3.497  1.00 37.65 ? 231  LYS A NZ    1 
ATOM   1932 N  N     . ASN A 1 232 ? -13.797 -9.707  1.555  1.00 21.36 ? 232  ASN A N     1 
ATOM   1933 C  CA    . ASN A 1 232 ? -13.110 -9.748  0.261  1.00 23.40 ? 232  ASN A CA    1 
ATOM   1934 C  C     . ASN A 1 232 ? -13.884 -10.514 -0.805 1.00 23.76 ? 232  ASN A C     1 
ATOM   1935 O  O     . ASN A 1 232 ? -13.933 -10.093 -1.959 1.00 24.73 ? 232  ASN A O     1 
ATOM   1936 C  CB    . ASN A 1 232 ? -11.702 -10.339 0.409  1.00 24.97 ? 232  ASN A CB    1 
ATOM   1937 C  CG    . ASN A 1 232 ? -10.740 -9.392  1.102  1.00 28.26 ? 232  ASN A CG    1 
ATOM   1938 O  OD1   . ASN A 1 232 ? -11.023 -8.205  1.258  1.00 32.63 ? 232  ASN A OD1   1 
ATOM   1939 N  ND2   . ASN A 1 232 ? -9.590  -9.917  1.521  1.00 29.42 ? 232  ASN A ND2   1 
ATOM   1940 N  N     . ILE A 1 233 ? -14.498 -11.626 -0.406 1.00 21.65 ? 233  ILE A N     1 
ATOM   1941 C  CA    . ILE A 1 233 ? -15.224 -12.494 -1.334 1.00 21.62 ? 233  ILE A CA    1 
ATOM   1942 C  C     . ILE A 1 233 ? -16.639 -11.991 -1.621 1.00 22.33 ? 233  ILE A C     1 
ATOM   1943 O  O     . ILE A 1 233 ? -17.085 -12.022 -2.775 1.00 22.54 ? 233  ILE A O     1 
ATOM   1944 C  CB    . ILE A 1 233 ? -15.308 -13.956 -0.813 1.00 21.53 ? 233  ILE A CB    1 
ATOM   1945 C  CG1   . ILE A 1 233 ? -13.914 -14.590 -0.751 1.00 22.82 ? 233  ILE A CG1   1 
ATOM   1946 C  CG2   . ILE A 1 233 ? -16.218 -14.803 -1.712 1.00 24.19 ? 233  ILE A CG2   1 
ATOM   1947 C  CD1   . ILE A 1 233 ? -13.882 -15.925 -0.022 1.00 22.41 ? 233  ILE A CD1   1 
ATOM   1948 N  N     . PHE A 1 234 ? -17.339 -11.543 -0.577 1.00 20.45 ? 234  PHE A N     1 
ATOM   1949 C  CA    . PHE A 1 234 ? -18.767 -11.212 -0.690 1.00 20.93 ? 234  PHE A CA    1 
ATOM   1950 C  C     . PHE A 1 234 ? -19.125 -9.734  -0.544 1.00 20.33 ? 234  PHE A C     1 
ATOM   1951 O  O     . PHE A 1 234 ? -20.217 -9.325  -0.933 1.00 21.60 ? 234  PHE A O     1 
ATOM   1952 C  CB    . PHE A 1 234 ? -19.584 -12.008 0.335  1.00 21.57 ? 234  PHE A CB    1 
ATOM   1953 C  CG    . PHE A 1 234 ? -19.504 -13.500 0.160  1.00 20.88 ? 234  PHE A CG    1 
ATOM   1954 C  CD1   . PHE A 1 234 ? -18.673 -14.259 0.974  1.00 22.29 ? 234  PHE A CD1   1 
ATOM   1955 C  CD2   . PHE A 1 234 ? -20.269 -14.148 -0.809 1.00 23.43 ? 234  PHE A CD2   1 
ATOM   1956 C  CE1   . PHE A 1 234 ? -18.600 -15.647 0.826  1.00 22.76 ? 234  PHE A CE1   1 
ATOM   1957 C  CE2   . PHE A 1 234 ? -20.203 -15.530 -0.965 1.00 23.23 ? 234  PHE A CE2   1 
ATOM   1958 C  CZ    . PHE A 1 234 ? -19.365 -16.279 -0.145 1.00 22.58 ? 234  PHE A CZ    1 
ATOM   1959 N  N     . GLY A 1 235 ? -18.230 -8.940  0.033  1.00 20.79 ? 235  GLY A N     1 
ATOM   1960 C  CA    . GLY A 1 235 ? -18.555 -7.547  0.342  1.00 22.96 ? 235  GLY A CA    1 
ATOM   1961 C  C     . GLY A 1 235 ? -18.819 -7.340  1.825  1.00 22.38 ? 235  GLY A C     1 
ATOM   1962 O  O     . GLY A 1 235 ? -19.005 -8.302  2.575  1.00 23.07 ? 235  GLY A O     1 
ATOM   1963 N  N     . GLU A 1 236 ? -18.847 -6.078  2.236  1.00 23.18 ? 236  GLU A N     1 
ATOM   1964 C  CA    . GLU A 1 236 ? -19.009 -5.682  3.643  1.00 26.30 ? 236  GLU A CA    1 
ATOM   1965 C  C     . GLU A 1 236 ? -20.273 -6.176  4.343  1.00 25.12 ? 236  GLU A C     1 
ATOM   1966 O  O     . GLU A 1 236 ? -20.207 -6.623  5.499  1.00 22.71 ? 236  GLU A O     1 
ATOM   1967 C  CB    . GLU A 1 236 ? -18.978 -4.155  3.762  1.00 31.20 ? 236  GLU A CB    1 
ATOM   1968 C  CG    . GLU A 1 236 ? -17.623 -3.564  4.070  1.00 39.69 ? 236  GLU A CG    1 
ATOM   1969 C  CD    . GLU A 1 236 ? -17.724 -2.152  4.630  1.00 45.03 ? 236  GLU A CD    1 
ATOM   1970 O  OE1   . GLU A 1 236 ? -18.523 -1.347  4.103  1.00 47.36 ? 236  GLU A OE1   1 
ATOM   1971 O  OE2   . GLU A 1 236 ? -17.002 -1.848  5.603  1.00 48.69 ? 236  GLU A OE2   1 
ATOM   1972 N  N     . SER A 1 237 ? -21.419 -6.056  3.671  1.00 22.78 ? 237  SER A N     1 
ATOM   1973 C  CA    . SER A 1 237 ? -22.716 -6.366  4.286  1.00 21.06 ? 237  SER A CA    1 
ATOM   1974 C  C     . SER A 1 237 ? -22.786 -7.826  4.734  1.00 21.52 ? 237  SER A C     1 
ATOM   1975 O  O     . SER A 1 237 ? -23.322 -8.136  5.798  1.00 19.74 ? 237  SER A O     1 
ATOM   1976 C  CB    . SER A 1 237 ? -23.876 -6.028  3.336  1.00 21.75 ? 237  SER A CB    1 
ATOM   1977 O  OG    . SER A 1 237 ? -24.004 -6.988  2.293  1.00 21.16 ? 237  SER A OG    1 
ATOM   1978 N  N     . THR A 1 238 ? -22.215 -8.717  3.929  1.00 19.38 ? 238  THR A N     1 
ATOM   1979 C  CA    . THR A 1 238 ? -22.197 -10.140 4.258  1.00 19.86 ? 238  THR A CA    1 
ATOM   1980 C  C     . THR A 1 238 ? -21.281 -10.422 5.455  1.00 19.25 ? 238  THR A C     1 
ATOM   1981 O  O     . THR A 1 238 ? -21.630 -11.204 6.339  1.00 20.29 ? 238  THR A O     1 
ATOM   1982 C  CB    . THR A 1 238 ? -21.810 -10.977 3.017  1.00 18.90 ? 238  THR A CB    1 
ATOM   1983 O  OG1   . THR A 1 238 ? -22.750 -10.707 1.972  1.00 21.56 ? 238  THR A OG1   1 
ATOM   1984 C  CG2   . THR A 1 238 ? -21.827 -12.470 3.314  1.00 19.96 ? 238  THR A CG2   1 
ATOM   1985 N  N     . ALA A 1 239 ? -20.127 -9.763  5.493  1.00 18.07 ? 239  ALA A N     1 
ATOM   1986 C  CA    . ALA A 1 239 ? -19.183 -9.945  6.598  1.00 18.86 ? 239  ALA A CA    1 
ATOM   1987 C  C     . ALA A 1 239 ? -19.794 -9.482  7.918  1.00 18.57 ? 239  ALA A C     1 
ATOM   1988 O  O     . ALA A 1 239 ? -19.526 -10.064 8.973  1.00 17.29 ? 239  ALA A O     1 
ATOM   1989 C  CB    . ALA A 1 239 ? -17.870 -9.207  6.313  1.00 18.78 ? 239  ALA A CB    1 
ATOM   1990 N  N     . LYS A 1 240 ? -20.643 -8.459  7.849  1.00 17.00 ? 240  LYS A N     1 
ATOM   1991 C  CA    . LYS A 1 240 ? -21.273 -7.913  9.061  1.00 19.23 ? 240  LYS A CA    1 
ATOM   1992 C  C     . LYS A 1 240 ? -22.334 -8.830  9.676  1.00 17.92 ? 240  LYS A C     1 
ATOM   1993 O  O     . LYS A 1 240 ? -22.823 -8.570  10.769 1.00 17.98 ? 240  LYS A O     1 
ATOM   1994 C  CB    . LYS A 1 240 ? -21.835 -6.516  8.796  1.00 20.21 ? 240  LYS A CB    1 
ATOM   1995 C  CG    . LYS A 1 240 ? -20.741 -5.475  8.606  1.00 21.71 ? 240  LYS A CG    1 
ATOM   1996 C  CD    . LYS A 1 240 ? -21.313 -4.101  8.345  1.00 23.68 ? 240  LYS A CD    1 
ATOM   1997 C  CE    . LYS A 1 240 ? -20.212 -3.103  7.992  1.00 28.74 ? 240  LYS A CE    1 
ATOM   1998 N  NZ    . LYS A 1 240 ? -19.354 -2.798  9.167  1.00 28.97 ? 240  LYS A NZ    1 
ATOM   1999 N  N     . ARG A 1 241 ? -22.654 -9.923  8.988  1.00 17.83 ? 241  ARG A N     1 
ATOM   2000 C  CA    . ARG A 1 241 ? -23.565 -10.937 9.527  1.00 18.23 ? 241  ARG A CA    1 
ATOM   2001 C  C     . ARG A 1 241 ? -22.950 -11.693 10.709 1.00 17.12 ? 241  ARG A C     1 
ATOM   2002 O  O     . ARG A 1 241 ? -23.643 -12.435 11.413 1.00 17.94 ? 241  ARG A O     1 
ATOM   2003 C  CB    . ARG A 1 241 ? -24.023 -11.897 8.426  1.00 18.99 ? 241  ARG A CB    1 
ATOM   2004 C  CG    . ARG A 1 241 ? -24.911 -11.228 7.376  1.00 19.00 ? 241  ARG A CG    1 
ATOM   2005 C  CD    . ARG A 1 241 ? -25.239 -12.178 6.217  1.00 20.29 ? 241  ARG A CD    1 
ATOM   2006 N  NE    . ARG A 1 241 ? -25.783 -13.437 6.716  1.00 19.82 ? 241  ARG A NE    1 
ATOM   2007 C  CZ    . ARG A 1 241 ? -25.783 -14.593 6.061  1.00 20.34 ? 241  ARG A CZ    1 
ATOM   2008 N  NH1   . ARG A 1 241 ? -25.286 -14.686 4.832  1.00 20.29 ? 241  ARG A NH1   1 
ATOM   2009 N  NH2   . ARG A 1 241 ? -26.300 -15.666 6.641  1.00 18.22 ? 241  ARG A NH2   1 
ATOM   2010 N  N     . LEU A 1 242 ? -21.654 -11.486 10.936 1.00 17.54 ? 242  LEU A N     1 
ATOM   2011 C  CA    . LEU A 1 242 ? -21.000 -12.024 12.131 1.00 17.22 ? 242  LEU A CA    1 
ATOM   2012 C  C     . LEU A 1 242 ? -21.483 -11.328 13.406 1.00 18.03 ? 242  LEU A C     1 
ATOM   2013 O  O     . LEU A 1 242 ? -21.274 -11.830 14.519 1.00 18.51 ? 242  LEU A O     1 
ATOM   2014 C  CB    . LEU A 1 242 ? -19.475 -11.938 12.008 1.00 17.52 ? 242  LEU A CB    1 
ATOM   2015 C  CG    . LEU A 1 242 ? -18.840 -12.864 10.966 1.00 18.50 ? 242  LEU A CG    1 
ATOM   2016 C  CD1   . LEU A 1 242 ? -17.375 -12.505 10.780 1.00 22.41 ? 242  LEU A CD1   1 
ATOM   2017 C  CD2   . LEU A 1 242 ? -18.994 -14.335 11.352 1.00 20.13 ? 242  LEU A CD2   1 
ATOM   2018 N  N     . SER A 1 243 ? -22.113 -10.170 13.235 1.00 16.70 ? 243  SER A N     1 
ATOM   2019 C  CA    . SER A 1 243 ? -22.739 -9.444  14.333 1.00 17.32 ? 243  SER A CA    1 
ATOM   2020 C  C     . SER A 1 243 ? -24.247 -9.639  14.269 1.00 19.24 ? 243  SER A C     1 
ATOM   2021 O  O     . SER A 1 243 ? -24.846 -9.427  13.212 1.00 20.65 ? 243  SER A O     1 
ATOM   2022 C  CB    . SER A 1 243 ? -22.416 -7.952  14.227 1.00 19.24 ? 243  SER A CB    1 
ATOM   2023 O  OG    . SER A 1 243 ? -23.342 -7.180  14.975 1.00 18.45 ? 243  SER A OG    1 
ATOM   2024 N  N     . PRO A 1 244 ? -24.878 -10.018 15.398 1.00 19.65 ? 244  PRO A N     1 
ATOM   2025 C  CA    . PRO A 1 244 ? -26.338 -10.185 15.382 1.00 21.05 ? 244  PRO A CA    1 
ATOM   2026 C  C     . PRO A 1 244 ? -27.099 -8.894  15.072 1.00 21.65 ? 244  PRO A C     1 
ATOM   2027 O  O     . PRO A 1 244 ? -28.259 -8.955  14.677 1.00 21.85 ? 244  PRO A O     1 
ATOM   2028 C  CB    . PRO A 1 244 ? -26.664 -10.654 16.804 1.00 21.39 ? 244  PRO A CB    1 
ATOM   2029 C  CG    . PRO A 1 244 ? -25.487 -10.259 17.627 1.00 21.92 ? 244  PRO A CG    1 
ATOM   2030 C  CD    . PRO A 1 244 ? -24.300 -10.345 16.714 1.00 19.40 ? 244  PRO A CD    1 
ATOM   2031 N  N     . HIS A 1 245 ? -26.447 -7.746  15.248 1.00 20.73 ? 245  HIS A N     1 
ATOM   2032 C  CA    . HIS A 1 245 ? -27.067 -6.460  14.932 1.00 21.25 ? 245  HIS A CA    1 
ATOM   2033 C  C     . HIS A 1 245 ? -26.518 -5.849  13.647 1.00 21.81 ? 245  HIS A C     1 
ATOM   2034 O  O     . HIS A 1 245 ? -26.806 -4.693  13.335 1.00 24.05 ? 245  HIS A O     1 
ATOM   2035 C  CB    . HIS A 1 245 ? -26.888 -5.486  16.097 1.00 20.40 ? 245  HIS A CB    1 
ATOM   2036 C  CG    . HIS A 1 245 ? -27.158 -6.097  17.433 1.00 19.22 ? 245  HIS A CG    1 
ATOM   2037 N  ND1   . HIS A 1 245 ? -28.348 -6.717  17.738 1.00 19.77 ? 245  HIS A ND1   1 
ATOM   2038 C  CD2   . HIS A 1 245 ? -26.386 -6.193  18.542 1.00 20.89 ? 245  HIS A CD2   1 
ATOM   2039 C  CE1   . HIS A 1 245 ? -28.302 -7.166  18.981 1.00 20.91 ? 245  HIS A CE1   1 
ATOM   2040 N  NE2   . HIS A 1 245 ? -27.122 -6.859  19.490 1.00 19.99 ? 245  HIS A NE2   1 
ATOM   2041 N  N     . ARG A 1 246 ? -25.732 -6.634  12.910 1.00 20.87 ? 246  ARG A N     1 
ATOM   2042 C  CA    . ARG A 1 246 ? -25.118 -6.206  11.640 1.00 23.10 ? 246  ARG A CA    1 
ATOM   2043 C  C     . ARG A 1 246 ? -24.273 -4.939  11.779 1.00 23.86 ? 246  ARG A C     1 
ATOM   2044 O  O     . ARG A 1 246 ? -24.240 -4.091  10.881 1.00 25.01 ? 246  ARG A O     1 
ATOM   2045 C  CB    . ARG A 1 246 ? -26.174 -6.032  10.531 1.00 25.39 ? 246  ARG A CB    1 
ATOM   2046 C  CG    . ARG A 1 246 ? -27.147 -7.198  10.360 1.00 29.23 ? 246  ARG A CG    1 
ATOM   2047 C  CD    . ARG A 1 246 ? -26.445 -8.504  9.993  1.00 30.54 ? 246  ARG A CD    1 
ATOM   2048 N  NE    . ARG A 1 246 ? -27.414 -9.571  9.751  1.00 32.60 ? 246  ARG A NE    1 
ATOM   2049 C  CZ    . ARG A 1 246 ? -27.654 -10.587 10.576 1.00 35.10 ? 246  ARG A CZ    1 
ATOM   2050 N  NH1   . ARG A 1 246 ? -26.980 -10.716 11.717 1.00 30.24 ? 246  ARG A NH1   1 
ATOM   2051 N  NH2   . ARG A 1 246 ? -28.570 -11.489 10.250 1.00 36.20 ? 246  ARG A NH2   1 
ATOM   2052 N  N     . LYS A 1 247 ? -23.600 -4.805  12.916 1.00 22.59 ? 247  LYS A N     1 
ATOM   2053 C  CA    . LYS A 1 247 ? -22.725 -3.672  13.141 1.00 22.80 ? 247  LYS A CA    1 
ATOM   2054 C  C     . LYS A 1 247 ? -21.367 -4.161  13.600 1.00 21.52 ? 247  LYS A C     1 
ATOM   2055 O  O     . LYS A 1 247 ? -21.255 -4.966  14.529 1.00 20.07 ? 247  LYS A O     1 
ATOM   2056 C  CB    . LYS A 1 247 ? -23.322 -2.686  14.148 1.00 24.05 ? 247  LYS A CB    1 
ATOM   2057 C  CG    . LYS A 1 247 ? -22.440 -1.463  14.398 1.00 30.89 ? 247  LYS A CG    1 
ATOM   2058 C  CD    . LYS A 1 247 ? -23.249 -0.262  14.862 1.00 36.55 ? 247  LYS A CD    1 
ATOM   2059 C  CE    . LYS A 1 247 ? -22.394 0.744   15.632 1.00 40.09 ? 247  LYS A CE    1 
ATOM   2060 N  NZ    . LYS A 1 247 ? -21.229 1.255   14.857 1.00 42.57 ? 247  LYS A NZ    1 
ATOM   2061 N  N     . THR A 1 248 ? -20.336 -3.677  12.917 1.00 20.52 ? 248  THR A N     1 
ATOM   2062 C  CA    . THR A 1 248 ? -18.965 -3.996  13.271 1.00 22.12 ? 248  THR A CA    1 
ATOM   2063 C  C     . THR A 1 248 ? -18.145 -2.728  13.144 1.00 25.12 ? 248  THR A C     1 
ATOM   2064 O  O     . THR A 1 248 ? -18.528 -1.795  12.436 1.00 26.56 ? 248  THR A O     1 
ATOM   2065 C  CB    . THR A 1 248 ? -18.351 -5.067  12.337 1.00 21.59 ? 248  THR A CB    1 
ATOM   2066 O  OG1   . THR A 1 248 ? -18.194 -4.519  11.021 1.00 25.55 ? 248  THR A OG1   1 
ATOM   2067 C  CG2   . THR A 1 248 ? -19.219 -6.313  12.267 1.00 20.75 ? 248  THR A CG2   1 
ATOM   2068 N  N     . ARG A 1 249 ? -17.020 -2.684  13.841 1.00 26.41 ? 249  ARG A N     1 
ATOM   2069 C  CA    . ARG A 1 249 ? -16.041 -1.648  13.567 1.00 28.78 ? 249  ARG A CA    1 
ATOM   2070 C  C     . ARG A 1 249 ? -14.631 -2.172  13.738 1.00 27.36 ? 249  ARG A C     1 
ATOM   2071 O  O     . ARG A 1 249 ? -14.373 -3.049  14.568 1.00 25.15 ? 249  ARG A O     1 
ATOM   2072 C  CB    . ARG A 1 249 ? -16.292 -0.376  14.392 1.00 32.69 ? 249  ARG A CB    1 
ATOM   2073 C  CG    . ARG A 1 249 ? -16.169 -0.511  15.896 1.00 37.71 ? 249  ARG A CG    1 
ATOM   2074 C  CD    . ARG A 1 249 ? -16.264 0.866   16.557 1.00 45.27 ? 249  ARG A CD    1 
ATOM   2075 N  NE    . ARG A 1 249 ? -15.246 1.789   16.053 1.00 50.62 ? 249  ARG A NE    1 
ATOM   2076 C  CZ    . ARG A 1 249 ? -14.019 1.918   16.556 1.00 53.08 ? 249  ARG A CZ    1 
ATOM   2077 N  NH1   . ARG A 1 249 ? -13.630 1.186   17.594 1.00 53.55 ? 249  ARG A NH1   1 
ATOM   2078 N  NH2   . ARG A 1 249 ? -13.174 2.787   16.015 1.00 54.26 ? 249  ARG A NH2   1 
ATOM   2079 N  N     . VAL A 1 250 ? -13.731 -1.656  12.913 1.00 26.91 ? 250  VAL A N     1 
ATOM   2080 C  CA    . VAL A 1 250 ? -12.318 -1.916  13.089 1.00 28.17 ? 250  VAL A CA    1 
ATOM   2081 C  C     . VAL A 1 250 ? -11.876 -1.103  14.300 1.00 27.67 ? 250  VAL A C     1 
ATOM   2082 O  O     . VAL A 1 250 ? -12.045 0.118   14.328 1.00 30.13 ? 250  VAL A O     1 
ATOM   2083 C  CB    . VAL A 1 250 ? -11.503 -1.511  11.845 1.00 29.27 ? 250  VAL A CB    1 
ATOM   2084 C  CG1   . VAL A 1 250 ? -10.007 -1.642  12.117 1.00 32.02 ? 250  VAL A CG1   1 
ATOM   2085 C  CG2   . VAL A 1 250 ? -11.909 -2.356  10.635 1.00 29.97 ? 250  VAL A CG2   1 
ATOM   2086 N  N     . LYS A 1 251 ? -11.350 -1.785  15.311 1.00 26.92 ? 251  LYS A N     1 
ATOM   2087 C  CA    . LYS A 1 251 ? -10.811 -1.112  16.485 1.00 27.85 ? 251  LYS A CA    1 
ATOM   2088 C  C     . LYS A 1 251 ? -9.292  -1.170  16.463 1.00 27.10 ? 251  LYS A C     1 
ATOM   2089 O  O     . LYS A 1 251 ? -8.704  -2.248  16.323 1.00 26.07 ? 251  LYS A O     1 
ATOM   2090 C  CB    . LYS A 1 251 ? -11.344 -1.741  17.772 1.00 27.89 ? 251  LYS A CB    1 
ATOM   2091 C  CG    . LYS A 1 251 ? -10.939 -0.991  19.036 1.00 30.17 ? 251  LYS A CG    1 
ATOM   2092 C  CD    . LYS A 1 251 ? -11.517 -1.659  20.264 1.00 31.84 ? 251  LYS A CD    1 
ATOM   2093 C  CE    . LYS A 1 251 ? -11.144 -0.903  21.526 1.00 35.94 ? 251  LYS A CE    1 
ATOM   2094 N  NZ    . LYS A 1 251 ? -11.738 -1.562  22.718 1.00 36.03 ? 251  LYS A NZ    1 
ATOM   2095 N  N     . VAL A 1 252 ? -8.666  -0.005  16.608 1.00 27.25 ? 252  VAL A N     1 
ATOM   2096 C  CA    . VAL A 1 252 ? -7.216  0.093   16.594 0.50 26.16 ? 252  VAL A CA    1 
ATOM   2097 C  C     . VAL A 1 252 ? -6.723  -0.048  18.021 1.00 27.70 ? 252  VAL A C     1 
ATOM   2098 O  O     . VAL A 1 252 ? -7.028  0.783   18.877 1.00 30.92 ? 252  VAL A O     1 
ATOM   2099 C  CB    . VAL A 1 252 ? -6.728  1.431   15.982 0.50 25.94 ? 252  VAL A CB    1 
ATOM   2100 C  CG1   . VAL A 1 252 ? -5.204  1.500   15.990 0.50 24.74 ? 252  VAL A CG1   1 
ATOM   2101 C  CG2   . VAL A 1 252 ? -7.258  1.600   14.565 0.50 23.21 ? 252  VAL A CG2   1 
ATOM   2102 N  N     . ILE A 1 253 ? -5.990  -1.124  18.275 1.00 27.48 ? 253  ILE A N     1 
ATOM   2103 C  CA    . ILE A 1 253 ? -5.415  -1.377  19.587 1.00 29.14 ? 253  ILE A CA    1 
ATOM   2104 C  C     . ILE A 1 253 ? -3.993  -0.826  19.590 1.00 28.68 ? 253  ILE A C     1 
ATOM   2105 O  O     . ILE A 1 253 ? -3.144  -1.296  18.834 1.00 27.24 ? 253  ILE A O     1 
ATOM   2106 C  CB    . ILE A 1 253 ? -5.422  -2.896  19.938 1.00 28.48 ? 253  ILE A CB    1 
ATOM   2107 C  CG1   . ILE A 1 253 ? -6.851  -3.469  19.959 1.00 29.21 ? 253  ILE A CG1   1 
ATOM   2108 C  CG2   . ILE A 1 253 ? -4.700  -3.162  21.260 1.00 29.35 ? 253  ILE A CG2   1 
ATOM   2109 C  CD1   . ILE A 1 253 ? -7.833  -2.765  20.898 1.00 32.71 ? 253  ILE A CD1   1 
ATOM   2110 N  N     . GLU A 1 254 ? -3.749  0.177   20.430 1.00 30.96 ? 254  GLU A N     1 
ATOM   2111 C  CA    . GLU A 1 254 ? -2.441  0.836   20.495 1.00 34.31 ? 254  GLU A CA    1 
ATOM   2112 C  C     . GLU A 1 254 ? -1.607  0.350   21.675 1.00 35.51 ? 254  GLU A C     1 
ATOM   2113 O  O     . GLU A 1 254 ? -2.122  0.152   22.779 1.00 34.22 ? 254  GLU A O     1 
ATOM   2114 C  CB    . GLU A 1 254 ? -2.601  2.357   20.600 1.00 35.90 ? 254  GLU A CB    1 
ATOM   2115 C  CG    . GLU A 1 254 ? -3.259  3.018   19.394 1.00 37.24 ? 254  GLU A CG    1 
ATOM   2116 C  CD    . GLU A 1 254 ? -3.216  4.542   19.440 1.00 42.86 ? 254  GLU A CD    1 
ATOM   2117 O  OE1   . GLU A 1 254 ? -3.116  5.125   20.544 1.00 44.24 ? 254  GLU A OE1   1 
ATOM   2118 O  OE2   . GLU A 1 254 ? -3.290  5.161   18.359 1.00 46.25 ? 254  GLU A OE2   1 
ATOM   2119 N  N     . ASN A 1 255 ? -0.315  0.158   21.437 1.00 37.08 ? 255  ASN A N     1 
ATOM   2120 C  CA    . ASN A 1 255 ? 0.631   0.030   22.540 1.00 38.65 ? 255  ASN A CA    1 
ATOM   2121 C  C     . ASN A 1 255 ? 1.824   0.962   22.366 1.00 39.42 ? 255  ASN A C     1 
ATOM   2122 O  O     . ASN A 1 255 ? 1.851   1.783   21.446 1.00 38.49 ? 255  ASN A O     1 
ATOM   2123 C  CB    . ASN A 1 255 ? 1.045   -1.435  22.805 1.00 38.95 ? 255  ASN A CB    1 
ATOM   2124 C  CG    . ASN A 1 255 ? 1.860   -2.057  21.672 1.00 41.25 ? 255  ASN A CG    1 
ATOM   2125 O  OD1   . ASN A 1 255 ? 2.699   -1.409  21.039 1.00 41.56 ? 255  ASN A OD1   1 
ATOM   2126 N  ND2   . ASN A 1 255 ? 1.631   -3.346  21.438 1.00 43.19 ? 255  ASN A ND2   1 
ATOM   2127 N  N     . MET A 1 256 ? 2.794   0.833   23.261 1.00 41.63 ? 256  MET A N     1 
ATOM   2128 C  CA    . MET A 1 256 ? 3.959   1.711   23.310 1.00 43.79 ? 256  MET A CA    1 
ATOM   2129 C  C     . MET A 1 256 ? 4.719   1.816   21.976 1.00 43.52 ? 256  MET A C     1 
ATOM   2130 O  O     . MET A 1 256 ? 5.236   2.887   21.641 1.00 42.58 ? 256  MET A O     1 
ATOM   2131 C  CB    . MET A 1 256 ? 4.883   1.234   24.435 1.00 46.71 ? 256  MET A CB    1 
ATOM   2132 C  CG    . MET A 1 256 ? 5.860   2.263   24.981 1.00 52.41 ? 256  MET A CG    1 
ATOM   2133 S  SD    . MET A 1 256 ? 6.294   1.942   26.712 1.00 58.93 ? 256  MET A SD    1 
ATOM   2134 C  CE    . MET A 1 256 ? 6.580   0.167   26.725 1.00 56.32 ? 256  MET A CE    1 
ATOM   2135 N  N     . TYR A 1 257 ? 4.763   0.723   21.211 1.00 41.95 ? 257  TYR A N     1 
ATOM   2136 C  CA    . TYR A 1 257 ? 5.617   0.666   20.015 1.00 42.57 ? 257  TYR A CA    1 
ATOM   2137 C  C     . TYR A 1 257 ? 4.914   0.492   18.663 1.00 40.40 ? 257  TYR A C     1 
ATOM   2138 O  O     . TYR A 1 257 ? 5.574   0.407   17.626 1.00 41.01 ? 257  TYR A O     1 
ATOM   2139 C  CB    . TYR A 1 257 ? 6.746   -0.357  20.210 1.00 44.39 ? 257  TYR A CB    1 
ATOM   2140 C  CG    . TYR A 1 257 ? 7.533   -0.104  21.477 1.00 48.07 ? 257  TYR A CG    1 
ATOM   2141 C  CD1   . TYR A 1 257 ? 7.592   -1.061  22.489 1.00 48.39 ? 257  TYR A CD1   1 
ATOM   2142 C  CD2   . TYR A 1 257 ? 8.187   1.116   21.682 1.00 51.85 ? 257  TYR A CD2   1 
ATOM   2143 C  CE1   . TYR A 1 257 ? 8.302   -0.821  23.666 1.00 51.25 ? 257  TYR A CE1   1 
ATOM   2144 C  CE2   . TYR A 1 257 ? 8.893   1.369   22.855 1.00 53.77 ? 257  TYR A CE2   1 
ATOM   2145 C  CZ    . TYR A 1 257 ? 8.948   0.397   23.843 1.00 54.16 ? 257  TYR A CZ    1 
ATOM   2146 O  OH    . TYR A 1 257 ? 9.656   0.646   25.003 1.00 55.81 ? 257  TYR A OH    1 
ATOM   2147 N  N     . GLY A 1 258 ? 3.585   0.457   18.672 1.00 37.70 ? 258  GLY A N     1 
ATOM   2148 C  CA    . GLY A 1 258 ? 2.822   0.319   17.433 1.00 36.03 ? 258  GLY A CA    1 
ATOM   2149 C  C     . GLY A 1 258 ? 1.360   0.031   17.685 1.00 34.64 ? 258  GLY A C     1 
ATOM   2150 O  O     . GLY A 1 258 ? 0.877   0.165   18.809 1.00 34.53 ? 258  GLY A O     1 
ATOM   2151 N  N     . SER A 1 259 ? 0.649   -0.360  16.632 1.00 34.38 ? 259  SER A N     1 
ATOM   2152 C  CA    . SER A 1 259 ? -0.774  -0.654  16.746 1.00 32.58 ? 259  SER A CA    1 
ATOM   2153 C  C     . SER A 1 259 ? -1.191  -1.836  15.877 1.00 31.20 ? 259  SER A C     1 
ATOM   2154 O  O     . SER A 1 259 ? -0.502  -2.206  14.931 1.00 30.23 ? 259  SER A O     1 
ATOM   2155 C  CB    . SER A 1 259 ? -1.611  0.582   16.402 1.00 33.70 ? 259  SER A CB    1 
ATOM   2156 O  OG    . SER A 1 259 ? -1.554  0.866   15.017 1.00 34.75 ? 259  SER A OG    1 
ATOM   2157 N  N     . ARG A 1 260 ? -2.329  -2.425  16.220 1.00 28.99 ? 260  ARG A N     1 
ATOM   2158 C  CA    . ARG A 1 260 ? -2.884  -3.539  15.468 1.00 28.27 ? 260  ARG A CA    1 
ATOM   2159 C  C     . ARG A 1 260 ? -4.390  -3.348  15.399 1.00 27.04 ? 260  ARG A C     1 
ATOM   2160 O  O     . ARG A 1 260 ? -4.956  -2.578  16.181 1.00 28.99 ? 260  ARG A O     1 
ATOM   2161 C  CB    . ARG A 1 260 ? -2.525  -4.871  16.137 1.00 28.35 ? 260  ARG A CB    1 
ATOM   2162 C  CG    . ARG A 1 260 ? -3.012  -5.008  17.583 1.00 27.23 ? 260  ARG A CG    1 
ATOM   2163 C  CD    . ARG A 1 260 ? -2.449  -6.254  18.234 1.00 27.79 ? 260  ARG A CD    1 
ATOM   2164 N  NE    . ARG A 1 260 ? -2.972  -6.446  19.587 1.00 26.00 ? 260  ARG A NE    1 
ATOM   2165 C  CZ    . ARG A 1 260 ? -4.085  -7.116  19.875 1.00 26.23 ? 260  ARG A CZ    1 
ATOM   2166 N  NH1   . ARG A 1 260 ? -4.804  -7.674  18.904 1.00 24.04 ? 260  ARG A NH1   1 
ATOM   2167 N  NH2   . ARG A 1 260 ? -4.474  -7.244  21.139 1.00 24.05 ? 260  ARG A NH2   1 
ATOM   2168 N  N     . GLU A 1 261 ? -5.034  -4.039  14.465 1.00 25.63 ? 261  GLU A N     1 
ATOM   2169 C  CA    . GLU A 1 261 ? -6.479  -3.927  14.297 1.00 25.06 ? 261  GLU A CA    1 
ATOM   2170 C  C     . GLU A 1 261 ? -7.185  -5.192  14.747 1.00 23.15 ? 261  GLU A C     1 
ATOM   2171 O  O     . GLU A 1 261 ? -6.699  -6.303  14.519 1.00 21.72 ? 261  GLU A O     1 
ATOM   2172 C  CB    . GLU A 1 261 ? -6.833  -3.658  12.834 1.00 26.18 ? 261  GLU A CB    1 
ATOM   2173 C  CG    . GLU A 1 261 ? -6.299  -2.345  12.289 1.00 32.57 ? 261  GLU A CG    1 
ATOM   2174 C  CD    . GLU A 1 261 ? -6.708  -2.093  10.851 1.00 34.81 ? 261  GLU A CD    1 
ATOM   2175 O  OE1   . GLU A 1 261 ? -7.133  -3.048  10.159 1.00 37.95 ? 261  GLU A OE1   1 
ATOM   2176 O  OE2   . GLU A 1 261 ? -6.604  -0.929  10.417 1.00 38.86 ? 261  GLU A OE2   1 
ATOM   2177 N  N     . ILE A 1 262 ? -8.331  -5.012  15.395 1.00 21.72 ? 262  ILE A N     1 
ATOM   2178 C  CA    . ILE A 1 262 ? -9.254  -6.110  15.662 1.00 21.08 ? 262  ILE A CA    1 
ATOM   2179 C  C     . ILE A 1 262 ? -10.621 -5.702  15.131 1.00 21.59 ? 262  ILE A C     1 
ATOM   2180 O  O     . ILE A 1 262 ? -10.824 -4.545  14.753 1.00 21.99 ? 262  ILE A O     1 
ATOM   2181 C  CB    . ILE A 1 262 ? -9.327  -6.501  17.176 1.00 22.06 ? 262  ILE A CB    1 
ATOM   2182 C  CG1   . ILE A 1 262 ? -9.925  -5.368  18.022 1.00 24.40 ? 262  ILE A CG1   1 
ATOM   2183 C  CG2   . ILE A 1 262 ? -7.951  -6.946  17.690 1.00 23.68 ? 262  ILE A CG2   1 
ATOM   2184 C  CD1   . ILE A 1 262 ? -10.190 -5.750  19.481 1.00 25.92 ? 262  ILE A CD1   1 
ATOM   2185 N  N     . ILE A 1 263 ? -11.549 -6.649  15.079 1.00 20.78 ? 263  ILE A N     1 
ATOM   2186 C  CA    . ILE A 1 263 ? -12.891 -6.354  14.604 1.00 21.61 ? 263  ILE A CA    1 
ATOM   2187 C  C     . ILE A 1 263 ? -13.848 -6.473  15.775 1.00 21.78 ? 263  ILE A C     1 
ATOM   2188 O  O     . ILE A 1 263 ? -13.999 -7.551  16.354 1.00 22.89 ? 263  ILE A O     1 
ATOM   2189 C  CB    . ILE A 1 263 ? -13.334 -7.310  13.463 1.00 22.74 ? 263  ILE A CB    1 
ATOM   2190 C  CG1   . ILE A 1 263 ? -12.282 -7.366  12.343 1.00 27.13 ? 263  ILE A CG1   1 
ATOM   2191 C  CG2   . ILE A 1 263 ? -14.716 -6.913  12.934 1.00 21.56 ? 263  ILE A CG2   1 
ATOM   2192 C  CD1   . ILE A 1 263 ? -11.983 -6.035  11.647 1.00 30.46 ? 263  ILE A CD1   1 
ATOM   2193 N  N     . THR A 1 264 ? -14.475 -5.361  16.136 1.00 19.85 ? 264  THR A N     1 
ATOM   2194 C  CA    . THR A 1 264 ? -15.504 -5.388  17.157 1.00 20.07 ? 264  THR A CA    1 
ATOM   2195 C  C     . THR A 1 264 ? -16.796 -5.880  16.525 1.00 19.23 ? 264  THR A C     1 
ATOM   2196 O  O     . THR A 1 264 ? -17.299 -5.271  15.583 1.00 20.05 ? 264  THR A O     1 
ATOM   2197 C  CB    . THR A 1 264 ? -15.712 -3.999  17.808 1.00 21.54 ? 264  THR A CB    1 
ATOM   2198 O  OG1   . THR A 1 264 ? -14.496 -3.583  18.441 1.00 21.06 ? 264  THR A OG1   1 
ATOM   2199 C  CG2   . THR A 1 264 ? -16.827 -4.045  18.855 1.00 20.49 ? 264  THR A CG2   1 
ATOM   2200 N  N     . LEU A 1 265 ? -17.311 -6.994  17.039 1.00 18.26 ? 265  LEU A N     1 
ATOM   2201 C  CA    . LEU A 1 265 ? -18.594 -7.530  16.595 1.00 18.95 ? 265  LEU A CA    1 
ATOM   2202 C  C     . LEU A 1 265 ? -19.653 -7.130  17.605 1.00 18.34 ? 265  LEU A C     1 
ATOM   2203 O  O     . LEU A 1 265 ? -19.720 -7.693  18.703 1.00 19.85 ? 265  LEU A O     1 
ATOM   2204 C  CB    . LEU A 1 265 ? -18.540 -9.056  16.474 1.00 17.19 ? 265  LEU A CB    1 
ATOM   2205 C  CG    . LEU A 1 265 ? -17.446 -9.663  15.590 1.00 20.29 ? 265  LEU A CG    1 
ATOM   2206 C  CD1   . LEU A 1 265 ? -17.443 -11.177 15.719 1.00 20.85 ? 265  LEU A CD1   1 
ATOM   2207 C  CD2   . LEU A 1 265 ? -17.645 -9.249  14.144 1.00 17.72 ? 265  LEU A CD2   1 
ATOM   2208 N  N     . PHE A 1 266 ? -20.471 -6.143  17.253 1.00 18.99 ? 266  PHE A N     1 
ATOM   2209 C  CA    . PHE A 1 266 ? -21.507 -5.669  18.168 1.00 19.85 ? 266  PHE A CA    1 
ATOM   2210 C  C     . PHE A 1 266 ? -22.479 -6.796  18.472 1.00 19.40 ? 266  PHE A C     1 
ATOM   2211 O  O     . PHE A 1 266 ? -22.925 -7.502  17.567 1.00 18.61 ? 266  PHE A O     1 
ATOM   2212 C  CB    . PHE A 1 266 ? -22.250 -4.464  17.591 1.00 20.67 ? 266  PHE A CB    1 
ATOM   2213 C  CG    . PHE A 1 266 ? -21.500 -3.169  17.731 1.00 26.06 ? 266  PHE A CG    1 
ATOM   2214 C  CD1   . PHE A 1 266 ? -20.370 -2.914  16.961 1.00 27.08 ? 266  PHE A CD1   1 
ATOM   2215 C  CD2   . PHE A 1 266 ? -21.931 -2.199  18.632 1.00 32.70 ? 266  PHE A CD2   1 
ATOM   2216 C  CE1   . PHE A 1 266 ? -19.673 -1.711  17.085 1.00 30.47 ? 266  PHE A CE1   1 
ATOM   2217 C  CE2   . PHE A 1 266 ? -21.240 -0.993  18.768 1.00 34.12 ? 266  PHE A CE2   1 
ATOM   2218 C  CZ    . PHE A 1 266 ? -20.105 -0.752  17.993 1.00 35.69 ? 266  PHE A CZ    1 
ATOM   2219 N  N     . GLY A 1 267 ? -22.773 -6.977  19.754 1.00 17.52 ? 267  GLY A N     1 
ATOM   2220 C  CA    . GLY A 1 267 ? -23.727 -7.994  20.180 1.00 18.14 ? 267  GLY A CA    1 
ATOM   2221 C  C     . GLY A 1 267 ? -23.087 -9.341  20.463 1.00 17.46 ? 267  GLY A C     1 
ATOM   2222 O  O     . GLY A 1 267 ? -23.791 -10.308 20.742 1.00 18.17 ? 267  GLY A O     1 
ATOM   2223 N  N     . ILE A 1 268 ? -21.758 -9.407  20.363 1.00 15.55 ? 268  ILE A N     1 
ATOM   2224 C  CA    . ILE A 1 268 ? -20.999 -10.587 20.799 1.00 16.23 ? 268  ILE A CA    1 
ATOM   2225 C  C     . ILE A 1 268 ? -19.983 -10.174 21.865 1.00 15.80 ? 268  ILE A C     1 
ATOM   2226 O  O     . ILE A 1 268 ? -19.483 -9.052  21.844 1.00 15.82 ? 268  ILE A O     1 
ATOM   2227 C  CB    . ILE A 1 268 ? -20.335 -11.318 19.605 1.00 15.59 ? 268  ILE A CB    1 
ATOM   2228 C  CG1   . ILE A 1 268 ? -21.437 -11.756 18.612 1.00 18.11 ? 268  ILE A CG1   1 
ATOM   2229 C  CG2   . ILE A 1 268 ? -19.485 -12.515 20.075 1.00 17.95 ? 268  ILE A CG2   1 
ATOM   2230 C  CD1   . ILE A 1 268 ? -21.022 -12.736 17.584 1.00 24.55 ? 268  ILE A CD1   1 
ATOM   2231 N  N     . SER A 1 269 ? -19.725 -11.064 22.819 1.00 15.57 ? 269  SER A N     1 
ATOM   2232 C  CA    . SER A 1 269 ? -18.692 -10.832 23.823 1.00 16.12 ? 269  SER A CA    1 
ATOM   2233 C  C     . SER A 1 269 ? -17.496 -11.736 23.553 1.00 15.47 ? 269  SER A C     1 
ATOM   2234 O  O     . SER A 1 269 ? -17.533 -12.933 23.845 1.00 16.52 ? 269  SER A O     1 
ATOM   2235 C  CB    . SER A 1 269 ? -19.235 -11.060 25.240 1.00 15.52 ? 269  SER A CB    1 
ATOM   2236 O  OG    . SER A 1 269 ? -20.105 -10.003 25.615 1.00 17.15 ? 269  SER A OG    1 
ATOM   2237 N  N     . VAL A 1 270 ? -16.436 -11.155 23.000 1.00 14.47 ? 270  VAL A N     1 
ATOM   2238 C  CA    . VAL A 1 270 ? -15.230 -11.918 22.666 1.00 15.38 ? 270  VAL A CA    1 
ATOM   2239 C  C     . VAL A 1 270 ? -14.306 -11.988 23.875 1.00 17.78 ? 270  VAL A C     1 
ATOM   2240 O  O     . VAL A 1 270 ? -13.854 -10.957 24.381 1.00 17.01 ? 270  VAL A O     1 
ATOM   2241 C  CB    . VAL A 1 270 ? -14.504 -11.328 21.443 1.00 17.80 ? 270  VAL A CB    1 
ATOM   2242 C  CG1   . VAL A 1 270 ? -13.201 -12.083 21.156 1.00 17.89 ? 270  VAL A CG1   1 
ATOM   2243 C  CG2   . VAL A 1 270 ? -15.424 -11.381 20.228 1.00 17.01 ? 270  VAL A CG2   1 
ATOM   2244 N  N     . LEU A 1 271 ? -14.074 -13.213 24.346 1.00 16.86 ? 271  LEU A N     1 
ATOM   2245 C  CA    . LEU A 1 271 ? -13.133 -13.488 25.430 1.00 17.94 ? 271  LEU A CA    1 
ATOM   2246 C  C     . LEU A 1 271 ? -12.074 -14.432 24.898 1.00 18.98 ? 271  LEU A C     1 
ATOM   2247 O  O     . LEU A 1 271 ? -12.158 -15.644 25.106 1.00 20.21 ? 271  LEU A O     1 
ATOM   2248 C  CB    . LEU A 1 271 ? -13.833 -14.131 26.631 1.00 20.59 ? 271  LEU A CB    1 
ATOM   2249 C  CG    . LEU A 1 271 ? -14.990 -13.392 27.304 1.00 23.60 ? 271  LEU A CG    1 
ATOM   2250 C  CD1   . LEU A 1 271 ? -15.553 -14.240 28.446 1.00 23.80 ? 271  LEU A CD1   1 
ATOM   2251 C  CD2   . LEU A 1 271 ? -14.532 -12.049 27.815 1.00 22.26 ? 271  LEU A CD2   1 
ATOM   2252 N  N     . ASP A 1 272 ? -11.079 -13.871 24.214 1.00 17.88 ? 272  ASP A N     1 
ATOM   2253 C  CA    . ASP A 1 272 ? -10.006 -14.662 23.619 1.00 17.65 ? 272  ASP A CA    1 
ATOM   2254 C  C     . ASP A 1 272 ? -9.330  -15.432 24.747 1.00 16.53 ? 272  ASP A C     1 
ATOM   2255 O  O     . ASP A 1 272 ? -8.920  -14.830 25.736 1.00 15.13 ? 272  ASP A O     1 
ATOM   2256 C  CB    . ASP A 1 272 ? -9.005  -13.740 22.920 1.00 17.05 ? 272  ASP A CB    1 
ATOM   2257 C  CG    . ASP A 1 272 ? -8.071  -14.482 21.977 1.00 20.74 ? 272  ASP A CG    1 
ATOM   2258 O  OD1   . ASP A 1 272 ? -7.825  -15.691 22.187 1.00 21.13 ? 272  ASP A OD1   1 
ATOM   2259 O  OD2   . ASP A 1 272 ? -7.567  -13.845 21.026 1.00 18.25 ? 272  ASP A OD2   1 
ATOM   2260 N  N     . TYR A 1 273 ? -9.220  -16.754 24.613 1.00 16.98 ? 273  TYR A N     1 
ATOM   2261 C  CA    . TYR A 1 273 ? -8.689  -17.552 25.727 1.00 15.61 ? 273  TYR A CA    1 
ATOM   2262 C  C     . TYR A 1 273 ? -7.222  -17.260 26.046 1.00 15.65 ? 273  TYR A C     1 
ATOM   2263 O  O     . TYR A 1 273 ? -6.815  -17.356 27.200 1.00 16.64 ? 273  TYR A O     1 
ATOM   2264 C  CB    . TYR A 1 273 ? -8.934  -19.068 25.568 1.00 17.91 ? 273  TYR A CB    1 
ATOM   2265 C  CG    . TYR A 1 273 ? -9.223  -19.709 26.911 1.00 16.96 ? 273  TYR A CG    1 
ATOM   2266 C  CD1   . TYR A 1 273 ? -8.184  -20.118 27.754 1.00 19.43 ? 273  TYR A CD1   1 
ATOM   2267 C  CD2   . TYR A 1 273 ? -10.535 -19.854 27.363 1.00 17.89 ? 273  TYR A CD2   1 
ATOM   2268 C  CE1   . TYR A 1 273 ? -8.450  -20.669 29.016 1.00 18.11 ? 273  TYR A CE1   1 
ATOM   2269 C  CE2   . TYR A 1 273 ? -10.815 -20.408 28.616 1.00 17.76 ? 273  TYR A CE2   1 
ATOM   2270 C  CZ    . TYR A 1 273 ? -9.765  -20.809 29.434 1.00 18.06 ? 273  TYR A CZ    1 
ATOM   2271 O  OH    . TYR A 1 273 ? -10.037 -21.350 30.665 1.00 21.11 ? 273  TYR A OH    1 
ATOM   2272 N  N     . ILE A 1 274 ? -6.429  -16.872 25.048 1.00 14.95 ? 274  ILE A N     1 
ATOM   2273 C  CA    . ILE A 1 274 ? -5.040  -16.499 25.336 1.00 16.18 ? 274  ILE A CA    1 
ATOM   2274 C  C     . ILE A 1 274 ? -5.002  -15.299 26.293 1.00 15.21 ? 274  ILE A C     1 
ATOM   2275 O  O     . ILE A 1 274 ? -4.139  -15.212 27.167 1.00 16.77 ? 274  ILE A O     1 
ATOM   2276 C  CB    . ILE A 1 274 ? -4.200  -16.242 24.048 1.00 17.73 ? 274  ILE A CB    1 
ATOM   2277 C  CG1   . ILE A 1 274 ? -2.705  -16.139 24.390 1.00 17.63 ? 274  ILE A CG1   1 
ATOM   2278 C  CG2   . ILE A 1 274 ? -4.688  -14.994 23.288 1.00 18.43 ? 274  ILE A CG2   1 
ATOM   2279 C  CD1   . ILE A 1 274 ? -1.790  -16.150 23.170 1.00 20.54 ? 274  ILE A CD1   1 
ATOM   2280 N  N     . ASP A 1 275 ? -5.958  -14.391 26.133 1.00 15.65 ? 275  ASP A N     1 
ATOM   2281 C  CA    . ASP A 1 275 ? -6.019  -13.205 26.983 1.00 16.68 ? 275  ASP A CA    1 
ATOM   2282 C  C     . ASP A 1 275 ? -6.618  -13.505 28.351 1.00 14.98 ? 275  ASP A C     1 
ATOM   2283 O  O     . ASP A 1 275 ? -6.165  -12.956 29.361 1.00 15.07 ? 275  ASP A O     1 
ATOM   2284 C  CB    . ASP A 1 275 ? -6.742  -12.063 26.265 1.00 17.97 ? 275  ASP A CB    1 
ATOM   2285 C  CG    . ASP A 1 275 ? -5.955  -11.546 25.062 1.00 21.01 ? 275  ASP A CG    1 
ATOM   2286 O  OD1   . ASP A 1 275 ? -4.699  -11.580 25.084 1.00 22.53 ? 275  ASP A OD1   1 
ATOM   2287 O  OD2   . ASP A 1 275 ? -6.594  -11.096 24.096 1.00 22.84 ? 275  ASP A OD2   1 
ATOM   2288 N  N     . LEU A 1 276 ? -7.614  -14.392 28.395 1.00 15.66 ? 276  LEU A N     1 
ATOM   2289 C  CA    . LEU A 1 276 ? -8.110  -14.886 29.680 1.00 14.72 ? 276  LEU A CA    1 
ATOM   2290 C  C     . LEU A 1 276 ? -6.974  -15.562 30.432 1.00 14.66 ? 276  LEU A C     1 
ATOM   2291 O  O     . LEU A 1 276 ? -6.769  -15.311 31.620 1.00 13.79 ? 276  LEU A O     1 
ATOM   2292 C  CB    . LEU A 1 276 ? -9.253  -15.884 29.493 1.00 14.08 ? 276  LEU A CB    1 
ATOM   2293 C  CG    . LEU A 1 276 ? -10.596 -15.397 28.940 1.00 13.37 ? 276  LEU A CG    1 
ATOM   2294 C  CD1   . LEU A 1 276 ? -11.491 -16.603 28.738 1.00 15.72 ? 276  LEU A CD1   1 
ATOM   2295 C  CD2   . LEU A 1 276 ? -11.247 -14.414 29.899 1.00 16.26 ? 276  LEU A CD2   1 
ATOM   2296 N  N     . TYR A 1 277 ? -6.224  -16.397 29.717 1.00 13.58 ? 277  TYR A N     1 
ATOM   2297 C  CA    . TYR A 1 277 ? -5.099  -17.112 30.311 1.00 15.22 ? 277  TYR A CA    1 
ATOM   2298 C  C     . TYR A 1 277 ? -4.044  -16.153 30.874 1.00 14.44 ? 277  TYR A C     1 
ATOM   2299 O  O     . TYR A 1 277 ? -3.635  -16.287 32.021 1.00 15.93 ? 277  TYR A O     1 
ATOM   2300 C  CB    . TYR A 1 277 ? -4.475  -18.086 29.308 1.00 14.87 ? 277  TYR A CB    1 
ATOM   2301 C  CG    . TYR A 1 277 ? -3.464  -19.016 29.934 1.00 17.35 ? 277  TYR A CG    1 
ATOM   2302 C  CD1   . TYR A 1 277 ? -3.861  -20.233 30.496 1.00 16.88 ? 277  TYR A CD1   1 
ATOM   2303 C  CD2   . TYR A 1 277 ? -2.110  -18.672 29.984 1.00 17.46 ? 277  TYR A CD2   1 
ATOM   2304 C  CE1   . TYR A 1 277 ? -2.930  -21.091 31.073 1.00 16.92 ? 277  TYR A CE1   1 
ATOM   2305 C  CE2   . TYR A 1 277 ? -1.175  -19.514 30.567 1.00 16.59 ? 277  TYR A CE2   1 
ATOM   2306 C  CZ    . TYR A 1 277 ? -1.587  -20.721 31.102 1.00 16.33 ? 277  TYR A CZ    1 
ATOM   2307 O  OH    . TYR A 1 277 ? -0.647  -21.550 31.679 1.00 16.99 ? 277  TYR A OH    1 
ATOM   2308 N  N     . LYS A 1 278 ? -3.632  -15.168 30.080 1.00 14.34 ? 278  LYS A N     1 
ATOM   2309 C  CA    . LYS A 1 278 ? -2.647  -14.190 30.533 1.00 16.04 ? 278  LYS A CA    1 
ATOM   2310 C  C     . LYS A 1 278 ? -3.110  -13.390 31.761 1.00 16.98 ? 278  LYS A C     1 
ATOM   2311 O  O     . LYS A 1 278 ? -2.317  -13.118 32.660 1.00 17.20 ? 278  LYS A O     1 
ATOM   2312 C  CB    . LYS A 1 278 ? -2.258  -13.255 29.385 1.00 17.04 ? 278  LYS A CB    1 
ATOM   2313 C  CG    . LYS A 1 278 ? -1.316  -13.914 28.395 1.00 18.47 ? 278  LYS A CG    1 
ATOM   2314 C  CD    . LYS A 1 278 ? -1.159  -13.088 27.129 1.00 20.41 ? 278  LYS A CD    1 
ATOM   2315 C  CE    . LYS A 1 278 ? -0.113  -13.697 26.215 1.00 24.95 ? 278  LYS A CE    1 
ATOM   2316 N  NZ    . LYS A 1 278 ? 0.029   -12.904 24.956 1.00 25.54 ? 278  LYS A NZ    1 
ATOM   2317 N  N     . LYS A 1 279 ? -4.386  -13.026 31.801 1.00 15.88 ? 279  LYS A N     1 
ATOM   2318 C  CA    . LYS A 1 279 ? -4.903  -12.246 32.925 1.00 16.04 ? 279  LYS A CA    1 
ATOM   2319 C  C     . LYS A 1 279 ? -5.092  -13.087 34.187 1.00 16.92 ? 279  LYS A C     1 
ATOM   2320 O  O     . LYS A 1 279 ? -4.732  -12.663 35.291 1.00 17.66 ? 279  LYS A O     1 
ATOM   2321 C  CB    . LYS A 1 279 ? -6.218  -11.543 32.567 1.00 18.68 ? 279  LYS A CB    1 
ATOM   2322 C  CG    . LYS A 1 279 ? -6.726  -10.611 33.692 1.00 21.54 ? 279  LYS A CG    1 
ATOM   2323 C  CD    . LYS A 1 279 ? -8.054  -9.940  33.358 1.00 23.92 ? 279  LYS A CD    1 
ATOM   2324 C  CE    . LYS A 1 279 ? -8.593  -9.158  34.568 1.00 25.95 ? 279  LYS A CE    1 
ATOM   2325 N  NZ    . LYS A 1 279 ? -7.631  -8.140  35.059 1.00 24.36 ? 279  LYS A NZ    1 
ATOM   2326 N  N     . PHE A 1 280 ? -5.658  -14.277 34.020 1.00 16.00 ? 280  PHE A N     1 
ATOM   2327 C  CA    . PHE A 1 280 ? -6.176  -15.038 35.159 1.00 16.08 ? 280  PHE A CA    1 
ATOM   2328 C  C     . PHE A 1 280 ? -5.300  -16.192 35.670 1.00 17.08 ? 280  PHE A C     1 
ATOM   2329 O  O     . PHE A 1 280 ? -5.556  -16.718 36.756 1.00 17.42 ? 280  PHE A O     1 
ATOM   2330 C  CB    . PHE A 1 280 ? -7.569  -15.586 34.824 1.00 15.12 ? 280  PHE A CB    1 
ATOM   2331 C  CG    . PHE A 1 280 ? -8.633  -14.530 34.625 1.00 16.42 ? 280  PHE A CG    1 
ATOM   2332 C  CD1   . PHE A 1 280 ? -9.548  -14.649 33.585 1.00 21.31 ? 280  PHE A CD1   1 
ATOM   2333 C  CD2   . PHE A 1 280 ? -8.764  -13.455 35.505 1.00 19.02 ? 280  PHE A CD2   1 
ATOM   2334 C  CE1   . PHE A 1 280 ? -10.558 -13.700 33.408 1.00 20.58 ? 280  PHE A CE1   1 
ATOM   2335 C  CE2   . PHE A 1 280 ? -9.773  -12.502 35.331 1.00 19.81 ? 280  PHE A CE2   1 
ATOM   2336 C  CZ    . PHE A 1 280 ? -10.666 -12.628 34.282 1.00 22.21 ? 280  PHE A CZ    1 
ATOM   2337 N  N     . SER A 1 281 ? -4.276  -16.582 34.908 1.00 15.61 ? 281  SER A N     1 
ATOM   2338 C  CA    . SER A 1 281 ? -3.495  -17.790 35.236 1.00 15.21 ? 281  SER A CA    1 
ATOM   2339 C  C     . SER A 1 281 ? -2.374  -17.598 36.250 1.00 18.01 ? 281  SER A C     1 
ATOM   2340 O  O     . SER A 1 281 ? -1.964  -18.565 36.904 1.00 18.73 ? 281  SER A O     1 
ATOM   2341 C  CB    . SER A 1 281 ? -2.906  -18.422 33.965 1.00 15.56 ? 281  SER A CB    1 
ATOM   2342 O  OG    . SER A 1 281 ? -1.733  -17.731 33.554 1.00 17.18 ? 281  SER A OG    1 
ATOM   2343 N  N     . PHE A 1 282 ? -1.886  -16.362 36.367 1.00 17.17 ? 282  PHE A N     1 
ATOM   2344 C  CA    . PHE A 1 282 ? -0.691  -16.025 37.157 1.00 22.39 ? 282  PHE A CA    1 
ATOM   2345 C  C     . PHE A 1 282 ? 0.501   -16.923 36.848 1.00 23.83 ? 282  PHE A C     1 
ATOM   2346 O  O     . PHE A 1 282 ? 1.128   -17.515 37.736 1.00 23.46 ? 282  PHE A O     1 
ATOM   2347 C  CB    . PHE A 1 282 ? -1.010  -15.902 38.652 1.00 23.43 ? 282  PHE A CB    1 
ATOM   2348 C  CG    . PHE A 1 282 ? -1.861  -14.705 38.960 1.00 25.92 ? 282  PHE A CG    1 
ATOM   2349 C  CD1   . PHE A 1 282 ? -1.274  -13.494 39.305 1.00 26.19 ? 282  PHE A CD1   1 
ATOM   2350 C  CD2   . PHE A 1 282 ? -3.249  -14.768 38.831 1.00 24.34 ? 282  PHE A CD2   1 
ATOM   2351 C  CE1   . PHE A 1 282 ? -2.055  -12.368 39.556 1.00 28.78 ? 282  PHE A CE1   1 
ATOM   2352 C  CE2   . PHE A 1 282 ? -4.039  -13.649 39.078 1.00 24.75 ? 282  PHE A CE2   1 
ATOM   2353 C  CZ    . PHE A 1 282 ? -3.440  -12.444 39.442 1.00 28.47 ? 282  PHE A CZ    1 
ATOM   2354 N  N     . THR A 1 283 ? 0.777   -17.020 35.551 1.00 24.05 ? 283  THR A N     1 
ATOM   2355 C  CA    . THR A 1 283 ? 1.972   -17.661 35.031 1.00 26.42 ? 283  THR A CA    1 
ATOM   2356 C  C     . THR A 1 283 ? 2.638   -16.626 34.139 1.00 27.46 ? 283  THR A C     1 
ATOM   2357 O  O     . THR A 1 283 ? 1.992   -15.670 33.697 1.00 29.17 ? 283  THR A O     1 
ATOM   2358 C  CB    . THR A 1 283 ? 1.629   -18.889 34.152 1.00 26.20 ? 283  THR A CB    1 
ATOM   2359 O  OG1   . THR A 1 283 ? 0.889   -18.459 33.001 1.00 26.92 ? 283  THR A OG1   1 
ATOM   2360 C  CG2   . THR A 1 283 ? 0.809   -19.926 34.929 1.00 26.69 ? 283  THR A CG2   1 
ATOM   2361 N  N     . ASN A 1 284 ? 3.930   -16.788 33.895 1.00 27.11 ? 284  ASN A N     1 
ATOM   2362 C  CA    . ASN A 1 284 ? 4.562   -16.100 32.777 1.00 26.75 ? 284  ASN A CA    1 
ATOM   2363 C  C     . ASN A 1 284 ? 5.276   -17.179 31.986 1.00 25.03 ? 284  ASN A C     1 
ATOM   2364 O  O     . ASN A 1 284 ? 6.224   -17.790 32.468 1.00 28.23 ? 284  ASN A O     1 
ATOM   2365 C  CB    . ASN A 1 284 ? 5.517   -14.989 33.236 1.00 28.12 ? 284  ASN A CB    1 
ATOM   2366 C  CG    . ASN A 1 284 ? 5.930   -14.051 32.095 1.00 30.68 ? 284  ASN A CG    1 
ATOM   2367 O  OD1   . ASN A 1 284 ? 5.415   -14.135 30.973 1.00 29.97 ? 284  ASN A OD1   1 
ATOM   2368 N  ND2   . ASN A 1 284 ? 6.863   -13.152 32.384 1.00 34.69 ? 284  ASN A ND2   1 
ATOM   2369 N  N     . GLN A 1 285 ? 4.781   -17.434 30.784 1.00 23.67 ? 285  GLN A N     1 
ATOM   2370 C  CA    . GLN A 1 285 ? 5.224   -18.575 29.996 1.00 21.71 ? 285  GLN A CA    1 
ATOM   2371 C  C     . GLN A 1 285 ? 6.253   -18.176 28.942 1.00 22.19 ? 285  GLN A C     1 
ATOM   2372 O  O     . GLN A 1 285 ? 6.150   -17.087 28.365 1.00 25.38 ? 285  GLN A O     1 
ATOM   2373 C  CB    . GLN A 1 285 ? 4.012   -19.225 29.319 1.00 19.90 ? 285  GLN A CB    1 
ATOM   2374 C  CG    . GLN A 1 285 ? 2.929   -19.716 30.290 1.00 21.29 ? 285  GLN A CG    1 
ATOM   2375 C  CD    . GLN A 1 285 ? 3.297   -21.007 31.003 1.00 24.14 ? 285  GLN A CD    1 
ATOM   2376 O  OE1   . GLN A 1 285 ? 4.432   -21.478 30.925 1.00 25.97 ? 285  GLN A OE1   1 
ATOM   2377 N  NE2   . GLN A 1 285 ? 2.329   -21.590 31.706 1.00 20.38 ? 285  GLN A NE2   1 
ATOM   2378 N  N     . PRO A 1 286 ? 7.234   -19.062 28.659 1.00 19.94 ? 286  PRO A N     1 
ATOM   2379 C  CA    . PRO A 1 286 ? 8.211   -18.782 27.595 1.00 22.08 ? 286  PRO A CA    1 
ATOM   2380 C  C     . PRO A 1 286 ? 7.572   -18.727 26.213 1.00 21.11 ? 286  PRO A C     1 
ATOM   2381 O  O     . PRO A 1 286 ? 8.104   -18.077 25.324 1.00 22.46 ? 286  PRO A O     1 
ATOM   2382 C  CB    . PRO A 1 286 ? 9.171   -19.979 27.659 1.00 21.44 ? 286  PRO A CB    1 
ATOM   2383 C  CG    . PRO A 1 286 ? 8.952   -20.602 28.961 1.00 21.70 ? 286  PRO A CG    1 
ATOM   2384 C  CD    . PRO A 1 286 ? 7.545   -20.314 29.374 1.00 21.59 ? 286  PRO A CD    1 
ATOM   2385 N  N     . SER A 1 287 ? 6.438   -19.407 26.048 1.00 22.29 ? 287  SER A N     1 
ATOM   2386 C  CA    . SER A 1 287 ? 5.688   -19.410 24.796 1.00 21.84 ? 287  SER A CA    1 
ATOM   2387 C  C     . SER A 1 287 ? 4.198   -19.474 25.078 1.00 21.70 ? 287  SER A C     1 
ATOM   2388 O  O     . SER A 1 287 ? 3.775   -20.085 26.061 1.00 20.11 ? 287  SER A O     1 
ATOM   2389 C  CB    . SER A 1 287 ? 6.082   -20.611 23.929 1.00 23.92 ? 287  SER A CB    1 
ATOM   2390 O  OG    . SER A 1 287 ? 5.175   -20.773 22.841 1.00 25.94 ? 287  SER A OG    1 
ATOM   2391 N  N     . TYR A 1 288 ? 3.411   -18.846 24.208 1.00 21.91 ? 288  TYR A N     1 
ATOM   2392 C  CA    . TYR A 1 288 ? 1.952   -18.905 24.309 1.00 23.38 ? 288  TYR A CA    1 
ATOM   2393 C  C     . TYR A 1 288 ? 1.290   -19.588 23.117 1.00 23.23 ? 288  TYR A C     1 
ATOM   2394 O  O     . TYR A 1 288 ? 0.117   -19.349 22.821 1.00 24.43 ? 288  TYR A O     1 
ATOM   2395 C  CB    . TYR A 1 288 ? 1.368   -17.511 24.549 1.00 24.48 ? 288  TYR A CB    1 
ATOM   2396 C  CG    . TYR A 1 288 ? 1.649   -17.016 25.942 1.00 23.71 ? 288  TYR A CG    1 
ATOM   2397 C  CD1   . TYR A 1 288 ? 2.795   -16.270 26.217 1.00 25.47 ? 288  TYR A CD1   1 
ATOM   2398 C  CD2   . TYR A 1 288 ? 0.788   -17.320 26.994 1.00 21.35 ? 288  TYR A CD2   1 
ATOM   2399 C  CE1   . TYR A 1 288 ? 3.069   -15.828 27.500 1.00 24.22 ? 288  TYR A CE1   1 
ATOM   2400 C  CE2   . TYR A 1 288 ? 1.049   -16.882 28.278 1.00 23.18 ? 288  TYR A CE2   1 
ATOM   2401 C  CZ    . TYR A 1 288 ? 2.190   -16.138 28.525 1.00 23.03 ? 288  TYR A CZ    1 
ATOM   2402 O  OH    . TYR A 1 288 ? 2.455   -15.701 29.794 1.00 23.04 ? 288  TYR A OH    1 
ATOM   2403 N  N     . SER A 1 289 ? 2.044   -20.447 22.438 1.00 24.97 ? 289  SER A N     1 
ATOM   2404 C  CA    . SER A 1 289 ? 1.453   -21.324 21.440 1.00 25.72 ? 289  SER A CA    1 
ATOM   2405 C  C     . SER A 1 289 ? 0.501   -22.266 22.173 1.00 24.69 ? 289  SER A C     1 
ATOM   2406 O  O     . SER A 1 289 ? 0.726   -22.617 23.343 1.00 22.73 ? 289  SER A O     1 
ATOM   2407 C  CB    . SER A 1 289 ? 2.524   -22.114 20.693 1.00 25.85 ? 289  SER A CB    1 
ATOM   2408 O  OG    . SER A 1 289 ? 3.058   -23.147 21.495 1.00 27.99 ? 289  SER A OG    1 
ATOM   2409 N  N     . LEU A 1 290 ? -0.581  -22.650 21.505 1.00 22.79 ? 290  LEU A N     1 
ATOM   2410 C  CA    . LEU A 1 290 ? -1.528  -23.560 22.133 1.00 21.78 ? 290  LEU A CA    1 
ATOM   2411 C  C     . LEU A 1 290 ? -0.853  -24.880 22.499 1.00 21.57 ? 290  LEU A C     1 
ATOM   2412 O  O     . LEU A 1 290 ? -1.151  -25.450 23.546 1.00 20.72 ? 290  LEU A O     1 
ATOM   2413 C  CB    . LEU A 1 290 ? -2.762  -23.781 21.254 1.00 20.67 ? 290  LEU A CB    1 
ATOM   2414 C  CG    . LEU A 1 290 ? -3.879  -24.634 21.863 1.00 20.85 ? 290  LEU A CG    1 
ATOM   2415 C  CD1   . LEU A 1 290 ? -4.330  -24.100 23.215 1.00 20.16 ? 290  LEU A CD1   1 
ATOM   2416 C  CD2   . LEU A 1 290 ? -5.043  -24.661 20.900 1.00 22.54 ? 290  LEU A CD2   1 
ATOM   2417 N  N     . ASP A 1 291 ? 0.058   -25.349 21.640 1.00 23.62 ? 291  ASP A N     1 
ATOM   2418 C  CA    A ASP A 1 291 ? 0.821   -26.558 21.912 0.50 25.60 ? 291  ASP A CA    1 
ATOM   2419 C  CA    B ASP A 1 291 ? 0.853   -26.553 21.903 0.50 25.16 ? 291  ASP A CA    1 
ATOM   2420 C  C     . ASP A 1 291 ? 1.552   -26.467 23.255 1.00 25.74 ? 291  ASP A C     1 
ATOM   2421 O  O     . ASP A 1 291 ? 1.465   -27.381 24.083 1.00 23.98 ? 291  ASP A O     1 
ATOM   2422 C  CB    A ASP A 1 291 ? 1.821   -26.819 20.782 0.50 28.91 ? 291  ASP A CB    1 
ATOM   2423 C  CB    B ASP A 1 291 ? 1.922   -26.744 20.817 0.50 27.61 ? 291  ASP A CB    1 
ATOM   2424 C  CG    A ASP A 1 291 ? 2.636   -28.066 21.009 0.50 32.07 ? 291  ASP A CG    1 
ATOM   2425 C  CG    B ASP A 1 291 ? 1.477   -27.668 19.702 0.50 29.34 ? 291  ASP A CG    1 
ATOM   2426 O  OD1   A ASP A 1 291 ? 2.046   -29.084 21.423 0.50 36.57 ? 291  ASP A OD1   1 
ATOM   2427 O  OD1   B ASP A 1 291 ? 0.416   -28.311 19.835 0.50 29.72 ? 291  ASP A OD1   1 
ATOM   2428 O  OD2   A ASP A 1 291 ? 3.864   -28.028 20.780 0.50 36.01 ? 291  ASP A OD2   1 
ATOM   2429 O  OD2   B ASP A 1 291 ? 2.206   -27.754 18.690 0.50 29.53 ? 291  ASP A OD2   1 
ATOM   2430 N  N     . TYR A 1 292 ? 2.256   -25.360 23.467 1.00 23.51 ? 292  TYR A N     1 
ATOM   2431 C  CA    . TYR A 1 292 ? 3.039   -25.164 24.679 1.00 22.57 ? 292  TYR A CA    1 
ATOM   2432 C  C     . TYR A 1 292 ? 2.169   -25.121 25.926 1.00 19.72 ? 292  TYR A C     1 
ATOM   2433 O  O     . TYR A 1 292 ? 2.470   -25.775 26.933 1.00 19.66 ? 292  TYR A O     1 
ATOM   2434 C  CB    . TYR A 1 292 ? 3.855   -23.875 24.575 1.00 23.55 ? 292  TYR A CB    1 
ATOM   2435 C  CG    . TYR A 1 292 ? 4.973   -23.819 25.572 1.00 23.65 ? 292  TYR A CG    1 
ATOM   2436 C  CD1   . TYR A 1 292 ? 4.782   -23.262 26.833 1.00 23.32 ? 292  TYR A CD1   1 
ATOM   2437 C  CD2   . TYR A 1 292 ? 6.222   -24.345 25.260 1.00 26.80 ? 292  TYR A CD2   1 
ATOM   2438 C  CE1   . TYR A 1 292 ? 5.810   -23.225 27.759 1.00 26.13 ? 292  TYR A CE1   1 
ATOM   2439 C  CE2   . TYR A 1 292 ? 7.256   -24.311 26.175 1.00 26.95 ? 292  TYR A CE2   1 
ATOM   2440 C  CZ    . TYR A 1 292 ? 7.046   -23.749 27.419 1.00 25.94 ? 292  TYR A CZ    1 
ATOM   2441 O  OH    . TYR A 1 292 ? 8.077   -23.723 28.319 1.00 30.81 ? 292  TYR A OH    1 
ATOM   2442 N  N     . ILE A 1 293 ? 1.097   -24.344 25.856 1.00 18.28 ? 293  ILE A N     1 
ATOM   2443 C  CA    . ILE A 1 293 ? 0.208   -24.162 27.001 1.00 17.28 ? 293  ILE A CA    1 
ATOM   2444 C  C     . ILE A 1 293 ? -0.553  -25.448 27.330 1.00 17.16 ? 293  ILE A C     1 
ATOM   2445 O  O     . ILE A 1 293 ? -0.701  -25.792 28.502 1.00 16.16 ? 293  ILE A O     1 
ATOM   2446 C  CB    . ILE A 1 293 ? -0.747  -22.955 26.801 1.00 17.20 ? 293  ILE A CB    1 
ATOM   2447 C  CG1   . ILE A 1 293 ? 0.054   -21.663 26.541 1.00 17.82 ? 293  ILE A CG1   1 
ATOM   2448 C  CG2   . ILE A 1 293 ? -1.671  -22.788 28.011 1.00 14.51 ? 293  ILE A CG2   1 
ATOM   2449 C  CD1   . ILE A 1 293 ? 0.969   -21.239 27.692 1.00 18.42 ? 293  ILE A CD1   1 
ATOM   2450 N  N     . SER A 1 294 ? -0.998  -26.173 26.300 1.00 20.26 ? 294  SER A N     1 
ATOM   2451 C  CA    A SER A 1 294 ? -1.702  -27.441 26.507 0.50 18.98 ? 294  SER A CA    1 
ATOM   2452 C  CA    B SER A 1 294 ? -1.709  -27.433 26.516 0.50 20.59 ? 294  SER A CA    1 
ATOM   2453 C  C     . SER A 1 294 ? -0.803  -28.465 27.184 1.00 20.84 ? 294  SER A C     1 
ATOM   2454 O  O     . SER A 1 294 ? -1.245  -29.208 28.056 1.00 20.13 ? 294  SER A O     1 
ATOM   2455 C  CB    A SER A 1 294 ? -2.240  -27.997 25.186 0.50 18.44 ? 294  SER A CB    1 
ATOM   2456 C  CB    B SER A 1 294 ? -2.304  -27.975 25.209 0.50 21.10 ? 294  SER A CB    1 
ATOM   2457 O  OG    A SER A 1 294 ? -3.162  -27.101 24.602 0.50 12.64 ? 294  SER A OG    1 
ATOM   2458 O  OG    B SER A 1 294 ? -1.300  -28.194 24.234 0.50 24.32 ? 294  SER A OG    1 
ATOM   2459 N  N     . GLU A 1 295 ? 0.466   -28.494 26.783 1.00 22.05 ? 295  GLU A N     1 
ATOM   2460 C  CA    . GLU A 1 295 ? 1.449   -29.377 27.404 1.00 24.59 ? 295  GLU A CA    1 
ATOM   2461 C  C     . GLU A 1 295 ? 1.629   -29.003 28.872 1.00 22.49 ? 295  GLU A C     1 
ATOM   2462 O  O     . GLU A 1 295 ? 1.616   -29.872 29.746 1.00 23.43 ? 295  GLU A O     1 
ATOM   2463 C  CB    . GLU A 1 295 ? 2.796   -29.302 26.678 1.00 26.09 ? 295  GLU A CB    1 
ATOM   2464 C  CG    . GLU A 1 295 ? 2.842   -30.030 25.351 1.00 35.33 ? 295  GLU A CG    1 
ATOM   2465 C  CD    . GLU A 1 295 ? 4.249   -30.144 24.792 1.00 41.63 ? 295  GLU A CD    1 
ATOM   2466 O  OE1   . GLU A 1 295 ? 5.098   -30.788 25.451 1.00 44.03 ? 295  GLU A OE1   1 
ATOM   2467 O  OE2   . GLU A 1 295 ? 4.499   -29.595 23.693 1.00 44.78 ? 295  GLU A OE2   1 
ATOM   2468 N  N     . PHE A 1 296 ? 1.783   -27.705 29.131 1.00 20.53 ? 296  PHE A N     1 
ATOM   2469 C  CA    . PHE A 1 296 ? 1.958   -27.204 30.491 1.00 21.30 ? 296  PHE A CA    1 
ATOM   2470 C  C     . PHE A 1 296 ? 0.746   -27.496 31.372 1.00 19.78 ? 296  PHE A C     1 
ATOM   2471 O  O     . PHE A 1 296 ? 0.901   -27.943 32.509 1.00 20.30 ? 296  PHE A O     1 
ATOM   2472 C  CB    . PHE A 1 296 ? 2.265   -25.699 30.493 1.00 20.10 ? 296  PHE A CB    1 
ATOM   2473 C  CG    . PHE A 1 296 ? 2.445   -25.120 31.870 1.00 22.19 ? 296  PHE A CG    1 
ATOM   2474 C  CD1   . PHE A 1 296 ? 3.709   -25.048 32.447 1.00 22.10 ? 296  PHE A CD1   1 
ATOM   2475 C  CD2   . PHE A 1 296 ? 1.351   -24.645 32.588 1.00 22.79 ? 296  PHE A CD2   1 
ATOM   2476 C  CE1   . PHE A 1 296 ? 3.882   -24.512 33.719 1.00 24.49 ? 296  PHE A CE1   1 
ATOM   2477 C  CE2   . PHE A 1 296 ? 1.511   -24.111 33.861 1.00 24.66 ? 296  PHE A CE2   1 
ATOM   2478 C  CZ    . PHE A 1 296 ? 2.777   -24.041 34.427 1.00 25.08 ? 296  PHE A CZ    1 
ATOM   2479 N  N     . GLU A 1 297 ? -0.450  -27.245 30.843 1.00 18.14 ? 297  GLU A N     1 
ATOM   2480 C  CA    . GLU A 1 297 ? -1.679  -27.339 31.636 1.00 18.42 ? 297  GLU A CA    1 
ATOM   2481 C  C     . GLU A 1 297 ? -2.224  -28.757 31.777 1.00 19.71 ? 297  GLU A C     1 
ATOM   2482 O  O     . GLU A 1 297 ? -2.765  -29.112 32.830 1.00 19.88 ? 297  GLU A O     1 
ATOM   2483 C  CB    . GLU A 1 297 ? -2.776  -26.449 31.044 1.00 18.53 ? 297  GLU A CB    1 
ATOM   2484 C  CG    . GLU A 1 297 ? -2.506  -24.962 31.145 1.00 19.43 ? 297  GLU A CG    1 
ATOM   2485 C  CD    . GLU A 1 297 ? -2.556  -24.450 32.568 1.00 20.19 ? 297  GLU A CD    1 
ATOM   2486 O  OE1   . GLU A 1 297 ? -3.388  -24.948 33.365 1.00 20.66 ? 297  GLU A OE1   1 
ATOM   2487 O  OE2   . GLU A 1 297 ? -1.755  -23.548 32.885 1.00 20.35 ? 297  GLU A OE2   1 
ATOM   2488 N  N     . LEU A 1 298 ? -2.079  -29.553 30.719 1.00 18.91 ? 298  LEU A N     1 
ATOM   2489 C  CA    . LEU A 1 298 ? -2.784  -30.837 30.598 1.00 21.62 ? 298  LEU A CA    1 
ATOM   2490 C  C     . LEU A 1 298 ? -1.860  -32.045 30.496 1.00 23.66 ? 298  LEU A C     1 
ATOM   2491 O  O     . LEU A 1 298 ? -2.318  -33.194 30.552 1.00 22.22 ? 298  LEU A O     1 
ATOM   2492 C  CB    . LEU A 1 298 ? -3.679  -30.815 29.361 1.00 20.59 ? 298  LEU A CB    1 
ATOM   2493 C  CG    . LEU A 1 298 ? -4.686  -29.676 29.218 1.00 20.12 ? 298  LEU A CG    1 
ATOM   2494 C  CD1   . LEU A 1 298 ? -5.312  -29.767 27.840 1.00 21.47 ? 298  LEU A CD1   1 
ATOM   2495 C  CD2   . LEU A 1 298 ? -5.744  -29.747 30.321 1.00 22.24 ? 298  LEU A CD2   1 
ATOM   2496 N  N     . ASN A 1 299 ? -0.571  -31.778 30.314 1.00 23.66 ? 299  ASN A N     1 
ATOM   2497 C  CA    . ASN A 1 299 ? 0.430   -32.826 30.136 1.00 28.66 ? 299  ASN A CA    1 
ATOM   2498 C  C     . ASN A 1 299 ? 0.134   -33.718 28.921 1.00 28.88 ? 299  ASN A C     1 
ATOM   2499 O  O     . ASN A 1 299 ? 0.420   -34.916 28.929 1.00 31.28 ? 299  ASN A O     1 
ATOM   2500 C  CB    . ASN A 1 299 ? 0.573   -33.653 31.415 1.00 31.47 ? 299  ASN A CB    1 
ATOM   2501 C  CG    . ASN A 1 299 ? 2.012   -33.853 31.810 1.00 39.94 ? 299  ASN A CG    1 
ATOM   2502 O  OD1   . ASN A 1 299 ? 2.774   -34.529 31.114 1.00 41.86 ? 299  ASN A OD1   1 
ATOM   2503 N  ND2   . ASN A 1 299 ? 2.402   -33.256 32.932 1.00 42.65 ? 299  ASN A ND2   1 
ATOM   2504 N  N     . VAL A 1 300 ? -0.456  -33.119 27.891 1.00 29.62 ? 300  VAL A N     1 
ATOM   2505 C  CA    . VAL A 1 300 ? -0.671  -33.792 26.612 1.00 33.11 ? 300  VAL A CA    1 
ATOM   2506 C  C     . VAL A 1 300 ? 0.566   -33.582 25.750 1.00 36.71 ? 300  VAL A C     1 
ATOM   2507 O  O     . VAL A 1 300 ? 1.253   -32.569 25.888 1.00 37.76 ? 300  VAL A O     1 
ATOM   2508 C  CB    . VAL A 1 300 ? -1.932  -33.268 25.878 1.00 32.88 ? 300  VAL A CB    1 
ATOM   2509 C  CG1   . VAL A 1 300 ? -3.198  -33.738 26.582 1.00 32.27 ? 300  VAL A CG1   1 
ATOM   2510 C  CG2   . VAL A 1 300 ? -1.913  -31.742 25.769 1.00 31.59 ? 300  VAL A CG2   1 
ATOM   2511 N  N     . GLY A 1 301 ? 0.857   -34.541 24.875 1.00 39.99 ? 301  GLY A N     1 
ATOM   2512 C  CA    . GLY A 1 301 ? 2.018   -34.448 23.991 1.00 43.47 ? 301  GLY A CA    1 
ATOM   2513 C  C     . GLY A 1 301 ? 1.819   -33.443 22.873 1.00 45.73 ? 301  GLY A C     1 
ATOM   2514 O  O     . GLY A 1 301 ? 0.686   -33.077 22.552 1.00 44.63 ? 301  GLY A O     1 
ATOM   2515 N  N     . LYS A 1 302 ? 2.926   -32.993 22.285 1.00 48.08 ? 302  LYS A N     1 
ATOM   2516 C  CA    . LYS A 1 302 ? 2.892   -32.086 21.138 1.00 49.99 ? 302  LYS A CA    1 
ATOM   2517 C  C     . LYS A 1 302 ? 2.115   -32.703 19.969 1.00 50.00 ? 302  LYS A C     1 
ATOM   2518 O  O     . LYS A 1 302 ? 2.283   -33.889 19.666 1.00 50.14 ? 302  LYS A O     1 
ATOM   2519 C  CB    . LYS A 1 302 ? 4.322   -31.725 20.705 1.00 52.04 ? 302  LYS A CB    1 
ATOM   2520 C  CG    . LYS A 1 302 ? 4.404   -30.816 19.475 1.00 55.05 ? 302  LYS A CG    1 
ATOM   2521 C  CD    . LYS A 1 302 ? 5.828   -30.347 19.191 1.00 58.71 ? 302  LYS A CD    1 
ATOM   2522 C  CE    . LYS A 1 302 ? 6.582   -31.328 18.303 1.00 61.30 ? 302  LYS A CE    1 
ATOM   2523 N  NZ    . LYS A 1 302 ? 7.925   -30.804 17.916 1.00 62.63 ? 302  LYS A NZ    1 
ATOM   2524 N  N     . LEU A 1 303 ? 1.258   -31.900 19.336 1.00 49.51 ? 303  LEU A N     1 
ATOM   2525 C  CA    . LEU A 1 303 ? 0.548   -32.318 18.127 0.50 49.44 ? 303  LEU A CA    1 
ATOM   2526 C  C     . LEU A 1 303 ? 1.549   -32.445 16.981 1.00 50.25 ? 303  LEU A C     1 
ATOM   2527 O  O     . LEU A 1 303 ? 1.993   -31.446 16.402 1.00 51.44 ? 303  LEU A O     1 
ATOM   2528 C  CB    . LEU A 1 303 ? -0.586  -31.349 17.777 0.50 48.54 ? 303  LEU A CB    1 
ATOM   2529 C  CG    . LEU A 1 303 ? -1.932  -31.602 18.464 0.50 47.94 ? 303  LEU A CG    1 
ATOM   2530 C  CD1   . LEU A 1 303 ? -2.312  -33.072 18.377 0.50 48.66 ? 303  LEU A CD1   1 
ATOM   2531 C  CD2   . LEU A 1 303 ? -1.921  -31.139 19.911 0.50 48.79 ? 303  LEU A CD2   1 
ATOM   2532 N  N     . LYS A 1 304 ? 1.895   -33.690 16.669 1.00 49.94 ? 304  LYS A N     1 
ATOM   2533 C  CA    . LYS A 1 304 ? 3.050   -34.003 15.840 1.00 49.87 ? 304  LYS A CA    1 
ATOM   2534 C  C     . LYS A 1 304 ? 2.694   -34.205 14.371 1.00 48.74 ? 304  LYS A C     1 
ATOM   2535 O  O     . LYS A 1 304 ? 1.822   -35.012 14.038 1.00 48.40 ? 304  LYS A O     1 
ATOM   2536 C  CB    . LYS A 1 304 ? 3.729   -35.253 16.395 1.00 51.01 ? 304  LYS A CB    1 
ATOM   2537 C  CG    . LYS A 1 304 ? 5.153   -35.498 15.927 1.00 54.84 ? 304  LYS A CG    1 
ATOM   2538 C  CD    . LYS A 1 304 ? 5.819   -36.528 16.832 1.00 57.50 ? 304  LYS A CD    1 
ATOM   2539 C  CE    . LYS A 1 304 ? 5.038   -37.837 16.851 1.00 58.68 ? 304  LYS A CE    1 
ATOM   2540 N  NZ    . LYS A 1 304 ? 4.777   -38.298 18.242 1.00 60.07 ? 304  LYS A NZ    1 
ATOM   2541 N  N     . TYR A 1 305 ? 3.379   -33.465 13.503 1.00 46.68 ? 305  TYR A N     1 
ATOM   2542 C  CA    . TYR A 1 305 ? 3.248   -33.632 12.057 1.00 45.66 ? 305  TYR A CA    1 
ATOM   2543 C  C     . TYR A 1 305 ? 4.582   -33.428 11.340 1.00 45.65 ? 305  TYR A C     1 
ATOM   2544 O  O     . TYR A 1 305 ? 5.496   -32.801 11.881 1.00 44.90 ? 305  TYR A O     1 
ATOM   2545 C  CB    . TYR A 1 305 ? 2.153   -32.717 11.482 1.00 44.92 ? 305  TYR A CB    1 
ATOM   2546 C  CG    . TYR A 1 305 ? 2.325   -31.233 11.750 1.00 44.21 ? 305  TYR A CG    1 
ATOM   2547 C  CD1   . TYR A 1 305 ? 2.977   -30.408 10.831 1.00 45.15 ? 305  TYR A CD1   1 
ATOM   2548 C  CD2   . TYR A 1 305 ? 1.807   -30.649 12.906 1.00 44.85 ? 305  TYR A CD2   1 
ATOM   2549 C  CE1   . TYR A 1 305 ? 3.128   -29.043 11.066 1.00 44.81 ? 305  TYR A CE1   1 
ATOM   2550 C  CE2   . TYR A 1 305 ? 1.952   -29.282 13.153 1.00 44.12 ? 305  TYR A CE2   1 
ATOM   2551 C  CZ    . TYR A 1 305 ? 2.613   -28.488 12.229 1.00 45.46 ? 305  TYR A CZ    1 
ATOM   2552 O  OH    . TYR A 1 305 ? 2.757   -27.141 12.467 1.00 46.34 ? 305  TYR A OH    1 
ATOM   2553 N  N     . ASP A 1 306 ? 4.685   -33.972 10.129 1.00 45.44 ? 306  ASP A N     1 
ATOM   2554 C  CA    . ASP A 1 306 ? 5.877   -33.820 9.294  1.00 46.11 ? 306  ASP A CA    1 
ATOM   2555 C  C     . ASP A 1 306 ? 5.760   -32.615 8.367  1.00 45.92 ? 306  ASP A C     1 
ATOM   2556 O  O     . ASP A 1 306 ? 4.681   -32.331 7.835  1.00 44.48 ? 306  ASP A O     1 
ATOM   2557 C  CB    . ASP A 1 306 ? 6.111   -35.078 8.453  1.00 47.36 ? 306  ASP A CB    1 
ATOM   2558 C  CG    . ASP A 1 306 ? 6.416   -36.307 9.296  1.00 50.26 ? 306  ASP A CG    1 
ATOM   2559 O  OD1   . ASP A 1 306 ? 6.265   -37.428 8.768  1.00 51.83 ? 306  ASP A OD1   1 
ATOM   2560 O  OD2   . ASP A 1 306 ? 6.805   -36.160 10.477 1.00 50.68 ? 306  ASP A OD2   1 
ATOM   2561 N  N     . GLY A 1 307 ? 6.878   -31.918 8.171  1.00 45.99 ? 307  GLY A N     1 
ATOM   2562 C  CA    . GLY A 1 307 ? 6.940   -30.779 7.254  1.00 45.49 ? 307  GLY A CA    1 
ATOM   2563 C  C     . GLY A 1 307 ? 6.279   -29.514 7.780  1.00 44.13 ? 307  GLY A C     1 
ATOM   2564 O  O     . GLY A 1 307 ? 5.714   -29.514 8.877  1.00 43.86 ? 307  GLY A O     1 
ATOM   2565 N  N     . PRO A 1 308 ? 6.345   -28.421 6.995  1.00 44.12 ? 308  PRO A N     1 
ATOM   2566 C  CA    . PRO A 1 308 ? 5.746   -27.143 7.391  1.00 42.89 ? 308  PRO A CA    1 
ATOM   2567 C  C     . PRO A 1 308 ? 4.218   -27.180 7.358  1.00 41.25 ? 308  PRO A C     1 
ATOM   2568 O  O     . PRO A 1 308 ? 3.634   -27.985 6.629  1.00 40.86 ? 308  PRO A O     1 
ATOM   2569 C  CB    . PRO A 1 308 ? 6.272   -26.169 6.336  1.00 43.41 ? 308  PRO A CB    1 
ATOM   2570 C  CG    . PRO A 1 308 ? 6.570   -27.017 5.151  1.00 44.22 ? 308  PRO A CG    1 
ATOM   2571 C  CD    . PRO A 1 308 ? 7.031   -28.331 5.693  1.00 44.68 ? 308  PRO A CD    1 
ATOM   2572 N  N     . ILE A 1 309 ? 3.589   -26.310 8.143  1.00 39.60 ? 309  ILE A N     1 
ATOM   2573 C  CA    . ILE A 1 309 ? 2.130   -26.238 8.218  1.00 37.90 ? 309  ILE A CA    1 
ATOM   2574 C  C     . ILE A 1 309 ? 1.524   -25.779 6.879  1.00 36.11 ? 309  ILE A C     1 
ATOM   2575 O  O     . ILE A 1 309 ? 0.369   -26.083 6.580  1.00 34.41 ? 309  ILE A O     1 
ATOM   2576 C  CB    . ILE A 1 309 ? 1.664   -25.354 9.425  1.00 38.18 ? 309  ILE A CB    1 
ATOM   2577 C  CG1   . ILE A 1 309 ? 0.400   -25.927 10.099 1.00 40.16 ? 309  ILE A CG1   1 
ATOM   2578 C  CG2   . ILE A 1 309 ? 1.569   -23.870 9.046  1.00 39.28 ? 309  ILE A CG2   1 
ATOM   2579 C  CD1   . ILE A 1 309 ? -0.932  -25.567 9.456  1.00 41.44 ? 309  ILE A CD1   1 
ATOM   2580 N  N     . SER A 1 310 ? 2.326   -25.088 6.070  1.00 34.61 ? 310  SER A N     1 
ATOM   2581 C  CA    . SER A 1 310 ? 1.894   -24.602 4.759  1.00 33.41 ? 310  SER A CA    1 
ATOM   2582 C  C     . SER A 1 310 ? 1.748   -25.726 3.733  1.00 32.09 ? 310  SER A C     1 
ATOM   2583 O  O     . SER A 1 310 ? 1.154   -25.537 2.667  1.00 31.29 ? 310  SER A O     1 
ATOM   2584 C  CB    . SER A 1 310 ? 2.871   -23.546 4.234  1.00 35.00 ? 310  SER A CB    1 
ATOM   2585 O  OG    . SER A 1 310 ? 4.112   -24.129 3.878  1.00 37.31 ? 310  SER A OG    1 
ATOM   2586 N  N     . LYS A 1 311 ? 2.297   -26.893 4.057  1.00 30.26 ? 311  LYS A N     1 
ATOM   2587 C  CA    . LYS A 1 311 ? 2.214   -28.051 3.175  1.00 29.47 ? 311  LYS A CA    1 
ATOM   2588 C  C     . LYS A 1 311 ? 1.441   -29.201 3.823  1.00 26.81 ? 311  LYS A C     1 
ATOM   2589 O  O     . LYS A 1 311 ? 1.260   -30.257 3.213  1.00 26.96 ? 311  LYS A O     1 
ATOM   2590 C  CB    . LYS A 1 311 ? 3.617   -28.499 2.746  1.00 30.82 ? 311  LYS A CB    1 
ATOM   2591 C  CG    . LYS A 1 311 ? 4.352   -27.452 1.915  1.00 35.23 ? 311  LYS A CG    1 
ATOM   2592 C  CD    . LYS A 1 311 ? 5.692   -27.942 1.397  1.00 40.23 ? 311  LYS A CD    1 
ATOM   2593 C  CE    . LYS A 1 311 ? 6.381   -26.845 0.587  1.00 41.99 ? 311  LYS A CE    1 
ATOM   2594 N  NZ    . LYS A 1 311 ? 7.677   -27.289 0.004  1.00 48.14 ? 311  LYS A NZ    1 
ATOM   2595 N  N     . LEU A 1 312 ? 0.971   -28.992 5.050  1.00 25.07 ? 312  LEU A N     1 
ATOM   2596 C  CA    . LEU A 1 312 ? 0.291   -30.062 5.784  1.00 24.82 ? 312  LEU A CA    1 
ATOM   2597 C  C     . LEU A 1 312 ? -1.034  -30.475 5.151  1.00 23.38 ? 312  LEU A C     1 
ATOM   2598 O  O     . LEU A 1 312 ? -1.357  -31.659 5.126  1.00 25.13 ? 312  LEU A O     1 
ATOM   2599 C  CB    . LEU A 1 312 ? 0.090   -29.709 7.263  1.00 23.68 ? 312  LEU A CB    1 
ATOM   2600 C  CG    . LEU A 1 312 ? -0.476  -30.831 8.148  1.00 23.00 ? 312  LEU A CG    1 
ATOM   2601 C  CD1   . LEU A 1 312 ? 0.416   -32.077 8.111  1.00 24.88 ? 312  LEU A CD1   1 
ATOM   2602 C  CD2   . LEU A 1 312 ? -0.680  -30.356 9.586  1.00 25.90 ? 312  LEU A CD2   1 
ATOM   2603 N  N     . ARG A 1 313 ? -1.796  -29.513 4.638  1.00 21.38 ? 313  ARG A N     1 
ATOM   2604 C  CA    . ARG A 1 313 ? -3.084  -29.843 4.041  1.00 20.89 ? 313  ARG A CA    1 
ATOM   2605 C  C     . ARG A 1 313 ? -2.898  -30.727 2.805  1.00 23.36 ? 313  ARG A C     1 
ATOM   2606 O  O     . ARG A 1 313 ? -3.559  -31.757 2.664  1.00 22.86 ? 313  ARG A O     1 
ATOM   2607 C  CB    . ARG A 1 313 ? -3.885  -28.580 3.703  1.00 20.33 ? 313  ARG A CB    1 
ATOM   2608 C  CG    . ARG A 1 313 ? -5.262  -28.878 3.131  1.00 22.36 ? 313  ARG A CG    1 
ATOM   2609 C  CD    . ARG A 1 313 ? -6.008  -27.599 2.784  1.00 23.51 ? 313  ARG A CD    1 
ATOM   2610 N  NE    . ARG A 1 313 ? -7.230  -27.873 2.032  1.00 24.29 ? 313  ARG A NE    1 
ATOM   2611 C  CZ    . ARG A 1 313 ? -7.299  -27.912 0.701  1.00 25.29 ? 313  ARG A CZ    1 
ATOM   2612 N  NH1   . ARG A 1 313 ? -6.216  -27.689 -0.032 1.00 22.83 ? 313  ARG A NH1   1 
ATOM   2613 N  NH2   . ARG A 1 313 ? -8.456  -28.173 0.099  1.00 23.74 ? 313  ARG A NH2   1 
ATOM   2614 N  N     . GLU A 1 314 ? -1.982  -30.339 1.923  1.00 24.78 ? 314  GLU A N     1 
ATOM   2615 C  CA    . GLU A 1 314 ? -1.780  -31.098 0.685  1.00 28.43 ? 314  GLU A CA    1 
ATOM   2616 C  C     . GLU A 1 314 ? -1.163  -32.480 0.926  1.00 28.57 ? 314  GLU A C     1 
ATOM   2617 O  O     . GLU A 1 314 ? -1.524  -33.441 0.252  1.00 29.90 ? 314  GLU A O     1 
ATOM   2618 C  CB    . GLU A 1 314 ? -0.991  -30.297 -0.364 1.00 32.37 ? 314  GLU A CB    1 
ATOM   2619 C  CG    . GLU A 1 314 ? 0.459   -29.988 -0.008 1.00 41.01 ? 314  GLU A CG    1 
ATOM   2620 C  CD    . GLU A 1 314 ? 1.205   -29.276 -1.127 1.00 46.44 ? 314  GLU A CD    1 
ATOM   2621 O  OE1   . GLU A 1 314 ? 1.012   -29.638 -2.310 1.00 48.75 ? 314  GLU A OE1   1 
ATOM   2622 O  OE2   . GLU A 1 314 ? 1.995   -28.357 -0.818 1.00 49.52 ? 314  GLU A OE2   1 
ATOM   2623 N  N     . SER A 1 315 ? -0.262  -32.578 1.900  1.00 27.99 ? 315  SER A N     1 
ATOM   2624 C  CA    . SER A 1 315 ? 0.426   -33.837 2.183  1.00 28.72 ? 315  SER A CA    1 
ATOM   2625 C  C     . SER A 1 315 ? -0.373  -34.768 3.098  1.00 27.42 ? 315  SER A C     1 
ATOM   2626 O  O     . SER A 1 315 ? -0.323  -35.992 2.942  1.00 27.45 ? 315  SER A O     1 
ATOM   2627 C  CB    . SER A 1 315 ? 1.809   -33.573 2.782  1.00 28.83 ? 315  SER A CB    1 
ATOM   2628 O  OG    . SER A 1 315 ? 1.702   -32.906 4.025  1.00 29.24 ? 315  SER A OG    1 
ATOM   2629 N  N     . ASN A 1 316 ? -1.110  -34.189 4.045  1.00 24.71 ? 316  ASN A N     1 
ATOM   2630 C  CA    . ASN A 1 316 ? -1.831  -34.977 5.046  1.00 23.39 ? 316  ASN A CA    1 
ATOM   2631 C  C     . ASN A 1 316 ? -3.066  -34.243 5.561  1.00 22.41 ? 316  ASN A C     1 
ATOM   2632 O  O     . ASN A 1 316 ? -3.117  -33.813 6.719  1.00 20.87 ? 316  ASN A O     1 
ATOM   2633 C  CB    . ASN A 1 316 ? -0.889  -35.354 6.198  1.00 23.83 ? 316  ASN A CB    1 
ATOM   2634 C  CG    . ASN A 1 316 ? -1.366  -36.568 6.981  1.00 24.99 ? 316  ASN A CG    1 
ATOM   2635 O  OD1   . ASN A 1 316 ? -2.541  -36.941 6.934  1.00 21.64 ? 316  ASN A OD1   1 
ATOM   2636 N  ND2   . ASN A 1 316 ? -0.446  -37.189 7.715  1.00 25.49 ? 316  ASN A ND2   1 
ATOM   2637 N  N     . HIS A 1 317 ? -4.055  -34.105 4.682  1.00 21.28 ? 317  HIS A N     1 
ATOM   2638 C  CA    . HIS A 1 317 ? -5.316  -33.423 4.985  1.00 19.94 ? 317  HIS A CA    1 
ATOM   2639 C  C     . HIS A 1 317 ? -6.067  -34.095 6.135  1.00 20.12 ? 317  HIS A C     1 
ATOM   2640 O  O     . HIS A 1 317 ? -6.721  -33.424 6.947  1.00 19.83 ? 317  HIS A O     1 
ATOM   2641 C  CB    . HIS A 1 317 ? -6.178  -33.364 3.718  1.00 21.36 ? 317  HIS A CB    1 
ATOM   2642 C  CG    . HIS A 1 317 ? -7.575  -32.890 3.958  1.00 19.29 ? 317  HIS A CG    1 
ATOM   2643 N  ND1   . HIS A 1 317 ? -8.657  -33.742 3.950  1.00 22.29 ? 317  HIS A ND1   1 
ATOM   2644 C  CD2   . HIS A 1 317 ? -8.065  -31.658 4.230  1.00 19.09 ? 317  HIS A CD2   1 
ATOM   2645 C  CE1   . HIS A 1 317 ? -9.758  -33.054 4.194  1.00 21.02 ? 317  HIS A CE1   1 
ATOM   2646 N  NE2   . HIS A 1 317 ? -9.426  -31.788 4.370  1.00 18.50 ? 317  HIS A NE2   1 
ATOM   2647 N  N     . GLN A 1 318 ? -5.955  -35.418 6.205  1.00 20.57 ? 318  GLN A N     1 
ATOM   2648 C  CA    . GLN A 1 318 ? -6.508  -36.196 7.309  1.00 21.02 ? 318  GLN A CA    1 
ATOM   2649 C  C     . GLN A 1 318 ? -6.038  -35.635 8.655  1.00 20.20 ? 318  GLN A C     1 
ATOM   2650 O  O     . GLN A 1 318 ? -6.859  -35.265 9.500  1.00 19.53 ? 318  GLN A O     1 
ATOM   2651 C  CB    . GLN A 1 318 ? -6.118  -37.675 7.169  1.00 20.93 ? 318  GLN A CB    1 
ATOM   2652 C  CG    . GLN A 1 318 ? -6.498  -38.542 8.377  1.00 21.64 ? 318  GLN A CG    1 
ATOM   2653 C  CD    . GLN A 1 318 ? -8.005  -38.663 8.569  1.00 21.48 ? 318  GLN A CD    1 
ATOM   2654 O  OE1   . GLN A 1 318 ? -8.765  -38.736 7.598  1.00 22.33 ? 318  GLN A OE1   1 
ATOM   2655 N  NE2   . GLN A 1 318 ? -8.440  -38.697 9.824  1.00 21.10 ? 318  GLN A NE2   1 
ATOM   2656 N  N     . ARG A 1 319 ? -4.720  -35.563 8.832  1.00 19.18 ? 319  ARG A N     1 
ATOM   2657 C  CA    . ARG A 1 319 ? -4.113  -35.020 10.047 1.00 21.09 ? 319  ARG A CA    1 
ATOM   2658 C  C     . ARG A 1 319 ? -4.423  -33.530 10.223 1.00 20.47 ? 319  ARG A C     1 
ATOM   2659 O  O     . ARG A 1 319 ? -4.659  -33.067 11.338 1.00 16.78 ? 319  ARG A O     1 
ATOM   2660 C  CB    . ARG A 1 319 ? -2.598  -35.263 10.037 1.00 22.03 ? 319  ARG A CB    1 
ATOM   2661 C  CG    . ARG A 1 319 ? -1.873  -34.798 11.294 1.00 28.12 ? 319  ARG A CG    1 
ATOM   2662 C  CD    . ARG A 1 319 ? -0.712  -35.719 11.641 1.00 34.34 ? 319  ARG A CD    1 
ATOM   2663 N  NE    . ARG A 1 319 ? -1.179  -37.028 12.100 1.00 39.32 ? 319  ARG A NE    1 
ATOM   2664 C  CZ    . ARG A 1 319 ? -0.380  -38.032 12.450 1.00 43.88 ? 319  ARG A CZ    1 
ATOM   2665 N  NH1   . ARG A 1 319 ? 0.940   -37.893 12.400 1.00 45.62 ? 319  ARG A NH1   1 
ATOM   2666 N  NH2   . ARG A 1 319 ? -0.901  -39.183 12.852 1.00 45.20 ? 319  ARG A NH2   1 
ATOM   2667 N  N     . TYR A 1 320 ? -4.422  -32.793 9.112  1.00 19.01 ? 320  TYR A N     1 
ATOM   2668 C  CA    . TYR A 1 320 ? -4.727  -31.358 9.102  1.00 19.93 ? 320  TYR A CA    1 
ATOM   2669 C  C     . TYR A 1 320 ? -6.048  -31.041 9.799  1.00 19.40 ? 320  TYR A C     1 
ATOM   2670 O  O     . TYR A 1 320 ? -6.106  -30.157 10.667 1.00 17.28 ? 320  TYR A O     1 
ATOM   2671 C  CB    . TYR A 1 320 ? -4.784  -30.884 7.653  1.00 19.30 ? 320  TYR A CB    1 
ATOM   2672 C  CG    . TYR A 1 320 ? -4.812  -29.388 7.407  1.00 20.19 ? 320  TYR A CG    1 
ATOM   2673 C  CD1   . TYR A 1 320 ? -3.667  -28.603 7.596  1.00 19.81 ? 320  TYR A CD1   1 
ATOM   2674 C  CD2   . TYR A 1 320 ? -5.961  -28.771 6.907  1.00 17.58 ? 320  TYR A CD2   1 
ATOM   2675 C  CE1   . TYR A 1 320 ? -3.674  -27.230 7.321  1.00 22.19 ? 320  TYR A CE1   1 
ATOM   2676 C  CE2   . TYR A 1 320 ? -5.983  -27.398 6.635  1.00 18.96 ? 320  TYR A CE2   1 
ATOM   2677 C  CZ    . TYR A 1 320 ? -4.835  -26.638 6.835  1.00 18.73 ? 320  TYR A CZ    1 
ATOM   2678 O  OH    . TYR A 1 320 ? -4.846  -25.287 6.561  1.00 20.84 ? 320  TYR A OH    1 
ATOM   2679 N  N     . ILE A 1 321 ? -7.095  -31.779 9.428  1.00 18.04 ? 321  ILE A N     1 
ATOM   2680 C  CA    . ILE A 1 321 ? -8.430  -31.581 9.989  1.00 17.18 ? 321  ILE A CA    1 
ATOM   2681 C  C     . ILE A 1 321 ? -8.505  -32.073 11.429 1.00 17.36 ? 321  ILE A C     1 
ATOM   2682 O  O     . ILE A 1 321 ? -9.035  -31.372 12.289 1.00 16.42 ? 321  ILE A O     1 
ATOM   2683 C  CB    . ILE A 1 321 ? -9.531  -32.244 9.118  1.00 17.74 ? 321  ILE A CB    1 
ATOM   2684 C  CG1   . ILE A 1 321 ? -9.594  -31.586 7.727  1.00 16.83 ? 321  ILE A CG1   1 
ATOM   2685 C  CG2   . ILE A 1 321 ? -10.910 -32.185 9.810  1.00 19.82 ? 321  ILE A CG2   1 
ATOM   2686 C  CD1   . ILE A 1 321 ? -9.841  -30.057 7.734  1.00 19.58 ? 321  ILE A CD1   1 
ATOM   2687 N  N     . SER A 1 322 ? -7.961  -33.261 11.693 1.00 17.29 ? 322  SER A N     1 
ATOM   2688 C  CA    . SER A 1 322 ? -7.962  -33.803 13.052 1.00 18.40 ? 322  SER A CA    1 
ATOM   2689 C  C     . SER A 1 322 ? -7.285  -32.851 14.037 1.00 18.80 ? 322  SER A C     1 
ATOM   2690 O  O     . SER A 1 322 ? -7.742  -32.689 15.167 1.00 18.68 ? 322  SER A O     1 
ATOM   2691 C  CB    . SER A 1 322 ? -7.279  -35.167 13.095 1.00 18.67 ? 322  SER A CB    1 
ATOM   2692 O  OG    . SER A 1 322 ? -8.107  -36.175 12.537 1.00 18.98 ? 322  SER A OG    1 
ATOM   2693 N  N     . TYR A 1 323 ? -6.200  -32.219 13.600 1.00 19.14 ? 323  TYR A N     1 
ATOM   2694 C  CA    . TYR A 1 323 ? -5.459  -31.307 14.470 1.00 19.64 ? 323  TYR A CA    1 
ATOM   2695 C  C     . TYR A 1 323 ? -6.209  -30.004 14.718 1.00 18.23 ? 323  TYR A C     1 
ATOM   2696 O  O     . TYR A 1 323 ? -6.134  -29.454 15.817 1.00 16.71 ? 323  TYR A O     1 
ATOM   2697 C  CB    . TYR A 1 323 ? -4.041  -31.080 13.948 1.00 22.10 ? 323  TYR A CB    1 
ATOM   2698 C  CG    . TYR A 1 323 ? -3.095  -32.240 14.268 1.00 26.11 ? 323  TYR A CG    1 
ATOM   2699 C  CD1   . TYR A 1 323 ? -1.715  -32.099 14.131 1.00 32.29 ? 323  TYR A CD1   1 
ATOM   2700 C  CD2   . TYR A 1 323 ? -3.587  -33.472 14.732 1.00 30.82 ? 323  TYR A CD2   1 
ATOM   2701 C  CE1   . TYR A 1 323 ? -0.845  -33.160 14.429 1.00 33.18 ? 323  TYR A CE1   1 
ATOM   2702 C  CE2   . TYR A 1 323 ? -2.727  -34.535 15.036 1.00 31.94 ? 323  TYR A CE2   1 
ATOM   2703 C  CZ    . TYR A 1 323 ? -1.361  -34.369 14.881 1.00 34.63 ? 323  TYR A CZ    1 
ATOM   2704 O  OH    . TYR A 1 323 ? -0.513  -35.416 15.174 1.00 37.43 ? 323  TYR A OH    1 
ATOM   2705 N  N     . ASN A 1 324 ? -6.944  -29.537 13.709 1.00 16.18 ? 324  ASN A N     1 
ATOM   2706 C  CA    . ASN A 1 324 ? -7.868  -28.402 13.855 1.00 17.23 ? 324  ASN A CA    1 
ATOM   2707 C  C     . ASN A 1 324 ? -8.939  -28.700 14.911 1.00 17.31 ? 324  ASN A C     1 
ATOM   2708 O  O     . ASN A 1 324 ? -9.210  -27.869 15.784 1.00 17.21 ? 324  ASN A O     1 
ATOM   2709 C  CB    . ASN A 1 324 ? -8.492  -28.069 12.486 1.00 17.94 ? 324  ASN A CB    1 
ATOM   2710 C  CG    . ASN A 1 324 ? -9.528  -26.944 12.541 1.00 21.18 ? 324  ASN A CG    1 
ATOM   2711 O  OD1   . ASN A 1 324 ? -10.651 -27.109 12.059 1.00 22.34 ? 324  ASN A OD1   1 
ATOM   2712 N  ND2   . ASN A 1 324 ? -9.144  -25.789 13.082 1.00 21.11 ? 324  ASN A ND2   1 
ATOM   2713 N  N     . ILE A 1 325 ? -9.529  -29.893 14.841 1.00 16.17 ? 325  ILE A N     1 
ATOM   2714 C  CA    . ILE A 1 325 ? -10.528 -30.330 15.826 1.00 15.85 ? 325  ILE A CA    1 
ATOM   2715 C  C     . ILE A 1 325 ? -9.905  -30.425 17.222 1.00 16.26 ? 325  ILE A C     1 
ATOM   2716 O  O     . ILE A 1 325 ? -10.467 -29.906 18.197 1.00 15.71 ? 325  ILE A O     1 
ATOM   2717 C  CB    . ILE A 1 325 ? -11.158 -31.701 15.449 1.00 17.06 ? 325  ILE A CB    1 
ATOM   2718 C  CG1   . ILE A 1 325 ? -11.951 -31.590 14.143 1.00 19.29 ? 325  ILE A CG1   1 
ATOM   2719 C  CG2   . ILE A 1 325 ? -12.054 -32.224 16.583 1.00 15.80 ? 325  ILE A CG2   1 
ATOM   2720 C  CD1   . ILE A 1 325 ? -12.244 -32.948 13.476 1.00 18.78 ? 325  ILE A CD1   1 
ATOM   2721 N  N     . ILE A 1 326 ? -8.742  -31.074 17.315 1.00 15.73 ? 326  ILE A N     1 
ATOM   2722 C  CA    . ILE A 1 326 ? -8.064  -31.240 18.611 1.00 18.86 ? 326  ILE A CA    1 
ATOM   2723 C  C     . ILE A 1 326 ? -7.712  -29.895 19.250 1.00 18.08 ? 326  ILE A C     1 
ATOM   2724 O  O     . ILE A 1 326 ? -7.851  -29.736 20.462 1.00 18.07 ? 326  ILE A O     1 
ATOM   2725 C  CB    . ILE A 1 326 ? -6.816  -32.165 18.515 1.00 19.14 ? 326  ILE A CB    1 
ATOM   2726 C  CG1   . ILE A 1 326 ? -7.253  -33.605 18.216 1.00 21.91 ? 326  ILE A CG1   1 
ATOM   2727 C  CG2   . ILE A 1 326 ? -6.009  -32.128 19.824 1.00 22.40 ? 326  ILE A CG2   1 
ATOM   2728 C  CD1   . ILE A 1 326 ? -6.147  -34.502 17.649 1.00 22.29 ? 326  ILE A CD1   1 
ATOM   2729 N  N     . ALA A 1 327 ? -7.291  -28.932 18.429 1.00 18.78 ? 327  ALA A N     1 
ATOM   2730 C  CA    . ALA A 1 327 ? -6.993  -27.571 18.900 1.00 20.31 ? 327  ALA A CA    1 
ATOM   2731 C  C     . ALA A 1 327 ? -8.182  -26.933 19.617 1.00 20.23 ? 327  ALA A C     1 
ATOM   2732 O  O     . ALA A 1 327 ? -8.021  -26.289 20.657 1.00 19.04 ? 327  ALA A O     1 
ATOM   2733 C  CB    . ALA A 1 327 ? -6.556  -26.691 17.739 1.00 20.28 ? 327  ALA A CB    1 
ATOM   2734 N  N     . VAL A 1 328 ? -9.376  -27.110 19.056 1.00 18.11 ? 328  VAL A N     1 
ATOM   2735 C  CA    . VAL A 1 328 ? -10.592 -26.570 19.670 1.00 17.41 ? 328  VAL A CA    1 
ATOM   2736 C  C     . VAL A 1 328 ? -10.851 -27.274 21.002 1.00 17.51 ? 328  VAL A C     1 
ATOM   2737 O  O     . VAL A 1 328 ? -11.117 -26.618 22.016 1.00 16.70 ? 328  VAL A O     1 
ATOM   2738 C  CB    . VAL A 1 328 ? -11.809 -26.667 18.717 1.00 17.54 ? 328  VAL A CB    1 
ATOM   2739 C  CG1   . VAL A 1 328 ? -13.092 -26.199 19.410 1.00 19.43 ? 328  VAL A CG1   1 
ATOM   2740 C  CG2   . VAL A 1 328 ? -11.557 -25.818 17.472 1.00 16.89 ? 328  VAL A CG2   1 
ATOM   2741 N  N     . TYR A 1 329 ? -10.729 -28.601 21.005 1.00 16.34 ? 329  TYR A N     1 
ATOM   2742 C  CA    . TYR A 1 329 ? -10.930 -29.376 22.227 1.00 16.78 ? 329  TYR A CA    1 
ATOM   2743 C  C     . TYR A 1 329 ? -9.915  -29.023 23.319 1.00 16.91 ? 329  TYR A C     1 
ATOM   2744 O  O     . TYR A 1 329 ? -10.274 -28.973 24.497 1.00 17.90 ? 329  TYR A O     1 
ATOM   2745 C  CB    . TYR A 1 329 ? -10.911 -30.887 21.933 1.00 17.22 ? 329  TYR A CB    1 
ATOM   2746 C  CG    . TYR A 1 329 ? -11.277 -31.755 23.126 1.00 19.95 ? 329  TYR A CG    1 
ATOM   2747 C  CD1   . TYR A 1 329 ? -12.356 -31.425 23.950 1.00 20.14 ? 329  TYR A CD1   1 
ATOM   2748 C  CD2   . TYR A 1 329 ? -10.559 -32.917 23.416 1.00 22.32 ? 329  TYR A CD2   1 
ATOM   2749 C  CE1   . TYR A 1 329 ? -12.690 -32.210 25.055 1.00 21.18 ? 329  TYR A CE1   1 
ATOM   2750 C  CE2   . TYR A 1 329 ? -10.896 -33.717 24.513 1.00 22.20 ? 329  TYR A CE2   1 
ATOM   2751 C  CZ    . TYR A 1 329 ? -11.966 -33.358 25.319 1.00 24.81 ? 329  TYR A CZ    1 
ATOM   2752 O  OH    . TYR A 1 329 ? -12.307 -34.139 26.403 1.00 25.35 ? 329  TYR A OH    1 
ATOM   2753 N  N     . ARG A 1 330 ? -8.662  -28.760 22.939 1.00 17.06 ? 330  ARG A N     1 
ATOM   2754 C  CA    A ARG A 1 330 ? -7.651  -28.426 23.941 0.50 18.14 ? 330  ARG A CA    1 
ATOM   2755 C  CA    B ARG A 1 330 ? -7.618  -28.405 23.913 0.50 18.07 ? 330  ARG A CA    1 
ATOM   2756 C  C     . ARG A 1 330 ? -8.008  -27.182 24.745 1.00 17.10 ? 330  ARG A C     1 
ATOM   2757 O  O     . ARG A 1 330 ? -7.783  -27.147 25.950 1.00 16.85 ? 330  ARG A O     1 
ATOM   2758 C  CB    A ARG A 1 330 ? -6.254  -28.339 23.327 0.50 19.74 ? 330  ARG A CB    1 
ATOM   2759 C  CB    B ARG A 1 330 ? -6.268  -28.168 23.222 0.50 19.28 ? 330  ARG A CB    1 
ATOM   2760 C  CG    A ARG A 1 330 ? -5.611  -29.707 23.218 0.50 20.81 ? 330  ARG A CG    1 
ATOM   2761 C  CG    B ARG A 1 330 ? -5.630  -29.417 22.613 0.50 20.51 ? 330  ARG A CG    1 
ATOM   2762 C  CD    A ARG A 1 330 ? -4.259  -29.669 22.551 0.50 22.94 ? 330  ARG A CD    1 
ATOM   2763 C  CD    B ARG A 1 330 ? -5.263  -30.463 23.663 0.50 20.30 ? 330  ARG A CD    1 
ATOM   2764 N  NE    A ARG A 1 330 ? -3.652  -30.995 22.563 0.50 25.60 ? 330  ARG A NE    1 
ATOM   2765 N  NE    B ARG A 1 330 ? -4.582  -31.610 23.061 0.50 20.49 ? 330  ARG A NE    1 
ATOM   2766 C  CZ    A ARG A 1 330 ? -2.377  -31.236 22.292 0.50 24.84 ? 330  ARG A CZ    1 
ATOM   2767 C  CZ    B ARG A 1 330 ? -5.024  -32.865 23.100 0.50 19.97 ? 330  ARG A CZ    1 
ATOM   2768 N  NH1   A ARG A 1 330 ? -1.564  -30.237 21.990 0.50 23.25 ? 330  ARG A NH1   1 
ATOM   2769 N  NH1   B ARG A 1 330 ? -6.150  -33.165 23.732 0.50 20.20 ? 330  ARG A NH1   1 
ATOM   2770 N  NH2   A ARG A 1 330 ? -1.916  -32.479 22.330 0.50 26.00 ? 330  ARG A NH2   1 
ATOM   2771 N  NH2   B ARG A 1 330 ? -4.331  -33.828 22.510 0.50 17.30 ? 330  ARG A NH2   1 
ATOM   2772 N  N     . VAL A 1 331 ? -8.591  -26.178 24.095 1.00 16.29 ? 331  VAL A N     1 
ATOM   2773 C  CA    . VAL A 1 331 ? -9.046  -24.973 24.814 1.00 16.75 ? 331  VAL A CA    1 
ATOM   2774 C  C     . VAL A 1 331 ? -10.162 -25.308 25.814 1.00 17.01 ? 331  VAL A C     1 
ATOM   2775 O  O     . VAL A 1 331 ? -10.180 -24.795 26.939 1.00 15.85 ? 331  VAL A O     1 
ATOM   2776 C  CB    . VAL A 1 331 ? -9.501  -23.847 23.852 1.00 17.15 ? 331  VAL A CB    1 
ATOM   2777 C  CG1   . VAL A 1 331 ? -9.990  -22.621 24.644 1.00 19.29 ? 331  VAL A CG1   1 
ATOM   2778 C  CG2   . VAL A 1 331 ? -8.364  -23.441 22.919 1.00 19.80 ? 331  VAL A CG2   1 
ATOM   2779 N  N     . LEU A 1 332 ? -11.081 -26.175 25.403 1.00 15.63 ? 332  LEU A N     1 
ATOM   2780 C  CA    . LEU A 1 332 ? -12.144 -26.657 26.287 1.00 14.43 ? 332  LEU A CA    1 
ATOM   2781 C  C     . LEU A 1 332 ? -11.586 -27.421 27.491 1.00 16.29 ? 332  LEU A C     1 
ATOM   2782 O  O     . LEU A 1 332 ? -12.080 -27.286 28.612 1.00 15.98 ? 332  LEU A O     1 
ATOM   2783 C  CB    . LEU A 1 332 ? -13.125 -27.538 25.507 1.00 16.43 ? 332  LEU A CB    1 
ATOM   2784 C  CG    . LEU A 1 332 ? -13.921 -26.824 24.415 1.00 18.57 ? 332  LEU A CG    1 
ATOM   2785 C  CD1   . LEU A 1 332 ? -14.623 -27.851 23.551 1.00 19.95 ? 332  LEU A CD1   1 
ATOM   2786 C  CD2   . LEU A 1 332 ? -14.924 -25.844 25.029 1.00 18.12 ? 332  LEU A CD2   1 
ATOM   2787 N  N     . GLN A 1 333 ? -10.544 -28.205 27.252 1.00 16.17 ? 333  GLN A N     1 
ATOM   2788 C  CA    . GLN A 1 333 ? -9.887  -28.958 28.318 1.00 15.77 ? 333  GLN A CA    1 
ATOM   2789 C  C     . GLN A 1 333 ? -9.178  -28.033 29.304 1.00 16.61 ? 333  GLN A C     1 
ATOM   2790 O  O     . GLN A 1 333 ? -9.228  -28.244 30.527 1.00 16.01 ? 333  GLN A O     1 
ATOM   2791 C  CB    . GLN A 1 333 ? -8.891  -29.951 27.729 1.00 16.68 ? 333  GLN A CB    1 
ATOM   2792 C  CG    . GLN A 1 333 ? -9.546  -31.143 27.059 1.00 19.82 ? 333  GLN A CG    1 
ATOM   2793 C  CD    . GLN A 1 333 ? -8.534  -32.136 26.546 1.00 22.29 ? 333  GLN A CD    1 
ATOM   2794 O  OE1   . GLN A 1 333 ? -8.444  -33.259 27.042 1.00 29.30 ? 333  GLN A OE1   1 
ATOM   2795 N  NE2   . GLN A 1 333 ? -7.758  -31.726 25.556 1.00 21.68 ? 333  GLN A NE2   1 
ATOM   2796 N  N     . ILE A 1 334 ? -8.502  -27.018 28.774 1.00 15.47 ? 334  ILE A N     1 
ATOM   2797 C  CA    . ILE A 1 334 ? -7.873  -26.013 29.629 1.00 15.15 ? 334  ILE A CA    1 
ATOM   2798 C  C     . ILE A 1 334 ? -8.940  -25.291 30.463 1.00 16.53 ? 334  ILE A C     1 
ATOM   2799 O  O     . ILE A 1 334 ? -8.755  -25.089 31.666 1.00 16.76 ? 334  ILE A O     1 
ATOM   2800 C  CB    . ILE A 1 334 ? -7.015  -25.012 28.810 1.00 16.85 ? 334  ILE A CB    1 
ATOM   2801 C  CG1   . ILE A 1 334 ? -5.821  -25.735 28.170 1.00 17.52 ? 334  ILE A CG1   1 
ATOM   2802 C  CG2   . ILE A 1 334 ? -6.522  -23.866 29.703 1.00 16.45 ? 334  ILE A CG2   1 
ATOM   2803 C  CD1   . ILE A 1 334 ? -5.143  -24.951 27.040 1.00 19.25 ? 334  ILE A CD1   1 
ATOM   2804 N  N     . ASP A 1 335 ? -10.066 -24.936 29.840 1.00 14.65 ? 335  ASP A N     1 
ATOM   2805 C  CA    . ASP A 1 335 ? -11.136 -24.276 30.587 1.00 16.96 ? 335  ASP A CA    1 
ATOM   2806 C  C     . ASP A 1 335 ? -11.798 -25.180 31.623 1.00 17.24 ? 335  ASP A C     1 
ATOM   2807 O  O     . ASP A 1 335 ? -12.159 -24.718 32.712 1.00 16.73 ? 335  ASP A O     1 
ATOM   2808 C  CB    . ASP A 1 335 ? -12.198 -23.647 29.692 1.00 16.08 ? 335  ASP A CB    1 
ATOM   2809 C  CG    . ASP A 1 335 ? -13.120 -22.723 30.478 1.00 19.13 ? 335  ASP A CG    1 
ATOM   2810 O  OD1   . ASP A 1 335 ? -12.618 -21.733 31.054 1.00 17.24 ? 335  ASP A OD1   1 
ATOM   2811 O  OD2   . ASP A 1 335 ? -14.329 -23.011 30.556 1.00 21.40 ? 335  ASP A OD2   1 
ATOM   2812 N  N     . ALA A 1 336 ? -11.949 -26.460 31.293 1.00 16.31 ? 336  ALA A N     1 
ATOM   2813 C  CA    . ALA A 1 336 ? -12.477 -27.427 32.260 1.00 16.04 ? 336  ALA A CA    1 
ATOM   2814 C  C     . ALA A 1 336 ? -11.633 -27.427 33.538 1.00 17.81 ? 336  ALA A C     1 
ATOM   2815 O  O     . ALA A 1 336 ? -12.167 -27.532 34.643 1.00 18.96 ? 336  ALA A O     1 
ATOM   2816 C  CB    . ALA A 1 336 ? -12.548 -28.827 31.644 1.00 17.70 ? 336  ALA A CB    1 
ATOM   2817 N  N     . LYS A 1 337 ? -10.318 -27.278 33.371 1.00 16.69 ? 337  LYS A N     1 
ATOM   2818 C  CA    . LYS A 1 337 ? -9.377  -27.198 34.484 1.00 16.17 ? 337  LYS A CA    1 
ATOM   2819 C  C     . LYS A 1 337 ? -9.387  -25.823 35.167 1.00 16.55 ? 337  LYS A C     1 
ATOM   2820 O  O     . LYS A 1 337 ? -9.619  -25.732 36.374 1.00 16.07 ? 337  LYS A O     1 
ATOM   2821 C  CB    . LYS A 1 337 ? -7.961  -27.549 34.004 1.00 15.90 ? 337  LYS A CB    1 
ATOM   2822 C  CG    . LYS A 1 337 ? -6.896  -27.402 35.072 1.00 17.99 ? 337  LYS A CG    1 
ATOM   2823 C  CD    . LYS A 1 337 ? -5.497  -27.623 34.518 1.00 18.59 ? 337  LYS A CD    1 
ATOM   2824 C  CE    . LYS A 1 337 ? -4.460  -27.411 35.609 1.00 22.89 ? 337  LYS A CE    1 
ATOM   2825 N  NZ    . LYS A 1 337 ? -3.054  -27.482 35.103 1.00 26.08 ? 337  LYS A NZ    1 
ATOM   2826 N  N     . ARG A 1 338 ? -9.139  -24.765 34.393 1.00 15.12 ? 338  ARG A N     1 
ATOM   2827 C  CA    . ARG A 1 338 ? -8.908  -23.427 34.948 1.00 12.91 ? 338  ARG A CA    1 
ATOM   2828 C  C     . ARG A 1 338 ? -10.181 -22.657 35.269 1.00 14.67 ? 338  ARG A C     1 
ATOM   2829 O  O     . ARG A 1 338 ? -10.185 -21.832 36.187 1.00 16.17 ? 338  ARG A O     1 
ATOM   2830 C  CB    . ARG A 1 338 ? -8.041  -22.589 34.001 1.00 13.21 ? 338  ARG A CB    1 
ATOM   2831 C  CG    . ARG A 1 338 ? -6.587  -23.054 33.914 1.00 13.91 ? 338  ARG A CG    1 
ATOM   2832 C  CD    . ARG A 1 338 ? -5.814  -22.768 35.198 1.00 15.50 ? 338  ARG A CD    1 
ATOM   2833 N  NE    . ARG A 1 338 ? -4.375  -22.800 34.937 1.00 17.64 ? 338  ARG A NE    1 
ATOM   2834 C  CZ    . ARG A 1 338 ? -3.470  -22.077 35.585 1.00 17.90 ? 338  ARG A CZ    1 
ATOM   2835 N  NH1   . ARG A 1 338 ? -3.832  -21.256 36.572 1.00 16.51 ? 338  ARG A NH1   1 
ATOM   2836 N  NH2   . ARG A 1 338 ? -2.190  -22.180 35.244 1.00 18.12 ? 338  ARG A NH2   1 
ATOM   2837 N  N     . GLN A 1 339 ? -11.240 -22.905 34.504 1.00 15.07 ? 339  GLN A N     1 
ATOM   2838 C  CA    . GLN A 1 339 ? -12.572 -22.315 34.756 1.00 14.72 ? 339  GLN A CA    1 
ATOM   2839 C  C     . GLN A 1 339 ? -12.595 -20.779 34.641 1.00 15.15 ? 339  GLN A C     1 
ATOM   2840 O  O     . GLN A 1 339 ? -13.249 -20.074 35.424 1.00 13.99 ? 339  GLN A O     1 
ATOM   2841 C  CB    . GLN A 1 339 ? -13.159 -22.821 36.082 1.00 16.65 ? 339  GLN A CB    1 
ATOM   2842 C  CG    . GLN A 1 339 ? -13.289 -24.339 36.088 1.00 20.62 ? 339  GLN A CG    1 
ATOM   2843 C  CD    . GLN A 1 339 ? -13.729 -24.938 37.411 1.00 27.27 ? 339  GLN A CD    1 
ATOM   2844 O  OE1   . GLN A 1 339 ? -13.586 -26.143 37.619 1.00 31.67 ? 339  GLN A OE1   1 
ATOM   2845 N  NE2   . GLN A 1 339 ? -14.267 -24.114 38.307 1.00 26.10 ? 339  GLN A NE2   1 
ATOM   2846 N  N     . PHE A 1 340 ? -11.885 -20.280 33.636 1.00 13.89 ? 340  PHE A N     1 
ATOM   2847 C  CA    . PHE A 1 340 ? -11.811 -18.841 33.384 1.00 15.81 ? 340  PHE A CA    1 
ATOM   2848 C  C     . PHE A 1 340 ? -13.093 -18.258 32.789 1.00 15.44 ? 340  PHE A C     1 
ATOM   2849 O  O     . PHE A 1 340 ? -13.428 -17.105 33.062 1.00 15.11 ? 340  PHE A O     1 
ATOM   2850 C  CB    . PHE A 1 340 ? -10.609 -18.495 32.496 1.00 16.40 ? 340  PHE A CB    1 
ATOM   2851 C  CG    . PHE A 1 340 ? -9.268  -18.768 33.140 1.00 16.21 ? 340  PHE A CG    1 
ATOM   2852 C  CD1   . PHE A 1 340 ? -9.118  -18.764 34.535 1.00 15.27 ? 340  PHE A CD1   1 
ATOM   2853 C  CD2   . PHE A 1 340 ? -8.153  -19.005 32.351 1.00 15.37 ? 340  PHE A CD2   1 
ATOM   2854 C  CE1   . PHE A 1 340 ? -7.881  -19.016 35.122 1.00 16.32 ? 340  PHE A CE1   1 
ATOM   2855 C  CE2   . PHE A 1 340 ? -6.903  -19.257 32.927 1.00 17.02 ? 340  PHE A CE2   1 
ATOM   2856 C  CZ    . PHE A 1 340 ? -6.768  -19.255 34.314 1.00 16.62 ? 340  PHE A CZ    1 
ATOM   2857 N  N     . ILE A 1 341 ? -13.810 -19.045 31.986 1.00 13.94 ? 341  ILE A N     1 
ATOM   2858 C  CA    . ILE A 1 341 ? -15.095 -18.584 31.440 1.00 15.34 ? 341  ILE A CA    1 
ATOM   2859 C  C     . ILE A 1 341 ? -16.098 -18.413 32.583 1.00 15.89 ? 341  ILE A C     1 
ATOM   2860 O  O     . ILE A 1 341 ? -16.774 -17.384 32.672 1.00 14.06 ? 341  ILE A O     1 
ATOM   2861 C  CB    . ILE A 1 341 ? -15.652 -19.543 30.343 1.00 16.65 ? 341  ILE A CB    1 
ATOM   2862 C  CG1   . ILE A 1 341 ? -14.674 -19.666 29.162 1.00 20.37 ? 341  ILE A CG1   1 
ATOM   2863 C  CG2   . ILE A 1 341 ? -17.059 -19.110 29.896 1.00 17.72 ? 341  ILE A CG2   1 
ATOM   2864 C  CD1   . ILE A 1 341 ? -14.587 -18.450 28.242 1.00 25.05 ? 341  ILE A CD1   1 
ATOM   2865 N  N     . ASN A 1 342 ? -16.177 -19.425 33.450 1.00 15.81 ? 342  ASN A N     1 
ATOM   2866 C  CA    . ASN A 1 342 ? -17.005 -19.365 34.661 1.00 17.66 ? 342  ASN A CA    1 
ATOM   2867 C  C     . ASN A 1 342 ? -16.693 -18.120 35.506 1.00 15.91 ? 342  ASN A C     1 
ATOM   2868 O  O     . ASN A 1 342 ? -17.598 -17.415 35.954 1.00 15.64 ? 342  ASN A O     1 
ATOM   2869 C  CB    . ASN A 1 342 ? -16.816 -20.635 35.504 1.00 18.61 ? 342  ASN A CB    1 
ATOM   2870 C  CG    . ASN A 1 342 ? -17.606 -20.595 36.802 1.00 25.18 ? 342  ASN A CG    1 
ATOM   2871 O  OD1   . ASN A 1 342 ? -18.828 -20.744 36.801 1.00 25.69 ? 342  ASN A OD1   1 
ATOM   2872 N  ND2   . ASN A 1 342 ? -16.907 -20.388 37.917 1.00 24.61 ? 342  ASN A ND2   1 
ATOM   2873 N  N     . LEU A 1 343 ? -15.404 -17.868 35.719 1.00 15.58 ? 343  LEU A N     1 
ATOM   2874 C  CA    . LEU A 1 343 ? -14.945 -16.688 36.446 1.00 15.99 ? 343  LEU A CA    1 
ATOM   2875 C  C     . LEU A 1 343 ? -15.426 -15.389 35.805 1.00 14.99 ? 343  LEU A C     1 
ATOM   2876 O  O     . LEU A 1 343 ? -15.910 -14.489 36.495 1.00 15.95 ? 343  LEU A O     1 
ATOM   2877 C  CB    . LEU A 1 343 ? -13.417 -16.687 36.523 1.00 18.60 ? 343  LEU A CB    1 
ATOM   2878 C  CG    . LEU A 1 343 ? -12.754 -15.471 37.183 1.00 19.73 ? 343  LEU A CG    1 
ATOM   2879 C  CD1   . LEU A 1 343 ? -13.116 -15.354 38.670 1.00 18.85 ? 343  LEU A CD1   1 
ATOM   2880 C  CD2   . LEU A 1 343 ? -11.245 -15.580 36.983 1.00 19.61 ? 343  LEU A CD2   1 
ATOM   2881 N  N     . SER A 1 344 ? -15.280 -15.305 34.485 1.00 14.36 ? 344  SER A N     1 
ATOM   2882 C  CA    . SER A 1 344 ? -15.664 -14.120 33.719 1.00 15.46 ? 344  SER A CA    1 
ATOM   2883 C  C     . SER A 1 344 ? -17.161 -13.848 33.821 1.00 15.23 ? 344  SER A C     1 
ATOM   2884 O  O     . SER A 1 344 ? -17.577 -12.706 33.992 1.00 15.76 ? 344  SER A O     1 
ATOM   2885 C  CB    . SER A 1 344 ? -15.264 -14.279 32.250 1.00 15.60 ? 344  SER A CB    1 
ATOM   2886 O  OG    . SER A 1 344 ? -13.863 -14.468 32.118 1.00 16.34 ? 344  SER A OG    1 
ATOM   2887 N  N     . LEU A 1 345 ? -17.968 -14.898 33.717 1.00 15.55 ? 345  LEU A N     1 
ATOM   2888 C  CA    . LEU A 1 345 ? -19.414 -14.741 33.861 1.00 15.92 ? 345  LEU A CA    1 
ATOM   2889 C  C     . LEU A 1 345 ? -19.774 -14.272 35.266 1.00 15.27 ? 345  LEU A C     1 
ATOM   2890 O  O     . LEU A 1 345 ? -20.519 -13.304 35.419 1.00 15.50 ? 345  LEU A O     1 
ATOM   2891 C  CB    . LEU A 1 345 ? -20.149 -16.034 33.503 1.00 17.91 ? 345  LEU A CB    1 
ATOM   2892 C  CG    . LEU A 1 345 ? -19.992 -16.506 32.054 1.00 14.93 ? 345  LEU A CG    1 
ATOM   2893 C  CD1   . LEU A 1 345 ? -20.544 -17.925 31.889 1.00 18.57 ? 345  LEU A CD1   1 
ATOM   2894 C  CD2   . LEU A 1 345 ? -20.653 -15.537 31.062 1.00 18.08 ? 345  LEU A CD2   1 
ATOM   2895 N  N     . ASP A 1 346 ? -19.208 -14.934 36.279 1.00 16.46 ? 346  ASP A N     1 
ATOM   2896 C  CA    . ASP A 1 346 ? -19.394 -14.544 37.679 1.00 16.39 ? 346  ASP A CA    1 
ATOM   2897 C  C     . ASP A 1 346 ? -19.125 -13.056 37.910 1.00 18.33 ? 346  ASP A C     1 
ATOM   2898 O  O     . ASP A 1 346 ? -19.976 -12.339 38.453 1.00 17.76 ? 346  ASP A O     1 
ATOM   2899 C  CB    . ASP A 1 346 ? -18.468 -15.354 38.590 1.00 17.52 ? 346  ASP A CB    1 
ATOM   2900 C  CG    . ASP A 1 346 ? -19.060 -16.682 39.016 1.00 26.37 ? 346  ASP A CG    1 
ATOM   2901 O  OD1   . ASP A 1 346 ? -20.122 -17.087 38.492 1.00 26.04 ? 346  ASP A OD1   1 
ATOM   2902 O  OD2   . ASP A 1 346 ? -18.448 -17.324 39.898 1.00 29.88 ? 346  ASP A OD2   1 
ATOM   2903 N  N     . MET A 1 347 ? -17.935 -12.609 37.505 1.00 17.71 ? 347  MET A N     1 
ATOM   2904 C  CA    . MET A 1 347 ? -17.502 -11.230 37.718 1.00 18.91 ? 347  MET A CA    1 
ATOM   2905 C  C     . MET A 1 347 ? -18.323 -10.236 36.905 1.00 16.50 ? 347  MET A C     1 
ATOM   2906 O  O     . MET A 1 347 ? -18.748 -9.209  37.432 1.00 15.92 ? 347  MET A O     1 
ATOM   2907 C  CB    . MET A 1 347 ? -16.007 -11.076 37.408 1.00 19.67 ? 347  MET A CB    1 
ATOM   2908 C  CG    . MET A 1 347 ? -15.095 -11.696 38.456 1.00 28.63 ? 347  MET A CG    1 
ATOM   2909 S  SD    . MET A 1 347 ? -13.323 -11.515 38.108 1.00 40.38 ? 347  MET A SD    1 
ATOM   2910 C  CE    . MET A 1 347 ? -13.155 -9.754  37.790 1.00 39.38 ? 347  MET A CE    1 
ATOM   2911 N  N     . GLY A 1 348 ? -18.558 -10.554 35.631 1.00 15.57 ? 348  GLY A N     1 
ATOM   2912 C  CA    . GLY A 1 348 ? -19.314 -9.678  34.741 1.00 16.05 ? 348  GLY A CA    1 
ATOM   2913 C  C     . GLY A 1 348 ? -20.739 -9.439  35.209 1.00 17.20 ? 348  GLY A C     1 
ATOM   2914 O  O     . GLY A 1 348 ? -21.207 -8.297  35.230 1.00 16.14 ? 348  GLY A O     1 
ATOM   2915 N  N     . TYR A 1 349 ? -21.427 -10.511 35.596 1.00 16.28 ? 349  TYR A N     1 
ATOM   2916 C  CA    . TYR A 1 349 ? -22.808 -10.386 36.064 1.00 17.89 ? 349  TYR A CA    1 
ATOM   2917 C  C     . TYR A 1 349 ? -22.886 -9.720  37.430 1.00 17.62 ? 349  TYR A C     1 
ATOM   2918 O  O     . TYR A 1 349 ? -23.838 -8.994  37.717 1.00 16.95 ? 349  TYR A O     1 
ATOM   2919 C  CB    . TYR A 1 349 ? -23.536 -11.736 36.053 1.00 18.33 ? 349  TYR A CB    1 
ATOM   2920 C  CG    . TYR A 1 349 ? -23.950 -12.172 34.660 1.00 17.00 ? 349  TYR A CG    1 
ATOM   2921 C  CD1   . TYR A 1 349 ? -24.820 -11.394 33.891 1.00 17.45 ? 349  TYR A CD1   1 
ATOM   2922 C  CD2   . TYR A 1 349 ? -23.471 -13.357 34.114 1.00 18.23 ? 349  TYR A CD2   1 
ATOM   2923 C  CE1   . TYR A 1 349 ? -25.201 -11.795 32.603 1.00 19.13 ? 349  TYR A CE1   1 
ATOM   2924 C  CE2   . TYR A 1 349 ? -23.843 -13.771 32.832 1.00 16.17 ? 349  TYR A CE2   1 
ATOM   2925 C  CZ    . TYR A 1 349 ? -24.708 -12.988 32.086 1.00 16.90 ? 349  TYR A CZ    1 
ATOM   2926 O  OH    . TYR A 1 349 ? -25.067 -13.406 30.823 1.00 16.80 ? 349  TYR A OH    1 
ATOM   2927 N  N     . TYR A 1 350 ? -21.869 -9.950  38.257 1.00 17.07 ? 350  TYR A N     1 
ATOM   2928 C  CA    . TYR A 1 350 ? -21.792 -9.303  39.557 1.00 17.13 ? 350  TYR A CA    1 
ATOM   2929 C  C     . TYR A 1 350 ? -21.707 -7.786  39.423 1.00 17.42 ? 350  TYR A C     1 
ATOM   2930 O  O     . TYR A 1 350 ? -22.384 -7.060  40.156 1.00 17.79 ? 350  TYR A O     1 
ATOM   2931 C  CB    . TYR A 1 350 ? -20.611 -9.832  40.374 1.00 18.39 ? 350  TYR A CB    1 
ATOM   2932 C  CG    . TYR A 1 350 ? -20.500 -9.185  41.742 1.00 18.27 ? 350  TYR A CG    1 
ATOM   2933 C  CD1   . TYR A 1 350 ? -21.274 -9.640  42.811 1.00 22.12 ? 350  TYR A CD1   1 
ATOM   2934 C  CD2   . TYR A 1 350 ? -19.623 -8.115  41.964 1.00 17.56 ? 350  TYR A CD2   1 
ATOM   2935 C  CE1   . TYR A 1 350 ? -21.186 -9.044  44.068 1.00 20.32 ? 350  TYR A CE1   1 
ATOM   2936 C  CE2   . TYR A 1 350 ? -19.527 -7.515  43.222 1.00 19.19 ? 350  TYR A CE2   1 
ATOM   2937 C  CZ    . TYR A 1 350 ? -20.308 -7.989  44.264 1.00 20.67 ? 350  TYR A CZ    1 
ATOM   2938 O  OH    . TYR A 1 350 ? -20.220 -7.407  45.509 1.00 23.46 ? 350  TYR A OH    1 
ATOM   2939 N  N     . ALA A 1 351 ? -20.876 -7.322  38.491 1.00 16.85 ? 351  ALA A N     1 
ATOM   2940 C  CA    . ALA A 1 351 ? -20.641 -5.896  38.267 1.00 16.74 ? 351  ALA A CA    1 
ATOM   2941 C  C     . ALA A 1 351 ? -21.728 -5.246  37.408 1.00 18.21 ? 351  ALA A C     1 
ATOM   2942 O  O     . ALA A 1 351 ? -21.925 -4.029  37.470 1.00 17.17 ? 351  ALA A O     1 
ATOM   2943 C  CB    . ALA A 1 351 ? -19.262 -5.686  37.623 1.00 15.96 ? 351  ALA A CB    1 
ATOM   2944 N  N     . LYS A 1 352 ? -22.434 -6.068  36.631 1.00 17.74 ? 352  LYS A N     1 
ATOM   2945 C  CA    . LYS A 1 352 ? -23.429 -5.613  35.641 1.00 17.45 ? 352  LYS A CA    1 
ATOM   2946 C  C     . LYS A 1 352 ? -22.755 -4.854  34.498 1.00 17.94 ? 352  LYS A C     1 
ATOM   2947 O  O     . LYS A 1 352 ? -23.088 -3.703  34.201 1.00 17.88 ? 352  LYS A O     1 
ATOM   2948 C  CB    . LYS A 1 352 ? -24.568 -4.811  36.295 1.00 19.13 ? 352  LYS A CB    1 
ATOM   2949 C  CG    . LYS A 1 352 ? -25.403 -5.645  37.247 1.00 21.20 ? 352  LYS A CG    1 
ATOM   2950 C  CD    . LYS A 1 352 ? -26.486 -4.819  37.936 1.00 26.08 ? 352  LYS A CD    1 
ATOM   2951 C  CE    . LYS A 1 352 ? -27.294 -5.717  38.855 1.00 27.87 ? 352  LYS A CE    1 
ATOM   2952 N  NZ    . LYS A 1 352 ? -28.057 -4.956  39.873 1.00 28.81 ? 352  LYS A NZ    1 
ATOM   2953 N  N     . ILE A 1 353 ? -21.789 -5.526  33.875 1.00 15.97 ? 353  ILE A N     1 
ATOM   2954 C  CA    . ILE A 1 353 ? -21.014 -4.977  32.761 1.00 16.92 ? 353  ILE A CA    1 
ATOM   2955 C  C     . ILE A 1 353 ? -21.131 -5.933  31.573 1.00 16.79 ? 353  ILE A C     1 
ATOM   2956 O  O     . ILE A 1 353 ? -21.572 -7.073  31.737 1.00 19.05 ? 353  ILE A O     1 
ATOM   2957 C  CB    . ILE A 1 353 ? -19.517 -4.789  33.141 1.00 17.16 ? 353  ILE A CB    1 
ATOM   2958 C  CG1   . ILE A 1 353 ? -18.906 -6.117  33.624 1.00 15.81 ? 353  ILE A CG1   1 
ATOM   2959 C  CG2   . ILE A 1 353 ? -19.361 -3.679  34.200 1.00 15.86 ? 353  ILE A CG2   1 
ATOM   2960 C  CD1   . ILE A 1 353 ? -17.449 -6.028  34.123 1.00 18.50 ? 353  ILE A CD1   1 
ATOM   2961 N  N     . GLN A 1 354 ? -20.733 -5.475  30.385 1.00 17.05 ? 354  GLN A N     1 
ATOM   2962 C  CA    . GLN A 1 354 ? -20.512 -6.379  29.262 1.00 16.71 ? 354  GLN A CA    1 
ATOM   2963 C  C     . GLN A 1 354 ? -19.480 -7.388  29.752 1.00 16.75 ? 354  GLN A C     1 
ATOM   2964 O  O     . GLN A 1 354 ? -18.509 -7.004  30.408 1.00 15.08 ? 354  GLN A O     1 
ATOM   2965 C  CB    . GLN A 1 354 ? -19.943 -5.628  28.062 1.00 16.66 ? 354  GLN A CB    1 
ATOM   2966 C  CG    . GLN A 1 354 ? -20.849 -4.538  27.485 1.00 18.08 ? 354  GLN A CG    1 
ATOM   2967 C  CD    . GLN A 1 354 ? -20.269 -3.924  26.222 1.00 24.32 ? 354  GLN A CD    1 
ATOM   2968 O  OE1   . GLN A 1 354 ? -20.920 -3.883  25.174 1.00 23.63 ? 354  GLN A OE1   1 
ATOM   2969 N  NE2   . GLN A 1 354 ? -19.027 -3.464  26.309 1.00 21.26 ? 354  GLN A NE2   1 
ATOM   2970 N  N     . ILE A 1 355 ? -19.686 -8.666  29.458 1.00 15.62 ? 355  ILE A N     1 
ATOM   2971 C  CA    . ILE A 1 355 ? -18.779 -9.698  29.984 1.00 16.84 ? 355  ILE A CA    1 
ATOM   2972 C  C     . ILE A 1 355 ? -17.315 -9.427  29.599 1.00 16.31 ? 355  ILE A C     1 
ATOM   2973 O  O     . ILE A 1 355 ? -16.423 -9.607  30.426 1.00 16.72 ? 355  ILE A O     1 
ATOM   2974 C  CB    . ILE A 1 355 ? -19.233 -11.144 29.617 1.00 16.16 ? 355  ILE A CB    1 
ATOM   2975 C  CG1   . ILE A 1 355 ? -20.673 -11.411 30.099 1.00 15.06 ? 355  ILE A CG1   1 
ATOM   2976 C  CG2   . ILE A 1 355 ? -18.272 -12.194 30.179 1.00 15.57 ? 355  ILE A CG2   1 
ATOM   2977 C  CD1   . ILE A 1 355 ? -20.910 -11.227 31.620 1.00 16.23 ? 355  ILE A CD1   1 
ATOM   2978 N  N     . GLN A 1 356 ? -17.070 -8.950  28.377 1.00 17.46 ? 356  GLN A N     1 
ATOM   2979 C  CA    . GLN A 1 356 ? -15.693 -8.662  27.940 1.00 16.67 ? 356  GLN A CA    1 
ATOM   2980 C  C     . GLN A 1 356 ? -15.023 -7.562  28.768 1.00 16.80 ? 356  GLN A C     1 
ATOM   2981 O  O     . GLN A 1 356 ? -13.805 -7.390  28.711 1.00 16.58 ? 356  GLN A O     1 
ATOM   2982 C  CB    . GLN A 1 356 ? -15.606 -8.344  26.438 1.00 17.41 ? 356  GLN A CB    1 
ATOM   2983 C  CG    . GLN A 1 356 ? -16.287 -7.033  26.015 1.00 17.11 ? 356  GLN A CG    1 
ATOM   2984 C  CD    . GLN A 1 356 ? -17.722 -7.242  25.573 1.00 18.87 ? 356  GLN A CD    1 
ATOM   2985 O  OE1   . GLN A 1 356 ? -18.443 -8.069  26.130 1.00 19.29 ? 356  GLN A OE1   1 
ATOM   2986 N  NE2   . GLN A 1 356 ? -18.143 -6.486  24.561 1.00 20.00 ? 356  GLN A NE2   1 
ATOM   2987 N  N     . SER A 1 357 ? -15.814 -6.825  29.541 1.00 16.10 ? 357  SER A N     1 
ATOM   2988 C  CA    . SER A 1 357 ? -15.260 -5.792  30.410 1.00 17.21 ? 357  SER A CA    1 
ATOM   2989 C  C     . SER A 1 357 ? -14.538 -6.329  31.649 1.00 17.07 ? 357  SER A C     1 
ATOM   2990 O  O     . SER A 1 357 ? -13.913 -5.552  32.379 1.00 16.42 ? 357  SER A O     1 
ATOM   2991 C  CB    . SER A 1 357 ? -16.339 -4.778  30.811 1.00 16.93 ? 357  SER A CB    1 
ATOM   2992 O  OG    . SER A 1 357 ? -16.648 -3.937  29.720 1.00 19.32 ? 357  SER A OG    1 
ATOM   2993 N  N     . VAL A 1 358 ? -14.608 -7.642  31.890 1.00 15.11 ? 358  VAL A N     1 
ATOM   2994 C  CA    . VAL A 1 358 ? -13.860 -8.236  33.011 1.00 15.60 ? 358  VAL A CA    1 
ATOM   2995 C  C     . VAL A 1 358 ? -12.345 -8.047  32.872 1.00 16.55 ? 358  VAL A C     1 
ATOM   2996 O  O     . VAL A 1 358 ? -11.624 -8.111  33.860 1.00 16.88 ? 358  VAL A O     1 
ATOM   2997 C  CB    . VAL A 1 358 ? -14.199 -9.741  33.281 1.00 16.32 ? 358  VAL A CB    1 
ATOM   2998 C  CG1   . VAL A 1 358 ? -15.686 -9.916  33.582 1.00 17.01 ? 358  VAL A CG1   1 
ATOM   2999 C  CG2   . VAL A 1 358 ? -13.736 -10.652 32.137 1.00 17.24 ? 358  VAL A CG2   1 
ATOM   3000 N  N     . PHE A 1 359 ? -11.874 -7.797  31.650 1.00 15.87 ? 359  PHE A N     1 
ATOM   3001 C  CA    . PHE A 1 359 ? -10.463 -7.492  31.421 1.00 17.08 ? 359  PHE A CA    1 
ATOM   3002 C  C     . PHE A 1 359 ? -10.045 -6.147  32.010 1.00 17.93 ? 359  PHE A C     1 
ATOM   3003 O  O     . PHE A 1 359 ? -8.848  -5.866  32.115 1.00 18.37 ? 359  PHE A O     1 
ATOM   3004 C  CB    . PHE A 1 359 ? -10.143 -7.484  29.929 1.00 17.68 ? 359  PHE A CB    1 
ATOM   3005 C  CG    . PHE A 1 359 ? -10.121 -8.846  29.297 1.00 16.13 ? 359  PHE A CG    1 
ATOM   3006 C  CD1   . PHE A 1 359 ? -9.109  -9.761  29.604 1.00 17.95 ? 359  PHE A CD1   1 
ATOM   3007 C  CD2   . PHE A 1 359 ? -11.086 -9.204  28.360 1.00 17.02 ? 359  PHE A CD2   1 
ATOM   3008 C  CE1   . PHE A 1 359 ? -9.079  -11.022 29.010 1.00 18.25 ? 359  PHE A CE1   1 
ATOM   3009 C  CE2   . PHE A 1 359 ? -11.059 -10.463 27.753 1.00 16.94 ? 359  PHE A CE2   1 
ATOM   3010 C  CZ    . PHE A 1 359 ? -10.050 -11.375 28.083 1.00 16.69 ? 359  PHE A CZ    1 
ATOM   3011 N  N     . SER A 1 360 ? -11.022 -5.325  32.387 1.00 17.81 ? 360  SER A N     1 
ATOM   3012 C  CA    . SER A 1 360 ? -10.748 -3.979  32.877 1.00 17.47 ? 360  SER A CA    1 
ATOM   3013 C  C     . SER A 1 360 ? -11.223 -3.781  34.320 1.00 17.81 ? 360  SER A C     1 
ATOM   3014 O  O     . SER A 1 360 ? -12.421 -3.567  34.553 1.00 17.28 ? 360  SER A O     1 
ATOM   3015 C  CB    . SER A 1 360 ? -11.400 -2.938  31.960 1.00 18.70 ? 360  SER A CB    1 
ATOM   3016 O  OG    . SER A 1 360 ? -11.300 -1.632  32.517 1.00 19.69 ? 360  SER A OG    1 
ATOM   3017 N  N     . PRO A 1 361 ? -10.289 -3.829  35.293 1.00 18.26 ? 361  PRO A N     1 
ATOM   3018 C  CA    . PRO A 1 361 ? -10.679 -3.559  36.682 1.00 18.93 ? 361  PRO A CA    1 
ATOM   3019 C  C     . PRO A 1 361 ? -11.278 -2.166  36.867 1.00 19.51 ? 361  PRO A C     1 
ATOM   3020 O  O     . PRO A 1 361 ? -12.139 -1.981  37.726 1.00 17.38 ? 361  PRO A O     1 
ATOM   3021 C  CB    . PRO A 1 361 ? -9.370  -3.702  37.478 1.00 20.44 ? 361  PRO A CB    1 
ATOM   3022 C  CG    . PRO A 1 361 ? -8.280  -3.806  36.475 1.00 21.09 ? 361  PRO A CG    1 
ATOM   3023 C  CD    . PRO A 1 361 ? -8.875  -4.236  35.173 1.00 20.45 ? 361  PRO A CD    1 
ATOM   3024 N  N     . ILE A 1 362 ? -10.842 -1.195  36.064 1.00 19.43 ? 362  ILE A N     1 
ATOM   3025 C  CA    . ILE A 1 362 ? -11.409 0.157   36.150 1.00 19.20 ? 362  ILE A CA    1 
ATOM   3026 C  C     . ILE A 1 362 ? -12.889 0.177   35.746 1.00 18.31 ? 362  ILE A C     1 
ATOM   3027 O  O     . ILE A 1 362 ? -13.719 0.732   36.470 1.00 19.94 ? 362  ILE A O     1 
ATOM   3028 C  CB    . ILE A 1 362 ? -10.561 1.190   35.359 1.00 20.32 ? 362  ILE A CB    1 
ATOM   3029 C  CG1   . ILE A 1 362 ? -9.255  1.464   36.109 1.00 20.40 ? 362  ILE A CG1   1 
ATOM   3030 C  CG2   . ILE A 1 362 ? -11.337 2.493   35.110 1.00 23.55 ? 362  ILE A CG2   1 
ATOM   3031 C  CD1   . ILE A 1 362 ? -8.199  2.115   35.253 1.00 26.39 ? 362  ILE A CD1   1 
ATOM   3032 N  N     . LYS A 1 363 ? -13.221 -0.452  34.620 1.00 17.07 ? 363  LYS A N     1 
ATOM   3033 C  CA    . LYS A 1 363 ? -14.612 -0.534  34.174 1.00 17.46 ? 363  LYS A CA    1 
ATOM   3034 C  C     . LYS A 1 363 ? -15.444 -1.356  35.161 1.00 15.75 ? 363  LYS A C     1 
ATOM   3035 O  O     . LYS A 1 363 ? -16.594 -1.015  35.452 1.00 15.48 ? 363  LYS A O     1 
ATOM   3036 C  CB    . LYS A 1 363 ? -14.706 -1.120  32.753 1.00 17.93 ? 363  LYS A CB    1 
ATOM   3037 C  CG    . LYS A 1 363 ? -16.134 -1.236  32.196 1.00 20.34 ? 363  LYS A CG    1 
ATOM   3038 C  CD    . LYS A 1 363 ? -16.837 0.115   32.061 1.00 24.26 ? 363  LYS A CD    1 
ATOM   3039 C  CE    . LYS A 1 363 ? -16.541 0.785   30.733 1.00 27.61 ? 363  LYS A CE    1 
ATOM   3040 N  NZ    . LYS A 1 363 ? -17.348 2.035   30.548 1.00 25.10 ? 363  LYS A NZ    1 
ATOM   3041 N  N     . THR A 1 364 ? -14.840 -2.423  35.683 1.00 14.37 ? 364  THR A N     1 
ATOM   3042 C  CA    . THR A 1 364 ? -15.506 -3.332  36.607 1.00 13.94 ? 364  THR A CA    1 
ATOM   3043 C  C     . THR A 1 364 ? -15.891 -2.587  37.886 1.00 14.24 ? 364  THR A C     1 
ATOM   3044 O  O     . THR A 1 364 ? -17.051 -2.629  38.318 1.00 16.29 ? 364  THR A O     1 
ATOM   3045 C  CB    . THR A 1 364 ? -14.614 -4.564  36.924 1.00 13.19 ? 364  THR A CB    1 
ATOM   3046 O  OG1   . THR A 1 364 ? -14.311 -5.261  35.703 1.00 13.90 ? 364  THR A OG1   1 
ATOM   3047 C  CG2   . THR A 1 364 ? -15.316 -5.534  37.888 1.00 14.35 ? 364  THR A CG2   1 
ATOM   3048 N  N     . TRP A 1 365 ? -14.926 -1.886  38.473 1.00 13.48 ? 365  TRP A N     1 
ATOM   3049 C  CA    . TRP A 1 365 ? -15.200 -1.131  39.694 1.00 13.85 ? 365  TRP A CA    1 
ATOM   3050 C  C     . TRP A 1 365 ? -16.080 0.087   39.450 1.00 14.88 ? 365  TRP A C     1 
ATOM   3051 O  O     . TRP A 1 365 ? -16.915 0.423   40.294 1.00 15.33 ? 365  TRP A O     1 
ATOM   3052 C  CB    . TRP A 1 365 ? -13.912 -0.762  40.433 1.00 15.48 ? 365  TRP A CB    1 
ATOM   3053 C  CG    . TRP A 1 365 ? -13.361 -1.923  41.183 1.00 15.56 ? 365  TRP A CG    1 
ATOM   3054 C  CD1   . TRP A 1 365 ? -12.210 -2.605  40.913 1.00 14.90 ? 365  TRP A CD1   1 
ATOM   3055 C  CD2   . TRP A 1 365 ? -13.964 -2.576  42.312 1.00 15.20 ? 365  TRP A CD2   1 
ATOM   3056 N  NE1   . TRP A 1 365 ? -12.047 -3.633  41.818 1.00 17.52 ? 365  TRP A NE1   1 
ATOM   3057 C  CE2   . TRP A 1 365 ? -13.109 -3.638  42.684 1.00 15.48 ? 365  TRP A CE2   1 
ATOM   3058 C  CE3   . TRP A 1 365 ? -15.140 -2.362  43.045 1.00 16.20 ? 365  TRP A CE3   1 
ATOM   3059 C  CZ2   . TRP A 1 365 ? -13.389 -4.488  43.765 1.00 15.88 ? 365  TRP A CZ2   1 
ATOM   3060 C  CZ3   . TRP A 1 365 ? -15.421 -3.215  44.126 1.00 14.98 ? 365  TRP A CZ3   1 
ATOM   3061 C  CH2   . TRP A 1 365 ? -14.545 -4.256  44.471 1.00 17.55 ? 365  TRP A CH2   1 
ATOM   3062 N  N     . ASP A 1 366 ? -15.933 0.735   38.298 1.00 13.64 ? 366  ASP A N     1 
ATOM   3063 C  CA    . ASP A 1 366 ? -16.826 1.847   37.978 1.00 15.85 ? 366  ASP A CA    1 
ATOM   3064 C  C     . ASP A 1 366 ? -18.289 1.403   38.041 1.00 15.96 ? 366  ASP A C     1 
ATOM   3065 O  O     . ASP A 1 366 ? -19.124 2.091   38.628 1.00 16.06 ? 366  ASP A O     1 
ATOM   3066 C  CB    . ASP A 1 366 ? -16.499 2.448   36.610 1.00 17.31 ? 366  ASP A CB    1 
ATOM   3067 C  CG    . ASP A 1 366 ? -17.050 3.859   36.441 1.00 20.14 ? 366  ASP A CG    1 
ATOM   3068 O  OD1   . ASP A 1 366 ? -17.004 4.652   37.403 1.00 18.05 ? 366  ASP A OD1   1 
ATOM   3069 O  OD2   . ASP A 1 366 ? -17.515 4.181   35.331 1.00 19.21 ? 366  ASP A OD2   1 
ATOM   3070 N  N     . ALA A 1 367 ? -18.586 0.245   37.455 1.00 14.79 ? 367  ALA A N     1 
ATOM   3071 C  CA    . ALA A 1 367 ? -19.943 -0.293  37.438 1.00 16.08 ? 367  ALA A CA    1 
ATOM   3072 C  C     . ALA A 1 367 ? -20.432 -0.727  38.812 1.00 16.11 ? 367  ALA A C     1 
ATOM   3073 O  O     . ALA A 1 367 ? -21.571 -0.435  39.182 1.00 16.64 ? 367  ALA A O     1 
ATOM   3074 C  CB    . ALA A 1 367 ? -20.041 -1.452  36.462 1.00 15.15 ? 367  ALA A CB    1 
ATOM   3075 N  N     . ILE A 1 368 ? -19.579 -1.431  39.557 1.00 15.46 ? 368  ILE A N     1 
ATOM   3076 C  CA    . ILE A 1 368 ? -19.935 -1.904  40.892 1.00 15.04 ? 368  ILE A CA    1 
ATOM   3077 C  C     . ILE A 1 368 ? -20.291 -0.704  41.776 1.00 15.52 ? 368  ILE A C     1 
ATOM   3078 O  O     . ILE A 1 368 ? -21.341 -0.687  42.408 1.00 15.71 ? 368  ILE A O     1 
ATOM   3079 C  CB    . ILE A 1 368 ? -18.801 -2.738  41.551 1.00 14.66 ? 368  ILE A CB    1 
ATOM   3080 C  CG1   . ILE A 1 368 ? -18.667 -4.108  40.868 1.00 16.62 ? 368  ILE A CG1   1 
ATOM   3081 C  CG2   . ILE A 1 368 ? -19.076 -2.949  43.061 1.00 14.81 ? 368  ILE A CG2   1 
ATOM   3082 C  CD1   . ILE A 1 368 ? -17.389 -4.865  41.253 1.00 18.42 ? 368  ILE A CD1   1 
ATOM   3083 N  N     . ILE A 1 369 ? -19.420 0.303   41.782 1.00 15.98 ? 369  ILE A N     1 
ATOM   3084 C  CA    . ILE A 1 369 ? -19.613 1.495   42.615 1.00 15.53 ? 369  ILE A CA    1 
ATOM   3085 C  C     . ILE A 1 369 ? -20.848 2.302   42.182 1.00 15.86 ? 369  ILE A C     1 
ATOM   3086 O  O     . ILE A 1 369 ? -21.636 2.754   43.029 1.00 15.33 ? 369  ILE A O     1 
ATOM   3087 C  CB    . ILE A 1 369 ? -18.319 2.360   42.671 1.00 14.79 ? 369  ILE A CB    1 
ATOM   3088 C  CG1   . ILE A 1 369 ? -17.201 1.570   43.376 1.00 16.76 ? 369  ILE A CG1   1 
ATOM   3089 C  CG2   . ILE A 1 369 ? -18.574 3.687   43.392 1.00 17.17 ? 369  ILE A CG2   1 
ATOM   3090 C  CD1   . ILE A 1 369 ? -15.792 2.095   43.140 1.00 16.50 ? 369  ILE A CD1   1 
ATOM   3091 N  N     . PHE A 1 370 ? -21.026 2.456   40.869 1.00 16.28 ? 370  PHE A N     1 
ATOM   3092 C  CA    . PHE A 1 370 ? -22.203 3.144   40.325 1.00 17.47 ? 370  PHE A CA    1 
ATOM   3093 C  C     . PHE A 1 370 ? -23.495 2.464   40.759 1.00 17.33 ? 370  PHE A C     1 
ATOM   3094 O  O     . PHE A 1 370 ? -24.417 3.128   41.253 1.00 16.45 ? 370  PHE A O     1 
ATOM   3095 C  CB    . PHE A 1 370 ? -22.120 3.242   38.794 1.00 15.57 ? 370  PHE A CB    1 
ATOM   3096 C  CG    . PHE A 1 370 ? -23.459 3.385   38.100 1.00 16.37 ? 370  PHE A CG    1 
ATOM   3097 C  CD1   . PHE A 1 370 ? -23.886 2.414   37.197 1.00 17.71 ? 370  PHE A CD1   1 
ATOM   3098 C  CD2   . PHE A 1 370 ? -24.280 4.489   38.337 1.00 18.11 ? 370  PHE A CD2   1 
ATOM   3099 C  CE1   . PHE A 1 370 ? -25.115 2.532   36.541 1.00 21.70 ? 370  PHE A CE1   1 
ATOM   3100 C  CE2   . PHE A 1 370 ? -25.518 4.612   37.692 1.00 19.73 ? 370  PHE A CE2   1 
ATOM   3101 C  CZ    . PHE A 1 370 ? -25.933 3.631   36.794 1.00 19.77 ? 370  PHE A CZ    1 
ATOM   3102 N  N     . ASN A 1 371 ? -23.562 1.147   40.582 1.00 17.74 ? 371  ASN A N     1 
ATOM   3103 C  CA    . ASN A 1 371 ? -24.760 0.403   40.970 1.00 19.85 ? 371  ASN A CA    1 
ATOM   3104 C  C     . ASN A 1 371 ? -25.060 0.535   42.460 1.00 20.22 ? 371  ASN A C     1 
ATOM   3105 O  O     . ASN A 1 371 ? -26.214 0.725   42.851 1.00 20.22 ? 371  ASN A O     1 
ATOM   3106 C  CB    . ASN A 1 371 ? -24.661 -1.056  40.529 1.00 19.07 ? 371  ASN A CB    1 
ATOM   3107 C  CG    . ASN A 1 371 ? -25.111 -1.248  39.099 1.00 20.23 ? 371  ASN A CG    1 
ATOM   3108 O  OD1   . ASN A 1 371 ? -26.308 -1.265  38.820 1.00 21.04 ? 371  ASN A OD1   1 
ATOM   3109 N  ND2   . ASN A 1 371 ? -24.156 -1.379  38.180 1.00 17.89 ? 371  ASN A ND2   1 
ATOM   3110 N  N     . SER A 1 372 ? -24.007 0.478   43.275 1.00 20.12 ? 372  SER A N     1 
ATOM   3111 C  CA    . SER A 1 372 ? -24.117 0.644   44.723 1.00 19.57 ? 372  SER A CA    1 
ATOM   3112 C  C     . SER A 1 372 ? -24.660 2.016   45.130 1.00 19.38 ? 372  SER A C     1 
ATOM   3113 O  O     . SER A 1 372 ? -25.561 2.107   45.966 1.00 20.06 ? 372  SER A O     1 
ATOM   3114 C  CB    . SER A 1 372 ? -22.758 0.408   45.390 1.00 19.79 ? 372  SER A CB    1 
ATOM   3115 O  OG    . SER A 1 372 ? -22.865 0.536   46.796 1.00 22.45 ? 372  SER A OG    1 
ATOM   3116 N  N     . LEU A 1 373 ? -24.114 3.077   44.536 1.00 18.90 ? 373  LEU A N     1 
ATOM   3117 C  CA    . LEU A 1 373 ? -24.531 4.449   44.845 1.00 18.99 ? 373  LEU A CA    1 
ATOM   3118 C  C     . LEU A 1 373 ? -25.950 4.737   44.358 1.00 19.88 ? 373  LEU A C     1 
ATOM   3119 O  O     . LEU A 1 373 ? -26.740 5.393   45.046 1.00 19.04 ? 373  LEU A O     1 
ATOM   3120 C  CB    . LEU A 1 373 ? -23.536 5.465   44.259 1.00 19.71 ? 373  LEU A CB    1 
ATOM   3121 C  CG    . LEU A 1 373 ? -22.151 5.467   44.912 1.00 19.17 ? 373  LEU A CG    1 
ATOM   3122 C  CD1   . LEU A 1 373 ? -21.162 6.280   44.086 1.00 19.69 ? 373  LEU A CD1   1 
ATOM   3123 C  CD2   . LEU A 1 373 ? -22.208 5.978   46.351 1.00 21.60 ? 373  LEU A CD2   1 
ATOM   3124 N  N     . LYS A 1 374 ? -26.271 4.225   43.177 1.00 21.24 ? 374  LYS A N     1 
ATOM   3125 C  CA    . LYS A 1 374 ? -27.599 4.389   42.593 1.00 22.02 ? 374  LYS A CA    1 
ATOM   3126 C  C     . LYS A 1 374 ? -28.697 3.858   43.512 1.00 23.94 ? 374  LYS A C     1 
ATOM   3127 O  O     . LYS A 1 374 ? -29.792 4.420   43.567 1.00 23.40 ? 374  LYS A O     1 
ATOM   3128 C  CB    . LYS A 1 374 ? -27.661 3.696   41.235 1.00 20.70 ? 374  LYS A CB    1 
ATOM   3129 C  CG    . LYS A 1 374 ? -28.996 3.847   40.522 1.00 20.84 ? 374  LYS A CG    1 
ATOM   3130 C  CD    . LYS A 1 374 ? -28.907 3.353   39.099 1.00 23.37 ? 374  LYS A CD    1 
ATOM   3131 C  CE    . LYS A 1 374 ? -30.259 2.892   38.605 1.00 26.11 ? 374  LYS A CE    1 
ATOM   3132 N  NZ    . LYS A 1 374 ? -30.586 1.535   39.115 1.00 27.84 ? 374  LYS A NZ    1 
ATOM   3133 N  N     . GLU A 1 375 ? -28.393 2.783   44.237 1.00 25.93 ? 375  GLU A N     1 
ATOM   3134 C  CA    . GLU A 1 375 ? -29.331 2.199   45.200 1.00 28.81 ? 375  GLU A CA    1 
ATOM   3135 C  C     . GLU A 1 375 ? -29.755 3.170   46.299 1.00 27.10 ? 375  GLU A C     1 
ATOM   3136 O  O     . GLU A 1 375 ? -30.849 3.046   46.851 1.00 29.02 ? 375  GLU A O     1 
ATOM   3137 C  CB    . GLU A 1 375 ? -28.743 0.929   45.829 1.00 31.50 ? 375  GLU A CB    1 
ATOM   3138 C  CG    . GLU A 1 375 ? -28.778 -0.284  44.925 1.00 37.38 ? 375  GLU A CG    1 
ATOM   3139 C  CD    . GLU A 1 375 ? -30.187 -0.629  44.479 1.00 44.66 ? 375  GLU A CD    1 
ATOM   3140 O  OE1   . GLU A 1 375 ? -31.004 -1.051  45.329 1.00 47.20 ? 375  GLU A OE1   1 
ATOM   3141 O  OE2   . GLU A 1 375 ? -30.475 -0.469  43.274 1.00 46.39 ? 375  GLU A OE2   1 
ATOM   3142 N  N     . GLN A 1 376 ? -28.886 4.130   46.606 1.00 25.07 ? 376  GLN A N     1 
ATOM   3143 C  CA    . GLN A 1 376 ? -29.144 5.135   47.630 1.00 25.45 ? 376  GLN A CA    1 
ATOM   3144 C  C     . GLN A 1 376 ? -29.533 6.487   47.015 1.00 22.98 ? 376  GLN A C     1 
ATOM   3145 O  O     . GLN A 1 376 ? -29.518 7.510   47.700 1.00 21.21 ? 376  GLN A O     1 
ATOM   3146 C  CB    . GLN A 1 376 ? -27.907 5.292   48.525 1.00 28.40 ? 376  GLN A CB    1 
ATOM   3147 C  CG    . GLN A 1 376 ? -27.265 3.955   48.946 1.00 32.58 ? 376  GLN A CG    1 
ATOM   3148 C  CD    . GLN A 1 376 ? -25.813 4.102   49.354 1.00 36.69 ? 376  GLN A CD    1 
ATOM   3149 O  OE1   . GLN A 1 376 ? -24.916 3.598   48.679 1.00 41.80 ? 376  GLN A OE1   1 
ATOM   3150 N  NE2   . GLN A 1 376 ? -25.571 4.800   50.460 1.00 38.41 ? 376  GLN A NE2   1 
ATOM   3151 N  N     . ASN A 1 377 ? -29.882 6.474   45.725 1.00 22.12 ? 377  ASN A N     1 
ATOM   3152 C  CA    . ASN A 1 377 ? -30.179 7.690   44.944 1.00 22.00 ? 377  ASN A CA    1 
ATOM   3153 C  C     . ASN A 1 377 ? -29.027 8.693   44.922 1.00 21.76 ? 377  ASN A C     1 
ATOM   3154 O  O     . ASN A 1 377 ? -29.230 9.906   44.790 1.00 22.49 ? 377  ASN A O     1 
ATOM   3155 C  CB    . ASN A 1 377 ? -31.488 8.356   45.406 1.00 23.82 ? 377  ASN A CB    1 
ATOM   3156 C  CG    . ASN A 1 377 ? -32.718 7.532   45.061 1.00 25.86 ? 377  ASN A CG    1 
ATOM   3157 O  OD1   . ASN A 1 377 ? -32.786 6.894   44.009 1.00 28.69 ? 377  ASN A OD1   1 
ATOM   3158 N  ND2   . ASN A 1 377 ? -33.702 7.546   45.949 1.00 30.18 ? 377  ASN A ND2   1 
ATOM   3159 N  N     . LYS A 1 378 ? -27.809 8.181   45.054 1.00 19.88 ? 378  LYS A N     1 
ATOM   3160 C  CA    . LYS A 1 378 ? -26.635 9.026   44.974 1.00 18.91 ? 378  LYS A CA    1 
ATOM   3161 C  C     . LYS A 1 378 ? -26.140 9.091   43.536 1.00 19.40 ? 378  LYS A C     1 
ATOM   3162 O  O     . LYS A 1 378 ? -26.447 8.218   42.719 1.00 19.62 ? 378  LYS A O     1 
ATOM   3163 C  CB    . LYS A 1 378 ? -25.550 8.555   45.943 1.00 20.08 ? 378  LYS A CB    1 
ATOM   3164 C  CG    . LYS A 1 378 ? -25.947 8.740   47.400 1.00 23.42 ? 378  LYS A CG    1 
ATOM   3165 C  CD    . LYS A 1 378 ? -24.901 8.169   48.344 1.00 28.47 ? 378  LYS A CD    1 
ATOM   3166 C  CE    . LYS A 1 378 ? -25.289 8.388   49.796 1.00 32.12 ? 378  LYS A CE    1 
ATOM   3167 N  NZ    . LYS A 1 378 ? -24.236 7.860   50.715 1.00 35.35 ? 378  LYS A NZ    1 
ATOM   3168 N  N     . VAL A 1 379 ? -25.387 10.144  43.243 1.00 18.56 ? 379  VAL A N     1 
ATOM   3169 C  CA    . VAL A 1 379 ? -25.021 10.489  41.882 1.00 19.13 ? 379  VAL A CA    1 
ATOM   3170 C  C     . VAL A 1 379 ? -23.502 10.520  41.769 1.00 17.95 ? 379  VAL A C     1 
ATOM   3171 O  O     . VAL A 1 379 ? -22.828 11.213  42.535 1.00 19.93 ? 379  VAL A O     1 
ATOM   3172 C  CB    . VAL A 1 379 ? -25.609 11.863  41.503 1.00 19.90 ? 379  VAL A CB    1 
ATOM   3173 C  CG1   . VAL A 1 379 ? -25.133 12.288  40.125 1.00 18.27 ? 379  VAL A CG1   1 
ATOM   3174 C  CG2   . VAL A 1 379 ? -27.143 11.827  41.557 1.00 20.74 ? 379  VAL A CG2   1 
ATOM   3175 N  N     . ILE A 1 380 ? -22.976 9.760   40.814 1.00 17.74 ? 380  ILE A N     1 
ATOM   3176 C  CA    . ILE A 1 380 ? -21.531 9.613   40.652 1.00 17.42 ? 380  ILE A CA    1 
ATOM   3177 C  C     . ILE A 1 380 ? -20.904 10.884  40.049 1.00 17.31 ? 380  ILE A C     1 
ATOM   3178 O  O     . ILE A 1 380 ? -21.541 11.559  39.240 1.00 15.94 ? 380  ILE A O     1 
ATOM   3179 C  CB    . ILE A 1 380 ? -21.173 8.335   39.827 1.00 17.57 ? 380  ILE A CB    1 
ATOM   3180 C  CG1   . ILE A 1 380 ? -21.588 8.477   38.357 1.00 17.89 ? 380  ILE A CG1   1 
ATOM   3181 C  CG2   . ILE A 1 380 ? -21.812 7.086   40.467 1.00 20.17 ? 380  ILE A CG2   1 
ATOM   3182 C  CD1   . ILE A 1 380 ? -21.207 7.271   37.485 1.00 17.38 ? 380  ILE A CD1   1 
ATOM   3183 N  N     . PRO A 1 381 ? -19.662 11.223  40.454 1.00 19.03 ? 381  PRO A N     1 
ATOM   3184 C  CA    . PRO A 1 381 ? -19.001 12.399  39.871 1.00 19.97 ? 381  PRO A CA    1 
ATOM   3185 C  C     . PRO A 1 381 ? -18.589 12.172  38.415 1.00 21.02 ? 381  PRO A C     1 
ATOM   3186 O  O     . PRO A 1 381 ? -18.471 11.028  37.972 1.00 20.02 ? 381  PRO A O     1 
ATOM   3187 C  CB    . PRO A 1 381 ? -17.760 12.578  40.751 1.00 21.20 ? 381  PRO A CB    1 
ATOM   3188 C  CG    . PRO A 1 381 ? -17.450 11.201  41.249 1.00 20.32 ? 381  PRO A CG    1 
ATOM   3189 C  CD    . PRO A 1 381 ? -18.785 10.505  41.399 1.00 20.15 ? 381  PRO A CD    1 
ATOM   3190 N  N     . GLN A 1 382 ? -18.367 13.255  37.678 1.00 21.35 ? 382  GLN A N     1 
ATOM   3191 C  CA    . GLN A 1 382 ? -17.856 13.139  36.322 1.00 21.22 ? 382  GLN A CA    1 
ATOM   3192 C  C     . GLN A 1 382 ? -16.383 12.743  36.341 1.00 22.77 ? 382  GLN A C     1 
ATOM   3193 O  O     . GLN A 1 382 ? -15.620 13.200  37.197 1.00 22.30 ? 382  GLN A O     1 
ATOM   3194 C  CB    . GLN A 1 382 ? -18.017 14.464  35.575 1.00 22.94 ? 382  GLN A CB    1 
ATOM   3195 C  CG    . GLN A 1 382 ? -17.605 14.406  34.108 1.00 25.35 ? 382  GLN A CG    1 
ATOM   3196 C  CD    . GLN A 1 382 ? -17.927 15.680  33.346 1.00 27.16 ? 382  GLN A CD    1 
ATOM   3197 O  OE1   . GLN A 1 382 ? -17.983 16.774  33.916 1.00 22.86 ? 382  GLN A OE1   1 
ATOM   3198 N  NE2   . GLN A 1 382 ? -18.155 15.538  32.043 1.00 29.27 ? 382  GLN A NE2   1 
ATOM   3199 N  N     . GLY A 1 383 ? -15.994 11.900  35.390 1.00 23.76 ? 383  GLY A N     1 
ATOM   3200 C  CA    . GLY A 1 383 ? -14.581 11.588  35.168 1.00 26.82 ? 383  GLY A CA    1 
ATOM   3201 C  C     . GLY A 1 383 ? -13.821 12.815  34.697 1.00 28.65 ? 383  GLY A C     1 
ATOM   3202 O  O     . GLY A 1 383 ? -14.318 13.581  33.864 1.00 28.46 ? 383  GLY A O     1 
ATOM   3203 N  N     . ARG A 1 384 ? -12.620 13.004  35.242 1.00 30.27 ? 384  ARG A N     1 
ATOM   3204 C  CA    . ARG A 1 384 ? -11.778 14.158  34.907 1.00 31.70 ? 384  ARG A CA    1 
ATOM   3205 C  C     . ARG A 1 384 ? -10.414 13.739  34.358 1.00 32.78 ? 384  ARG A C     1 
ATOM   3206 O  O     . ARG A 1 384 ? -9.978  12.598  34.542 1.00 31.24 ? 384  ARG A O     1 
ATOM   3207 C  CB    . ARG A 1 384 ? -11.590 15.051  36.134 1.00 33.46 ? 384  ARG A CB    1 
ATOM   3208 C  CG    . ARG A 1 384 ? -12.854 15.776  36.580 1.00 37.74 ? 384  ARG A CG    1 
ATOM   3209 C  CD    . ARG A 1 384 ? -12.710 16.313  37.995 1.00 44.21 ? 384  ARG A CD    1 
ATOM   3210 N  NE    . ARG A 1 384 ? -13.670 17.382  38.275 1.00 49.33 ? 384  ARG A NE    1 
ATOM   3211 C  CZ    . ARG A 1 384 ? -14.911 17.199  38.727 1.00 51.02 ? 384  ARG A CZ    1 
ATOM   3212 N  NH1   . ARG A 1 384 ? -15.381 15.976  38.963 1.00 49.05 ? 384  ARG A NH1   1 
ATOM   3213 N  NH2   . ARG A 1 384 ? -15.688 18.254  38.943 1.00 51.64 ? 384  ARG A NH2   1 
ATOM   3214 N  N     . SER A 1 385 ? -9.752  14.676  33.682 1.00 32.49 ? 385  SER A N     1 
ATOM   3215 C  CA    . SER A 1 385 ? -8.406  14.471  33.165 1.00 33.95 ? 385  SER A CA    1 
ATOM   3216 C  C     . SER A 1 385 ? -7.383  14.717  34.275 1.00 32.37 ? 385  SER A C     1 
ATOM   3217 O  O     . SER A 1 385 ? -7.505  15.676  35.046 1.00 34.16 ? 385  SER A O     1 
ATOM   3218 C  CB    . SER A 1 385 ? -8.157  15.417  31.982 1.00 35.63 ? 385  SER A CB    1 
ATOM   3219 O  OG    . SER A 1 385 ? -6.863  15.239  31.432 1.00 40.16 ? 385  SER A OG    1 
ATOM   3220 N  N     . HIS A 1 386 ? -6.387  13.838  34.363 1.00 31.40 ? 386  HIS A N     1 
ATOM   3221 C  CA    . HIS A 1 386 ? -5.288  13.998  35.319 1.00 29.91 ? 386  HIS A CA    1 
ATOM   3222 C  C     . HIS A 1 386 ? -3.954  13.675  34.660 1.00 28.26 ? 386  HIS A C     1 
ATOM   3223 O  O     . HIS A 1 386 ? -3.871  12.728  33.873 1.00 27.34 ? 386  HIS A O     1 
ATOM   3224 C  CB    . HIS A 1 386 ? -5.457  13.070  36.525 1.00 28.82 ? 386  HIS A CB    1 
ATOM   3225 C  CG    . HIS A 1 386 ? -6.818  13.107  37.142 1.00 26.58 ? 386  HIS A CG    1 
ATOM   3226 N  ND1   . HIS A 1 386 ? -7.188  14.054  38.073 1.00 26.98 ? 386  HIS A ND1   1 
ATOM   3227 C  CD2   . HIS A 1 386 ? -7.893  12.303  36.974 1.00 27.00 ? 386  HIS A CD2   1 
ATOM   3228 C  CE1   . HIS A 1 386 ? -8.435  13.834  38.447 1.00 27.98 ? 386  HIS A CE1   1 
ATOM   3229 N  NE2   . HIS A 1 386 ? -8.887  12.779  37.794 1.00 26.21 ? 386  HIS A NE2   1 
ATOM   3230 N  N     . PRO A 1 387 ? -2.902  14.448  34.987 1.00 29.73 ? 387  PRO A N     1 
ATOM   3231 C  CA    . PRO A 1 387 ? -1.561  14.081  34.537 1.00 30.58 ? 387  PRO A CA    1 
ATOM   3232 C  C     . PRO A 1 387 ? -1.029  12.883  35.328 1.00 29.06 ? 387  PRO A C     1 
ATOM   3233 O  O     . PRO A 1 387 ? -1.257  12.790  36.533 1.00 28.39 ? 387  PRO A O     1 
ATOM   3234 C  CB    . PRO A 1 387 ? -0.735  15.335  34.843 1.00 32.27 ? 387  PRO A CB    1 
ATOM   3235 C  CG    . PRO A 1 387 ? -1.437  15.980  35.986 1.00 33.04 ? 387  PRO A CG    1 
ATOM   3236 C  CD    . PRO A 1 387 ? -2.902  15.703  35.763 1.00 30.70 ? 387  PRO A CD    1 
ATOM   3237 N  N     . VAL A 1 388 ? -0.339  11.974  34.651 1.00 29.26 ? 388  VAL A N     1 
ATOM   3238 C  CA    . VAL A 1 388 ? 0.277   10.831  35.323 1.00 28.99 ? 388  VAL A CA    1 
ATOM   3239 C  C     . VAL A 1 388 ? 1.403   11.313  36.246 1.00 29.63 ? 388  VAL A C     1 
ATOM   3240 O  O     . VAL A 1 388 ? 2.320   12.013  35.812 1.00 28.67 ? 388  VAL A O     1 
ATOM   3241 C  CB    . VAL A 1 388 ? 0.775   9.772   34.310 1.00 29.98 ? 388  VAL A CB    1 
ATOM   3242 C  CG1   . VAL A 1 388 ? 1.521   8.638   35.012 1.00 30.65 ? 388  VAL A CG1   1 
ATOM   3243 C  CG2   . VAL A 1 388 ? -0.404  9.212   33.509 1.00 29.62 ? 388  VAL A CG2   1 
ATOM   3244 N  N     . GLN A 1 389 ? 1.295   10.957  37.524 1.00 27.46 ? 389  GLN A N     1 
ATOM   3245 C  CA    . GLN A 1 389 ? 2.289   11.307  38.536 1.00 28.36 ? 389  GLN A CA    1 
ATOM   3246 C  C     . GLN A 1 389 ? 2.743   10.054  39.286 1.00 26.47 ? 389  GLN A C     1 
ATOM   3247 O  O     . GLN A 1 389 ? 1.903   9.265   39.718 1.00 25.32 ? 389  GLN A O     1 
ATOM   3248 C  CB    . GLN A 1 389 ? 1.697   12.285  39.549 1.00 26.74 ? 389  GLN A CB    1 
ATOM   3249 C  CG    . GLN A 1 389 ? 1.438   13.690  39.038 1.00 33.56 ? 389  GLN A CG    1 
ATOM   3250 C  CD    . GLN A 1 389 ? 0.969   14.617  40.144 1.00 38.05 ? 389  GLN A CD    1 
ATOM   3251 O  OE1   . GLN A 1 389 ? -0.196  14.589  40.548 1.00 36.76 ? 389  GLN A OE1   1 
ATOM   3252 N  NE2   . GLN A 1 389 ? 1.879   15.448  40.640 1.00 41.61 ? 389  GLN A NE2   1 
ATOM   3253 N  N     . PRO A 1 390 ? 4.069   9.872   39.458 1.00 22.42 ? 390  PRO A N     1 
ATOM   3254 C  CA    . PRO A 1 390 ? 4.542   8.743   40.268 1.00 21.48 ? 390  PRO A CA    1 
ATOM   3255 C  C     . PRO A 1 390 ? 4.133   8.920   41.726 1.00 19.33 ? 390  PRO A C     1 
ATOM   3256 O  O     . PRO A 1 390 ? 3.957   10.058  42.184 1.00 22.12 ? 390  PRO A O     1 
ATOM   3257 C  CB    . PRO A 1 390 ? 6.075   8.819   40.133 1.00 23.64 ? 390  PRO A CB    1 
ATOM   3258 C  CG    . PRO A 1 390 ? 6.327   9.681   38.946 1.00 27.02 ? 390  PRO A CG    1 
ATOM   3259 C  CD    . PRO A 1 390 ? 5.189   10.656  38.908 1.00 24.25 ? 390  PRO A CD    1 
ATOM   3260 N  N     . TYR A 1 391 ? 3.950   7.812   42.440 1.00 18.79 ? 391  TYR A N     1 
ATOM   3261 C  CA    . TYR A 1 391 ? 3.667   7.867   43.876 1.00 18.04 ? 391  TYR A CA    1 
ATOM   3262 C  C     . TYR A 1 391 ? 4.282   6.674   44.604 1.00 19.13 ? 391  TYR A C     1 
ATOM   3263 O  O     . TYR A 1 391 ? 4.537   5.645   43.977 1.00 18.20 ? 391  TYR A O     1 
ATOM   3264 C  CB    . TYR A 1 391 ? 2.161   8.003   44.147 1.00 18.58 ? 391  TYR A CB    1 
ATOM   3265 C  CG    . TYR A 1 391 ? 1.307   6.803   43.798 1.00 17.79 ? 391  TYR A CG    1 
ATOM   3266 C  CD1   . TYR A 1 391 ? 0.815   6.623   42.502 1.00 17.49 ? 391  TYR A CD1   1 
ATOM   3267 C  CD2   . TYR A 1 391 ? 0.967   5.862   44.772 1.00 17.18 ? 391  TYR A CD2   1 
ATOM   3268 C  CE1   . TYR A 1 391 ? 0.002   5.538   42.185 1.00 17.04 ? 391  TYR A CE1   1 
ATOM   3269 C  CE2   . TYR A 1 391 ? 0.165   4.761   44.465 1.00 16.88 ? 391  TYR A CE2   1 
ATOM   3270 C  CZ    . TYR A 1 391 ? -0.314  4.609   43.169 1.00 15.13 ? 391  TYR A CZ    1 
ATOM   3271 O  OH    . TYR A 1 391 ? -1.111  3.526   42.863 1.00 17.13 ? 391  TYR A OH    1 
ATOM   3272 N  N     . PRO A 1 392 ? 4.535   6.807   45.922 1.00 18.76 ? 392  PRO A N     1 
ATOM   3273 C  CA    . PRO A 1 392 ? 5.229   5.747   46.658 1.00 18.47 ? 392  PRO A CA    1 
ATOM   3274 C  C     . PRO A 1 392 ? 4.383   4.514   46.959 1.00 16.97 ? 392  PRO A C     1 
ATOM   3275 O  O     . PRO A 1 392 ? 3.167   4.610   47.121 1.00 16.90 ? 392  PRO A O     1 
ATOM   3276 C  CB    . PRO A 1 392 ? 5.631   6.436   47.972 1.00 20.21 ? 392  PRO A CB    1 
ATOM   3277 C  CG    . PRO A 1 392 ? 4.644   7.497   48.154 1.00 22.41 ? 392  PRO A CG    1 
ATOM   3278 C  CD    . PRO A 1 392 ? 4.343   8.006   46.761 1.00 20.13 ? 392  PRO A CD    1 
ATOM   3279 N  N     . GLY A 1 393 ? 5.054   3.369   47.052 1.00 17.42 ? 393  GLY A N     1 
ATOM   3280 C  CA    . GLY A 1 393 ? 4.399   2.091   47.268 1.00 16.48 ? 393  GLY A CA    1 
ATOM   3281 C  C     . GLY A 1 393 ? 4.843   1.444   48.558 1.00 16.05 ? 393  GLY A C     1 
ATOM   3282 O  O     . GLY A 1 393 ? 4.875   2.089   49.619 1.00 16.45 ? 393  GLY A O     1 
ATOM   3283 N  N     . ALA A 1 394 ? 5.192   0.167   48.470 1.00 14.79 ? 394  ALA A N     1 
ATOM   3284 C  CA    . ALA A 1 394 ? 5.481   -0.624  49.663 1.00 16.75 ? 394  ALA A CA    1 
ATOM   3285 C  C     . ALA A 1 394 ? 6.907   -0.451  50.164 1.00 17.47 ? 394  ALA A C     1 
ATOM   3286 O  O     . ALA A 1 394 ? 7.774   0.075   49.457 1.00 18.22 ? 394  ALA A O     1 
ATOM   3287 C  CB    . ALA A 1 394 ? 5.199   -2.089  49.397 1.00 14.98 ? 394  ALA A CB    1 
ATOM   3288 N  N     . PHE A 1 395 ? 7.128   -0.903  51.396 1.00 16.10 ? 395  PHE A N     1 
ATOM   3289 C  CA    . PHE A 1 395 ? 8.451   -1.003  51.972 1.00 18.71 ? 395  PHE A CA    1 
ATOM   3290 C  C     . PHE A 1 395 ? 8.941   -2.443  51.884 1.00 17.96 ? 395  PHE A C     1 
ATOM   3291 O  O     . PHE A 1 395 ? 8.180   -3.390  52.126 1.00 17.04 ? 395  PHE A O     1 
ATOM   3292 C  CB    . PHE A 1 395 ? 8.432   -0.548  53.433 1.00 20.22 ? 395  PHE A CB    1 
ATOM   3293 C  CG    . PHE A 1 395 ? 9.725   -0.806  54.170 1.00 21.64 ? 395  PHE A CG    1 
ATOM   3294 C  CD1   . PHE A 1 395 ? 10.811  0.055   54.030 1.00 23.30 ? 395  PHE A CD1   1 
ATOM   3295 C  CD2   . PHE A 1 395 ? 9.850   -1.913  55.006 1.00 23.42 ? 395  PHE A CD2   1 
ATOM   3296 C  CE1   . PHE A 1 395 ? 12.005  -0.185  54.714 1.00 23.39 ? 395  PHE A CE1   1 
ATOM   3297 C  CE2   . PHE A 1 395 ? 11.042  -2.162  55.693 1.00 25.22 ? 395  PHE A CE2   1 
ATOM   3298 C  CZ    . PHE A 1 395 ? 12.116  -1.299  55.547 1.00 23.78 ? 395  PHE A CZ    1 
ATOM   3299 N  N     . VAL A 1 396 ? 10.211  -2.590  51.526 1.00 17.80 ? 396  VAL A N     1 
ATOM   3300 C  CA    . VAL A 1 396 ? 10.886  -3.887  51.483 1.00 17.92 ? 396  VAL A CA    1 
ATOM   3301 C  C     . VAL A 1 396 ? 12.164  -3.781  52.317 1.00 18.45 ? 396  VAL A C     1 
ATOM   3302 O  O     . VAL A 1 396 ? 13.002  -2.921  52.061 1.00 17.59 ? 396  VAL A O     1 
ATOM   3303 C  CB    . VAL A 1 396 ? 11.225  -4.297  50.025 1.00 17.67 ? 396  VAL A CB    1 
ATOM   3304 C  CG1   . VAL A 1 396 ? 11.778  -5.722  49.966 1.00 18.37 ? 396  VAL A CG1   1 
ATOM   3305 C  CG2   . VAL A 1 396 ? 9.998   -4.182  49.137 1.00 15.44 ? 396  VAL A CG2   1 
ATOM   3306 N  N     . LYS A 1 397 ? 12.299  -4.643  53.324 1.00 18.82 ? 397  LYS A N     1 
ATOM   3307 C  CA    . LYS A 1 397 ? 13.471  -4.626  54.203 1.00 20.25 ? 397  LYS A CA    1 
ATOM   3308 C  C     . LYS A 1 397 ? 14.690  -5.209  53.487 1.00 19.50 ? 397  LYS A C     1 
ATOM   3309 O  O     . LYS A 1 397 ? 14.570  -6.191  52.767 1.00 18.42 ? 397  LYS A O     1 
ATOM   3310 C  CB    . LYS A 1 397 ? 13.177  -5.408  55.489 1.00 18.83 ? 397  LYS A CB    1 
ATOM   3311 C  CG    . LYS A 1 397 ? 14.307  -5.402  56.518 1.00 20.10 ? 397  LYS A CG    1 
ATOM   3312 C  CD    . LYS A 1 397 ? 13.988  -6.320  57.687 1.00 19.18 ? 397  LYS A CD    1 
ATOM   3313 C  CE    . LYS A 1 397 ? 15.180  -6.463  58.638 1.00 21.13 ? 397  LYS A CE    1 
ATOM   3314 N  NZ    . LYS A 1 397 ? 15.540  -5.162  59.251 1.00 22.04 ? 397  LYS A NZ    1 
ATOM   3315 N  N     . GLU A 1 398 ? 15.856  -4.591  53.673 1.00 19.78 ? 398  GLU A N     1 
ATOM   3316 C  CA    . GLU A 1 398 ? 17.096  -5.124  53.112 1.00 20.14 ? 398  GLU A CA    1 
ATOM   3317 C  C     . GLU A 1 398 ? 17.589  -6.275  53.990 1.00 20.00 ? 398  GLU A C     1 
ATOM   3318 O  O     . GLU A 1 398 ? 17.968  -6.044  55.144 1.00 20.46 ? 398  GLU A O     1 
ATOM   3319 C  CB    . GLU A 1 398 ? 18.170  -4.033  53.042 1.00 21.84 ? 398  GLU A CB    1 
ATOM   3320 C  CG    . GLU A 1 398 ? 19.442  -4.466  52.313 1.00 24.09 ? 398  GLU A CG    1 
ATOM   3321 C  CD    . GLU A 1 398 ? 19.274  -4.470  50.804 1.00 24.79 ? 398  GLU A CD    1 
ATOM   3322 O  OE1   . GLU A 1 398 ? 19.071  -3.376  50.229 1.00 24.68 ? 398  GLU A OE1   1 
ATOM   3323 O  OE2   . GLU A 1 398 ? 19.341  -5.563  50.197 1.00 22.76 ? 398  GLU A OE2   1 
ATOM   3324 N  N     . PRO A 1 399 ? 17.587  -7.515  53.462 1.00 18.40 ? 399  PRO A N     1 
ATOM   3325 C  CA    . PRO A 1 399 ? 18.037  -8.607  54.320 1.00 18.74 ? 399  PRO A CA    1 
ATOM   3326 C  C     . PRO A 1 399 ? 19.562  -8.731  54.331 1.00 19.06 ? 399  PRO A C     1 
ATOM   3327 O  O     . PRO A 1 399 ? 20.222  -8.348  53.369 1.00 20.18 ? 399  PRO A O     1 
ATOM   3328 C  CB    . PRO A 1 399 ? 17.418  -9.835  53.656 1.00 19.53 ? 399  PRO A CB    1 
ATOM   3329 C  CG    . PRO A 1 399 ? 17.445  -9.487  52.180 1.00 19.32 ? 399  PRO A CG    1 
ATOM   3330 C  CD    . PRO A 1 399 ? 17.218  -7.988  52.110 1.00 18.06 ? 399  PRO A CD    1 
ATOM   3331 N  N     . ILE A 1 400 ? 20.111  -9.249  55.422 1.00 21.38 ? 400  ILE A N     1 
ATOM   3332 C  CA    . ILE A 1 400 ? 21.524  -9.615  55.455 1.00 20.94 ? 400  ILE A CA    1 
ATOM   3333 C  C     . ILE A 1 400 ? 21.656  -10.940 54.701 1.00 19.98 ? 400  ILE A C     1 
ATOM   3334 O  O     . ILE A 1 400 ? 21.074  -11.943 55.125 1.00 20.04 ? 400  ILE A O     1 
ATOM   3335 C  CB    . ILE A 1 400 ? 22.043  -9.768  56.902 1.00 22.10 ? 400  ILE A CB    1 
ATOM   3336 C  CG1   . ILE A 1 400 ? 21.964  -8.433  57.650 1.00 25.76 ? 400  ILE A CG1   1 
ATOM   3337 C  CG2   . ILE A 1 400 ? 23.480  -10.339 56.912 1.00 21.77 ? 400  ILE A CG2   1 
ATOM   3338 C  CD1   . ILE A 1 400 ? 22.128  -8.554  59.165 1.00 28.94 ? 400  ILE A CD1   1 
ATOM   3339 N  N     . PRO A 1 401 ? 22.409  -10.953 53.580 1.00 19.65 ? 401  PRO A N     1 
ATOM   3340 C  CA    . PRO A 1 401 ? 22.556  -12.205 52.831 1.00 20.53 ? 401  PRO A CA    1 
ATOM   3341 C  C     . PRO A 1 401 ? 23.204  -13.267 53.708 1.00 21.04 ? 401  PRO A C     1 
ATOM   3342 O  O     . PRO A 1 401 ? 24.248  -13.021 54.313 1.00 21.14 ? 401  PRO A O     1 
ATOM   3343 C  CB    . PRO A 1 401 ? 23.482  -11.826 51.668 1.00 20.56 ? 401  PRO A CB    1 
ATOM   3344 C  CG    . PRO A 1 401 ? 23.400  -10.338 51.575 1.00 24.00 ? 401  PRO A CG    1 
ATOM   3345 C  CD    . PRO A 1 401 ? 23.207  -9.868  52.982 1.00 20.80 ? 401  PRO A CD    1 
ATOM   3346 N  N     . ASN A 1 402 ? 22.554  -14.421 53.812 1.00 19.58 ? 402  ASN A N     1 
ATOM   3347 C  CA    . ASN A 1 402 ? 23.005  -15.469 54.714 1.00 20.40 ? 402  ASN A CA    1 
ATOM   3348 C  C     . ASN A 1 402 ? 22.159  -16.710 54.543 1.00 20.43 ? 402  ASN A C     1 
ATOM   3349 O  O     . ASN A 1 402 ? 21.119  -16.673 53.881 1.00 18.74 ? 402  ASN A O     1 
ATOM   3350 C  CB    . ASN A 1 402 ? 22.923  -14.994 56.177 1.00 21.20 ? 402  ASN A CB    1 
ATOM   3351 C  CG    . ASN A 1 402 ? 23.974  -15.643 57.068 1.00 25.02 ? 402  ASN A CG    1 
ATOM   3352 O  OD1   . ASN A 1 402 ? 24.611  -16.626 56.688 1.00 24.19 ? 402  ASN A OD1   1 
ATOM   3353 N  ND2   . ASN A 1 402 ? 24.158  -15.089 58.267 1.00 24.05 ? 402  ASN A ND2   1 
ATOM   3354 N  N     . ARG A 1 403 ? 22.630  -17.811 55.119 1.00 19.63 ? 403  ARG A N     1 
ATOM   3355 C  CA    . ARG A 1 403 ? 21.772  -18.948 55.396 1.00 20.87 ? 403  ARG A CA    1 
ATOM   3356 C  C     . ARG A 1 403 ? 20.954  -18.590 56.629 1.00 20.87 ? 403  ARG A C     1 
ATOM   3357 O  O     . ARG A 1 403 ? 21.416  -17.834 57.501 1.00 19.36 ? 403  ARG A O     1 
ATOM   3358 C  CB    . ARG A 1 403 ? 22.585  -20.220 55.649 1.00 21.85 ? 403  ARG A CB    1 
ATOM   3359 C  CG    . ARG A 1 403 ? 23.546  -20.132 56.833 1.00 22.84 ? 403  ARG A CG    1 
ATOM   3360 C  CD    . ARG A 1 403 ? 24.299  -21.436 57.048 1.00 26.44 ? 403  ARG A CD    1 
ATOM   3361 N  NE    . ARG A 1 403 ? 25.267  -21.696 55.986 1.00 27.70 ? 403  ARG A NE    1 
ATOM   3362 C  CZ    . ARG A 1 403 ? 26.059  -22.764 55.934 1.00 29.63 ? 403  ARG A CZ    1 
ATOM   3363 N  NH1   . ARG A 1 403 ? 26.005  -23.690 56.884 1.00 28.02 ? 403  ARG A NH1   1 
ATOM   3364 N  NH2   . ARG A 1 403 ? 26.909  -22.907 54.926 1.00 28.96 ? 403  ARG A NH2   1 
ATOM   3365 N  N     . TYR A 1 404 ? 19.732  -19.113 56.670 1.00 19.49 ? 404  TYR A N     1 
ATOM   3366 C  CA    . TYR A 1 404 ? 18.840  -18.957 57.807 1.00 19.84 ? 404  TYR A CA    1 
ATOM   3367 C  C     . TYR A 1 404 ? 18.194  -20.317 58.040 1.00 19.59 ? 404  TYR A C     1 
ATOM   3368 O  O     . TYR A 1 404 ? 17.431  -20.807 57.198 1.00 19.73 ? 404  TYR A O     1 
ATOM   3369 C  CB    . TYR A 1 404 ? 17.798  -17.869 57.529 1.00 20.05 ? 404  TYR A CB    1 
ATOM   3370 C  CG    . TYR A 1 404 ? 18.393  -16.478 57.466 1.00 20.24 ? 404  TYR A CG    1 
ATOM   3371 C  CD1   . TYR A 1 404 ? 18.575  -15.729 58.630 1.00 20.26 ? 404  TYR A CD1   1 
ATOM   3372 C  CD2   . TYR A 1 404 ? 18.791  -15.920 56.249 1.00 20.83 ? 404  TYR A CD2   1 
ATOM   3373 C  CE1   . TYR A 1 404 ? 19.126  -14.455 58.586 1.00 21.22 ? 404  TYR A CE1   1 
ATOM   3374 C  CE2   . TYR A 1 404 ? 19.347  -14.643 56.193 1.00 21.20 ? 404  TYR A CE2   1 
ATOM   3375 C  CZ    . TYR A 1 404 ? 19.507  -13.917 57.369 1.00 21.05 ? 404  TYR A CZ    1 
ATOM   3376 O  OH    . TYR A 1 404 ? 20.052  -12.657 57.333 1.00 21.59 ? 404  TYR A OH    1 
ATOM   3377 N  N     . LYS A 1 405 ? 18.526  -20.925 59.175 1.00 18.21 ? 405  LYS A N     1 
ATOM   3378 C  CA    . LYS A 1 405 ? 18.214  -22.332 59.426 1.00 20.16 ? 405  LYS A CA    1 
ATOM   3379 C  C     . LYS A 1 405 ? 16.729  -22.595 59.698 1.00 20.55 ? 405  LYS A C     1 
ATOM   3380 O  O     . LYS A 1 405 ? 16.079  -23.328 58.944 1.00 19.14 ? 405  LYS A O     1 
ATOM   3381 C  CB    . LYS A 1 405 ? 19.088  -22.877 60.557 1.00 20.44 ? 405  LYS A CB    1 
ATOM   3382 C  CG    . LYS A 1 405 ? 19.050  -24.399 60.692 1.00 21.30 ? 405  LYS A CG    1 
ATOM   3383 C  CD    . LYS A 1 405 ? 19.973  -24.873 61.804 1.00 25.70 ? 405  LYS A CD    1 
ATOM   3384 C  CE    . LYS A 1 405 ? 19.928  -26.387 61.935 1.00 30.81 ? 405  LYS A CE    1 
ATOM   3385 N  NZ    . LYS A 1 405 ? 20.702  -26.887 63.118 1.00 35.71 ? 405  LYS A NZ    1 
ATOM   3386 N  N     . TYR A 1 406 ? 16.204  -22.000 60.767 1.00 18.74 ? 406  TYR A N     1 
ATOM   3387 C  CA    . TYR A 1 406 ? 14.781  -22.091 61.077 1.00 20.45 ? 406  TYR A CA    1 
ATOM   3388 C  C     . TYR A 1 406 ? 14.106  -20.747 60.849 1.00 20.89 ? 406  TYR A C     1 
ATOM   3389 O  O     . TYR A 1 406 ? 14.562  -19.717 61.354 1.00 21.44 ? 406  TYR A O     1 
ATOM   3390 C  CB    . TYR A 1 406 ? 14.561  -22.550 62.520 1.00 21.50 ? 406  TYR A CB    1 
ATOM   3391 C  CG    . TYR A 1 406 ? 15.055  -23.953 62.792 1.00 21.37 ? 406  TYR A CG    1 
ATOM   3392 C  CD1   . TYR A 1 406 ? 16.256  -24.173 63.471 1.00 23.53 ? 406  TYR A CD1   1 
ATOM   3393 C  CD2   . TYR A 1 406 ? 14.320  -25.063 62.371 1.00 21.02 ? 406  TYR A CD2   1 
ATOM   3394 C  CE1   . TYR A 1 406 ? 16.712  -25.469 63.723 1.00 24.27 ? 406  TYR A CE1   1 
ATOM   3395 C  CE2   . TYR A 1 406 ? 14.764  -26.354 62.617 1.00 23.87 ? 406  TYR A CE2   1 
ATOM   3396 C  CZ    . TYR A 1 406 ? 15.954  -26.550 63.295 1.00 25.09 ? 406  TYR A CZ    1 
ATOM   3397 O  OH    . TYR A 1 406 ? 16.386  -27.834 63.527 1.00 27.34 ? 406  TYR A OH    1 
ATOM   3398 N  N     . VAL A 1 407 ? 13.025  -20.768 60.077 1.00 19.61 ? 407  VAL A N     1 
ATOM   3399 C  CA    . VAL A 1 407 ? 12.297  -19.547 59.725 1.00 19.86 ? 407  VAL A CA    1 
ATOM   3400 C  C     . VAL A 1 407 ? 10.788  -19.767 59.850 1.00 19.58 ? 407  VAL A C     1 
ATOM   3401 O  O     . VAL A 1 407 ? 10.256  -20.776 59.393 1.00 19.90 ? 407  VAL A O     1 
ATOM   3402 C  CB    . VAL A 1 407 ? 12.654  -19.052 58.290 1.00 19.92 ? 407  VAL A CB    1 
ATOM   3403 C  CG1   . VAL A 1 407 ? 11.797  -17.851 57.891 1.00 18.95 ? 407  VAL A CG1   1 
ATOM   3404 C  CG2   . VAL A 1 407 ? 14.137  -18.678 58.187 1.00 19.27 ? 407  VAL A CG2   1 
ATOM   3405 N  N     . MET A 1 408 ? 10.115  -18.826 60.502 1.00 20.54 ? 408  MET A N     1 
ATOM   3406 C  CA    . MET A 1 408 ? 8.668   -18.757 60.475 1.00 21.73 ? 408  MET A CA    1 
ATOM   3407 C  C     . MET A 1 408 ? 8.252   -17.427 59.888 1.00 21.47 ? 408  MET A C     1 
ATOM   3408 O  O     . MET A 1 408 ? 8.779   -16.379 60.272 1.00 22.48 ? 408  MET A O     1 
ATOM   3409 C  CB    . MET A 1 408 ? 8.076   -18.903 61.864 1.00 23.59 ? 408  MET A CB    1 
ATOM   3410 C  CG    . MET A 1 408 ? 7.814   -20.332 62.248 1.00 29.83 ? 408  MET A CG    1 
ATOM   3411 S  SD    . MET A 1 408 ? 6.584   -20.388 63.547 1.00 37.19 ? 408  MET A SD    1 
ATOM   3412 C  CE    . MET A 1 408 ? 7.483   -19.499 64.834 1.00 18.78 ? 408  MET A CE    1 
ATOM   3413 N  N     . SER A 1 409 ? 7.323   -17.469 58.940 1.00 19.99 ? 409  SER A N     1 
ATOM   3414 C  CA    . SER A 1 409 ? 6.835   -16.240 58.340 1.00 18.61 ? 409  SER A CA    1 
ATOM   3415 C  C     . SER A 1 409 ? 5.402   -15.944 58.738 1.00 18.96 ? 409  SER A C     1 
ATOM   3416 O  O     . SER A 1 409 ? 4.646   -16.843 59.119 1.00 19.74 ? 409  SER A O     1 
ATOM   3417 C  CB    . SER A 1 409 ? 6.967   -16.281 56.816 1.00 17.48 ? 409  SER A CB    1 
ATOM   3418 O  OG    . SER A 1 409 ? 6.127   -17.272 56.266 1.00 17.65 ? 409  SER A OG    1 
ATOM   3419 N  N     . PHE A 1 410 ? 5.048   -14.668 58.633 1.00 18.39 ? 410  PHE A N     1 
ATOM   3420 C  CA    . PHE A 1 410 ? 3.728   -14.168 58.978 1.00 18.52 ? 410  PHE A CA    1 
ATOM   3421 C  C     . PHE A 1 410 ? 3.328   -13.165 57.909 1.00 18.48 ? 410  PHE A C     1 
ATOM   3422 O  O     . PHE A 1 410 ? 4.180   -12.462 57.356 1.00 17.94 ? 410  PHE A O     1 
ATOM   3423 C  CB    . PHE A 1 410 ? 3.758   -13.493 60.349 1.00 18.17 ? 410  PHE A CB    1 
ATOM   3424 C  CG    . PHE A 1 410 ? 4.123   -14.417 61.480 1.00 18.65 ? 410  PHE A CG    1 
ATOM   3425 C  CD1   . PHE A 1 410 ? 5.455   -14.734 61.741 1.00 19.03 ? 410  PHE A CD1   1 
ATOM   3426 C  CD2   . PHE A 1 410 ? 3.135   -14.962 62.294 1.00 20.40 ? 410  PHE A CD2   1 
ATOM   3427 C  CE1   . PHE A 1 410 ? 5.797   -15.598 62.787 1.00 19.97 ? 410  PHE A CE1   1 
ATOM   3428 C  CE2   . PHE A 1 410 ? 3.470   -15.824 63.350 1.00 21.36 ? 410  PHE A CE2   1 
ATOM   3429 C  CZ    . PHE A 1 410 ? 4.801   -16.138 63.592 1.00 20.07 ? 410  PHE A CZ    1 
ATOM   3430 N  N     . ASP A 1 411 ? 2.034   -13.098 57.620 1.00 18.04 ? 411  ASP A N     1 
ATOM   3431 C  CA    . ASP A 1 411 ? 1.542   -12.303 56.511 1.00 20.42 ? 411  ASP A CA    1 
ATOM   3432 C  C     . ASP A 1 411 ? 0.171   -11.718 56.855 1.00 18.57 ? 411  ASP A C     1 
ATOM   3433 O  O     . ASP A 1 411 ? -0.666  -12.401 57.446 1.00 19.94 ? 411  ASP A O     1 
ATOM   3434 C  CB    . ASP A 1 411 ? 1.469   -13.190 55.260 1.00 23.33 ? 411  ASP A CB    1 
ATOM   3435 C  CG    . ASP A 1 411 ? 0.666   -12.572 54.149 1.00 25.06 ? 411  ASP A CG    1 
ATOM   3436 O  OD1   . ASP A 1 411 ? -0.536  -12.877 54.046 1.00 33.20 ? 411  ASP A OD1   1 
ATOM   3437 O  OD2   . ASP A 1 411 ? 1.219   -11.763 53.385 1.00 29.97 ? 411  ASP A OD2   1 
ATOM   3438 N  N     . LEU A 1 412 ? -0.042  -10.457 56.489 1.00 16.62 ? 412  LEU A N     1 
ATOM   3439 C  CA    . LEU A 1 412 ? -1.337  -9.799  56.674 1.00 17.11 ? 412  LEU A CA    1 
ATOM   3440 C  C     . LEU A 1 412 ? -2.359  -10.254 55.634 1.00 18.09 ? 412  LEU A C     1 
ATOM   3441 O  O     . LEU A 1 412 ? -2.056  -10.328 54.445 1.00 17.80 ? 412  LEU A O     1 
ATOM   3442 C  CB    . LEU A 1 412 ? -1.168  -8.275  56.632 1.00 17.58 ? 412  LEU A CB    1 
ATOM   3443 C  CG    . LEU A 1 412 ? -0.536  -7.690  57.900 1.00 17.40 ? 412  LEU A CG    1 
ATOM   3444 C  CD1   . LEU A 1 412 ? 0.324   -6.474  57.597 1.00 19.14 ? 412  LEU A CD1   1 
ATOM   3445 C  CD2   . LEU A 1 412 ? -1.612  -7.363  58.940 1.00 17.34 ? 412  LEU A CD2   1 
ATOM   3446 N  N     . THR A 1 413 ? -3.570  -10.568 56.087 1.00 17.52 ? 413  THR A N     1 
ATOM   3447 C  CA    . THR A 1 413 ? -4.638  -10.994 55.190 1.00 17.80 ? 413  THR A CA    1 
ATOM   3448 C  C     . THR A 1 413 ? -5.087  -9.833  54.313 1.00 17.36 ? 413  THR A C     1 
ATOM   3449 O  O     . THR A 1 413 ? -5.356  -8.740  54.825 1.00 18.47 ? 413  THR A O     1 
ATOM   3450 C  CB    . THR A 1 413 ? -5.841  -11.530 55.984 1.00 20.38 ? 413  THR A CB    1 
ATOM   3451 O  OG1   . THR A 1 413 ? -5.432  -12.673 56.743 1.00 22.07 ? 413  THR A OG1   1 
ATOM   3452 C  CG2   . THR A 1 413 ? -6.992  -11.926 55.050 1.00 21.23 ? 413  THR A CG2   1 
ATOM   3453 N  N     . SER A 1 414 ? -5.136  -10.075 53.001 1.00 16.38 ? 414  SER A N     1 
ATOM   3454 C  CA    A SER A 1 414 ? -5.642  -9.099  52.042 0.50 15.53 ? 414  SER A CA    1 
ATOM   3455 C  CA    B SER A 1 414 ? -5.625  -9.089  52.028 0.50 16.71 ? 414  SER A CA    1 
ATOM   3456 C  C     . SER A 1 414 ? -5.282  -7.669  52.466 1.00 15.61 ? 414  SER A C     1 
ATOM   3457 O  O     . SER A 1 414 ? -6.170  -6.870  52.789 1.00 14.74 ? 414  SER A O     1 
ATOM   3458 C  CB    A SER A 1 414 ? -7.159  -9.265  51.923 0.50 15.87 ? 414  SER A CB    1 
ATOM   3459 C  CB    B SER A 1 414 ? -7.138  -9.232  51.818 0.50 18.03 ? 414  SER A CB    1 
ATOM   3460 O  OG    A SER A 1 414 ? -7.696  -8.435  50.919 0.50 13.72 ? 414  SER A OG    1 
ATOM   3461 O  OG    B SER A 1 414 ? -7.439  -10.266 50.896 0.50 22.10 ? 414  SER A OG    1 
ATOM   3462 N  N     . LEU A 1 415 ? -3.987  -7.348  52.463 1.00 13.23 ? 415  LEU A N     1 
ATOM   3463 C  CA    . LEU A 1 415 ? -3.533  -6.099  53.082 1.00 15.06 ? 415  LEU A CA    1 
ATOM   3464 C  C     . LEU A 1 415 ? -4.191  -4.817  52.583 1.00 14.36 ? 415  LEU A C     1 
ATOM   3465 O  O     . LEU A 1 415 ? -4.788  -4.093  53.371 1.00 14.30 ? 415  LEU A O     1 
ATOM   3466 C  CB    . LEU A 1 415 ? -2.008  -5.937  53.043 1.00 14.28 ? 415  LEU A CB    1 
ATOM   3467 C  CG    . LEU A 1 415 ? -1.601  -4.659  53.788 1.00 16.67 ? 415  LEU A CG    1 
ATOM   3468 C  CD1   . LEU A 1 415 ? -1.939  -4.748  55.289 1.00 15.55 ? 415  LEU A CD1   1 
ATOM   3469 C  CD2   . LEU A 1 415 ? -0.140  -4.331  53.573 1.00 20.13 ? 415  LEU A CD2   1 
ATOM   3470 N  N     . TYR A 1 416 ? -4.046  -4.513  51.297 1.00 14.35 ? 416  TYR A N     1 
ATOM   3471 C  CA    . TYR A 1 416 ? -4.531  -3.226  50.808 1.00 15.11 ? 416  TYR A CA    1 
ATOM   3472 C  C     . TYR A 1 416 ? -6.044  -3.067  50.977 1.00 15.10 ? 416  TYR A C     1 
ATOM   3473 O  O     . TYR A 1 416 ? -6.493  -2.021  51.456 1.00 13.32 ? 416  TYR A O     1 
ATOM   3474 C  CB    . TYR A 1 416 ? -4.051  -2.959  49.377 1.00 15.19 ? 416  TYR A CB    1 
ATOM   3475 C  CG    . TYR A 1 416 ? -2.607  -2.484  49.290 1.00 15.13 ? 416  TYR A CG    1 
ATOM   3476 C  CD1   . TYR A 1 416 ? -1.727  -2.615  50.379 1.00 15.02 ? 416  TYR A CD1   1 
ATOM   3477 C  CD2   . TYR A 1 416 ? -2.114  -1.924  48.107 1.00 17.19 ? 416  TYR A CD2   1 
ATOM   3478 C  CE1   . TYR A 1 416 ? -0.390  -2.188  50.292 1.00 16.69 ? 416  TYR A CE1   1 
ATOM   3479 C  CE2   . TYR A 1 416 ? -0.783  -1.498  48.008 1.00 17.93 ? 416  TYR A CE2   1 
ATOM   3480 C  CZ    . TYR A 1 416 ? 0.069   -1.634  49.100 1.00 16.50 ? 416  TYR A CZ    1 
ATOM   3481 O  OH    . TYR A 1 416 ? 1.373   -1.217  49.003 1.00 17.48 ? 416  TYR A OH    1 
ATOM   3482 N  N     . PRO A 1 417 ? -6.835  -4.113  50.639 1.00 14.60 ? 417  PRO A N     1 
ATOM   3483 C  CA    . PRO A 1 417 ? -8.267  -4.006  50.920 1.00 15.65 ? 417  PRO A CA    1 
ATOM   3484 C  C     . PRO A 1 417 ? -8.591  -3.892  52.415 1.00 15.10 ? 417  PRO A C     1 
ATOM   3485 O  O     . PRO A 1 417 ? -9.518  -3.161  52.782 1.00 15.66 ? 417  PRO A O     1 
ATOM   3486 C  CB    . PRO A 1 417 ? -8.837  -5.301  50.329 1.00 14.65 ? 417  PRO A CB    1 
ATOM   3487 C  CG    . PRO A 1 417 ? -7.876  -5.632  49.212 1.00 14.66 ? 417  PRO A CG    1 
ATOM   3488 C  CD    . PRO A 1 417 ? -6.536  -5.299  49.811 1.00 14.44 ? 417  PRO A CD    1 
ATOM   3489 N  N     . SER A 1 418 ? -7.823  -4.581  53.261 1.00 15.35 ? 418  SER A N     1 
ATOM   3490 C  CA    . SER A 1 418 ? -7.986  -4.472  54.715 1.00 14.98 ? 418  SER A CA    1 
ATOM   3491 C  C     . SER A 1 418 ? -7.665  -3.076  55.237 1.00 15.15 ? 418  SER A C     1 
ATOM   3492 O  O     . SER A 1 418 ? -8.332  -2.594  56.159 1.00 15.48 ? 418  SER A O     1 
ATOM   3493 C  CB    . SER A 1 418 ? -7.154  -5.526  55.451 1.00 13.87 ? 418  SER A CB    1 
ATOM   3494 O  OG    . SER A 1 418 ? -7.629  -6.832  55.139 1.00 14.96 ? 418  SER A OG    1 
ATOM   3495 N  N     . ILE A 1 419 ? -6.656  -2.433  54.648 1.00 15.08 ? 419  ILE A N     1 
ATOM   3496 C  CA    . ILE A 1 419 ? -6.311  -1.040  54.981 1.00 14.57 ? 419  ILE A CA    1 
ATOM   3497 C  C     . ILE A 1 419 ? -7.445  -0.093  54.590 1.00 14.91 ? 419  ILE A C     1 
ATOM   3498 O  O     . ILE A 1 419 ? -7.824  0.787   55.365 1.00 14.37 ? 419  ILE A O     1 
ATOM   3499 C  CB    . ILE A 1 419 ? -4.984  -0.588  54.301 1.00 14.54 ? 419  ILE A CB    1 
ATOM   3500 C  CG1   . ILE A 1 419 ? -3.785  -1.357  54.880 1.00 15.42 ? 419  ILE A CG1   1 
ATOM   3501 C  CG2   . ILE A 1 419 ? -4.769  0.925   54.470 1.00 14.73 ? 419  ILE A CG2   1 
ATOM   3502 C  CD1   . ILE A 1 419 ? -2.468  -1.065  54.174 1.00 15.32 ? 419  ILE A CD1   1 
ATOM   3503 N  N     . ILE A 1 420 ? -7.970  -0.273  53.380 1.00 12.48 ? 420  ILE A N     1 
ATOM   3504 C  CA    . ILE A 1 420 ? -9.107  0.511   52.902 1.00 14.55 ? 420  ILE A CA    1 
ATOM   3505 C  C     . ILE A 1 420 ? -10.276 0.422   53.895 1.00 15.35 ? 420  ILE A C     1 
ATOM   3506 O  O     . ILE A 1 420 ? -10.882 1.436   54.253 1.00 15.02 ? 420  ILE A O     1 
ATOM   3507 C  CB    . ILE A 1 420 ? -9.555  0.044   51.495 1.00 12.86 ? 420  ILE A CB    1 
ATOM   3508 C  CG1   . ILE A 1 420 ? -8.575  0.564   50.435 1.00 13.71 ? 420  ILE A CG1   1 
ATOM   3509 C  CG2   . ILE A 1 420 ? -10.981 0.521   51.191 1.00 13.38 ? 420  ILE A CG2   1 
ATOM   3510 C  CD1   . ILE A 1 420 ? -8.705  -0.099  49.076 1.00 14.53 ? 420  ILE A CD1   1 
ATOM   3511 N  N     . ARG A 1 421 ? -10.565 -0.792  54.349 1.00 14.90 ? 421  ARG A N     1 
ATOM   3512 C  CA    . ARG A 1 421 ? -11.675 -1.028  55.264 1.00 15.29 ? 421  ARG A CA    1 
ATOM   3513 C  C     . ARG A 1 421 ? -11.395 -0.484  56.669 1.00 16.33 ? 421  ARG A C     1 
ATOM   3514 O  O     . ARG A 1 421 ? -12.270 0.122   57.283 1.00 16.86 ? 421  ARG A O     1 
ATOM   3515 C  CB    . ARG A 1 421 ? -11.989 -2.519  55.334 1.00 16.67 ? 421  ARG A CB    1 
ATOM   3516 C  CG    . ARG A 1 421 ? -12.519 -3.110  54.023 1.00 16.62 ? 421  ARG A CG    1 
ATOM   3517 C  CD    . ARG A 1 421 ? -12.490 -4.630  54.087 1.00 17.03 ? 421  ARG A CD    1 
ATOM   3518 N  NE    . ARG A 1 421 ? -13.364 -5.132  55.143 1.00 18.98 ? 421  ARG A NE    1 
ATOM   3519 C  CZ    . ARG A 1 421 ? -13.154 -6.254  55.824 1.00 20.36 ? 421  ARG A CZ    1 
ATOM   3520 N  NH1   . ARG A 1 421 ? -12.092 -7.013  55.569 1.00 18.50 ? 421  ARG A NH1   1 
ATOM   3521 N  NH2   . ARG A 1 421 ? -14.012 -6.614  56.768 1.00 20.87 ? 421  ARG A NH2   1 
ATOM   3522 N  N     . GLN A 1 422 ? -10.179 -0.713  57.163 1.00 14.50 ? 422  GLN A N     1 
ATOM   3523 C  CA    . GLN A 1 422 ? -9.785  -0.291  58.512 1.00 15.89 ? 422  GLN A CA    1 
ATOM   3524 C  C     . GLN A 1 422 ? -9.790  1.228   58.640 1.00 16.34 ? 422  GLN A C     1 
ATOM   3525 O  O     . GLN A 1 422 ? -10.344 1.783   59.590 1.00 16.66 ? 422  GLN A O     1 
ATOM   3526 C  CB    . GLN A 1 422 ? -8.398  -0.854  58.865 1.00 15.01 ? 422  GLN A CB    1 
ATOM   3527 C  CG    . GLN A 1 422 ? -7.686  -0.123  60.012 1.00 14.40 ? 422  GLN A CG    1 
ATOM   3528 C  CD    . GLN A 1 422 ? -6.799  -1.043  60.841 1.00 16.50 ? 422  GLN A CD    1 
ATOM   3529 O  OE1   . GLN A 1 422 ? -6.862  -2.263  60.709 1.00 16.41 ? 422  GLN A OE1   1 
ATOM   3530 N  NE2   . GLN A 1 422 ? -5.981  -0.456  61.716 1.00 14.63 ? 422  GLN A NE2   1 
ATOM   3531 N  N     . VAL A 1 423 ? -9.184  1.889   57.661 1.00 16.40 ? 423  VAL A N     1 
ATOM   3532 C  CA    . VAL A 1 423 ? -9.021  3.338   57.692 1.00 15.57 ? 423  VAL A CA    1 
ATOM   3533 C  C     . VAL A 1 423 ? -10.283 4.056   57.200 1.00 16.20 ? 423  VAL A C     1 
ATOM   3534 O  O     . VAL A 1 423 ? -10.518 5.205   57.566 1.00 17.02 ? 423  VAL A O     1 
ATOM   3535 C  CB    . VAL A 1 423 ? -7.760  3.782   56.889 1.00 15.82 ? 423  VAL A CB    1 
ATOM   3536 C  CG1   . VAL A 1 423 ? -7.533  5.286   57.011 1.00 15.51 ? 423  VAL A CG1   1 
ATOM   3537 C  CG2   . VAL A 1 423 ? -6.519  3.019   57.376 1.00 14.70 ? 423  VAL A CG2   1 
ATOM   3538 N  N     . ASN A 1 424 ? -11.099 3.349   56.412 1.00 15.44 ? 424  ASN A N     1 
ATOM   3539 C  CA    . ASN A 1 424 ? -12.319 3.886   55.778 1.00 15.74 ? 424  ASN A CA    1 
ATOM   3540 C  C     . ASN A 1 424 ? -11.991 4.834   54.623 1.00 16.24 ? 424  ASN A C     1 
ATOM   3541 O  O     . ASN A 1 424 ? -12.518 5.950   54.540 1.00 16.96 ? 424  ASN A O     1 
ATOM   3542 C  CB    . ASN A 1 424 ? -13.284 4.533   56.793 1.00 17.52 ? 424  ASN A CB    1 
ATOM   3543 C  CG    . ASN A 1 424 ? -14.697 4.665   56.247 1.00 19.87 ? 424  ASN A CG    1 
ATOM   3544 O  OD1   . ASN A 1 424 ? -15.113 3.894   55.374 1.00 19.49 ? 424  ASN A OD1   1 
ATOM   3545 N  ND2   . ASN A 1 424 ? -15.447 5.638   56.761 1.00 17.04 ? 424  ASN A ND2   1 
ATOM   3546 N  N     . ILE A 1 425 ? -11.120 4.366   53.729 1.00 14.89 ? 425  ILE A N     1 
ATOM   3547 C  CA    . ILE A 1 425 ? -10.618 5.178   52.616 1.00 15.17 ? 425  ILE A CA    1 
ATOM   3548 C  C     . ILE A 1 425 ? -11.566 5.104   51.423 1.00 15.99 ? 425  ILE A C     1 
ATOM   3549 O  O     . ILE A 1 425 ? -11.804 4.030   50.870 1.00 16.98 ? 425  ILE A O     1 
ATOM   3550 C  CB    . ILE A 1 425 ? -9.183  4.750   52.212 1.00 15.22 ? 425  ILE A CB    1 
ATOM   3551 C  CG1   . ILE A 1 425 ? -8.214  4.984   53.377 1.00 14.87 ? 425  ILE A CG1   1 
ATOM   3552 C  CG2   . ILE A 1 425 ? -8.702  5.526   50.978 1.00 14.18 ? 425  ILE A CG2   1 
ATOM   3553 C  CD1   . ILE A 1 425 ? -6.891  4.211   53.248 1.00 15.49 ? 425  ILE A CD1   1 
ATOM   3554 N  N     . SER A 1 426 ? -12.105 6.262   51.045 1.00 16.66 ? 426  SER A N     1 
ATOM   3555 C  CA    . SER A 1 426 ? -13.103 6.361   49.985 1.00 16.83 ? 426  SER A CA    1 
ATOM   3556 C  C     . SER A 1 426 ? -13.116 7.808   49.482 1.00 16.96 ? 426  SER A C     1 
ATOM   3557 O  O     . SER A 1 426 ? -12.737 8.721   50.222 1.00 16.78 ? 426  SER A O     1 
ATOM   3558 C  CB    . SER A 1 426 ? -14.480 5.966   50.539 1.00 16.88 ? 426  SER A CB    1 
ATOM   3559 O  OG    . SER A 1 426 ? -15.369 5.549   49.514 1.00 18.79 ? 426  SER A OG    1 
ATOM   3560 N  N     . PRO A 1 427 ? -13.544 8.034   48.226 1.00 17.14 ? 427  PRO A N     1 
ATOM   3561 C  CA    . PRO A 1 427 ? -13.641 9.416   47.744 1.00 18.09 ? 427  PRO A CA    1 
ATOM   3562 C  C     . PRO A 1 427 ? -14.464 10.338  48.657 1.00 20.09 ? 427  PRO A C     1 
ATOM   3563 O  O     . PRO A 1 427 ? -14.063 11.484  48.898 1.00 20.63 ? 427  PRO A O     1 
ATOM   3564 C  CB    . PRO A 1 427 ? -14.315 9.266   46.363 1.00 18.70 ? 427  PRO A CB    1 
ATOM   3565 C  CG    . PRO A 1 427 ? -14.869 7.864   46.333 1.00 18.00 ? 427  PRO A CG    1 
ATOM   3566 C  CD    . PRO A 1 427 ? -13.902 7.071   47.170 1.00 17.89 ? 427  PRO A CD    1 
ATOM   3567 N  N     . GLU A 1 428 ? -15.576 9.831   49.188 1.00 20.83 ? 428  GLU A N     1 
ATOM   3568 C  CA    . GLU A 1 428 ? -16.522 10.666  49.933 1.00 21.10 ? 428  GLU A CA    1 
ATOM   3569 C  C     . GLU A 1 428 ? -16.316 10.665  51.451 1.00 20.79 ? 428  GLU A C     1 
ATOM   3570 O  O     . GLU A 1 428 ? -17.057 11.326  52.181 1.00 21.00 ? 428  GLU A O     1 
ATOM   3571 C  CB    . GLU A 1 428 ? -17.969 10.289  49.572 1.00 22.06 ? 428  GLU A CB    1 
ATOM   3572 C  CG    . GLU A 1 428 ? -18.575 9.104   50.353 1.00 23.79 ? 428  GLU A CG    1 
ATOM   3573 C  CD    . GLU A 1 428 ? -18.085 7.740   49.886 1.00 24.67 ? 428  GLU A CD    1 
ATOM   3574 O  OE1   . GLU A 1 428 ? -17.030 7.660   49.220 1.00 24.56 ? 428  GLU A OE1   1 
ATOM   3575 O  OE2   . GLU A 1 428 ? -18.762 6.736   50.197 1.00 22.76 ? 428  GLU A OE2   1 
ATOM   3576 N  N     . THR A 1 429 ? -15.315 9.929   51.928 1.00 17.99 ? 429  THR A N     1 
ATOM   3577 C  CA    . THR A 1 429 ? -15.064 9.866   53.368 1.00 19.07 ? 429  THR A CA    1 
ATOM   3578 C  C     . THR A 1 429 ? -13.879 10.725  53.790 1.00 18.06 ? 429  THR A C     1 
ATOM   3579 O  O     . THR A 1 429 ? -13.504 10.722  54.955 1.00 17.57 ? 429  THR A O     1 
ATOM   3580 C  CB    . THR A 1 429 ? -14.840 8.426   53.865 1.00 17.25 ? 429  THR A CB    1 
ATOM   3581 O  OG1   . THR A 1 429 ? -13.769 7.826   53.127 1.00 16.48 ? 429  THR A OG1   1 
ATOM   3582 C  CG2   . THR A 1 429 ? -16.106 7.602   53.708 1.00 18.62 ? 429  THR A CG2   1 
ATOM   3583 N  N     . ILE A 1 430 ? -13.291 11.462  52.846 1.00 17.96 ? 430  ILE A N     1 
ATOM   3584 C  CA    . ILE A 1 430 ? -12.183 12.365  53.177 1.00 17.82 ? 430  ILE A CA    1 
ATOM   3585 C  C     . ILE A 1 430 ? -12.666 13.459  54.131 1.00 19.39 ? 430  ILE A C     1 
ATOM   3586 O  O     . ILE A 1 430 ? -13.623 14.186  53.836 1.00 20.71 ? 430  ILE A O     1 
ATOM   3587 C  CB    . ILE A 1 430 ? -11.531 12.983  51.916 1.00 19.60 ? 430  ILE A CB    1 
ATOM   3588 C  CG1   . ILE A 1 430 ? -10.813 11.895  51.107 1.00 17.07 ? 430  ILE A CG1   1 
ATOM   3589 C  CG2   . ILE A 1 430 ? -10.548 14.082  52.304 1.00 20.31 ? 430  ILE A CG2   1 
ATOM   3590 C  CD1   . ILE A 1 430 ? -10.469 12.287  49.667 1.00 20.74 ? 430  ILE A CD1   1 
ATOM   3591 N  N     . ALA A 1 431 ? -11.998 13.563  55.276 1.00 18.20 ? 431  ALA A N     1 
ATOM   3592 C  CA    . ALA A 1 431 ? -12.405 14.483  56.339 1.00 19.26 ? 431  ALA A CA    1 
ATOM   3593 C  C     . ALA A 1 431 ? -11.473 15.674  56.466 1.00 20.66 ? 431  ALA A C     1 
ATOM   3594 O  O     . ALA A 1 431 ? -11.842 16.695  57.048 1.00 22.18 ? 431  ALA A O     1 
ATOM   3595 C  CB    . ALA A 1 431 ? -12.476 13.743  57.672 1.00 19.61 ? 431  ALA A CB    1 
ATOM   3596 N  N     . GLY A 1 432 ? -10.260 15.540  55.941 1.00 20.92 ? 432  GLY A N     1 
ATOM   3597 C  CA    . GLY A 1 432 ? -9.267  16.605  56.048 1.00 22.22 ? 432  GLY A CA    1 
ATOM   3598 C  C     . GLY A 1 432 ? -7.864  16.045  56.108 1.00 21.44 ? 432  GLY A C     1 
ATOM   3599 O  O     . GLY A 1 432 ? -7.624  14.914  55.699 1.00 21.08 ? 432  GLY A O     1 
ATOM   3600 N  N     . THR A 1 433 ? -6.936  16.851  56.612 1.00 21.36 ? 433  THR A N     1 
ATOM   3601 C  CA    . THR A 1 433 ? -5.537  16.461  56.713 1.00 21.42 ? 433  THR A CA    1 
ATOM   3602 C  C     . THR A 1 433 ? -5.016  16.801  58.098 1.00 19.96 ? 433  THR A C     1 
ATOM   3603 O  O     . THR A 1 433 ? -5.600  17.632  58.795 1.00 20.93 ? 433  THR A O     1 
ATOM   3604 C  CB    . THR A 1 433 ? -4.647  17.199  55.669 1.00 22.29 ? 433  THR A CB    1 
ATOM   3605 O  OG1   . THR A 1 433 ? -4.728  18.618  55.873 1.00 22.28 ? 433  THR A OG1   1 
ATOM   3606 C  CG2   . THR A 1 433 ? -5.067  16.856  54.237 1.00 22.90 ? 433  THR A CG2   1 
ATOM   3607 N  N     . PHE A 1 434 ? -3.926  16.148  58.489 1.00 20.10 ? 434  PHE A N     1 
ATOM   3608 C  CA    . PHE A 1 434 ? -3.187  16.515  59.689 1.00 20.84 ? 434  PHE A CA    1 
ATOM   3609 C  C     . PHE A 1 434 ? -1.719  16.725  59.325 1.00 21.84 ? 434  PHE A C     1 
ATOM   3610 O  O     . PHE A 1 434 ? -1.261  16.293  58.256 1.00 20.56 ? 434  PHE A O     1 
ATOM   3611 C  CB    . PHE A 1 434 ? -3.347  15.455  60.795 1.00 18.37 ? 434  PHE A CB    1 
ATOM   3612 C  CG    . PHE A 1 434 ? -2.726  14.125  60.463 1.00 17.57 ? 434  PHE A CG    1 
ATOM   3613 C  CD1   . PHE A 1 434 ? -3.460  13.140  59.804 1.00 17.86 ? 434  PHE A CD1   1 
ATOM   3614 C  CD2   . PHE A 1 434 ? -1.413  13.848  60.823 1.00 20.26 ? 434  PHE A CD2   1 
ATOM   3615 C  CE1   . PHE A 1 434 ? -2.882  11.904  59.498 1.00 17.58 ? 434  PHE A CE1   1 
ATOM   3616 C  CE2   . PHE A 1 434 ? -0.828  12.616  60.508 1.00 19.64 ? 434  PHE A CE2   1 
ATOM   3617 C  CZ    . PHE A 1 434 ? -1.568  11.649  59.849 1.00 19.14 ? 434  PHE A CZ    1 
ATOM   3618 N  N     . LYS A 1 435 ? -0.988  17.392  60.212 1.00 21.28 ? 435  LYS A N     1 
ATOM   3619 C  CA    . LYS A 1 435 ? 0.422   17.681  59.985 1.00 23.31 ? 435  LYS A CA    1 
ATOM   3620 C  C     . LYS A 1 435 ? 1.273   16.428  60.193 1.00 22.45 ? 435  LYS A C     1 
ATOM   3621 O  O     . LYS A 1 435 ? 1.354   15.893  61.304 1.00 23.35 ? 435  LYS A O     1 
ATOM   3622 C  CB    . LYS A 1 435 ? 0.864   18.819  60.909 1.00 24.13 ? 435  LYS A CB    1 
ATOM   3623 C  CG    . LYS A 1 435 ? 2.134   19.523  60.479 1.00 30.08 ? 435  LYS A CG    1 
ATOM   3624 C  CD    . LYS A 1 435 ? 2.210   20.930  61.066 1.00 30.97 ? 435  LYS A CD    1 
ATOM   3625 C  CE    . LYS A 1 435 ? 2.452   20.911  62.569 1.00 33.07 ? 435  LYS A CE    1 
ATOM   3626 N  NZ    . LYS A 1 435 ? 2.516   22.286  63.134 1.00 29.19 ? 435  LYS A NZ    1 
ATOM   3627 N  N     . VAL A 1 436 ? 1.906   15.962  59.118 1.00 22.30 ? 436  VAL A N     1 
ATOM   3628 C  CA    . VAL A 1 436 ? 2.640   14.700  59.147 0.50 20.17 ? 436  VAL A CA    1 
ATOM   3629 C  C     . VAL A 1 436 ? 4.019   14.825  59.779 1.00 24.89 ? 436  VAL A C     1 
ATOM   3630 O  O     . VAL A 1 436 ? 4.730   15.817  59.572 1.00 26.84 ? 436  VAL A O     1 
ATOM   3631 C  CB    . VAL A 1 436 ? 2.773   14.059  57.736 0.50 18.34 ? 436  VAL A CB    1 
ATOM   3632 C  CG1   . VAL A 1 436 ? 1.426   13.961  57.078 0.50 16.94 ? 436  VAL A CG1   1 
ATOM   3633 C  CG2   . VAL A 1 436 ? 3.736   14.847  56.852 0.50 18.67 ? 436  VAL A CG2   1 
ATOM   3634 N  N     . ALA A 1 437 ? 4.371   13.820  60.577 1.00 23.61 ? 437  ALA A N     1 
ATOM   3635 C  CA    . ALA A 1 437 ? 5.730   13.636  61.058 1.00 25.22 ? 437  ALA A CA    1 
ATOM   3636 C  C     . ALA A 1 437 ? 6.447   12.680  60.097 1.00 25.50 ? 437  ALA A C     1 
ATOM   3637 O  O     . ALA A 1 437 ? 5.792   12.059  59.249 1.00 23.76 ? 437  ALA A O     1 
ATOM   3638 C  CB    . ALA A 1 437 ? 5.707   13.070  62.468 1.00 25.16 ? 437  ALA A CB    1 
ATOM   3639 N  N     . PRO A 1 438 ? 7.790   12.563  60.199 1.00 26.19 ? 438  PRO A N     1 
ATOM   3640 C  CA    . PRO A 1 438 ? 8.453   11.533  59.394 1.00 26.78 ? 438  PRO A CA    1 
ATOM   3641 C  C     . PRO A 1 438 ? 7.902   10.147  59.738 1.00 24.89 ? 438  PRO A C     1 
ATOM   3642 O  O     . PRO A 1 438 ? 7.551   9.902   60.894 1.00 23.64 ? 438  PRO A O     1 
ATOM   3643 C  CB    . PRO A 1 438 ? 9.917   11.636  59.830 1.00 28.75 ? 438  PRO A CB    1 
ATOM   3644 C  CG    . PRO A 1 438 ? 10.068  13.027  60.328 1.00 30.14 ? 438  PRO A CG    1 
ATOM   3645 C  CD    . PRO A 1 438 ? 8.760   13.361  60.976 1.00 28.02 ? 438  PRO A CD    1 
ATOM   3646 N  N     . LEU A 1 439 ? 7.822   9.259   58.745 1.00 23.93 ? 439  LEU A N     1 
ATOM   3647 C  CA    . LEU A 1 439 ? 7.233   7.929   58.936 1.00 24.18 ? 439  LEU A CA    1 
ATOM   3648 C  C     . LEU A 1 439 ? 7.839   7.168   60.116 1.00 23.54 ? 439  LEU A C     1 
ATOM   3649 O  O     . LEU A 1 439 ? 7.129   6.476   60.843 1.00 24.06 ? 439  LEU A O     1 
ATOM   3650 C  CB    . LEU A 1 439 ? 7.344   7.092   57.651 1.00 23.16 ? 439  LEU A CB    1 
ATOM   3651 C  CG    . LEU A 1 439 ? 6.597   5.753   57.636 1.00 25.62 ? 439  LEU A CG    1 
ATOM   3652 C  CD1   . LEU A 1 439 ? 5.089   5.966   57.577 1.00 24.23 ? 439  LEU A CD1   1 
ATOM   3653 C  CD2   . LEU A 1 439 ? 7.067   4.886   56.460 1.00 26.47 ? 439  LEU A CD2   1 
ATOM   3654 N  N     . HIS A 1 440 ? 9.152   7.311   60.297 1.00 25.14 ? 440  HIS A N     1 
ATOM   3655 C  CA    . HIS A 1 440 ? 9.897   6.706   61.404 1.00 27.34 ? 440  HIS A CA    1 
ATOM   3656 C  C     . HIS A 1 440 ? 9.268   7.027   62.770 1.00 25.91 ? 440  HIS A C     1 
ATOM   3657 O  O     . HIS A 1 440 ? 9.240   6.180   63.673 1.00 24.37 ? 440  HIS A O     1 
ATOM   3658 C  CB    . HIS A 1 440 ? 11.352  7.208   61.335 1.00 31.01 ? 440  HIS A CB    1 
ATOM   3659 C  CG    . HIS A 1 440 ? 12.230  6.750   62.459 1.00 38.96 ? 440  HIS A CG    1 
ATOM   3660 N  ND1   . HIS A 1 440 ? 12.477  7.525   63.573 1.00 44.25 ? 440  HIS A ND1   1 
ATOM   3661 C  CD2   . HIS A 1 440 ? 12.964  5.621   62.616 1.00 42.79 ? 440  HIS A CD2   1 
ATOM   3662 C  CE1   . HIS A 1 440 ? 13.304  6.883   64.379 1.00 45.09 ? 440  HIS A CE1   1 
ATOM   3663 N  NE2   . HIS A 1 440 ? 13.615  5.726   63.822 1.00 45.54 ? 440  HIS A NE2   1 
ATOM   3664 N  N     . ASP A 1 441 ? 8.754   8.246   62.905 1.00 24.36 ? 441  ASP A N     1 
ATOM   3665 C  CA    . ASP A 1 441 ? 8.161   8.696   64.163 1.00 25.78 ? 441  ASP A CA    1 
ATOM   3666 C  C     . ASP A 1 441 ? 6.853   7.977   64.492 1.00 24.35 ? 441  ASP A C     1 
ATOM   3667 O  O     . ASP A 1 441 ? 6.564   7.721   65.663 1.00 24.77 ? 441  ASP A O     1 
ATOM   3668 C  CB    . ASP A 1 441 ? 7.953   10.214  64.154 1.00 25.91 ? 441  ASP A CB    1 
ATOM   3669 C  CG    . ASP A 1 441 ? 9.253   10.992  64.305 1.00 31.86 ? 441  ASP A CG    1 
ATOM   3670 O  OD1   . ASP A 1 441 ? 10.308  10.383  64.595 1.00 31.53 ? 441  ASP A OD1   1 
ATOM   3671 O  OD2   . ASP A 1 441 ? 9.209   12.226  64.136 1.00 30.60 ? 441  ASP A OD2   1 
ATOM   3672 N  N     . TYR A 1 442 ? 6.071   7.644   63.467 1.00 21.16 ? 442  TYR A N     1 
ATOM   3673 C  CA    . TYR A 1 442 ? 4.873   6.824   63.667 1.00 21.47 ? 442  TYR A CA    1 
ATOM   3674 C  C     . TYR A 1 442 ? 5.237   5.370   63.934 1.00 21.50 ? 442  TYR A C     1 
ATOM   3675 O  O     . TYR A 1 442 ? 4.665   4.741   64.817 1.00 21.50 ? 442  TYR A O     1 
ATOM   3676 C  CB    . TYR A 1 442 ? 3.911   6.929   62.474 1.00 19.91 ? 442  TYR A CB    1 
ATOM   3677 C  CG    . TYR A 1 442 ? 3.400   8.336   62.268 1.00 21.04 ? 442  TYR A CG    1 
ATOM   3678 C  CD1   . TYR A 1 442 ? 2.552   8.928   63.202 1.00 21.32 ? 442  TYR A CD1   1 
ATOM   3679 C  CD2   . TYR A 1 442 ? 3.792   9.083   61.159 1.00 20.53 ? 442  TYR A CD2   1 
ATOM   3680 C  CE1   . TYR A 1 442 ? 2.097   10.229  63.039 1.00 20.82 ? 442  TYR A CE1   1 
ATOM   3681 C  CE2   . TYR A 1 442 ? 3.338   10.391  60.980 1.00 21.89 ? 442  TYR A CE2   1 
ATOM   3682 C  CZ    . TYR A 1 442 ? 2.495   10.953  61.928 1.00 22.28 ? 442  TYR A CZ    1 
ATOM   3683 O  OH    . TYR A 1 442 ? 2.043   12.237  61.778 1.00 21.75 ? 442  TYR A OH    1 
ATOM   3684 N  N     . ILE A 1 443 ? 6.186   4.840   63.160 1.00 22.71 ? 443  ILE A N     1 
ATOM   3685 C  CA    . ILE A 1 443 ? 6.667   3.472   63.347 1.00 22.20 ? 443  ILE A CA    1 
ATOM   3686 C  C     . ILE A 1 443 ? 7.091   3.230   64.789 1.00 23.65 ? 443  ILE A C     1 
ATOM   3687 O  O     . ILE A 1 443 ? 6.788   2.182   65.368 1.00 23.08 ? 443  ILE A O     1 
ATOM   3688 C  CB    . ILE A 1 443 ? 7.827   3.137   62.368 1.00 22.63 ? 443  ILE A CB    1 
ATOM   3689 C  CG1   . ILE A 1 443 ? 7.302   3.089   60.926 1.00 20.85 ? 443  ILE A CG1   1 
ATOM   3690 C  CG2   . ILE A 1 443 ? 8.505   1.805   62.742 1.00 22.94 ? 443  ILE A CG2   1 
ATOM   3691 C  CD1   . ILE A 1 443 ? 8.385   3.252   59.860 1.00 20.55 ? 443  ILE A CD1   1 
ATOM   3692 N  N     . ASN A 1 444 ? 7.761   4.218   65.377 1.00 24.30 ? 444  ASN A N     1 
ATOM   3693 C  CA    . ASN A 1 444 ? 8.287   4.074   66.727 1.00 27.87 ? 444  ASN A CA    1 
ATOM   3694 C  C     . ASN A 1 444 ? 7.393   4.708   67.787 1.00 28.17 ? 444  ASN A C     1 
ATOM   3695 O  O     . ASN A 1 444 ? 7.780   4.823   68.953 1.00 28.80 ? 444  ASN A O     1 
ATOM   3696 C  CB    . ASN A 1 444 ? 9.725   4.595   66.792 1.00 29.53 ? 444  ASN A CB    1 
ATOM   3697 C  CG    . ASN A 1 444 ? 10.679  3.751   65.966 1.00 33.71 ? 444  ASN A CG    1 
ATOM   3698 O  OD1   . ASN A 1 444 ? 10.779  2.540   66.158 1.00 35.47 ? 444  ASN A OD1   1 
ATOM   3699 N  ND2   . ASN A 1 444 ? 11.365  4.382   65.026 1.00 37.78 ? 444  ASN A ND2   1 
ATOM   3700 N  N     . ALA A 1 445 ? 6.190   5.103   67.367 1.00 28.23 ? 445  ALA A N     1 
ATOM   3701 C  CA    . ALA A 1 445 ? 5.143   5.598   68.270 1.00 28.38 ? 445  ALA A CA    1 
ATOM   3702 C  C     . ALA A 1 445 ? 5.564   6.826   69.080 1.00 30.39 ? 445  ALA A C     1 
ATOM   3703 O  O     . ALA A 1 445 ? 5.171   6.978   70.240 1.00 31.70 ? 445  ALA A O     1 
ATOM   3704 C  CB    . ALA A 1 445 ? 4.652   4.468   69.202 1.00 29.20 ? 445  ALA A CB    1 
ATOM   3705 N  N     . VAL A 1 446 ? 6.356   7.706   68.469 1.00 30.01 ? 446  VAL A N     1 
ATOM   3706 C  CA    . VAL A 1 446 ? 6.795   8.924   69.156 1.00 31.10 ? 446  VAL A CA    1 
ATOM   3707 C  C     . VAL A 1 446 ? 6.125   10.181  68.600 1.00 28.73 ? 446  VAL A C     1 
ATOM   3708 O  O     . VAL A 1 446 ? 6.119   11.223  69.251 1.00 27.78 ? 446  VAL A O     1 
ATOM   3709 C  CB    . VAL A 1 446 ? 8.344   9.069   69.191 1.00 33.33 ? 446  VAL A CB    1 
ATOM   3710 C  CG1   . VAL A 1 446 ? 8.972   7.939   70.012 1.00 34.74 ? 446  VAL A CG1   1 
ATOM   3711 C  CG2   . VAL A 1 446 ? 8.935   9.113   67.788 1.00 32.25 ? 446  VAL A CG2   1 
ATOM   3712 N  N     . ALA A 1 447 ? 5.555   10.077  67.403 1.00 26.13 ? 447  ALA A N     1 
ATOM   3713 C  CA    . ALA A 1 447 ? 4.805   11.185  66.825 1.00 26.32 ? 447  ALA A CA    1 
ATOM   3714 C  C     . ALA A 1 447 ? 3.510   11.408  67.600 1.00 27.19 ? 447  ALA A C     1 
ATOM   3715 O  O     . ALA A 1 447 ? 2.946   10.463  68.171 1.00 24.49 ? 447  ALA A O     1 
ATOM   3716 C  CB    . ALA A 1 447 ? 4.502   10.922  65.367 1.00 26.71 ? 447  ALA A CB    1 
ATOM   3717 N  N     . GLU A 1 448 ? 3.057   12.661  67.615 1.00 27.02 ? 448  GLU A N     1 
ATOM   3718 C  CA    . GLU A 1 448 ? 1.763   13.032  68.182 1.00 29.87 ? 448  GLU A CA    1 
ATOM   3719 C  C     . GLU A 1 448 ? 0.647   12.243  67.493 1.00 27.22 ? 448  GLU A C     1 
ATOM   3720 O  O     . GLU A 1 448 ? 0.710   11.987  66.285 1.00 24.12 ? 448  GLU A O     1 
ATOM   3721 C  CB    . GLU A 1 448 ? 1.528   14.535  67.993 1.00 34.14 ? 448  GLU A CB    1 
ATOM   3722 C  CG    . GLU A 1 448 ? 0.431   15.134  68.868 1.00 40.70 ? 448  GLU A CG    1 
ATOM   3723 C  CD    . GLU A 1 448 ? 0.127   16.592  68.531 1.00 47.26 ? 448  GLU A CD    1 
ATOM   3724 O  OE1   . GLU A 1 448 ? -0.880  17.122  69.053 1.00 49.06 ? 448  GLU A OE1   1 
ATOM   3725 O  OE2   . GLU A 1 448 ? 0.889   17.209  67.749 1.00 48.10 ? 448  GLU A OE2   1 
ATOM   3726 N  N     . ARG A 1 449 ? -0.362  11.852  68.264 1.00 25.84 ? 449  ARG A N     1 
ATOM   3727 C  CA    . ARG A 1 449 ? -1.531  11.166  67.709 1.00 24.84 ? 449  ARG A CA    1 
ATOM   3728 C  C     . ARG A 1 449 ? -2.170  12.071  66.650 1.00 22.05 ? 449  ARG A C     1 
ATOM   3729 O  O     . ARG A 1 449 ? -2.499  13.223  66.949 1.00 23.33 ? 449  ARG A O     1 
ATOM   3730 C  CB    . ARG A 1 449 ? -2.526  10.834  68.828 1.00 27.47 ? 449  ARG A CB    1 
ATOM   3731 C  CG    . ARG A 1 449 ? -3.657  9.895   68.424 1.00 27.76 ? 449  ARG A CG    1 
ATOM   3732 C  CD    . ARG A 1 449 ? -4.150  9.095   69.629 1.00 33.19 ? 449  ARG A CD    1 
ATOM   3733 N  NE    . ARG A 1 449 ? -5.197  8.135   69.273 1.00 30.26 ? 449  ARG A NE    1 
ATOM   3734 C  CZ    . ARG A 1 449 ? -6.501  8.397   69.313 1.00 29.04 ? 449  ARG A CZ    1 
ATOM   3735 N  NH1   . ARG A 1 449 ? -6.930  9.588   69.695 1.00 34.15 ? 449  ARG A NH1   1 
ATOM   3736 N  NH2   . ARG A 1 449 ? -7.381  7.463   68.982 1.00 29.43 ? 449  ARG A NH2   1 
ATOM   3737 N  N     . PRO A 1 450 ? -2.320  11.565  65.410 1.00 20.70 ? 450  PRO A N     1 
ATOM   3738 C  CA    . PRO A 1 450 ? -2.842  12.364  64.287 1.00 19.17 ? 450  PRO A CA    1 
ATOM   3739 C  C     . PRO A 1 450 ? -4.198  13.031  64.557 1.00 19.16 ? 450  PRO A C     1 
ATOM   3740 O  O     . PRO A 1 450 ? -4.356  14.215  64.268 1.00 19.93 ? 450  PRO A O     1 
ATOM   3741 C  CB    . PRO A 1 450 ? -2.959  11.339  63.160 1.00 17.74 ? 450  PRO A CB    1 
ATOM   3742 C  CG    . PRO A 1 450 ? -1.883  10.368  63.444 1.00 22.00 ? 450  PRO A CG    1 
ATOM   3743 C  CD    . PRO A 1 450 ? -1.836  10.248  64.952 1.00 18.39 ? 450  PRO A CD    1 
ATOM   3744 N  N     . SER A 1 451 ? -5.158  12.286  65.110 1.00 18.44 ? 451  SER A N     1 
ATOM   3745 C  CA    . SER A 1 451 ? -6.513  12.818  65.330 1.00 19.44 ? 451  SER A CA    1 
ATOM   3746 C  C     . SER A 1 451 ? -7.232  12.130  66.476 1.00 19.95 ? 451  SER A C     1 
ATOM   3747 O  O     . SER A 1 451 ? -7.092  10.918  66.682 1.00 18.79 ? 451  SER A O     1 
ATOM   3748 C  CB    . SER A 1 451 ? -7.373  12.674  64.069 1.00 19.12 ? 451  SER A CB    1 
ATOM   3749 O  OG    . SER A 1 451 ? -8.668  13.249  64.239 1.00 19.01 ? 451  SER A OG    1 
ATOM   3750 N  N     . ASP A 1 452 ? -8.021  12.916  67.201 1.00 20.29 ? 452  ASP A N     1 
ATOM   3751 C  CA    . ASP A 1 452 ? -8.935  12.385  68.202 1.00 22.18 ? 452  ASP A CA    1 
ATOM   3752 C  C     . ASP A 1 452 ? -10.371 12.309  67.681 1.00 21.15 ? 452  ASP A C     1 
ATOM   3753 O  O     . ASP A 1 452 ? -11.298 12.062  68.442 1.00 22.15 ? 452  ASP A O     1 
ATOM   3754 C  CB    . ASP A 1 452 ? -8.885  13.243  69.468 1.00 26.00 ? 452  ASP A CB    1 
ATOM   3755 C  CG    . ASP A 1 452 ? -7.897  12.722  70.478 1.00 35.21 ? 452  ASP A CG    1 
ATOM   3756 O  OD1   . ASP A 1 452 ? -7.890  11.495  70.717 1.00 42.10 ? 452  ASP A OD1   1 
ATOM   3757 O  OD2   . ASP A 1 452 ? -7.137  13.533  71.045 1.00 41.61 ? 452  ASP A OD2   1 
ATOM   3758 N  N     . VAL A 1 453 ? -10.553 12.528  66.385 1.00 19.92 ? 453  VAL A N     1 
ATOM   3759 C  CA    . VAL A 1 453 ? -11.899 12.577  65.812 1.00 19.33 ? 453  VAL A CA    1 
ATOM   3760 C  C     . VAL A 1 453 ? -12.008 11.650  64.612 1.00 19.63 ? 453  VAL A C     1 
ATOM   3761 O  O     . VAL A 1 453 ? -13.007 10.939  64.444 1.00 20.42 ? 453  VAL A O     1 
ATOM   3762 C  CB    . VAL A 1 453 ? -12.277 14.020  65.397 1.00 19.43 ? 453  VAL A CB    1 
ATOM   3763 C  CG1   . VAL A 1 453 ? -13.636 14.057  64.715 1.00 21.82 ? 453  VAL A CG1   1 
ATOM   3764 C  CG2   . VAL A 1 453 ? -12.278 14.947  66.610 1.00 20.75 ? 453  VAL A CG2   1 
ATOM   3765 N  N     . TYR A 1 454 ? -10.976 11.670  63.778 1.00 16.92 ? 454  TYR A N     1 
ATOM   3766 C  CA    . TYR A 1 454 ? -11.026 10.982  62.495 1.00 16.38 ? 454  TYR A CA    1 
ATOM   3767 C  C     . TYR A 1 454 ? -10.039 9.825   62.390 1.00 15.91 ? 454  TYR A C     1 
ATOM   3768 O  O     . TYR A 1 454 ? -9.083  9.729   63.158 1.00 17.44 ? 454  TYR A O     1 
ATOM   3769 C  CB    . TYR A 1 454 ? -10.802 11.986  61.363 1.00 17.31 ? 454  TYR A CB    1 
ATOM   3770 C  CG    . TYR A 1 454 ? -11.830 13.100  61.333 1.00 16.92 ? 454  TYR A CG    1 
ATOM   3771 C  CD1   . TYR A 1 454 ? -13.177 12.824  61.097 1.00 20.48 ? 454  TYR A CD1   1 
ATOM   3772 C  CD2   . TYR A 1 454 ? -11.451 14.427  61.536 1.00 20.76 ? 454  TYR A CD2   1 
ATOM   3773 C  CE1   . TYR A 1 454 ? -14.128 13.847  61.066 1.00 22.46 ? 454  TYR A CE1   1 
ATOM   3774 C  CE2   . TYR A 1 454 ? -12.390 15.453  61.509 1.00 23.38 ? 454  TYR A CE2   1 
ATOM   3775 C  CZ    . TYR A 1 454 ? -13.724 15.154  61.272 1.00 24.22 ? 454  TYR A CZ    1 
ATOM   3776 O  OH    . TYR A 1 454 ? -14.659 16.162  61.243 1.00 28.67 ? 454  TYR A OH    1 
ATOM   3777 N  N     . SER A 1 455 ? -10.287 8.949   61.423 1.00 15.88 ? 455  SER A N     1 
ATOM   3778 C  CA    . SER A 1 455 ? -9.442  7.788   61.175 1.00 17.88 ? 455  SER A CA    1 
ATOM   3779 C  C     . SER A 1 455 ? -8.323  8.164   60.206 1.00 16.98 ? 455  SER A C     1 
ATOM   3780 O  O     . SER A 1 455 ? -8.577  8.754   59.150 1.00 18.36 ? 455  SER A O     1 
ATOM   3781 C  CB    . SER A 1 455 ? -10.286 6.649   60.602 1.00 17.11 ? 455  SER A CB    1 
ATOM   3782 O  OG    . SER A 1 455 ? -9.459  5.609   60.113 1.00 16.47 ? 455  SER A OG    1 
ATOM   3783 N  N     . CYS A 1 456 ? -7.091  7.803   60.553 1.00 16.76 ? 456  CYS A N     1 
ATOM   3784 C  CA    . CYS A 1 456 ? -5.928  8.387   59.885 1.00 16.73 ? 456  CYS A CA    1 
ATOM   3785 C  C     . CYS A 1 456 ? -4.986  7.409   59.204 1.00 16.59 ? 456  CYS A C     1 
ATOM   3786 O  O     . CYS A 1 456 ? -4.876  6.246   59.596 1.00 16.17 ? 456  CYS A O     1 
ATOM   3787 C  CB    . CYS A 1 456 ? -5.132  9.220   60.886 1.00 17.15 ? 456  CYS A CB    1 
ATOM   3788 S  SG    . CYS A 1 456 ? -6.087  10.574  61.560 1.00 20.91 ? 456  CYS A SG    1 
ATOM   3789 N  N     . SER A 1 457 ? -4.299  7.917   58.183 1.00 16.26 ? 457  SER A N     1 
ATOM   3790 C  CA    . SER A 1 457 ? -3.162  7.238   57.576 1.00 16.06 ? 457  SER A CA    1 
ATOM   3791 C  C     . SER A 1 457 ? -1.948  8.136   57.766 1.00 16.27 ? 457  SER A C     1 
ATOM   3792 O  O     . SER A 1 457 ? -2.086  9.360   57.733 1.00 17.77 ? 457  SER A O     1 
ATOM   3793 C  CB    . SER A 1 457 ? -3.405  7.026   56.082 1.00 15.70 ? 457  SER A CB    1 
ATOM   3794 O  OG    . SER A 1 457 ? -2.244  6.487   55.463 1.00 17.39 ? 457  SER A OG    1 
ATOM   3795 N  N     . PRO A 1 458 ? -0.753  7.546   57.938 1.00 16.89 ? 458  PRO A N     1 
ATOM   3796 C  CA    . PRO A 1 458 ? 0.445   8.373   58.166 1.00 18.14 ? 458  PRO A CA    1 
ATOM   3797 C  C     . PRO A 1 458 ? 0.922   9.199   56.951 1.00 19.12 ? 458  PRO A C     1 
ATOM   3798 O  O     . PRO A 1 458 ? 1.971   9.851   57.027 1.00 19.58 ? 458  PRO A O     1 
ATOM   3799 C  CB    . PRO A 1 458 ? 1.507   7.339   58.586 1.00 16.65 ? 458  PRO A CB    1 
ATOM   3800 C  CG    . PRO A 1 458 ? 1.038   6.058   57.979 1.00 16.25 ? 458  PRO A CG    1 
ATOM   3801 C  CD    . PRO A 1 458 ? -0.455  6.105   58.074 1.00 15.71 ? 458  PRO A CD    1 
ATOM   3802 N  N     . ASN A 1 459 ? 0.161   9.197   55.854 1.00 16.83 ? 459  ASN A N     1 
ATOM   3803 C  CA    . ASN A 1 459 ? 0.430   10.140  54.760 1.00 17.15 ? 459  ASN A CA    1 
ATOM   3804 C  C     . ASN A 1 459 ? -0.190  11.523  54.997 1.00 17.41 ? 459  ASN A C     1 
ATOM   3805 O  O     . ASN A 1 459 ? -0.024  12.433  54.175 1.00 20.12 ? 459  ASN A O     1 
ATOM   3806 C  CB    . ASN A 1 459 ? -0.040  9.573   53.409 1.00 16.50 ? 459  ASN A CB    1 
ATOM   3807 C  CG    . ASN A 1 459 ? -1.539  9.730   53.198 1.00 17.35 ? 459  ASN A CG    1 
ATOM   3808 O  OD1   . ASN A 1 459 ? -2.325  9.617   54.138 1.00 15.85 ? 459  ASN A OD1   1 
ATOM   3809 N  ND2   . ASN A 1 459 ? -1.941  9.981   51.956 1.00 16.58 ? 459  ASN A ND2   1 
ATOM   3810 N  N     . GLY A 1 460 ? -0.920  11.675  56.104 1.00 16.43 ? 460  GLY A N     1 
ATOM   3811 C  CA    . GLY A 1 460 ? -1.542  12.953  56.450 1.00 18.55 ? 460  GLY A CA    1 
ATOM   3812 C  C     . GLY A 1 460 ? -3.045  13.022  56.270 1.00 18.16 ? 460  GLY A C     1 
ATOM   3813 O  O     . GLY A 1 460 ? -3.668  14.029  56.605 1.00 19.10 ? 460  GLY A O     1 
ATOM   3814 N  N     . MET A 1 461 ? -3.637  11.954  55.746 1.00 16.12 ? 461  MET A N     1 
ATOM   3815 C  CA    . MET A 1 461 ? -5.064  11.962  55.444 1.00 15.96 ? 461  MET A CA    1 
ATOM   3816 C  C     . MET A 1 461 ? -5.920  11.526  56.627 1.00 16.33 ? 461  MET A C     1 
ATOM   3817 O  O     . MET A 1 461 ? -5.523  10.648  57.398 1.00 17.13 ? 461  MET A O     1 
ATOM   3818 C  CB    . MET A 1 461 ? -5.354  11.085  54.228 1.00 17.11 ? 461  MET A CB    1 
ATOM   3819 C  CG    . MET A 1 461 ? -4.801  11.651  52.941 1.00 15.78 ? 461  MET A CG    1 
ATOM   3820 S  SD    . MET A 1 461 ? -5.565  13.221  52.494 1.00 21.73 ? 461  MET A SD    1 
ATOM   3821 C  CE    . MET A 1 461 ? -7.202  12.666  52.021 1.00 23.46 ? 461  MET A CE    1 
ATOM   3822 N  N     . MET A 1 462 ? -7.088  12.157  56.756 1.00 17.16 ? 462  MET A N     1 
ATOM   3823 C  CA    . MET A 1 462 ? -8.089  11.796  57.760 1.00 17.63 ? 462  MET A CA    1 
ATOM   3824 C  C     . MET A 1 462 ? -9.420  11.454  57.104 1.00 17.48 ? 462  MET A C     1 
ATOM   3825 O  O     . MET A 1 462 ? -9.796  12.051  56.080 1.00 17.62 ? 462  MET A O     1 
ATOM   3826 C  CB    . MET A 1 462 ? -8.319  12.939  58.750 1.00 18.97 ? 462  MET A CB    1 
ATOM   3827 C  CG    . MET A 1 462 ? -7.066  13.548  59.325 1.00 19.18 ? 462  MET A CG    1 
ATOM   3828 S  SD    . MET A 1 462 ? -7.460  14.601  60.730 1.00 22.30 ? 462  MET A SD    1 
ATOM   3829 C  CE    . MET A 1 462 ? -8.380  15.934  59.963 1.00 22.20 ? 462  MET A CE    1 
ATOM   3830 N  N     . TYR A 1 463 ? -10.149 10.530  57.731 1.00 17.43 ? 463  TYR A N     1 
ATOM   3831 C  CA    . TYR A 1 463 ? -11.385 9.996   57.177 1.00 16.89 ? 463  TYR A CA    1 
ATOM   3832 C  C     . TYR A 1 463 ? -12.507 9.928   58.206 1.00 17.64 ? 463  TYR A C     1 
ATOM   3833 O  O     . TYR A 1 463 ? -12.269 9.694   59.399 1.00 15.27 ? 463  TYR A O     1 
ATOM   3834 C  CB    . TYR A 1 463 ? -11.137 8.604   56.564 1.00 15.14 ? 463  TYR A CB    1 
ATOM   3835 C  CG    . TYR A 1 463 ? -10.113 8.630   55.461 1.00 15.84 ? 463  TYR A CG    1 
ATOM   3836 C  CD1   . TYR A 1 463 ? -8.752  8.470   55.739 1.00 14.99 ? 463  TYR A CD1   1 
ATOM   3837 C  CD2   . TYR A 1 463 ? -10.496 8.855   54.140 1.00 13.77 ? 463  TYR A CD2   1 
ATOM   3838 C  CE1   . TYR A 1 463 ? -7.800  8.529   54.724 1.00 16.66 ? 463  TYR A CE1   1 
ATOM   3839 C  CE2   . TYR A 1 463 ? -9.555  8.898   53.119 1.00 15.38 ? 463  TYR A CE2   1 
ATOM   3840 C  CZ    . TYR A 1 463 ? -8.216  8.740   53.415 1.00 16.82 ? 463  TYR A CZ    1 
ATOM   3841 O  OH    . TYR A 1 463 ? -7.283  8.795   52.407 1.00 16.68 ? 463  TYR A OH    1 
ATOM   3842 N  N     . TYR A 1 464 ? -13.739 10.106  57.731 1.00 19.41 ? 464  TYR A N     1 
ATOM   3843 C  CA    . TYR A 1 464 ? -14.908 9.979   58.598 1.00 19.81 ? 464  TYR A CA    1 
ATOM   3844 C  C     . TYR A 1 464 ? -14.995 8.600   59.239 1.00 20.10 ? 464  TYR A C     1 
ATOM   3845 O  O     . TYR A 1 464 ? -14.601 7.598   58.640 1.00 19.14 ? 464  TYR A O     1 
ATOM   3846 C  CB    . TYR A 1 464 ? -16.206 10.230  57.831 1.00 20.48 ? 464  TYR A CB    1 
ATOM   3847 C  CG    . TYR A 1 464 ? -16.316 11.579  57.166 1.00 24.07 ? 464  TYR A CG    1 
ATOM   3848 C  CD1   . TYR A 1 464 ? -16.874 11.696  55.894 1.00 28.16 ? 464  TYR A CD1   1 
ATOM   3849 C  CD2   . TYR A 1 464 ? -15.872 12.739  57.802 1.00 25.52 ? 464  TYR A CD2   1 
ATOM   3850 C  CE1   . TYR A 1 464 ? -16.987 12.929  55.267 1.00 28.58 ? 464  TYR A CE1   1 
ATOM   3851 C  CE2   . TYR A 1 464 ? -15.984 13.985  57.179 1.00 29.66 ? 464  TYR A CE2   1 
ATOM   3852 C  CZ    . TYR A 1 464 ? -16.536 14.066  55.909 1.00 30.57 ? 464  TYR A CZ    1 
ATOM   3853 O  OH    . TYR A 1 464 ? -16.650 15.287  55.281 1.00 34.01 ? 464  TYR A OH    1 
ATOM   3854 N  N     . LYS A 1 465 ? -15.524 8.563   60.458 1.00 18.89 ? 465  LYS A N     1 
ATOM   3855 C  CA    . LYS A 1 465 ? -15.756 7.305   61.157 1.00 20.08 ? 465  LYS A CA    1 
ATOM   3856 C  C     . LYS A 1 465 ? -17.241 7.004   61.396 1.00 21.41 ? 465  LYS A C     1 
ATOM   3857 O  O     . LYS A 1 465 ? -17.577 5.971   61.974 1.00 24.85 ? 465  LYS A O     1 
ATOM   3858 C  CB    . LYS A 1 465 ? -15.011 7.296   62.492 1.00 18.94 ? 465  LYS A CB    1 
ATOM   3859 C  CG    . LYS A 1 465 ? -13.499 7.446   62.375 1.00 20.17 ? 465  LYS A CG    1 
ATOM   3860 C  CD    . LYS A 1 465 ? -12.835 7.321   63.742 1.00 21.42 ? 465  LYS A CD    1 
ATOM   3861 C  CE    . LYS A 1 465 ? -12.957 5.905   64.284 1.00 19.74 ? 465  LYS A CE    1 
ATOM   3862 N  NZ    . LYS A 1 465 ? -12.208 5.735   65.544 1.00 19.42 ? 465  LYS A NZ    1 
ATOM   3863 N  N     . ASP A 1 466 ? -18.129 7.892   60.962 1.00 21.48 ? 466  ASP A N     1 
ATOM   3864 C  CA    . ASP A 1 466 ? -19.559 7.721   61.268 1.00 23.99 ? 466  ASP A CA    1 
ATOM   3865 C  C     . ASP A 1 466 ? -20.241 6.680   60.379 1.00 25.61 ? 466  ASP A C     1 
ATOM   3866 O  O     . ASP A 1 466 ? -21.235 6.072   60.777 1.00 28.02 ? 466  ASP A O     1 
ATOM   3867 C  CB    . ASP A 1 466 ? -20.302 9.049   61.161 1.00 25.89 ? 466  ASP A CB    1 
ATOM   3868 C  CG    . ASP A 1 466 ? -20.286 9.615   59.755 1.00 28.81 ? 466  ASP A CG    1 
ATOM   3869 O  OD1   . ASP A 1 466 ? -19.188 9.740   59.170 1.00 30.07 ? 466  ASP A OD1   1 
ATOM   3870 O  OD2   . ASP A 1 466 ? -21.373 9.926   59.228 1.00 31.66 ? 466  ASP A OD2   1 
ATOM   3871 N  N     . ARG A 1 467 ? -19.707 6.494   59.176 1.00 23.34 ? 467  ARG A N     1 
ATOM   3872 C  CA    . ARG A 1 467 ? -20.315 5.619   58.179 1.00 23.36 ? 467  ARG A CA    1 
ATOM   3873 C  C     . ARG A 1 467 ? -19.246 5.088   57.233 1.00 22.35 ? 467  ARG A C     1 
ATOM   3874 O  O     . ARG A 1 467 ? -18.259 5.774   56.962 1.00 19.88 ? 467  ARG A O     1 
ATOM   3875 C  CB    . ARG A 1 467 ? -21.394 6.377   57.389 1.00 25.55 ? 467  ARG A CB    1 
ATOM   3876 C  CG    . ARG A 1 467 ? -20.879 7.623   56.656 1.00 31.47 ? 467  ARG A CG    1 
ATOM   3877 C  CD    . ARG A 1 467 ? -22.008 8.481   56.088 1.00 41.08 ? 467  ARG A CD    1 
ATOM   3878 N  NE    . ARG A 1 467 ? -21.582 9.865   55.858 1.00 46.19 ? 467  ARG A NE    1 
ATOM   3879 C  CZ    . ARG A 1 467 ? -21.005 10.313  54.742 1.00 48.31 ? 467  ARG A CZ    1 
ATOM   3880 N  NH1   . ARG A 1 467 ? -20.772 9.493   53.723 1.00 48.55 ? 467  ARG A NH1   1 
ATOM   3881 N  NH2   . ARG A 1 467 ? -20.660 11.591  54.642 1.00 49.11 ? 467  ARG A NH2   1 
ATOM   3882 N  N     . ASP A 1 468 ? -19.445 3.863   56.749 1.00 23.00 ? 468  ASP A N     1 
ATOM   3883 C  CA    . ASP A 1 468 ? -18.549 3.257   55.766 1.00 22.79 ? 468  ASP A CA    1 
ATOM   3884 C  C     . ASP A 1 468 ? -18.673 3.958   54.419 1.00 21.90 ? 468  ASP A C     1 
ATOM   3885 O  O     . ASP A 1 468 ? -19.779 4.271   53.963 1.00 21.31 ? 468  ASP A O     1 
ATOM   3886 C  CB    . ASP A 1 468 ? -18.852 1.761   55.590 1.00 25.02 ? 468  ASP A CB    1 
ATOM   3887 C  CG    . ASP A 1 468 ? -18.207 0.880   56.661 1.00 31.07 ? 468  ASP A CG    1 
ATOM   3888 O  OD1   . ASP A 1 468 ? -17.310 1.337   57.400 1.00 31.86 ? 468  ASP A OD1   1 
ATOM   3889 O  OD2   . ASP A 1 468 ? -18.591 -0.305  56.743 1.00 35.99 ? 468  ASP A OD2   1 
ATOM   3890 N  N     . GLY A 1 469 ? -17.528 4.203   53.788 1.00 20.99 ? 469  GLY A N     1 
ATOM   3891 C  CA    . GLY A 1 469 ? -17.502 4.746   52.436 1.00 19.30 ? 469  GLY A CA    1 
ATOM   3892 C  C     . GLY A 1 469 ? -17.949 3.684   51.449 1.00 18.28 ? 469  GLY A C     1 
ATOM   3893 O  O     . GLY A 1 469 ? -17.959 2.496   51.771 1.00 16.79 ? 469  GLY A O     1 
ATOM   3894 N  N     . VAL A 1 470 ? -18.314 4.102   50.241 1.00 17.74 ? 470  VAL A N     1 
ATOM   3895 C  CA    . VAL A 1 470 ? -18.748 3.136   49.227 1.00 17.62 ? 470  VAL A CA    1 
ATOM   3896 C  C     . VAL A 1 470 ? -17.624 2.163   48.834 1.00 15.59 ? 470  VAL A C     1 
ATOM   3897 O  O     . VAL A 1 470 ? -17.876 0.989   48.571 1.00 16.69 ? 470  VAL A O     1 
ATOM   3898 C  CB    . VAL A 1 470 ? -19.391 3.826   47.982 1.00 18.29 ? 470  VAL A CB    1 
ATOM   3899 C  CG1   . VAL A 1 470 ? -18.414 4.760   47.279 1.00 19.17 ? 470  VAL A CG1   1 
ATOM   3900 C  CG2   . VAL A 1 470 ? -19.970 2.789   47.014 1.00 18.04 ? 470  VAL A CG2   1 
ATOM   3901 N  N     . VAL A 1 471 ? -16.390 2.654   48.804 1.00 14.73 ? 471  VAL A N     1 
ATOM   3902 C  CA    . VAL A 1 471 ? -15.248 1.804   48.449 1.00 14.63 ? 471  VAL A CA    1 
ATOM   3903 C  C     . VAL A 1 471 ? -15.029 0.706   49.517 1.00 15.30 ? 471  VAL A C     1 
ATOM   3904 O  O     . VAL A 1 471 ? -14.974 -0.468  49.172 1.00 16.56 ? 471  VAL A O     1 
ATOM   3905 C  CB    . VAL A 1 471 ? -13.982 2.643   48.123 1.00 15.07 ? 471  VAL A CB    1 
ATOM   3906 C  CG1   . VAL A 1 471 ? -12.719 1.796   48.168 1.00 15.50 ? 471  VAL A CG1   1 
ATOM   3907 C  CG2   . VAL A 1 471 ? -14.146 3.331   46.753 1.00 15.84 ? 471  VAL A CG2   1 
ATOM   3908 N  N     . PRO A 1 472 ? -14.945 1.077   50.812 1.00 16.69 ? 472  PRO A N     1 
ATOM   3909 C  CA    . PRO A 1 472 ? -14.928 0.026   51.836 1.00 15.53 ? 472  PRO A CA    1 
ATOM   3910 C  C     . PRO A 1 472 ? -16.119 -0.949  51.771 1.00 16.11 ? 472  PRO A C     1 
ATOM   3911 O  O     . PRO A 1 472 ? -15.918 -2.154  51.911 1.00 17.08 ? 472  PRO A O     1 
ATOM   3912 C  CB    . PRO A 1 472 ? -14.923 0.817   53.146 1.00 16.36 ? 472  PRO A CB    1 
ATOM   3913 C  CG    . PRO A 1 472 ? -14.154 2.065   52.789 1.00 15.50 ? 472  PRO A CG    1 
ATOM   3914 C  CD    . PRO A 1 472 ? -14.646 2.401   51.393 1.00 16.63 ? 472  PRO A CD    1 
ATOM   3915 N  N     . THR A 1 473 ? -17.332 -0.446  51.532 1.00 15.53 ? 473  THR A N     1 
ATOM   3916 C  CA    . THR A 1 473 ? -18.527 -1.315  51.518 1.00 16.23 ? 473  THR A CA    1 
ATOM   3917 C  C     . THR A 1 473 ? -18.470 -2.348  50.388 1.00 13.49 ? 473  THR A C     1 
ATOM   3918 O  O     . THR A 1 473 ? -18.716 -3.547  50.600 1.00 14.01 ? 473  THR A O     1 
ATOM   3919 C  CB    . THR A 1 473 ? -19.824 -0.488  51.435 1.00 17.05 ? 473  THR A CB    1 
ATOM   3920 O  OG1   . THR A 1 473 ? -19.951 0.301   52.628 1.00 20.42 ? 473  THR A OG1   1 
ATOM   3921 C  CG2   . THR A 1 473 ? -21.063 -1.399  51.303 1.00 19.81 ? 473  THR A CG2   1 
ATOM   3922 N  N     . GLU A 1 474 ? -18.116 -1.883  49.198 1.00 14.41 ? 474  GLU A N     1 
ATOM   3923 C  CA    . GLU A 1 474 ? -18.064 -2.767  48.036 1.00 15.12 ? 474  GLU A CA    1 
ATOM   3924 C  C     . GLU A 1 474 ? -16.859 -3.700  48.016 1.00 15.77 ? 474  GLU A C     1 
ATOM   3925 O  O     . GLU A 1 474 ? -16.974 -4.851  47.589 1.00 15.62 ? 474  GLU A O     1 
ATOM   3926 C  CB    . GLU A 1 474 ? -18.178 -1.970  46.741 1.00 16.75 ? 474  GLU A CB    1 
ATOM   3927 C  CG    . GLU A 1 474 ? -19.556 -1.309  46.569 1.00 20.10 ? 474  GLU A CG    1 
ATOM   3928 C  CD    . GLU A 1 474 ? -20.713 -2.293  46.725 1.00 22.39 ? 474  GLU A CD    1 
ATOM   3929 O  OE1   . GLU A 1 474 ? -21.673 -1.970  47.465 1.00 22.30 ? 474  GLU A OE1   1 
ATOM   3930 O  OE2   . GLU A 1 474 ? -20.661 -3.393  46.122 1.00 20.60 ? 474  GLU A OE2   1 
ATOM   3931 N  N     . ILE A 1 475 ? -15.714 -3.217  48.489 1.00 14.54 ? 475  ILE A N     1 
ATOM   3932 C  CA    . ILE A 1 475 ? -14.511 -4.055  48.540 1.00 14.30 ? 475  ILE A CA    1 
ATOM   3933 C  C     . ILE A 1 475 ? -14.700 -5.193  49.549 1.00 15.36 ? 475  ILE A C     1 
ATOM   3934 O  O     . ILE A 1 475 ? -14.196 -6.291  49.344 1.00 15.28 ? 475  ILE A O     1 
ATOM   3935 C  CB    . ILE A 1 475 ? -13.217 -3.225  48.803 1.00 14.87 ? 475  ILE A CB    1 
ATOM   3936 C  CG1   . ILE A 1 475 ? -12.009 -3.852  48.092 1.00 14.21 ? 475  ILE A CG1   1 
ATOM   3937 C  CG2   . ILE A 1 475 ? -12.967 -3.003  50.297 1.00 14.57 ? 475  ILE A CG2   1 
ATOM   3938 C  CD1   . ILE A 1 475 ? -10.723 -3.000  48.205 1.00 14.05 ? 475  ILE A CD1   1 
ATOM   3939 N  N     . THR A 1 476 ? -15.456 -4.928  50.613 1.00 16.09 ? 476  THR A N     1 
ATOM   3940 C  CA    . THR A 1 476 ? -15.734 -5.937  51.647 1.00 15.82 ? 476  THR A CA    1 
ATOM   3941 C  C     . THR A 1 476 ? -16.543 -7.105  51.079 1.00 16.18 ? 476  THR A C     1 
ATOM   3942 O  O     . THR A 1 476 ? -16.284 -8.267  51.408 1.00 16.63 ? 476  THR A O     1 
ATOM   3943 C  CB    . THR A 1 476 ? -16.492 -5.327  52.839 1.00 17.87 ? 476  THR A CB    1 
ATOM   3944 O  OG1   . THR A 1 476 ? -15.695 -4.288  53.426 1.00 18.91 ? 476  THR A OG1   1 
ATOM   3945 C  CG2   . THR A 1 476 ? -16.784 -6.389  53.904 1.00 17.78 ? 476  THR A CG2   1 
ATOM   3946 N  N     . LYS A 1 477 ? -17.518 -6.788  50.233 1.00 17.27 ? 477  LYS A N     1 
ATOM   3947 C  CA    . LYS A 1 477 ? -18.363 -7.810  49.609 1.00 17.10 ? 477  LYS A CA    1 
ATOM   3948 C  C     . LYS A 1 477 ? -17.542 -8.779  48.763 1.00 17.74 ? 477  LYS A C     1 
ATOM   3949 O  O     . LYS A 1 477 ? -17.718 -9.998  48.854 1.00 17.48 ? 477  LYS A O     1 
ATOM   3950 C  CB    . LYS A 1 477 ? -19.467 -7.161  48.765 1.00 17.29 ? 477  LYS A CB    1 
ATOM   3951 C  CG    . LYS A 1 477 ? -20.544 -6.445  49.584 1.00 19.05 ? 477  LYS A CG    1 
ATOM   3952 C  CD    . LYS A 1 477 ? -21.540 -5.715  48.687 1.00 21.08 ? 477  LYS A CD    1 
ATOM   3953 C  CE    . LYS A 1 477 ? -22.479 -4.841  49.511 1.00 24.22 ? 477  LYS A CE    1 
ATOM   3954 N  NZ    . LYS A 1 477 ? -23.302 -3.906  48.673 1.00 27.12 ? 477  LYS A NZ    1 
ATOM   3955 N  N     . VAL A 1 478 ? -16.630 -8.244  47.955 1.00 15.31 ? 478  VAL A N     1 
ATOM   3956 C  CA    . VAL A 1 478 ? -15.793 -9.099  47.111 1.00 16.44 ? 478  VAL A CA    1 
ATOM   3957 C  C     . VAL A 1 478 ? -14.745 -9.844  47.948 1.00 16.54 ? 478  VAL A C     1 
ATOM   3958 O  O     . VAL A 1 478 ? -14.488 -11.030 47.710 1.00 17.51 ? 478  VAL A O     1 
ATOM   3959 C  CB    . VAL A 1 478 ? -15.148 -8.325  45.941 1.00 15.27 ? 478  VAL A CB    1 
ATOM   3960 C  CG1   . VAL A 1 478 ? -14.286 -9.258  45.094 1.00 16.22 ? 478  VAL A CG1   1 
ATOM   3961 C  CG2   . VAL A 1 478 ? -16.227 -7.685  45.077 1.00 16.11 ? 478  VAL A CG2   1 
ATOM   3962 N  N     . PHE A 1 479 ? -14.166 -9.168  48.941 1.00 16.89 ? 479  PHE A N     1 
ATOM   3963 C  CA    . PHE A 1 479 ? -13.278 -9.847  49.894 1.00 17.30 ? 479  PHE A CA    1 
ATOM   3964 C  C     . PHE A 1 479 ? -13.937 -11.080 50.528 1.00 17.68 ? 479  PHE A C     1 
ATOM   3965 O  O     . PHE A 1 479 ? -13.319 -12.141 50.623 1.00 17.74 ? 479  PHE A O     1 
ATOM   3966 C  CB    . PHE A 1 479 ? -12.797 -8.901  51.000 1.00 16.60 ? 479  PHE A CB    1 
ATOM   3967 C  CG    . PHE A 1 479 ? -12.070 -9.615  52.104 1.00 19.39 ? 479  PHE A CG    1 
ATOM   3968 C  CD1   . PHE A 1 479 ? -10.780 -10.104 51.896 1.00 18.65 ? 479  PHE A CD1   1 
ATOM   3969 C  CD2   . PHE A 1 479 ? -12.686 -9.846  53.325 1.00 18.83 ? 479  PHE A CD2   1 
ATOM   3970 C  CE1   . PHE A 1 479 ? -10.112 -10.796 52.903 1.00 20.96 ? 479  PHE A CE1   1 
ATOM   3971 C  CE2   . PHE A 1 479 ? -12.020 -10.530 54.342 1.00 21.82 ? 479  PHE A CE2   1 
ATOM   3972 C  CZ    . PHE A 1 479 ? -10.731 -10.998 54.131 1.00 20.57 ? 479  PHE A CZ    1 
ATOM   3973 N  N     . ASN A 1 480 ? -15.191 -10.942 50.955 1.00 18.58 ? 480  ASN A N     1 
ATOM   3974 C  CA    . ASN A 1 480 ? -15.899 -12.066 51.574 1.00 19.62 ? 480  ASN A CA    1 
ATOM   3975 C  C     . ASN A 1 480 ? -16.103 -13.251 50.622 1.00 21.25 ? 480  ASN A C     1 
ATOM   3976 O  O     . ASN A 1 480 ? -15.994 -14.407 51.036 1.00 22.54 ? 480  ASN A O     1 
ATOM   3977 C  CB    . ASN A 1 480 ? -17.214 -11.604 52.208 1.00 19.53 ? 480  ASN A CB    1 
ATOM   3978 C  CG    . ASN A 1 480 ? -16.990 -10.800 53.483 1.00 22.75 ? 480  ASN A CG    1 
ATOM   3979 O  OD1   . ASN A 1 480 ? -15.953 -10.928 54.132 1.00 24.71 ? 480  ASN A OD1   1 
ATOM   3980 N  ND2   . ASN A 1 480 ? -17.958 -9.964  53.840 1.00 24.02 ? 480  ASN A ND2   1 
ATOM   3981 N  N     . GLN A 1 481 ? -16.373 -12.962 49.351 1.00 21.41 ? 481  GLN A N     1 
ATOM   3982 C  CA    . GLN A 1 481 ? -16.429 -14.008 48.323 1.00 21.88 ? 481  GLN A CA    1 
ATOM   3983 C  C     . GLN A 1 481 ? -15.079 -14.689 48.181 1.00 20.70 ? 481  GLN A C     1 
ATOM   3984 O  O     . GLN A 1 481 ? -15.004 -15.918 48.123 1.00 19.41 ? 481  GLN A O     1 
ATOM   3985 C  CB    . GLN A 1 481 ? -16.782 -13.434 46.960 1.00 24.45 ? 481  GLN A CB    1 
ATOM   3986 C  CG    . GLN A 1 481 ? -18.150 -12.839 46.824 1.00 29.32 ? 481  GLN A CG    1 
ATOM   3987 C  CD    . GLN A 1 481 ? -18.258 -12.026 45.547 1.00 34.70 ? 481  GLN A CD    1 
ATOM   3988 O  OE1   . GLN A 1 481 ? -17.606 -12.330 44.540 1.00 36.19 ? 481  GLN A OE1   1 
ATOM   3989 N  NE2   . GLN A 1 481 ? -19.066 -10.981 45.584 1.00 35.92 ? 481  GLN A NE2   1 
ATOM   3990 N  N     . ARG A 1 482 ? -14.025 -13.877 48.093 1.00 17.45 ? 482  ARG A N     1 
ATOM   3991 C  CA    . ARG A 1 482 ? -12.662 -14.370 47.962 1.00 18.04 ? 482  ARG A CA    1 
ATOM   3992 C  C     . ARG A 1 482 ? -12.322 -15.324 49.108 1.00 18.38 ? 482  ARG A C     1 
ATOM   3993 O  O     . ARG A 1 482 ? -11.775 -16.404 48.875 1.00 19.16 ? 482  ARG A O     1 
ATOM   3994 C  CB    . ARG A 1 482 ? -11.671 -13.203 47.908 1.00 17.51 ? 482  ARG A CB    1 
ATOM   3995 C  CG    . ARG A 1 482 ? -10.230 -13.611 47.603 1.00 19.65 ? 482  ARG A CG    1 
ATOM   3996 C  CD    . ARG A 1 482 ? -9.406  -13.800 48.852 1.00 19.79 ? 482  ARG A CD    1 
ATOM   3997 N  NE    . ARG A 1 482 ? -8.079  -14.322 48.538 1.00 17.72 ? 482  ARG A NE    1 
ATOM   3998 C  CZ    . ARG A 1 482 ? -6.970  -14.012 49.205 1.00 18.69 ? 482  ARG A CZ    1 
ATOM   3999 N  NH1   . ARG A 1 482 ? -7.012  -13.159 50.229 1.00 17.92 ? 482  ARG A NH1   1 
ATOM   4000 N  NH2   . ARG A 1 482 ? -5.814  -14.541 48.834 1.00 17.99 ? 482  ARG A NH2   1 
ATOM   4001 N  N     . LYS A 1 483 ? -12.659 -14.921 50.332 1.00 18.70 ? 483  LYS A N     1 
ATOM   4002 C  CA    . LYS A 1 483 ? -12.379 -15.718 51.524 1.00 21.38 ? 483  LYS A CA    1 
ATOM   4003 C  C     . LYS A 1 483 ? -13.048 -17.098 51.473 1.00 21.79 ? 483  LYS A C     1 
ATOM   4004 O  O     . LYS A 1 483 ? -12.429 -18.105 51.843 1.00 21.28 ? 483  LYS A O     1 
ATOM   4005 C  CB    . LYS A 1 483 ? -12.805 -14.950 52.781 1.00 23.61 ? 483  LYS A CB    1 
ATOM   4006 C  CG    . LYS A 1 483 ? -12.488 -15.647 54.085 1.00 27.66 ? 483  LYS A CG    1 
ATOM   4007 C  CD    . LYS A 1 483 ? -12.860 -14.750 55.256 1.00 32.85 ? 483  LYS A CD    1 
ATOM   4008 C  CE    . LYS A 1 483 ? -12.356 -15.311 56.567 1.00 36.76 ? 483  LYS A CE    1 
ATOM   4009 N  NZ    . LYS A 1 483 ? -12.626 -14.361 57.680 1.00 39.46 ? 483  LYS A NZ    1 
ATOM   4010 N  N     . GLU A 1 484 ? -14.298 -17.137 51.010 1.00 21.13 ? 484  GLU A N     1 
ATOM   4011 C  CA    . GLU A 1 484 ? -15.044 -18.396 50.860 1.00 21.67 ? 484  GLU A CA    1 
ATOM   4012 C  C     . GLU A 1 484 ? -14.302 -19.365 49.932 1.00 19.72 ? 484  GLU A C     1 
ATOM   4013 O  O     . GLU A 1 484 ? -14.077 -20.537 50.275 1.00 18.87 ? 484  GLU A O     1 
ATOM   4014 C  CB    . GLU A 1 484 ? -16.459 -18.132 50.324 1.00 23.89 ? 484  GLU A CB    1 
ATOM   4015 C  CG    . GLU A 1 484 ? -17.293 -19.401 50.119 1.00 30.21 ? 484  GLU A CG    1 
ATOM   4016 C  CD    . GLU A 1 484 ? -18.645 -19.157 49.443 1.00 36.47 ? 484  GLU A CD    1 
ATOM   4017 O  OE1   . GLU A 1 484 ? -19.038 -17.984 49.246 1.00 37.67 ? 484  GLU A OE1   1 
ATOM   4018 O  OE2   . GLU A 1 484 ? -19.322 -20.156 49.109 1.00 36.00 ? 484  GLU A OE2   1 
ATOM   4019 N  N     . HIS A 1 485 ? -13.924 -18.866 48.761 1.00 19.18 ? 485  HIS A N     1 
ATOM   4020 C  CA    . HIS A 1 485 ? -13.222 -19.680 47.773 1.00 18.32 ? 485  HIS A CA    1 
ATOM   4021 C  C     . HIS A 1 485 ? -11.822 -20.082 48.203 1.00 17.30 ? 485  HIS A C     1 
ATOM   4022 O  O     . HIS A 1 485 ? -11.385 -21.195 47.900 1.00 17.18 ? 485  HIS A O     1 
ATOM   4023 C  CB    . HIS A 1 485 ? -13.186 -18.975 46.423 1.00 17.31 ? 485  HIS A CB    1 
ATOM   4024 C  CG    . HIS A 1 485 ? -14.522 -18.907 45.754 1.00 19.31 ? 485  HIS A CG    1 
ATOM   4025 N  ND1   . HIS A 1 485 ? -15.118 -20.006 45.174 1.00 19.41 ? 485  HIS A ND1   1 
ATOM   4026 C  CD2   . HIS A 1 485 ? -15.377 -17.873 45.573 1.00 20.73 ? 485  HIS A CD2   1 
ATOM   4027 C  CE1   . HIS A 1 485 ? -16.283 -19.651 44.662 1.00 22.79 ? 485  HIS A CE1   1 
ATOM   4028 N  NE2   . HIS A 1 485 ? -16.465 -18.362 44.891 1.00 22.83 ? 485  HIS A NE2   1 
ATOM   4029 N  N     . LYS A 1 486 ? -11.111 -19.186 48.889 1.00 17.43 ? 486  LYS A N     1 
ATOM   4030 C  CA    . LYS A 1 486 ? -9.794  -19.541 49.414 1.00 16.87 ? 486  LYS A CA    1 
ATOM   4031 C  C     . LYS A 1 486 ? -9.914  -20.675 50.437 1.00 15.56 ? 486  LYS A C     1 
ATOM   4032 O  O     . LYS A 1 486 ? -9.036  -21.534 50.515 1.00 16.16 ? 486  LYS A O     1 
ATOM   4033 C  CB    . LYS A 1 486 ? -9.050  -18.341 50.011 1.00 19.49 ? 486  LYS A CB    1 
ATOM   4034 C  CG    . LYS A 1 486 ? -7.682  -18.729 50.581 1.00 20.61 ? 486  LYS A CG    1 
ATOM   4035 C  CD    . LYS A 1 486 ? -6.749  -17.551 50.782 1.00 23.61 ? 486  LYS A CD    1 
ATOM   4036 C  CE    . LYS A 1 486 ? -5.410  -18.039 51.330 1.00 26.19 ? 486  LYS A CE    1 
ATOM   4037 N  NZ    . LYS A 1 486 ? -4.572  -16.935 51.870 1.00 27.05 ? 486  LYS A NZ    1 
ATOM   4038 N  N     . GLY A 1 487 ? -10.995 -20.666 51.216 1.00 16.03 ? 487  GLY A N     1 
ATOM   4039 C  CA    . GLY A 1 487 ? -11.311 -21.770 52.125 1.00 17.17 ? 487  GLY A CA    1 
ATOM   4040 C  C     . GLY A 1 487 ? -11.429 -23.107 51.409 1.00 17.82 ? 487  GLY A C     1 
ATOM   4041 O  O     . GLY A 1 487 ? -10.873 -24.113 51.863 1.00 18.62 ? 487  GLY A O     1 
ATOM   4042 N  N     . TYR A 1 488 ? -12.143 -23.118 50.282 1.00 16.12 ? 488  TYR A N     1 
ATOM   4043 C  CA    . TYR A 1 488 ? -12.301 -24.332 49.485 1.00 16.98 ? 488  TYR A CA    1 
ATOM   4044 C  C     . TYR A 1 488 ? -10.968 -24.787 48.899 1.00 17.15 ? 488  TYR A C     1 
ATOM   4045 O  O     . TYR A 1 488 ? -10.694 -25.991 48.832 1.00 16.01 ? 488  TYR A O     1 
ATOM   4046 C  CB    . TYR A 1 488 ? -13.301 -24.136 48.341 1.00 16.56 ? 488  TYR A CB    1 
ATOM   4047 C  CG    . TYR A 1 488 ? -14.703 -23.729 48.756 1.00 19.20 ? 488  TYR A CG    1 
ATOM   4048 C  CD1   . TYR A 1 488 ? -15.263 -24.167 49.960 1.00 18.27 ? 488  TYR A CD1   1 
ATOM   4049 C  CD2   . TYR A 1 488 ? -15.478 -22.924 47.926 1.00 21.34 ? 488  TYR A CD2   1 
ATOM   4050 C  CE1   . TYR A 1 488 ? -16.561 -23.794 50.332 1.00 21.71 ? 488  TYR A CE1   1 
ATOM   4051 C  CE2   . TYR A 1 488 ? -16.769 -22.552 48.281 1.00 23.66 ? 488  TYR A CE2   1 
ATOM   4052 C  CZ    . TYR A 1 488 ? -17.303 -22.989 49.485 1.00 25.58 ? 488  TYR A CZ    1 
ATOM   4053 O  OH    . TYR A 1 488 ? -18.582 -22.617 49.832 1.00 26.43 ? 488  TYR A OH    1 
ATOM   4054 N  N     . MET A 1 489 ? -10.152 -23.819 48.480 1.00 15.65 ? 489  MET A N     1 
ATOM   4055 C  CA    . MET A 1 489 ? -8.856  -24.106 47.880 1.00 16.72 ? 489  MET A CA    1 
ATOM   4056 C  C     . MET A 1 489 ? -7.937  -24.779 48.885 1.00 17.47 ? 489  MET A C     1 
ATOM   4057 O  O     . MET A 1 489 ? -7.309  -25.782 48.566 1.00 17.07 ? 489  MET A O     1 
ATOM   4058 C  CB    . MET A 1 489 ? -8.199  -22.833 47.335 1.00 16.82 ? 489  MET A CB    1 
ATOM   4059 C  CG    . MET A 1 489 ? -6.847  -23.082 46.682 1.00 19.14 ? 489  MET A CG    1 
ATOM   4060 S  SD    . MET A 1 489 ? -5.875  -21.587 46.383 1.00 23.02 ? 489  MET A SD    1 
ATOM   4061 C  CE    . MET A 1 489 ? -5.344  -21.198 48.062 1.00 21.49 ? 489  MET A CE    1 
ATOM   4062 N  N     . LEU A 1 490 ? -7.872  -24.227 50.097 1.00 16.23 ? 490  LEU A N     1 
ATOM   4063 C  CA    . LEU A 1 490 ? -6.994  -24.765 51.133 1.00 16.85 ? 490  LEU A CA    1 
ATOM   4064 C  C     . LEU A 1 490 ? -7.459  -26.122 51.647 1.00 15.59 ? 490  LEU A C     1 
ATOM   4065 O  O     . LEU A 1 490 ? -6.631  -26.992 51.916 1.00 15.47 ? 490  LEU A O     1 
ATOM   4066 C  CB    . LEU A 1 490 ? -6.806  -23.772 52.286 1.00 18.36 ? 490  LEU A CB    1 
ATOM   4067 C  CG    . LEU A 1 490 ? -6.018  -22.495 51.956 1.00 20.03 ? 490  LEU A CG    1 
ATOM   4068 C  CD1   . LEU A 1 490 ? -6.075  -21.523 53.132 1.00 22.58 ? 490  LEU A CD1   1 
ATOM   4069 C  CD2   . LEU A 1 490 ? -4.564  -22.793 51.571 1.00 23.06 ? 490  LEU A CD2   1 
ATOM   4070 N  N     . ALA A 1 491 ? -8.773  -26.313 51.756 1.00 15.21 ? 491  ALA A N     1 
ATOM   4071 C  CA    . ALA A 1 491 ? -9.325  -27.630 52.089 1.00 16.84 ? 491  ALA A CA    1 
ATOM   4072 C  C     . ALA A 1 491 ? -8.910  -28.683 51.067 1.00 16.96 ? 491  ALA A C     1 
ATOM   4073 O  O     . ALA A 1 491 ? -8.478  -29.779 51.445 1.00 16.56 ? 491  ALA A O     1 
ATOM   4074 C  CB    . ALA A 1 491 ? -10.845 -27.571 52.215 1.00 17.99 ? 491  ALA A CB    1 
ATOM   4075 N  N     . ALA A 1 492 ? -9.009  -28.347 49.779 1.00 16.64 ? 492  ALA A N     1 
ATOM   4076 C  CA    . ALA A 1 492 ? -8.631  -29.285 48.713 1.00 17.62 ? 492  ALA A CA    1 
ATOM   4077 C  C     . ALA A 1 492 ? -7.136  -29.605 48.760 1.00 17.79 ? 492  ALA A C     1 
ATOM   4078 O  O     . ALA A 1 492 ? -6.717  -30.744 48.521 1.00 17.70 ? 492  ALA A O     1 
ATOM   4079 C  CB    . ALA A 1 492 ? -9.025  -28.739 47.352 1.00 15.10 ? 492  ALA A CB    1 
ATOM   4080 N  N     . GLN A 1 493 ? -6.343  -28.586 49.076 1.00 18.43 ? 493  GLN A N     1 
ATOM   4081 C  CA    . GLN A 1 493 ? -4.913  -28.746 49.281 1.00 18.88 ? 493  GLN A CA    1 
ATOM   4082 C  C     . GLN A 1 493 ? -4.608  -29.712 50.433 1.00 18.78 ? 493  GLN A C     1 
ATOM   4083 O  O     . GLN A 1 493 ? -3.806  -30.636 50.272 1.00 17.06 ? 493  GLN A O     1 
ATOM   4084 C  CB    . GLN A 1 493 ? -4.285  -27.379 49.545 1.00 19.88 ? 493  GLN A CB    1 
ATOM   4085 C  CG    . GLN A 1 493 ? -2.794  -27.313 49.361 1.00 22.57 ? 493  GLN A CG    1 
ATOM   4086 C  CD    . GLN A 1 493 ? -2.284  -25.916 49.595 1.00 27.82 ? 493  GLN A CD    1 
ATOM   4087 O  OE1   . GLN A 1 493 ? -2.130  -25.491 50.736 1.00 25.90 ? 493  GLN A OE1   1 
ATOM   4088 N  NE2   . GLN A 1 493 ? -2.036  -25.182 48.508 1.00 28.66 ? 493  GLN A NE2   1 
ATOM   4089 N  N     . ARG A 1 494 ? -5.243  -29.497 51.588 1.00 16.26 ? 494  ARG A N     1 
ATOM   4090 C  CA    . ARG A 1 494 ? -5.057  -30.377 52.747 1.00 17.10 ? 494  ARG A CA    1 
ATOM   4091 C  C     . ARG A 1 494 ? -5.518  -31.799 52.426 1.00 17.41 ? 494  ARG A C     1 
ATOM   4092 O  O     . ARG A 1 494 ? -4.849  -32.778 52.790 1.00 17.41 ? 494  ARG A O     1 
ATOM   4093 C  CB    . ARG A 1 494 ? -5.788  -29.833 53.982 1.00 18.27 ? 494  ARG A CB    1 
ATOM   4094 C  CG    . ARG A 1 494 ? -5.203  -28.517 54.496 1.00 19.28 ? 494  ARG A CG    1 
ATOM   4095 C  CD    . ARG A 1 494 ? -5.862  -28.052 55.785 1.00 21.28 ? 494  ARG A CD    1 
ATOM   4096 N  NE    . ARG A 1 494 ? -7.297  -27.784 55.649 1.00 20.48 ? 494  ARG A NE    1 
ATOM   4097 C  CZ    . ARG A 1 494 ? -7.831  -26.579 55.451 1.00 21.46 ? 494  ARG A CZ    1 
ATOM   4098 N  NH1   . ARG A 1 494 ? -7.056  -25.506 55.324 1.00 18.27 ? 494  ARG A NH1   1 
ATOM   4099 N  NH2   . ARG A 1 494 ? -9.153  -26.448 55.369 1.00 22.53 ? 494  ARG A NH2   1 
ATOM   4100 N  N     . ASN A 1 495 ? -6.644  -31.901 51.721 1.00 15.75 ? 495  ASN A N     1 
ATOM   4101 C  CA    . ASN A 1 495 ? -7.177  -33.193 51.294 1.00 17.18 ? 495  ASN A CA    1 
ATOM   4102 C  C     . ASN A 1 495 ? -6.206  -33.933 50.378 1.00 17.77 ? 495  ASN A C     1 
ATOM   4103 O  O     . ASN A 1 495 ? -6.031  -35.147 50.498 1.00 16.90 ? 495  ASN A O     1 
ATOM   4104 C  CB    . ASN A 1 495 ? -8.548  -33.024 50.624 1.00 17.56 ? 495  ASN A CB    1 
ATOM   4105 C  CG    . ASN A 1 495 ? -9.670  -32.748 51.629 1.00 17.27 ? 495  ASN A CG    1 
ATOM   4106 O  OD1   . ASN A 1 495 ? -9.580  -33.114 52.798 1.00 18.91 ? 495  ASN A OD1   1 
ATOM   4107 N  ND2   . ASN A 1 495 ? -10.738 -32.116 51.162 1.00 17.95 ? 495  ASN A ND2   1 
ATOM   4108 N  N     . GLY A 1 496 ? -5.558  -33.188 49.481 1.00 17.53 ? 496  GLY A N     1 
ATOM   4109 C  CA    . GLY A 1 496 ? -4.532  -33.751 48.603 1.00 18.85 ? 496  GLY A CA    1 
ATOM   4110 C  C     . GLY A 1 496 ? -3.380  -34.382 49.372 1.00 19.29 ? 496  GLY A C     1 
ATOM   4111 O  O     . GLY A 1 496 ? -2.894  -35.456 49.001 1.00 17.20 ? 496  GLY A O     1 
ATOM   4112 N  N     . GLU A 1 497 ? -2.944  -33.720 50.446 1.00 18.29 ? 497  GLU A N     1 
ATOM   4113 C  CA    . GLU A 1 497 ? -1.849  -34.243 51.278 1.00 20.39 ? 497  GLU A CA    1 
ATOM   4114 C  C     . GLU A 1 497 ? -2.227  -35.524 52.031 1.00 20.79 ? 497  GLU A C     1 
ATOM   4115 O  O     . GLU A 1 497 ? -1.382  -36.395 52.237 1.00 20.76 ? 497  GLU A O     1 
ATOM   4116 C  CB    . GLU A 1 497 ? -1.329  -33.177 52.250 1.00 20.48 ? 497  GLU A CB    1 
ATOM   4117 C  CG    . GLU A 1 497 ? -0.721  -31.945 51.576 1.00 20.57 ? 497  GLU A CG    1 
ATOM   4118 C  CD    . GLU A 1 497 ? 0.395   -32.275 50.585 1.00 22.74 ? 497  GLU A CD    1 
ATOM   4119 O  OE1   . GLU A 1 497 ? 1.331   -33.020 50.942 1.00 19.16 ? 497  GLU A OE1   1 
ATOM   4120 O  OE2   . GLU A 1 497 ? 0.341   -31.775 49.443 1.00 23.53 ? 497  GLU A OE2   1 
ATOM   4121 N  N     . ILE A 1 498 ? -3.490  -35.633 52.436 1.00 20.38 ? 498  ILE A N     1 
ATOM   4122 C  CA    . ILE A 1 498 ? -4.011  -36.861 53.046 1.00 21.34 ? 498  ILE A CA    1 
ATOM   4123 C  C     . ILE A 1 498 ? -3.863  -38.042 52.074 1.00 19.64 ? 498  ILE A C     1 
ATOM   4124 O  O     . ILE A 1 498 ? -3.414  -39.129 52.458 1.00 20.34 ? 498  ILE A O     1 
ATOM   4125 C  CB    . ILE A 1 498 ? -5.494  -36.703 53.496 1.00 21.02 ? 498  ILE A CB    1 
ATOM   4126 C  CG1   . ILE A 1 498 ? -5.599  -35.740 54.685 1.00 20.95 ? 498  ILE A CG1   1 
ATOM   4127 C  CG2   . ILE A 1 498 ? -6.110  -38.064 53.858 1.00 22.32 ? 498  ILE A CG2   1 
ATOM   4128 C  CD1   . ILE A 1 498 ? -7.025  -35.284 54.997 1.00 24.29 ? 498  ILE A CD1   1 
ATOM   4129 N  N     . ILE A 1 499 ? -4.234  -37.807 50.818 1.00 19.01 ? 499  ILE A N     1 
ATOM   4130 C  CA    . ILE A 1 499 ? -4.146  -38.816 49.759 1.00 18.93 ? 499  ILE A CA    1 
ATOM   4131 C  C     . ILE A 1 499 ? -2.690  -39.184 49.430 1.00 19.55 ? 499  ILE A C     1 
ATOM   4132 O  O     . ILE A 1 499 ? -2.352  -40.364 49.274 1.00 20.36 ? 499  ILE A O     1 
ATOM   4133 C  CB    . ILE A 1 499 ? -4.935  -38.354 48.510 1.00 18.08 ? 499  ILE A CB    1 
ATOM   4134 C  CG1   . ILE A 1 499 ? -6.429  -38.220 48.850 1.00 17.71 ? 499  ILE A CG1   1 
ATOM   4135 C  CG2   . ILE A 1 499 ? -4.740  -39.318 47.343 1.00 18.15 ? 499  ILE A CG2   1 
ATOM   4136 C  CD1   . ILE A 1 499 ? -7.205  -37.276 47.915 1.00 20.27 ? 499  ILE A CD1   1 
ATOM   4137 N  N     . LYS A 1 500 ? -1.824  -38.179 49.346 1.00 20.64 ? 500  LYS A N     1 
ATOM   4138 C  CA    . LYS A 1 500 ? -0.393  -38.418 49.157 1.00 22.60 ? 500  LYS A CA    1 
ATOM   4139 C  C     . LYS A 1 500 ? 0.196   -39.305 50.259 1.00 24.82 ? 500  LYS A C     1 
ATOM   4140 O  O     . LYS A 1 500 ? 1.017   -40.181 49.978 1.00 25.67 ? 500  LYS A O     1 
ATOM   4141 C  CB    . LYS A 1 500 ? 0.375   -37.102 49.068 1.00 22.30 ? 500  LYS A CB    1 
ATOM   4142 C  CG    . LYS A 1 500 ? 0.146   -36.332 47.780 1.00 20.31 ? 500  LYS A CG    1 
ATOM   4143 C  CD    . LYS A 1 500 ? 0.921   -35.031 47.800 1.00 22.74 ? 500  LYS A CD    1 
ATOM   4144 C  CE    . LYS A 1 500 ? 0.480   -34.094 46.690 1.00 24.52 ? 500  LYS A CE    1 
ATOM   4145 N  NZ    . LYS A 1 500 ? 1.163   -32.768 46.809 1.00 24.16 ? 500  LYS A NZ    1 
ATOM   4146 N  N     . GLU A 1 501 ? -0.231  -39.084 51.501 1.00 24.90 ? 501  GLU A N     1 
ATOM   4147 C  CA    . GLU A 1 501 ? 0.229   -39.902 52.631 1.00 28.21 ? 501  GLU A CA    1 
ATOM   4148 C  C     . GLU A 1 501 ? -0.256  -41.341 52.492 1.00 28.09 ? 501  GLU A C     1 
ATOM   4149 O  O     . GLU A 1 501 ? 0.509   -42.281 52.703 1.00 30.15 ? 501  GLU A O     1 
ATOM   4150 C  CB    . GLU A 1 501 ? -0.232  -39.319 53.972 1.00 28.95 ? 501  GLU A CB    1 
ATOM   4151 C  CG    . GLU A 1 501 ? 0.326   -37.937 54.307 1.00 32.89 ? 501  GLU A CG    1 
ATOM   4152 C  CD    . GLU A 1 501 ? 1.665   -37.963 55.036 1.00 38.67 ? 501  GLU A CD    1 
ATOM   4153 O  OE1   . GLU A 1 501 ? 2.347   -39.017 55.053 1.00 36.26 ? 501  GLU A OE1   1 
ATOM   4154 O  OE2   . GLU A 1 501 ? 2.036   -36.906 55.598 1.00 37.73 ? 501  GLU A OE2   1 
ATOM   4155 N  N     . ALA A 1 502 ? -1.524  -41.503 52.121 1.00 27.44 ? 502  ALA A N     1 
ATOM   4156 C  CA    . ALA A 1 502 ? -2.122  -42.820 51.940 1.00 27.62 ? 502  ALA A CA    1 
ATOM   4157 C  C     . ALA A 1 502 ? -1.459  -43.592 50.804 1.00 27.89 ? 502  ALA A C     1 
ATOM   4158 O  O     . ALA A 1 502 ? -1.393  -44.822 50.845 1.00 29.61 ? 502  ALA A O     1 
ATOM   4159 C  CB    . ALA A 1 502 ? -3.612  -42.696 51.691 1.00 25.99 ? 502  ALA A CB    1 
ATOM   4160 N  N     . LEU A 1 503 ? -0.976  -42.864 49.796 1.00 27.20 ? 503  LEU A N     1 
ATOM   4161 C  CA    . LEU A 1 503 ? -0.285  -43.463 48.654 1.00 28.01 ? 503  LEU A CA    1 
ATOM   4162 C  C     . LEU A 1 503 ? 1.039   -44.155 49.005 1.00 29.82 ? 503  LEU A C     1 
ATOM   4163 O  O     . LEU A 1 503 ? 1.546   -44.938 48.207 1.00 31.22 ? 503  LEU A O     1 
ATOM   4164 C  CB    . LEU A 1 503 ? -0.083  -42.439 47.529 1.00 27.08 ? 503  LEU A CB    1 
ATOM   4165 C  CG    . LEU A 1 503 ? -1.236  -42.286 46.529 1.00 26.41 ? 503  LEU A CG    1 
ATOM   4166 C  CD1   . LEU A 1 503 ? -1.140  -40.959 45.780 1.00 26.18 ? 503  LEU A CD1   1 
ATOM   4167 C  CD2   . LEU A 1 503 ? -1.291  -43.465 45.548 1.00 27.58 ? 503  LEU A CD2   1 
ATOM   4168 N  N     . HIS A 1 504 ? 1.589   -43.874 50.187 1.00 32.71 ? 504  HIS A N     1 
ATOM   4169 C  CA    . HIS A 1 504 ? 2.765   -44.605 50.684 1.00 35.84 ? 504  HIS A CA    1 
ATOM   4170 C  C     . HIS A 1 504 ? 2.429   -46.065 50.981 1.00 37.19 ? 504  HIS A C     1 
ATOM   4171 O  O     . HIS A 1 504 ? 3.313   -46.922 50.974 1.00 38.51 ? 504  HIS A O     1 
ATOM   4172 C  CB    . HIS A 1 504 ? 3.352   -43.958 51.948 1.00 37.14 ? 504  HIS A CB    1 
ATOM   4173 C  CG    . HIS A 1 504 ? 3.779   -42.534 51.768 1.00 39.65 ? 504  HIS A CG    1 
ATOM   4174 N  ND1   . HIS A 1 504 ? 4.295   -42.050 50.585 1.00 43.24 ? 504  HIS A ND1   1 
ATOM   4175 C  CD2   . HIS A 1 504 ? 3.785   -41.492 52.633 1.00 40.44 ? 504  HIS A CD2   1 
ATOM   4176 C  CE1   . HIS A 1 504 ? 4.584   -40.768 50.723 1.00 42.07 ? 504  HIS A CE1   1 
ATOM   4177 N  NE2   . HIS A 1 504 ? 4.286   -40.406 51.957 1.00 42.91 ? 504  HIS A NE2   1 
ATOM   4178 N  N     . ASN A 1 505 ? 1.153   -46.340 51.249 1.00 36.49 ? 505  ASN A N     1 
ATOM   4179 C  CA    . ASN A 1 505 ? 0.697   -47.693 51.569 1.00 37.05 ? 505  ASN A CA    1 
ATOM   4180 C  C     . ASN A 1 505 ? -0.576  -48.103 50.817 1.00 35.31 ? 505  ASN A C     1 
ATOM   4181 O  O     . ASN A 1 505 ? -1.611  -48.350 51.445 1.00 34.36 ? 505  ASN A O     1 
ATOM   4182 C  CB    . ASN A 1 505 ? 0.484   -47.834 53.081 1.00 38.45 ? 505  ASN A CB    1 
ATOM   4183 C  CG    . ASN A 1 505 ? 1.769   -47.678 53.871 1.00 43.18 ? 505  ASN A CG    1 
ATOM   4184 O  OD1   . ASN A 1 505 ? 1.933   -46.718 54.626 1.00 45.20 ? 505  ASN A OD1   1 
ATOM   4185 N  ND2   . ASN A 1 505 ? 2.690   -48.621 53.697 1.00 43.91 ? 505  ASN A ND2   1 
ATOM   4186 N  N     . PRO A 1 506 ? -0.503  -48.194 49.472 1.00 34.20 ? 506  PRO A N     1 
ATOM   4187 C  CA    . PRO A 1 506 ? -1.704  -48.522 48.700 1.00 34.46 ? 506  PRO A CA    1 
ATOM   4188 C  C     . PRO A 1 506 ? -2.106  -49.986 48.868 1.00 35.38 ? 506  PRO A C     1 
ATOM   4189 O  O     . PRO A 1 506 ? -1.242  -50.851 49.007 1.00 35.66 ? 506  PRO A O     1 
ATOM   4190 C  CB    . PRO A 1 506 ? -1.283  -48.245 47.257 1.00 34.89 ? 506  PRO A CB    1 
ATOM   4191 C  CG    . PRO A 1 506 ? 0.198   -48.411 47.242 1.00 35.13 ? 506  PRO A CG    1 
ATOM   4192 C  CD    . PRO A 1 506 ? 0.706   -48.135 48.627 1.00 35.08 ? 506  PRO A CD    1 
ATOM   4193 N  N     . ASN A 1 507 ? -3.407  -50.258 48.865 1.00 35.48 ? 507  ASN A N     1 
ATOM   4194 C  CA    . ASN A 1 507 ? -3.885  -51.626 49.048 1.00 35.22 ? 507  ASN A CA    1 
ATOM   4195 C  C     . ASN A 1 507 ? -3.948  -52.397 47.741 1.00 36.04 ? 507  ASN A C     1 
ATOM   4196 O  O     . ASN A 1 507 ? -4.219  -51.830 46.678 1.00 33.57 ? 507  ASN A O     1 
ATOM   4197 C  CB    . ASN A 1 507 ? -5.243  -51.658 49.754 1.00 35.69 ? 507  ASN A CB    1 
ATOM   4198 C  CG    . ASN A 1 507 ? -5.167  -51.166 51.186 1.00 36.81 ? 507  ASN A CG    1 
ATOM   4199 O  OD1   . ASN A 1 507 ? -4.785  -50.022 51.439 1.00 35.19 ? 507  ASN A OD1   1 
ATOM   4200 N  ND2   . ASN A 1 507 ? -5.542  -52.026 52.134 1.00 34.59 ? 507  ASN A ND2   1 
ATOM   4201 N  N     . LEU A 1 508 ? -3.683  -53.697 47.829 1.00 36.57 ? 508  LEU A N     1 
ATOM   4202 C  CA    . LEU A 1 508 ? -3.740  -54.565 46.665 1.00 38.40 ? 508  LEU A CA    1 
ATOM   4203 C  C     . LEU A 1 508 ? -5.166  -55.067 46.495 1.00 39.62 ? 508  LEU A C     1 
ATOM   4204 O  O     . LEU A 1 508 ? -5.534  -56.138 46.988 1.00 39.88 ? 508  LEU A O     1 
ATOM   4205 C  CB    . LEU A 1 508 ? -2.722  -55.706 46.787 1.00 39.18 ? 508  LEU A CB    1 
ATOM   4206 C  CG    . LEU A 1 508 ? -1.260  -55.238 46.839 1.00 40.48 ? 508  LEU A CG    1 
ATOM   4207 C  CD1   . LEU A 1 508 ? -0.336  -56.356 47.293 1.00 41.37 ? 508  LEU A CD1   1 
ATOM   4208 C  CD2   . LEU A 1 508 ? -0.801  -54.681 45.492 1.00 43.01 ? 508  LEU A CD2   1 
ATOM   4209 N  N     . SER A 1 509 ? -5.971  -54.256 45.812 1.00 39.76 ? 509  SER A N     1 
ATOM   4210 C  CA    . SER A 1 509 ? -7.386  -54.545 45.599 1.00 41.53 ? 509  SER A CA    1 
ATOM   4211 C  C     . SER A 1 509 ? -7.911  -53.820 44.365 1.00 41.34 ? 509  SER A C     1 
ATOM   4212 O  O     . SER A 1 509 ? -7.234  -52.959 43.803 1.00 40.42 ? 509  SER A O     1 
ATOM   4213 C  CB    . SER A 1 509 ? -8.207  -54.153 46.834 1.00 42.20 ? 509  SER A CB    1 
ATOM   4214 O  OG    . SER A 1 509 ? -8.111  -52.763 47.091 1.00 45.97 ? 509  SER A OG    1 
ATOM   4215 N  N     . VAL A 1 510 ? -9.114  -54.191 43.937 1.00 42.21 ? 510  VAL A N     1 
ATOM   4216 C  CA    . VAL A 1 510 ? -9.799  -53.470 42.871 1.00 42.40 ? 510  VAL A CA    1 
ATOM   4217 C  C     . VAL A 1 510 ? -11.000 -52.765 43.485 1.00 41.77 ? 510  VAL A C     1 
ATOM   4218 O  O     . VAL A 1 510 ? -11.871 -53.403 44.086 1.00 42.63 ? 510  VAL A O     1 
ATOM   4219 C  CB    . VAL A 1 510 ? -10.216 -54.395 41.698 1.00 43.99 ? 510  VAL A CB    1 
ATOM   4220 C  CG1   . VAL A 1 510 ? -10.932 -53.599 40.612 1.00 44.36 ? 510  VAL A CG1   1 
ATOM   4221 C  CG2   . VAL A 1 510 ? -8.997  -55.081 41.109 1.00 44.69 ? 510  VAL A CG2   1 
ATOM   4222 N  N     . ASP A 1 511 ? -11.015 -51.440 43.351 1.00 39.92 ? 511  ASP A N     1 
ATOM   4223 C  CA    . ASP A 1 511 ? -12.042 -50.598 43.954 1.00 38.36 ? 511  ASP A CA    1 
ATOM   4224 C  C     . ASP A 1 511 ? -12.279 -49.328 43.135 1.00 38.35 ? 511  ASP A C     1 
ATOM   4225 O  O     . ASP A 1 511 ? -11.776 -49.193 42.014 1.00 38.98 ? 511  ASP A O     1 
ATOM   4226 C  CB    . ASP A 1 511 ? -11.663 -50.245 45.400 1.00 36.36 ? 511  ASP A CB    1 
ATOM   4227 C  CG    . ASP A 1 511 ? -10.221 -49.756 45.533 1.00 34.70 ? 511  ASP A CG    1 
ATOM   4228 O  OD1   . ASP A 1 511 ? -9.691  -49.126 44.590 1.00 34.95 ? 511  ASP A OD1   1 
ATOM   4229 O  OD2   . ASP A 1 511 ? -9.613  -50.003 46.590 1.00 33.79 ? 511  ASP A OD2   1 
ATOM   4230 N  N     . GLU A 1 512 ? -13.048 -48.405 43.706 1.00 37.45 ? 512  GLU A N     1 
ATOM   4231 C  CA    . GLU A 1 512 ? -13.380 -47.146 43.052 1.00 36.62 ? 512  GLU A CA    1 
ATOM   4232 C  C     . GLU A 1 512 ? -12.924 -45.955 43.899 1.00 33.98 ? 512  GLU A C     1 
ATOM   4233 O  O     . GLU A 1 512 ? -12.796 -46.078 45.121 1.00 32.27 ? 512  GLU A O     1 
ATOM   4234 C  CB    . GLU A 1 512 ? -14.889 -47.061 42.793 1.00 39.41 ? 512  GLU A CB    1 
ATOM   4235 C  CG    . GLU A 1 512 ? -15.437 -48.109 41.815 1.00 45.65 ? 512  GLU A CG    1 
ATOM   4236 C  CD    . GLU A 1 512 ? -15.200 -47.755 40.348 1.00 52.62 ? 512  GLU A CD    1 
ATOM   4237 O  OE1   . GLU A 1 512 ? -16.200 -47.561 39.621 1.00 56.40 ? 512  GLU A OE1   1 
ATOM   4238 O  OE2   . GLU A 1 512 ? -14.027 -47.672 39.917 1.00 53.43 ? 512  GLU A OE2   1 
ATOM   4239 N  N     . PRO A 1 513 ? -12.655 -44.803 43.252 1.00 32.84 ? 513  PRO A N     1 
ATOM   4240 C  CA    . PRO A 1 513 ? -12.453 -43.584 44.034 1.00 31.35 ? 513  PRO A CA    1 
ATOM   4241 C  C     . PRO A 1 513 ? -13.736 -43.236 44.788 1.00 30.92 ? 513  PRO A C     1 
ATOM   4242 O  O     . PRO A 1 513 ? -14.837 -43.503 44.290 1.00 31.65 ? 513  PRO A O     1 
ATOM   4243 C  CB    . PRO A 1 513 ? -12.151 -42.525 42.967 1.00 31.74 ? 513  PRO A CB    1 
ATOM   4244 C  CG    . PRO A 1 513 ? -12.645 -43.100 41.677 1.00 31.85 ? 513  PRO A CG    1 
ATOM   4245 C  CD    . PRO A 1 513 ? -12.446 -44.572 41.811 1.00 32.78 ? 513  PRO A CD    1 
ATOM   4246 N  N     . LEU A 1 514 ? -13.589 -42.671 45.985 1.00 29.05 ? 514  LEU A N     1 
ATOM   4247 C  CA    . LEU A 1 514 ? -14.727 -42.261 46.806 1.00 30.54 ? 514  LEU A CA    1 
ATOM   4248 C  C     . LEU A 1 514 ? -15.416 -41.038 46.215 1.00 30.58 ? 514  LEU A C     1 
ATOM   4249 O  O     . LEU A 1 514 ? -14.751 -40.125 45.720 1.00 30.16 ? 514  LEU A O     1 
ATOM   4250 C  CB    . LEU A 1 514 ? -14.259 -41.926 48.223 1.00 31.70 ? 514  LEU A CB    1 
ATOM   4251 C  CG    . LEU A 1 514 ? -14.210 -42.966 49.345 1.00 34.59 ? 514  LEU A CG    1 
ATOM   4252 C  CD1   . LEU A 1 514 ? -13.845 -44.381 48.884 1.00 36.80 ? 514  LEU A CD1   1 
ATOM   4253 C  CD2   . LEU A 1 514 ? -13.256 -42.476 50.423 1.00 33.18 ? 514  LEU A CD2   1 
ATOM   4254 N  N     . ASP A 1 515 ? -16.745 -41.023 46.277 1.00 30.87 ? 515  ASP A N     1 
ATOM   4255 C  CA    . ASP A 1 515 ? -17.527 -39.865 45.848 1.00 32.50 ? 515  ASP A CA    1 
ATOM   4256 C  C     . ASP A 1 515 ? -17.557 -38.834 46.978 1.00 31.37 ? 515  ASP A C     1 
ATOM   4257 O  O     . ASP A 1 515 ? -18.335 -38.959 47.931 1.00 32.24 ? 515  ASP A O     1 
ATOM   4258 C  CB    . ASP A 1 515 ? -18.948 -40.292 45.455 1.00 36.00 ? 515  ASP A CB    1 
ATOM   4259 C  CG    . ASP A 1 515 ? -19.713 -39.202 44.713 1.00 41.41 ? 515  ASP A CG    1 
ATOM   4260 O  OD1   . ASP A 1 515 ? -20.951 -39.338 44.585 1.00 45.22 ? 515  ASP A OD1   1 
ATOM   4261 O  OD2   . ASP A 1 515 ? -19.089 -38.217 44.254 1.00 44.25 ? 515  ASP A OD2   1 
ATOM   4262 N  N     . VAL A 1 516 ? -16.694 -37.826 46.873 1.00 28.66 ? 516  VAL A N     1 
ATOM   4263 C  CA    . VAL A 1 516 ? -16.533 -36.828 47.935 1.00 27.22 ? 516  VAL A CA    1 
ATOM   4264 C  C     . VAL A 1 516 ? -16.470 -35.397 47.392 1.00 25.59 ? 516  VAL A C     1 
ATOM   4265 O  O     . VAL A 1 516 ? -16.159 -35.181 46.216 1.00 24.85 ? 516  VAL A O     1 
ATOM   4266 C  CB    . VAL A 1 516 ? -15.268 -37.104 48.804 1.00 27.93 ? 516  VAL A CB    1 
ATOM   4267 C  CG1   . VAL A 1 516 ? -15.415 -38.405 49.589 1.00 29.98 ? 516  VAL A CG1   1 
ATOM   4268 C  CG2   . VAL A 1 516 ? -13.998 -37.130 47.948 1.00 28.08 ? 516  VAL A CG2   1 
ATOM   4269 N  N     . ASP A 1 517 ? -16.768 -34.430 48.257 1.00 23.15 ? 517  ASP A N     1 
ATOM   4270 C  CA    . ASP A 1 517 ? -16.580 -33.013 47.943 1.00 23.42 ? 517  ASP A CA    1 
ATOM   4271 C  C     . ASP A 1 517 ? -15.228 -32.552 48.488 1.00 21.89 ? 517  ASP A C     1 
ATOM   4272 O  O     . ASP A 1 517 ? -15.045 -32.416 49.701 1.00 21.44 ? 517  ASP A O     1 
ATOM   4273 C  CB    . ASP A 1 517 ? -17.723 -32.176 48.527 1.00 24.24 ? 517  ASP A CB    1 
ATOM   4274 C  CG    . ASP A 1 517 ? -17.725 -30.729 48.020 1.00 22.97 ? 517  ASP A CG    1 
ATOM   4275 O  OD1   . ASP A 1 517 ? -18.779 -30.078 48.145 1.00 24.90 ? 517  ASP A OD1   1 
ATOM   4276 O  OD2   . ASP A 1 517 ? -16.695 -30.239 47.508 1.00 20.92 ? 517  ASP A OD2   1 
ATOM   4277 N  N     . TYR A 1 518 ? -14.285 -32.320 47.579 1.00 20.02 ? 518  TYR A N     1 
ATOM   4278 C  CA    . TYR A 1 518 ? -12.906 -32.010 47.953 1.00 18.56 ? 518  TYR A CA    1 
ATOM   4279 C  C     . TYR A 1 518 ? -12.725 -30.607 48.526 1.00 17.85 ? 518  TYR A C     1 
ATOM   4280 O  O     . TYR A 1 518 ? -11.656 -30.289 49.047 1.00 17.88 ? 518  TYR A O     1 
ATOM   4281 C  CB    . TYR A 1 518 ? -11.977 -32.209 46.755 1.00 18.87 ? 518  TYR A CB    1 
ATOM   4282 C  CG    . TYR A 1 518 ? -11.889 -33.637 46.279 1.00 17.55 ? 518  TYR A CG    1 
ATOM   4283 C  CD1   . TYR A 1 518 ? -12.715 -34.106 45.259 1.00 18.09 ? 518  TYR A CD1   1 
ATOM   4284 C  CD2   . TYR A 1 518 ? -10.974 -34.523 46.848 1.00 19.55 ? 518  TYR A CD2   1 
ATOM   4285 C  CE1   . TYR A 1 518 ? -12.639 -35.422 44.825 1.00 20.58 ? 518  TYR A CE1   1 
ATOM   4286 C  CE2   . TYR A 1 518 ? -10.885 -35.838 46.414 1.00 20.62 ? 518  TYR A CE2   1 
ATOM   4287 C  CZ    . TYR A 1 518 ? -11.718 -36.278 45.403 1.00 20.46 ? 518  TYR A CZ    1 
ATOM   4288 O  OH    . TYR A 1 518 ? -11.633 -37.582 44.980 1.00 22.49 ? 518  TYR A OH    1 
ATOM   4289 N  N     . ARG A 1 519 ? -13.769 -29.782 48.431 1.00 16.83 ? 519  ARG A N     1 
ATOM   4290 C  CA    . ARG A 1 519 ? -13.756 -28.422 48.976 1.00 17.74 ? 519  ARG A CA    1 
ATOM   4291 C  C     . ARG A 1 519 ? -13.876 -28.389 50.498 1.00 19.94 ? 519  ARG A C     1 
ATOM   4292 O  O     . ARG A 1 519 ? -13.749 -27.322 51.107 1.00 18.91 ? 519  ARG A O     1 
ATOM   4293 C  CB    . ARG A 1 519 ? -14.891 -27.588 48.375 1.00 18.25 ? 519  ARG A CB    1 
ATOM   4294 C  CG    . ARG A 1 519 ? -14.847 -27.423 46.859 1.00 19.61 ? 519  ARG A CG    1 
ATOM   4295 C  CD    . ARG A 1 519 ? -16.076 -26.655 46.372 1.00 19.85 ? 519  ARG A CD    1 
ATOM   4296 N  NE    . ARG A 1 519 ? -17.305 -27.338 46.778 1.00 22.62 ? 519  ARG A NE    1 
ATOM   4297 C  CZ    . ARG A 1 519 ? -18.513 -26.785 46.798 1.00 27.71 ? 519  ARG A CZ    1 
ATOM   4298 N  NH1   . ARG A 1 519 ? -18.684 -25.517 46.434 1.00 26.18 ? 519  ARG A NH1   1 
ATOM   4299 N  NH2   . ARG A 1 519 ? -19.553 -27.506 47.196 1.00 26.98 ? 519  ARG A NH2   1 
ATOM   4300 N  N     . PHE A 1 520 ? -14.128 -29.551 51.103 1.00 20.23 ? 520  PHE A N     1 
ATOM   4301 C  CA    . PHE A 1 520 ? -14.291 -29.651 52.551 1.00 21.03 ? 520  PHE A CA    1 
ATOM   4302 C  C     . PHE A 1 520 ? -13.346 -30.696 53.138 1.00 19.78 ? 520  PHE A C     1 
ATOM   4303 O  O     . PHE A 1 520 ? -13.131 -31.748 52.539 1.00 19.24 ? 520  PHE A O     1 
ATOM   4304 C  CB    . PHE A 1 520 ? -15.753 -29.962 52.898 1.00 21.93 ? 520  PHE A CB    1 
ATOM   4305 C  CG    . PHE A 1 520 ? -16.708 -28.876 52.475 1.00 24.59 ? 520  PHE A CG    1 
ATOM   4306 C  CD1   . PHE A 1 520 ? -16.864 -27.727 53.251 1.00 26.87 ? 520  PHE A CD1   1 
ATOM   4307 C  CD2   . PHE A 1 520 ? -17.421 -28.983 51.282 1.00 27.11 ? 520  PHE A CD2   1 
ATOM   4308 C  CE1   . PHE A 1 520 ? -17.731 -26.703 52.851 1.00 28.60 ? 520  PHE A CE1   1 
ATOM   4309 C  CE2   . PHE A 1 520 ? -18.291 -27.969 50.875 1.00 27.75 ? 520  PHE A CE2   1 
ATOM   4310 C  CZ    . PHE A 1 520 ? -18.445 -26.827 51.661 1.00 27.39 ? 520  PHE A CZ    1 
ATOM   4311 N  N     . ASP A 1 521 ? -12.762 -30.390 54.296 1.00 19.90 ? 521  ASP A N     1 
ATOM   4312 C  CA    . ASP A 1 521 ? -11.822 -31.310 54.939 1.00 21.02 ? 521  ASP A CA    1 
ATOM   4313 C  C     . ASP A 1 521 ? -12.448 -32.681 55.137 1.00 21.56 ? 521  ASP A C     1 
ATOM   4314 O  O     . ASP A 1 521 ? -13.571 -32.799 55.645 1.00 20.01 ? 521  ASP A O     1 
ATOM   4315 C  CB    . ASP A 1 521 ? -11.327 -30.755 56.273 1.00 22.50 ? 521  ASP A CB    1 
ATOM   4316 C  CG    . ASP A 1 521 ? -10.381 -29.590 56.093 1.00 26.89 ? 521  ASP A CG    1 
ATOM   4317 O  OD1   . ASP A 1 521 ? -9.262  -29.807 55.582 1.00 25.89 ? 521  ASP A OD1   1 
ATOM   4318 O  OD2   . ASP A 1 521 ? -10.758 -28.459 56.460 1.00 27.57 ? 521  ASP A OD2   1 
ATOM   4319 N  N     . PHE A 1 522 ? -11.717 -33.710 54.716 1.00 19.91 ? 522  PHE A N     1 
ATOM   4320 C  CA    . PHE A 1 522 ? -12.185 -35.091 54.812 1.00 20.28 ? 522  PHE A CA    1 
ATOM   4321 C  C     . PHE A 1 522 ? -12.552 -35.452 56.238 1.00 22.20 ? 522  PHE A C     1 
ATOM   4322 O  O     . PHE A 1 522 ? -11.790 -35.190 57.175 1.00 21.22 ? 522  PHE A O     1 
ATOM   4323 C  CB    . PHE A 1 522 ? -11.117 -36.075 54.324 1.00 18.85 ? 522  PHE A CB    1 
ATOM   4324 C  CG    . PHE A 1 522 ? -10.887 -36.064 52.834 1.00 20.23 ? 522  PHE A CG    1 
ATOM   4325 C  CD1   . PHE A 1 522 ? -11.870 -35.625 51.952 1.00 20.21 ? 522  PHE A CD1   1 
ATOM   4326 C  CD2   . PHE A 1 522 ? -9.684  -36.534 52.317 1.00 21.35 ? 522  PHE A CD2   1 
ATOM   4327 C  CE1   . PHE A 1 522 ? -11.648 -35.629 50.571 1.00 19.40 ? 522  PHE A CE1   1 
ATOM   4328 C  CE2   . PHE A 1 522 ? -9.451  -36.549 50.940 1.00 21.13 ? 522  PHE A CE2   1 
ATOM   4329 C  CZ    . PHE A 1 522 ? -10.435 -36.097 50.066 1.00 19.97 ? 522  PHE A CZ    1 
ATOM   4330 N  N     . SER A 1 523 ? -13.728 -36.056 56.391 1.00 21.45 ? 523  SER A N     1 
ATOM   4331 C  CA    . SER A 1 523 ? -14.171 -36.594 57.674 1.00 22.88 ? 523  SER A CA    1 
ATOM   4332 C  C     . SER A 1 523 ? -13.317 -37.791 58.093 1.00 23.38 ? 523  SER A C     1 
ATOM   4333 O  O     . SER A 1 523 ? -12.572 -38.352 57.282 1.00 22.76 ? 523  SER A O     1 
ATOM   4334 C  CB    . SER A 1 523 ? -15.632 -37.034 57.567 1.00 22.35 ? 523  SER A CB    1 
ATOM   4335 O  OG    . SER A 1 523 ? -15.736 -38.177 56.735 1.00 22.92 ? 523  SER A OG    1 
ATOM   4336 N  N     . ASP A 1 524 ? -13.447 -38.197 59.356 1.00 24.89 ? 524  ASP A N     1 
ATOM   4337 C  CA    . ASP A 1 524 ? -12.749 -39.383 59.854 1.00 27.08 ? 524  ASP A CA    1 
ATOM   4338 C  C     . ASP A 1 524 ? -13.128 -40.638 59.074 1.00 27.51 ? 524  ASP A C     1 
ATOM   4339 O  O     . ASP A 1 524 ? -12.277 -41.488 58.824 1.00 27.17 ? 524  ASP A O     1 
ATOM   4340 C  CB    . ASP A 1 524 ? -13.013 -39.589 61.350 1.00 29.00 ? 524  ASP A CB    1 
ATOM   4341 C  CG    . ASP A 1 524 ? -12.367 -38.515 62.212 1.00 33.14 ? 524  ASP A CG    1 
ATOM   4342 O  OD1   . ASP A 1 524 ? -11.472 -37.798 61.715 1.00 33.02 ? 524  ASP A OD1   1 
ATOM   4343 O  OD2   . ASP A 1 524 ? -12.750 -38.392 63.396 1.00 37.56 ? 524  ASP A OD2   1 
ATOM   4344 N  N     . GLU A 1 525 ? -14.400 -40.740 58.687 1.00 28.73 ? 525  GLU A N     1 
ATOM   4345 C  CA    . GLU A 1 525 ? -14.886 -41.888 57.923 1.00 29.15 ? 525  GLU A CA    1 
ATOM   4346 C  C     . GLU A 1 525 ? -14.195 -41.969 56.564 1.00 27.72 ? 525  GLU A C     1 
ATOM   4347 O  O     . GLU A 1 525 ? -13.711 -43.033 56.168 1.00 28.28 ? 525  GLU A O     1 
ATOM   4348 C  CB    . GLU A 1 525 ? -16.405 -41.825 57.739 1.00 30.62 ? 525  GLU A CB    1 
ATOM   4349 C  CG    . GLU A 1 525 ? -16.969 -42.994 56.942 1.00 36.36 ? 525  GLU A CG    1 
ATOM   4350 C  CD    . GLU A 1 525 ? -18.479 -42.949 56.773 1.00 42.20 ? 525  GLU A CD    1 
ATOM   4351 O  OE1   . GLU A 1 525 ? -19.105 -41.915 57.095 1.00 41.58 ? 525  GLU A OE1   1 
ATOM   4352 O  OE2   . GLU A 1 525 ? -19.041 -43.964 56.306 1.00 46.74 ? 525  GLU A OE2   1 
ATOM   4353 N  N     . ILE A 1 526 ? -14.151 -40.840 55.857 1.00 25.07 ? 526  ILE A N     1 
ATOM   4354 C  CA    . ILE A 1 526 ? -13.480 -40.774 54.561 1.00 24.36 ? 526  ILE A CA    1 
ATOM   4355 C  C     . ILE A 1 526 ? -12.003 -41.147 54.692 1.00 24.34 ? 526  ILE A C     1 
ATOM   4356 O  O     . ILE A 1 526 ? -11.476 -41.918 53.884 1.00 24.70 ? 526  ILE A O     1 
ATOM   4357 C  CB    . ILE A 1 526 ? -13.645 -39.387 53.901 1.00 23.99 ? 526  ILE A CB    1 
ATOM   4358 C  CG1   . ILE A 1 526 ? -15.101 -39.194 53.465 1.00 23.78 ? 526  ILE A CG1   1 
ATOM   4359 C  CG2   . ILE A 1 526 ? -12.680 -39.228 52.716 1.00 23.46 ? 526  ILE A CG2   1 
ATOM   4360 C  CD1   . ILE A 1 526 ? -15.476 -37.752 53.158 1.00 28.67 ? 526  ILE A CD1   1 
ATOM   4361 N  N     . LYS A 1 527 ? -11.346 -40.608 55.716 1.00 23.87 ? 527  LYS A N     1 
ATOM   4362 C  CA    . LYS A 1 527 ? -9.932  -40.889 55.948 1.00 25.82 ? 527  LYS A CA    1 
ATOM   4363 C  C     . LYS A 1 527 ? -9.675  -42.376 56.163 1.00 27.32 ? 527  LYS A C     1 
ATOM   4364 O  O     . LYS A 1 527 ? -8.668  -42.903 55.693 1.00 27.18 ? 527  LYS A O     1 
ATOM   4365 C  CB    . LYS A 1 527 ? -9.385  -40.062 57.115 1.00 27.39 ? 527  LYS A CB    1 
ATOM   4366 C  CG    . LYS A 1 527 ? -9.184  -38.599 56.759 1.00 28.96 ? 527  LYS A CG    1 
ATOM   4367 C  CD    . LYS A 1 527 ? -8.216  -37.883 57.697 1.00 33.13 ? 527  LYS A CD    1 
ATOM   4368 C  CE    . LYS A 1 527 ? -8.931  -37.281 58.880 1.00 35.30 ? 527  LYS A CE    1 
ATOM   4369 N  NZ    . LYS A 1 527 ? -8.233  -36.062 59.379 1.00 36.89 ? 527  LYS A NZ    1 
ATOM   4370 N  N     . GLU A 1 528 ? -10.599 -43.046 56.848 1.00 27.27 ? 528  GLU A N     1 
ATOM   4371 C  CA    . GLU A 1 528 ? -10.480 -44.482 57.089 1.00 30.45 ? 528  GLU A CA    1 
ATOM   4372 C  C     . GLU A 1 528 ? -10.637 -45.301 55.809 1.00 29.57 ? 528  GLU A C     1 
ATOM   4373 O  O     . GLU A 1 528 ? -9.895  -46.259 55.598 1.00 29.98 ? 528  GLU A O     1 
ATOM   4374 C  CB    . GLU A 1 528 ? -11.460 -44.945 58.173 1.00 32.69 ? 528  GLU A CB    1 
ATOM   4375 C  CG    . GLU A 1 528 ? -11.126 -44.433 59.576 1.00 39.47 ? 528  GLU A CG    1 
ATOM   4376 C  CD    . GLU A 1 528 ? -9.737  -44.842 60.055 1.00 44.87 ? 528  GLU A CD    1 
ATOM   4377 O  OE1   . GLU A 1 528 ? -8.931  -43.942 60.375 1.00 48.01 ? 528  GLU A OE1   1 
ATOM   4378 O  OE2   . GLU A 1 528 ? -9.447  -46.057 60.107 1.00 47.83 ? 528  GLU A OE2   1 
ATOM   4379 N  N     . LYS A 1 529 ? -11.582 -44.905 54.953 1.00 28.62 ? 529  LYS A N     1 
ATOM   4380 C  CA    . LYS A 1 529 ? -11.793 -45.560 53.656 1.00 28.78 ? 529  LYS A CA    1 
ATOM   4381 C  C     . LYS A 1 529 ? -10.600 -45.361 52.715 1.00 29.00 ? 529  LYS A C     1 
ATOM   4382 O  O     . LYS A 1 529 ? -10.205 -46.281 51.992 1.00 26.75 ? 529  LYS A O     1 
ATOM   4383 C  CB    . LYS A 1 529 ? -13.071 -45.044 52.987 1.00 29.10 ? 529  LYS A CB    1 
ATOM   4384 C  CG    . LYS A 1 529 ? -14.373 -45.439 53.667 1.00 31.96 ? 529  LYS A CG    1 
ATOM   4385 C  CD    . LYS A 1 529 ? -15.568 -44.765 52.989 1.00 34.82 ? 529  LYS A CD    1 
ATOM   4386 C  CE    . LYS A 1 529 ? -16.873 -45.113 53.688 1.00 36.78 ? 529  LYS A CE    1 
ATOM   4387 N  NZ    . LYS A 1 529 ? -18.052 -44.468 53.044 1.00 36.16 ? 529  LYS A NZ    1 
ATOM   4388 N  N     . ILE A 1 530 ? -10.041 -44.152 52.730 1.00 27.51 ? 530  ILE A N     1 
ATOM   4389 C  CA    . ILE A 1 530 ? -8.860  -43.811 51.934 1.00 28.22 ? 530  ILE A CA    1 
ATOM   4390 C  C     . ILE A 1 530 ? -7.681  -44.745 52.232 1.00 28.77 ? 530  ILE A C     1 
ATOM   4391 O  O     . ILE A 1 530 ? -6.978  -45.177 51.315 1.00 27.81 ? 530  ILE A O     1 
ATOM   4392 C  CB    . ILE A 1 530 ? -8.477  -42.320 52.128 1.00 26.92 ? 530  ILE A CB    1 
ATOM   4393 C  CG1   . ILE A 1 530 ? -9.353  -41.444 51.228 1.00 27.23 ? 530  ILE A CG1   1 
ATOM   4394 C  CG2   . ILE A 1 530 ? -6.997  -42.068 51.835 1.00 28.11 ? 530  ILE A CG2   1 
ATOM   4395 C  CD1   . ILE A 1 530 ? -9.226  -39.964 51.498 1.00 27.55 ? 530  ILE A CD1   1 
ATOM   4396 N  N     . LYS A 1 531 ? -7.498  -45.068 53.512 1.00 30.51 ? 531  LYS A N     1 
ATOM   4397 C  CA    . LYS A 1 531 ? -6.419  -45.955 53.963 1.00 31.45 ? 531  LYS A CA    1 
ATOM   4398 C  C     . LYS A 1 531 ? -6.581  -47.406 53.498 1.00 33.19 ? 531  LYS A C     1 
ATOM   4399 O  O     . LYS A 1 531 ? -5.668  -48.218 53.673 1.00 33.54 ? 531  LYS A O     1 
ATOM   4400 C  CB    . LYS A 1 531 ? -6.279  -45.902 55.489 1.00 33.12 ? 531  LYS A CB    1 
ATOM   4401 C  CG    . LYS A 1 531 ? -5.630  -44.624 56.009 1.00 34.95 ? 531  LYS A CG    1 
ATOM   4402 C  CD    . LYS A 1 531 ? -5.601  -44.591 57.531 1.00 39.34 ? 531  LYS A CD    1 
ATOM   4403 C  CE    . LYS A 1 531 ? -4.828  -43.383 58.038 1.00 42.59 ? 531  LYS A CE    1 
ATOM   4404 N  NZ    . LYS A 1 531 ? -4.745  -43.359 59.527 1.00 45.09 ? 531  LYS A NZ    1 
ATOM   4405 N  N     . LYS A 1 532 ? -7.731  -47.722 52.904 1.00 32.88 ? 532  LYS A N     1 
ATOM   4406 C  CA    . LYS A 1 532 ? -8.005  -49.065 52.388 1.00 33.40 ? 532  LYS A CA    1 
ATOM   4407 C  C     . LYS A 1 532 ? -8.040  -49.122 50.859 1.00 32.96 ? 532  LYS A C     1 
ATOM   4408 O  O     . LYS A 1 532 ? -8.220  -50.194 50.275 1.00 32.87 ? 532  LYS A O     1 
ATOM   4409 C  CB    . LYS A 1 532 ? -9.322  -49.596 52.964 1.00 35.36 ? 532  LYS A CB    1 
ATOM   4410 C  CG    . LYS A 1 532 ? -9.258  -49.942 54.440 1.00 39.69 ? 532  LYS A CG    1 
ATOM   4411 C  CD    . LYS A 1 532 ? -10.625 -50.326 54.970 1.00 44.75 ? 532  LYS A CD    1 
ATOM   4412 C  CE    . LYS A 1 532 ? -10.597 -50.491 56.480 1.00 47.50 ? 532  LYS A CE    1 
ATOM   4413 N  NZ    . LYS A 1 532 ? -11.924 -50.902 57.010 1.00 50.18 ? 532  LYS A NZ    1 
ATOM   4414 N  N     . LEU A 1 533 ? -7.861  -47.971 50.213 1.00 30.92 ? 533  LEU A N     1 
ATOM   4415 C  CA    . LEU A 1 533 ? -7.974  -47.886 48.756 1.00 30.26 ? 533  LEU A CA    1 
ATOM   4416 C  C     . LEU A 1 533 ? -6.714  -48.316 48.003 1.00 29.10 ? 533  LEU A C     1 
ATOM   4417 O  O     . LEU A 1 533 ? -5.596  -48.223 48.523 1.00 29.12 ? 533  LEU A O     1 
ATOM   4418 C  CB    . LEU A 1 533 ? -8.408  -46.477 48.318 1.00 28.76 ? 533  LEU A CB    1 
ATOM   4419 C  CG    . LEU A 1 533 ? -9.857  -46.061 48.607 1.00 28.51 ? 533  LEU A CG    1 
ATOM   4420 C  CD1   . LEU A 1 533 ? -10.078 -44.635 48.137 1.00 29.03 ? 533  LEU A CD1   1 
ATOM   4421 C  CD2   . LEU A 1 533 ? -10.885 -46.992 47.966 1.00 30.22 ? 533  LEU A CD2   1 
ATOM   4422 N  N     . SER A 1 534 ? -6.920  -48.778 46.770 1.00 29.99 ? 534  SER A N     1 
ATOM   4423 C  CA    . SER A 1 534 ? -5.840  -49.100 45.840 1.00 30.78 ? 534  SER A CA    1 
ATOM   4424 C  C     . SER A 1 534 ? -5.125  -47.843 45.353 1.00 31.27 ? 534  SER A C     1 
ATOM   4425 O  O     . SER A 1 534 ? -5.657  -46.733 45.463 1.00 28.47 ? 534  SER A O     1 
ATOM   4426 C  CB    . SER A 1 534 ? -6.397  -49.856 44.631 1.00 32.22 ? 534  SER A CB    1 
ATOM   4427 O  OG    . SER A 1 534 ? -7.176  -49.003 43.803 1.00 32.15 ? 534  SER A OG    1 
ATOM   4428 N  N     . ALA A 1 535 ? -3.928  -48.033 44.804 1.00 31.48 ? 535  ALA A N     1 
ATOM   4429 C  CA    . ALA A 1 535 ? -3.158  -46.952 44.190 1.00 31.72 ? 535  ALA A CA    1 
ATOM   4430 C  C     . ALA A 1 535 ? -3.922  -46.292 43.044 1.00 32.17 ? 535  ALA A C     1 
ATOM   4431 O  O     . ALA A 1 535 ? -3.904  -45.071 42.912 1.00 32.16 ? 535  ALA A O     1 
ATOM   4432 C  CB    . ALA A 1 535 ? -1.807  -47.464 43.706 1.00 31.64 ? 535  ALA A CB    1 
ATOM   4433 N  N     . LYS A 1 536 ? -4.586  -47.103 42.221 1.00 32.19 ? 536  LYS A N     1 
ATOM   4434 C  CA    . LYS A 1 536 ? -5.380  -46.593 41.101 1.00 32.49 ? 536  LYS A CA    1 
ATOM   4435 C  C     . LYS A 1 536 ? -6.452  -45.608 41.580 1.00 29.63 ? 536  LYS A C     1 
ATOM   4436 O  O     . LYS A 1 536 ? -6.555  -44.493 41.058 1.00 29.13 ? 536  LYS A O     1 
ATOM   4437 C  CB    . LYS A 1 536 ? -6.021  -47.753 40.329 1.00 34.18 ? 536  LYS A CB    1 
ATOM   4438 C  CG    . LYS A 1 536 ? -6.788  -47.348 39.070 1.00 37.37 ? 536  LYS A CG    1 
ATOM   4439 C  CD    . LYS A 1 536 ? -7.321  -48.585 38.348 1.00 41.15 ? 536  LYS A CD    1 
ATOM   4440 C  CE    . LYS A 1 536 ? -8.557  -48.279 37.512 1.00 42.45 ? 536  LYS A CE    1 
ATOM   4441 N  NZ    . LYS A 1 536 ? -8.244  -47.506 36.282 1.00 44.14 ? 536  LYS A NZ    1 
ATOM   4442 N  N     . SER A 1 537 ? -7.238  -46.025 42.570 1.00 28.19 ? 537  SER A N     1 
ATOM   4443 C  CA    . SER A 1 537 ? -8.298  -45.181 43.123 1.00 28.17 ? 537  SER A CA    1 
ATOM   4444 C  C     . SER A 1 537 ? -7.738  -43.942 43.812 1.00 26.93 ? 537  SER A C     1 
ATOM   4445 O  O     . SER A 1 537 ? -8.270  -42.844 43.642 1.00 25.14 ? 537  SER A O     1 
ATOM   4446 C  CB    . SER A 1 537 ? -9.172  -45.967 44.096 1.00 28.70 ? 537  SER A CB    1 
ATOM   4447 O  OG    . SER A 1 537 ? -10.018 -46.857 43.394 1.00 32.38 ? 537  SER A OG    1 
ATOM   4448 N  N     . LEU A 1 538 ? -6.672  -44.126 44.589 1.00 25.59 ? 538  LEU A N     1 
ATOM   4449 C  CA    . LEU A 1 538 ? -6.010  -43.008 45.264 1.00 25.21 ? 538  LEU A CA    1 
ATOM   4450 C  C     . LEU A 1 538 ? -5.500  -41.963 44.279 1.00 24.59 ? 538  LEU A C     1 
ATOM   4451 O  O     . LEU A 1 538 ? -5.685  -40.767 44.498 1.00 24.65 ? 538  LEU A O     1 
ATOM   4452 C  CB    . LEU A 1 538 ? -4.862  -43.499 46.152 1.00 25.40 ? 538  LEU A CB    1 
ATOM   4453 C  CG    . LEU A 1 538 ? -5.264  -44.248 47.426 1.00 26.47 ? 538  LEU A CG    1 
ATOM   4454 C  CD1   . LEU A 1 538 ? -4.042  -44.924 48.048 1.00 27.12 ? 538  LEU A CD1   1 
ATOM   4455 C  CD2   . LEU A 1 538 ? -5.965  -43.328 48.426 1.00 26.22 ? 538  LEU A CD2   1 
ATOM   4456 N  N     . ASN A 1 539 ? -4.875  -42.414 43.194 1.00 25.27 ? 539  ASN A N     1 
ATOM   4457 C  CA    . ASN A 1 539 ? -4.361  -41.489 42.186 1.00 25.45 ? 539  ASN A CA    1 
ATOM   4458 C  C     . ASN A 1 539 ? -5.458  -40.718 41.466 1.00 24.66 ? 539  ASN A C     1 
ATOM   4459 O  O     . ASN A 1 539 ? -5.270  -39.550 41.128 1.00 23.22 ? 539  ASN A O     1 
ATOM   4460 C  CB    . ASN A 1 539 ? -3.445  -42.197 41.185 1.00 28.28 ? 539  ASN A CB    1 
ATOM   4461 C  CG    . ASN A 1 539 ? -2.061  -42.466 41.755 1.00 31.34 ? 539  ASN A CG    1 
ATOM   4462 O  OD1   . ASN A 1 539 ? -1.576  -43.596 41.725 1.00 35.00 ? 539  ASN A OD1   1 
ATOM   4463 N  ND2   . ASN A 1 539 ? -1.420  -41.427 42.280 1.00 31.14 ? 539  ASN A ND2   1 
ATOM   4464 N  N     . GLU A 1 540 ? -6.600  -41.365 41.237 1.00 25.56 ? 540  GLU A N     1 
ATOM   4465 C  CA    . GLU A 1 540 ? -7.745  -40.668 40.659 1.00 25.98 ? 540  GLU A CA    1 
ATOM   4466 C  C     . GLU A 1 540 ? -8.274  -39.620 41.630 1.00 23.07 ? 540  GLU A C     1 
ATOM   4467 O  O     . GLU A 1 540 ? -8.587  -38.505 41.218 1.00 21.36 ? 540  GLU A O     1 
ATOM   4468 C  CB    . GLU A 1 540 ? -8.854  -41.639 40.240 1.00 28.28 ? 540  GLU A CB    1 
ATOM   4469 C  CG    . GLU A 1 540 ? -10.081 -40.959 39.603 1.00 34.21 ? 540  GLU A CG    1 
ATOM   4470 C  CD    . GLU A 1 540 ? -9.754  -40.136 38.353 1.00 39.32 ? 540  GLU A CD    1 
ATOM   4471 O  OE1   . GLU A 1 540 ? -8.928  -40.587 37.526 1.00 43.48 ? 540  GLU A OE1   1 
ATOM   4472 O  OE2   . GLU A 1 540 ? -10.336 -39.038 38.193 1.00 36.97 ? 540  GLU A OE2   1 
ATOM   4473 N  N     . MET A 1 541 ? -8.354  -39.975 42.915 1.00 20.90 ? 541  MET A N     1 
ATOM   4474 C  CA    . MET A 1 541 ? -8.775  -39.029 43.957 1.00 19.16 ? 541  MET A CA    1 
ATOM   4475 C  C     . MET A 1 541 ? -7.820  -37.843 44.085 1.00 19.44 ? 541  MET A C     1 
ATOM   4476 O  O     . MET A 1 541 ? -8.263  -36.712 44.314 1.00 19.53 ? 541  MET A O     1 
ATOM   4477 C  CB    . MET A 1 541 ? -8.934  -39.730 45.315 1.00 19.63 ? 541  MET A CB    1 
ATOM   4478 C  CG    . MET A 1 541 ? -10.104 -40.692 45.370 1.00 19.77 ? 541  MET A CG    1 
ATOM   4479 S  SD    . MET A 1 541 ? -10.448 -41.295 47.032 1.00 23.80 ? 541  MET A SD    1 
ATOM   4480 C  CE    . MET A 1 541 ? -11.076 -39.811 47.823 1.00 23.94 ? 541  MET A CE    1 
ATOM   4481 N  N     . LEU A 1 542 ? -6.517  -38.101 43.942 1.00 18.21 ? 542  LEU A N     1 
ATOM   4482 C  CA    . LEU A 1 542 ? -5.511  -37.037 43.989 1.00 19.05 ? 542  LEU A CA    1 
ATOM   4483 C  C     . LEU A 1 542 ? -5.691  -36.072 42.822 1.00 19.79 ? 542  LEU A C     1 
ATOM   4484 O  O     . LEU A 1 542 ? -5.649  -34.858 43.008 1.00 17.94 ? 542  LEU A O     1 
ATOM   4485 C  CB    . LEU A 1 542 ? -4.077  -37.592 44.016 1.00 18.55 ? 542  LEU A CB    1 
ATOM   4486 C  CG    . LEU A 1 542 ? -2.924  -36.575 44.145 1.00 21.00 ? 542  LEU A CG    1 
ATOM   4487 C  CD1   . LEU A 1 542 ? -3.084  -35.688 45.377 1.00 23.42 ? 542  LEU A CD1   1 
ATOM   4488 C  CD2   . LEU A 1 542 ? -1.551  -37.249 44.148 1.00 24.78 ? 542  LEU A CD2   1 
ATOM   4489 N  N     . PHE A 1 543 ? -5.888  -36.623 41.625 1.00 20.31 ? 543  PHE A N     1 
ATOM   4490 C  CA    . PHE A 1 543 ? -6.167  -35.813 40.444 1.00 20.27 ? 543  PHE A CA    1 
ATOM   4491 C  C     . PHE A 1 543 ? -7.391  -34.923 40.675 1.00 19.62 ? 543  PHE A C     1 
ATOM   4492 O  O     . PHE A 1 543 ? -7.354  -33.725 40.406 1.00 20.32 ? 543  PHE A O     1 
ATOM   4493 C  CB    . PHE A 1 543 ? -6.380  -36.703 39.215 1.00 22.01 ? 543  PHE A CB    1 
ATOM   4494 C  CG    . PHE A 1 543 ? -6.785  -35.942 37.978 1.00 26.86 ? 543  PHE A CG    1 
ATOM   4495 C  CD1   . PHE A 1 543 ? -5.831  -35.297 37.200 1.00 29.81 ? 543  PHE A CD1   1 
ATOM   4496 C  CD2   . PHE A 1 543 ? -8.125  -35.869 37.596 1.00 28.78 ? 543  PHE A CD2   1 
ATOM   4497 C  CE1   . PHE A 1 543 ? -6.202  -34.584 36.056 1.00 31.51 ? 543  PHE A CE1   1 
ATOM   4498 C  CE2   . PHE A 1 543 ? -8.508  -35.158 36.459 1.00 31.76 ? 543  PHE A CE2   1 
ATOM   4499 C  CZ    . PHE A 1 543 ? -7.542  -34.517 35.685 1.00 31.36 ? 543  PHE A CZ    1 
ATOM   4500 N  N     . ARG A 1 544 ? -8.469  -35.515 41.183 1.00 19.16 ? 544  ARG A N     1 
ATOM   4501 C  CA    . ARG A 1 544 ? -9.702  -34.774 41.466 1.00 19.37 ? 544  ARG A CA    1 
ATOM   4502 C  C     . ARG A 1 544 ? -9.536  -33.712 42.558 1.00 19.15 ? 544  ARG A C     1 
ATOM   4503 O  O     . ARG A 1 544 ? -10.099 -32.623 42.456 1.00 17.95 ? 544  ARG A O     1 
ATOM   4504 C  CB    . ARG A 1 544 ? -10.823 -35.739 41.843 1.00 20.70 ? 544  ARG A CB    1 
ATOM   4505 C  CG    . ARG A 1 544 ? -11.303 -36.603 40.691 1.00 21.43 ? 544  ARG A CG    1 
ATOM   4506 C  CD    . ARG A 1 544 ? -12.265 -37.662 41.165 1.00 22.57 ? 544  ARG A CD    1 
ATOM   4507 N  NE    . ARG A 1 544 ? -12.566 -38.612 40.095 1.00 27.15 ? 544  ARG A NE    1 
ATOM   4508 C  CZ    . ARG A 1 544 ? -13.498 -39.559 40.159 1.00 29.27 ? 544  ARG A CZ    1 
ATOM   4509 N  NH1   . ARG A 1 544 ? -14.248 -39.698 41.246 1.00 28.26 ? 544  ARG A NH1   1 
ATOM   4510 N  NH2   . ARG A 1 544 ? -13.682 -40.369 39.125 1.00 27.18 ? 544  ARG A NH2   1 
ATOM   4511 N  N     . ALA A 1 545 ? -8.780  -34.044 43.604 1.00 18.61 ? 545  ALA A N     1 
ATOM   4512 C  CA    . ALA A 1 545 ? -8.471  -33.093 44.675 1.00 18.48 ? 545  ALA A CA    1 
ATOM   4513 C  C     . ALA A 1 545 ? -7.686  -31.902 44.125 1.00 18.28 ? 545  ALA A C     1 
ATOM   4514 O  O     . ALA A 1 545 ? -7.979  -30.743 44.434 1.00 19.04 ? 545  ALA A O     1 
ATOM   4515 C  CB    . ALA A 1 545 ? -7.681  -33.780 45.784 1.00 17.51 ? 545  ALA A CB    1 
ATOM   4516 N  N     . GLN A 1 546 ? -6.690  -32.199 43.303 1.00 16.91 ? 546  GLN A N     1 
ATOM   4517 C  CA    . GLN A 1 546 ? -5.871  -31.159 42.673 1.00 17.62 ? 546  GLN A CA    1 
ATOM   4518 C  C     . GLN A 1 546 ? -6.666  -30.292 41.696 1.00 17.07 ? 546  GLN A C     1 
ATOM   4519 O  O     . GLN A 1 546 ? -6.435  -29.085 41.622 1.00 17.22 ? 546  GLN A O     1 
ATOM   4520 C  CB    . GLN A 1 546 ? -4.635  -31.771 42.010 1.00 18.34 ? 546  GLN A CB    1 
ATOM   4521 C  CG    . GLN A 1 546 ? -3.595  -32.250 43.025 1.00 20.58 ? 546  GLN A CG    1 
ATOM   4522 C  CD    . GLN A 1 546 ? -2.484  -33.097 42.426 1.00 25.44 ? 546  GLN A CD    1 
ATOM   4523 O  OE1   . GLN A 1 546 ? -1.446  -33.292 43.054 1.00 30.91 ? 546  GLN A OE1   1 
ATOM   4524 N  NE2   . GLN A 1 546 ? -2.700  -33.614 41.220 1.00 24.72 ? 546  GLN A NE2   1 
ATOM   4525 N  N     . ARG A 1 547 ? -7.612  -30.896 40.974 1.00 17.84 ? 547  ARG A N     1 
ATOM   4526 C  CA    . ARG A 1 547 ? -8.505  -30.128 40.096 1.00 17.56 ? 547  ARG A CA    1 
ATOM   4527 C  C     . ARG A 1 547 ? -9.431  -29.208 40.902 1.00 16.70 ? 547  ARG A C     1 
ATOM   4528 O  O     . ARG A 1 547 ? -9.685  -28.081 40.497 1.00 17.33 ? 547  ARG A O     1 
ATOM   4529 C  CB    . ARG A 1 547 ? -9.323  -31.043 39.176 1.00 19.50 ? 547  ARG A CB    1 
ATOM   4530 C  CG    . ARG A 1 547 ? -8.559  -31.566 37.963 1.00 23.11 ? 547  ARG A CG    1 
ATOM   4531 C  CD    . ARG A 1 547 ? -8.117  -30.413 37.065 1.00 22.68 ? 547  ARG A CD    1 
ATOM   4532 N  NE    . ARG A 1 547 ? -7.302  -30.853 35.932 1.00 29.04 ? 547  ARG A NE    1 
ATOM   4533 C  CZ    . ARG A 1 547 ? -7.784  -31.126 34.725 1.00 29.86 ? 547  ARG A CZ    1 
ATOM   4534 N  NH1   . ARG A 1 547 ? -9.088  -31.025 34.485 1.00 32.60 ? 547  ARG A NH1   1 
ATOM   4535 N  NH2   . ARG A 1 547 ? -6.960  -31.505 33.755 1.00 27.53 ? 547  ARG A NH2   1 
ATOM   4536 N  N     . THR A 1 548 ? -9.920  -29.697 42.043 1.00 16.23 ? 548  THR A N     1 
ATOM   4537 C  CA    . THR A 1 548 ? -10.724 -28.881 42.955 1.00 16.88 ? 548  THR A CA    1 
ATOM   4538 C  C     . THR A 1 548 ? -9.899  -27.711 43.501 1.00 16.91 ? 548  THR A C     1 
ATOM   4539 O  O     . THR A 1 548 ? -10.394 -26.586 43.596 1.00 15.92 ? 548  THR A O     1 
ATOM   4540 C  CB    . THR A 1 548 ? -11.276 -29.719 44.134 1.00 16.52 ? 548  THR A CB    1 
ATOM   4541 O  OG1   . THR A 1 548 ? -12.093 -30.776 43.624 1.00 20.63 ? 548  THR A OG1   1 
ATOM   4542 C  CG2   . THR A 1 548 ? -12.114 -28.851 45.063 1.00 15.78 ? 548  THR A CG2   1 
ATOM   4543 N  N     . GLU A 1 549 ? -8.645  -27.987 43.858 1.00 15.85 ? 549  GLU A N     1 
ATOM   4544 C  CA    . GLU A 1 549 ? -7.733  -26.946 44.335 1.00 16.93 ? 549  GLU A CA    1 
ATOM   4545 C  C     . GLU A 1 549 ? -7.508  -25.866 43.269 1.00 15.84 ? 549  GLU A C     1 
ATOM   4546 O  O     . GLU A 1 549 ? -7.511  -24.679 43.575 1.00 14.57 ? 549  GLU A O     1 
ATOM   4547 C  CB    . GLU A 1 549 ? -6.396  -27.554 44.769 1.00 18.09 ? 549  GLU A CB    1 
ATOM   4548 C  CG    . GLU A 1 549 ? -5.440  -26.541 45.406 1.00 21.07 ? 549  GLU A CG    1 
ATOM   4549 C  CD    . GLU A 1 549 ? -4.059  -27.113 45.708 1.00 24.04 ? 549  GLU A CD    1 
ATOM   4550 O  OE1   . GLU A 1 549 ? -3.888  -28.352 45.683 1.00 22.76 ? 549  GLU A OE1   1 
ATOM   4551 O  OE2   . GLU A 1 549 ? -3.139  -26.310 45.967 1.00 22.86 ? 549  GLU A OE2   1 
ATOM   4552 N  N     . VAL A 1 550 ? -7.330  -26.289 42.022 1.00 14.26 ? 550  VAL A N     1 
ATOM   4553 C  CA    . VAL A 1 550 ? -7.147  -25.358 40.904 1.00 15.23 ? 550  VAL A CA    1 
ATOM   4554 C  C     . VAL A 1 550 ? -8.379  -24.473 40.706 1.00 16.13 ? 550  VAL A C     1 
ATOM   4555 O  O     . VAL A 1 550 ? -8.253  -23.258 40.545 1.00 16.61 ? 550  VAL A O     1 
ATOM   4556 C  CB    . VAL A 1 550 ? -6.766  -26.088 39.590 1.00 15.77 ? 550  VAL A CB    1 
ATOM   4557 C  CG1   . VAL A 1 550 ? -6.810  -25.125 38.385 1.00 16.80 ? 550  VAL A CG1   1 
ATOM   4558 C  CG2   . VAL A 1 550 ? -5.376  -26.684 39.716 1.00 17.67 ? 550  VAL A CG2   1 
ATOM   4559 N  N     . ALA A 1 551 ? -9.563  -25.080 40.730 1.00 15.78 ? 551  ALA A N     1 
ATOM   4560 C  CA    . ALA A 1 551 ? -10.807 -24.315 40.622 1.00 17.20 ? 551  ALA A CA    1 
ATOM   4561 C  C     . ALA A 1 551 ? -10.924 -23.279 41.750 1.00 17.94 ? 551  ALA A C     1 
ATOM   4562 O  O     . ALA A 1 551 ? -11.293 -22.127 41.504 1.00 18.02 ? 551  ALA A O     1 
ATOM   4563 C  CB    . ALA A 1 551 ? -12.007 -25.247 40.609 1.00 17.47 ? 551  ALA A CB    1 
ATOM   4564 N  N     . GLY A 1 552 ? -10.604 -23.688 42.977 1.00 17.66 ? 552  GLY A N     1 
ATOM   4565 C  CA    . GLY A 1 552 ? -10.603 -22.771 44.125 1.00 18.08 ? 552  GLY A CA    1 
ATOM   4566 C  C     . GLY A 1 552 ? -9.579  -21.655 43.946 1.00 17.21 ? 552  GLY A C     1 
ATOM   4567 O  O     . GLY A 1 552 ? -9.851  -20.497 44.269 1.00 17.20 ? 552  GLY A O     1 
ATOM   4568 N  N     . MET A 1 553 ? -8.401  -22.013 43.433 1.00 14.69 ? 553  MET A N     1 
ATOM   4569 C  CA    . MET A 1 553 ? -7.338  -21.044 43.163 1.00 14.39 ? 553  MET A CA    1 
ATOM   4570 C  C     . MET A 1 553 ? -7.802  -19.993 42.152 1.00 14.49 ? 553  MET A C     1 
ATOM   4571 O  O     . MET A 1 553 ? -7.644  -18.801 42.390 1.00 15.24 ? 553  MET A O     1 
ATOM   4572 C  CB    . MET A 1 553 ? -6.057  -21.741 42.674 1.00 14.80 ? 553  MET A CB    1 
ATOM   4573 C  CG    . MET A 1 553 ? -4.938  -20.792 42.196 1.00 15.72 ? 553  MET A CG    1 
ATOM   4574 S  SD    . MET A 1 553 ? -4.267  -19.688 43.465 1.00 24.70 ? 553  MET A SD    1 
ATOM   4575 C  CE    . MET A 1 553 ? -3.006  -20.692 44.241 1.00 27.56 ? 553  MET A CE    1 
ATOM   4576 N  N     . THR A 1 554 ? -8.393  -20.436 41.044 1.00 13.31 ? 554  THR A N     1 
ATOM   4577 C  CA    . THR A 1 554 ? -8.919  -19.497 40.041 1.00 13.39 ? 554  THR A CA    1 
ATOM   4578 C  C     . THR A 1 554 ? -9.897  -18.513 40.672 1.00 14.22 ? 554  THR A C     1 
ATOM   4579 O  O     . THR A 1 554 ? -9.778  -17.300 40.484 1.00 13.02 ? 554  THR A O     1 
ATOM   4580 C  CB    . THR A 1 554 ? -9.616  -20.234 38.898 1.00 13.88 ? 554  THR A CB    1 
ATOM   4581 O  OG1   . THR A 1 554 ? -8.631  -20.911 38.114 1.00 15.50 ? 554  THR A OG1   1 
ATOM   4582 C  CG2   . THR A 1 554 ? -10.414 -19.246 38.003 1.00 14.80 ? 554  THR A CG2   1 
ATOM   4583 N  N     . ALA A 1 555 ? -10.850 -19.047 41.435 1.00 13.34 ? 555  ALA A N     1 
ATOM   4584 C  CA    . ALA A 1 555 ? -11.914 -18.240 42.019 1.00 14.56 ? 555  ALA A CA    1 
ATOM   4585 C  C     . ALA A 1 555 ? -11.392 -17.249 43.048 1.00 15.29 ? 555  ALA A C     1 
ATOM   4586 O  O     . ALA A 1 555 ? -11.810 -16.089 43.054 1.00 15.98 ? 555  ALA A O     1 
ATOM   4587 C  CB    . ALA A 1 555 ? -12.992 -19.128 42.629 1.00 14.48 ? 555  ALA A CB    1 
ATOM   4588 N  N     . GLN A 1 556 ? -10.454 -17.690 43.883 1.00 13.78 ? 556  GLN A N     1 
ATOM   4589 C  CA    . GLN A 1 556 ? -9.951  -16.836 44.965 1.00 15.16 ? 556  GLN A CA    1 
ATOM   4590 C  C     . GLN A 1 556 ? -8.881  -15.842 44.516 1.00 15.59 ? 556  GLN A C     1 
ATOM   4591 O  O     . GLN A 1 556 ? -8.940  -14.672 44.891 1.00 15.44 ? 556  GLN A O     1 
ATOM   4592 C  CB    . GLN A 1 556 ? -9.485  -17.672 46.177 1.00 16.03 ? 556  GLN A CB    1 
ATOM   4593 C  CG    . GLN A 1 556 ? -8.125  -18.385 46.031 1.00 14.55 ? 556  GLN A CG    1 
ATOM   4594 C  CD    . GLN A 1 556 ? -6.932  -17.507 46.435 1.00 17.30 ? 556  GLN A CD    1 
ATOM   4595 O  OE1   . GLN A 1 556 ? -7.094  -16.461 47.066 1.00 18.83 ? 556  GLN A OE1   1 
ATOM   4596 N  NE2   . GLN A 1 556 ? -5.734  -17.943 46.079 1.00 17.88 ? 556  GLN A NE2   1 
ATOM   4597 N  N     . ILE A 1 557 ? -7.913  -16.287 43.711 1.00 13.95 ? 557  ILE A N     1 
ATOM   4598 C  CA    . ILE A 1 557 ? -6.785  -15.419 43.361 1.00 14.93 ? 557  ILE A CA    1 
ATOM   4599 C  C     . ILE A 1 557 ? -7.240  -14.264 42.476 1.00 16.37 ? 557  ILE A C     1 
ATOM   4600 O  O     . ILE A 1 557 ? -6.667  -13.174 42.511 1.00 14.43 ? 557  ILE A O     1 
ATOM   4601 C  CB    . ILE A 1 557 ? -5.603  -16.194 42.696 1.00 15.69 ? 557  ILE A CB    1 
ATOM   4602 C  CG1   . ILE A 1 557 ? -4.291  -15.411 42.875 1.00 18.79 ? 557  ILE A CG1   1 
ATOM   4603 C  CG2   . ILE A 1 557 ? -5.900  -16.507 41.211 1.00 14.82 ? 557  ILE A CG2   1 
ATOM   4604 C  CD1   . ILE A 1 557 ? -3.037  -16.171 42.457 1.00 24.50 ? 557  ILE A CD1   1 
ATOM   4605 N  N     . ASN A 1 558 ? -8.281  -14.494 41.684 1.00 16.04 ? 558  ASN A N     1 
ATOM   4606 C  CA    . ASN A 1 558 ? -8.736  -13.436 40.792 1.00 14.83 ? 558  ASN A CA    1 
ATOM   4607 C  C     . ASN A 1 558 ? -9.725  -12.476 41.433 1.00 14.84 ? 558  ASN A C     1 
ATOM   4608 O  O     . ASN A 1 558 ? -9.877  -11.338 40.982 1.00 15.88 ? 558  ASN A O     1 
ATOM   4609 C  CB    . ASN A 1 558 ? -9.211  -14.018 39.473 1.00 15.75 ? 558  ASN A CB    1 
ATOM   4610 C  CG    . ASN A 1 558 ? -8.057  -14.569 38.669 1.00 15.28 ? 558  ASN A CG    1 
ATOM   4611 O  OD1   . ASN A 1 558 ? -7.160  -13.820 38.282 1.00 16.87 ? 558  ASN A OD1   1 
ATOM   4612 N  ND2   . ASN A 1 558 ? -8.045  -15.880 38.453 1.00 13.94 ? 558  ASN A ND2   1 
ATOM   4613 N  N     . ARG A 1 559 ? -10.378 -12.934 42.495 1.00 14.17 ? 559  ARG A N     1 
ATOM   4614 C  CA    . ARG A 1 559 ? -11.133 -12.035 43.355 1.00 13.56 ? 559  ARG A CA    1 
ATOM   4615 C  C     . ARG A 1 559 ? -10.169 -11.199 44.195 1.00 14.23 ? 559  ARG A C     1 
ATOM   4616 O  O     . ARG A 1 559 ? -10.388 -10.002 44.362 1.00 12.58 ? 559  ARG A O     1 
ATOM   4617 C  CB    . ARG A 1 559 ? -12.156 -12.793 44.203 1.00 13.70 ? 559  ARG A CB    1 
ATOM   4618 C  CG    . ARG A 1 559 ? -13.383 -13.208 43.382 1.00 13.51 ? 559  ARG A CG    1 
ATOM   4619 C  CD    . ARG A 1 559 ? -14.321 -14.132 44.158 1.00 18.38 ? 559  ARG A CD    1 
ATOM   4620 N  NE    . ARG A 1 559 ? -15.544 -14.441 43.406 1.00 19.19 ? 559  ARG A NE    1 
ATOM   4621 C  CZ    . ARG A 1 559 ? -15.649 -15.373 42.456 1.00 21.00 ? 559  ARG A CZ    1 
ATOM   4622 N  NH1   . ARG A 1 559 ? -14.603 -16.111 42.099 1.00 18.25 ? 559  ARG A NH1   1 
ATOM   4623 N  NH2   . ARG A 1 559 ? -16.816 -15.569 41.851 1.00 19.87 ? 559  ARG A NH2   1 
ATOM   4624 N  N     . LYS A 1 560 ? -9.086  -11.819 44.672 1.00 15.28 ? 560  LYS A N     1 
ATOM   4625 C  CA    . LYS A 1 560 ? -7.974  -11.075 45.281 1.00 15.21 ? 560  LYS A CA    1 
ATOM   4626 C  C     . LYS A 1 560 ? -7.440  -10.027 44.290 1.00 14.37 ? 560  LYS A C     1 
ATOM   4627 O  O     . LYS A 1 560 ? -7.217  -8.869  44.658 1.00 14.93 ? 560  LYS A O     1 
ATOM   4628 C  CB    . LYS A 1 560 ? -6.849  -12.027 45.718 1.00 15.47 ? 560  LYS A CB    1 
ATOM   4629 C  CG    . LYS A 1 560 ? -5.504  -11.340 45.965 1.00 15.61 ? 560  LYS A CG    1 
ATOM   4630 C  CD    . LYS A 1 560 ? -4.400  -12.350 46.285 1.00 18.13 ? 560  LYS A CD    1 
ATOM   4631 C  CE    . LYS A 1 560 ? -3.062  -11.641 46.359 1.00 20.57 ? 560  LYS A CE    1 
ATOM   4632 N  NZ    . LYS A 1 560 ? -1.940  -12.603 46.554 1.00 27.45 ? 560  LYS A NZ    1 
ATOM   4633 N  N     . ALA A 1 561 ? -7.246  -10.433 43.034 1.00 13.22 ? 561  ALA A N     1 
ATOM   4634 C  CA    . ALA A 1 561 ? -6.742  -9.514  42.009 1.00 14.56 ? 561  ALA A CA    1 
ATOM   4635 C  C     . ALA A 1 561 ? -7.684  -8.329  41.787 1.00 14.99 ? 561  ALA A C     1 
ATOM   4636 O  O     . ALA A 1 561 ? -7.235  -7.195  41.637 1.00 13.94 ? 561  ALA A O     1 
ATOM   4637 C  CB    . ALA A 1 561 ? -6.471  -10.256 40.690 1.00 16.26 ? 561  ALA A CB    1 
ATOM   4638 N  N     . LEU A 1 562 ? -8.987  -8.593  41.793 1.00 14.13 ? 562  LEU A N     1 
ATOM   4639 C  CA    . LEU A 1 562 ? -9.987  -7.539  41.626 1.00 14.99 ? 562  LEU A CA    1 
ATOM   4640 C  C     . LEU A 1 562 ? -9.949  -6.509  42.765 1.00 14.13 ? 562  LEU A C     1 
ATOM   4641 O  O     . LEU A 1 562 ? -9.952  -5.308  42.505 1.00 14.71 ? 562  LEU A O     1 
ATOM   4642 C  CB    . LEU A 1 562 ? -11.395 -8.140  41.489 1.00 14.12 ? 562  LEU A CB    1 
ATOM   4643 C  CG    . LEU A 1 562 ? -12.526 -7.145  41.195 1.00 14.72 ? 562  LEU A CG    1 
ATOM   4644 C  CD1   . LEU A 1 562 ? -12.288 -6.397  39.869 1.00 15.30 ? 562  LEU A CD1   1 
ATOM   4645 C  CD2   . LEU A 1 562 ? -13.863 -7.861  41.189 1.00 17.10 ? 562  LEU A CD2   1 
ATOM   4646 N  N     . ILE A 1 563 ? -9.910  -6.975  44.014 1.00 13.42 ? 563  ILE A N     1 
ATOM   4647 C  CA    . ILE A 1 563 ? -9.900  -6.053  45.158 1.00 13.95 ? 563  ILE A CA    1 
ATOM   4648 C  C     . ILE A 1 563 ? -8.575  -5.295  45.283 1.00 14.56 ? 563  ILE A C     1 
ATOM   4649 O  O     . ILE A 1 563 ? -8.578  -4.108  45.579 1.00 15.03 ? 563  ILE A O     1 
ATOM   4650 C  CB    . ILE A 1 563 ? -10.325 -6.716  46.508 1.00 14.26 ? 563  ILE A CB    1 
ATOM   4651 C  CG1   . ILE A 1 563 ? -9.454  -7.931  46.854 1.00 14.62 ? 563  ILE A CG1   1 
ATOM   4652 C  CG2   . ILE A 1 563 ? -11.804 -7.094  46.453 1.00 15.17 ? 563  ILE A CG2   1 
ATOM   4653 C  CD1   . ILE A 1 563 ? -9.841  -8.625  48.196 1.00 13.64 ? 563  ILE A CD1   1 
ATOM   4654 N  N     . ASN A 1 564 ? -7.452  -5.961  45.006 1.00 14.43 ? 564  ASN A N     1 
ATOM   4655 C  CA    . ASN A 1 564 ? -6.166  -5.256  44.969 1.00 14.20 ? 564  ASN A CA    1 
ATOM   4656 C  C     . ASN A 1 564 ? -6.115  -4.268  43.806 1.00 15.74 ? 564  ASN A C     1 
ATOM   4657 O  O     . ASN A 1 564 ? -5.457  -3.221  43.892 1.00 14.48 ? 564  ASN A O     1 
ATOM   4658 C  CB    . ASN A 1 564 ? -4.989  -6.234  44.913 1.00 14.12 ? 564  ASN A CB    1 
ATOM   4659 C  CG    . ASN A 1 564 ? -4.804  -6.998  46.216 1.00 14.40 ? 564  ASN A CG    1 
ATOM   4660 O  OD1   . ASN A 1 564 ? -5.350  -6.619  47.249 1.00 17.58 ? 564  ASN A OD1   1 
ATOM   4661 N  ND2   . ASN A 1 564 ? -4.033  -8.079  46.170 1.00 14.96 ? 564  ASN A ND2   1 
ATOM   4662 N  N     . GLY A 1 565 ? -6.833  -4.608  42.736 1.00 15.42 ? 565  GLY A N     1 
ATOM   4663 C  CA    . GLY A 1 565 ? -6.987  -3.741  41.564 1.00 16.53 ? 565  GLY A CA    1 
ATOM   4664 C  C     . GLY A 1 565 ? -7.741  -2.452  41.865 1.00 16.63 ? 565  GLY A C     1 
ATOM   4665 O  O     . GLY A 1 565 ? -7.504  -1.434  41.224 1.00 16.72 ? 565  GLY A O     1 
ATOM   4666 N  N     . LEU A 1 566 ? -8.649  -2.494  42.837 1.00 15.74 ? 566  LEU A N     1 
ATOM   4667 C  CA    . LEU A 1 566 ? -9.323  -1.272  43.283 1.00 16.20 ? 566  LEU A CA    1 
ATOM   4668 C  C     . LEU A 1 566 ? -8.333  -0.306  43.959 1.00 16.35 ? 566  LEU A C     1 
ATOM   4669 O  O     . LEU A 1 566 ? -8.348  0.892   43.679 1.00 15.56 ? 566  LEU A O     1 
ATOM   4670 C  CB    . LEU A 1 566 ? -10.510 -1.594  44.197 1.00 16.47 ? 566  LEU A CB    1 
ATOM   4671 C  CG    . LEU A 1 566 ? -11.347 -0.427  44.740 1.00 15.40 ? 566  LEU A CG    1 
ATOM   4672 C  CD1   . LEU A 1 566 ? -11.763 0.538   43.611 1.00 15.86 ? 566  LEU A CD1   1 
ATOM   4673 C  CD2   . LEU A 1 566 ? -12.574 -0.978  45.464 1.00 14.95 ? 566  LEU A CD2   1 
ATOM   4674 N  N     . ALA A 1 567 ? -7.467  -0.828  44.828 1.00 15.43 ? 567  ALA A N     1 
ATOM   4675 C  CA    . ALA A 1 567 ? -6.398  -0.010  45.429 1.00 16.72 ? 567  ALA A CA    1 
ATOM   4676 C  C     . ALA A 1 567 ? -5.497  0.622   44.357 1.00 16.00 ? 567  ALA A C     1 
ATOM   4677 O  O     . ALA A 1 567 ? -5.129  1.798   44.451 1.00 15.40 ? 567  ALA A O     1 
ATOM   4678 C  CB    . ALA A 1 567 ? -5.571  -0.839  46.410 1.00 17.68 ? 567  ALA A CB    1 
ATOM   4679 N  N     . GLY A 1 568 ? -5.145  -0.160  43.341 1.00 15.44 ? 568  GLY A N     1 
ATOM   4680 C  CA    . GLY A 1 568 ? -4.336  0.347   42.227 1.00 15.76 ? 568  GLY A CA    1 
ATOM   4681 C  C     . GLY A 1 568 ? -5.084  1.327   41.342 1.00 16.07 ? 568  GLY A C     1 
ATOM   4682 O  O     . GLY A 1 568 ? -4.498  2.296   40.829 1.00 15.88 ? 568  GLY A O     1 
ATOM   4683 N  N     . ALA A 1 569 ? -6.381  1.084   41.156 1.00 14.95 ? 569  ALA A N     1 
ATOM   4684 C  CA    . ALA A 1 569 ? -7.212  1.958   40.312 1.00 15.93 ? 569  ALA A CA    1 
ATOM   4685 C  C     . ALA A 1 569 ? -7.283  3.384   40.869 1.00 17.71 ? 569  ALA A C     1 
ATOM   4686 O  O     . ALA A 1 569 ? -7.364  4.354   40.113 1.00 16.76 ? 569  ALA A O     1 
ATOM   4687 C  CB    . ALA A 1 569 ? -8.610  1.369   40.132 1.00 17.48 ? 569  ALA A CB    1 
ATOM   4688 N  N     . LEU A 1 570 ? -7.216  3.507   42.192 1.00 16.04 ? 570  LEU A N     1 
ATOM   4689 C  CA    . LEU A 1 570 ? -7.162  4.816   42.845 1.00 15.91 ? 570  LEU A CA    1 
ATOM   4690 C  C     . LEU A 1 570 ? -5.933  5.617   42.409 1.00 15.67 ? 570  LEU A C     1 
ATOM   4691 O  O     . LEU A 1 570 ? -5.908  6.844   42.537 1.00 15.05 ? 570  LEU A O     1 
ATOM   4692 C  CB    . LEU A 1 570 ? -7.175  4.652   44.369 1.00 16.29 ? 570  LEU A CB    1 
ATOM   4693 C  CG    . LEU A 1 570 ? -8.465  4.095   44.973 1.00 15.64 ? 570  LEU A CG    1 
ATOM   4694 C  CD1   . LEU A 1 570 ? -8.245  3.693   46.424 1.00 18.43 ? 570  LEU A CD1   1 
ATOM   4695 C  CD2   . LEU A 1 570 ? -9.598  5.110   44.868 1.00 19.63 ? 570  LEU A CD2   1 
ATOM   4696 N  N     . GLY A 1 571 ? -4.930  4.910   41.885 1.00 15.42 ? 571  GLY A N     1 
ATOM   4697 C  CA    . GLY A 1 571 ? -3.726  5.531   41.338 1.00 15.30 ? 571  GLY A CA    1 
ATOM   4698 C  C     . GLY A 1 571 ? -3.626  5.509   39.814 1.00 18.02 ? 571  GLY A C     1 
ATOM   4699 O  O     . GLY A 1 571 ? -2.539  5.696   39.258 1.00 20.56 ? 571  GLY A O     1 
ATOM   4700 N  N     . ASN A 1 572 ? -4.747  5.266   39.139 1.00 15.99 ? 572  ASN A N     1 
ATOM   4701 C  CA    . ASN A 1 572 ? -4.794  5.334   37.673 1.00 17.23 ? 572  ASN A CA    1 
ATOM   4702 C  C     . ASN A 1 572 ? -5.631  6.517   37.205 1.00 16.59 ? 572  ASN A C     1 
ATOM   4703 O  O     . ASN A 1 572 ? -6.794  6.656   37.601 1.00 16.19 ? 572  ASN A O     1 
ATOM   4704 C  CB    . ASN A 1 572 ? -5.331  4.024   37.088 1.00 19.13 ? 572  ASN A CB    1 
ATOM   4705 C  CG    . ASN A 1 572 ? -5.447  4.070   35.567 1.00 21.54 ? 572  ASN A CG    1 
ATOM   4706 O  OD1   . ASN A 1 572 ? -6.356  4.694   35.028 1.00 26.44 ? 572  ASN A OD1   1 
ATOM   4707 N  ND2   . ASN A 1 572 ? -4.531  3.405   34.878 1.00 23.84 ? 572  ASN A ND2   1 
ATOM   4708 N  N     . VAL A 1 573 ? -5.041  7.361   36.354 1.00 17.91 ? 573  VAL A N     1 
ATOM   4709 C  CA    . VAL A 1 573 ? -5.662  8.621   35.921 1.00 18.78 ? 573  VAL A CA    1 
ATOM   4710 C  C     . VAL A 1 573 ? -7.015  8.496   35.195 1.00 19.07 ? 573  VAL A C     1 
ATOM   4711 O  O     . VAL A 1 573 ? -7.758  9.481   35.104 1.00 20.34 ? 573  VAL A O     1 
ATOM   4712 C  CB    . VAL A 1 573 ? -4.683  9.497   35.066 1.00 21.39 ? 573  VAL A CB    1 
ATOM   4713 C  CG1   . VAL A 1 573 ? -3.465  9.908   35.898 1.00 21.36 ? 573  VAL A CG1   1 
ATOM   4714 C  CG2   . VAL A 1 573 ? -4.257  8.767   33.789 1.00 21.13 ? 573  VAL A CG2   1 
ATOM   4715 N  N     . TRP A 1 574 ? -7.330  7.305   34.689 1.00 18.71 ? 574  TRP A N     1 
ATOM   4716 C  CA    . TRP A 1 574 ? -8.591  7.084   33.966 1.00 21.83 ? 574  TRP A CA    1 
ATOM   4717 C  C     . TRP A 1 574 ? -9.733  6.585   34.858 1.00 19.72 ? 574  TRP A C     1 
ATOM   4718 O  O     . TRP A 1 574 ? -10.875 6.475   34.407 1.00 19.76 ? 574  TRP A O     1 
ATOM   4719 C  CB    . TRP A 1 574 ? -8.380  6.128   32.787 1.00 23.64 ? 574  TRP A CB    1 
ATOM   4720 C  CG    . TRP A 1 574 ? -7.349  6.616   31.818 1.00 29.37 ? 574  TRP A CG    1 
ATOM   4721 C  CD1   . TRP A 1 574 ? -6.061  6.174   31.700 1.00 34.19 ? 574  TRP A CD1   1 
ATOM   4722 C  CD2   . TRP A 1 574 ? -7.510  7.651   30.842 1.00 33.39 ? 574  TRP A CD2   1 
ATOM   4723 N  NE1   . TRP A 1 574 ? -5.412  6.865   30.702 1.00 35.90 ? 574  TRP A NE1   1 
ATOM   4724 C  CE2   . TRP A 1 574 ? -6.277  7.779   30.161 1.00 35.99 ? 574  TRP A CE2   1 
ATOM   4725 C  CE3   . TRP A 1 574 ? -8.577  8.480   30.472 1.00 36.69 ? 574  TRP A CE3   1 
ATOM   4726 C  CZ2   . TRP A 1 574 ? -6.082  8.703   29.127 1.00 38.88 ? 574  TRP A CZ2   1 
ATOM   4727 C  CZ3   . TRP A 1 574 ? -8.382  9.404   29.443 1.00 40.09 ? 574  TRP A CZ3   1 
ATOM   4728 C  CH2   . TRP A 1 574 ? -7.143  9.504   28.784 1.00 40.92 ? 574  TRP A CH2   1 
ATOM   4729 N  N     . PHE A 1 575 ? -9.425  6.285   36.115 1.00 18.98 ? 575  PHE A N     1 
ATOM   4730 C  CA    . PHE A 1 575 ? -10.444 5.866   37.077 1.00 16.82 ? 575  PHE A CA    1 
ATOM   4731 C  C     . PHE A 1 575 ? -11.244 7.081   37.525 1.00 17.69 ? 575  PHE A C     1 
ATOM   4732 O  O     . PHE A 1 575 ? -10.669 8.129   37.851 1.00 17.62 ? 575  PHE A O     1 
ATOM   4733 C  CB    . PHE A 1 575 ? -9.771  5.212   38.283 1.00 18.16 ? 575  PHE A CB    1 
ATOM   4734 C  CG    . PHE A 1 575 ? -10.710 4.492   39.217 1.00 15.15 ? 575  PHE A CG    1 
ATOM   4735 C  CD1   . PHE A 1 575 ? -11.737 3.691   38.732 1.00 17.86 ? 575  PHE A CD1   1 
ATOM   4736 C  CD2   . PHE A 1 575 ? -10.525 4.579   40.595 1.00 15.73 ? 575  PHE A CD2   1 
ATOM   4737 C  CE1   . PHE A 1 575 ? -12.584 3.001   39.601 1.00 18.31 ? 575  PHE A CE1   1 
ATOM   4738 C  CE2   . PHE A 1 575 ? -11.363 3.887   41.477 1.00 17.78 ? 575  PHE A CE2   1 
ATOM   4739 C  CZ    . PHE A 1 575 ? -12.393 3.099   40.977 1.00 15.84 ? 575  PHE A CZ    1 
ATOM   4740 N  N     . ARG A 1 576 ? -12.569 6.935   37.553 1.00 17.33 ? 576  ARG A N     1 
ATOM   4741 C  CA    . ARG A 1 576 ? -13.470 8.003   38.011 1.00 17.25 ? 576  ARG A CA    1 
ATOM   4742 C  C     . ARG A 1 576 ? -13.098 8.523   39.402 1.00 18.11 ? 576  ARG A C     1 
ATOM   4743 O  O     . ARG A 1 576 ? -13.267 9.714   39.689 1.00 19.88 ? 576  ARG A O     1 
ATOM   4744 C  CB    . ARG A 1 576 ? -14.917 7.509   38.018 1.00 15.94 ? 576  ARG A CB    1 
ATOM   4745 C  CG    . ARG A 1 576 ? -15.976 8.600   38.205 1.00 17.96 ? 576  ARG A CG    1 
ATOM   4746 C  CD    . ARG A 1 576 ? -17.393 8.012   38.175 1.00 19.12 ? 576  ARG A CD    1 
ATOM   4747 N  NE    . ARG A 1 576 ? -17.665 7.272   36.936 1.00 18.81 ? 576  ARG A NE    1 
ATOM   4748 C  CZ    . ARG A 1 576 ? -18.183 7.793   35.825 1.00 20.89 ? 576  ARG A CZ    1 
ATOM   4749 N  NH1   . ARG A 1 576 ? -18.507 9.081   35.756 1.00 21.74 ? 576  ARG A NH1   1 
ATOM   4750 N  NH2   . ARG A 1 576 ? -18.386 7.008   34.772 1.00 19.38 ? 576  ARG A NH2   1 
ATOM   4751 N  N     . TYR A 1 577 ? -12.590 7.634   40.252 1.00 16.61 ? 577  TYR A N     1 
ATOM   4752 C  CA    . TYR A 1 577 ? -12.268 7.979   41.641 1.00 17.42 ? 577  TYR A CA    1 
ATOM   4753 C  C     . TYR A 1 577 ? -10.760 8.057   41.877 1.00 17.69 ? 577  TYR A C     1 
ATOM   4754 O  O     . TYR A 1 577 ? -10.292 7.872   42.996 1.00 17.39 ? 577  TYR A O     1 
ATOM   4755 C  CB    . TYR A 1 577 ? -12.965 7.001   42.611 1.00 16.47 ? 577  TYR A CB    1 
ATOM   4756 C  CG    . TYR A 1 577 ? -14.439 6.865   42.305 1.00 16.39 ? 577  TYR A CG    1 
ATOM   4757 C  CD1   . TYR A 1 577 ? -14.929 5.770   41.588 1.00 17.04 ? 577  TYR A CD1   1 
ATOM   4758 C  CD2   . TYR A 1 577 ? -15.340 7.855   42.695 1.00 16.98 ? 577  TYR A CD2   1 
ATOM   4759 C  CE1   . TYR A 1 577 ? -16.286 5.669   41.272 1.00 17.92 ? 577  TYR A CE1   1 
ATOM   4760 C  CE2   . TYR A 1 577 ? -16.687 7.757   42.398 1.00 17.16 ? 577  TYR A CE2   1 
ATOM   4761 C  CZ    . TYR A 1 577 ? -17.154 6.669   41.682 1.00 16.20 ? 577  TYR A CZ    1 
ATOM   4762 O  OH    . TYR A 1 577 ? -18.493 6.584   41.391 1.00 18.90 ? 577  TYR A OH    1 
ATOM   4763 N  N     . TYR A 1 578 ? -10.010 8.339   40.808 1.00 17.92 ? 578  TYR A N     1 
ATOM   4764 C  CA    . TYR A 1 578 ? -8.574  8.611   40.918 1.00 17.95 ? 578  TYR A CA    1 
ATOM   4765 C  C     . TYR A 1 578 ? -8.303  9.679   41.970 1.00 17.55 ? 578  TYR A C     1 
ATOM   4766 O  O     . TYR A 1 578 ? -8.905  10.759  41.942 1.00 16.72 ? 578  TYR A O     1 
ATOM   4767 C  CB    . TYR A 1 578 ? -8.014  9.077   39.571 1.00 17.83 ? 578  TYR A CB    1 
ATOM   4768 C  CG    . TYR A 1 578 ? -6.582  9.573   39.627 1.00 19.52 ? 578  TYR A CG    1 
ATOM   4769 C  CD1   . TYR A 1 578 ? -6.299  10.941  39.678 1.00 21.85 ? 578  TYR A CD1   1 
ATOM   4770 C  CD2   . TYR A 1 578 ? -5.510  8.674   39.633 1.00 19.11 ? 578  TYR A CD2   1 
ATOM   4771 C  CE1   . TYR A 1 578 ? -4.989  11.401  39.720 1.00 23.24 ? 578  TYR A CE1   1 
ATOM   4772 C  CE2   . TYR A 1 578 ? -4.192  9.124   39.670 1.00 20.12 ? 578  TYR A CE2   1 
ATOM   4773 C  CZ    . TYR A 1 578 ? -3.941  10.488  39.712 1.00 22.32 ? 578  TYR A CZ    1 
ATOM   4774 O  OH    . TYR A 1 578 ? -2.644  10.940  39.749 1.00 21.93 ? 578  TYR A OH    1 
ATOM   4775 N  N     . ASP A 1 579 ? -7.393  9.372   42.892 1.00 17.37 ? 579  ASP A N     1 
ATOM   4776 C  CA    . ASP A 1 579 ? -6.999  10.307  43.938 1.00 17.08 ? 579  ASP A CA    1 
ATOM   4777 C  C     . ASP A 1 579 ? -5.724  9.811   44.609 1.00 17.65 ? 579  ASP A C     1 
ATOM   4778 O  O     . ASP A 1 579 ? -5.756  8.848   45.377 1.00 15.57 ? 579  ASP A O     1 
ATOM   4779 C  CB    . ASP A 1 579 ? -8.123  10.455  44.977 1.00 18.24 ? 579  ASP A CB    1 
ATOM   4780 C  CG    . ASP A 1 579 ? -7.972  11.709  45.830 1.00 19.82 ? 579  ASP A CG    1 
ATOM   4781 O  OD1   . ASP A 1 579 ? -9.004  12.238  46.292 1.00 20.82 ? 579  ASP A OD1   1 
ATOM   4782 O  OD2   . ASP A 1 579 ? -6.826  12.170  46.032 1.00 20.70 ? 579  ASP A OD2   1 
ATOM   4783 N  N     . LEU A 1 580 ? -4.606  10.476  44.331 1.00 17.57 ? 580  LEU A N     1 
ATOM   4784 C  CA    A LEU A 1 580 ? -3.322  10.076  44.911 0.50 18.80 ? 580  LEU A CA    1 
ATOM   4785 C  CA    B LEU A 1 580 ? -3.327  10.067  44.910 0.50 17.29 ? 580  LEU A CA    1 
ATOM   4786 C  C     . LEU A 1 580 ? -3.302  10.212  46.432 1.00 16.71 ? 580  LEU A C     1 
ATOM   4787 O  O     . LEU A 1 580 ? -2.504  9.566   47.102 1.00 16.87 ? 580  LEU A O     1 
ATOM   4788 C  CB    A LEU A 1 580 ? -2.161  10.847  44.277 0.50 20.09 ? 580  LEU A CB    1 
ATOM   4789 C  CB    B LEU A 1 580 ? -2.171  10.831  44.269 0.50 17.00 ? 580  LEU A CB    1 
ATOM   4790 C  CG    A LEU A 1 580 ? -1.204  10.028  43.402 0.50 23.81 ? 580  LEU A CG    1 
ATOM   4791 C  CG    B LEU A 1 580 ? -1.926  10.505  42.798 0.50 14.44 ? 580  LEU A CG    1 
ATOM   4792 C  CD1   A LEU A 1 580 ? -1.952  9.020   42.540 0.50 22.75 ? 580  LEU A CD1   1 
ATOM   4793 C  CD1   B LEU A 1 580 ? -0.639  11.169  42.337 0.50 19.82 ? 580  LEU A CD1   1 
ATOM   4794 C  CD2   A LEU A 1 580 ? -0.327  10.937  42.550 0.50 25.18 ? 580  LEU A CD2   1 
ATOM   4795 C  CD2   B LEU A 1 580 ? -1.863  8.994   42.585 0.50 14.96 ? 580  LEU A CD2   1 
ATOM   4796 N  N     . ARG A 1 581 ? -4.181  11.049  46.980 1.00 16.99 ? 581  ARG A N     1 
ATOM   4797 C  CA    . ARG A 1 581 ? -4.292  11.154  48.440 1.00 17.05 ? 581  ARG A CA    1 
ATOM   4798 C  C     . ARG A 1 581 ? -4.752  9.814   49.010 1.00 16.99 ? 581  ARG A C     1 
ATOM   4799 O  O     . ARG A 1 581 ? -4.216  9.344   50.013 1.00 17.81 ? 581  ARG A O     1 
ATOM   4800 C  CB    . ARG A 1 581 ? -5.263  12.256  48.865 1.00 18.50 ? 581  ARG A CB    1 
ATOM   4801 C  CG    . ARG A 1 581 ? -4.833  13.671  48.494 1.00 20.75 ? 581  ARG A CG    1 
ATOM   4802 C  CD    . ARG A 1 581 ? -5.923  14.668  48.861 1.00 24.09 ? 581  ARG A CD    1 
ATOM   4803 N  NE    . ARG A 1 581 ? -7.161  14.413  48.122 1.00 22.39 ? 581  ARG A NE    1 
ATOM   4804 C  CZ    . ARG A 1 581 ? -8.304  15.068  48.306 1.00 24.69 ? 581  ARG A CZ    1 
ATOM   4805 N  NH1   . ARG A 1 581 ? -8.389  16.034  49.217 1.00 21.25 ? 581  ARG A NH1   1 
ATOM   4806 N  NH2   . ARG A 1 581 ? -9.366  14.759  47.573 1.00 22.72 ? 581  ARG A NH2   1 
ATOM   4807 N  N     . ASN A 1 582 ? -5.736  9.203   48.358 1.00 15.34 ? 582  ASN A N     1 
ATOM   4808 C  CA    . ASN A 1 582 ? -6.234  7.896   48.775 1.00 14.60 ? 582  ASN A CA    1 
ATOM   4809 C  C     . ASN A 1 582 ? -5.285  6.750   48.414 1.00 14.92 ? 582  ASN A C     1 
ATOM   4810 O  O     . ASN A 1 582 ? -5.068  5.847   49.217 1.00 14.40 ? 582  ASN A O     1 
ATOM   4811 C  CB    . ASN A 1 582 ? -7.647  7.660   48.223 1.00 15.86 ? 582  ASN A CB    1 
ATOM   4812 C  CG    . ASN A 1 582 ? -8.697  8.503   48.939 1.00 17.35 ? 582  ASN A CG    1 
ATOM   4813 O  OD1   . ASN A 1 582 ? -8.442  9.036   50.018 1.00 16.22 ? 582  ASN A OD1   1 
ATOM   4814 N  ND2   . ASN A 1 582 ? -9.878  8.633   48.338 1.00 15.97 ? 582  ASN A ND2   1 
ATOM   4815 N  N     . ALA A 1 583 ? -4.715  6.794   47.212 1.00 15.41 ? 583  ALA A N     1 
ATOM   4816 C  CA    . ALA A 1 583 ? -3.747  5.773   46.805 1.00 16.86 ? 583  ALA A CA    1 
ATOM   4817 C  C     . ALA A 1 583 ? -2.549  5.728   47.764 1.00 16.65 ? 583  ALA A C     1 
ATOM   4818 O  O     . ALA A 1 583 ? -2.143  4.645   48.200 1.00 15.52 ? 583  ALA A O     1 
ATOM   4819 C  CB    . ALA A 1 583 ? -3.294  5.996   45.364 1.00 14.93 ? 583  ALA A CB    1 
ATOM   4820 N  N     . THR A 1 584 ? -2.014  6.904   48.111 1.00 15.07 ? 584  THR A N     1 
ATOM   4821 C  CA    A THR A 1 584 ? -0.859  7.013   49.004 0.50 16.55 ? 584  THR A CA    1 
ATOM   4822 C  CA    B THR A 1 584 ? -0.859  6.974   49.009 0.50 15.79 ? 584  THR A CA    1 
ATOM   4823 C  C     . THR A 1 584 ? -1.246  6.746   50.464 1.00 15.80 ? 584  THR A C     1 
ATOM   4824 O  O     . THR A 1 584 ? -0.431  6.270   51.251 1.00 15.49 ? 584  THR A O     1 
ATOM   4825 C  CB    A THR A 1 584 ? -0.170  8.394   48.851 0.50 16.47 ? 584  THR A CB    1 
ATOM   4826 C  CB    B THR A 1 584 ? -0.070  8.295   48.879 0.50 15.01 ? 584  THR A CB    1 
ATOM   4827 O  OG1   A THR A 1 584 ? 0.033   8.671   47.459 0.50 18.11 ? 584  THR A OG1   1 
ATOM   4828 O  OG1   B THR A 1 584 ? -0.917  9.402   49.212 0.50 14.99 ? 584  THR A OG1   1 
ATOM   4829 C  CG2   A THR A 1 584 ? 1.174   8.436   49.560 0.50 18.18 ? 584  THR A CG2   1 
ATOM   4830 C  CG2   B THR A 1 584 ? 0.473   8.461   47.464 0.50 15.88 ? 584  THR A CG2   1 
ATOM   4831 N  N     . ALA A 1 585 ? -2.493  7.057   50.824 1.00 15.73 ? 585  ALA A N     1 
ATOM   4832 C  CA    . ALA A 1 585 ? -2.974  6.721   52.169 1.00 15.37 ? 585  ALA A CA    1 
ATOM   4833 C  C     . ALA A 1 585 ? -2.873  5.216   52.417 1.00 16.07 ? 585  ALA A C     1 
ATOM   4834 O  O     . ALA A 1 585 ? -2.499  4.789   53.510 1.00 15.40 ? 585  ALA A O     1 
ATOM   4835 C  CB    . ALA A 1 585 ? -4.400  7.217   52.393 1.00 16.41 ? 585  ALA A CB    1 
ATOM   4836 N  N     . ILE A 1 586 ? -3.201  4.424   51.396 1.00 13.56 ? 586  ILE A N     1 
ATOM   4837 C  CA    . ILE A 1 586 ? -3.092  2.965   51.466 1.00 14.01 ? 586  ILE A CA    1 
ATOM   4838 C  C     . ILE A 1 586 ? -1.637  2.516   51.588 1.00 14.08 ? 586  ILE A C     1 
ATOM   4839 O  O     . ILE A 1 586 ? -1.280  1.804   52.533 1.00 14.03 ? 586  ILE A O     1 
ATOM   4840 C  CB    . ILE A 1 586 ? -3.765  2.281   50.245 1.00 15.00 ? 586  ILE A CB    1 
ATOM   4841 C  CG1   . ILE A 1 586 ? -5.263  2.608   50.206 1.00 14.46 ? 586  ILE A CG1   1 
ATOM   4842 C  CG2   . ILE A 1 586 ? -3.544  0.749   50.282 1.00 16.42 ? 586  ILE A CG2   1 
ATOM   4843 C  CD1   . ILE A 1 586 ? -5.903  2.375   48.855 1.00 17.33 ? 586  ILE A CD1   1 
ATOM   4844 N  N     . THR A 1 587 ? -0.798  2.946   50.648 1.00 14.10 ? 587  THR A N     1 
ATOM   4845 C  CA    . THR A 1 587 ? 0.578   2.442   50.576 1.00 13.60 ? 587  THR A CA    1 
ATOM   4846 C  C     . THR A 1 587 ? 1.418   2.881   51.762 1.00 15.00 ? 587  THR A C     1 
ATOM   4847 O  O     . THR A 1 587 ? 2.237   2.105   52.255 1.00 15.56 ? 587  THR A O     1 
ATOM   4848 C  CB    . THR A 1 587 ? 1.290   2.826   49.256 1.00 16.29 ? 587  THR A CB    1 
ATOM   4849 O  OG1   . THR A 1 587 ? 1.431   4.250   49.168 1.00 16.81 ? 587  THR A OG1   1 
ATOM   4850 C  CG2   . THR A 1 587 ? 0.510   2.300   48.040 1.00 15.26 ? 587  THR A CG2   1 
ATOM   4851 N  N     . THR A 1 588 ? 1.188   4.107   52.237 1.00 14.19 ? 588  THR A N     1 
ATOM   4852 C  CA    . THR A 1 588 ? 1.977   4.656   53.336 1.00 14.27 ? 588  THR A CA    1 
ATOM   4853 C  C     . THR A 1 588 ? 1.583   3.958   54.634 1.00 15.08 ? 588  THR A C     1 
ATOM   4854 O  O     . THR A 1 588 ? 2.439   3.635   55.454 1.00 14.77 ? 588  THR A O     1 
ATOM   4855 C  CB    . THR A 1 588 ? 1.817   6.188   53.437 1.00 14.52 ? 588  THR A CB    1 
ATOM   4856 O  OG1   . THR A 1 588 ? 2.094   6.772   52.155 1.00 16.72 ? 588  THR A OG1   1 
ATOM   4857 C  CG2   . THR A 1 588 ? 2.779   6.779   54.458 1.00 15.82 ? 588  THR A CG2   1 
ATOM   4858 N  N     . PHE A 1 589 ? 0.286   3.702   54.803 1.00 14.43 ? 589  PHE A N     1 
ATOM   4859 C  CA    . PHE A 1 589 ? -0.198  2.942   55.966 1.00 16.36 ? 589  PHE A CA    1 
ATOM   4860 C  C     . PHE A 1 589 ? 0.432   1.548   55.975 1.00 16.15 ? 589  PHE A C     1 
ATOM   4861 O  O     . PHE A 1 589 ? 0.842   1.045   57.029 1.00 16.29 ? 589  PHE A O     1 
ATOM   4862 C  CB    . PHE A 1 589 ? -1.730  2.846   55.926 1.00 15.45 ? 589  PHE A CB    1 
ATOM   4863 C  CG    . PHE A 1 589 ? -2.353  2.263   57.176 1.00 15.44 ? 589  PHE A CG    1 
ATOM   4864 C  CD1   . PHE A 1 589 ? -2.423  0.885   57.368 1.00 17.84 ? 589  PHE A CD1   1 
ATOM   4865 C  CD2   . PHE A 1 589 ? -2.906  3.101   58.142 1.00 15.65 ? 589  PHE A CD2   1 
ATOM   4866 C  CE1   . PHE A 1 589 ? -3.024  0.347   58.527 1.00 13.65 ? 589  PHE A CE1   1 
ATOM   4867 C  CE2   . PHE A 1 589 ? -3.499  2.579   59.298 1.00 14.68 ? 589  PHE A CE2   1 
ATOM   4868 C  CZ    . PHE A 1 589 ? -3.565  1.204   59.483 1.00 16.16 ? 589  PHE A CZ    1 
ATOM   4869 N  N     . GLY A 1 590 ? 0.513   0.933   54.796 1.00 16.59 ? 590  GLY A N     1 
ATOM   4870 C  CA    . GLY A 1 590 ? 1.162   -0.368  54.633 1.00 16.85 ? 590  GLY A CA    1 
ATOM   4871 C  C     . GLY A 1 590 ? 2.619   -0.358  55.062 1.00 15.29 ? 590  GLY A C     1 
ATOM   4872 O  O     . GLY A 1 590 ? 3.070   -1.281  55.744 1.00 16.23 ? 590  GLY A O     1 
ATOM   4873 N  N     . GLN A 1 591 ? 3.356   0.684   54.669 1.00 14.55 ? 591  GLN A N     1 
ATOM   4874 C  CA    . GLN A 1 591 ? 4.761   0.836   55.077 1.00 16.73 ? 591  GLN A CA    1 
ATOM   4875 C  C     . GLN A 1 591 ? 4.878   0.905   56.598 1.00 17.05 ? 591  GLN A C     1 
ATOM   4876 O  O     . GLN A 1 591 ? 5.729   0.243   57.200 1.00 19.68 ? 591  GLN A O     1 
ATOM   4877 C  CB    . GLN A 1 591 ? 5.386   2.088   54.460 1.00 17.06 ? 591  GLN A CB    1 
ATOM   4878 C  CG    . GLN A 1 591 ? 5.598   2.020   52.947 1.00 19.26 ? 591  GLN A CG    1 
ATOM   4879 C  CD    . GLN A 1 591 ? 6.872   2.727   52.524 1.00 26.81 ? 591  GLN A CD    1 
ATOM   4880 O  OE1   . GLN A 1 591 ? 7.733   3.020   53.355 1.00 30.35 ? 591  GLN A OE1   1 
ATOM   4881 N  NE2   . GLN A 1 591 ? 7.007   2.991   51.229 1.00 24.89 ? 591  GLN A NE2   1 
ATOM   4882 N  N     . MET A 1 592 ? 4.011   1.702   57.213 1.00 16.99 ? 592  MET A N     1 
ATOM   4883 C  CA    . MET A 1 592 ? 3.981   1.828   58.667 1.00 17.44 ? 592  MET A CA    1 
ATOM   4884 C  C     . MET A 1 592 ? 3.645   0.492   59.314 1.00 18.16 ? 592  MET A C     1 
ATOM   4885 O  O     . MET A 1 592 ? 4.334   0.073   60.239 1.00 19.04 ? 592  MET A O     1 
ATOM   4886 C  CB    . MET A 1 592 ? 2.979   2.899   59.105 1.00 15.82 ? 592  MET A CB    1 
ATOM   4887 C  CG    . MET A 1 592 ? 2.872   3.057   60.629 1.00 17.54 ? 592  MET A CG    1 
ATOM   4888 S  SD    . MET A 1 592 ? 1.550   4.175   61.107 1.00 19.89 ? 592  MET A SD    1 
ATOM   4889 C  CE    . MET A 1 592 ? 0.118   3.305   60.463 1.00 20.49 ? 592  MET A CE    1 
ATOM   4890 N  N     . ALA A 1 593 ? 2.606   -0.182  58.814 1.00 17.67 ? 593  ALA A N     1 
ATOM   4891 C  CA    . ALA A 1 593 ? 2.130   -1.431  59.432 1.00 18.42 ? 593  ALA A CA    1 
ATOM   4892 C  C     . ALA A 1 593 ? 3.244   -2.474  59.513 1.00 17.37 ? 593  ALA A C     1 
ATOM   4893 O  O     . ALA A 1 593 ? 3.436   -3.119  60.552 1.00 17.52 ? 593  ALA A O     1 
ATOM   4894 C  CB    . ALA A 1 593 ? 0.914   -1.997  58.668 1.00 15.98 ? 593  ALA A CB    1 
ATOM   4895 N  N     . LEU A 1 594 ? 3.970   -2.633  58.408 1.00 18.12 ? 594  LEU A N     1 
ATOM   4896 C  CA    . LEU A 1 594 ? 5.053   -3.611  58.332 1.00 17.81 ? 594  LEU A CA    1 
ATOM   4897 C  C     . LEU A 1 594 ? 6.168   -3.285  59.329 1.00 18.64 ? 594  LEU A C     1 
ATOM   4898 O  O     . LEU A 1 594 ? 6.605   -4.149  60.090 1.00 18.67 ? 594  LEU A O     1 
ATOM   4899 C  CB    . LEU A 1 594 ? 5.608   -3.697  56.903 1.00 17.64 ? 594  LEU A CB    1 
ATOM   4900 C  CG    . LEU A 1 594 ? 6.762   -4.677  56.654 1.00 20.27 ? 594  LEU A CG    1 
ATOM   4901 C  CD1   . LEU A 1 594 ? 6.404   -6.061  57.143 1.00 21.18 ? 594  LEU A CD1   1 
ATOM   4902 C  CD2   . LEU A 1 594 ? 7.140   -4.715  55.170 1.00 20.54 ? 594  LEU A CD2   1 
ATOM   4903 N  N     . GLN A 1 595 ? 6.613   -2.034  59.326 1.00 17.90 ? 595  GLN A N     1 
ATOM   4904 C  CA    . GLN A 1 595 ? 7.721   -1.618  60.179 1.00 19.07 ? 595  GLN A CA    1 
ATOM   4905 C  C     . GLN A 1 595 ? 7.327   -1.518  61.651 1.00 19.55 ? 595  GLN A C     1 
ATOM   4906 O  O     . GLN A 1 595 ? 8.144   -1.789  62.536 1.00 20.54 ? 595  GLN A O     1 
ATOM   4907 C  CB    . GLN A 1 595 ? 8.345   -0.334  59.642 1.00 19.59 ? 595  GLN A CB    1 
ATOM   4908 C  CG    . GLN A 1 595 ? 8.982   -0.583  58.258 1.00 21.02 ? 595  GLN A CG    1 
ATOM   4909 C  CD    . GLN A 1 595 ? 9.444   0.677   57.557 1.00 23.39 ? 595  GLN A CD    1 
ATOM   4910 O  OE1   . GLN A 1 595 ? 10.592  1.090   57.702 1.00 25.65 ? 595  GLN A OE1   1 
ATOM   4911 N  NE2   . GLN A 1 595 ? 8.555   1.285   56.776 1.00 22.75 ? 595  GLN A NE2   1 
ATOM   4912 N  N     . TRP A 1 596 ? 6.068   -1.160  61.899 1.00 18.44 ? 596  TRP A N     1 
ATOM   4913 C  CA    . TRP A 1 596 ? 5.501   -1.174  63.245 1.00 19.58 ? 596  TRP A CA    1 
ATOM   4914 C  C     . TRP A 1 596 ? 5.556   -2.588  63.822 1.00 18.09 ? 596  TRP A C     1 
ATOM   4915 O  O     . TRP A 1 596 ? 6.045   -2.795  64.942 1.00 19.83 ? 596  TRP A O     1 
ATOM   4916 C  CB    . TRP A 1 596 ? 4.052   -0.667  63.213 1.00 18.31 ? 596  TRP A CB    1 
ATOM   4917 C  CG    . TRP A 1 596 ? 3.325   -0.737  64.525 1.00 17.90 ? 596  TRP A CG    1 
ATOM   4918 C  CD1   . TRP A 1 596 ? 2.749   -1.842  65.086 1.00 18.55 ? 596  TRP A CD1   1 
ATOM   4919 C  CD2   . TRP A 1 596 ? 3.078   0.348   65.436 1.00 19.06 ? 596  TRP A CD2   1 
ATOM   4920 N  NE1   . TRP A 1 596 ? 2.169   -1.514  66.290 1.00 19.07 ? 596  TRP A NE1   1 
ATOM   4921 C  CE2   . TRP A 1 596 ? 2.349   -0.178  66.523 1.00 17.17 ? 596  TRP A CE2   1 
ATOM   4922 C  CE3   . TRP A 1 596 ? 3.400   1.714   65.434 1.00 19.08 ? 596  TRP A CE3   1 
ATOM   4923 C  CZ2   . TRP A 1 596 ? 1.943   0.614   67.615 1.00 19.18 ? 596  TRP A CZ2   1 
ATOM   4924 C  CZ3   . TRP A 1 596 ? 2.989   2.502   66.508 1.00 20.71 ? 596  TRP A CZ3   1 
ATOM   4925 C  CH2   . TRP A 1 596 ? 2.262   1.949   67.580 1.00 19.00 ? 596  TRP A CH2   1 
ATOM   4926 N  N     . ILE A 1 597 ? 5.062   -3.563  63.060 1.00 18.27 ? 597  ILE A N     1 
ATOM   4927 C  CA    . ILE A 1 597 ? 5.001   -4.935  63.567 1.00 18.15 ? 597  ILE A CA    1 
ATOM   4928 C  C     . ILE A 1 597 ? 6.374   -5.612  63.627 1.00 19.21 ? 597  ILE A C     1 
ATOM   4929 O  O     . ILE A 1 597 ? 6.602   -6.468  64.489 1.00 19.15 ? 597  ILE A O     1 
ATOM   4930 C  CB    . ILE A 1 597 ? 3.925   -5.800  62.844 1.00 17.04 ? 597  ILE A CB    1 
ATOM   4931 C  CG1   . ILE A 1 597 ? 3.319   -6.816  63.817 1.00 15.72 ? 597  ILE A CG1   1 
ATOM   4932 C  CG2   . ILE A 1 597 ? 4.460   -6.444  61.558 1.00 18.68 ? 597  ILE A CG2   1 
ATOM   4933 C  CD1   . ILE A 1 597 ? 2.461   -6.175  64.912 1.00 17.53 ? 597  ILE A CD1   1 
ATOM   4934 N  N     . GLU A 1 598 ? 7.288   -5.210  62.745 1.00 19.73 ? 598  GLU A N     1 
ATOM   4935 C  CA    . GLU A 1 598 ? 8.682   -5.653  62.850 1.00 19.68 ? 598  GLU A CA    1 
ATOM   4936 C  C     . GLU A 1 598 ? 9.226   -5.282  64.228 1.00 20.91 ? 598  GLU A C     1 
ATOM   4937 O  O     . GLU A 1 598 ? 9.816   -6.122  64.909 1.00 22.02 ? 598  GLU A O     1 
ATOM   4938 C  CB    . GLU A 1 598 ? 9.557   -5.042  61.749 1.00 19.62 ? 598  GLU A CB    1 
ATOM   4939 C  CG    . GLU A 1 598 ? 11.062  -5.276  61.950 1.00 20.56 ? 598  GLU A CG    1 
ATOM   4940 C  CD    . GLU A 1 598 ? 11.938  -4.565  60.923 1.00 26.50 ? 598  GLU A CD    1 
ATOM   4941 O  OE1   . GLU A 1 598 ? 11.485  -3.565  60.317 1.00 25.79 ? 598  GLU A OE1   1 
ATOM   4942 O  OE2   . GLU A 1 598 ? 13.094  -5.004  60.731 1.00 26.04 ? 598  GLU A OE2   1 
ATOM   4943 N  N     . ARG A 1 599 ? 9.018   -4.024  64.622 1.00 20.35 ? 599  ARG A N     1 
ATOM   4944 C  CA    . ARG A 1 599 ? 9.452   -3.531  65.932 1.00 21.81 ? 599  ARG A CA    1 
ATOM   4945 C  C     . ARG A 1 599 ? 8.792   -4.301  67.075 1.00 21.80 ? 599  ARG A C     1 
ATOM   4946 O  O     . ARG A 1 599 ? 9.471   -4.715  68.017 1.00 22.32 ? 599  ARG A O     1 
ATOM   4947 C  CB    . ARG A 1 599 ? 9.192   -2.024  66.079 1.00 19.87 ? 599  ARG A CB    1 
ATOM   4948 C  CG    . ARG A 1 599 ? 9.563   -1.480  67.466 1.00 22.54 ? 599  ARG A CG    1 
ATOM   4949 C  CD    . ARG A 1 599 ? 9.329   0.014   67.620 1.00 22.37 ? 599  ARG A CD    1 
ATOM   4950 N  NE    . ARG A 1 599 ? 7.943   0.430   67.379 1.00 24.05 ? 599  ARG A NE    1 
ATOM   4951 C  CZ    . ARG A 1 599 ? 6.977   0.436   68.299 1.00 26.67 ? 599  ARG A CZ    1 
ATOM   4952 N  NH1   . ARG A 1 599 ? 7.220   0.026   69.539 1.00 24.76 ? 599  ARG A NH1   1 
ATOM   4953 N  NH2   . ARG A 1 599 ? 5.759   0.859   67.980 1.00 24.55 ? 599  ARG A NH2   1 
ATOM   4954 N  N     . LYS A 1 600 ? 7.478   -4.496  66.983 1.00 22.16 ? 600  LYS A N     1 
ATOM   4955 C  CA    . LYS A 1 600 ? 6.724   -5.231  68.008 1.00 21.48 ? 600  LYS A CA    1 
ATOM   4956 C  C     . LYS A 1 600 ? 7.159   -6.689  68.134 1.00 22.51 ? 600  LYS A C     1 
ATOM   4957 O  O     . LYS A 1 600 ? 7.274   -7.212  69.246 1.00 23.35 ? 600  LYS A O     1 
ATOM   4958 C  CB    . LYS A 1 600 ? 5.216   -5.157  67.728 1.00 22.56 ? 600  LYS A CB    1 
ATOM   4959 C  CG    . LYS A 1 600 ? 4.608   -3.778  67.959 1.00 21.60 ? 600  LYS A CG    1 
ATOM   4960 C  CD    . LYS A 1 600 ? 4.618   -3.393  69.443 1.00 23.31 ? 600  LYS A CD    1 
ATOM   4961 C  CE    . LYS A 1 600 ? 3.716   -2.184  69.702 1.00 22.97 ? 600  LYS A CE    1 
ATOM   4962 N  NZ    . LYS A 1 600 ? 3.611   -1.884  71.160 1.00 25.28 ? 600  LYS A NZ    1 
ATOM   4963 N  N     . VAL A 1 601 ? 7.394   -7.344  66.997 1.00 20.79 ? 601  VAL A N     1 
ATOM   4964 C  CA    . VAL A 1 601 ? 7.836   -8.738  67.008 1.00 22.37 ? 601  VAL A CA    1 
ATOM   4965 C  C     . VAL A 1 601 ? 9.250   -8.858  67.591 1.00 22.63 ? 601  VAL A C     1 
ATOM   4966 O  O     . VAL A 1 601 ? 9.507   -9.741  68.415 1.00 23.60 ? 601  VAL A O     1 
ATOM   4967 C  CB    . VAL A 1 601 ? 7.707   -9.414  65.612 1.00 22.33 ? 601  VAL A CB    1 
ATOM   4968 C  CG1   . VAL A 1 601 ? 8.488   -10.722 65.564 1.00 20.95 ? 601  VAL A CG1   1 
ATOM   4969 C  CG2   . VAL A 1 601 ? 6.240   -9.680  65.293 1.00 23.56 ? 601  VAL A CG2   1 
ATOM   4970 N  N     . ASN A 1 602 ? 10.150  -7.959  67.193 1.00 21.54 ? 602  ASN A N     1 
ATOM   4971 C  CA    . ASN A 1 602 ? 11.499  -7.913  67.781 1.00 22.40 ? 602  ASN A CA    1 
ATOM   4972 C  C     . ASN A 1 602 ? 11.451  -7.699  69.295 1.00 23.35 ? 602  ASN A C     1 
ATOM   4973 O  O     . ASN A 1 602 ? 12.141  -8.385  70.054 1.00 25.57 ? 602  ASN A O     1 
ATOM   4974 C  CB    . ASN A 1 602 ? 12.358  -6.824  67.122 1.00 22.82 ? 602  ASN A CB    1 
ATOM   4975 C  CG    . ASN A 1 602 ? 12.946  -7.261  65.788 1.00 22.05 ? 602  ASN A CG    1 
ATOM   4976 O  OD1   . ASN A 1 602 ? 13.098  -8.454  65.519 1.00 23.71 ? 602  ASN A OD1   1 
ATOM   4977 N  ND2   . ASN A 1 602 ? 13.288  -6.287  64.945 1.00 21.68 ? 602  ASN A ND2   1 
ATOM   4978 N  N     . GLU A 1 603 ? 10.615  -6.761  69.728 1.00 23.44 ? 603  GLU A N     1 
ATOM   4979 C  CA    . GLU A 1 603 ? 10.458  -6.473  71.156 1.00 24.87 ? 603  GLU A CA    1 
ATOM   4980 C  C     . GLU A 1 603 ? 9.939   -7.694  71.909 1.00 24.89 ? 603  GLU A C     1 
ATOM   4981 O  O     . GLU A 1 603 ? 10.471  -8.034  72.963 1.00 25.76 ? 603  GLU A O     1 
ATOM   4982 C  CB    . GLU A 1 603 ? 9.530   -5.276  71.383 1.00 26.12 ? 603  GLU A CB    1 
ATOM   4983 C  CG    . GLU A 1 603 ? 10.144  -3.915  71.069 1.00 29.54 ? 603  GLU A CG    1 
ATOM   4984 C  CD    . GLU A 1 603 ? 9.124   -2.780  71.116 1.00 31.80 ? 603  GLU A CD    1 
ATOM   4985 O  OE1   . GLU A 1 603 ? 7.946   -3.041  71.444 1.00 33.79 ? 603  GLU A OE1   1 
ATOM   4986 O  OE2   . GLU A 1 603 ? 9.499   -1.623  70.822 1.00 29.21 ? 603  GLU A OE2   1 
ATOM   4987 N  N     . TYR A 1 604 ? 8.917   -8.355  71.358 1.00 25.17 ? 604  TYR A N     1 
ATOM   4988 C  CA    . TYR A 1 604 ? 8.333   -9.533  71.997 1.00 24.39 ? 604  TYR A CA    1 
ATOM   4989 C  C     . TYR A 1 604 ? 9.354   -10.660 72.148 1.00 26.40 ? 604  TYR A C     1 
ATOM   4990 O  O     . TYR A 1 604 ? 9.506   -11.223 73.232 1.00 25.89 ? 604  TYR A O     1 
ATOM   4991 C  CB    . TYR A 1 604 ? 7.087   -10.034 71.254 1.00 26.04 ? 604  TYR A CB    1 
ATOM   4992 C  CG    . TYR A 1 604 ? 6.491   -11.292 71.858 1.00 26.54 ? 604  TYR A CG    1 
ATOM   4993 C  CD1   . TYR A 1 604 ? 6.609   -12.526 71.212 1.00 26.86 ? 604  TYR A CD1   1 
ATOM   4994 C  CD2   . TYR A 1 604 ? 5.824   -11.252 73.085 1.00 30.23 ? 604  TYR A CD2   1 
ATOM   4995 C  CE1   . TYR A 1 604 ? 6.069   -13.689 71.771 1.00 28.73 ? 604  TYR A CE1   1 
ATOM   4996 C  CE2   . TYR A 1 604 ? 5.285   -12.405 73.653 1.00 32.63 ? 604  TYR A CE2   1 
ATOM   4997 C  CZ    . TYR A 1 604 ? 5.413   -13.618 72.993 1.00 32.14 ? 604  TYR A CZ    1 
ATOM   4998 O  OH    . TYR A 1 604 ? 4.878   -14.752 73.559 1.00 31.87 ? 604  TYR A OH    1 
ATOM   4999 N  N     . LEU A 1 605 ? 10.053  -10.986 71.063 1.00 24.94 ? 605  LEU A N     1 
ATOM   5000 C  CA    . LEU A 1 605 ? 10.988  -12.111 71.094 1.00 26.48 ? 605  LEU A CA    1 
ATOM   5001 C  C     . LEU A 1 605 ? 12.243  -11.837 71.927 1.00 27.41 ? 605  LEU A C     1 
ATOM   5002 O  O     . LEU A 1 605 ? 12.777  -12.749 72.561 1.00 29.07 ? 605  LEU A O     1 
ATOM   5003 C  CB    . LEU A 1 605 ? 11.325  -12.588 69.677 1.00 22.93 ? 605  LEU A CB    1 
ATOM   5004 C  CG    . LEU A 1 605 ? 10.139  -13.205 68.923 1.00 24.13 ? 605  LEU A CG    1 
ATOM   5005 C  CD1   . LEU A 1 605 ? 10.498  -13.440 67.467 1.00 23.12 ? 605  LEU A CD1   1 
ATOM   5006 C  CD2   . LEU A 1 605 ? 9.637   -14.493 69.569 1.00 25.35 ? 605  LEU A CD2   1 
ATOM   5007 N  N     . ASN A 1 606 ? 12.703  -10.589 71.948 1.00 27.72 ? 606  ASN A N     1 
ATOM   5008 C  CA    . ASN A 1 606 ? 13.796  -10.212 72.858 1.00 28.95 ? 606  ASN A CA    1 
ATOM   5009 C  C     . ASN A 1 606 ? 13.421  -10.415 74.329 1.00 32.33 ? 606  ASN A C     1 
ATOM   5010 O  O     . ASN A 1 606 ? 14.259  -10.824 75.142 1.00 31.78 ? 606  ASN A O     1 
ATOM   5011 C  CB    . ASN A 1 606 ? 14.244  -8.767  72.616 1.00 30.30 ? 606  ASN A CB    1 
ATOM   5012 C  CG    . ASN A 1 606 ? 15.282  -8.655  71.513 1.00 29.85 ? 606  ASN A CG    1 
ATOM   5013 O  OD1   . ASN A 1 606 ? 16.452  -8.994  71.707 1.00 29.70 ? 606  ASN A OD1   1 
ATOM   5014 N  ND2   . ASN A 1 606 ? 14.859  -8.179  70.350 1.00 31.20 ? 606  ASN A ND2   1 
ATOM   5015 N  N     . GLU A 1 607 ? 12.158  -10.132 74.650 1.00 33.42 ? 607  GLU A N     1 
ATOM   5016 C  CA    . GLU A 1 607 ? 11.615  -10.317 75.992 1.00 37.06 ? 607  GLU A CA    1 
ATOM   5017 C  C     . GLU A 1 607 ? 11.571  -11.797 76.366 1.00 37.54 ? 607  GLU A C     1 
ATOM   5018 O  O     . GLU A 1 607 ? 12.022  -12.180 77.448 1.00 37.21 ? 607  GLU A O     1 
ATOM   5019 C  CB    . GLU A 1 607 ? 10.214  -9.698  76.090 1.00 37.52 ? 607  GLU A CB    1 
ATOM   5020 C  CG    . GLU A 1 607 ? 9.572   -9.779  77.478 1.00 44.13 ? 607  GLU A CG    1 
ATOM   5021 C  CD    . GLU A 1 607 ? 8.110   -9.349  77.476 1.00 48.62 ? 607  GLU A CD    1 
ATOM   5022 O  OE1   . GLU A 1 607 ? 7.293   -9.993  76.782 1.00 51.45 ? 607  GLU A OE1   1 
ATOM   5023 O  OE2   . GLU A 1 607 ? 7.777   -8.370  78.177 1.00 50.85 ? 607  GLU A OE2   1 
ATOM   5024 N  N     . VAL A 1 608 ? 11.039  -12.622 75.466 1.00 37.51 ? 608  VAL A N     1 
ATOM   5025 C  CA    . VAL A 1 608 ? 10.931  -14.061 75.719 1.00 40.21 ? 608  VAL A CA    1 
ATOM   5026 C  C     . VAL A 1 608 ? 12.310  -14.752 75.783 1.00 39.78 ? 608  VAL A C     1 
ATOM   5027 O  O     . VAL A 1 608 ? 12.490  -15.716 76.536 1.00 38.80 ? 608  VAL A O     1 
ATOM   5028 C  CB    . VAL A 1 608 ? 9.944   -14.764 74.730 1.00 41.24 ? 608  VAL A CB    1 
ATOM   5029 C  CG1   . VAL A 1 608 ? 10.575  -14.987 73.367 1.00 42.76 ? 608  VAL A CG1   1 
ATOM   5030 C  CG2   . VAL A 1 608 ? 9.443   -16.084 75.311 1.00 45.25 ? 608  VAL A CG2   1 
ATOM   5031 N  N     . CYS A 1 609 ? 13.280  -14.232 75.030 1.00 38.13 ? 609  CYS A N     1 
ATOM   5032 C  CA    . CYS A 1 609 ? 14.638  -14.792 75.016 1.00 39.19 ? 609  CYS A CA    1 
ATOM   5033 C  C     . CYS A 1 609 ? 15.571  -14.177 76.064 1.00 41.08 ? 609  CYS A C     1 
ATOM   5034 O  O     . CYS A 1 609 ? 16.623  -14.741 76.372 1.00 41.83 ? 609  CYS A O     1 
ATOM   5035 C  CB    . CYS A 1 609 ? 15.255  -14.678 73.620 1.00 37.83 ? 609  CYS A CB    1 
ATOM   5036 S  SG    . CYS A 1 609 ? 14.464  -15.749 72.396 1.00 37.86 ? 609  CYS A SG    1 
ATOM   5037 N  N     . GLY A 1 610 ? 15.182  -13.028 76.608 1.00 42.81 ? 610  GLY A N     1 
ATOM   5038 C  CA    . GLY A 1 610 ? 15.974  -12.345 77.630 1.00 44.50 ? 610  GLY A CA    1 
ATOM   5039 C  C     . GLY A 1 610 ? 17.191  -11.630 77.069 1.00 45.67 ? 610  GLY A C     1 
ATOM   5040 O  O     . GLY A 1 610 ? 18.223  -11.536 77.739 1.00 45.11 ? 610  GLY A O     1 
ATOM   5041 N  N     . THR A 1 611 ? 17.069  -11.132 75.838 1.00 45.33 ? 611  THR A N     1 
ATOM   5042 C  CA    . THR A 1 611 ? 18.141  -10.375 75.185 1.00 46.54 ? 611  THR A CA    1 
ATOM   5043 C  C     . THR A 1 611 ? 17.723  -8.924  74.935 1.00 46.99 ? 611  THR A C     1 
ATOM   5044 O  O     . THR A 1 611 ? 16.634  -8.504  75.344 1.00 47.08 ? 611  THR A O     1 
ATOM   5045 C  CB    . THR A 1 611 ? 18.608  -11.037 73.859 1.00 46.74 ? 611  THR A CB    1 
ATOM   5046 O  OG1   . THR A 1 611 ? 17.476  -11.340 73.033 1.00 45.88 ? 611  THR A OG1   1 
ATOM   5047 C  CG2   . THR A 1 611 ? 19.382  -12.314 74.137 1.00 47.39 ? 611  THR A CG2   1 
ATOM   5048 N  N     . GLU A 1 612 ? 18.593  -8.160  74.279 1.00 47.70 ? 612  GLU A N     1 
ATOM   5049 C  CA    . GLU A 1 612 ? 18.312  -6.757  73.983 1.00 48.47 ? 612  GLU A CA    1 
ATOM   5050 C  C     . GLU A 1 612 ? 18.863  -6.355  72.618 1.00 46.67 ? 612  GLU A C     1 
ATOM   5051 O  O     . GLU A 1 612 ? 20.035  -6.590  72.311 1.00 46.62 ? 612  GLU A O     1 
ATOM   5052 C  CB    . GLU A 1 612 ? 18.880  -5.855  75.087 1.00 51.69 ? 612  GLU A CB    1 
ATOM   5053 C  CG    . GLU A 1 612 ? 18.216  -4.487  75.186 1.00 54.98 ? 612  GLU A CG    1 
ATOM   5054 C  CD    . GLU A 1 612 ? 18.805  -3.624  76.295 1.00 59.90 ? 612  GLU A CD    1 
ATOM   5055 O  OE1   . GLU A 1 612 ? 18.993  -4.133  77.423 1.00 61.82 ? 612  GLU A OE1   1 
ATOM   5056 O  OE2   . GLU A 1 612 ? 19.072  -2.430  76.039 1.00 61.93 ? 612  GLU A OE2   1 
ATOM   5057 N  N     . GLY A 1 613 ? 17.997  -5.769  71.794 1.00 45.02 ? 613  GLY A N     1 
ATOM   5058 C  CA    . GLY A 1 613 ? 18.394  -5.222  70.499 1.00 42.80 ? 613  GLY A CA    1 
ATOM   5059 C  C     . GLY A 1 613 ? 18.710  -6.215  69.393 1.00 41.02 ? 613  GLY A C     1 
ATOM   5060 O  O     . GLY A 1 613 ? 19.168  -5.814  68.321 1.00 40.70 ? 613  GLY A O     1 
ATOM   5061 N  N     . GLU A 1 614 ? 18.467  -7.503  69.639 1.00 39.65 ? 614  GLU A N     1 
ATOM   5062 C  CA    . GLU A 1 614 ? 18.708  -8.535  68.627 1.00 39.61 ? 614  GLU A CA    1 
ATOM   5063 C  C     . GLU A 1 614 ? 17.609  -8.556  67.567 1.00 35.70 ? 614  GLU A C     1 
ATOM   5064 O  O     . GLU A 1 614 ? 16.426  -8.403  67.887 1.00 33.68 ? 614  GLU A O     1 
ATOM   5065 C  CB    . GLU A 1 614 ? 18.825  -9.914  69.268 1.00 42.66 ? 614  GLU A CB    1 
ATOM   5066 C  CG    . GLU A 1 614 ? 19.665  -10.883 68.444 1.00 50.37 ? 614  GLU A CG    1 
ATOM   5067 C  CD    . GLU A 1 614 ? 19.051  -12.262 68.341 1.00 55.34 ? 614  GLU A CD    1 
ATOM   5068 O  OE1   . GLU A 1 614 ? 18.239  -12.623 69.219 1.00 59.20 ? 614  GLU A OE1   1 
ATOM   5069 O  OE2   . GLU A 1 614 ? 19.381  -12.986 67.376 1.00 56.39 ? 614  GLU A OE2   1 
ATOM   5070 N  N     . ALA A 1 615 ? 18.007  -8.762  66.312 1.00 33.02 ? 615  ALA A N     1 
ATOM   5071 C  CA    . ALA A 1 615 ? 17.072  -8.731  65.187 1.00 31.06 ? 615  ALA A CA    1 
ATOM   5072 C  C     . ALA A 1 615 ? 16.502  -10.113 64.858 1.00 29.86 ? 615  ALA A C     1 
ATOM   5073 O  O     . ALA A 1 615 ? 17.147  -10.926 64.190 1.00 31.68 ? 615  ALA A O     1 
ATOM   5074 C  CB    . ALA A 1 615 ? 17.732  -8.108  63.952 1.00 30.75 ? 615  ALA A CB    1 
ATOM   5075 N  N     . PHE A 1 616 ? 15.283  -10.364 65.327 1.00 26.11 ? 616  PHE A N     1 
ATOM   5076 C  CA    . PHE A 1 616 ? 14.569  -11.604 65.026 1.00 23.64 ? 616  PHE A CA    1 
ATOM   5077 C  C     . PHE A 1 616 ? 13.923  -11.554 63.645 1.00 21.92 ? 616  PHE A C     1 
ATOM   5078 O  O     . PHE A 1 616 ? 13.917  -12.551 62.914 1.00 21.80 ? 616  PHE A O     1 
ATOM   5079 C  CB    . PHE A 1 616 ? 13.517  -11.883 66.098 1.00 22.38 ? 616  PHE A CB    1 
ATOM   5080 C  CG    . PHE A 1 616 ? 14.097  -12.359 67.405 1.00 24.03 ? 616  PHE A CG    1 
ATOM   5081 C  CD1   . PHE A 1 616 ? 14.200  -13.719 67.675 1.00 22.86 ? 616  PHE A CD1   1 
ATOM   5082 C  CD2   . PHE A 1 616 ? 14.535  -11.445 68.365 1.00 23.19 ? 616  PHE A CD2   1 
ATOM   5083 C  CE1   . PHE A 1 616 ? 14.735  -14.171 68.886 1.00 25.19 ? 616  PHE A CE1   1 
ATOM   5084 C  CE2   . PHE A 1 616 ? 15.073  -11.886 69.580 1.00 27.64 ? 616  PHE A CE2   1 
ATOM   5085 C  CZ    . PHE A 1 616 ? 15.170  -13.253 69.838 1.00 26.47 ? 616  PHE A CZ    1 
ATOM   5086 N  N     . VAL A 1 617 ? 13.387  -10.393 63.281 1.00 20.93 ? 617  VAL A N     1 
ATOM   5087 C  CA    . VAL A 1 617 ? 12.824  -10.217 61.940 1.00 19.96 ? 617  VAL A CA    1 
ATOM   5088 C  C     . VAL A 1 617 ? 13.970  -10.001 60.958 1.00 19.89 ? 617  VAL A C     1 
ATOM   5089 O  O     . VAL A 1 617 ? 14.658  -8.983  61.009 1.00 19.95 ? 617  VAL A O     1 
ATOM   5090 C  CB    . VAL A 1 617 ? 11.802  -9.053  61.878 1.00 19.86 ? 617  VAL A CB    1 
ATOM   5091 C  CG1   . VAL A 1 617 ? 11.282  -8.848  60.445 1.00 18.68 ? 617  VAL A CG1   1 
ATOM   5092 C  CG2   . VAL A 1 617 ? 10.643  -9.305  62.845 1.00 22.42 ? 617  VAL A CG2   1 
ATOM   5093 N  N     . LEU A 1 618 ? 14.187  -10.980 60.080 1.00 19.97 ? 618  LEU A N     1 
ATOM   5094 C  CA    . LEU A 1 618 ? 15.322  -10.948 59.162 1.00 19.27 ? 618  LEU A CA    1 
ATOM   5095 C  C     . LEU A 1 618 ? 14.965  -10.304 57.830 1.00 18.61 ? 618  LEU A C     1 
ATOM   5096 O  O     . LEU A 1 618 ? 15.853  -9.883  57.079 1.00 18.90 ? 618  LEU A O     1 
ATOM   5097 C  CB    . LEU A 1 618 ? 15.859  -12.365 58.926 1.00 20.06 ? 618  LEU A CB    1 
ATOM   5098 C  CG    . LEU A 1 618 ? 14.921  -13.327 58.190 1.00 18.05 ? 618  LEU A CG    1 
ATOM   5099 C  CD1   . LEU A 1 618 ? 15.424  -13.559 56.772 1.00 18.36 ? 618  LEU A CD1   1 
ATOM   5100 C  CD2   . LEU A 1 618 ? 14.800  -14.654 58.918 1.00 20.94 ? 618  LEU A CD2   1 
ATOM   5101 N  N     . TYR A 1 619 ? 13.667  -10.252 57.536 1.00 17.87 ? 619  TYR A N     1 
ATOM   5102 C  CA    . TYR A 1 619 ? 13.175  -9.798  56.242 1.00 16.73 ? 619  TYR A CA    1 
ATOM   5103 C  C     . TYR A 1 619 ? 11.685  -9.503  56.278 1.00 16.77 ? 619  TYR A C     1 
ATOM   5104 O  O     . TYR A 1 619 ? 10.936  -10.058 57.087 1.00 17.08 ? 619  TYR A O     1 
ATOM   5105 C  CB    . TYR A 1 619 ? 13.451  -10.857 55.163 1.00 16.94 ? 619  TYR A CB    1 
ATOM   5106 C  CG    . TYR A 1 619 ? 13.059  -10.436 53.764 1.00 16.90 ? 619  TYR A CG    1 
ATOM   5107 C  CD1   . TYR A 1 619 ? 12.016  -11.071 53.089 1.00 17.15 ? 619  TYR A CD1   1 
ATOM   5108 C  CD2   . TYR A 1 619 ? 13.736  -9.400  53.114 1.00 19.42 ? 619  TYR A CD2   1 
ATOM   5109 C  CE1   . TYR A 1 619 ? 11.661  -10.693 51.791 1.00 15.42 ? 619  TYR A CE1   1 
ATOM   5110 C  CE2   . TYR A 1 619 ? 13.383  -9.008  51.826 1.00 18.62 ? 619  TYR A CE2   1 
ATOM   5111 C  CZ    . TYR A 1 619 ? 12.351  -9.655  51.175 1.00 17.96 ? 619  TYR A CZ    1 
ATOM   5112 O  OH    . TYR A 1 619 ? 12.023  -9.256  49.905 1.00 16.91 ? 619  TYR A OH    1 
ATOM   5113 N  N     . GLY A 1 620 ? 11.263  -8.621  55.385 1.00 17.80 ? 620  GLY A N     1 
ATOM   5114 C  CA    . GLY A 1 620 ? 9.856   -8.348  55.183 1.00 18.43 ? 620  GLY A CA    1 
ATOM   5115 C  C     . GLY A 1 620 ? 9.675   -7.680  53.840 1.00 18.43 ? 620  GLY A C     1 
ATOM   5116 O  O     . GLY A 1 620 ? 10.566  -6.962  53.383 1.00 17.29 ? 620  GLY A O     1 
ATOM   5117 N  N     . ASP A 1 621 ? 8.532   -7.931  53.206 1.00 17.22 ? 621  ASP A N     1 
ATOM   5118 C  CA    . ASP A 1 621 ? 8.199   -7.307  51.928 1.00 17.26 ? 621  ASP A CA    1 
ATOM   5119 C  C     . ASP A 1 621 ? 6.710   -7.001  51.885 1.00 15.98 ? 621  ASP A C     1 
ATOM   5120 O  O     . ASP A 1 621 ? 5.873   -7.917  51.810 1.00 15.88 ? 621  ASP A O     1 
ATOM   5121 C  CB    . ASP A 1 621 ? 8.623   -8.211  50.761 1.00 15.99 ? 621  ASP A CB    1 
ATOM   5122 C  CG    . ASP A 1 621 ? 8.339   -7.598  49.380 1.00 18.50 ? 621  ASP A CG    1 
ATOM   5123 O  OD1   . ASP A 1 621 ? 7.526   -6.658  49.261 1.00 17.21 ? 621  ASP A OD1   1 
ATOM   5124 O  OD2   . ASP A 1 621 ? 8.921   -8.093  48.392 1.00 18.85 ? 621  ASP A OD2   1 
ATOM   5125 N  N     . THR A 1 622 ? 6.402   -5.704  51.947 1.00 16.18 ? 622  THR A N     1 
ATOM   5126 C  CA    . THR A 1 622 ? 5.035   -5.163  51.845 1.00 15.46 ? 622  THR A CA    1 
ATOM   5127 C  C     . THR A 1 622 ? 4.172   -5.438  53.080 1.00 17.36 ? 622  THR A C     1 
ATOM   5128 O  O     . THR A 1 622 ? 3.748   -4.504  53.756 1.00 18.54 ? 622  THR A O     1 
ATOM   5129 C  CB    . THR A 1 622 ? 4.312   -5.635  50.556 1.00 15.09 ? 622  THR A CB    1 
ATOM   5130 O  OG1   . THR A 1 622 ? 5.125   -5.336  49.414 1.00 14.51 ? 622  THR A OG1   1 
ATOM   5131 C  CG2   . THR A 1 622 ? 2.950   -4.949  50.405 1.00 16.07 ? 622  THR A CG2   1 
ATOM   5132 N  N     . ASP A 1 623 ? 3.923   -6.711  53.370 1.00 17.90 ? 623  ASP A N     1 
ATOM   5133 C  CA    . ASP A 1 623 ? 2.992   -7.081  54.424 1.00 18.51 ? 623  ASP A CA    1 
ATOM   5134 C  C     . ASP A 1 623 ? 3.354   -8.391  55.108 1.00 18.91 ? 623  ASP A C     1 
ATOM   5135 O  O     . ASP A 1 623 ? 2.518   -8.982  55.784 1.00 18.58 ? 623  ASP A O     1 
ATOM   5136 C  CB    . ASP A 1 623 ? 1.583   -7.186  53.847 1.00 18.96 ? 623  ASP A CB    1 
ATOM   5137 C  CG    . ASP A 1 623 ? 1.398   -8.414  52.981 1.00 21.81 ? 623  ASP A CG    1 
ATOM   5138 O  OD1   . ASP A 1 623 ? 0.264   -8.935  52.943 1.00 27.22 ? 623  ASP A OD1   1 
ATOM   5139 O  OD2   . ASP A 1 623 ? 2.379   -8.874  52.355 1.00 22.78 ? 623  ASP A OD2   1 
ATOM   5140 N  N     . SER A 1 624 ? 4.593   -8.833  54.915 1.00 18.14 ? 624  SER A N     1 
ATOM   5141 C  CA    . SER A 1 624 ? 5.063   -10.100 55.463 1.00 19.42 ? 624  SER A CA    1 
ATOM   5142 C  C     . SER A 1 624 ? 6.322   -9.881  56.271 1.00 19.81 ? 624  SER A C     1 
ATOM   5143 O  O     . SER A 1 624 ? 7.118   -8.988  55.967 1.00 20.52 ? 624  SER A O     1 
ATOM   5144 C  CB    . SER A 1 624 ? 5.365   -11.093 54.341 1.00 22.26 ? 624  SER A CB    1 
ATOM   5145 O  OG    . SER A 1 624 ? 6.509   -10.683 53.609 1.00 25.82 ? 624  SER A OG    1 
ATOM   5146 N  N     . ILE A 1 625 ? 6.499   -10.702 57.302 1.00 16.69 ? 625  ILE A N     1 
ATOM   5147 C  CA    . ILE A 1 625 ? 7.755   -10.735 58.040 1.00 17.60 ? 625  ILE A CA    1 
ATOM   5148 C  C     . ILE A 1 625 ? 8.284   -12.161 58.078 1.00 17.26 ? 625  ILE A C     1 
ATOM   5149 O  O     . ILE A 1 625 ? 7.509   -13.122 58.095 1.00 18.23 ? 625  ILE A O     1 
ATOM   5150 C  CB    . ILE A 1 625 ? 7.626   -10.170 59.480 1.00 18.89 ? 625  ILE A CB    1 
ATOM   5151 C  CG1   . ILE A 1 625 ? 6.523   -10.898 60.262 1.00 19.08 ? 625  ILE A CG1   1 
ATOM   5152 C  CG2   . ILE A 1 625 ? 7.394   -8.650  59.439 1.00 21.29 ? 625  ILE A CG2   1 
ATOM   5153 C  CD1   . ILE A 1 625 ? 6.541   -10.647 61.747 1.00 19.99 ? 625  ILE A CD1   1 
ATOM   5154 N  N     . TYR A 1 626 ? 9.605   -12.281 58.074 1.00 17.24 ? 626  TYR A N     1 
ATOM   5155 C  CA    . TYR A 1 626 ? 10.267  -13.564 58.213 1.00 17.97 ? 626  TYR A CA    1 
ATOM   5156 C  C     . TYR A 1 626 ? 11.079  -13.532 59.487 1.00 18.52 ? 626  TYR A C     1 
ATOM   5157 O  O     . TYR A 1 626 ? 11.943  -12.671 59.669 1.00 18.86 ? 626  TYR A O     1 
ATOM   5158 C  CB    . TYR A 1 626 ? 11.131  -13.852 56.986 1.00 17.78 ? 626  TYR A CB    1 
ATOM   5159 C  CG    . TYR A 1 626 ? 10.274  -14.140 55.779 1.00 17.90 ? 626  TYR A CG    1 
ATOM   5160 C  CD1   . TYR A 1 626 ? 9.640   -13.106 55.087 1.00 19.56 ? 626  TYR A CD1   1 
ATOM   5161 C  CD2   . TYR A 1 626 ? 10.067  -15.448 55.350 1.00 19.38 ? 626  TYR A CD2   1 
ATOM   5162 C  CE1   . TYR A 1 626 ? 8.822   -13.373 53.985 1.00 21.59 ? 626  TYR A CE1   1 
ATOM   5163 C  CE2   . TYR A 1 626 ? 9.260   -15.723 54.252 1.00 22.39 ? 626  TYR A CE2   1 
ATOM   5164 C  CZ    . TYR A 1 626 ? 8.643   -14.682 53.579 1.00 23.95 ? 626  TYR A CZ    1 
ATOM   5165 O  OH    . TYR A 1 626 ? 7.845   -14.961 52.494 1.00 28.59 ? 626  TYR A OH    1 
ATOM   5166 N  N     . VAL A 1 627 ? 10.765  -14.471 60.370 1.00 17.57 ? 627  VAL A N     1 
ATOM   5167 C  CA    . VAL A 1 627 ? 11.296  -14.484 61.723 1.00 19.57 ? 627  VAL A CA    1 
ATOM   5168 C  C     . VAL A 1 627 ? 12.247  -15.661 61.886 1.00 20.25 ? 627  VAL A C     1 
ATOM   5169 O  O     . VAL A 1 627 ? 11.901  -16.805 61.579 1.00 22.01 ? 627  VAL A O     1 
ATOM   5170 C  CB    . VAL A 1 627 ? 10.155  -14.584 62.760 1.00 20.05 ? 627  VAL A CB    1 
ATOM   5171 C  CG1   . VAL A 1 627 ? 10.705  -14.524 64.177 1.00 23.34 ? 627  VAL A CG1   1 
ATOM   5172 C  CG2   . VAL A 1 627 ? 9.109   -13.476 62.524 1.00 20.97 ? 627  VAL A CG2   1 
ATOM   5173 N  N     . SER A 1 628 ? 13.457  -15.364 62.346 1.00 20.39 ? 628  SER A N     1 
ATOM   5174 C  CA    . SER A 1 628 ? 14.443  -16.401 62.649 1.00 21.36 ? 628  SER A CA    1 
ATOM   5175 C  C     . SER A 1 628 ? 14.007  -17.139 63.912 1.00 22.98 ? 628  SER A C     1 
ATOM   5176 O  O     . SER A 1 628 ? 13.820  -16.522 64.965 1.00 24.16 ? 628  SER A O     1 
ATOM   5177 C  CB    . SER A 1 628 ? 15.830  -15.774 62.820 1.00 22.07 ? 628  SER A CB    1 
ATOM   5178 O  OG    . SER A 1 628 ? 16.800  -16.742 63.179 1.00 26.61 ? 628  SER A OG    1 
ATOM   5179 N  N     . ALA A 1 629 ? 13.816  -18.453 63.791 1.00 22.31 ? 629  ALA A N     1 
ATOM   5180 C  CA    . ALA A 1 629 ? 13.340  -19.277 64.905 1.00 22.26 ? 629  ALA A CA    1 
ATOM   5181 C  C     . ALA A 1 629 ? 14.435  -20.131 65.562 1.00 22.37 ? 629  ALA A C     1 
ATOM   5182 O  O     . ALA A 1 629 ? 14.148  -20.921 66.462 1.00 22.25 ? 629  ALA A O     1 
ATOM   5183 C  CB    . ALA A 1 629 ? 12.171  -20.154 64.455 1.00 23.77 ? 629  ALA A CB    1 
ATOM   5184 N  N     . ASP A 1 630 ? 15.682  -19.957 65.125 1.00 22.73 ? 630  ASP A N     1 
ATOM   5185 C  CA    . ASP A 1 630 ? 16.830  -20.691 65.690 1.00 23.28 ? 630  ASP A CA    1 
ATOM   5186 C  C     . ASP A 1 630 ? 16.838  -20.727 67.212 1.00 23.47 ? 630  ASP A C     1 
ATOM   5187 O  O     . ASP A 1 630 ? 16.979  -21.799 67.814 1.00 23.04 ? 630  ASP A O     1 
ATOM   5188 C  CB    . ASP A 1 630 ? 18.151  -20.074 65.224 1.00 25.37 ? 630  ASP A CB    1 
ATOM   5189 C  CG    . ASP A 1 630 ? 18.408  -20.267 63.745 1.00 27.47 ? 630  ASP A CG    1 
ATOM   5190 O  OD1   . ASP A 1 630 ? 17.478  -20.652 63.006 1.00 26.16 ? 630  ASP A OD1   1 
ATOM   5191 O  OD2   . ASP A 1 630 ? 19.561  -20.030 63.325 1.00 28.10 ? 630  ASP A OD2   1 
ATOM   5192 N  N     . LYS A 1 631 ? 16.700  -19.553 67.828 1.00 22.30 ? 631  LYS A N     1 
ATOM   5193 C  CA    . LYS A 1 631 ? 16.758  -19.432 69.285 1.00 24.69 ? 631  LYS A CA    1 
ATOM   5194 C  C     . LYS A 1 631 ? 15.601  -20.121 69.995 1.00 25.12 ? 631  LYS A C     1 
ATOM   5195 O  O     . LYS A 1 631 ? 15.766  -20.610 71.119 1.00 25.57 ? 631  LYS A O     1 
ATOM   5196 C  CB    . LYS A 1 631 ? 16.846  -17.965 69.706 1.00 26.14 ? 631  LYS A CB    1 
ATOM   5197 C  CG    . LYS A 1 631 ? 18.203  -17.343 69.422 1.00 30.38 ? 631  LYS A CG    1 
ATOM   5198 C  CD    . LYS A 1 631 ? 18.267  -15.890 69.874 1.00 34.39 ? 631  LYS A CD    1 
ATOM   5199 C  CE    . LYS A 1 631 ? 19.699  -15.373 69.825 1.00 35.78 ? 631  LYS A CE    1 
ATOM   5200 N  NZ    . LYS A 1 631 ? 20.244  -15.380 68.437 1.00 38.91 ? 631  LYS A NZ    1 
ATOM   5201 N  N     . ILE A 1 632 ? 14.444  -20.179 69.338 1.00 23.72 ? 632  ILE A N     1 
ATOM   5202 C  CA    . ILE A 1 632 ? 13.280  -20.874 69.903 1.00 25.41 ? 632  ILE A CA    1 
ATOM   5203 C  C     . ILE A 1 632 ? 13.516  -22.384 69.897 1.00 24.50 ? 632  ILE A C     1 
ATOM   5204 O  O     . ILE A 1 632 ? 13.320  -23.050 70.913 1.00 26.41 ? 632  ILE A O     1 
ATOM   5205 C  CB    . ILE A 1 632 ? 11.960  -20.498 69.170 1.00 25.96 ? 632  ILE A CB    1 
ATOM   5206 C  CG1   . ILE A 1 632 ? 11.765  -18.973 69.132 1.00 26.17 ? 632  ILE A CG1   1 
ATOM   5207 C  CG2   . ILE A 1 632 ? 10.754  -21.211 69.797 1.00 28.11 ? 632  ILE A CG2   1 
ATOM   5208 C  CD1   . ILE A 1 632 ? 11.736  -18.276 70.498 1.00 28.98 ? 632  ILE A CD1   1 
ATOM   5209 N  N     . ILE A 1 633 ? 13.958  -22.911 68.755 1.00 24.17 ? 633  ILE A N     1 
ATOM   5210 C  CA    . ILE A 1 633 ? 14.347  -24.315 68.648 1.00 24.58 ? 633  ILE A CA    1 
ATOM   5211 C  C     . ILE A 1 633 ? 15.440  -24.651 69.666 1.00 25.24 ? 633  ILE A C     1 
ATOM   5212 O  O     . ILE A 1 633 ? 15.332  -25.642 70.390 1.00 26.17 ? 633  ILE A O     1 
ATOM   5213 C  CB    . ILE A 1 633 ? 14.811  -24.679 67.205 1.00 23.23 ? 633  ILE A CB    1 
ATOM   5214 C  CG1   . ILE A 1 633 ? 13.637  -24.634 66.210 1.00 23.59 ? 633  ILE A CG1   1 
ATOM   5215 C  CG2   . ILE A 1 633 ? 15.540  -26.039 67.172 1.00 24.46 ? 633  ILE A CG2   1 
ATOM   5216 C  CD1   . ILE A 1 633 ? 12.537  -25.689 66.445 1.00 21.77 ? 633  ILE A CD1   1 
ATOM   5217 N  N     . ASP A 1 634 ? 16.473  -23.809 69.729 1.00 25.85 ? 634  ASP A N     1 
ATOM   5218 C  CA    . ASP A 1 634 ? 17.614  -24.027 70.630 1.00 28.48 ? 634  ASP A CA    1 
ATOM   5219 C  C     . ASP A 1 634 ? 17.253  -23.971 72.115 1.00 30.47 ? 634  ASP A C     1 
ATOM   5220 O  O     . ASP A 1 634 ? 17.977  -24.520 72.947 1.00 30.65 ? 634  ASP A O     1 
ATOM   5221 C  CB    . ASP A 1 634 ? 18.739  -23.026 70.349 1.00 29.05 ? 634  ASP A CB    1 
ATOM   5222 C  CG    . ASP A 1 634 ? 19.486  -23.317 69.062 1.00 31.92 ? 634  ASP A CG    1 
ATOM   5223 O  OD1   . ASP A 1 634 ? 19.215  -24.352 68.409 1.00 31.62 ? 634  ASP A OD1   1 
ATOM   5224 O  OD2   . ASP A 1 634 ? 20.356  -22.494 68.702 1.00 34.27 ? 634  ASP A OD2   1 
ATOM   5225 N  N     . LYS A 1 635 ? 16.151  -23.303 72.446 1.00 31.14 ? 635  LYS A N     1 
ATOM   5226 C  CA    . LYS A 1 635 ? 15.719  -23.213 73.842 1.00 34.02 ? 635  LYS A CA    1 
ATOM   5227 C  C     . LYS A 1 635 ? 15.186  -24.536 74.382 1.00 34.82 ? 635  LYS A C     1 
ATOM   5228 O  O     . LYS A 1 635 ? 15.285  -24.803 75.578 1.00 35.25 ? 635  LYS A O     1 
ATOM   5229 C  CB    . LYS A 1 635 ? 14.722  -22.073 74.048 1.00 34.71 ? 635  LYS A CB    1 
ATOM   5230 C  CG    . LYS A 1 635 ? 15.405  -20.765 74.402 1.00 41.59 ? 635  LYS A CG    1 
ATOM   5231 C  CD    . LYS A 1 635 ? 14.417  -19.642 74.677 1.00 46.17 ? 635  LYS A CD    1 
ATOM   5232 C  CE    . LYS A 1 635 ? 15.030  -18.588 75.597 1.00 49.66 ? 635  LYS A CE    1 
ATOM   5233 N  NZ    . LYS A 1 635 ? 16.289  -17.994 75.054 1.00 49.40 ? 635  LYS A NZ    1 
ATOM   5234 N  N     . VAL A 1 636 ? 14.642  -25.376 73.503 1.00 34.40 ? 636  VAL A N     1 
ATOM   5235 C  CA    . VAL A 1 636 ? 14.294  -26.733 73.923 1.00 36.04 ? 636  VAL A CA    1 
ATOM   5236 C  C     . VAL A 1 636 ? 15.434  -27.707 73.610 1.00 35.26 ? 636  VAL A C     1 
ATOM   5237 O  O     . VAL A 1 636 ? 15.686  -28.636 74.384 1.00 36.36 ? 636  VAL A O     1 
ATOM   5238 C  CB    . VAL A 1 636 ? 12.903  -27.234 73.388 1.00 36.98 ? 636  VAL A CB    1 
ATOM   5239 C  CG1   . VAL A 1 636 ? 12.017  -26.079 72.936 1.00 34.16 ? 636  VAL A CG1   1 
ATOM   5240 C  CG2   . VAL A 1 636 ? 13.049  -28.285 72.313 1.00 36.87 ? 636  VAL A CG2   1 
ATOM   5241 N  N     . GLY A 1 637 ? 16.132  -27.467 72.499 1.00 33.84 ? 637  GLY A N     1 
ATOM   5242 C  CA    . GLY A 1 637 ? 17.261  -28.295 72.076 1.00 35.31 ? 637  GLY A CA    1 
ATOM   5243 C  C     . GLY A 1 637 ? 16.853  -29.340 71.058 1.00 36.17 ? 637  GLY A C     1 
ATOM   5244 O  O     . GLY A 1 637 ? 15.910  -30.097 71.287 1.00 36.40 ? 637  GLY A O     1 
ATOM   5245 N  N     . GLU A 1 638 ? 17.571  -29.386 69.937 1.00 37.71 ? 638  GLU A N     1 
ATOM   5246 C  CA    . GLU A 1 638 ? 17.264  -30.309 68.833 1.00 39.17 ? 638  GLU A CA    1 
ATOM   5247 C  C     . GLU A 1 638 ? 17.157  -31.780 69.256 1.00 40.62 ? 638  GLU A C     1 
ATOM   5248 O  O     . GLU A 1 638 ? 16.379  -32.541 68.676 1.00 40.94 ? 638  GLU A O     1 
ATOM   5249 C  CB    . GLU A 1 638 ? 18.275  -30.149 67.690 1.00 39.04 ? 638  GLU A CB    1 
ATOM   5250 C  CG    . GLU A 1 638 ? 17.921  -29.034 66.701 1.00 39.96 ? 638  GLU A CG    1 
ATOM   5251 C  CD    . GLU A 1 638 ? 19.020  -28.745 65.682 1.00 43.64 ? 638  GLU A CD    1 
ATOM   5252 O  OE1   . GLU A 1 638 ? 18.688  -28.348 64.545 1.00 39.99 ? 638  GLU A OE1   1 
ATOM   5253 O  OE2   . GLU A 1 638 ? 20.216  -28.909 66.010 1.00 45.51 ? 638  GLU A OE2   1 
ATOM   5254 N  N     . SER A 1 639 ? 17.925  -32.161 70.276 1.00 42.47 ? 639  SER A N     1 
ATOM   5255 C  CA    . SER A 1 639 ? 17.954  -33.537 70.784 1.00 42.91 ? 639  SER A CA    1 
ATOM   5256 C  C     . SER A 1 639 ? 16.622  -34.006 71.373 1.00 41.91 ? 639  SER A C     1 
ATOM   5257 O  O     . SER A 1 639 ? 16.361  -35.209 71.436 1.00 42.92 ? 639  SER A O     1 
ATOM   5258 C  CB    . SER A 1 639 ? 19.058  -33.689 71.834 1.00 44.88 ? 639  SER A CB    1 
ATOM   5259 O  OG    . SER A 1 639 ? 20.313  -33.290 71.311 1.00 48.33 ? 639  SER A OG    1 
ATOM   5260 N  N     . LYS A 1 640 ? 15.790  -33.062 71.806 1.00 38.96 ? 640  LYS A N     1 
ATOM   5261 C  CA    . LYS A 1 640 ? 14.499  -33.387 72.417 1.00 38.75 ? 640  LYS A CA    1 
ATOM   5262 C  C     . LYS A 1 640 ? 13.376  -33.689 71.421 1.00 36.69 ? 640  LYS A C     1 
ATOM   5263 O  O     . LYS A 1 640 ? 12.291  -34.125 71.819 1.00 37.17 ? 640  LYS A O     1 
ATOM   5264 C  CB    . LYS A 1 640 ? 14.062  -32.279 73.382 1.00 40.25 ? 640  LYS A CB    1 
ATOM   5265 C  CG    . LYS A 1 640 ? 14.470  -32.508 74.833 1.00 45.93 ? 640  LYS A CG    1 
ATOM   5266 C  CD    . LYS A 1 640 ? 15.844  -31.934 75.146 1.00 49.65 ? 640  LYS A CD    1 
ATOM   5267 C  CE    . LYS A 1 640 ? 16.066  -31.876 76.650 1.00 53.51 ? 640  LYS A CE    1 
ATOM   5268 N  NZ    . LYS A 1 640 ? 17.040  -30.816 77.030 1.00 56.21 ? 640  LYS A NZ    1 
ATOM   5269 N  N     . PHE A 1 641 ? 13.627  -33.455 70.133 1.00 34.11 ? 641  PHE A N     1 
ATOM   5270 C  CA    . PHE A 1 641 ? 12.620  -33.722 69.104 1.00 31.06 ? 641  PHE A CA    1 
ATOM   5271 C  C     . PHE A 1 641 ? 12.756  -35.125 68.522 1.00 31.18 ? 641  PHE A C     1 
ATOM   5272 O  O     . PHE A 1 641 ? 13.858  -35.566 68.202 1.00 31.80 ? 641  PHE A O     1 
ATOM   5273 C  CB    . PHE A 1 641 ? 12.682  -32.674 67.993 1.00 28.81 ? 641  PHE A CB    1 
ATOM   5274 C  CG    . PHE A 1 641 ? 12.343  -31.291 68.454 1.00 27.60 ? 641  PHE A CG    1 
ATOM   5275 C  CD1   . PHE A 1 641 ? 13.317  -30.306 68.500 1.00 27.94 ? 641  PHE A CD1   1 
ATOM   5276 C  CD2   . PHE A 1 641 ? 11.050  -30.975 68.858 1.00 27.59 ? 641  PHE A CD2   1 
ATOM   5277 C  CE1   . PHE A 1 641 ? 13.008  -29.022 68.927 1.00 24.99 ? 641  PHE A CE1   1 
ATOM   5278 C  CE2   . PHE A 1 641 ? 10.734  -29.693 69.293 1.00 28.40 ? 641  PHE A CE2   1 
ATOM   5279 C  CZ    . PHE A 1 641 ? 11.719  -28.716 69.321 1.00 24.83 ? 641  PHE A CZ    1 
ATOM   5280 N  N     . ARG A 1 642 ? 11.624  -35.812 68.392 1.00 32.66 ? 642  ARG A N     1 
ATOM   5281 C  CA    . ARG A 1 642 ? 11.585  -37.182 67.874 1.00 34.58 ? 642  ARG A CA    1 
ATOM   5282 C  C     . ARG A 1 642 ? 11.885  -37.232 66.384 1.00 33.03 ? 642  ARG A C     1 
ATOM   5283 O  O     . ARG A 1 642 ? 12.585  -38.129 65.910 1.00 32.54 ? 642  ARG A O     1 
ATOM   5284 C  CB    . ARG A 1 642 ? 10.219  -37.816 68.143 1.00 37.60 ? 642  ARG A CB    1 
ATOM   5285 C  CG    . ARG A 1 642 ? 10.014  -38.279 69.579 1.00 44.08 ? 642  ARG A CG    1 
ATOM   5286 C  CD    . ARG A 1 642 ? 8.600   -38.803 69.807 1.00 48.05 ? 642  ARG A CD    1 
ATOM   5287 N  NE    . ARG A 1 642 ? 7.607   -37.728 69.832 1.00 50.21 ? 642  ARG A NE    1 
ATOM   5288 C  CZ    . ARG A 1 642 ? 6.798   -37.414 68.823 1.00 50.77 ? 642  ARG A CZ    1 
ATOM   5289 N  NH1   . ARG A 1 642 ? 6.845   -38.090 67.680 1.00 52.20 ? 642  ARG A NH1   1 
ATOM   5290 N  NH2   . ARG A 1 642 ? 5.935   -36.416 68.959 1.00 50.97 ? 642  ARG A NH2   1 
ATOM   5291 N  N     . ASP A 1 643 ? 11.347  -36.254 65.658 1.00 29.77 ? 643  ASP A N     1 
ATOM   5292 C  CA    . ASP A 1 643 ? 11.479  -36.168 64.209 1.00 28.47 ? 643  ASP A CA    1 
ATOM   5293 C  C     . ASP A 1 643 ? 11.192  -34.739 63.749 1.00 25.91 ? 643  ASP A C     1 
ATOM   5294 O  O     . ASP A 1 643 ? 10.875  -33.861 64.565 1.00 23.79 ? 643  ASP A O     1 
ATOM   5295 C  CB    . ASP A 1 643 ? 10.544  -37.177 63.510 1.00 28.42 ? 643  ASP A CB    1 
ATOM   5296 C  CG    . ASP A 1 643 ? 9.105   -37.108 64.012 1.00 32.89 ? 643  ASP A CG    1 
ATOM   5297 O  OD1   . ASP A 1 643 ? 8.627   -36.010 64.380 1.00 31.96 ? 643  ASP A OD1   1 
ATOM   5298 O  OD2   . ASP A 1 643 ? 8.438   -38.164 64.026 1.00 34.62 ? 643  ASP A OD2   1 
ATOM   5299 N  N     . THR A 1 644 ? 11.293  -34.514 62.442 1.00 25.20 ? 644  THR A N     1 
ATOM   5300 C  CA    . THR A 1 644 ? 11.039  -33.198 61.858 1.00 24.73 ? 644  THR A CA    1 
ATOM   5301 C  C     . THR A 1 644 ? 9.651   -32.682 62.224 1.00 25.41 ? 644  THR A C     1 
ATOM   5302 O  O     . THR A 1 644 ? 9.518   -31.543 62.676 1.00 24.88 ? 644  THR A O     1 
ATOM   5303 C  CB    . THR A 1 644 ? 11.206  -33.218 60.329 1.00 22.82 ? 644  THR A CB    1 
ATOM   5304 O  OG1   . THR A 1 644 ? 12.528  -33.670 60.003 1.00 24.71 ? 644  THR A OG1   1 
ATOM   5305 C  CG2   . THR A 1 644 ? 10.985  -31.827 59.736 1.00 21.59 ? 644  THR A CG2   1 
ATOM   5306 N  N     . ASN A 1 645 ? 8.633   -33.529 62.052 1.00 25.54 ? 645  ASN A N     1 
ATOM   5307 C  CA    A ASN A 1 645 ? 7.258   -33.132 62.338 0.50 25.11 ? 645  ASN A CA    1 
ATOM   5308 C  CA    B ASN A 1 645 ? 7.248   -33.166 62.359 0.50 26.03 ? 645  ASN A CA    1 
ATOM   5309 C  C     . ASN A 1 645 ? 7.065   -32.648 63.776 1.00 25.40 ? 645  ASN A C     1 
ATOM   5310 O  O     . ASN A 1 645 ? 6.205   -31.810 64.033 1.00 25.48 ? 645  ASN A O     1 
ATOM   5311 C  CB    A ASN A 1 645 ? 6.279   -34.264 62.015 0.50 25.34 ? 645  ASN A CB    1 
ATOM   5312 C  CB    B ASN A 1 645 ? 6.311   -34.352 62.128 0.50 27.73 ? 645  ASN A CB    1 
ATOM   5313 C  CG    A ASN A 1 645 ? 4.864   -33.765 61.794 0.50 23.99 ? 645  ASN A CG    1 
ATOM   5314 C  CG    B ASN A 1 645 ? 5.515   -34.224 60.851 0.50 28.24 ? 645  ASN A CG    1 
ATOM   5315 O  OD1   A ASN A 1 645 ? 4.616   -32.932 60.920 0.50 24.41 ? 645  ASN A OD1   1 
ATOM   5316 O  OD1   B ASN A 1 645 ? 4.961   -33.164 60.556 0.50 30.19 ? 645  ASN A OD1   1 
ATOM   5317 N  ND2   A ASN A 1 645 ? 3.928   -34.274 62.583 0.50 22.46 ? 645  ASN A ND2   1 
ATOM   5318 N  ND2   B ASN A 1 645 ? 5.444   -35.307 60.088 0.50 30.84 ? 645  ASN A ND2   1 
ATOM   5319 N  N     . HIS A 1 646 ? 7.875   -33.169 64.698 1.00 24.28 ? 646  HIS A N     1 
ATOM   5320 C  CA    . HIS A 1 646 ? 7.795   -32.779 66.105 1.00 25.92 ? 646  HIS A CA    1 
ATOM   5321 C  C     . HIS A 1 646 ? 8.165   -31.308 66.326 1.00 25.53 ? 646  HIS A C     1 
ATOM   5322 O  O     . HIS A 1 646 ? 7.417   -30.584 66.993 1.00 25.49 ? 646  HIS A O     1 
ATOM   5323 C  CB    . HIS A 1 646 ? 8.641   -33.717 66.976 1.00 26.53 ? 646  HIS A CB    1 
ATOM   5324 C  CG    . HIS A 1 646 ? 8.394   -33.577 68.447 1.00 28.42 ? 646  HIS A CG    1 
ATOM   5325 N  ND1   . HIS A 1 646 ? 9.216   -34.150 69.392 1.00 30.90 ? 646  HIS A ND1   1 
ATOM   5326 C  CD2   . HIS A 1 646 ? 7.424   -32.929 69.137 1.00 29.81 ? 646  HIS A CD2   1 
ATOM   5327 C  CE1   . HIS A 1 646 ? 8.765   -33.864 70.600 1.00 31.45 ? 646  HIS A CE1   1 
ATOM   5328 N  NE2   . HIS A 1 646 ? 7.680   -33.123 70.474 1.00 32.43 ? 646  HIS A NE2   1 
ATOM   5329 N  N     . TRP A 1 647 ? 9.287   -30.850 65.762 1.00 23.89 ? 647  TRP A N     1 
ATOM   5330 C  CA    . TRP A 1 647 ? 9.631   -29.422 65.892 1.00 22.90 ? 647  TRP A CA    1 
ATOM   5331 C  C     . TRP A 1 647 ? 8.745   -28.511 65.041 1.00 21.55 ? 647  TRP A C     1 
ATOM   5332 O  O     . TRP A 1 647 ? 8.545   -27.344 65.389 1.00 22.54 ? 647  TRP A O     1 
ATOM   5333 C  CB    . TRP A 1 647 ? 11.129  -29.124 65.673 1.00 23.31 ? 647  TRP A CB    1 
ATOM   5334 C  CG    . TRP A 1 647 ? 11.689  -29.323 64.261 1.00 21.04 ? 647  TRP A CG    1 
ATOM   5335 C  CD1   . TRP A 1 647 ? 12.481  -30.358 63.840 1.00 20.74 ? 647  TRP A CD1   1 
ATOM   5336 C  CD2   . TRP A 1 647 ? 11.549  -28.442 63.129 1.00 20.68 ? 647  TRP A CD2   1 
ATOM   5337 N  NE1   . TRP A 1 647 ? 12.821  -30.190 62.516 1.00 20.61 ? 647  TRP A NE1   1 
ATOM   5338 C  CE2   . TRP A 1 647 ? 12.264  -29.024 62.057 1.00 19.78 ? 647  TRP A CE2   1 
ATOM   5339 C  CE3   . TRP A 1 647 ? 10.877  -27.226 62.914 1.00 18.86 ? 647  TRP A CE3   1 
ATOM   5340 C  CZ2   . TRP A 1 647 ? 12.324  -28.435 60.779 1.00 19.52 ? 647  TRP A CZ2   1 
ATOM   5341 C  CZ3   . TRP A 1 647 ? 10.947  -26.633 61.640 1.00 16.83 ? 647  TRP A CZ3   1 
ATOM   5342 C  CH2   . TRP A 1 647 ? 11.657  -27.247 60.593 1.00 18.79 ? 647  TRP A CH2   1 
ATOM   5343 N  N     . VAL A 1 648 ? 8.211   -29.043 63.942 1.00 21.43 ? 648  VAL A N     1 
ATOM   5344 C  CA    . VAL A 1 648 ? 7.257   -28.295 63.118 1.00 20.94 ? 648  VAL A CA    1 
ATOM   5345 C  C     . VAL A 1 648 ? 5.984   -28.040 63.928 1.00 22.83 ? 648  VAL A C     1 
ATOM   5346 O  O     . VAL A 1 648 ? 5.495   -26.914 63.974 1.00 22.19 ? 648  VAL A O     1 
ATOM   5347 C  CB    . VAL A 1 648 ? 6.951   -28.996 61.765 1.00 21.73 ? 648  VAL A CB    1 
ATOM   5348 C  CG1   . VAL A 1 648 ? 5.852   -28.252 61.003 1.00 18.88 ? 648  VAL A CG1   1 
ATOM   5349 C  CG2   . VAL A 1 648 ? 8.204   -29.064 60.905 1.00 17.91 ? 648  VAL A CG2   1 
ATOM   5350 N  N     . ASP A 1 649 ? 5.483   -29.087 64.587 1.00 22.51 ? 649  ASP A N     1 
ATOM   5351 C  CA    . ASP A 1 649 ? 4.363   -28.978 65.527 1.00 24.55 ? 649  ASP A CA    1 
ATOM   5352 C  C     . ASP A 1 649 ? 4.635   -27.947 66.610 1.00 24.06 ? 649  ASP A C     1 
ATOM   5353 O  O     . ASP A 1 649 ? 3.756   -27.164 66.962 1.00 23.49 ? 649  ASP A O     1 
ATOM   5354 C  CB    . ASP A 1 649 ? 4.082   -30.329 66.200 1.00 27.31 ? 649  ASP A CB    1 
ATOM   5355 C  CG    . ASP A 1 649 ? 3.193   -31.235 65.369 1.00 31.07 ? 649  ASP A CG    1 
ATOM   5356 O  OD1   . ASP A 1 649 ? 2.543   -30.755 64.415 1.00 33.05 ? 649  ASP A OD1   1 
ATOM   5357 O  OD2   . ASP A 1 649 ? 3.134   -32.441 65.691 1.00 35.97 ? 649  ASP A OD2   1 
ATOM   5358 N  N     . PHE A 1 650 ? 5.856   -27.964 67.139 1.00 24.99 ? 650  PHE A N     1 
ATOM   5359 C  CA    . PHE A 1 650 ? 6.250   -27.077 68.232 1.00 24.94 ? 650  PHE A CA    1 
ATOM   5360 C  C     . PHE A 1 650 ? 6.233   -25.612 67.798 1.00 24.27 ? 650  PHE A C     1 
ATOM   5361 O  O     . PHE A 1 650 ? 5.668   -24.758 68.495 1.00 23.82 ? 650  PHE A O     1 
ATOM   5362 C  CB    . PHE A 1 650 ? 7.629   -27.476 68.774 1.00 26.37 ? 650  PHE A CB    1 
ATOM   5363 C  CG    . PHE A 1 650 ? 8.246   -26.449 69.685 1.00 30.06 ? 650  PHE A CG    1 
ATOM   5364 C  CD1   . PHE A 1 650 ? 7.735   -26.228 70.959 1.00 34.16 ? 650  PHE A CD1   1 
ATOM   5365 C  CD2   . PHE A 1 650 ? 9.348   -25.708 69.266 1.00 32.34 ? 650  PHE A CD2   1 
ATOM   5366 C  CE1   . PHE A 1 650 ? 8.307   -25.278 71.802 1.00 35.87 ? 650  PHE A CE1   1 
ATOM   5367 C  CE2   . PHE A 1 650 ? 9.928   -24.757 70.100 1.00 34.85 ? 650  PHE A CE2   1 
ATOM   5368 C  CZ    . PHE A 1 650 ? 9.404   -24.538 71.365 1.00 34.29 ? 650  PHE A CZ    1 
ATOM   5369 N  N     . LEU A 1 651 ? 6.838   -25.331 66.646 1.00 23.88 ? 651  LEU A N     1 
ATOM   5370 C  CA    . LEU A 1 651 ? 6.817   -23.982 66.077 1.00 22.80 ? 651  LEU A CA    1 
ATOM   5371 C  C     . LEU A 1 651 ? 5.411   -23.536 65.693 1.00 22.61 ? 651  LEU A C     1 
ATOM   5372 O  O     . LEU A 1 651 ? 5.067   -22.367 65.859 1.00 23.46 ? 651  LEU A O     1 
ATOM   5373 C  CB    . LEU A 1 651 ? 7.767   -23.865 64.879 1.00 23.29 ? 651  LEU A CB    1 
ATOM   5374 C  CG    . LEU A 1 651 ? 9.264   -23.982 65.197 1.00 22.78 ? 651  LEU A CG    1 
ATOM   5375 C  CD1   . LEU A 1 651 ? 10.093  -23.728 63.950 1.00 21.43 ? 651  LEU A CD1   1 
ATOM   5376 C  CD2   . LEU A 1 651 ? 9.684   -23.030 66.330 1.00 22.92 ? 651  LEU A CD2   1 
ATOM   5377 N  N     . ASP A 1 652 ? 4.607   -24.465 65.181 1.00 23.11 ? 652  ASP A N     1 
ATOM   5378 C  CA    . ASP A 1 652 ? 3.215   -24.176 64.826 1.00 24.14 ? 652  ASP A CA    1 
ATOM   5379 C  C     . ASP A 1 652 ? 2.443   -23.692 66.053 1.00 24.41 ? 652  ASP A C     1 
ATOM   5380 O  O     . ASP A 1 652 ? 1.744   -22.675 65.996 1.00 23.53 ? 652  ASP A O     1 
ATOM   5381 C  CB    . ASP A 1 652 ? 2.556   -25.416 64.203 1.00 25.16 ? 652  ASP A CB    1 
ATOM   5382 C  CG    . ASP A 1 652 ? 1.059   -25.259 64.010 1.00 29.36 ? 652  ASP A CG    1 
ATOM   5383 O  OD1   . ASP A 1 652 ? 0.627   -24.273 63.387 1.00 28.57 ? 652  ASP A OD1   1 
ATOM   5384 O  OD2   . ASP A 1 652 ? 0.307   -26.130 64.496 1.00 36.33 ? 652  ASP A OD2   1 
ATOM   5385 N  N     . LYS A 1 653 ? 2.596   -24.416 67.161 1.00 25.91 ? 653  LYS A N     1 
ATOM   5386 C  CA    . LYS A 1 653 ? 1.959   -24.052 68.424 1.00 27.62 ? 653  LYS A CA    1 
ATOM   5387 C  C     . LYS A 1 653 ? 2.508   -22.726 68.963 1.00 26.39 ? 653  LYS A C     1 
ATOM   5388 O  O     . LYS A 1 653 ? 1.739   -21.875 69.411 1.00 26.13 ? 653  LYS A O     1 
ATOM   5389 C  CB    . LYS A 1 653 ? 2.119   -25.177 69.455 1.00 28.56 ? 653  LYS A CB    1 
ATOM   5390 C  CG    . LYS A 1 653 ? 1.155   -25.086 70.634 1.00 35.25 ? 653  LYS A CG    1 
ATOM   5391 C  CD    . LYS A 1 653 ? 1.179   -26.351 71.492 1.00 38.88 ? 653  LYS A CD    1 
ATOM   5392 C  CE    . LYS A 1 653 ? 0.204   -26.238 72.660 1.00 42.71 ? 653  LYS A CE    1 
ATOM   5393 N  NZ    . LYS A 1 653 ? 0.109   -27.483 73.467 1.00 46.96 ? 653  LYS A NZ    1 
ATOM   5394 N  N     . PHE A 1 654 ? 3.829   -22.549 68.901 1.00 24.97 ? 654  PHE A N     1 
ATOM   5395 C  CA    . PHE A 1 654 ? 4.459   -21.307 69.351 1.00 25.92 ? 654  PHE A CA    1 
ATOM   5396 C  C     . PHE A 1 654 ? 3.938   -20.106 68.557 1.00 25.21 ? 654  PHE A C     1 
ATOM   5397 O  O     . PHE A 1 654 ? 3.660   -19.049 69.131 1.00 26.20 ? 654  PHE A O     1 
ATOM   5398 C  CB    . PHE A 1 654 ? 5.992   -21.390 69.262 1.00 24.32 ? 654  PHE A CB    1 
ATOM   5399 C  CG    . PHE A 1 654 ? 6.698   -20.205 69.862 1.00 25.68 ? 654  PHE A CG    1 
ATOM   5400 C  CD1   . PHE A 1 654 ? 7.107   -19.144 69.064 1.00 27.58 ? 654  PHE A CD1   1 
ATOM   5401 C  CD2   . PHE A 1 654 ? 6.940   -20.142 71.232 1.00 29.93 ? 654  PHE A CD2   1 
ATOM   5402 C  CE1   . PHE A 1 654 ? 7.755   -18.044 69.615 1.00 29.01 ? 654  PHE A CE1   1 
ATOM   5403 C  CE2   . PHE A 1 654 ? 7.585   -19.041 71.789 1.00 32.87 ? 654  PHE A CE2   1 
ATOM   5404 C  CZ    . PHE A 1 654 ? 7.991   -17.991 70.976 1.00 27.81 ? 654  PHE A CZ    1 
ATOM   5405 N  N     . ALA A 1 655 ? 3.789   -20.284 67.248 1.00 25.52 ? 655  ALA A N     1 
ATOM   5406 C  CA    . ALA A 1 655 ? 3.276   -19.222 66.382 1.00 26.23 ? 655  ALA A CA    1 
ATOM   5407 C  C     . ALA A 1 655 ? 1.828   -18.869 66.727 1.00 28.59 ? 655  ALA A C     1 
ATOM   5408 O  O     . ALA A 1 655 ? 1.479   -17.693 66.859 1.00 29.00 ? 655  ALA A O     1 
ATOM   5409 C  CB    . ALA A 1 655 ? 3.395   -19.619 64.920 1.00 25.43 ? 655  ALA A CB    1 
ATOM   5410 N  N     . ARG A 1 656 ? 0.995   -19.890 66.899 1.00 28.44 ? 656  ARG A N     1 
ATOM   5411 C  CA    . ARG A 1 656 ? -0.430  -19.679 67.146 1.00 30.60 ? 656  ARG A CA    1 
ATOM   5412 C  C     . ARG A 1 656 ? -0.731  -19.177 68.564 1.00 30.71 ? 656  ARG A C     1 
ATOM   5413 O  O     . ARG A 1 656 ? -1.562  -18.285 68.747 1.00 31.15 ? 656  ARG A O     1 
ATOM   5414 C  CB    . ARG A 1 656 ? -1.208  -20.961 66.832 1.00 33.16 ? 656  ARG A CB    1 
ATOM   5415 C  CG    . ARG A 1 656 ? -2.732  -20.859 66.964 1.00 38.64 ? 656  ARG A CG    1 
ATOM   5416 C  CD    . ARG A 1 656 ? -3.430  -22.146 66.510 1.00 42.90 ? 656  ARG A CD    1 
ATOM   5417 N  NE    . ARG A 1 656 ? -2.827  -23.346 67.095 1.00 46.69 ? 656  ARG A NE    1 
ATOM   5418 C  CZ    . ARG A 1 656 ? -2.047  -24.198 66.432 1.00 46.63 ? 656  ARG A CZ    1 
ATOM   5419 N  NH1   . ARG A 1 656 ? -1.773  -23.998 65.147 1.00 46.72 ? 656  ARG A NH1   1 
ATOM   5420 N  NH2   . ARG A 1 656 ? -1.539  -25.252 67.057 1.00 48.29 ? 656  ARG A NH2   1 
ATOM   5421 N  N     . GLU A 1 657 ? -0.046  -19.732 69.560 1.00 30.15 ? 657  GLU A N     1 
ATOM   5422 C  CA    . GLU A 1 657 ? -0.377  -19.466 70.960 1.00 31.27 ? 657  GLU A CA    1 
ATOM   5423 C  C     . GLU A 1 657 ? 0.417   -18.329 71.601 1.00 30.40 ? 657  GLU A C     1 
ATOM   5424 O  O     . GLU A 1 657 ? -0.033  -17.736 72.576 1.00 29.60 ? 657  GLU A O     1 
ATOM   5425 C  CB    . GLU A 1 657 ? -0.238  -20.741 71.793 1.00 33.76 ? 657  GLU A CB    1 
ATOM   5426 C  CG    . GLU A 1 657 ? -1.190  -21.849 71.376 1.00 37.93 ? 657  GLU A CG    1 
ATOM   5427 C  CD    . GLU A 1 657 ? -1.223  -23.007 72.356 1.00 43.89 ? 657  GLU A CD    1 
ATOM   5428 O  OE1   . GLU A 1 657 ? -0.402  -23.032 73.302 1.00 45.25 ? 657  GLU A OE1   1 
ATOM   5429 O  OE2   . GLU A 1 657 ? -2.076  -23.900 72.171 1.00 46.65 ? 657  GLU A OE2   1 
ATOM   5430 N  N     . ARG A 1 658 ? 1.586   -18.017 71.048 1.00 28.79 ? 658  ARG A N     1 
ATOM   5431 C  CA    . ARG A 1 658 ? 2.436   -16.973 71.620 1.00 28.65 ? 658  ARG A CA    1 
ATOM   5432 C  C     . ARG A 1 658 ? 2.646   -15.786 70.689 1.00 27.97 ? 658  ARG A C     1 
ATOM   5433 O  O     . ARG A 1 658 ? 2.458   -14.635 71.089 1.00 28.92 ? 658  ARG A O     1 
ATOM   5434 C  CB    . ARG A 1 658 ? 3.791   -17.547 72.050 1.00 29.46 ? 658  ARG A CB    1 
ATOM   5435 C  CG    . ARG A 1 658 ? 3.714   -18.662 73.087 1.00 33.08 ? 658  ARG A CG    1 
ATOM   5436 C  CD    . ARG A 1 658 ? 3.054   -18.199 74.383 1.00 40.02 ? 658  ARG A CD    1 
ATOM   5437 N  NE    . ARG A 1 658 ? 2.726   -19.333 75.245 1.00 45.89 ? 658  ARG A NE    1 
ATOM   5438 C  CZ    . ARG A 1 658 ? 1.886   -19.288 76.275 1.00 49.01 ? 658  ARG A CZ    1 
ATOM   5439 N  NH1   . ARG A 1 658 ? 1.266   -18.158 76.599 1.00 51.26 ? 658  ARG A NH1   1 
ATOM   5440 N  NH2   . ARG A 1 658 ? 1.662   -20.384 76.984 1.00 50.73 ? 658  ARG A NH2   1 
ATOM   5441 N  N     . MET A 1 659 ? 3.024   -16.056 69.445 1.00 24.62 ? 659  MET A N     1 
ATOM   5442 C  CA    . MET A 1 659 ? 3.379   -14.959 68.543 1.00 26.27 ? 659  MET A CA    1 
ATOM   5443 C  C     . MET A 1 659 ? 2.187   -14.207 67.967 1.00 25.27 ? 659  MET A C     1 
ATOM   5444 O  O     . MET A 1 659 ? 2.190   -12.979 67.938 1.00 25.66 ? 659  MET A O     1 
ATOM   5445 C  CB    . MET A 1 659 ? 4.313   -15.431 67.442 1.00 26.77 ? 659  MET A CB    1 
ATOM   5446 C  CG    . MET A 1 659 ? 5.709   -15.692 67.969 1.00 30.41 ? 659  MET A CG    1 
ATOM   5447 S  SD    . MET A 1 659 ? 6.862   -16.065 66.665 1.00 35.15 ? 659  MET A SD    1 
ATOM   5448 C  CE    . MET A 1 659 ? 7.098   -14.432 65.951 1.00 34.92 ? 659  MET A CE    1 
ATOM   5449 N  N     . GLU A 1 660 ? 1.176   -14.943 67.519 1.00 25.31 ? 660  GLU A N     1 
ATOM   5450 C  CA    . GLU A 1 660 ? -0.016  -14.316 66.949 1.00 23.99 ? 660  GLU A CA    1 
ATOM   5451 C  C     . GLU A 1 660 ? -0.780  -13.422 67.947 1.00 24.40 ? 660  GLU A C     1 
ATOM   5452 O  O     . GLU A 1 660 ? -1.222  -12.338 67.565 1.00 23.42 ? 660  GLU A O     1 
ATOM   5453 C  CB    . GLU A 1 660 ? -0.922  -15.353 66.276 1.00 23.79 ? 660  GLU A CB    1 
ATOM   5454 C  CG    . GLU A 1 660 ? -0.393  -15.812 64.914 1.00 26.97 ? 660  GLU A CG    1 
ATOM   5455 C  CD    . GLU A 1 660 ? -1.249  -16.884 64.258 1.00 31.26 ? 660  GLU A CD    1 
ATOM   5456 O  OE1   . GLU A 1 660 ? -2.354  -17.181 64.767 1.00 32.22 ? 660  GLU A OE1   1 
ATOM   5457 O  OE2   . GLU A 1 660 ? -0.810  -17.432 63.223 1.00 31.34 ? 660  GLU A OE2   1 
ATOM   5458 N  N     . PRO A 1 661 ? -0.923  -13.850 69.223 1.00 24.06 ? 661  PRO A N     1 
ATOM   5459 C  CA    . PRO A 1 661 ? -1.535  -12.927 70.187 1.00 25.34 ? 661  PRO A CA    1 
ATOM   5460 C  C     . PRO A 1 661 ? -0.722  -11.650 70.409 1.00 24.83 ? 661  PRO A C     1 
ATOM   5461 O  O     . PRO A 1 661 ? -1.306  -10.577 70.548 1.00 25.03 ? 661  PRO A O     1 
ATOM   5462 C  CB    . PRO A 1 661 ? -1.594  -13.755 71.475 1.00 25.94 ? 661  PRO A CB    1 
ATOM   5463 C  CG    . PRO A 1 661 ? -1.673  -15.155 70.998 1.00 25.25 ? 661  PRO A CG    1 
ATOM   5464 C  CD    . PRO A 1 661 ? -0.757  -15.193 69.812 1.00 24.81 ? 661  PRO A CD    1 
ATOM   5465 N  N     . ALA A 1 662 ? 0.604   -11.768 70.440 1.00 23.79 ? 662  ALA A N     1 
ATOM   5466 C  CA    . ALA A 1 662 ? 1.476   -10.598 70.571 1.00 24.69 ? 662  ALA A CA    1 
ATOM   5467 C  C     . ALA A 1 662 ? 1.329   -9.673  69.367 1.00 22.95 ? 662  ALA A C     1 
ATOM   5468 O  O     . ALA A 1 662 ? 1.308   -8.454  69.513 1.00 21.73 ? 662  ALA A O     1 
ATOM   5469 C  CB    . ALA A 1 662 ? 2.933   -11.020 70.747 1.00 23.76 ? 662  ALA A CB    1 
ATOM   5470 N  N     . ILE A 1 663 ? 1.211   -10.268 68.184 1.00 20.84 ? 663  ILE A N     1 
ATOM   5471 C  CA    . ILE A 1 663 ? 1.075   -9.504  66.947 1.00 19.65 ? 663  ILE A CA    1 
ATOM   5472 C  C     . ILE A 1 663 ? -0.264  -8.755  66.944 1.00 19.81 ? 663  ILE A C     1 
ATOM   5473 O  O     . ILE A 1 663 ? -0.310  -7.562  66.624 1.00 20.67 ? 663  ILE A O     1 
ATOM   5474 C  CB    . ILE A 1 663 ? 1.239   -10.420 65.704 1.00 19.27 ? 663  ILE A CB    1 
ATOM   5475 C  CG1   . ILE A 1 663 ? 2.705   -10.865 65.566 1.00 20.31 ? 663  ILE A CG1   1 
ATOM   5476 C  CG2   . ILE A 1 663 ? 0.758   -9.725  64.431 1.00 16.14 ? 663  ILE A CG2   1 
ATOM   5477 C  CD1   . ILE A 1 663 ? 2.931   -12.040 64.595 1.00 18.12 ? 663  ILE A CD1   1 
ATOM   5478 N  N     . ASP A 1 664 ? -1.333  -9.463  67.312 1.00 20.49 ? 664  ASP A N     1 
ATOM   5479 C  CA    A ASP A 1 664 ? -2.662  -8.865  67.370 0.50 22.00 ? 664  ASP A CA    1 
ATOM   5480 C  CA    B ASP A 1 664 ? -2.677  -8.890  67.403 0.50 21.44 ? 664  ASP A CA    1 
ATOM   5481 C  C     . ASP A 1 664 ? -2.701  -7.719  68.384 1.00 22.37 ? 664  ASP A C     1 
ATOM   5482 O  O     . ASP A 1 664 ? -3.305  -6.684  68.116 1.00 23.47 ? 664  ASP A O     1 
ATOM   5483 C  CB    A ASP A 1 664 ? -3.729  -9.919  67.682 0.50 23.12 ? 664  ASP A CB    1 
ATOM   5484 C  CB    B ASP A 1 664 ? -3.691  -9.951  67.847 0.50 22.13 ? 664  ASP A CB    1 
ATOM   5485 C  CG    A ASP A 1 664 ? -5.142  -9.421  67.407 0.50 25.64 ? 664  ASP A CG    1 
ATOM   5486 C  CG    B ASP A 1 664 ? -3.837  -11.086 66.850 0.50 21.65 ? 664  ASP A CG    1 
ATOM   5487 O  OD1   A ASP A 1 664 ? -5.899  -9.227  68.381 0.50 26.17 ? 664  ASP A OD1   1 
ATOM   5488 O  OD1   B ASP A 1 664 ? -3.457  -10.914 65.674 0.50 20.33 ? 664  ASP A OD1   1 
ATOM   5489 O  OD2   A ASP A 1 664 ? -5.494  -9.218  66.223 0.50 24.43 ? 664  ASP A OD2   1 
ATOM   5490 O  OD2   B ASP A 1 664 ? -4.331  -12.162 67.250 0.50 23.26 ? 664  ASP A OD2   1 
ATOM   5491 N  N     . ARG A 1 665 ? -2.044  -7.894  69.532 1.00 22.95 ? 665  ARG A N     1 
ATOM   5492 C  CA    . ARG A 1 665 ? -1.958  -6.819  70.530 1.00 24.05 ? 665  ARG A CA    1 
ATOM   5493 C  C     . ARG A 1 665 ? -1.251  -5.602  69.927 1.00 22.38 ? 665  ARG A C     1 
ATOM   5494 O  O     . ARG A 1 665 ? -1.704  -4.464  70.085 1.00 21.81 ? 665  ARG A O     1 
ATOM   5495 C  CB    . ARG A 1 665 ? -1.223  -7.283  71.794 1.00 26.08 ? 665  ARG A CB    1 
ATOM   5496 C  CG    . ARG A 1 665 ? -2.061  -8.141  72.736 1.00 31.46 ? 665  ARG A CG    1 
ATOM   5497 C  CD    . ARG A 1 665 ? -1.393  -8.315  74.108 1.00 36.16 ? 665  ARG A CD    1 
ATOM   5498 N  NE    . ARG A 1 665 ? -0.016  -8.810  74.022 1.00 39.24 ? 665  ARG A NE    1 
ATOM   5499 C  CZ    . ARG A 1 665 ? 0.330   -10.097 73.966 1.00 41.04 ? 665  ARG A CZ    1 
ATOM   5500 N  NH1   . ARG A 1 665 ? -0.595  -11.051 73.973 1.00 37.54 ? 665  ARG A NH1   1 
ATOM   5501 N  NH2   . ARG A 1 665 ? 1.611   -10.433 73.896 1.00 41.57 ? 665  ARG A NH2   1 
ATOM   5502 N  N     . GLY A 1 666 ? -0.148  -5.861  69.228 1.00 21.16 ? 666  GLY A N     1 
ATOM   5503 C  CA    . GLY A 1 666 ? 0.629   -4.818  68.560 1.00 20.67 ? 666  GLY A CA    1 
ATOM   5504 C  C     . GLY A 1 666 ? -0.193  -4.031  67.552 1.00 19.43 ? 666  GLY A C     1 
ATOM   5505 O  O     . GLY A 1 666 ? -0.157  -2.801  67.543 1.00 18.71 ? 666  GLY A O     1 
ATOM   5506 N  N     . PHE A 1 667 ? -0.944  -4.739  66.711 1.00 19.93 ? 667  PHE A N     1 
ATOM   5507 C  CA    . PHE A 1 667 ? -1.785  -4.081  65.715 1.00 18.33 ? 667  PHE A CA    1 
ATOM   5508 C  C     . PHE A 1 667 ? -2.989  -3.347  66.311 1.00 19.46 ? 667  PHE A C     1 
ATOM   5509 O  O     . PHE A 1 667 ? -3.376  -2.295  65.799 1.00 19.75 ? 667  PHE A O     1 
ATOM   5510 C  CB    . PHE A 1 667 ? -2.216  -5.049  64.602 1.00 17.33 ? 667  PHE A CB    1 
ATOM   5511 C  CG    . PHE A 1 667 ? -1.185  -5.209  63.510 1.00 17.85 ? 667  PHE A CG    1 
ATOM   5512 C  CD1   . PHE A 1 667 ? -0.605  -4.085  62.917 1.00 17.35 ? 667  PHE A CD1   1 
ATOM   5513 C  CD2   . PHE A 1 667 ? -0.797  -6.475  63.076 1.00 18.99 ? 667  PHE A CD2   1 
ATOM   5514 C  CE1   . PHE A 1 667 ? 0.354   -4.220  61.911 1.00 17.80 ? 667  PHE A CE1   1 
ATOM   5515 C  CE2   . PHE A 1 667 ? 0.153   -6.624  62.059 1.00 18.69 ? 667  PHE A CE2   1 
ATOM   5516 C  CZ    . PHE A 1 667 ? 0.725   -5.495  61.471 1.00 16.88 ? 667  PHE A CZ    1 
ATOM   5517 N  N     . ARG A 1 668 ? -3.581  -3.882  67.382 1.00 18.83 ? 668  ARG A N     1 
ATOM   5518 C  CA    A ARG A 1 668 ? -4.680  -3.193  68.062 0.50 20.87 ? 668  ARG A CA    1 
ATOM   5519 C  CA    B ARG A 1 668 ? -4.684  -3.188  68.039 0.50 20.53 ? 668  ARG A CA    1 
ATOM   5520 C  C     . ARG A 1 668 ? -4.220  -1.830  68.566 1.00 21.11 ? 668  ARG A C     1 
ATOM   5521 O  O     . ARG A 1 668 ? -4.957  -0.847  68.496 1.00 21.86 ? 668  ARG A O     1 
ATOM   5522 C  CB    A ARG A 1 668 ? -5.240  -4.027  69.219 0.50 22.47 ? 668  ARG A CB    1 
ATOM   5523 C  CB    B ARG A 1 668 ? -5.311  -4.055  69.136 0.50 21.78 ? 668  ARG A CB    1 
ATOM   5524 C  CG    A ARG A 1 668 ? -6.303  -5.027  68.803 0.50 26.23 ? 668  ARG A CG    1 
ATOM   5525 C  CG    B ARG A 1 668 ? -6.199  -5.159  68.570 0.50 24.19 ? 668  ARG A CG    1 
ATOM   5526 C  CD    A ARG A 1 668 ? -7.069  -5.550  70.010 0.50 29.80 ? 668  ARG A CD    1 
ATOM   5527 C  CD    B ARG A 1 668 ? -6.766  -6.079  69.639 0.50 26.45 ? 668  ARG A CD    1 
ATOM   5528 N  NE    A ARG A 1 668 ? -6.259  -6.456  70.817 0.50 33.06 ? 668  ARG A NE    1 
ATOM   5529 N  NE    B ARG A 1 668 ? -8.057  -6.618  69.219 0.50 29.79 ? 668  ARG A NE    1 
ATOM   5530 C  CZ    A ARG A 1 668 ? -6.236  -7.775  70.659 0.50 34.02 ? 668  ARG A CZ    1 
ATOM   5531 C  CZ    B ARG A 1 668 ? -8.210  -7.686  68.444 0.50 30.38 ? 668  ARG A CZ    1 
ATOM   5532 N  NH1   A ARG A 1 668 ? -6.985  -8.345  69.724 0.50 33.58 ? 668  ARG A NH1   1 
ATOM   5533 N  NH1   B ARG A 1 668 ? -7.148  -8.351  68.005 0.50 31.25 ? 668  ARG A NH1   1 
ATOM   5534 N  NH2   A ARG A 1 668 ? -5.468  -8.525  71.437 0.50 34.64 ? 668  ARG A NH2   1 
ATOM   5535 N  NH2   B ARG A 1 668 ? -9.426  -8.092  68.108 0.50 29.42 ? 668  ARG A NH2   1 
ATOM   5536 N  N     . GLU A 1 669 ? -2.987  -1.774  69.061 1.00 20.69 ? 669  GLU A N     1 
ATOM   5537 C  CA    . GLU A 1 669 ? -2.413  -0.517  69.528 1.00 22.04 ? 669  GLU A CA    1 
ATOM   5538 C  C     . GLU A 1 669 ? -2.230  0.461   68.365 1.00 20.34 ? 669  GLU A C     1 
ATOM   5539 O  O     . GLU A 1 669 ? -2.493  1.659   68.507 1.00 20.71 ? 669  GLU A O     1 
ATOM   5540 C  CB    . GLU A 1 669 ? -1.083  -0.762  70.248 1.00 24.78 ? 669  GLU A CB    1 
ATOM   5541 C  CG    . GLU A 1 669 ? -0.475  0.486   70.877 1.00 28.97 ? 669  GLU A CG    1 
ATOM   5542 C  CD    . GLU A 1 669 ? 0.806   0.190   71.627 1.00 33.87 ? 669  GLU A CD    1 
ATOM   5543 O  OE1   . GLU A 1 669 ? 0.727   -0.256  72.792 1.00 36.34 ? 669  GLU A OE1   1 
ATOM   5544 O  OE2   . GLU A 1 669 ? 1.891   0.413   71.056 1.00 33.72 ? 669  GLU A OE2   1 
ATOM   5545 N  N     . MET A 1 670 ? -1.783  -0.056  67.220 1.00 17.92 ? 670  MET A N     1 
ATOM   5546 C  CA    . MET A 1 670 ? -1.589  0.772   66.034 1.00 18.40 ? 670  MET A CA    1 
ATOM   5547 C  C     . MET A 1 670 ? -2.915  1.331   65.524 1.00 17.84 ? 670  MET A C     1 
ATOM   5548 O  O     . MET A 1 670 ? -2.976  2.484   65.090 1.00 18.06 ? 670  MET A O     1 
ATOM   5549 C  CB    . MET A 1 670 ? -0.892  -0.017  64.926 1.00 17.40 ? 670  MET A CB    1 
ATOM   5550 C  CG    . MET A 1 670 ? -0.329  0.868   63.829 1.00 20.05 ? 670  MET A CG    1 
ATOM   5551 S  SD    . MET A 1 670 ? 0.293   -0.118  62.471 1.00 20.86 ? 670  MET A SD    1 
ATOM   5552 C  CE    . MET A 1 670 ? -1.224  -0.510  61.609 1.00 23.59 ? 670  MET A CE    1 
ATOM   5553 N  N     . CYS A 1 671 ? -3.966  0.507   65.571 1.00 17.47 ? 671  CYS A N     1 
ATOM   5554 C  CA    . CYS A 1 671 ? -5.321  0.944   65.218 1.00 18.80 ? 671  CYS A CA    1 
ATOM   5555 C  C     . CYS A 1 671 ? -5.766  2.135   66.076 1.00 20.28 ? 671  CYS A C     1 
ATOM   5556 O  O     . CYS A 1 671 ? -6.304  3.123   65.559 1.00 18.22 ? 671  CYS A O     1 
ATOM   5557 C  CB    . CYS A 1 671 ? -6.309  -0.218  65.361 1.00 21.10 ? 671  CYS A CB    1 
ATOM   5558 S  SG    . CYS A 1 671 ? -7.996  0.147   64.777 1.00 22.30 ? 671  CYS A SG    1 
ATOM   5559 N  N     . GLU A 1 672 ? -5.528  2.031   67.381 1.00 21.11 ? 672  GLU A N     1 
ATOM   5560 C  CA    A GLU A 1 672 ? -5.872  3.086   68.343 0.50 23.33 ? 672  GLU A CA    1 
ATOM   5561 C  CA    B GLU A 1 672 ? -5.901  3.094   68.313 0.50 22.62 ? 672  GLU A CA    1 
ATOM   5562 C  C     . GLU A 1 672 ? -5.080  4.368   68.093 1.00 22.52 ? 672  GLU A C     1 
ATOM   5563 O  O     . GLU A 1 672 ? -5.618  5.477   68.183 1.00 21.67 ? 672  GLU A O     1 
ATOM   5564 C  CB    A GLU A 1 672 ? -5.627  2.597   69.774 0.50 25.72 ? 672  GLU A CB    1 
ATOM   5565 C  CB    B GLU A 1 672 ? -5.788  2.604   69.759 0.50 24.24 ? 672  GLU A CB    1 
ATOM   5566 C  CG    A GLU A 1 672 ? -6.881  2.262   70.561 0.50 32.46 ? 672  GLU A CG    1 
ATOM   5567 C  CG    B GLU A 1 672 ? -6.745  1.468   70.089 0.50 28.38 ? 672  GLU A CG    1 
ATOM   5568 C  CD    A GLU A 1 672 ? -7.479  3.478   71.238 0.50 36.70 ? 672  GLU A CD    1 
ATOM   5569 C  CD    B GLU A 1 672 ? -6.532  0.910   71.480 0.50 31.35 ? 672  GLU A CD    1 
ATOM   5570 O  OE1   A GLU A 1 672 ? -7.842  3.384   72.432 0.50 40.23 ? 672  GLU A OE1   1 
ATOM   5571 O  OE1   B GLU A 1 672 ? -5.603  1.373   72.173 0.50 34.26 ? 672  GLU A OE1   1 
ATOM   5572 O  OE2   A GLU A 1 672 ? -7.577  4.533   70.582 0.50 38.69 ? 672  GLU A OE2   1 
ATOM   5573 O  OE2   B GLU A 1 672 ? -7.292  0.004   71.878 0.50 34.04 ? 672  GLU A OE2   1 
ATOM   5574 N  N     . TYR A 1 673 ? -3.791  4.200   67.792 1.00 21.64 ? 673  TYR A N     1 
ATOM   5575 C  CA    . TYR A 1 673 ? -2.868  5.305   67.509 1.00 20.77 ? 673  TYR A CA    1 
ATOM   5576 C  C     . TYR A 1 673 ? -3.330  6.118   66.296 1.00 19.87 ? 673  TYR A C     1 
ATOM   5577 O  O     . TYR A 1 673 ? -3.360  7.348   66.342 1.00 20.19 ? 673  TYR A O     1 
ATOM   5578 C  CB    . TYR A 1 673 ? -1.466  4.729   67.286 1.00 21.22 ? 673  TYR A CB    1 
ATOM   5579 C  CG    . TYR A 1 673 ? -0.312  5.702   67.131 1.00 21.33 ? 673  TYR A CG    1 
ATOM   5580 C  CD1   . TYR A 1 673 ? -0.291  6.944   67.783 1.00 21.24 ? 673  TYR A CD1   1 
ATOM   5581 C  CD2   . TYR A 1 673 ? 0.799   5.343   66.370 1.00 22.56 ? 673  TYR A CD2   1 
ATOM   5582 C  CE1   . TYR A 1 673 ? 0.801   7.816   67.638 1.00 23.06 ? 673  TYR A CE1   1 
ATOM   5583 C  CE2   . TYR A 1 673 ? 1.887   6.194   66.228 1.00 22.92 ? 673  TYR A CE2   1 
ATOM   5584 C  CZ    . TYR A 1 673 ? 1.886   7.423   66.862 1.00 25.15 ? 673  TYR A CZ    1 
ATOM   5585 O  OH    . TYR A 1 673 ? 2.980   8.240   66.706 1.00 25.89 ? 673  TYR A OH    1 
ATOM   5586 N  N     . MET A 1 674 ? -3.712  5.418   65.229 1.00 17.55 ? 674  MET A N     1 
ATOM   5587 C  CA    . MET A 1 674 ? -4.246  6.039   64.019 1.00 17.25 ? 674  MET A CA    1 
ATOM   5588 C  C     . MET A 1 674 ? -5.743  6.362   64.116 1.00 16.83 ? 674  MET A C     1 
ATOM   5589 O  O     . MET A 1 674 ? -6.315  6.951   63.193 1.00 16.75 ? 674  MET A O     1 
ATOM   5590 C  CB    . MET A 1 674 ? -3.987  5.131   62.807 1.00 16.17 ? 674  MET A CB    1 
ATOM   5591 C  CG    . MET A 1 674 ? -2.513  5.000   62.404 1.00 20.12 ? 674  MET A CG    1 
ATOM   5592 S  SD    . MET A 1 674 ? -1.763  6.563   61.881 1.00 23.75 ? 674  MET A SD    1 
ATOM   5593 C  CE    . MET A 1 674 ? -0.653  6.827   63.249 1.00 21.86 ? 674  MET A CE    1 
ATOM   5594 N  N     . ASN A 1 675 ? -6.366  5.984   65.236 1.00 15.91 ? 675  ASN A N     1 
ATOM   5595 C  CA    . ASN A 1 675 ? -7.805  6.191   65.475 1.00 15.96 ? 675  ASN A CA    1 
ATOM   5596 C  C     . ASN A 1 675 ? -8.679  5.598   64.372 1.00 16.12 ? 675  ASN A C     1 
ATOM   5597 O  O     . ASN A 1 675 ? -9.676  6.199   63.968 1.00 16.37 ? 675  ASN A O     1 
ATOM   5598 C  CB    . ASN A 1 675 ? -8.135  7.682   65.703 1.00 17.52 ? 675  ASN A CB    1 
ATOM   5599 C  CG    . ASN A 1 675 ? -9.537  7.899   66.279 1.00 20.15 ? 675  ASN A CG    1 
ATOM   5600 O  OD1   . ASN A 1 675 ? -10.038 7.088   67.070 1.00 19.24 ? 675  ASN A OD1   1 
ATOM   5601 N  ND2   . ASN A 1 675 ? -10.173 9.000   65.885 1.00 16.36 ? 675  ASN A ND2   1 
ATOM   5602 N  N     . ASN A 1 676 ? -8.307  4.415   63.893 1.00 16.17 ? 676  ASN A N     1 
ATOM   5603 C  CA    . ASN A 1 676 ? -8.997  3.828   62.741 1.00 15.02 ? 676  ASN A CA    1 
ATOM   5604 C  C     . ASN A 1 676 ? -10.408 3.346   63.060 1.00 17.42 ? 676  ASN A C     1 
ATOM   5605 O  O     . ASN A 1 676 ? -10.772 3.169   64.232 1.00 17.74 ? 676  ASN A O     1 
ATOM   5606 C  CB    . ASN A 1 676 ? -8.170  2.715   62.090 1.00 14.33 ? 676  ASN A CB    1 
ATOM   5607 C  CG    . ASN A 1 676 ? -6.854  3.215   61.510 1.00 13.32 ? 676  ASN A CG    1 
ATOM   5608 O  OD1   . ASN A 1 676 ? -5.832  2.550   61.642 1.00 16.05 ? 676  ASN A OD1   1 
ATOM   5609 N  ND2   . ASN A 1 676 ? -6.874  4.379   60.863 1.00 15.34 ? 676  ASN A ND2   1 
ATOM   5610 N  N     . LYS A 1 677 ? -11.201 3.149   62.008 1.00 15.95 ? 677  LYS A N     1 
ATOM   5611 C  CA    . LYS A 1 677 ? -12.604 2.782   62.172 1.00 17.69 ? 677  LYS A CA    1 
ATOM   5612 C  C     . LYS A 1 677 ? -12.765 1.379   62.754 1.00 20.25 ? 677  LYS A C     1 
ATOM   5613 O  O     . LYS A 1 677 ? -13.586 1.161   63.646 1.00 21.61 ? 677  LYS A O     1 
ATOM   5614 C  CB    . LYS A 1 677 ? -13.360 2.906   60.841 1.00 18.54 ? 677  LYS A CB    1 
ATOM   5615 C  CG    . LYS A 1 677 ? -14.881 2.813   60.982 1.00 19.93 ? 677  LYS A CG    1 
ATOM   5616 C  CD    . LYS A 1 677 ? -15.598 3.337   59.742 1.00 20.91 ? 677  LYS A CD    1 
ATOM   5617 C  CE    . LYS A 1 677 ? -17.117 3.336   59.916 1.00 21.76 ? 677  LYS A CE    1 
ATOM   5618 N  NZ    . LYS A 1 677 ? -17.653 1.981   60.214 1.00 25.07 ? 677  LYS A NZ    1 
ATOM   5619 N  N     . GLN A 1 678 ? -11.971 0.437   62.253 1.00 21.63 ? 678  GLN A N     1 
ATOM   5620 C  CA    . GLN A 1 678 ? -12.091 -0.966  62.644 1.00 23.07 ? 678  GLN A CA    1 
ATOM   5621 C  C     . GLN A 1 678 ? -10.747 -1.668  62.522 1.00 21.21 ? 678  GLN A C     1 
ATOM   5622 O  O     . GLN A 1 678 ? -10.058 -1.503  61.529 1.00 20.18 ? 678  GLN A O     1 
ATOM   5623 C  CB    . GLN A 1 678 ? -13.126 -1.666  61.753 1.00 24.14 ? 678  GLN A CB    1 
ATOM   5624 C  CG    . GLN A 1 678 ? -13.403 -3.123  62.107 1.00 31.07 ? 678  GLN A CG    1 
ATOM   5625 C  CD    . GLN A 1 678 ? -14.369 -3.803  61.139 1.00 30.04 ? 678  GLN A CD    1 
ATOM   5626 O  OE1   . GLN A 1 678 ? -14.688 -3.276  60.075 1.00 30.46 ? 678  GLN A OE1   1 
ATOM   5627 N  NE2   . GLN A 1 678 ? -14.833 -4.985  61.515 1.00 37.58 ? 678  GLN A NE2   1 
ATOM   5628 N  N     . HIS A 1 679 ? -10.394 -2.465  63.525 1.00 19.47 ? 679  HIS A N     1 
ATOM   5629 C  CA    . HIS A 1 679 ? -9.148  -3.230  63.499 1.00 19.32 ? 679  HIS A CA    1 
ATOM   5630 C  C     . HIS A 1 679 ? -9.274  -4.420  62.554 1.00 19.03 ? 679  HIS A C     1 
ATOM   5631 O  O     . HIS A 1 679 ? -10.062 -5.340  62.795 1.00 18.90 ? 679  HIS A O     1 
ATOM   5632 C  CB    . HIS A 1 679 ? -8.769  -3.700  64.906 1.00 20.33 ? 679  HIS A CB    1 
ATOM   5633 C  CG    . HIS A 1 679 ? -7.742  -4.793  64.925 1.00 18.80 ? 679  HIS A CG    1 
ATOM   5634 N  ND1   . HIS A 1 679 ? -6.487  -4.644  64.380 1.00 20.55 ? 679  HIS A ND1   1 
ATOM   5635 C  CD2   . HIS A 1 679 ? -7.781  -6.044  65.442 1.00 19.36 ? 679  HIS A CD2   1 
ATOM   5636 C  CE1   . HIS A 1 679 ? -5.799  -5.759  64.553 1.00 24.17 ? 679  HIS A CE1   1 
ATOM   5637 N  NE2   . HIS A 1 679 ? -6.558  -6.622  65.202 1.00 18.76 ? 679  HIS A NE2   1 
ATOM   5638 N  N     . LEU A 1 680 ? -8.494  -4.387  61.478 1.00 16.59 ? 680  LEU A N     1 
ATOM   5639 C  CA    . LEU A 1 680 ? -8.560  -5.422  60.452 1.00 17.96 ? 680  LEU A CA    1 
ATOM   5640 C  C     . LEU A 1 680 ? -7.176  -5.879  60.003 1.00 17.66 ? 680  LEU A C     1 
ATOM   5641 O  O     . LEU A 1 680 ? -7.043  -6.531  58.969 1.00 17.80 ? 680  LEU A O     1 
ATOM   5642 C  CB    . LEU A 1 680 ? -9.393  -4.944  59.251 1.00 16.72 ? 680  LEU A CB    1 
ATOM   5643 C  CG    . LEU A 1 680 ? -10.898 -4.785  59.508 1.00 17.28 ? 680  LEU A CG    1 
ATOM   5644 C  CD1   . LEU A 1 680 ? -11.541 -3.969  58.393 1.00 17.17 ? 680  LEU A CD1   1 
ATOM   5645 C  CD2   . LEU A 1 680 ? -11.597 -6.134  59.663 1.00 16.51 ? 680  LEU A CD2   1 
ATOM   5646 N  N     . MET A 1 681 ? -6.149  -5.535  60.785 1.00 17.24 ? 681  MET A N     1 
ATOM   5647 C  CA    . MET A 1 681 ? -4.789  -5.986  60.499 1.00 16.82 ? 681  MET A CA    1 
ATOM   5648 C  C     . MET A 1 681 ? -4.618  -7.373  61.106 1.00 18.46 ? 681  MET A C     1 
ATOM   5649 O  O     . MET A 1 681 ? -4.307  -7.507  62.296 1.00 16.91 ? 681  MET A O     1 
ATOM   5650 C  CB    . MET A 1 681 ? -3.742  -4.998  61.045 1.00 19.00 ? 681  MET A CB    1 
ATOM   5651 C  CG    . MET A 1 681 ? -3.695  -3.626  60.334 1.00 19.48 ? 681  MET A CG    1 
ATOM   5652 S  SD    . MET A 1 681 ? -3.353  -3.675  58.561 1.00 19.22 ? 681  MET A SD    1 
ATOM   5653 C  CE    . MET A 1 681 ? -5.004  -3.580  57.870 1.00 18.01 ? 681  MET A CE    1 
ATOM   5654 N  N     . PHE A 1 682 ? -4.857  -8.398  60.289 1.00 17.29 ? 682  PHE A N     1 
ATOM   5655 C  CA    . PHE A 1 682 ? -4.837  -9.775  60.754 1.00 20.42 ? 682  PHE A CA    1 
ATOM   5656 C  C     . PHE A 1 682 ? -3.639  -10.469 60.144 1.00 21.15 ? 682  PHE A C     1 
ATOM   5657 O  O     . PHE A 1 682 ? -3.641  -10.813 58.960 1.00 17.88 ? 682  PHE A O     1 
ATOM   5658 C  CB    . PHE A 1 682 ? -6.125  -10.524 60.384 1.00 22.18 ? 682  PHE A CB    1 
ATOM   5659 C  CG    . PHE A 1 682 ? -7.389  -9.885  60.908 1.00 22.28 ? 682  PHE A CG    1 
ATOM   5660 C  CD1   . PHE A 1 682 ? -7.421  -9.265  62.156 1.00 22.90 ? 682  PHE A CD1   1 
ATOM   5661 C  CD2   . PHE A 1 682 ? -8.566  -9.949  60.162 1.00 20.71 ? 682  PHE A CD2   1 
ATOM   5662 C  CE1   . PHE A 1 682 ? -8.597  -8.686  62.638 1.00 23.01 ? 682  PHE A CE1   1 
ATOM   5663 C  CE2   . PHE A 1 682 ? -9.754  -9.377  60.639 1.00 24.36 ? 682  PHE A CE2   1 
ATOM   5664 C  CZ    . PHE A 1 682 ? -9.764  -8.744  61.881 1.00 23.50 ? 682  PHE A CZ    1 
ATOM   5665 N  N     . MET A 1 683 ? -2.612  -10.650 60.966 1.00 22.51 ? 683  MET A N     1 
ATOM   5666 C  CA    . MET A 1 683 ? -1.369  -11.257 60.522 1.00 22.52 ? 683  MET A CA    1 
ATOM   5667 C  C     . MET A 1 683 ? -1.219  -12.640 61.150 1.00 24.82 ? 683  MET A C     1 
ATOM   5668 O  O     . MET A 1 683 ? -1.025  -12.774 62.368 1.00 26.56 ? 683  MET A O     1 
ATOM   5669 C  CB    . MET A 1 683 ? -0.185  -10.343 60.847 1.00 21.78 ? 683  MET A CB    1 
ATOM   5670 C  CG    . MET A 1 683 ? 1.170   -10.995 60.662 1.00 22.09 ? 683  MET A CG    1 
ATOM   5671 S  SD    . MET A 1 683 ? 2.528   -9.862  60.949 1.00 23.15 ? 683  MET A SD    1 
ATOM   5672 C  CE    . MET A 1 683 ? 2.930   -9.403  59.273 1.00 19.54 ? 683  MET A CE    1 
ATOM   5673 N  N     . ASP A 1 684 ? -1.333  -13.659 60.301 1.00 24.55 ? 684  ASP A N     1 
ATOM   5674 C  CA    . ASP A 1 684 ? -1.277  -15.056 60.721 1.00 25.52 ? 684  ASP A CA    1 
ATOM   5675 C  C     . ASP A 1 684 ? 0.000   -15.702 60.220 1.00 23.47 ? 684  ASP A C     1 
ATOM   5676 O  O     . ASP A 1 684 ? 0.592   -15.255 59.239 1.00 21.74 ? 684  ASP A O     1 
ATOM   5677 C  CB    . ASP A 1 684 ? -2.453  -15.841 60.135 1.00 27.79 ? 684  ASP A CB    1 
ATOM   5678 C  CG    . ASP A 1 684 ? -3.796  -15.346 60.620 1.00 33.20 ? 684  ASP A CG    1 
ATOM   5679 O  OD1   . ASP A 1 684 ? -3.896  -14.909 61.785 1.00 35.20 ? 684  ASP A OD1   1 
ATOM   5680 O  OD2   . ASP A 1 684 ? -4.761  -15.414 59.832 1.00 38.42 ? 684  ASP A OD2   1 
ATOM   5681 N  N     . ARG A 1 685 ? 0.397   -16.786 60.873 1.00 22.72 ? 685  ARG A N     1 
ATOM   5682 C  CA    . ARG A 1 685 ? 1.563   -17.547 60.438 1.00 21.52 ? 685  ARG A CA    1 
ATOM   5683 C  C     . ARG A 1 685 ? 1.355   -18.085 59.020 1.00 21.35 ? 685  ARG A C     1 
ATOM   5684 O  O     . ARG A 1 685 ? 0.276   -18.573 58.678 1.00 21.36 ? 685  ARG A O     1 
ATOM   5685 C  CB    . ARG A 1 685 ? 1.865   -18.668 61.447 1.00 20.97 ? 685  ARG A CB    1 
ATOM   5686 C  CG    . ARG A 1 685 ? 3.193   -19.396 61.218 1.00 20.93 ? 685  ARG A CG    1 
ATOM   5687 C  CD    . ARG A 1 685 ? 3.037   -20.576 60.261 1.00 23.03 ? 685  ARG A CD    1 
ATOM   5688 N  NE    . ARG A 1 685 ? 2.239   -21.670 60.823 1.00 19.02 ? 685  ARG A NE    1 
ATOM   5689 C  CZ    . ARG A 1 685 ? 1.897   -22.767 60.149 1.00 21.90 ? 685  ARG A CZ    1 
ATOM   5690 N  NH1   . ARG A 1 685 ? 2.274   -22.913 58.882 1.00 18.79 ? 685  ARG A NH1   1 
ATOM   5691 N  NH2   . ARG A 1 685 ? 1.179   -23.720 60.737 1.00 21.66 ? 685  ARG A NH2   1 
ATOM   5692 N  N     . GLU A 1 686 ? 2.381   -17.944 58.185 1.00 20.87 ? 686  GLU A N     1 
ATOM   5693 C  CA    . GLU A 1 686 ? 2.358   -18.495 56.841 1.00 21.17 ? 686  GLU A CA    1 
ATOM   5694 C  C     . GLU A 1 686 ? 3.198   -19.776 56.771 1.00 21.22 ? 686  GLU A C     1 
ATOM   5695 O  O     . GLU A 1 686 ? 2.650   -20.888 56.796 1.00 21.35 ? 686  GLU A O     1 
ATOM   5696 C  CB    . GLU A 1 686 ? 2.828   -17.448 55.820 1.00 22.06 ? 686  GLU A CB    1 
ATOM   5697 C  CG    . GLU A 1 686 ? 2.344   -17.724 54.412 1.00 29.51 ? 686  GLU A CG    1 
ATOM   5698 C  CD    . GLU A 1 686 ? 2.365   -16.493 53.524 1.00 35.34 ? 686  GLU A CD    1 
ATOM   5699 O  OE1   . GLU A 1 686 ? 1.275   -16.039 53.112 1.00 37.42 ? 686  GLU A OE1   1 
ATOM   5700 O  OE2   . GLU A 1 686 ? 3.466   -15.979 53.243 1.00 38.52 ? 686  GLU A OE2   1 
ATOM   5701 N  N     . ALA A 1 687 ? 4.520   -19.622 56.719 1.00 19.19 ? 687  ALA A N     1 
ATOM   5702 C  CA    . ALA A 1 687 ? 5.414   -20.756 56.503 1.00 19.25 ? 687  ALA A CA    1 
ATOM   5703 C  C     . ALA A 1 687 ? 6.157   -21.163 57.767 1.00 19.47 ? 687  ALA A C     1 
ATOM   5704 O  O     . ALA A 1 687 ? 6.506   -20.314 58.593 1.00 18.99 ? 687  ALA A O     1 
ATOM   5705 C  CB    . ALA A 1 687 ? 6.409   -20.446 55.373 1.00 21.32 ? 687  ALA A CB    1 
ATOM   5706 N  N     . ILE A 1 688 ? 6.360   -22.471 57.921 1.00 18.76 ? 688  ILE A N     1 
ATOM   5707 C  CA    . ILE A 1 688 ? 7.334   -23.009 58.869 1.00 17.55 ? 688  ILE A CA    1 
ATOM   5708 C  C     . ILE A 1 688 ? 8.408   -23.719 58.052 1.00 18.64 ? 688  ILE A C     1 
ATOM   5709 O  O     . ILE A 1 688 ? 8.118   -24.665 57.309 1.00 18.97 ? 688  ILE A O     1 
ATOM   5710 C  CB    . ILE A 1 688 ? 6.699   -23.967 59.894 1.00 18.51 ? 688  ILE A CB    1 
ATOM   5711 C  CG1   . ILE A 1 688 ? 5.655   -23.215 60.726 1.00 19.06 ? 688  ILE A CG1   1 
ATOM   5712 C  CG2   . ILE A 1 688 ? 7.781   -24.587 60.786 1.00 18.37 ? 688  ILE A CG2   1 
ATOM   5713 C  CD1   . ILE A 1 688 ? 4.875   -24.096 61.681 1.00 24.25 ? 688  ILE A CD1   1 
ATOM   5714 N  N     . ALA A 1 689 ? 9.640   -23.242 58.181 1.00 17.69 ? 689  ALA A N     1 
ATOM   5715 C  CA    . ALA A 1 689 ? 10.746  -23.717 57.356 1.00 17.51 ? 689  ALA A CA    1 
ATOM   5716 C  C     . ALA A 1 689 ? 11.957  -24.128 58.183 1.00 17.63 ? 689  ALA A C     1 
ATOM   5717 O  O     . ALA A 1 689 ? 12.205  -23.583 59.260 1.00 18.50 ? 689  ALA A O     1 
ATOM   5718 C  CB    . ALA A 1 689 ? 11.136  -22.649 56.322 1.00 17.64 ? 689  ALA A CB    1 
ATOM   5719 N  N     . GLY A 1 690 ? 12.704  -25.098 57.662 1.00 17.27 ? 690  GLY A N     1 
ATOM   5720 C  CA    . GLY A 1 690 ? 13.921  -25.599 58.308 1.00 17.63 ? 690  GLY A CA    1 
ATOM   5721 C  C     . GLY A 1 690 ? 14.465  -26.819 57.587 1.00 18.57 ? 690  GLY A C     1 
ATOM   5722 O  O     . GLY A 1 690 ? 13.789  -27.375 56.714 1.00 20.63 ? 690  GLY A O     1 
ATOM   5723 N  N     . PRO A 1 691 ? 15.692  -27.250 57.947 1.00 19.07 ? 691  PRO A N     1 
ATOM   5724 C  CA    . PRO A 1 691 ? 16.247  -28.476 57.376 1.00 20.38 ? 691  PRO A CA    1 
ATOM   5725 C  C     . PRO A 1 691 ? 15.593  -29.712 57.998 1.00 20.89 ? 691  PRO A C     1 
ATOM   5726 O  O     . PRO A 1 691 ? 15.027  -29.615 59.091 1.00 21.55 ? 691  PRO A O     1 
ATOM   5727 C  CB    . PRO A 1 691 ? 17.728  -28.404 57.768 1.00 21.51 ? 691  PRO A CB    1 
ATOM   5728 C  CG    . PRO A 1 691 ? 17.759  -27.586 59.015 1.00 21.80 ? 691  PRO A CG    1 
ATOM   5729 C  CD    . PRO A 1 691 ? 16.596  -26.630 58.933 1.00 19.65 ? 691  PRO A CD    1 
ATOM   5730 N  N     . PRO A 1 692 ? 15.641  -30.864 57.299 1.00 22.65 ? 692  PRO A N     1 
ATOM   5731 C  CA    . PRO A 1 692 ? 15.183  -32.103 57.933 1.00 23.15 ? 692  PRO A CA    1 
ATOM   5732 C  C     . PRO A 1 692 ? 15.993  -32.386 59.194 1.00 24.39 ? 692  PRO A C     1 
ATOM   5733 O  O     . PRO A 1 692 ? 17.211  -32.199 59.183 1.00 24.63 ? 692  PRO A O     1 
ATOM   5734 C  CB    . PRO A 1 692 ? 15.474  -33.170 56.867 1.00 23.30 ? 692  PRO A CB    1 
ATOM   5735 C  CG    . PRO A 1 692 ? 15.464  -32.430 55.571 1.00 23.11 ? 692  PRO A CG    1 
ATOM   5736 C  CD    . PRO A 1 692 ? 16.012  -31.067 55.884 1.00 22.59 ? 692  PRO A CD    1 
ATOM   5737 N  N     . LEU A 1 693 ? 15.329  -32.814 60.269 1.00 25.99 ? 693  LEU A N     1 
ATOM   5738 C  CA    . LEU A 1 693 ? 16.017  -33.104 61.533 1.00 27.27 ? 693  LEU A CA    1 
ATOM   5739 C  C     . LEU A 1 693 ? 17.147  -34.110 61.307 1.00 27.61 ? 693  LEU A C     1 
ATOM   5740 O  O     . LEU A 1 693 ? 16.956  -35.122 60.634 1.00 28.31 ? 693  LEU A O     1 
ATOM   5741 C  CB    . LEU A 1 693 ? 15.040  -33.642 62.589 1.00 29.31 ? 693  LEU A CB    1 
ATOM   5742 C  CG    . LEU A 1 693 ? 15.138  -33.223 64.068 1.00 31.46 ? 693  LEU A CG    1 
ATOM   5743 C  CD1   . LEU A 1 693 ? 14.681  -34.370 64.971 1.00 28.63 ? 693  LEU A CD1   1 
ATOM   5744 C  CD2   . LEU A 1 693 ? 16.516  -32.736 64.496 1.00 33.23 ? 693  LEU A CD2   1 
ATOM   5745 N  N     . GLY A 1 694 ? 18.322  -33.806 61.853 1.00 28.08 ? 694  GLY A N     1 
ATOM   5746 C  CA    . GLY A 1 694 ? 19.493  -34.672 61.728 1.00 28.43 ? 694  GLY A CA    1 
ATOM   5747 C  C     . GLY A 1 694 ? 20.309  -34.522 60.452 1.00 28.43 ? 694  GLY A C     1 
ATOM   5748 O  O     . GLY A 1 694 ? 21.367  -35.136 60.322 1.00 28.59 ? 694  GLY A O     1 
ATOM   5749 N  N     . SER A 1 695 ? 19.827  -33.713 59.510 1.00 27.11 ? 695  SER A N     1 
ATOM   5750 C  CA    . SER A 1 695 ? 20.529  -33.500 58.247 1.00 26.43 ? 695  SER A CA    1 
ATOM   5751 C  C     . SER A 1 695 ? 21.569  -32.381 58.341 1.00 25.71 ? 695  SER A C     1 
ATOM   5752 O  O     . SER A 1 695 ? 21.652  -31.682 59.350 1.00 26.06 ? 695  SER A O     1 
ATOM   5753 C  CB    . SER A 1 695 ? 19.530  -33.176 57.131 1.00 25.84 ? 695  SER A CB    1 
ATOM   5754 O  OG    . SER A 1 695 ? 19.025  -31.860 57.285 1.00 25.92 ? 695  SER A OG    1 
ATOM   5755 N  N     . LYS A 1 696 ? 22.352  -32.224 57.273 1.00 24.38 ? 696  LYS A N     1 
ATOM   5756 C  CA    . LYS A 1 696 ? 23.264  -31.096 57.117 1.00 24.78 ? 696  LYS A CA    1 
ATOM   5757 C  C     . LYS A 1 696 ? 22.683  -29.988 56.220 1.00 24.68 ? 696  LYS A C     1 
ATOM   5758 O  O     . LYS A 1 696 ? 23.404  -29.083 55.792 1.00 23.38 ? 696  LYS A O     1 
ATOM   5759 C  CB    . LYS A 1 696 ? 24.616  -31.577 56.567 1.00 26.55 ? 696  LYS A CB    1 
ATOM   5760 C  CG    . LYS A 1 696 ? 25.351  -32.548 57.490 1.00 29.84 ? 696  LYS A CG    1 
ATOM   5761 C  CD    . LYS A 1 696 ? 26.589  -33.131 56.815 1.00 31.97 ? 696  LYS A CD    1 
ATOM   5762 C  CE    . LYS A 1 696 ? 27.232  -34.200 57.693 1.00 37.18 ? 696  LYS A CE    1 
ATOM   5763 N  NZ    . LYS A 1 696 ? 28.402  -34.824 57.023 1.00 39.59 ? 696  LYS A NZ    1 
ATOM   5764 N  N     . GLY A 1 697 ? 21.383  -30.054 55.945 1.00 22.43 ? 697  GLY A N     1 
ATOM   5765 C  CA    . GLY A 1 697 ? 20.713  -29.027 55.134 1.00 21.97 ? 697  GLY A CA    1 
ATOM   5766 C  C     . GLY A 1 697 ? 20.717  -27.674 55.830 1.00 21.43 ? 697  GLY A C     1 
ATOM   5767 O  O     . GLY A 1 697 ? 20.744  -27.605 57.059 1.00 23.01 ? 697  GLY A O     1 
ATOM   5768 N  N     . ILE A 1 698 ? 20.700  -26.594 55.054 1.00 20.39 ? 698  ILE A N     1 
ATOM   5769 C  CA    . ILE A 1 698 ? 20.807  -25.261 55.645 1.00 20.56 ? 698  ILE A CA    1 
ATOM   5770 C  C     . ILE A 1 698 ? 19.453  -24.611 55.945 1.00 20.51 ? 698  ILE A C     1 
ATOM   5771 O  O     . ILE A 1 698 ? 19.397  -23.583 56.618 1.00 21.24 ? 698  ILE A O     1 
ATOM   5772 C  CB    . ILE A 1 698 ? 21.718  -24.308 54.812 1.00 19.44 ? 698  ILE A CB    1 
ATOM   5773 C  CG1   . ILE A 1 698 ? 21.084  -23.981 53.451 1.00 18.71 ? 698  ILE A CG1   1 
ATOM   5774 C  CG2   . ILE A 1 698 ? 23.134  -24.890 54.692 1.00 20.73 ? 698  ILE A CG2   1 
ATOM   5775 C  CD1   . ILE A 1 698 ? 21.766  -22.850 52.710 1.00 19.89 ? 698  ILE A CD1   1 
ATOM   5776 N  N     . GLY A 1 699 ? 18.374  -25.216 55.447 1.00 19.06 ? 699  GLY A N     1 
ATOM   5777 C  CA    . GLY A 1 699 ? 17.021  -24.737 55.730 1.00 17.47 ? 699  GLY A CA    1 
ATOM   5778 C  C     . GLY A 1 699 ? 16.547  -23.672 54.758 1.00 18.45 ? 699  GLY A C     1 
ATOM   5779 O  O     . GLY A 1 699 ? 15.517  -23.834 54.105 1.00 19.54 ? 699  GLY A O     1 
ATOM   5780 N  N     . GLY A 1 700 ? 17.296  -22.576 54.676 1.00 17.24 ? 700  GLY A N     1 
ATOM   5781 C  CA    . GLY A 1 700 ? 16.919  -21.448 53.838 1.00 17.53 ? 700  GLY A CA    1 
ATOM   5782 C  C     . GLY A 1 700 ? 18.080  -20.508 53.596 1.00 17.63 ? 700  GLY A C     1 
ATOM   5783 O  O     . GLY A 1 700 ? 19.112  -20.601 54.263 1.00 18.12 ? 700  GLY A O     1 
ATOM   5784 N  N     . PHE A 1 701 ? 17.920  -19.612 52.625 1.00 16.52 ? 701  PHE A N     1 
ATOM   5785 C  CA    . PHE A 1 701 ? 18.877  -18.521 52.418 1.00 17.64 ? 701  PHE A CA    1 
ATOM   5786 C  C     . PHE A 1 701 ? 18.227  -17.326 51.720 1.00 16.94 ? 701  PHE A C     1 
ATOM   5787 O  O     . PHE A 1 701 ? 17.220  -17.475 51.026 1.00 17.51 ? 701  PHE A O     1 
ATOM   5788 C  CB    . PHE A 1 701 ? 20.139  -18.991 51.659 1.00 16.06 ? 701  PHE A CB    1 
ATOM   5789 C  CG    . PHE A 1 701 ? 19.890  -19.390 50.218 1.00 17.54 ? 701  PHE A CG    1 
ATOM   5790 C  CD1   . PHE A 1 701 ? 19.648  -20.721 49.881 1.00 19.45 ? 701  PHE A CD1   1 
ATOM   5791 C  CD2   . PHE A 1 701 ? 19.919  -18.440 49.199 1.00 17.35 ? 701  PHE A CD2   1 
ATOM   5792 C  CE1   . PHE A 1 701 ? 19.429  -21.101 48.544 1.00 18.14 ? 701  PHE A CE1   1 
ATOM   5793 C  CE2   . PHE A 1 701 ? 19.694  -18.802 47.859 1.00 17.07 ? 701  PHE A CE2   1 
ATOM   5794 C  CZ    . PHE A 1 701 ? 19.443  -20.133 47.531 1.00 16.24 ? 701  PHE A CZ    1 
ATOM   5795 N  N     . TRP A 1 702 ? 18.801  -16.148 51.947 1.00 16.85 ? 702  TRP A N     1 
ATOM   5796 C  CA    . TRP A 1 702 ? 18.450  -14.912 51.235 1.00 17.55 ? 702  TRP A CA    1 
ATOM   5797 C  C     . TRP A 1 702 ? 19.682  -14.395 50.517 1.00 17.72 ? 702  TRP A C     1 
ATOM   5798 O  O     . TRP A 1 702 ? 20.774  -14.424 51.081 1.00 20.52 ? 702  TRP A O     1 
ATOM   5799 C  CB    . TRP A 1 702 ? 18.000  -13.828 52.223 1.00 16.25 ? 702  TRP A CB    1 
ATOM   5800 C  CG    . TRP A 1 702 ? 16.528  -13.725 52.394 1.00 16.84 ? 702  TRP A CG    1 
ATOM   5801 C  CD1   . TRP A 1 702 ? 15.700  -12.775 51.852 1.00 17.57 ? 702  TRP A CD1   1 
ATOM   5802 C  CD2   . TRP A 1 702 ? 15.695  -14.597 53.155 1.00 16.41 ? 702  TRP A CD2   1 
ATOM   5803 N  NE1   . TRP A 1 702 ? 14.401  -13.004 52.239 1.00 18.12 ? 702  TRP A NE1   1 
ATOM   5804 C  CE2   . TRP A 1 702 ? 14.367  -14.114 53.041 1.00 16.34 ? 702  TRP A CE2   1 
ATOM   5805 C  CE3   . TRP A 1 702 ? 15.938  -15.741 53.932 1.00 18.95 ? 702  TRP A CE3   1 
ATOM   5806 C  CZ2   . TRP A 1 702 ? 13.284  -14.743 53.664 1.00 19.66 ? 702  TRP A CZ2   1 
ATOM   5807 C  CZ3   . TRP A 1 702 ? 14.854  -16.362 54.562 1.00 22.38 ? 702  TRP A CZ3   1 
ATOM   5808 C  CH2   . TRP A 1 702 ? 13.550  -15.859 54.424 1.00 19.21 ? 702  TRP A CH2   1 
ATOM   5809 N  N     . THR A 1 703 ? 19.521  -13.906 49.289 1.00 19.22 ? 703  THR A N     1 
ATOM   5810 C  CA    . THR A 1 703 ? 20.637  -13.231 48.611 1.00 19.14 ? 703  THR A CA    1 
ATOM   5811 C  C     . THR A 1 703 ? 20.448  -11.719 48.598 1.00 18.55 ? 703  THR A C     1 
ATOM   5812 O  O     . THR A 1 703 ? 21.414  -10.963 48.468 1.00 20.20 ? 703  THR A O     1 
ATOM   5813 C  CB    . THR A 1 703 ? 20.852  -13.711 47.141 1.00 19.46 ? 703  THR A CB    1 
ATOM   5814 O  OG1   . THR A 1 703 ? 19.901  -13.076 46.278 1.00 19.18 ? 703  THR A OG1   1 
ATOM   5815 C  CG2   . THR A 1 703 ? 20.734  -15.220 47.025 1.00 19.91 ? 703  THR A CG2   1 
ATOM   5816 N  N     . GLY A 1 704 ? 19.199  -11.283 48.712 1.00 18.57 ? 704  GLY A N     1 
ATOM   5817 C  CA    . GLY A 1 704 ? 18.866  -9.867  48.641 1.00 15.65 ? 704  GLY A CA    1 
ATOM   5818 C  C     . GLY A 1 704 ? 17.367  -9.695  48.711 1.00 16.59 ? 704  GLY A C     1 
ATOM   5819 O  O     . GLY A 1 704 ? 16.642  -10.658 48.964 1.00 16.17 ? 704  GLY A O     1 
ATOM   5820 N  N     . LYS A 1 705 ? 16.906  -8.467  48.492 1.00 17.26 ? 705  LYS A N     1 
ATOM   5821 C  CA    . LYS A 1 705 ? 15.471  -8.185  48.421 1.00 16.65 ? 705  LYS A CA    1 
ATOM   5822 C  C     . LYS A 1 705 ? 14.831  -9.025  47.322 1.00 16.17 ? 705  LYS A C     1 
ATOM   5823 O  O     . LYS A 1 705 ? 15.395  -9.168  46.236 1.00 16.70 ? 705  LYS A O     1 
ATOM   5824 C  CB    . LYS A 1 705 ? 15.221  -6.694  48.150 1.00 16.41 ? 705  LYS A CB    1 
ATOM   5825 C  CG    . LYS A 1 705 ? 15.580  -5.772  49.330 1.00 15.63 ? 705  LYS A CG    1 
ATOM   5826 C  CD    . LYS A 1 705 ? 15.214  -4.330  49.017 1.00 16.72 ? 705  LYS A CD    1 
ATOM   5827 C  CE    . LYS A 1 705 ? 15.602  -3.384  50.152 1.00 17.02 ? 705  LYS A CE    1 
ATOM   5828 N  NZ    . LYS A 1 705 ? 15.269  -1.975  49.786 1.00 17.53 ? 705  LYS A NZ    1 
ATOM   5829 N  N     . LYS A 1 706 ? 13.663  -9.588  47.622 1.00 15.78 ? 706  LYS A N     1 
ATOM   5830 C  CA    . LYS A 1 706 ? 12.873  -10.379 46.666 1.00 16.14 ? 706  LYS A CA    1 
ATOM   5831 C  C     . LYS A 1 706 ? 13.618  -11.589 46.074 1.00 15.64 ? 706  LYS A C     1 
ATOM   5832 O  O     . LYS A 1 706 ? 13.318  -12.030 44.961 1.00 15.62 ? 706  LYS A O     1 
ATOM   5833 C  CB    . LYS A 1 706 ? 12.284  -9.472  45.565 1.00 16.65 ? 706  LYS A CB    1 
ATOM   5834 C  CG    . LYS A 1 706 ? 11.369  -8.368  46.102 1.00 19.29 ? 706  LYS A CG    1 
ATOM   5835 C  CD    . LYS A 1 706 ? 10.856  -7.459  44.987 1.00 19.00 ? 706  LYS A CD    1 
ATOM   5836 C  CE    . LYS A 1 706 ? 10.145  -6.241  45.559 1.00 17.58 ? 706  LYS A CE    1 
ATOM   5837 N  NZ    . LYS A 1 706 ? 8.829   -6.575  46.163 1.00 20.81 ? 706  LYS A NZ    1 
ATOM   5838 N  N     . ARG A 1 707 ? 14.575  -12.131 46.835 1.00 16.03 ? 707  ARG A N     1 
ATOM   5839 C  CA    . ARG A 1 707 ? 15.419  -13.236 46.373 1.00 17.12 ? 707  ARG A CA    1 
ATOM   5840 C  C     . ARG A 1 707 ? 15.773  -14.165 47.531 1.00 17.03 ? 707  ARG A C     1 
ATOM   5841 O  O     . ARG A 1 707 ? 16.703  -13.892 48.297 1.00 16.73 ? 707  ARG A O     1 
ATOM   5842 C  CB    . ARG A 1 707 ? 16.701  -12.714 45.712 1.00 16.81 ? 707  ARG A CB    1 
ATOM   5843 C  CG    . ARG A 1 707 ? 16.508  -12.081 44.330 1.00 19.70 ? 707  ARG A CG    1 
ATOM   5844 C  CD    . ARG A 1 707 ? 17.843  -11.664 43.712 1.00 21.05 ? 707  ARG A CD    1 
ATOM   5845 N  NE    . ARG A 1 707 ? 18.745  -12.800 43.512 1.00 23.02 ? 707  ARG A NE    1 
ATOM   5846 C  CZ    . ARG A 1 707 ? 18.773  -13.585 42.434 1.00 26.61 ? 707  ARG A CZ    1 
ATOM   5847 N  NH1   . ARG A 1 707 ? 17.947  -13.385 41.417 1.00 23.33 ? 707  ARG A NH1   1 
ATOM   5848 N  NH2   . ARG A 1 707 ? 19.641  -14.583 42.374 1.00 27.56 ? 707  ARG A NH2   1 
ATOM   5849 N  N     . TYR A 1 708 ? 15.025  -15.258 47.653 1.00 15.69 ? 708  TYR A N     1 
ATOM   5850 C  CA    . TYR A 1 708 ? 15.212  -16.199 48.759 1.00 15.01 ? 708  TYR A CA    1 
ATOM   5851 C  C     . TYR A 1 708 ? 14.659  -17.588 48.469 1.00 15.99 ? 708  TYR A C     1 
ATOM   5852 O  O     . TYR A 1 708 ? 13.911  -17.781 47.511 1.00 16.59 ? 708  TYR A O     1 
ATOM   5853 C  CB    . TYR A 1 708 ? 14.623  -15.641 50.065 1.00 16.81 ? 708  TYR A CB    1 
ATOM   5854 C  CG    . TYR A 1 708 ? 13.128  -15.392 50.058 1.00 17.94 ? 708  TYR A CG    1 
ATOM   5855 C  CD1   . TYR A 1 708 ? 12.606  -14.190 49.569 1.00 17.97 ? 708  TYR A CD1   1 
ATOM   5856 C  CD2   . TYR A 1 708 ? 12.240  -16.348 50.550 1.00 17.49 ? 708  TYR A CD2   1 
ATOM   5857 C  CE1   . TYR A 1 708 ? 11.236  -13.940 49.569 1.00 18.02 ? 708  TYR A CE1   1 
ATOM   5858 C  CE2   . TYR A 1 708 ? 10.855  -16.110 50.558 1.00 18.35 ? 708  TYR A CE2   1 
ATOM   5859 C  CZ    . TYR A 1 708 ? 10.366  -14.900 50.062 1.00 20.99 ? 708  TYR A CZ    1 
ATOM   5860 O  OH    . TYR A 1 708 ? 9.005   -14.650 50.065 1.00 19.89 ? 708  TYR A OH    1 
ATOM   5861 N  N     . ALA A 1 709 ? 15.059  -18.551 49.298 1.00 15.55 ? 709  ALA A N     1 
ATOM   5862 C  CA    . ALA A 1 709 ? 14.611  -19.930 49.175 1.00 17.01 ? 709  ALA A CA    1 
ATOM   5863 C  C     . ALA A 1 709 ? 14.427  -20.525 50.562 1.00 17.37 ? 709  ALA A C     1 
ATOM   5864 O  O     . ALA A 1 709 ? 15.259  -20.314 51.451 1.00 18.25 ? 709  ALA A O     1 
ATOM   5865 C  CB    . ALA A 1 709 ? 15.616  -20.757 48.352 1.00 15.73 ? 709  ALA A CB    1 
ATOM   5866 N  N     . LEU A 1 710 ? 13.320  -21.239 50.751 1.00 17.21 ? 710  LEU A N     1 
ATOM   5867 C  CA    . LEU A 1 710 ? 13.012  -21.885 52.029 1.00 17.53 ? 710  LEU A CA    1 
ATOM   5868 C  C     . LEU A 1 710 ? 12.529  -23.312 51.836 1.00 18.70 ? 710  LEU A C     1 
ATOM   5869 O  O     . LEU A 1 710 ? 11.768  -23.597 50.905 1.00 18.41 ? 710  LEU A O     1 
ATOM   5870 C  CB    . LEU A 1 710 ? 11.922  -21.115 52.785 1.00 19.39 ? 710  LEU A CB    1 
ATOM   5871 C  CG    . LEU A 1 710 ? 12.181  -19.697 53.291 1.00 21.96 ? 710  LEU A CG    1 
ATOM   5872 C  CD1   . LEU A 1 710 ? 10.879  -19.113 53.828 1.00 20.68 ? 710  LEU A CD1   1 
ATOM   5873 C  CD2   . LEU A 1 710 ? 13.253  -19.695 54.375 1.00 21.64 ? 710  LEU A CD2   1 
ATOM   5874 N  N     . ASN A 1 711 ? 12.960  -24.197 52.734 1.00 17.38 ? 711  ASN A N     1 
ATOM   5875 C  CA    . ASN A 1 711 ? 12.465  -25.565 52.778 1.00 19.49 ? 711  ASN A CA    1 
ATOM   5876 C  C     . ASN A 1 711 ? 11.274  -25.634 53.735 1.00 19.40 ? 711  ASN A C     1 
ATOM   5877 O  O     . ASN A 1 711 ? 11.454  -25.642 54.953 1.00 19.60 ? 711  ASN A O     1 
ATOM   5878 C  CB    . ASN A 1 711 ? 13.573  -26.517 53.238 1.00 19.92 ? 711  ASN A CB    1 
ATOM   5879 C  CG    . ASN A 1 711 ? 13.186  -27.973 53.083 1.00 19.84 ? 711  ASN A CG    1 
ATOM   5880 O  OD1   . ASN A 1 711 ? 12.793  -28.409 51.999 1.00 21.59 ? 711  ASN A OD1   1 
ATOM   5881 N  ND2   . ASN A 1 711 ? 13.308  -28.740 54.165 1.00 20.74 ? 711  ASN A ND2   1 
ATOM   5882 N  N     . VAL A 1 712 ? 10.069  -25.680 53.171 1.00 17.86 ? 712  VAL A N     1 
ATOM   5883 C  CA    . VAL A 1 712 ? 8.826   -25.494 53.932 1.00 17.60 ? 712  VAL A CA    1 
ATOM   5884 C  C     . VAL A 1 712 ? 8.115   -26.807 54.249 1.00 18.63 ? 712  VAL A C     1 
ATOM   5885 O  O     . VAL A 1 712 ? 7.937   -27.661 53.373 1.00 18.43 ? 712  VAL A O     1 
ATOM   5886 C  CB    . VAL A 1 712 ? 7.856   -24.529 53.187 1.00 17.78 ? 712  VAL A CB    1 
ATOM   5887 C  CG1   . VAL A 1 712 ? 6.561   -24.323 53.976 1.00 17.76 ? 712  VAL A CG1   1 
ATOM   5888 C  CG2   . VAL A 1 712 ? 8.524   -23.193 52.942 1.00 17.70 ? 712  VAL A CG2   1 
ATOM   5889 N  N     . TRP A 1 713 ? 7.721   -26.959 55.513 1.00 16.71 ? 713  TRP A N     1 
ATOM   5890 C  CA    . TRP A 1 713 ? 7.026   -28.152 55.987 1.00 18.46 ? 713  TRP A CA    1 
ATOM   5891 C  C     . TRP A 1 713 ? 5.531   -27.924 56.173 1.00 19.06 ? 713  TRP A C     1 
ATOM   5892 O  O     . TRP A 1 713 ? 4.732   -28.866 56.105 1.00 18.86 ? 713  TRP A O     1 
ATOM   5893 C  CB    . TRP A 1 713 ? 7.641   -28.617 57.304 1.00 18.99 ? 713  TRP A CB    1 
ATOM   5894 C  CG    . TRP A 1 713 ? 9.096   -28.907 57.168 1.00 21.36 ? 713  TRP A CG    1 
ATOM   5895 C  CD1   . TRP A 1 713 ? 10.125  -28.034 57.370 1.00 21.85 ? 713  TRP A CD1   1 
ATOM   5896 C  CD2   . TRP A 1 713 ? 9.692   -30.148 56.765 1.00 21.78 ? 713  TRP A CD2   1 
ATOM   5897 N  NE1   . TRP A 1 713 ? 11.327  -28.657 57.129 1.00 21.52 ? 713  TRP A NE1   1 
ATOM   5898 C  CE2   . TRP A 1 713 ? 11.089  -29.954 56.758 1.00 20.67 ? 713  TRP A CE2   1 
ATOM   5899 C  CE3   . TRP A 1 713 ? 9.179   -31.407 56.417 1.00 22.73 ? 713  TRP A CE3   1 
ATOM   5900 C  CZ2   . TRP A 1 713 ? 11.986  -30.970 56.416 1.00 22.50 ? 713  TRP A CZ2   1 
ATOM   5901 C  CZ3   . TRP A 1 713 ? 10.075  -32.423 56.078 1.00 23.49 ? 713  TRP A CZ3   1 
ATOM   5902 C  CH2   . TRP A 1 713 ? 11.461  -32.195 56.080 1.00 23.57 ? 713  TRP A CH2   1 
ATOM   5903 N  N     . ASP A 1 714 ? 5.168   -26.670 56.416 1.00 18.59 ? 714  ASP A N     1 
ATOM   5904 C  CA    . ASP A 1 714 ? 3.781   -26.291 56.633 1.00 19.34 ? 714  ASP A CA    1 
ATOM   5905 C  C     . ASP A 1 714 ? 3.546   -24.894 56.076 1.00 20.01 ? 714  ASP A C     1 
ATOM   5906 O  O     . ASP A 1 714 ? 4.299   -23.955 56.353 1.00 19.01 ? 714  ASP A O     1 
ATOM   5907 C  CB    . ASP A 1 714 ? 3.411   -26.373 58.127 1.00 18.94 ? 714  ASP A CB    1 
ATOM   5908 C  CG    . ASP A 1 714 ? 1.901   -26.340 58.369 1.00 21.74 ? 714  ASP A CG    1 
ATOM   5909 O  OD1   . ASP A 1 714 ? 1.256   -25.318 58.052 1.00 20.41 ? 714  ASP A OD1   1 
ATOM   5910 O  OD2   . ASP A 1 714 ? 1.361   -27.333 58.897 1.00 24.56 ? 714  ASP A OD2   1 
ATOM   5911 N  N     . MET A 1 715 ? 2.493   -24.772 55.279 1.00 20.36 ? 715  MET A N     1 
ATOM   5912 C  CA    . MET A 1 715 ? 2.160   -23.518 54.630 1.00 20.92 ? 715  MET A CA    1 
ATOM   5913 C  C     . MET A 1 715 ? 0.681   -23.256 54.851 1.00 21.55 ? 715  MET A C     1 
ATOM   5914 O  O     . MET A 1 715 ? -0.164  -23.971 54.311 1.00 19.09 ? 715  MET A O     1 
ATOM   5915 C  CB    . MET A 1 715 ? 2.488   -23.592 53.137 1.00 22.02 ? 715  MET A CB    1 
ATOM   5916 C  CG    . MET A 1 715 ? 2.248   -22.306 52.369 1.00 27.28 ? 715  MET A CG    1 
ATOM   5917 S  SD    . MET A 1 715 ? 3.315   -20.972 52.943 1.00 33.22 ? 715  MET A SD    1 
ATOM   5918 C  CE    . MET A 1 715 ? 3.149   -19.816 51.576 1.00 35.28 ? 715  MET A CE    1 
ATOM   5919 N  N     . GLU A 1 716 ? 0.385   -22.241 55.667 1.00 20.72 ? 716  GLU A N     1 
ATOM   5920 C  CA    . GLU A 1 716 ? -0.994  -21.823 55.970 1.00 22.78 ? 716  GLU A CA    1 
ATOM   5921 C  C     . GLU A 1 716 ? -1.891  -22.961 56.463 1.00 21.94 ? 716  GLU A C     1 
ATOM   5922 O  O     . GLU A 1 716 ? -3.077  -23.018 56.123 1.00 21.09 ? 716  GLU A O     1 
ATOM   5923 C  CB    . GLU A 1 716 ? -1.636  -21.145 54.751 1.00 24.82 ? 716  GLU A CB    1 
ATOM   5924 C  CG    . GLU A 1 716 ? -1.234  -19.703 54.543 1.00 32.66 ? 716  GLU A CG    1 
ATOM   5925 C  CD    . GLU A 1 716 ? -2.133  -19.001 53.548 1.00 37.53 ? 716  GLU A CD    1 
ATOM   5926 O  OE1   . GLU A 1 716 ? -2.963  -18.170 53.982 1.00 42.35 ? 716  GLU A OE1   1 
ATOM   5927 O  OE2   . GLU A 1 716 ? -2.024  -19.297 52.339 1.00 38.18 ? 716  GLU A OE2   1 
ATOM   5928 N  N     . GLY A 1 717 ? -1.324  -23.861 57.264 1.00 20.13 ? 717  GLY A N     1 
ATOM   5929 C  CA    . GLY A 1 717 ? -2.088  -24.967 57.839 1.00 20.52 ? 717  GLY A CA    1 
ATOM   5930 C  C     . GLY A 1 717 ? -2.068  -26.250 57.029 1.00 20.59 ? 717  GLY A C     1 
ATOM   5931 O  O     . GLY A 1 717 ? -2.648  -27.257 57.443 1.00 21.03 ? 717  GLY A O     1 
ATOM   5932 N  N     . THR A 1 718 ? -1.417  -26.220 55.870 1.00 18.85 ? 718  THR A N     1 
ATOM   5933 C  CA    . THR A 1 718 ? -1.228  -27.424 55.068 1.00 18.30 ? 718  THR A CA    1 
ATOM   5934 C  C     . THR A 1 718 ? 0.088   -28.064 55.472 1.00 19.36 ? 718  THR A C     1 
ATOM   5935 O  O     . THR A 1 718 ? 1.158   -27.504 55.225 1.00 18.67 ? 718  THR A O     1 
ATOM   5936 C  CB    . THR A 1 718 ? -1.190  -27.112 53.559 1.00 17.25 ? 718  THR A CB    1 
ATOM   5937 O  OG1   . THR A 1 718 ? -2.426  -26.517 53.160 1.00 19.24 ? 718  THR A OG1   1 
ATOM   5938 C  CG2   . THR A 1 718 ? -0.944  -28.385 52.728 1.00 15.74 ? 718  THR A CG2   1 
ATOM   5939 N  N     . ARG A 1 719 ? -0.002  -29.227 56.111 1.00 18.43 ? 719  ARG A N     1 
ATOM   5940 C  CA    . ARG A 1 719 ? 1.183   -29.992 56.483 1.00 20.29 ? 719  ARG A CA    1 
ATOM   5941 C  C     . ARG A 1 719 ? 1.538   -30.939 55.345 1.00 21.51 ? 719  ARG A C     1 
ATOM   5942 O  O     . ARG A 1 719 ? 0.811   -31.898 55.074 1.00 22.02 ? 719  ARG A O     1 
ATOM   5943 C  CB    . ARG A 1 719 ? 0.941   -30.777 57.779 1.00 19.81 ? 719  ARG A CB    1 
ATOM   5944 C  CG    . ARG A 1 719 ? 2.178   -31.483 58.341 1.00 21.42 ? 719  ARG A CG    1 
ATOM   5945 C  CD    . ARG A 1 719 ? 3.210   -30.494 58.905 1.00 23.83 ? 719  ARG A CD    1 
ATOM   5946 N  NE    . ARG A 1 719 ? 2.622   -29.590 59.891 1.00 22.52 ? 719  ARG A NE    1 
ATOM   5947 C  CZ    . ARG A 1 719 ? 2.601   -29.810 61.203 1.00 26.91 ? 719  ARG A CZ    1 
ATOM   5948 N  NH1   . ARG A 1 719 ? 3.144   -30.911 61.706 1.00 28.05 ? 719  ARG A NH1   1 
ATOM   5949 N  NH2   . ARG A 1 719 ? 2.035   -28.924 62.013 1.00 26.13 ? 719  ARG A NH2   1 
ATOM   5950 N  N     . TYR A 1 720 ? 2.656   -30.666 54.682 1.00 22.25 ? 720  TYR A N     1 
ATOM   5951 C  CA    . TYR A 1 720 ? 3.054   -31.429 53.505 1.00 24.14 ? 720  TYR A CA    1 
ATOM   5952 C  C     . TYR A 1 720 ? 3.503   -32.846 53.825 1.00 25.05 ? 720  TYR A C     1 
ATOM   5953 O  O     . TYR A 1 720 ? 4.202   -33.080 54.818 1.00 24.75 ? 720  TYR A O     1 
ATOM   5954 C  CB    . TYR A 1 720 ? 4.189   -30.726 52.762 1.00 23.51 ? 720  TYR A CB    1 
ATOM   5955 C  CG    . TYR A 1 720 ? 3.868   -29.356 52.224 1.00 24.52 ? 720  TYR A CG    1 
ATOM   5956 C  CD1   . TYR A 1 720 ? 2.790   -29.150 51.359 1.00 28.09 ? 720  TYR A CD1   1 
ATOM   5957 C  CD2   . TYR A 1 720 ? 4.680   -28.270 52.536 1.00 29.71 ? 720  TYR A CD2   1 
ATOM   5958 C  CE1   . TYR A 1 720 ? 2.507   -27.882 50.854 1.00 28.58 ? 720  TYR A CE1   1 
ATOM   5959 C  CE2   . TYR A 1 720 ? 4.412   -27.002 52.035 1.00 30.34 ? 720  TYR A CE2   1 
ATOM   5960 C  CZ    . TYR A 1 720 ? 3.328   -26.816 51.199 1.00 30.56 ? 720  TYR A CZ    1 
ATOM   5961 O  OH    . TYR A 1 720 ? 3.087   -25.560 50.702 1.00 31.89 ? 720  TYR A OH    1 
ATOM   5962 N  N     . ALA A 1 721 ? 3.108   -33.786 52.967 1.00 25.09 ? 721  ALA A N     1 
ATOM   5963 C  CA    . ALA A 1 721 ? 3.646   -35.143 53.017 1.00 26.78 ? 721  ALA A CA    1 
ATOM   5964 C  C     . ALA A 1 721 ? 5.161   -35.122 52.788 1.00 27.01 ? 721  ALA A C     1 
ATOM   5965 O  O     . ALA A 1 721 ? 5.907   -35.847 53.452 1.00 27.57 ? 721  ALA A O     1 
ATOM   5966 C  CB    . ALA A 1 721 ? 2.956   -36.030 51.989 1.00 26.99 ? 721  ALA A CB    1 
ATOM   5967 N  N     . GLU A 1 722 ? 5.602   -34.284 51.850 1.00 26.54 ? 722  GLU A N     1 
ATOM   5968 C  CA    . GLU A 1 722 ? 7.028   -34.076 51.582 1.00 27.02 ? 722  GLU A CA    1 
ATOM   5969 C  C     . GLU A 1 722 ? 7.339   -32.579 51.613 1.00 23.42 ? 722  GLU A C     1 
ATOM   5970 O  O     . GLU A 1 722 ? 6.521   -31.776 51.170 1.00 23.68 ? 722  GLU A O     1 
ATOM   5971 C  CB    . GLU A 1 722 ? 7.425   -34.649 50.215 1.00 29.57 ? 722  GLU A CB    1 
ATOM   5972 C  CG    . GLU A 1 722 ? 7.210   -36.154 50.040 1.00 36.23 ? 722  GLU A CG    1 
ATOM   5973 C  CD    . GLU A 1 722 ? 8.120   -37.005 50.911 1.00 41.51 ? 722  GLU A CD    1 
ATOM   5974 O  OE1   . GLU A 1 722 ? 9.263   -36.579 51.190 1.00 44.72 ? 722  GLU A OE1   1 
ATOM   5975 O  OE2   . GLU A 1 722 ? 7.690   -38.110 51.309 1.00 44.17 ? 722  GLU A OE2   1 
ATOM   5976 N  N     . PRO A 1 723 ? 8.530   -32.195 52.113 1.00 23.98 ? 723  PRO A N     1 
ATOM   5977 C  CA    . PRO A 1 723 ? 8.860   -30.767 52.183 1.00 22.51 ? 723  PRO A CA    1 
ATOM   5978 C  C     . PRO A 1 723 ? 8.796   -30.111 50.813 1.00 22.57 ? 723  PRO A C     1 
ATOM   5979 O  O     . PRO A 1 723 ? 9.155   -30.737 49.805 1.00 22.86 ? 723  PRO A O     1 
ATOM   5980 C  CB    . PRO A 1 723 ? 10.296  -30.754 52.720 1.00 22.04 ? 723  PRO A CB    1 
ATOM   5981 C  CG    . PRO A 1 723 ? 10.825  -32.118 52.439 1.00 24.67 ? 723  PRO A CG    1 
ATOM   5982 C  CD    . PRO A 1 723 ? 9.644   -33.034 52.587 1.00 23.95 ? 723  PRO A CD    1 
ATOM   5983 N  N     . LYS A 1 724 ? 8.314   -28.873 50.779 1.00 21.81 ? 724  LYS A N     1 
ATOM   5984 C  CA    . LYS A 1 724 ? 8.177   -28.127 49.537 1.00 22.77 ? 724  LYS A CA    1 
ATOM   5985 C  C     . LYS A 1 724 ? 9.122   -26.937 49.544 1.00 22.07 ? 724  LYS A C     1 
ATOM   5986 O  O     . LYS A 1 724 ? 9.199   -26.196 50.532 1.00 22.48 ? 724  LYS A O     1 
ATOM   5987 C  CB    . LYS A 1 724 ? 6.732   -27.650 49.365 1.00 24.69 ? 724  LYS A CB    1 
ATOM   5988 C  CG    . LYS A 1 724 ? 6.395   -27.098 47.984 1.00 29.50 ? 724  LYS A CG    1 
ATOM   5989 C  CD    . LYS A 1 724 ? 4.883   -26.984 47.803 1.00 35.64 ? 724  LYS A CD    1 
ATOM   5990 C  CE    . LYS A 1 724 ? 4.514   -26.158 46.577 1.00 40.26 ? 724  LYS A CE    1 
ATOM   5991 N  NZ    . LYS A 1 724 ? 4.913   -26.823 45.305 1.00 44.38 ? 724  LYS A NZ    1 
ATOM   5992 N  N     . LEU A 1 725 ? 9.845   -26.754 48.444 1.00 20.97 ? 725  LEU A N     1 
ATOM   5993 C  CA    . LEU A 1 725 ? 10.699  -25.585 48.306 1.00 20.28 ? 725  LEU A CA    1 
ATOM   5994 C  C     . LEU A 1 725 ? 9.864   -24.360 47.971 1.00 21.32 ? 725  LEU A C     1 
ATOM   5995 O  O     . LEU A 1 725 ? 9.111   -24.357 46.993 1.00 22.62 ? 725  LEU A O     1 
ATOM   5996 C  CB    . LEU A 1 725 ? 11.762  -25.798 47.223 1.00 20.52 ? 725  LEU A CB    1 
ATOM   5997 C  CG    . LEU A 1 725 ? 12.748  -26.951 47.405 1.00 20.63 ? 725  LEU A CG    1 
ATOM   5998 C  CD1   . LEU A 1 725 ? 13.724  -26.973 46.232 1.00 22.72 ? 725  LEU A CD1   1 
ATOM   5999 C  CD2   . LEU A 1 725 ? 13.482  -26.852 48.742 1.00 24.51 ? 725  LEU A CD2   1 
ATOM   6000 N  N     . LYS A 1 726 ? 9.978   -23.335 48.802 1.00 19.41 ? 726  LYS A N     1 
ATOM   6001 C  CA    . LYS A 1 726 ? 9.428   -22.035 48.470 1.00 18.58 ? 726  LYS A CA    1 
ATOM   6002 C  C     . LYS A 1 726 ? 10.580  -21.167 47.981 1.00 19.13 ? 726  LYS A C     1 
ATOM   6003 O  O     . LYS A 1 726 ? 11.415  -20.716 48.770 1.00 18.62 ? 726  LYS A O     1 
ATOM   6004 C  CB    . LYS A 1 726 ? 8.731   -21.399 49.673 1.00 19.52 ? 726  LYS A CB    1 
ATOM   6005 C  CG    . LYS A 1 726 ? 8.211   -19.994 49.390 1.00 22.86 ? 726  LYS A CG    1 
ATOM   6006 C  CD    . LYS A 1 726 ? 7.487   -19.399 50.586 1.00 24.68 ? 726  LYS A CD    1 
ATOM   6007 C  CE    . LYS A 1 726 ? 6.969   -18.002 50.265 1.00 27.18 ? 726  LYS A CE    1 
ATOM   6008 N  NZ    . LYS A 1 726 ? 6.037   -18.004 49.091 1.00 30.02 ? 726  LYS A NZ    1 
ATOM   6009 N  N     . ILE A 1 727 ? 10.637  -20.963 46.669 1.00 17.15 ? 727  ILE A N     1 
ATOM   6010 C  CA    . ILE A 1 727 ? 11.700  -20.166 46.074 1.00 17.48 ? 727  ILE A CA    1 
ATOM   6011 C  C     . ILE A 1 727 ? 11.081  -18.934 45.436 1.00 17.93 ? 727  ILE A C     1 
ATOM   6012 O  O     . ILE A 1 727 ? 10.202  -19.053 44.585 1.00 18.36 ? 727  ILE A O     1 
ATOM   6013 C  CB    . ILE A 1 727 ? 12.503  -20.963 45.022 1.00 16.85 ? 727  ILE A CB    1 
ATOM   6014 C  CG1   . ILE A 1 727 ? 13.051  -22.261 45.633 1.00 18.64 ? 727  ILE A CG1   1 
ATOM   6015 C  CG2   . ILE A 1 727 ? 13.637  -20.102 44.456 1.00 17.80 ? 727  ILE A CG2   1 
ATOM   6016 C  CD1   . ILE A 1 727 ? 13.579  -23.272 44.602 1.00 21.87 ? 727  ILE A CD1   1 
ATOM   6017 N  N     . MET A 1 728 ? 11.525  -17.757 45.874 1.00 17.41 ? 728  MET A N     1 
ATOM   6018 C  CA    . MET A 1 728 ? 11.029  -16.497 45.318 1.00 17.15 ? 728  MET A CA    1 
ATOM   6019 C  C     . MET A 1 728 ? 12.143  -15.704 44.648 1.00 15.75 ? 728  MET A C     1 
ATOM   6020 O  O     . MET A 1 728 ? 13.213  -15.508 45.229 1.00 17.33 ? 728  MET A O     1 
ATOM   6021 C  CB    . MET A 1 728 ? 10.352  -15.646 46.407 1.00 16.44 ? 728  MET A CB    1 
ATOM   6022 C  CG    . MET A 1 728 ? 9.312   -16.392 47.262 1.00 23.85 ? 728  MET A CG    1 
ATOM   6023 S  SD    . MET A 1 728 ? 8.026   -17.292 46.362 1.00 29.01 ? 728  MET A SD    1 
ATOM   6024 C  CE    . MET A 1 728 ? 7.299   -15.994 45.383 1.00 21.23 ? 728  MET A CE    1 
ATOM   6025 N  N     . GLY A 1 729 ? 11.889  -15.267 43.416 1.00 15.17 ? 729  GLY A N     1 
ATOM   6026 C  CA    . GLY A 1 729 ? 12.769  -14.328 42.726 1.00 16.48 ? 729  GLY A CA    1 
ATOM   6027 C  C     . GLY A 1 729 ? 13.991  -14.924 42.055 1.00 16.32 ? 729  GLY A C     1 
ATOM   6028 O  O     . GLY A 1 729 ? 14.473  -14.381 41.063 1.00 17.26 ? 729  GLY A O     1 
ATOM   6029 N  N     . LEU A 1 730 ? 14.506  -16.026 42.601 1.00 15.56 ? 730  LEU A N     1 
ATOM   6030 C  CA    . LEU A 1 730 ? 15.693  -16.682 42.045 1.00 15.70 ? 730  LEU A CA    1 
ATOM   6031 C  C     . LEU A 1 730 ? 15.422  -17.201 40.643 1.00 16.86 ? 730  LEU A C     1 
ATOM   6032 O  O     . LEU A 1 730 ? 14.263  -17.346 40.242 1.00 15.87 ? 730  LEU A O     1 
ATOM   6033 C  CB    . LEU A 1 730 ? 16.163  -17.830 42.949 1.00 16.79 ? 730  LEU A CB    1 
ATOM   6034 C  CG    . LEU A 1 730 ? 16.427  -17.486 44.418 1.00 17.03 ? 730  LEU A CG    1 
ATOM   6035 C  CD1   . LEU A 1 730 ? 17.101  -18.661 45.124 1.00 16.69 ? 730  LEU A CD1   1 
ATOM   6036 C  CD2   . LEU A 1 730 ? 17.274  -16.212 44.552 1.00 19.40 ? 730  LEU A CD2   1 
ATOM   6037 N  N     . GLU A 1 731 ? 16.502  -17.495 39.922 1.00 16.99 ? 731  GLU A N     1 
ATOM   6038 C  CA    . GLU A 1 731 ? 16.454  -17.824 38.500 1.00 18.98 ? 731  GLU A CA    1 
ATOM   6039 C  C     . GLU A 1 731 ? 15.576  -19.033 38.172 1.00 18.94 ? 731  GLU A C     1 
ATOM   6040 O  O     . GLU A 1 731 ? 15.064  -19.134 37.057 1.00 17.94 ? 731  GLU A O     1 
ATOM   6041 C  CB    . GLU A 1 731 ? 17.876  -18.010 37.956 1.00 20.55 ? 731  GLU A CB    1 
ATOM   6042 C  CG    . GLU A 1 731 ? 18.613  -16.691 37.660 1.00 21.84 ? 731  GLU A CG    1 
ATOM   6043 C  CD    . GLU A 1 731 ? 19.117  -15.942 38.905 1.00 23.59 ? 731  GLU A CD    1 
ATOM   6044 O  OE1   . GLU A 1 731 ? 18.987  -16.444 40.044 1.00 21.94 ? 731  GLU A OE1   1 
ATOM   6045 O  OE2   . GLU A 1 731 ? 19.654  -14.829 38.730 1.00 26.29 ? 731  GLU A OE2   1 
ATOM   6046 N  N     . THR A 1 732 ? 15.389  -19.928 39.146 1.00 17.79 ? 732  THR A N     1 
ATOM   6047 C  CA    . THR A 1 732 ? 14.454  -21.058 39.004 1.00 17.26 ? 732  THR A CA    1 
ATOM   6048 C  C     . THR A 1 732 ? 13.034  -20.580 38.704 1.00 18.15 ? 732  THR A C     1 
ATOM   6049 O  O     . THR A 1 732 ? 12.238  -21.318 38.109 1.00 17.91 ? 732  THR A O     1 
ATOM   6050 C  CB    . THR A 1 732 ? 14.388  -21.931 40.278 1.00 18.25 ? 732  THR A CB    1 
ATOM   6051 O  OG1   . THR A 1 732 ? 14.116  -21.100 41.415 1.00 20.25 ? 732  THR A OG1   1 
ATOM   6052 C  CG2   . THR A 1 732 ? 15.688  -22.671 40.508 1.00 16.13 ? 732  THR A CG2   1 
ATOM   6053 N  N     . GLN A 1 733 ? 12.731  -19.347 39.112 1.00 15.58 ? 733  GLN A N     1 
ATOM   6054 C  CA    . GLN A 1 733 ? 11.376  -18.798 39.017 1.00 17.83 ? 733  GLN A CA    1 
ATOM   6055 C  C     . GLN A 1 733 ? 11.161  -17.904 37.805 1.00 18.42 ? 733  GLN A C     1 
ATOM   6056 O  O     . GLN A 1 733 ? 10.049  -17.411 37.591 1.00 21.41 ? 733  GLN A O     1 
ATOM   6057 C  CB    . GLN A 1 733 ? 11.020  -18.004 40.282 1.00 17.15 ? 733  GLN A CB    1 
ATOM   6058 C  CG    . GLN A 1 733 ? 11.250  -18.752 41.578 1.00 18.31 ? 733  GLN A CG    1 
ATOM   6059 C  CD    . GLN A 1 733 ? 10.672  -20.148 41.561 1.00 19.35 ? 733  GLN A CD    1 
ATOM   6060 O  OE1   . GLN A 1 733 ? 11.415  -21.128 41.590 1.00 20.64 ? 733  GLN A OE1   1 
ATOM   6061 N  NE2   . GLN A 1 733 ? 9.339   -20.252 41.507 1.00 18.65 ? 733  GLN A NE2   1 
ATOM   6062 N  N     . LYS A 1 734 ? 12.214  -17.695 37.018 1.00 17.80 ? 734  LYS A N     1 
ATOM   6063 C  CA    . LYS A 1 734 ? 12.165  -16.741 35.910 1.00 18.69 ? 734  LYS A CA    1 
ATOM   6064 C  C     . LYS A 1 734 ? 11.984  -17.434 34.561 1.00 19.34 ? 734  LYS A C     1 
ATOM   6065 O  O     . LYS A 1 734 ? 12.736  -18.348 34.220 1.00 20.46 ? 734  LYS A O     1 
ATOM   6066 C  CB    . LYS A 1 734 ? 13.436  -15.890 35.896 1.00 19.53 ? 734  LYS A CB    1 
ATOM   6067 C  CG    . LYS A 1 734 ? 13.603  -15.003 37.131 1.00 24.44 ? 734  LYS A CG    1 
ATOM   6068 C  CD    . LYS A 1 734 ? 14.841  -14.122 37.037 1.00 28.55 ? 734  LYS A CD    1 
ATOM   6069 C  CE    . LYS A 1 734 ? 14.677  -13.026 35.983 1.00 34.26 ? 734  LYS A CE    1 
ATOM   6070 N  NZ    . LYS A 1 734 ? 15.692  -11.943 36.146 1.00 36.74 ? 734  LYS A NZ    1 
ATOM   6071 N  N     . SER A 1 735 ? 10.999  -16.977 33.787 1.00 19.38 ? 735  SER A N     1 
ATOM   6072 C  CA    . SER A 1 735 ? 10.739  -17.532 32.451 1.00 19.72 ? 735  SER A CA    1 
ATOM   6073 C  C     . SER A 1 735 ? 11.898  -17.332 31.467 1.00 19.25 ? 735  SER A C     1 
ATOM   6074 O  O     . SER A 1 735 ? 11.992  -18.031 30.461 1.00 19.55 ? 735  SER A O     1 
ATOM   6075 C  CB    . SER A 1 735 ? 9.440   -16.969 31.865 1.00 21.25 ? 735  SER A CB    1 
ATOM   6076 O  OG    . SER A 1 735 ? 9.522   -15.569 31.683 1.00 21.24 ? 735  SER A OG    1 
ATOM   6077 N  N     . SER A 1 736 ? 12.771  -16.374 31.762 1.00 19.72 ? 736  SER A N     1 
ATOM   6078 C  CA    . SER A 1 736 ? 13.943  -16.100 30.934 1.00 18.98 ? 736  SER A CA    1 
ATOM   6079 C  C     . SER A 1 736 ? 15.044  -17.152 31.101 1.00 18.37 ? 736  SER A C     1 
ATOM   6080 O  O     . SER A 1 736 ? 15.909  -17.289 30.235 1.00 19.74 ? 736  SER A O     1 
ATOM   6081 C  CB    . SER A 1 736 ? 14.496  -14.713 31.265 1.00 21.46 ? 736  SER A CB    1 
ATOM   6082 O  OG    . SER A 1 736 ? 14.514  -14.531 32.669 1.00 20.42 ? 736  SER A OG    1 
ATOM   6083 N  N     . THR A 1 737 ? 15.011  -17.888 32.214 1.00 16.42 ? 737  THR A N     1 
ATOM   6084 C  CA    . THR A 1 737 ? 16.024  -18.903 32.519 1.00 17.44 ? 737  THR A CA    1 
ATOM   6085 C  C     . THR A 1 737 ? 15.742  -20.186 31.722 1.00 16.88 ? 737  THR A C     1 
ATOM   6086 O  O     . THR A 1 737 ? 14.599  -20.627 31.679 1.00 17.18 ? 737  THR A O     1 
ATOM   6087 C  CB    . THR A 1 737 ? 16.031  -19.217 34.037 1.00 16.58 ? 737  THR A CB    1 
ATOM   6088 O  OG1   . THR A 1 737 ? 16.402  -18.041 34.761 1.00 20.35 ? 737  THR A OG1   1 
ATOM   6089 C  CG2   . THR A 1 737 ? 17.020  -20.331 34.380 1.00 17.74 ? 737  THR A CG2   1 
ATOM   6090 N  N     . PRO A 1 738 ? 16.774  -20.786 31.079 1.00 16.19 ? 738  PRO A N     1 
ATOM   6091 C  CA    . PRO A 1 738 ? 16.521  -22.007 30.292 1.00 16.83 ? 738  PRO A CA    1 
ATOM   6092 C  C     . PRO A 1 738 ? 15.856  -23.121 31.108 1.00 17.52 ? 738  PRO A C     1 
ATOM   6093 O  O     . PRO A 1 738 ? 16.141  -23.271 32.294 1.00 17.38 ? 738  PRO A O     1 
ATOM   6094 C  CB    . PRO A 1 738 ? 17.924  -22.442 29.857 1.00 16.32 ? 738  PRO A CB    1 
ATOM   6095 C  CG    . PRO A 1 738 ? 18.704  -21.186 29.833 1.00 17.88 ? 738  PRO A CG    1 
ATOM   6096 C  CD    . PRO A 1 738 ? 18.182  -20.364 30.983 1.00 15.51 ? 738  PRO A CD    1 
ATOM   6097 N  N     . LYS A 1 739 ? 14.975  -23.893 30.473 1.00 18.32 ? 739  LYS A N     1 
ATOM   6098 C  CA    . LYS A 1 739 ? 14.194  -24.903 31.199 1.00 21.00 ? 739  LYS A CA    1 
ATOM   6099 C  C     . LYS A 1 739 ? 15.042  -25.902 31.994 1.00 19.82 ? 739  LYS A C     1 
ATOM   6100 O  O     . LYS A 1 739 ? 14.765  -26.151 33.172 1.00 21.18 ? 739  LYS A O     1 
ATOM   6101 C  CB    . LYS A 1 739 ? 13.207  -25.617 30.266 1.00 23.01 ? 739  LYS A CB    1 
ATOM   6102 C  CG    . LYS A 1 739 ? 11.822  -24.968 30.235 1.00 32.10 ? 739  LYS A CG    1 
ATOM   6103 C  CD    . LYS A 1 739 ? 10.994  -25.359 31.470 1.00 35.27 ? 739  LYS A CD    1 
ATOM   6104 C  CE    . LYS A 1 739 ? 9.900   -24.340 31.801 1.00 40.21 ? 739  LYS A CE    1 
ATOM   6105 N  NZ    . LYS A 1 739 ? 8.712   -24.387 30.892 1.00 43.44 ? 739  LYS A NZ    1 
ATOM   6106 N  N     . ALA A 1 740 ? 16.076  -26.455 31.361 1.00 20.48 ? 740  ALA A N     1 
ATOM   6107 C  CA    . ALA A 1 740 ? 16.949  -27.431 32.023 1.00 20.45 ? 740  ALA A CA    1 
ATOM   6108 C  C     . ALA A 1 740 ? 17.805  -26.795 33.118 1.00 20.99 ? 740  ALA A C     1 
ATOM   6109 O  O     . ALA A 1 740 ? 18.217  -27.474 34.062 1.00 21.66 ? 740  ALA A O     1 
ATOM   6110 C  CB    . ALA A 1 740 ? 17.830  -28.149 31.001 1.00 21.34 ? 740  ALA A CB    1 
ATOM   6111 N  N     . VAL A 1 741 ? 18.051  -25.492 32.993 1.00 19.14 ? 741  VAL A N     1 
ATOM   6112 C  CA    . VAL A 1 741 ? 18.835  -24.738 33.980 1.00 18.10 ? 741  VAL A CA    1 
ATOM   6113 C  C     . VAL A 1 741 ? 17.988  -24.420 35.220 1.00 18.33 ? 741  VAL A C     1 
ATOM   6114 O  O     . VAL A 1 741 ? 18.477  -24.508 36.358 1.00 17.59 ? 741  VAL A O     1 
ATOM   6115 C  CB    . VAL A 1 741 ? 19.448  -23.459 33.343 1.00 16.96 ? 741  VAL A CB    1 
ATOM   6116 C  CG1   . VAL A 1 741 ? 20.088  -22.573 34.383 1.00 18.98 ? 741  VAL A CG1   1 
ATOM   6117 C  CG2   . VAL A 1 741 ? 20.488  -23.843 32.275 1.00 20.80 ? 741  VAL A CG2   1 
ATOM   6118 N  N     . GLN A 1 742 ? 16.718  -24.071 34.996 1.00 16.57 ? 742  GLN A N     1 
ATOM   6119 C  CA    . GLN A 1 742 ? 15.747  -23.943 36.083 1.00 18.91 ? 742  GLN A CA    1 
ATOM   6120 C  C     . GLN A 1 742 ? 15.768  -25.231 36.901 1.00 18.21 ? 742  GLN A C     1 
ATOM   6121 O  O     . GLN A 1 742 ? 15.905  -25.196 38.121 1.00 21.35 ? 742  GLN A O     1 
ATOM   6122 C  CB    . GLN A 1 742 ? 14.327  -23.729 35.546 1.00 17.74 ? 742  GLN A CB    1 
ATOM   6123 C  CG    . GLN A 1 742 ? 14.047  -22.389 34.857 1.00 17.65 ? 742  GLN A CG    1 
ATOM   6124 C  CD    . GLN A 1 742 ? 12.623  -22.319 34.303 1.00 21.13 ? 742  GLN A CD    1 
ATOM   6125 O  OE1   . GLN A 1 742 ? 12.018  -23.346 34.002 1.00 22.72 ? 742  GLN A OE1   1 
ATOM   6126 N  NE2   . GLN A 1 742 ? 12.087  -21.109 34.169 1.00 22.22 ? 742  GLN A NE2   1 
ATOM   6127 N  N     . LYS A 1 743 ? 15.656  -26.364 36.206 1.00 18.61 ? 743  LYS A N     1 
ATOM   6128 C  CA    . LYS A 1 743 ? 15.601  -27.683 36.836 1.00 18.56 ? 743  LYS A CA    1 
ATOM   6129 C  C     . LYS A 1 743 ? 16.862  -27.967 37.658 1.00 18.64 ? 743  LYS A C     1 
ATOM   6130 O  O     . LYS A 1 743 ? 16.771  -28.383 38.817 1.00 18.40 ? 743  LYS A O     1 
ATOM   6131 C  CB    . LYS A 1 743 ? 15.387  -28.753 35.759 1.00 21.09 ? 743  LYS A CB    1 
ATOM   6132 C  CG    . LYS A 1 743 ? 15.119  -30.159 36.269 1.00 24.47 ? 743  LYS A CG    1 
ATOM   6133 C  CD    . LYS A 1 743 ? 14.932  -31.102 35.075 1.00 26.97 ? 743  LYS A CD    1 
ATOM   6134 C  CE    . LYS A 1 743 ? 14.953  -32.561 35.483 1.00 31.55 ? 743  LYS A CE    1 
ATOM   6135 N  NZ    . LYS A 1 743 ? 13.832  -32.922 36.388 1.00 32.90 ? 743  LYS A NZ    1 
ATOM   6136 N  N     . ALA A 1 744 ? 18.028  -27.718 37.060 1.00 16.80 ? 744  ALA A N     1 
ATOM   6137 C  CA    . ALA A 1 744 ? 19.318  -27.946 37.720 1.00 18.19 ? 744  ALA A CA    1 
ATOM   6138 C  C     . ALA A 1 744 ? 19.533  -27.013 38.904 1.00 18.31 ? 744  ALA A C     1 
ATOM   6139 O  O     . ALA A 1 744 ? 19.989  -27.450 39.966 1.00 19.01 ? 744  ALA A O     1 
ATOM   6140 C  CB    . ALA A 1 744 ? 20.449  -27.808 36.734 1.00 19.96 ? 744  ALA A CB    1 
ATOM   6141 N  N     . LEU A 1 745 ? 19.197  -25.735 38.729 1.00 17.99 ? 745  LEU A N     1 
ATOM   6142 C  CA    . LEU A 1 745 ? 19.323  -24.776 39.821 1.00 17.11 ? 745  LEU A CA    1 
ATOM   6143 C  C     . LEU A 1 745 ? 18.396  -25.145 40.976 1.00 16.94 ? 745  LEU A C     1 
ATOM   6144 O  O     . LEU A 1 745 ? 18.768  -25.005 42.150 1.00 18.63 ? 745  LEU A O     1 
ATOM   6145 C  CB    . LEU A 1 745 ? 19.076  -23.339 39.348 1.00 18.06 ? 745  LEU A CB    1 
ATOM   6146 C  CG    . LEU A 1 745 ? 20.193  -22.660 38.543 1.00 16.43 ? 745  LEU A CG    1 
ATOM   6147 C  CD1   . LEU A 1 745 ? 19.732  -21.296 38.033 1.00 15.74 ? 745  LEU A CD1   1 
ATOM   6148 C  CD2   . LEU A 1 745 ? 21.504  -22.534 39.333 1.00 18.50 ? 745  LEU A CD2   1 
ATOM   6149 N  N     . LYS A 1 746 ? 17.205  -25.642 40.650 1.00 16.51 ? 746  LYS A N     1 
ATOM   6150 C  CA    . LYS A 1 746 ? 16.263  -26.078 41.687 1.00 17.80 ? 746  LYS A CA    1 
ATOM   6151 C  C     . LYS A 1 746 ? 16.812  -27.254 42.489 1.00 18.00 ? 746  LYS A C     1 
ATOM   6152 O  O     . LYS A 1 746 ? 16.691  -27.282 43.714 1.00 17.39 ? 746  LYS A O     1 
ATOM   6153 C  CB    . LYS A 1 746 ? 14.887  -26.413 41.101 1.00 18.12 ? 746  LYS A CB    1 
ATOM   6154 C  CG    . LYS A 1 746 ? 13.858  -26.740 42.169 1.00 20.74 ? 746  LYS A CG    1 
ATOM   6155 C  CD    . LYS A 1 746 ? 12.446  -26.726 41.636 1.00 25.83 ? 746  LYS A CD    1 
ATOM   6156 C  CE    . LYS A 1 746 ? 11.458  -27.012 42.755 1.00 28.90 ? 746  LYS A CE    1 
ATOM   6157 N  NZ    . LYS A 1 746 ? 10.063  -26.772 42.298 1.00 34.04 ? 746  LYS A NZ    1 
ATOM   6158 N  N     . GLU A 1 747 ? 17.432  -28.213 41.804 1.00 17.10 ? 747  GLU A N     1 
ATOM   6159 C  CA    . GLU A 1 747 ? 18.027  -29.356 42.498 1.00 18.32 ? 747  GLU A CA    1 
ATOM   6160 C  C     . GLU A 1 747 ? 19.234  -28.941 43.356 1.00 18.82 ? 747  GLU A C     1 
ATOM   6161 O  O     . GLU A 1 747 ? 19.446  -29.488 44.441 1.00 19.65 ? 747  GLU A O     1 
ATOM   6162 C  CB    . GLU A 1 747 ? 18.371  -30.483 41.508 1.00 18.93 ? 747  GLU A CB    1 
ATOM   6163 C  CG    . GLU A 1 747 ? 19.046  -31.726 42.114 1.00 20.13 ? 747  GLU A CG    1 
ATOM   6164 C  CD    . GLU A 1 747 ? 18.208  -32.476 43.145 1.00 23.13 ? 747  GLU A CD    1 
ATOM   6165 O  OE1   . GLU A 1 747 ? 18.775  -33.385 43.793 1.00 23.37 ? 747  GLU A OE1   1 
ATOM   6166 O  OE2   . GLU A 1 747 ? 17.005  -32.176 43.319 1.00 23.88 ? 747  GLU A OE2   1 
ATOM   6167 N  N     . CYS A 1 748 ? 20.003  -27.965 42.880 1.00 18.34 ? 748  CYS A N     1 
ATOM   6168 C  CA    . CYS A 1 748 ? 21.105  -27.404 43.663 1.00 18.67 ? 748  CYS A CA    1 
ATOM   6169 C  C     . CYS A 1 748 ? 20.566  -26.801 44.951 1.00 18.17 ? 748  CYS A C     1 
ATOM   6170 O  O     . CYS A 1 748 ? 21.086  -27.062 46.034 1.00 18.98 ? 748  CYS A O     1 
ATOM   6171 C  CB    . CYS A 1 748 ? 21.848  -26.336 42.865 1.00 18.63 ? 748  CYS A CB    1 
ATOM   6172 S  SG    . CYS A 1 748 ? 22.960  -27.014 41.640 1.00 22.28 ? 748  CYS A SG    1 
ATOM   6173 N  N     . ILE A 1 749 ? 19.504  -26.016 44.818 1.00 17.35 ? 749  ILE A N     1 
ATOM   6174 C  CA    . ILE A 1 749 ? 18.835  -25.421 45.966 1.00 17.52 ? 749  ILE A CA    1 
ATOM   6175 C  C     . ILE A 1 749 ? 18.253  -26.489 46.893 1.00 18.37 ? 749  ILE A C     1 
ATOM   6176 O  O     . ILE A 1 749 ? 18.433  -26.415 48.108 1.00 19.07 ? 749  ILE A O     1 
ATOM   6177 C  CB    . ILE A 1 749 ? 17.760  -24.402 45.525 1.00 15.97 ? 749  ILE A CB    1 
ATOM   6178 C  CG1   . ILE A 1 749 ? 18.433  -23.203 44.851 1.00 17.41 ? 749  ILE A CG1   1 
ATOM   6179 C  CG2   . ILE A 1 749 ? 16.921  -23.948 46.720 1.00 18.08 ? 749  ILE A CG2   1 
ATOM   6180 C  CD1   . ILE A 1 749 ? 17.466  -22.291 44.102 1.00 19.09 ? 749  ILE A CD1   1 
ATOM   6181 N  N     . ARG A 1 750 ? 17.585  -27.494 46.330 1.00 18.22 ? 750  ARG A N     1 
ATOM   6182 C  CA    . ARG A 1 750 ? 17.032  -28.567 47.163 1.00 18.38 ? 750  ARG A CA    1 
ATOM   6183 C  C     . ARG A 1 750 ? 18.124  -29.210 48.010 1.00 19.43 ? 750  ARG A C     1 
ATOM   6184 O  O     . ARG A 1 750 ? 17.949  -29.409 49.212 1.00 19.26 ? 750  ARG A O     1 
ATOM   6185 C  CB    . ARG A 1 750 ? 16.314  -29.636 46.330 1.00 18.07 ? 750  ARG A CB    1 
ATOM   6186 C  CG    . ARG A 1 750 ? 15.546  -30.633 47.197 1.00 19.73 ? 750  ARG A CG    1 
ATOM   6187 C  CD    . ARG A 1 750 ? 15.231  -31.931 46.461 1.00 20.54 ? 750  ARG A CD    1 
ATOM   6188 N  NE    . ARG A 1 750 ? 16.441  -32.668 46.080 1.00 23.05 ? 750  ARG A NE    1 
ATOM   6189 C  CZ    . ARG A 1 750 ? 17.174  -33.416 46.903 1.00 25.22 ? 750  ARG A CZ    1 
ATOM   6190 N  NH1   . ARG A 1 750 ? 16.848  -33.540 48.186 1.00 24.10 ? 750  ARG A NH1   1 
ATOM   6191 N  NH2   . ARG A 1 750 ? 18.252  -34.042 46.437 1.00 26.03 ? 750  ARG A NH2   1 
ATOM   6192 N  N     . ARG A 1 751 ? 19.253  -29.516 47.378 1.00 18.70 ? 751  ARG A N     1 
ATOM   6193 C  CA    . ARG A 1 751 ? 20.376  -30.140 48.068 1.00 20.99 ? 751  ARG A CA    1 
ATOM   6194 C  C     . ARG A 1 751 ? 20.969  -29.229 49.136 1.00 20.96 ? 751  ARG A C     1 
ATOM   6195 O  O     . ARG A 1 751 ? 21.209  -29.673 50.253 1.00 22.36 ? 751  ARG A O     1 
ATOM   6196 C  CB    . ARG A 1 751 ? 21.437  -30.606 47.070 1.00 20.47 ? 751  ARG A CB    1 
ATOM   6197 C  CG    . ARG A 1 751 ? 20.975  -31.811 46.268 1.00 22.00 ? 751  ARG A CG    1 
ATOM   6198 C  CD    . ARG A 1 751 ? 21.961  -32.182 45.177 1.00 22.17 ? 751  ARG A CD    1 
ATOM   6199 N  NE    . ARG A 1 751 ? 21.577  -33.425 44.503 1.00 22.95 ? 751  ARG A NE    1 
ATOM   6200 C  CZ    . ARG A 1 751 ? 22.288  -34.550 44.526 1.00 26.51 ? 751  ARG A CZ    1 
ATOM   6201 N  NH1   . ARG A 1 751 ? 23.440  -34.609 45.183 1.00 29.18 ? 751  ARG A NH1   1 
ATOM   6202 N  NH2   . ARG A 1 751 ? 21.850  -35.624 43.878 1.00 29.96 ? 751  ARG A NH2   1 
ATOM   6203 N  N     . MET A 1 752 ? 21.169  -27.954 48.802 1.00 20.13 ? 752  MET A N     1 
ATOM   6204 C  CA    . MET A 1 752 ? 21.624  -26.967 49.787 1.00 19.31 ? 752  MET A CA    1 
ATOM   6205 C  C     . MET A 1 752 ? 20.733  -26.959 51.028 1.00 18.96 ? 752  MET A C     1 
ATOM   6206 O  O     . MET A 1 752 ? 21.226  -27.058 52.153 1.00 20.37 ? 752  MET A O     1 
ATOM   6207 C  CB    . MET A 1 752 ? 21.648  -25.561 49.181 1.00 20.18 ? 752  MET A CB    1 
ATOM   6208 C  CG    . MET A 1 752 ? 22.788  -25.315 48.224 1.00 22.06 ? 752  MET A CG    1 
ATOM   6209 S  SD    . MET A 1 752 ? 22.550  -23.781 47.321 1.00 23.02 ? 752  MET A SD    1 
ATOM   6210 C  CE    . MET A 1 752 ? 22.875  -22.592 48.619 1.00 20.27 ? 752  MET A CE    1 
ATOM   6211 N  N     . LEU A 1 753 ? 19.423  -26.853 50.814 1.00 18.76 ? 753  LEU A N     1 
ATOM   6212 C  CA    . LEU A 1 753 ? 18.477  -26.680 51.915 1.00 18.72 ? 753  LEU A CA    1 
ATOM   6213 C  C     . LEU A 1 753 ? 18.206  -27.954 52.706 1.00 19.39 ? 753  LEU A C     1 
ATOM   6214 O  O     . LEU A 1 753 ? 17.953  -27.886 53.903 1.00 19.27 ? 753  LEU A O     1 
ATOM   6215 C  CB    . LEU A 1 753 ? 17.152  -26.079 51.422 1.00 18.48 ? 753  LEU A CB    1 
ATOM   6216 C  CG    . LEU A 1 753 ? 17.190  -24.755 50.647 1.00 18.80 ? 753  LEU A CG    1 
ATOM   6217 C  CD1   . LEU A 1 753 ? 15.802  -24.157 50.590 1.00 20.50 ? 753  LEU A CD1   1 
ATOM   6218 C  CD2   . LEU A 1 753 ? 18.195  -23.756 51.237 1.00 20.98 ? 753  LEU A CD2   1 
ATOM   6219 N  N     . GLN A 1 754 ? 18.260  -29.107 52.042 1.00 18.29 ? 754  GLN A N     1 
ATOM   6220 C  CA    . GLN A 1 754 ? 17.844  -30.368 52.677 1.00 19.23 ? 754  GLN A CA    1 
ATOM   6221 C  C     . GLN A 1 754 ? 18.983  -31.311 53.040 1.00 19.88 ? 754  GLN A C     1 
ATOM   6222 O  O     . GLN A 1 754 ? 18.849  -32.129 53.952 1.00 22.18 ? 754  GLN A O     1 
ATOM   6223 C  CB    . GLN A 1 754 ? 16.873  -31.117 51.767 1.00 20.84 ? 754  GLN A CB    1 
ATOM   6224 C  CG    . GLN A 1 754 ? 15.540  -30.402 51.543 1.00 20.13 ? 754  GLN A CG    1 
ATOM   6225 C  CD    . GLN A 1 754 ? 14.628  -31.152 50.582 1.00 22.60 ? 754  GLN A CD    1 
ATOM   6226 O  OE1   . GLN A 1 754 ? 14.973  -32.224 50.079 1.00 22.41 ? 754  GLN A OE1   1 
ATOM   6227 N  NE2   . GLN A 1 754 ? 13.460  -30.585 50.319 1.00 19.78 ? 754  GLN A NE2   1 
ATOM   6228 N  N     . GLU A 1 755 ? 20.095  -31.212 52.322 1.00 22.12 ? 755  GLU A N     1 
ATOM   6229 C  CA    . GLU A 1 755 ? 21.155  -32.218 52.442 1.00 23.47 ? 755  GLU A CA    1 
ATOM   6230 C  C     . GLU A 1 755 ? 22.508  -31.612 52.804 1.00 24.82 ? 755  GLU A C     1 
ATOM   6231 O  O     . GLU A 1 755 ? 23.291  -32.227 53.530 1.00 26.14 ? 755  GLU A O     1 
ATOM   6232 C  CB    . GLU A 1 755 ? 21.242  -33.058 51.161 1.00 24.20 ? 755  GLU A CB    1 
ATOM   6233 C  CG    . GLU A 1 755 ? 19.964  -33.855 50.866 1.00 25.56 ? 755  GLU A CG    1 
ATOM   6234 C  CD    . GLU A 1 755 ? 19.973  -34.573 49.524 1.00 30.24 ? 755  GLU A CD    1 
ATOM   6235 O  OE1   . GLU A 1 755 ? 18.916  -35.117 49.148 1.00 29.01 ? 755  GLU A OE1   1 
ATOM   6236 O  OE2   . GLU A 1 755 ? 21.025  -34.610 48.853 1.00 31.33 ? 755  GLU A OE2   1 
ATOM   6237 N  N     . GLY A 1 756 ? 22.780  -30.413 52.298 1.00 22.87 ? 756  GLY A N     1 
ATOM   6238 C  CA    . GLY A 1 756 ? 23.989  -29.682 52.679 1.00 24.03 ? 756  GLY A CA    1 
ATOM   6239 C  C     . GLY A 1 756 ? 25.051  -29.552 51.599 1.00 23.98 ? 756  GLY A C     1 
ATOM   6240 O  O     . GLY A 1 756 ? 24.825  -29.901 50.441 1.00 24.03 ? 756  GLY A O     1 
ATOM   6241 N  N     . GLU A 1 757 ? 26.219  -29.063 52.005 1.00 24.62 ? 757  GLU A N     1 
ATOM   6242 C  CA    . GLU A 1 757 ? 27.296  -28.675 51.088 1.00 26.27 ? 757  GLU A CA    1 
ATOM   6243 C  C     . GLU A 1 757 ? 27.848  -29.799 50.210 1.00 25.89 ? 757  GLU A C     1 
ATOM   6244 O  O     . GLU A 1 757 ? 28.053  -29.604 49.011 1.00 24.89 ? 757  GLU A O     1 
ATOM   6245 C  CB    . GLU A 1 757 ? 28.436  -28.019 51.873 1.00 26.55 ? 757  GLU A CB    1 
ATOM   6246 C  CG    . GLU A 1 757 ? 29.538  -27.412 51.007 1.00 28.59 ? 757  GLU A CG    1 
ATOM   6247 C  CD    . GLU A 1 757 ? 30.581  -26.669 51.828 1.00 30.32 ? 757  GLU A CD    1 
ATOM   6248 O  OE1   . GLU A 1 757 ? 31.061  -27.234 52.826 1.00 32.90 ? 757  GLU A OE1   1 
ATOM   6249 O  OE2   . GLU A 1 757 ? 30.926  -25.525 51.467 1.00 29.58 ? 757  GLU A OE2   1 
ATOM   6250 N  N     . GLU A 1 758 ? 28.103  -30.965 50.801 1.00 27.22 ? 758  GLU A N     1 
ATOM   6251 C  CA    . GLU A 1 758 ? 28.708  -32.068 50.051 1.00 29.92 ? 758  GLU A CA    1 
ATOM   6252 C  C     . GLU A 1 758 ? 27.775  -32.581 48.956 1.00 27.95 ? 758  GLU A C     1 
ATOM   6253 O  O     . GLU A 1 758 ? 28.217  -32.883 47.843 1.00 27.47 ? 758  GLU A O     1 
ATOM   6254 C  CB    . GLU A 1 758 ? 29.154  -33.203 50.981 1.00 32.11 ? 758  GLU A CB    1 
ATOM   6255 C  CG    . GLU A 1 758 ? 30.094  -34.205 50.313 1.00 39.10 ? 758  GLU A CG    1 
ATOM   6256 C  CD    . GLU A 1 758 ? 30.595  -35.288 51.257 1.00 45.39 ? 758  GLU A CD    1 
ATOM   6257 O  OE1   . GLU A 1 758 ? 31.760  -35.712 51.102 1.00 48.50 ? 758  GLU A OE1   1 
ATOM   6258 O  OE2   . GLU A 1 758 ? 29.832  -35.718 52.150 1.00 49.05 ? 758  GLU A OE2   1 
ATOM   6259 N  N     . SER A 1 759 ? 26.483  -32.648 49.274 1.00 26.66 ? 759  SER A N     1 
ATOM   6260 C  CA    . SER A 1 759 ? 25.462  -33.054 48.314 1.00 25.64 ? 759  SER A CA    1 
ATOM   6261 C  C     . SER A 1 759 ? 25.413  -32.099 47.125 1.00 23.35 ? 759  SER A C     1 
ATOM   6262 O  O     . SER A 1 759 ? 25.339  -32.526 45.972 1.00 24.13 ? 759  SER A O     1 
ATOM   6263 C  CB    . SER A 1 759 ? 24.097  -33.107 48.992 1.00 24.90 ? 759  SER A CB    1 
ATOM   6264 O  OG    . SER A 1 759 ? 23.096  -33.521 48.081 1.00 23.21 ? 759  SER A OG    1 
ATOM   6265 N  N     . LEU A 1 760 ? 25.460  -30.804 47.418 1.00 24.28 ? 760  LEU A N     1 
ATOM   6266 C  CA    . LEU A 1 760 ? 25.485  -29.767 46.387 1.00 23.33 ? 760  LEU A CA    1 
ATOM   6267 C  C     . LEU A 1 760 ? 26.715  -29.916 45.478 1.00 22.99 ? 760  LEU A C     1 
ATOM   6268 O  O     . LEU A 1 760 ? 26.608  -29.819 44.255 1.00 21.99 ? 760  LEU A O     1 
ATOM   6269 C  CB    . LEU A 1 760 ? 25.425  -28.387 47.054 1.00 23.40 ? 760  LEU A CB    1 
ATOM   6270 C  CG    . LEU A 1 760 ? 25.371  -27.031 46.333 1.00 28.96 ? 760  LEU A CG    1 
ATOM   6271 C  CD1   . LEU A 1 760 ? 26.732  -26.397 46.295 1.00 30.21 ? 760  LEU A CD1   1 
ATOM   6272 C  CD2   . LEU A 1 760 ? 24.723  -27.061 44.950 1.00 27.30 ? 760  LEU A CD2   1 
ATOM   6273 N  N     . GLN A 1 761 ? 27.873  -30.175 46.079 1.00 23.88 ? 761  GLN A N     1 
ATOM   6274 C  CA    . GLN A 1 761 ? 29.120  -30.333 45.323 1.00 25.10 ? 761  GLN A CA    1 
ATOM   6275 C  C     . GLN A 1 761 ? 29.079  -31.533 44.377 1.00 26.99 ? 761  GLN A C     1 
ATOM   6276 O  O     . GLN A 1 761 ? 29.595  -31.466 43.257 1.00 26.85 ? 761  GLN A O     1 
ATOM   6277 C  CB    . GLN A 1 761 ? 30.316  -30.432 46.274 1.00 26.67 ? 761  GLN A CB    1 
ATOM   6278 C  CG    . GLN A 1 761 ? 30.650  -29.112 46.986 1.00 26.78 ? 761  GLN A CG    1 
ATOM   6279 C  CD    . GLN A 1 761 ? 31.677  -29.255 48.104 1.00 29.95 ? 761  GLN A CD    1 
ATOM   6280 O  OE1   . GLN A 1 761 ? 32.069  -28.266 48.731 1.00 31.82 ? 761  GLN A OE1   1 
ATOM   6281 N  NE2   . GLN A 1 761 ? 32.114  -30.479 48.359 1.00 28.28 ? 761  GLN A NE2   1 
ATOM   6282 N  N     . GLU A 1 762 ? 28.466  -32.622 44.837 1.00 27.14 ? 762  GLU A N     1 
ATOM   6283 C  CA    . GLU A 1 762 ? 28.310  -33.831 44.032 1.00 29.55 ? 762  GLU A CA    1 
ATOM   6284 C  C     . GLU A 1 762 ? 27.440  -33.574 42.807 1.00 27.26 ? 762  GLU A C     1 
ATOM   6285 O  O     . GLU A 1 762 ? 27.769  -34.018 41.703 1.00 27.77 ? 762  GLU A O     1 
ATOM   6286 C  CB    . GLU A 1 762 ? 27.711  -34.969 44.867 1.00 32.33 ? 762  GLU A CB    1 
ATOM   6287 C  CG    . GLU A 1 762 ? 28.688  -35.621 45.836 1.00 40.37 ? 762  GLU A CG    1 
ATOM   6288 C  CD    . GLU A 1 762 ? 28.125  -36.873 46.494 1.00 46.81 ? 762  GLU A CD    1 
ATOM   6289 O  OE1   . GLU A 1 762 ? 27.514  -37.704 45.785 1.00 49.73 ? 762  GLU A OE1   1 
ATOM   6290 O  OE2   . GLU A 1 762 ? 28.305  -37.032 47.721 1.00 49.70 ? 762  GLU A OE2   1 
ATOM   6291 N  N     . TYR A 1 763 ? 26.335  -32.857 43.005 1.00 24.86 ? 763  TYR A N     1 
ATOM   6292 C  CA    . TYR A 1 763 ? 25.429  -32.533 41.907 1.00 25.58 ? 763  TYR A CA    1 
ATOM   6293 C  C     . TYR A 1 763 ? 26.031  -31.554 40.907 1.00 25.93 ? 763  TYR A C     1 
ATOM   6294 O  O     . TYR A 1 763 ? 25.871  -31.724 39.695 1.00 26.40 ? 763  TYR A O     1 
ATOM   6295 C  CB    . TYR A 1 763 ? 24.094  -31.987 42.412 1.00 24.17 ? 763  TYR A CB    1 
ATOM   6296 C  CG    . TYR A 1 763 ? 23.026  -32.018 41.340 1.00 26.68 ? 763  TYR A CG    1 
ATOM   6297 C  CD1   . TYR A 1 763 ? 22.605  -30.849 40.694 1.00 27.62 ? 763  TYR A CD1   1 
ATOM   6298 C  CD2   . TYR A 1 763 ? 22.462  -33.227 40.948 1.00 26.55 ? 763  TYR A CD2   1 
ATOM   6299 C  CE1   . TYR A 1 763 ? 21.622  -30.899 39.695 1.00 26.50 ? 763  TYR A CE1   1 
ATOM   6300 C  CE2   . TYR A 1 763 ? 21.497  -33.285 39.965 1.00 28.04 ? 763  TYR A CE2   1 
ATOM   6301 C  CZ    . TYR A 1 763 ? 21.081  -32.131 39.344 1.00 30.34 ? 763  TYR A CZ    1 
ATOM   6302 O  OH    . TYR A 1 763 ? 20.117  -32.236 38.373 1.00 35.39 ? 763  TYR A OH    1 
ATOM   6303 N  N     . PHE A 1 764 ? 26.707  -30.525 41.414 1.00 25.68 ? 764  PHE A N     1 
ATOM   6304 C  CA    . PHE A 1 764 ? 27.327  -29.539 40.538 1.00 25.13 ? 764  PHE A CA    1 
ATOM   6305 C  C     . PHE A 1 764 ? 28.317  -30.200 39.585 1.00 26.32 ? 764  PHE A C     1 
ATOM   6306 O  O     . PHE A 1 764 ? 28.288  -29.940 38.380 1.00 28.18 ? 764  PHE A O     1 
ATOM   6307 C  CB    . PHE A 1 764 ? 28.029  -28.426 41.323 1.00 25.08 ? 764  PHE A CB    1 
ATOM   6308 C  CG    . PHE A 1 764 ? 28.802  -27.488 40.442 1.00 24.93 ? 764  PHE A CG    1 
ATOM   6309 C  CD1   . PHE A 1 764 ? 28.169  -26.419 39.824 1.00 25.67 ? 764  PHE A CD1   1 
ATOM   6310 C  CD2   . PHE A 1 764 ? 30.155  -27.707 40.187 1.00 25.70 ? 764  PHE A CD2   1 
ATOM   6311 C  CE1   . PHE A 1 764 ? 28.872  -25.558 38.984 1.00 26.36 ? 764  PHE A CE1   1 
ATOM   6312 C  CE2   . PHE A 1 764 ? 30.870  -26.854 39.345 1.00 26.84 ? 764  PHE A CE2   1 
ATOM   6313 C  CZ    . PHE A 1 764 ? 30.224  -25.777 38.741 1.00 25.57 ? 764  PHE A CZ    1 
ATOM   6314 N  N     . LYS A 1 765 ? 29.189  -31.042 40.140 1.00 26.96 ? 765  LYS A N     1 
ATOM   6315 C  CA    . LYS A 1 765 ? 30.235  -31.713 39.369 1.00 28.84 ? 765  LYS A CA    1 
ATOM   6316 C  C     . LYS A 1 765 ? 29.625  -32.524 38.226 1.00 28.97 ? 765  LYS A C     1 
ATOM   6317 O  O     . LYS A 1 765 ? 30.156  -32.531 37.115 1.00 29.08 ? 765  LYS A O     1 
ATOM   6318 C  CB    . LYS A 1 765 ? 31.084  -32.614 40.274 1.00 30.67 ? 765  LYS A CB    1 
ATOM   6319 C  CG    . LYS A 1 765 ? 32.408  -33.072 39.650 1.00 35.84 ? 765  LYS A CG    1 
ATOM   6320 C  CD    . LYS A 1 765 ? 33.049  -34.215 40.432 1.00 40.13 ? 765  LYS A CD    1 
ATOM   6321 C  CE    . LYS A 1 765 ? 33.646  -33.746 41.756 1.00 44.68 ? 765  LYS A CE    1 
ATOM   6322 N  NZ    . LYS A 1 765 ? 34.094  -34.898 42.588 1.00 48.14 ? 765  LYS A NZ    1 
ATOM   6323 N  N     . GLU A 1 766 ? 28.505  -33.188 38.502 1.00 29.12 ? 766  GLU A N     1 
ATOM   6324 C  CA    . GLU A 1 766 ? 27.811  -33.979 37.486 1.00 30.10 ? 766  GLU A CA    1 
ATOM   6325 C  C     . GLU A 1 766 ? 27.148  -33.113 36.411 1.00 27.90 ? 766  GLU A C     1 
ATOM   6326 O  O     . GLU A 1 766 ? 27.297  -33.388 35.219 1.00 27.55 ? 766  GLU A O     1 
ATOM   6327 C  CB    . GLU A 1 766 ? 26.790  -34.926 38.124 1.00 31.62 ? 766  GLU A CB    1 
ATOM   6328 C  CG    . GLU A 1 766 ? 26.565  -36.205 37.317 1.00 35.92 ? 766  GLU A CG    1 
ATOM   6329 C  CD    . GLU A 1 766 ? 27.849  -36.979 37.094 1.00 37.23 ? 766  GLU A CD    1 
ATOM   6330 O  OE1   . GLU A 1 766 ? 28.419  -37.504 38.075 1.00 40.01 ? 766  GLU A OE1   1 
ATOM   6331 O  OE2   . GLU A 1 766 ? 28.296  -37.060 35.932 1.00 39.28 ? 766  GLU A OE2   1 
ATOM   6332 N  N     . PHE A 1 767 ? 26.431  -32.067 36.820 1.00 25.19 ? 767  PHE A N     1 
ATOM   6333 C  CA    . PHE A 1 767 ? 25.764  -31.193 35.851 1.00 25.76 ? 767  PHE A CA    1 
ATOM   6334 C  C     . PHE A 1 767 ? 26.766  -30.561 34.881 1.00 26.45 ? 767  PHE A C     1 
ATOM   6335 O  O     . PHE A 1 767 ? 26.554  -30.573 33.665 1.00 25.81 ? 767  PHE A O     1 
ATOM   6336 C  CB    . PHE A 1 767 ? 24.912  -30.111 36.527 1.00 24.32 ? 767  PHE A CB    1 
ATOM   6337 C  CG    . PHE A 1 767 ? 24.069  -29.326 35.557 1.00 25.03 ? 767  PHE A CG    1 
ATOM   6338 C  CD1   . PHE A 1 767 ? 24.454  -28.050 35.153 1.00 26.65 ? 767  PHE A CD1   1 
ATOM   6339 C  CD2   . PHE A 1 767 ? 22.910  -29.882 35.015 1.00 23.96 ? 767  PHE A CD2   1 
ATOM   6340 C  CE1   . PHE A 1 767 ? 23.687  -27.326 34.240 1.00 27.22 ? 767  PHE A CE1   1 
ATOM   6341 C  CE2   . PHE A 1 767 ? 22.137  -29.167 34.100 1.00 23.58 ? 767  PHE A CE2   1 
ATOM   6342 C  CZ    . PHE A 1 767 ? 22.529  -27.881 33.715 1.00 26.75 ? 767  PHE A CZ    1 
ATOM   6343 N  N     . GLU A 1 768 ? 27.858  -30.035 35.432 1.00 24.41 ? 768  GLU A N     1 
ATOM   6344 C  CA    . GLU A 1 768 ? 28.939  -29.436 34.644 1.00 26.89 ? 768  GLU A CA    1 
ATOM   6345 C  C     . GLU A 1 768 ? 29.492  -30.413 33.609 1.00 26.58 ? 768  GLU A C     1 
ATOM   6346 O  O     . GLU A 1 768 ? 29.810  -30.024 32.479 1.00 26.43 ? 768  GLU A O     1 
ATOM   6347 C  CB    . GLU A 1 768 ? 30.059  -28.959 35.575 1.00 26.81 ? 768  GLU A CB    1 
ATOM   6348 C  CG    . GLU A 1 768 ? 31.170  -28.155 34.909 1.00 33.88 ? 768  GLU A CG    1 
ATOM   6349 C  CD    . GLU A 1 768 ? 32.201  -27.631 35.909 1.00 37.76 ? 768  GLU A CD    1 
ATOM   6350 O  OE1   . GLU A 1 768 ? 32.451  -26.407 35.915 1.00 41.31 ? 768  GLU A OE1   1 
ATOM   6351 O  OE2   . GLU A 1 768 ? 32.756  -28.439 36.689 1.00 38.51 ? 768  GLU A OE2   1 
ATOM   6352 N  N     . LYS A 1 769 ? 29.596  -31.677 34.009 1.00 27.04 ? 769  LYS A N     1 
ATOM   6353 C  CA    . LYS A 1 769 ? 30.174  -32.729 33.186 1.00 29.24 ? 769  LYS A CA    1 
ATOM   6354 C  C     . LYS A 1 769 ? 29.242  -33.166 32.055 1.00 28.48 ? 769  LYS A C     1 
ATOM   6355 O  O     . LYS A 1 769 ? 29.711  -33.508 30.973 1.00 27.92 ? 769  LYS A O     1 
ATOM   6356 C  CB    . LYS A 1 769 ? 30.537  -33.927 34.074 1.00 32.06 ? 769  LYS A CB    1 
ATOM   6357 C  CG    . LYS A 1 769 ? 31.551  -34.899 33.488 1.00 40.43 ? 769  LYS A CG    1 
ATOM   6358 C  CD    . LYS A 1 769 ? 32.519  -35.407 34.565 1.00 46.43 ? 769  LYS A CD    1 
ATOM   6359 C  CE    . LYS A 1 769 ? 31.801  -36.117 35.713 1.00 47.96 ? 769  LYS A CE    1 
ATOM   6360 N  NZ    . LYS A 1 769 ? 32.679  -36.275 36.908 1.00 50.74 ? 769  LYS A NZ    1 
ATOM   6361 N  N     . GLU A 1 770 ? 27.932  -33.134 32.298 1.00 27.66 ? 770  GLU A N     1 
ATOM   6362 C  CA    . GLU A 1 770 ? 26.961  -33.746 31.375 1.00 28.71 ? 770  GLU A CA    1 
ATOM   6363 C  C     . GLU A 1 770 ? 26.090  -32.775 30.571 1.00 27.94 ? 770  GLU A C     1 
ATOM   6364 O  O     . GLU A 1 770 ? 25.410  -33.193 29.635 1.00 28.47 ? 770  GLU A O     1 
ATOM   6365 C  CB    . GLU A 1 770 ? 26.030  -34.719 32.120 1.00 29.77 ? 770  GLU A CB    1 
ATOM   6366 C  CG    . GLU A 1 770 ? 26.689  -35.669 33.129 1.00 30.45 ? 770  GLU A CG    1 
ATOM   6367 C  CD    . GLU A 1 770 ? 27.519  -36.777 32.506 1.00 32.30 ? 770  GLU A CD    1 
ATOM   6368 O  OE1   . GLU A 1 770 ? 28.208  -37.483 33.273 1.00 34.16 ? 770  GLU A OE1   1 
ATOM   6369 O  OE2   . GLU A 1 770 ? 27.496  -36.953 31.269 1.00 32.65 ? 770  GLU A OE2   1 
ATOM   6370 N  N     . PHE A 1 771 ? 26.107  -31.492 30.923 1.00 27.00 ? 771  PHE A N     1 
ATOM   6371 C  CA    . PHE A 1 771 ? 25.084  -30.561 30.426 1.00 27.94 ? 771  PHE A CA    1 
ATOM   6372 C  C     . PHE A 1 771 ? 25.082  -30.360 28.903 1.00 27.78 ? 771  PHE A C     1 
ATOM   6373 O  O     . PHE A 1 771 ? 24.054  -29.987 28.338 1.00 25.32 ? 771  PHE A O     1 
ATOM   6374 C  CB    . PHE A 1 771 ? 25.183  -29.208 31.139 1.00 28.14 ? 771  PHE A CB    1 
ATOM   6375 C  CG    . PHE A 1 771 ? 26.177  -28.281 30.520 1.00 26.20 ? 771  PHE A CG    1 
ATOM   6376 C  CD1   . PHE A 1 771 ? 27.533  -28.414 30.794 1.00 30.05 ? 771  PHE A CD1   1 
ATOM   6377 C  CD2   . PHE A 1 771 ? 25.759  -27.282 29.644 1.00 26.60 ? 771  PHE A CD2   1 
ATOM   6378 C  CE1   . PHE A 1 771 ? 28.464  -27.561 30.208 1.00 30.81 ? 771  PHE A CE1   1 
ATOM   6379 C  CE2   . PHE A 1 771 ? 26.681  -26.427 29.050 1.00 27.30 ? 771  PHE A CE2   1 
ATOM   6380 C  CZ    . PHE A 1 771 ? 28.038  -26.566 29.333 1.00 29.79 ? 771  PHE A CZ    1 
ATOM   6381 N  N     . ARG A 1 772 ? 26.220  -30.620 28.254 1.00 28.14 ? 772  ARG A N     1 
ATOM   6382 C  CA    A ARG A 1 772 ? 26.362  -30.427 26.806 0.50 28.74 ? 772  ARG A CA    1 
ATOM   6383 C  CA    B ARG A 1 772 ? 26.354  -30.419 26.807 0.50 28.78 ? 772  ARG A CA    1 
ATOM   6384 C  C     . ARG A 1 772 ? 25.499  -31.392 25.994 1.00 29.05 ? 772  ARG A C     1 
ATOM   6385 O  O     . ARG A 1 772 ? 25.340  -31.230 24.782 1.00 28.39 ? 772  ARG A O     1 
ATOM   6386 C  CB    A ARG A 1 772 ? 27.829  -30.546 26.382 0.50 30.47 ? 772  ARG A CB    1 
ATOM   6387 C  CB    B ARG A 1 772 ? 27.821  -30.507 26.384 0.50 30.63 ? 772  ARG A CB    1 
ATOM   6388 C  CG    A ARG A 1 772 ? 28.712  -29.429 26.907 0.50 31.54 ? 772  ARG A CG    1 
ATOM   6389 C  CG    B ARG A 1 772 ? 28.694  -29.449 27.030 0.50 31.72 ? 772  ARG A CG    1 
ATOM   6390 C  CD    A ARG A 1 772 ? 30.158  -29.617 26.489 0.50 33.29 ? 772  ARG A CD    1 
ATOM   6391 C  CD    B ARG A 1 772 ? 30.162  -29.783 26.900 0.50 34.22 ? 772  ARG A CD    1 
ATOM   6392 N  NE    A ARG A 1 772 ? 30.971  -28.462 26.858 0.50 33.29 ? 772  ARG A NE    1 
ATOM   6393 N  NE    B ARG A 1 772 ? 30.974  -28.937 27.767 0.50 34.60 ? 772  ARG A NE    1 
ATOM   6394 C  CZ    A ARG A 1 772 ? 31.430  -27.563 25.995 0.50 32.51 ? 772  ARG A CZ    1 
ATOM   6395 C  CZ    B ARG A 1 772 ? 31.146  -29.153 29.066 0.50 33.88 ? 772  ARG A CZ    1 
ATOM   6396 N  NH1   A ARG A 1 772 ? 31.166  -27.685 24.700 0.50 33.13 ? 772  ARG A NH1   1 
ATOM   6397 N  NH1   B ARG A 1 772 ? 30.552  -30.184 29.650 0.50 32.51 ? 772  ARG A NH1   1 
ATOM   6398 N  NH2   A ARG A 1 772 ? 32.156  -26.543 26.425 0.50 31.50 ? 772  ARG A NH2   1 
ATOM   6399 N  NH2   B ARG A 1 772 ? 31.902  -28.332 29.782 0.50 33.44 ? 772  ARG A NH2   1 
ATOM   6400 N  N     . GLN A 1 773 ? 24.948  -32.393 26.674 1.00 27.01 ? 773  GLN A N     1 
ATOM   6401 C  CA    . GLN A 1 773 ? 24.064  -33.378 26.066 1.00 27.76 ? 773  GLN A CA    1 
ATOM   6402 C  C     . GLN A 1 773 ? 22.619  -32.881 26.035 1.00 25.75 ? 773  GLN A C     1 
ATOM   6403 O  O     . GLN A 1 773 ? 21.790  -33.437 25.325 1.00 26.00 ? 773  GLN A O     1 
ATOM   6404 C  CB    . GLN A 1 773 ? 24.125  -34.694 26.848 1.00 29.17 ? 773  GLN A CB    1 
ATOM   6405 C  CG    . GLN A 1 773 ? 25.514  -35.317 26.950 1.00 33.92 ? 773  GLN A CG    1 
ATOM   6406 C  CD    . GLN A 1 773 ? 25.670  -36.242 28.164 1.00 37.95 ? 773  GLN A CD    1 
ATOM   6407 O  OE1   . GLN A 1 773 ? 26.740  -36.312 28.768 1.00 38.58 ? 773  GLN A OE1   1 
ATOM   6408 N  NE2   . GLN A 1 773 ? 24.602  -36.949 28.520 1.00 38.81 ? 773  GLN A NE2   1 
ATOM   6409 N  N     . LEU A 1 774 ? 22.317  -31.846 26.817 1.00 24.16 ? 774  LEU A N     1 
ATOM   6410 C  CA    . LEU A 1 774 ? 20.947  -31.335 26.908 1.00 24.39 ? 774  LEU A CA    1 
ATOM   6411 C  C     . LEU A 1 774 ? 20.449  -30.789 25.569 1.00 23.38 ? 774  LEU A C     1 
ATOM   6412 O  O     . LEU A 1 774 ? 21.220  -30.204 24.805 1.00 24.65 ? 774  LEU A O     1 
ATOM   6413 C  CB    . LEU A 1 774 ? 20.835  -30.274 28.010 1.00 22.20 ? 774  LEU A CB    1 
ATOM   6414 C  CG    . LEU A 1 774 ? 20.936  -30.799 29.450 1.00 23.49 ? 774  LEU A CG    1 
ATOM   6415 C  CD1   . LEU A 1 774 ? 21.304  -29.677 30.398 1.00 25.47 ? 774  LEU A CD1   1 
ATOM   6416 C  CD2   . LEU A 1 774 ? 19.645  -31.481 29.896 1.00 24.52 ? 774  LEU A CD2   1 
ATOM   6417 N  N     . ASN A 1 775 ? 19.168  -31.012 25.285 1.00 24.85 ? 775  ASN A N     1 
ATOM   6418 C  CA    . ASN A 1 775 ? 18.551  -30.526 24.053 1.00 25.50 ? 775  ASN A CA    1 
ATOM   6419 C  C     . ASN A 1 775 ? 18.656  -29.005 23.964 1.00 24.44 ? 775  ASN A C     1 
ATOM   6420 O  O     . ASN A 1 775 ? 18.464  -28.307 24.965 1.00 23.84 ? 775  ASN A O     1 
ATOM   6421 C  CB    . ASN A 1 775 ? 17.089  -30.976 23.977 1.00 27.88 ? 775  ASN A CB    1 
ATOM   6422 C  CG    . ASN A 1 775 ? 16.371  -30.437 22.755 1.00 31.07 ? 775  ASN A CG    1 
ATOM   6423 O  OD1   . ASN A 1 775 ? 15.680  -29.421 22.829 1.00 33.09 ? 775  ASN A OD1   1 
ATOM   6424 N  ND2   . ASN A 1 775 ? 16.537  -31.108 21.623 1.00 32.64 ? 775  ASN A ND2   1 
ATOM   6425 N  N     . TYR A 1 776 ? 18.961  -28.498 22.770 1.00 22.55 ? 776  TYR A N     1 
ATOM   6426 C  CA    . TYR A 1 776 ? 19.240  -27.065 22.593 1.00 22.16 ? 776  TYR A CA    1 
ATOM   6427 C  C     . TYR A 1 776 ? 18.120  -26.142 23.083 1.00 20.45 ? 776  TYR A C     1 
ATOM   6428 O  O     . TYR A 1 776 ? 18.391  -25.087 23.657 1.00 21.78 ? 776  TYR A O     1 
ATOM   6429 C  CB    . TYR A 1 776 ? 19.635  -26.756 21.137 1.00 21.93 ? 776  TYR A CB    1 
ATOM   6430 C  CG    . TYR A 1 776 ? 18.501  -26.705 20.133 1.00 23.85 ? 776  TYR A CG    1 
ATOM   6431 C  CD1   . TYR A 1 776 ? 18.107  -25.491 19.568 1.00 25.21 ? 776  TYR A CD1   1 
ATOM   6432 C  CD2   . TYR A 1 776 ? 17.831  -27.868 19.731 1.00 25.21 ? 776  TYR A CD2   1 
ATOM   6433 C  CE1   . TYR A 1 776 ? 17.070  -25.429 18.635 1.00 25.60 ? 776  TYR A CE1   1 
ATOM   6434 C  CE2   . TYR A 1 776 ? 16.787  -27.816 18.800 1.00 26.40 ? 776  TYR A CE2   1 
ATOM   6435 C  CZ    . TYR A 1 776 ? 16.419  -26.592 18.255 1.00 27.14 ? 776  TYR A CZ    1 
ATOM   6436 O  OH    . TYR A 1 776 ? 15.400  -26.521 17.338 1.00 26.04 ? 776  TYR A OH    1 
ATOM   6437 N  N     . ILE A 1 777 ? 16.871  -26.547 22.878 1.00 22.41 ? 777  ILE A N     1 
ATOM   6438 C  CA    . ILE A 1 777 ? 15.725  -25.766 23.356 1.00 21.34 ? 777  ILE A CA    1 
ATOM   6439 C  C     . ILE A 1 777 ? 15.737  -25.643 24.884 1.00 21.62 ? 777  ILE A C     1 
ATOM   6440 O  O     . ILE A 1 777 ? 15.457  -24.570 25.429 1.00 20.80 ? 777  ILE A O     1 
ATOM   6441 C  CB    . ILE A 1 777 ? 14.392  -26.352 22.849 1.00 23.10 ? 777  ILE A CB    1 
ATOM   6442 C  CG1   . ILE A 1 777 ? 14.279  -26.138 21.331 1.00 24.55 ? 777  ILE A CG1   1 
ATOM   6443 C  CG2   . ILE A 1 777 ? 13.194  -25.735 23.591 1.00 21.38 ? 777  ILE A CG2   1 
ATOM   6444 C  CD1   . ILE A 1 777 ? 13.240  -27.002 20.660 1.00 29.44 ? 777  ILE A CD1   1 
ATOM   6445 N  N     . SER A 1 778 ? 16.102  -26.732 25.560 1.00 20.94 ? 778  SER A N     1 
ATOM   6446 C  CA    . SER A 1 778 ? 16.112  -26.781 27.022 1.00 20.38 ? 778  SER A CA    1 
ATOM   6447 C  C     . SER A 1 778 ? 17.199  -25.905 27.653 1.00 20.19 ? 778  SER A C     1 
ATOM   6448 O  O     . SER A 1 778 ? 17.124  -25.584 28.838 1.00 20.23 ? 778  SER A O     1 
ATOM   6449 C  CB    . SER A 1 778 ? 16.247  -28.233 27.516 1.00 21.01 ? 778  SER A CB    1 
ATOM   6450 O  OG    . SER A 1 778 ? 17.600  -28.655 27.502 1.00 20.19 ? 778  SER A OG    1 
ATOM   6451 N  N     . ILE A 1 779 ? 18.198  -25.518 26.858 1.00 20.36 ? 779  ILE A N     1 
ATOM   6452 C  CA    . ILE A 1 779 ? 19.289  -24.673 27.353 1.00 19.19 ? 779  ILE A CA    1 
ATOM   6453 C  C     . ILE A 1 779 ? 19.326  -23.276 26.707 1.00 19.30 ? 779  ILE A C     1 
ATOM   6454 O  O     . ILE A 1 779 ? 20.229  -22.475 26.971 1.00 17.92 ? 779  ILE A O     1 
ATOM   6455 C  CB    . ILE A 1 779 ? 20.661  -25.401 27.316 1.00 20.83 ? 779  ILE A CB    1 
ATOM   6456 C  CG1   . ILE A 1 779 ? 20.931  -26.017 25.937 1.00 19.99 ? 779  ILE A CG1   1 
ATOM   6457 C  CG2   . ILE A 1 779 ? 20.711  -26.478 28.411 1.00 22.22 ? 779  ILE A CG2   1 
ATOM   6458 C  CD1   . ILE A 1 779 ? 22.318  -26.656 25.802 1.00 23.82 ? 779  ILE A CD1   1 
ATOM   6459 N  N     . ALA A 1 780 ? 18.306  -22.972 25.906 1.00 19.14 ? 780  ALA A N     1 
ATOM   6460 C  CA    . ALA A 1 780 ? 18.134  -21.632 25.357 1.00 17.63 ? 780  ALA A CA    1 
ATOM   6461 C  C     . ALA A 1 780 ? 17.513  -20.691 26.390 1.00 17.44 ? 780  ALA A C     1 
ATOM   6462 O  O     . ALA A 1 780 ? 16.630  -21.085 27.159 1.00 16.49 ? 780  ALA A O     1 
ATOM   6463 C  CB    . ALA A 1 780 ? 17.276  -21.681 24.104 1.00 17.97 ? 780  ALA A CB    1 
ATOM   6464 N  N     . SER A 1 781 ? 17.987  -19.451 26.405 1.00 17.08 ? 781  SER A N     1 
ATOM   6465 C  CA    . SER A 1 781 ? 17.383  -18.404 27.220 1.00 17.00 ? 781  SER A CA    1 
ATOM   6466 C  C     . SER A 1 781 ? 16.130  -17.903 26.517 1.00 17.28 ? 781  SER A C     1 
ATOM   6467 O  O     . SER A 1 781 ? 15.912  -18.208 25.343 1.00 18.34 ? 781  SER A O     1 
ATOM   6468 C  CB    . SER A 1 781 ? 18.371  -17.257 27.438 1.00 18.37 ? 781  SER A CB    1 
ATOM   6469 O  OG    . SER A 1 781 ? 19.502  -17.697 28.168 1.00 23.21 ? 781  SER A OG    1 
ATOM   6470 N  N     . VAL A 1 782 ? 15.307  -17.147 27.237 1.00 17.16 ? 782  VAL A N     1 
ATOM   6471 C  CA    . VAL A 1 782 ? 14.049  -16.640 26.690 1.00 17.88 ? 782  VAL A CA    1 
ATOM   6472 C  C     . VAL A 1 782 ? 13.924  -15.155 26.995 1.00 19.50 ? 782  VAL A C     1 
ATOM   6473 O  O     . VAL A 1 782 ? 14.288  -14.699 28.083 1.00 16.99 ? 782  VAL A O     1 
ATOM   6474 C  CB    . VAL A 1 782 ? 12.809  -17.395 27.262 1.00 19.14 ? 782  VAL A CB    1 
ATOM   6475 C  CG1   . VAL A 1 782 ? 11.512  -16.835 26.672 1.00 22.13 ? 782  VAL A CG1   1 
ATOM   6476 C  CG2   . VAL A 1 782 ? 12.893  -18.889 26.988 1.00 19.25 ? 782  VAL A CG2   1 
ATOM   6477 N  N     . SER A 1 783 ? 13.421  -14.396 26.029 1.00 17.83 ? 783  SER A N     1 
ATOM   6478 C  CA    . SER A 1 783 ? 13.129  -12.989 26.270 1.00 19.66 ? 783  SER A CA    1 
ATOM   6479 C  C     . SER A 1 783 ? 12.016  -12.503 25.359 1.00 20.32 ? 783  SER A C     1 
ATOM   6480 O  O     . SER A 1 783 ? 11.919  -12.926 24.208 1.00 20.80 ? 783  SER A O     1 
ATOM   6481 C  CB    . SER A 1 783 ? 14.384  -12.138 26.043 1.00 19.90 ? 783  SER A CB    1 
ATOM   6482 O  OG    . SER A 1 783 ? 14.172  -10.796 26.443 1.00 21.02 ? 783  SER A OG    1 
ATOM   6483 N  N     . SER A 1 784 ? 11.185  -11.607 25.880 1.00 21.08 ? 784  SER A N     1 
ATOM   6484 C  CA    . SER A 1 784 ? 10.313  -10.801 25.034 1.00 21.50 ? 784  SER A CA    1 
ATOM   6485 C  C     . SER A 1 784 ? 11.191  -9.932  24.154 1.00 23.31 ? 784  SER A C     1 
ATOM   6486 O  O     . SER A 1 784 ? 12.306  -9.585  24.539 1.00 24.60 ? 784  SER A O     1 
ATOM   6487 C  CB    . SER A 1 784 ? 9.403   -9.923  25.883 1.00 20.92 ? 784  SER A CB    1 
ATOM   6488 O  OG    . SER A 1 784 ? 8.504   -10.722 26.618 1.00 21.97 ? 784  SER A OG    1 
ATOM   6489 N  N     . ALA A 1 785 ? 10.692  -9.596  22.973 1.00 24.01 ? 785  ALA A N     1 
ATOM   6490 C  CA    . ALA A 1 785 ? 11.471  -8.853  21.998 1.00 25.88 ? 785  ALA A CA    1 
ATOM   6491 C  C     . ALA A 1 785 ? 10.694  -7.642  21.502 1.00 25.87 ? 785  ALA A C     1 
ATOM   6492 O  O     . ALA A 1 785 ? 9.823   -7.765  20.644 1.00 27.75 ? 785  ALA A O     1 
ATOM   6493 C  CB    . ALA A 1 785 ? 11.848  -9.760  20.842 1.00 27.26 ? 785  ALA A CB    1 
ATOM   6494 N  N     . ASN A 1 786 ? 11.010  -6.475  22.057 1.00 26.40 ? 786  ASN A N     1 
ATOM   6495 C  CA    . ASN A 1 786 ? 10.390  -5.220  21.629 1.00 28.66 ? 786  ASN A CA    1 
ATOM   6496 C  C     . ASN A 1 786 ? 11.379  -4.320  20.904 1.00 31.79 ? 786  ASN A C     1 
ATOM   6497 O  O     . ASN A 1 786 ? 12.587  -4.437  21.107 1.00 32.68 ? 786  ASN A O     1 
ATOM   6498 C  CB    . ASN A 1 786 ? 9.792   -4.486  22.827 1.00 29.18 ? 786  ASN A CB    1 
ATOM   6499 C  CG    . ASN A 1 786 ? 8.813   -5.345  23.598 1.00 28.11 ? 786  ASN A CG    1 
ATOM   6500 O  OD1   . ASN A 1 786 ? 7.778   -5.751  23.069 1.00 26.94 ? 786  ASN A OD1   1 
ATOM   6501 N  ND2   . ASN A 1 786 ? 9.137   -5.632  24.851 1.00 26.53 ? 786  ASN A ND2   1 
ATOM   6502 N  N     . ASN A 1 787 ? 10.859  -3.434  20.054 1.00 34.26 ? 787  ASN A N     1 
ATOM   6503 C  CA    . ASN A 1 787 ? 11.674  -2.465  19.308 1.00 36.56 ? 787  ASN A CA    1 
ATOM   6504 C  C     . ASN A 1 787 ? 12.735  -3.081  18.406 1.00 35.65 ? 787  ASN A C     1 
ATOM   6505 O  O     . ASN A 1 787 ? 13.854  -2.567  18.329 1.00 37.65 ? 787  ASN A O     1 
ATOM   6506 C  CB    . ASN A 1 787 ? 12.357  -1.475  20.257 1.00 38.90 ? 787  ASN A CB    1 
ATOM   6507 C  CG    . ASN A 1 787 ? 11.436  -0.384  20.722 1.00 43.14 ? 787  ASN A CG    1 
ATOM   6508 O  OD1   . ASN A 1 787 ? 10.940  0.420   19.928 1.00 47.37 ? 787  ASN A OD1   1 
ATOM   6509 N  ND2   . ASN A 1 787 ? 11.220  -0.329  22.025 1.00 45.55 ? 787  ASN A ND2   1 
ATOM   6510 N  N     . ILE A 1 788 ? 12.395  -4.172  17.725 1.00 33.47 ? 788  ILE A N     1 
ATOM   6511 C  CA    . ILE A 1 788 ? 13.346  -4.814  16.818 1.00 33.80 ? 788  ILE A CA    1 
ATOM   6512 C  C     . ILE A 1 788 ? 13.812  -3.803  15.761 1.00 35.74 ? 788  ILE A C     1 
ATOM   6513 O  O     . ILE A 1 788 ? 15.014  -3.671  15.509 1.00 35.95 ? 788  ILE A O     1 
ATOM   6514 C  CB    . ILE A 1 788 ? 12.761  -6.093  16.162 1.00 33.13 ? 788  ILE A CB    1 
ATOM   6515 C  CG1   . ILE A 1 788 ? 12.395  -7.124  17.234 1.00 33.17 ? 788  ILE A CG1   1 
ATOM   6516 C  CG2   . ILE A 1 788 ? 13.754  -6.702  15.160 1.00 34.37 ? 788  ILE A CG2   1 
ATOM   6517 C  CD1   . ILE A 1 788 ? 11.389  -8.158  16.778 1.00 35.46 ? 788  ILE A CD1   1 
ATOM   6518 N  N     . ALA A 1 789 ? 12.857  -3.074  15.184 1.00 36.65 ? 789  ALA A N     1 
ATOM   6519 C  CA    . ALA A 1 789 ? 13.125  -2.091  14.126 1.00 37.92 ? 789  ALA A CA    1 
ATOM   6520 C  C     . ALA A 1 789 ? 14.029  -0.935  14.562 1.00 38.51 ? 789  ALA A C     1 
ATOM   6521 O  O     . ALA A 1 789 ? 14.857  -0.465  13.777 1.00 40.12 ? 789  ALA A O     1 
ATOM   6522 C  CB    . ALA A 1 789 ? 11.814  -1.553  13.560 1.00 38.09 ? 789  ALA A CB    1 
ATOM   6523 N  N     . LYS A 1 790 ? 13.857  -0.476  15.802 1.00 38.02 ? 790  LYS A N     1 
ATOM   6524 C  CA    . LYS A 1 790 ? 14.657  0.620   16.362 1.00 38.42 ? 790  LYS A CA    1 
ATOM   6525 C  C     . LYS A 1 790 ? 16.162  0.336   16.307 1.00 37.50 ? 790  LYS A C     1 
ATOM   6526 O  O     . LYS A 1 790 ? 16.961  1.228   16.006 1.00 37.16 ? 790  LYS A O     1 
ATOM   6527 C  CB    . LYS A 1 790 ? 14.220  0.913   17.806 1.00 38.79 ? 790  LYS A CB    1 
ATOM   6528 C  CG    . LYS A 1 790 ? 15.154  1.842   18.598 1.00 42.56 ? 790  LYS A CG    1 
ATOM   6529 C  CD    . LYS A 1 790 ? 14.652  2.110   20.017 1.00 43.71 ? 790  LYS A CD    1 
ATOM   6530 C  CE    . LYS A 1 790 ? 13.693  3.302   20.061 1.00 46.82 ? 790  LYS A CE    1 
ATOM   6531 N  NZ    . LYS A 1 790 ? 13.335  3.698   21.455 1.00 48.60 ? 790  LYS A NZ    1 
ATOM   6532 N  N     . TYR A 1 791 ? 16.530  -0.913  16.588 1.00 34.46 ? 791  TYR A N     1 
ATOM   6533 C  CA    . TYR A 1 791 ? 17.927  -1.315  16.710 1.00 34.46 ? 791  TYR A CA    1 
ATOM   6534 C  C     . TYR A 1 791 ? 18.502  -1.956  15.451 1.00 35.36 ? 791  TYR A C     1 
ATOM   6535 O  O     . TYR A 1 791 ? 19.655  -2.403  15.442 1.00 34.93 ? 791  TYR A O     1 
ATOM   6536 C  CB    . TYR A 1 791 ? 18.087  -2.261  17.902 1.00 32.80 ? 791  TYR A CB    1 
ATOM   6537 C  CG    . TYR A 1 791 ? 17.860  -1.581  19.230 1.00 33.07 ? 791  TYR A CG    1 
ATOM   6538 C  CD1   . TYR A 1 791 ? 16.686  -1.790  19.950 1.00 30.10 ? 791  TYR A CD1   1 
ATOM   6539 C  CD2   . TYR A 1 791 ? 18.816  -0.713  19.758 1.00 33.63 ? 791  TYR A CD2   1 
ATOM   6540 C  CE1   . TYR A 1 791 ? 16.473  -1.158  21.172 1.00 31.75 ? 791  TYR A CE1   1 
ATOM   6541 C  CE2   . TYR A 1 791 ? 18.616  -0.079  20.970 1.00 32.78 ? 791  TYR A CE2   1 
ATOM   6542 C  CZ    . TYR A 1 791 ? 17.445  -0.305  21.676 1.00 32.79 ? 791  TYR A CZ    1 
ATOM   6543 O  OH    . TYR A 1 791 ? 17.250  0.329   22.883 1.00 30.42 ? 791  TYR A OH    1 
ATOM   6544 N  N     . ASP A 1 792 ? 17.688  -1.995  14.400 1.00 35.56 ? 792  ASP A N     1 
ATOM   6545 C  CA    . ASP A 1 792 ? 18.064  -2.596  13.134 1.00 36.60 ? 792  ASP A CA    1 
ATOM   6546 C  C     . ASP A 1 792 ? 18.606  -1.511  12.205 1.00 39.01 ? 792  ASP A C     1 
ATOM   6547 O  O     . ASP A 1 792 ? 17.853  -0.665  11.725 1.00 40.41 ? 792  ASP A O     1 
ATOM   6548 C  CB    . ASP A 1 792 ? 16.846  -3.290  12.509 1.00 37.31 ? 792  ASP A CB    1 
ATOM   6549 C  CG    . ASP A 1 792 ? 17.170  -4.005  11.204 1.00 39.50 ? 792  ASP A CG    1 
ATOM   6550 O  OD1   . ASP A 1 792 ? 18.160  -3.645  10.530 1.00 43.02 ? 792  ASP A OD1   1 
ATOM   6551 O  OD2   . ASP A 1 792 ? 16.415  -4.931  10.843 1.00 40.99 ? 792  ASP A OD2   1 
ATOM   6552 N  N     . VAL A 1 793 ? 19.916  -1.544  11.972 1.00 38.17 ? 793  VAL A N     1 
ATOM   6553 C  CA    . VAL A 1 793 ? 20.572  -0.625  11.042 1.00 39.76 ? 793  VAL A CA    1 
ATOM   6554 C  C     . VAL A 1 793 ? 21.149  -1.439  9.882  1.00 40.17 ? 793  VAL A C     1 
ATOM   6555 O  O     . VAL A 1 793 ? 22.236  -2.018  9.990  1.00 38.54 ? 793  VAL A O     1 
ATOM   6556 C  CB    . VAL A 1 793 ? 21.679  0.217   11.735 1.00 40.05 ? 793  VAL A CB    1 
ATOM   6557 C  CG1   . VAL A 1 793 ? 22.264  1.254   10.768 1.00 42.42 ? 793  VAL A CG1   1 
ATOM   6558 C  CG2   . VAL A 1 793 ? 21.136  0.910   12.976 1.00 40.31 ? 793  VAL A CG2   1 
ATOM   6559 N  N     . GLY A 1 794 ? 20.395  -1.497  8.786  1.00 41.89 ? 794  GLY A N     1 
ATOM   6560 C  CA    . GLY A 1 794 ? 20.777  -2.270  7.604  1.00 43.35 ? 794  GLY A CA    1 
ATOM   6561 C  C     . GLY A 1 794 ? 21.000  -3.745  7.887  1.00 42.57 ? 794  GLY A C     1 
ATOM   6562 O  O     . GLY A 1 794 ? 21.885  -4.368  7.299  1.00 44.08 ? 794  GLY A O     1 
ATOM   6563 N  N     . GLY A 1 795 ? 20.204  -4.298  8.801  1.00 40.72 ? 795  GLY A N     1 
ATOM   6564 C  CA    . GLY A 1 795 ? 20.287  -5.714  9.154  1.00 38.93 ? 795  GLY A CA    1 
ATOM   6565 C  C     . GLY A 1 795 ? 21.264  -6.013  10.276 1.00 37.77 ? 795  GLY A C     1 
ATOM   6566 O  O     . GLY A 1 795 ? 21.364  -7.155  10.724 1.00 36.50 ? 795  GLY A O     1 
ATOM   6567 N  N     . PHE A 1 796 ? 21.977  -4.984  10.731 1.00 37.42 ? 796  PHE A N     1 
ATOM   6568 C  CA    . PHE A 1 796 ? 22.992  -5.124  11.772 1.00 36.43 ? 796  PHE A CA    1 
ATOM   6569 C  C     . PHE A 1 796 ? 22.645  -4.303  13.020 1.00 35.25 ? 796  PHE A C     1 
ATOM   6570 O  O     . PHE A 1 796 ? 21.892  -3.332  12.927 1.00 36.08 ? 796  PHE A O     1 
ATOM   6571 C  CB    . PHE A 1 796 ? 24.371  -4.736  11.221 1.00 39.01 ? 796  PHE A CB    1 
ATOM   6572 C  CG    . PHE A 1 796 ? 24.925  -5.721  10.226 1.00 40.44 ? 796  PHE A CG    1 
ATOM   6573 C  CD1   . PHE A 1 796 ? 25.599  -6.862  10.657 1.00 40.49 ? 796  PHE A CD1   1 
ATOM   6574 C  CD2   . PHE A 1 796 ? 24.773  -5.510  8.859  1.00 43.74 ? 796  PHE A CD2   1 
ATOM   6575 C  CE1   . PHE A 1 796 ? 26.112  -7.781  9.741  1.00 42.08 ? 796  PHE A CE1   1 
ATOM   6576 C  CE2   . PHE A 1 796 ? 25.283  -6.423  7.931  1.00 45.04 ? 796  PHE A CE2   1 
ATOM   6577 C  CZ    . PHE A 1 796 ? 25.955  -7.561  8.378  1.00 43.84 ? 796  PHE A CZ    1 
ATOM   6578 N  N     . PRO A 1 797 ? 23.183  -4.700  14.194 1.00 33.79 ? 797  PRO A N     1 
ATOM   6579 C  CA    . PRO A 1 797 ? 22.867  -4.019  15.455 1.00 33.17 ? 797  PRO A CA    1 
ATOM   6580 C  C     . PRO A 1 797 ? 23.302  -2.561  15.491 1.00 33.77 ? 797  PRO A C     1 
ATOM   6581 O  O     . PRO A 1 797 ? 24.454  -2.248  15.188 1.00 34.89 ? 797  PRO A O     1 
ATOM   6582 C  CB    . PRO A 1 797 ? 23.649  -4.824  16.501 1.00 31.38 ? 797  PRO A CB    1 
ATOM   6583 C  CG    . PRO A 1 797 ? 23.861  -6.151  15.878 1.00 32.71 ? 797  PRO A CG    1 
ATOM   6584 C  CD    . PRO A 1 797 ? 24.036  -5.883  14.420 1.00 33.30 ? 797  PRO A CD    1 
ATOM   6585 N  N     . GLY A 1 798 ? 22.370  -1.685  15.853 1.00 33.83 ? 798  GLY A N     1 
ATOM   6586 C  CA    . GLY A 1 798 ? 22.671  -0.277  16.084 1.00 35.91 ? 798  GLY A CA    1 
ATOM   6587 C  C     . GLY A 1 798 ? 23.217  -0.062  17.485 1.00 35.21 ? 798  GLY A C     1 
ATOM   6588 O  O     . GLY A 1 798 ? 23.401  -1.030  18.231 1.00 35.44 ? 798  GLY A O     1 
ATOM   6589 N  N     . PRO A 1 799 ? 23.482  1.207   17.855 1.00 36.01 ? 799  PRO A N     1 
ATOM   6590 C  CA    . PRO A 1 799 ? 24.005  1.526   19.188 1.00 35.93 ? 799  PRO A CA    1 
ATOM   6591 C  C     . PRO A 1 799 ? 23.078  1.049   20.309 1.00 34.48 ? 799  PRO A C     1 
ATOM   6592 O  O     . PRO A 1 799 ? 21.854  1.171   20.196 1.00 34.33 ? 799  PRO A O     1 
ATOM   6593 C  CB    . PRO A 1 799 ? 24.083  3.058   19.177 1.00 37.44 ? 799  PRO A CB    1 
ATOM   6594 C  CG    . PRO A 1 799 ? 24.169  3.426   17.745 1.00 39.17 ? 799  PRO A CG    1 
ATOM   6595 C  CD    . PRO A 1 799 ? 23.335  2.415   17.023 1.00 38.01 ? 799  PRO A CD    1 
ATOM   6596 N  N     . LYS A 1 800 ? 23.672  0.500   21.370 1.00 33.08 ? 800  LYS A N     1 
ATOM   6597 C  CA    . LYS A 1 800 ? 22.940  0.020   22.554 1.00 32.31 ? 800  LYS A CA    1 
ATOM   6598 C  C     . LYS A 1 800 ? 21.950  -1.114  22.265 1.00 30.05 ? 800  LYS A C     1 
ATOM   6599 O  O     . LYS A 1 800 ? 20.992  -1.310  23.018 1.00 30.72 ? 800  LYS A O     1 
ATOM   6600 C  CB    . LYS A 1 800 ? 22.240  1.185   23.278 1.00 34.11 ? 800  LYS A CB    1 
ATOM   6601 C  CG    . LYS A 1 800 ? 23.206  2.204   23.878 1.00 40.21 ? 800  LYS A CG    1 
ATOM   6602 C  CD    . LYS A 1 800 ? 22.672  3.624   23.760 1.00 44.40 ? 800  LYS A CD    1 
ATOM   6603 C  CE    . LYS A 1 800 ? 23.794  4.644   23.920 1.00 47.13 ? 800  LYS A CE    1 
ATOM   6604 N  NZ    . LYS A 1 800 ? 23.388  5.997   23.454 1.00 49.81 ? 800  LYS A NZ    1 
ATOM   6605 N  N     . CYS A 1 801 ? 22.200  -1.871  21.197 1.00 28.09 ? 801  CYS A N     1 
ATOM   6606 C  CA    . CYS A 1 801 ? 21.329  -2.984  20.821 1.00 27.40 ? 801  CYS A CA    1 
ATOM   6607 C  C     . CYS A 1 801 ? 21.351  -4.055  21.899 1.00 25.69 ? 801  CYS A C     1 
ATOM   6608 O  O     . CYS A 1 801 ? 22.425  -4.556  22.249 1.00 25.29 ? 801  CYS A O     1 
ATOM   6609 C  CB    . CYS A 1 801 ? 21.732  -3.589  19.474 1.00 26.41 ? 801  CYS A CB    1 
ATOM   6610 S  SG    . CYS A 1 801 ? 20.633  -4.933  18.918 1.00 27.99 ? 801  CYS A SG    1 
ATOM   6611 N  N     . PRO A 1 802 ? 20.167  -4.395  22.439 1.00 25.40 ? 802  PRO A N     1 
ATOM   6612 C  CA    . PRO A 1 802 ? 20.069  -5.456  23.438 1.00 25.08 ? 802  PRO A CA    1 
ATOM   6613 C  C     . PRO A 1 802 ? 20.515  -6.800  22.865 1.00 23.87 ? 802  PRO A C     1 
ATOM   6614 O  O     . PRO A 1 802 ? 20.387  -7.035  21.658 1.00 24.24 ? 802  PRO A O     1 
ATOM   6615 C  CB    . PRO A 1 802 ? 18.576  -5.483  23.780 1.00 24.75 ? 802  PRO A CB    1 
ATOM   6616 C  CG    . PRO A 1 802 ? 18.081  -4.121  23.433 1.00 25.66 ? 802  PRO A CG    1 
ATOM   6617 C  CD    . PRO A 1 802 ? 18.869  -3.734  22.215 1.00 26.80 ? 802  PRO A CD    1 
ATOM   6618 N  N     . PHE A 1 803 ? 21.032  -7.662  23.736 1.00 22.51 ? 803  PHE A N     1 
ATOM   6619 C  CA    . PHE A 1 803 ? 21.561  -8.969  23.347 1.00 22.40 ? 803  PHE A CA    1 
ATOM   6620 C  C     . PHE A 1 803 ? 20.555  -9.832  22.595 1.00 21.74 ? 803  PHE A C     1 
ATOM   6621 O  O     . PHE A 1 803 ? 20.887  -10.414 21.560 1.00 21.58 ? 803  PHE A O     1 
ATOM   6622 C  CB    . PHE A 1 803 ? 22.050  -9.710  24.592 1.00 22.00 ? 803  PHE A CB    1 
ATOM   6623 C  CG    . PHE A 1 803 ? 22.853  -10.950 24.301 1.00 22.16 ? 803  PHE A CG    1 
ATOM   6624 C  CD1   . PHE A 1 803 ? 24.216  -10.865 24.035 1.00 22.60 ? 803  PHE A CD1   1 
ATOM   6625 C  CD2   . PHE A 1 803 ? 22.255  -12.208 24.347 1.00 21.71 ? 803  PHE A CD2   1 
ATOM   6626 C  CE1   . PHE A 1 803 ? 24.968  -12.014 23.791 1.00 24.84 ? 803  PHE A CE1   1 
ATOM   6627 C  CE2   . PHE A 1 803 ? 22.998  -13.365 24.099 1.00 23.44 ? 803  PHE A CE2   1 
ATOM   6628 C  CZ    . PHE A 1 803 ? 24.360  -13.263 23.827 1.00 23.18 ? 803  PHE A CZ    1 
ATOM   6629 N  N     . HIS A 1 804 ? 19.332  -9.932  23.117 1.00 20.73 ? 804  HIS A N     1 
ATOM   6630 C  CA    . HIS A 1 804 ? 18.312  -10.751 22.458 1.00 20.26 ? 804  HIS A CA    1 
ATOM   6631 C  C     . HIS A 1 804 ? 17.899  -10.176 21.102 1.00 21.85 ? 804  HIS A C     1 
ATOM   6632 O  O     . HIS A 1 804 ? 17.597  -10.930 20.177 1.00 21.10 ? 804  HIS A O     1 
ATOM   6633 C  CB    . HIS A 1 804 ? 17.099  -10.993 23.365 1.00 21.01 ? 804  HIS A CB    1 
ATOM   6634 C  CG    . HIS A 1 804 ? 16.404  -9.744  23.801 1.00 21.96 ? 804  HIS A CG    1 
ATOM   6635 N  ND1   . HIS A 1 804 ? 16.964  -8.847  24.684 1.00 23.25 ? 804  HIS A ND1   1 
ATOM   6636 C  CD2   . HIS A 1 804 ? 15.183  -9.252  23.488 1.00 23.54 ? 804  HIS A CD2   1 
ATOM   6637 C  CE1   . HIS A 1 804 ? 16.124  -7.848  24.884 1.00 26.27 ? 804  HIS A CE1   1 
ATOM   6638 N  NE2   . HIS A 1 804 ? 15.034  -8.072  24.172 1.00 21.67 ? 804  HIS A NE2   1 
ATOM   6639 N  N     . ILE A 1 805 ? 17.909  -8.847  20.986 1.00 22.24 ? 805  ILE A N     1 
ATOM   6640 C  CA    . ILE A 1 805 ? 17.600  -8.182  19.713 1.00 22.87 ? 805  ILE A CA    1 
ATOM   6641 C  C     . ILE A 1 805 ? 18.698  -8.440  18.682 1.00 24.01 ? 805  ILE A C     1 
ATOM   6642 O  O     . ILE A 1 805 ? 18.406  -8.682  17.506 1.00 25.13 ? 805  ILE A O     1 
ATOM   6643 C  CB    . ILE A 1 805 ? 17.341  -6.658  19.895 1.00 23.54 ? 805  ILE A CB    1 
ATOM   6644 C  CG1   . ILE A 1 805 ? 16.215  -6.416  20.921 1.00 21.89 ? 805  ILE A CG1   1 
ATOM   6645 C  CG2   . ILE A 1 805 ? 17.049  -5.978  18.541 1.00 25.63 ? 805  ILE A CG2   1 
ATOM   6646 C  CD1   . ILE A 1 805 ? 14.853  -7.017  20.555 1.00 22.10 ? 805  ILE A CD1   1 
ATOM   6647 N  N     . ARG A 1 806 ? 19.954  -8.397  19.128 1.00 23.59 ? 806  ARG A N     1 
ATOM   6648 C  CA    . ARG A 1 806 ? 21.093  -8.769  18.280 1.00 23.63 ? 806  ARG A CA    1 
ATOM   6649 C  C     . ARG A 1 806 ? 20.911  -10.185 17.729 1.00 22.91 ? 806  ARG A C     1 
ATOM   6650 O  O     . ARG A 1 806 ? 21.144  -10.436 16.539 1.00 22.01 ? 806  ARG A O     1 
ATOM   6651 C  CB    . ARG A 1 806 ? 22.404  -8.665  19.064 1.00 23.28 ? 806  ARG A CB    1 
ATOM   6652 C  CG    . ARG A 1 806 ? 23.655  -9.066  18.285 1.00 25.20 ? 806  ARG A CG    1 
ATOM   6653 C  CD    . ARG A 1 806 ? 24.898  -9.081  19.185 1.00 27.76 ? 806  ARG A CD    1 
ATOM   6654 N  NE    . ARG A 1 806 ? 25.279  -7.740  19.629 1.00 27.22 ? 806  ARG A NE    1 
ATOM   6655 C  CZ    . ARG A 1 806 ? 26.052  -6.899  18.944 1.00 30.98 ? 806  ARG A CZ    1 
ATOM   6656 N  NH1   . ARG A 1 806 ? 26.550  -7.239  17.759 1.00 32.07 ? 806  ARG A NH1   1 
ATOM   6657 N  NH2   . ARG A 1 806 ? 26.326  -5.703  19.444 1.00 30.12 ? 806  ARG A NH2   1 
ATOM   6658 N  N     . GLY A 1 807 ? 20.484  -11.101 18.598 1.00 20.70 ? 807  GLY A N     1 
ATOM   6659 C  CA    . GLY A 1 807 ? 20.185  -12.477 18.196 1.00 20.16 ? 807  GLY A CA    1 
ATOM   6660 C  C     . GLY A 1 807 ? 19.129  -12.560 17.106 1.00 22.18 ? 807  GLY A C     1 
ATOM   6661 O  O     . GLY A 1 807 ? 19.239  -13.373 16.180 1.00 23.05 ? 807  GLY A O     1 
ATOM   6662 N  N     . ILE A 1 808 ? 18.106  -11.715 17.209 1.00 20.78 ? 808  ILE A N     1 
ATOM   6663 C  CA    . ILE A 1 808 ? 17.045  -11.671 16.200 1.00 23.70 ? 808  ILE A CA    1 
ATOM   6664 C  C     . ILE A 1 808 ? 17.583  -11.154 14.865 1.00 25.11 ? 808  ILE A C     1 
ATOM   6665 O  O     . ILE A 1 808 ? 17.260  -11.695 13.801 1.00 26.36 ? 808  ILE A O     1 
ATOM   6666 C  CB    . ILE A 1 808 ? 15.844  -10.816 16.666 1.00 22.97 ? 808  ILE A CB    1 
ATOM   6667 C  CG1   . ILE A 1 808 ? 15.123  -11.515 17.821 1.00 20.96 ? 808  ILE A CG1   1 
ATOM   6668 C  CG2   . ILE A 1 808 ? 14.866  -10.556 15.505 1.00 24.43 ? 808  ILE A CG2   1 
ATOM   6669 C  CD1   . ILE A 1 808 ? 14.232  -10.604 18.625 1.00 22.20 ? 808  ILE A CD1   1 
ATOM   6670 N  N     . LEU A 1 809 ? 18.407  -10.114 14.928 1.00 26.41 ? 809  LEU A N     1 
ATOM   6671 C  CA    . LEU A 1 809 ? 19.010  -9.558  13.723 1.00 27.88 ? 809  LEU A CA    1 
ATOM   6672 C  C     . LEU A 1 809 ? 19.891  -10.596 13.032 1.00 28.25 ? 809  LEU A C     1 
ATOM   6673 O  O     . LEU A 1 809 ? 19.873  -10.711 11.808 1.00 27.44 ? 809  LEU A O     1 
ATOM   6674 C  CB    . LEU A 1 809 ? 19.786  -8.277  14.040 1.00 29.34 ? 809  LEU A CB    1 
ATOM   6675 C  CG    . LEU A 1 809 ? 18.918  -7.102  14.506 1.00 30.80 ? 809  LEU A CG    1 
ATOM   6676 C  CD1   . LEU A 1 809 ? 19.780  -5.905  14.852 1.00 33.42 ? 809  LEU A CD1   1 
ATOM   6677 C  CD2   . LEU A 1 809 ? 17.871  -6.728  13.460 1.00 33.20 ? 809  LEU A CD2   1 
ATOM   6678 N  N     . THR A 1 810 ? 20.628  -11.371 13.826 1.00 26.53 ? 810  THR A N     1 
ATOM   6679 C  CA    . THR A 1 810 ? 21.441  -12.470 13.298 1.00 27.35 ? 810  THR A CA    1 
ATOM   6680 C  C     . THR A 1 810 ? 20.569  -13.498 12.570 1.00 25.80 ? 810  THR A C     1 
ATOM   6681 O  O     . THR A 1 810 ? 20.867  -13.896 11.434 1.00 28.62 ? 810  THR A O     1 
ATOM   6682 C  CB    . THR A 1 810 ? 22.243  -13.157 14.426 1.00 25.83 ? 810  THR A CB    1 
ATOM   6683 O  OG1   . THR A 1 810 ? 22.991  -12.172 15.149 1.00 28.21 ? 810  THR A OG1   1 
ATOM   6684 C  CG2   . THR A 1 810 ? 23.199  -14.189 13.861 1.00 27.95 ? 810  THR A CG2   1 
ATOM   6685 N  N     . TYR A 1 811 ? 19.490  -13.911 13.230 1.00 24.50 ? 811  TYR A N     1 
ATOM   6686 C  CA    . TYR A 1 811 ? 18.501  -14.814 12.653 1.00 24.78 ? 811  TYR A CA    1 
ATOM   6687 C  C     . TYR A 1 811 ? 17.968  -14.263 11.333 1.00 26.73 ? 811  TYR A C     1 
ATOM   6688 O  O     . TYR A 1 811 ? 17.953  -14.972 10.322 1.00 26.86 ? 811  TYR A O     1 
ATOM   6689 C  CB    . TYR A 1 811 ? 17.352  -15.040 13.649 1.00 24.10 ? 811  TYR A CB    1 
ATOM   6690 C  CG    . TYR A 1 811 ? 16.220  -15.902 13.124 1.00 24.90 ? 811  TYR A CG    1 
ATOM   6691 C  CD1   . TYR A 1 811 ? 16.349  -17.291 13.055 1.00 24.79 ? 811  TYR A CD1   1 
ATOM   6692 C  CD2   . TYR A 1 811 ? 15.017  -15.328 12.704 1.00 25.45 ? 811  TYR A CD2   1 
ATOM   6693 C  CE1   . TYR A 1 811 ? 15.313  -18.092 12.568 1.00 25.24 ? 811  TYR A CE1   1 
ATOM   6694 C  CE2   . TYR A 1 811 ? 13.964  -16.125 12.222 1.00 26.49 ? 811  TYR A CE2   1 
ATOM   6695 C  CZ    . TYR A 1 811 ? 14.125  -17.502 12.153 1.00 27.64 ? 811  TYR A CZ    1 
ATOM   6696 O  OH    . TYR A 1 811 ? 13.102  -18.296 11.673 1.00 28.77 ? 811  TYR A OH    1 
ATOM   6697 N  N     . ASN A 1 812 ? 17.558  -12.994 11.344 1.00 28.16 ? 812  ASN A N     1 
ATOM   6698 C  CA    . ASN A 1 812 ? 17.002  -12.345 10.152 1.00 30.76 ? 812  ASN A CA    1 
ATOM   6699 C  C     . ASN A 1 812 ? 17.924  -12.357 8.925  1.00 31.77 ? 812  ASN A C     1 
ATOM   6700 O  O     . ASN A 1 812 ? 17.449  -12.552 7.805  1.00 33.65 ? 812  ASN A O     1 
ATOM   6701 C  CB    . ASN A 1 812 ? 16.515  -10.926 10.475 1.00 31.90 ? 812  ASN A CB    1 
ATOM   6702 C  CG    . ASN A 1 812 ? 15.257  -10.918 11.339 1.00 32.58 ? 812  ASN A CG    1 
ATOM   6703 O  OD1   . ASN A 1 812 ? 14.652  -11.960 11.596 1.00 32.01 ? 812  ASN A OD1   1 
ATOM   6704 N  ND2   . ASN A 1 812 ? 14.861  -9.735  11.789 1.00 33.60 ? 812  ASN A ND2   1 
ATOM   6705 N  N     . ARG A 1 813 ? 19.227  -12.155 9.138  1.00 32.49 ? 813  ARG A N     1 
ATOM   6706 C  CA    . ARG A 1 813 ? 20.219  -12.230 8.056  1.00 34.21 ? 813  ARG A CA    1 
ATOM   6707 C  C     . ARG A 1 813 ? 20.362  -13.658 7.530  1.00 35.29 ? 813  ARG A C     1 
ATOM   6708 O  O     . ARG A 1 813 ? 20.506  -13.873 6.323  1.00 36.83 ? 813  ARG A O     1 
ATOM   6709 C  CB    . ARG A 1 813 ? 21.591  -11.722 8.521  1.00 33.82 ? 813  ARG A CB    1 
ATOM   6710 C  CG    . ARG A 1 813 ? 21.629  -10.251 8.902  1.00 33.91 ? 813  ARG A CG    1 
ATOM   6711 C  CD    . ARG A 1 813 ? 23.058  -9.715  8.985  1.00 35.51 ? 813  ARG A CD    1 
ATOM   6712 N  NE    . ARG A 1 813 ? 23.896  -10.447 9.936  1.00 34.56 ? 813  ARG A NE    1 
ATOM   6713 C  CZ    . ARG A 1 813 ? 23.929  -10.221 11.247 1.00 34.65 ? 813  ARG A CZ    1 
ATOM   6714 N  NH1   . ARG A 1 813 ? 23.165  -9.280  11.790 1.00 34.02 ? 813  ARG A NH1   1 
ATOM   6715 N  NH2   . ARG A 1 813 ? 24.733  -10.940 12.019 1.00 36.56 ? 813  ARG A NH2   1 
ATOM   6716 N  N     . ALA A 1 814 ? 20.317  -14.623 8.450  1.00 34.58 ? 814  ALA A N     1 
ATOM   6717 C  CA    . ALA A 1 814 ? 20.506  -16.039 8.129  1.00 34.99 ? 814  ALA A CA    1 
ATOM   6718 C  C     . ALA A 1 814 ? 19.348  -16.636 7.328  1.00 36.18 ? 814  ALA A C     1 
ATOM   6719 O  O     . ALA A 1 814 ? 19.548  -17.581 6.560  1.00 37.80 ? 814  ALA A O     1 
ATOM   6720 C  CB    . ALA A 1 814 ? 20.751  -16.847 9.408  1.00 33.91 ? 814  ALA A CB    1 
ATOM   6721 N  N     . ILE A 1 815 ? 18.149  -16.080 7.502  1.00 35.78 ? 815  ILE A N     1 
ATOM   6722 C  CA    . ILE A 1 815 ? 16.962  -16.554 6.780  1.00 37.26 ? 815  ILE A CA    1 
ATOM   6723 C  C     . ILE A 1 815 ? 16.525  -15.623 5.643  1.00 40.90 ? 815  ILE A C     1 
ATOM   6724 O  O     . ILE A 1 815 ? 15.527  -15.892 4.977  1.00 39.99 ? 815  ILE A O     1 
ATOM   6725 C  CB    . ILE A 1 815 ? 15.744  -16.808 7.719  1.00 35.50 ? 815  ILE A CB    1 
ATOM   6726 C  CG1   . ILE A 1 815 ? 15.221  -15.492 8.317  1.00 36.41 ? 815  ILE A CG1   1 
ATOM   6727 C  CG2   . ILE A 1 815 ? 16.091  -17.844 8.797  1.00 35.36 ? 815  ILE A CG2   1 
ATOM   6728 C  CD1   . ILE A 1 815 ? 13.754  -15.525 8.732  1.00 35.71 ? 815  ILE A CD1   1 
ATOM   6729 N  N     . LYS A 1 816 ? 17.272  -14.537 5.434  1.00 43.72 ? 816  LYS A N     1 
ATOM   6730 C  CA    . LYS A 1 816 ? 16.933  -13.526 4.426  1.00 47.89 ? 816  LYS A CA    1 
ATOM   6731 C  C     . LYS A 1 816 ? 16.611  -14.148 3.067  1.00 50.25 ? 816  LYS A C     1 
ATOM   6732 O  O     . LYS A 1 816 ? 17.318  -15.045 2.601  1.00 50.87 ? 816  LYS A O     1 
ATOM   6733 C  CB    . LYS A 1 816 ? 18.067  -12.503 4.289  1.00 48.92 ? 816  LYS A CB    1 
ATOM   6734 C  CG    . LYS A 1 816 ? 17.703  -11.253 3.480  1.00 53.03 ? 816  LYS A CG    1 
ATOM   6735 C  CD    . LYS A 1 816 ? 18.814  -10.198 3.514  1.00 55.47 ? 816  LYS A CD    1 
ATOM   6736 C  CE    . LYS A 1 816 ? 19.971  -10.533 2.578  1.00 57.05 ? 816  LYS A CE    1 
ATOM   6737 N  NZ    . LYS A 1 816 ? 19.628  -10.333 1.143  1.00 59.80 ? 816  LYS A NZ    1 
ATOM   6738 N  N     . GLY A 1 817 ? 15.528  -13.675 2.454  1.00 52.29 ? 817  GLY A N     1 
ATOM   6739 C  CA    . GLY A 1 817 ? 15.117  -14.145 1.133  1.00 56.05 ? 817  GLY A CA    1 
ATOM   6740 C  C     . GLY A 1 817 ? 14.093  -15.263 1.163  1.00 57.18 ? 817  GLY A C     1 
ATOM   6741 O  O     . GLY A 1 817 ? 13.279  -15.385 0.242  1.00 59.12 ? 817  GLY A O     1 
ATOM   6742 N  N     . ASN A 1 818 ? 14.140  -16.080 2.217  1.00 56.92 ? 818  ASN A N     1 
ATOM   6743 C  CA    A ASN A 1 818 ? 13.211  -17.197 2.379  0.50 57.10 ? 818  ASN A CA    1 
ATOM   6744 C  CA    B ASN A 1 818 ? 13.213  -17.197 2.379  0.50 57.07 ? 818  ASN A CA    1 
ATOM   6745 C  C     . ASN A 1 818 ? 11.847  -16.734 2.888  1.00 56.81 ? 818  ASN A C     1 
ATOM   6746 O  O     . ASN A 1 818 ? 11.722  -16.254 4.018  1.00 55.96 ? 818  ASN A O     1 
ATOM   6747 C  CB    A ASN A 1 818 ? 13.805  -18.269 3.299  0.50 56.02 ? 818  ASN A CB    1 
ATOM   6748 C  CB    B ASN A 1 818 ? 13.805  -18.258 3.311  0.50 55.92 ? 818  ASN A CB    1 
ATOM   6749 C  CG    A ASN A 1 818 ? 15.049  -18.912 2.716  0.50 56.12 ? 818  ASN A CG    1 
ATOM   6750 C  CG    B ASN A 1 818 ? 13.208  -19.629 3.083  0.50 55.81 ? 818  ASN A CG    1 
ATOM   6751 O  OD1   A ASN A 1 818 ? 15.122  -19.170 1.515  0.50 57.70 ? 818  ASN A OD1   1 
ATOM   6752 O  OD1   B ASN A 1 818 ? 13.181  -20.127 1.959  0.50 57.23 ? 818  ASN A OD1   1 
ATOM   6753 N  ND2   A ASN A 1 818 ? 16.034  -19.175 3.565  0.50 55.26 ? 818  ASN A ND2   1 
ATOM   6754 N  ND2   B ASN A 1 818 ? 12.729  -20.249 4.151  0.50 54.55 ? 818  ASN A ND2   1 
ATOM   6755 N  N     . ILE A 1 819 ? 10.833  -16.882 2.039  1.00 58.06 ? 819  ILE A N     1 
ATOM   6756 C  CA    . ILE A 1 819 ? 9.474   -16.409 2.322  1.00 58.35 ? 819  ILE A CA    1 
ATOM   6757 C  C     . ILE A 1 819 ? 8.747   -17.301 3.334  1.00 57.17 ? 819  ILE A C     1 
ATOM   6758 O  O     . ILE A 1 819 ? 7.880   -16.831 4.078  1.00 56.38 ? 819  ILE A O     1 
ATOM   6759 C  CB    . ILE A 1 819 ? 8.618   -16.293 1.014  1.00 60.00 ? 819  ILE A CB    1 
ATOM   6760 C  CG1   . ILE A 1 819 ? 9.487   -15.961 -0.220 1.00 62.37 ? 819  ILE A CG1   1 
ATOM   6761 C  CG2   . ILE A 1 819 ? 7.464   -15.299 1.195  1.00 60.67 ? 819  ILE A CG2   1 
ATOM   6762 C  CD1   . ILE A 1 819 ? 10.043  -14.525 -0.291 1.00 62.03 ? 819  ILE A CD1   1 
ATOM   6763 N  N     . ASP A 1 820 ? 9.115   -18.581 3.360  1.00 57.13 ? 820  ASP A N     1 
ATOM   6764 C  CA    . ASP A 1 820 ? 8.461   -19.578 4.214  1.00 56.32 ? 820  ASP A CA    1 
ATOM   6765 C  C     . ASP A 1 820 ? 9.028   -19.669 5.638  1.00 52.89 ? 820  ASP A C     1 
ATOM   6766 O  O     . ASP A 1 820 ? 8.377   -20.223 6.526  1.00 52.54 ? 820  ASP A O     1 
ATOM   6767 C  CB    . ASP A 1 820 ? 8.507   -20.959 3.550  1.00 59.10 ? 820  ASP A CB    1 
ATOM   6768 C  CG    . ASP A 1 820 ? 9.924   -21.405 3.230  1.00 62.74 ? 820  ASP A CG    1 
ATOM   6769 O  OD1   . ASP A 1 820 ? 10.563  -22.038 4.101  1.00 62.18 ? 820  ASP A OD1   1 
ATOM   6770 O  OD2   . ASP A 1 820 ? 10.404  -21.104 2.114  1.00 66.14 ? 820  ASP A OD2   1 
ATOM   6771 N  N     . ALA A 1 821 ? 10.236  -19.140 5.844  1.00 49.48 ? 821  ALA A N     1 
ATOM   6772 C  CA    . ALA A 1 821 ? 10.900  -19.179 7.151  1.00 45.86 ? 821  ALA A CA    1 
ATOM   6773 C  C     . ALA A 1 821 ? 10.065  -18.479 8.222  1.00 42.97 ? 821  ALA A C     1 
ATOM   6774 O  O     . ALA A 1 821 ? 9.519   -17.404 7.963  1.00 42.73 ? 821  ALA A O     1 
ATOM   6775 C  CB    . ALA A 1 821 ? 12.287  -18.553 7.064  1.00 46.10 ? 821  ALA A CB    1 
ATOM   6776 N  N     . PRO A 1 822 ? 9.947   -19.092 9.422  1.00 40.10 ? 822  PRO A N     1 
ATOM   6777 C  CA    . PRO A 1 822 ? 9.201   -18.465 10.517 1.00 38.01 ? 822  PRO A CA    1 
ATOM   6778 C  C     . PRO A 1 822 ? 9.800   -17.110 10.878 1.00 36.84 ? 822  PRO A C     1 
ATOM   6779 O  O     . PRO A 1 822 ? 11.014  -16.997 11.045 1.00 34.92 ? 822  PRO A O     1 
ATOM   6780 C  CB    . PRO A 1 822 ? 9.384   -19.444 11.680 1.00 36.59 ? 822  PRO A CB    1 
ATOM   6781 C  CG    . PRO A 1 822 ? 9.686   -20.741 11.044 1.00 38.37 ? 822  PRO A CG    1 
ATOM   6782 C  CD    . PRO A 1 822 ? 10.461  -20.420 9.804  1.00 39.83 ? 822  PRO A CD    1 
ATOM   6783 N  N     . GLN A 1 823 ? 8.954   -16.091 10.972 1.00 36.42 ? 823  GLN A N     1 
ATOM   6784 C  CA    . GLN A 1 823 ? 9.418   -14.749 11.306 1.00 34.97 ? 823  GLN A CA    1 
ATOM   6785 C  C     . GLN A 1 823 ? 9.261   -14.484 12.794 1.00 33.07 ? 823  GLN A C     1 
ATOM   6786 O  O     . GLN A 1 823 ? 8.285   -14.917 13.418 1.00 31.01 ? 823  GLN A O     1 
ATOM   6787 C  CB    . GLN A 1 823 ? 8.657   -13.684 10.507 1.00 36.22 ? 823  GLN A CB    1 
ATOM   6788 C  CG    . GLN A 1 823 ? 8.769   -13.807 8.988  1.00 38.43 ? 823  GLN A CG    1 
ATOM   6789 C  CD    . GLN A 1 823 ? 10.162  -13.489 8.454  1.00 39.28 ? 823  GLN A CD    1 
ATOM   6790 O  OE1   . GLN A 1 823 ? 10.665  -14.178 7.567  1.00 41.86 ? 823  GLN A OE1   1 
ATOM   6791 N  NE2   . GLN A 1 823 ? 10.786  -12.447 8.990  1.00 40.46 ? 823  GLN A NE2   1 
ATOM   6792 N  N     . VAL A 1 824 ? 10.240  -13.783 13.355 1.00 30.74 ? 824  VAL A N     1 
ATOM   6793 C  CA    . VAL A 1 824 ? 10.140  -13.246 14.701 1.00 29.15 ? 824  VAL A CA    1 
ATOM   6794 C  C     . VAL A 1 824 ? 9.089   -12.142 14.679 1.00 30.94 ? 824  VAL A C     1 
ATOM   6795 O  O     . VAL A 1 824 ? 9.150   -11.228 13.849 1.00 30.76 ? 824  VAL A O     1 
ATOM   6796 C  CB    . VAL A 1 824 ? 11.492  -12.669 15.186 1.00 27.67 ? 824  VAL A CB    1 
ATOM   6797 C  CG1   . VAL A 1 824 ? 11.335  -11.964 16.535 1.00 27.15 ? 824  VAL A CG1   1 
ATOM   6798 C  CG2   . VAL A 1 824 ? 12.546  -13.766 15.267 1.00 26.59 ? 824  VAL A CG2   1 
ATOM   6799 N  N     . VAL A 1 825 ? 8.122   -12.246 15.583 1.00 31.40 ? 825  VAL A N     1 
ATOM   6800 C  CA    . VAL A 1 825 ? 7.051   -11.263 15.693 1.00 33.06 ? 825  VAL A CA    1 
ATOM   6801 C  C     . VAL A 1 825 ? 7.358   -10.258 16.805 1.00 31.87 ? 825  VAL A C     1 
ATOM   6802 O  O     . VAL A 1 825 ? 7.560   -10.637 17.959 1.00 29.91 ? 825  VAL A O     1 
ATOM   6803 C  CB    . VAL A 1 825 ? 5.684   -11.950 15.947 1.00 33.67 ? 825  VAL A CB    1 
ATOM   6804 C  CG1   . VAL A 1 825 ? 4.555   -10.916 16.045 1.00 36.44 ? 825  VAL A CG1   1 
ATOM   6805 C  CG2   . VAL A 1 825 ? 5.383   -12.966 14.844 1.00 35.84 ? 825  VAL A CG2   1 
ATOM   6806 N  N     . GLU A 1 826 ? 7.402   -8.980  16.433 1.00 32.18 ? 826  GLU A N     1 
ATOM   6807 C  CA    . GLU A 1 826 ? 7.576   -7.878  17.380 1.00 32.12 ? 826  GLU A CA    1 
ATOM   6808 C  C     . GLU A 1 826 ? 6.654   -8.030  18.590 1.00 30.02 ? 826  GLU A C     1 
ATOM   6809 O  O     . GLU A 1 826 ? 5.442   -8.207  18.440 1.00 29.82 ? 826  GLU A O     1 
ATOM   6810 C  CB    . GLU A 1 826 ? 7.317   -6.540  16.674 1.00 33.78 ? 826  GLU A CB    1 
ATOM   6811 C  CG    . GLU A 1 826 ? 7.070   -5.344  17.602 1.00 36.57 ? 826  GLU A CG    1 
ATOM   6812 C  CD    . GLU A 1 826 ? 8.348   -4.738  18.167 1.00 38.47 ? 826  GLU A CD    1 
ATOM   6813 O  OE1   . GLU A 1 826 ? 8.252   -3.977  19.153 1.00 40.57 ? 826  GLU A OE1   1 
ATOM   6814 O  OE2   . GLU A 1 826 ? 9.442   -5.006  17.627 1.00 38.90 ? 826  GLU A OE2   1 
ATOM   6815 N  N     . GLY A 1 827 ? 7.244   -7.980  19.782 1.00 29.05 ? 827  GLY A N     1 
ATOM   6816 C  CA    . GLY A 1 827 ? 6.487   -8.029  21.026 1.00 29.15 ? 827  GLY A CA    1 
ATOM   6817 C  C     . GLY A 1 827 ? 6.302   -9.421  21.593 1.00 29.21 ? 827  GLY A C     1 
ATOM   6818 O  O     . GLY A 1 827 ? 5.862   -9.573  22.733 1.00 28.34 ? 827  GLY A O     1 
ATOM   6819 N  N     . GLU A 1 828 ? 6.624   -10.439 20.795 1.00 28.45 ? 828  GLU A N     1 
ATOM   6820 C  CA    . GLU A 1 828 ? 6.530   -11.822 21.254 1.00 28.30 ? 828  GLU A CA    1 
ATOM   6821 C  C     . GLU A 1 828 ? 7.871   -12.319 21.801 1.00 25.92 ? 828  GLU A C     1 
ATOM   6822 O  O     . GLU A 1 828 ? 8.824   -11.549 21.893 1.00 25.34 ? 828  GLU A O     1 
ATOM   6823 C  CB    . GLU A 1 828 ? 5.942   -12.729 20.167 1.00 31.69 ? 828  GLU A CB    1 
ATOM   6824 C  CG    . GLU A 1 828 ? 4.415   -12.569 20.056 1.00 38.74 ? 828  GLU A CG    1 
ATOM   6825 C  CD    . GLU A 1 828 ? 3.768   -13.429 18.982 1.00 44.97 ? 828  GLU A CD    1 
ATOM   6826 O  OE1   . GLU A 1 828 ? 2.865   -12.915 18.288 1.00 48.13 ? 828  GLU A OE1   1 
ATOM   6827 O  OE2   . GLU A 1 828 ? 4.142   -14.615 18.839 1.00 48.30 ? 828  GLU A OE2   1 
ATOM   6828 N  N     . LYS A 1 829 ? 7.932   -13.587 22.194 1.00 24.73 ? 829  LYS A N     1 
ATOM   6829 C  CA    . LYS A 1 829 ? 9.129   -14.109 22.855 1.00 22.42 ? 829  LYS A CA    1 
ATOM   6830 C  C     . LYS A 1 829 ? 10.022  -14.909 21.923 1.00 21.02 ? 829  LYS A C     1 
ATOM   6831 O  O     . LYS A 1 829 ? 9.543   -15.552 20.991 1.00 20.52 ? 829  LYS A O     1 
ATOM   6832 C  CB    . LYS A 1 829 ? 8.751   -14.929 24.086 1.00 23.11 ? 829  LYS A CB    1 
ATOM   6833 C  CG    . LYS A 1 829 ? 8.140   -14.061 25.175 1.00 24.76 ? 829  LYS A CG    1 
ATOM   6834 C  CD    . LYS A 1 829 ? 8.003   -14.787 26.477 1.00 23.87 ? 829  LYS A CD    1 
ATOM   6835 C  CE    . LYS A 1 829 ? 7.231   -13.933 27.462 1.00 25.49 ? 829  LYS A CE    1 
ATOM   6836 N  NZ    . LYS A 1 829 ? 7.221   -14.567 28.799 1.00 27.30 ? 829  LYS A NZ    1 
ATOM   6837 N  N     . VAL A 1 830 ? 11.323  -14.848 22.186 1.00 18.97 ? 830  VAL A N     1 
ATOM   6838 C  CA    . VAL A 1 830 ? 12.301  -15.618 21.428 1.00 18.43 ? 830  VAL A CA    1 
ATOM   6839 C  C     . VAL A 1 830 ? 13.145  -16.486 22.347 1.00 18.51 ? 830  VAL A C     1 
ATOM   6840 O  O     . VAL A 1 830 ? 13.373  -16.132 23.506 1.00 19.11 ? 830  VAL A O     1 
ATOM   6841 C  CB    . VAL A 1 830 ? 13.252  -14.718 20.587 1.00 17.83 ? 830  VAL A CB    1 
ATOM   6842 C  CG1   . VAL A 1 830 ? 12.506  -14.066 19.429 1.00 21.42 ? 830  VAL A CG1   1 
ATOM   6843 C  CG2   . VAL A 1 830 ? 13.961  -13.664 21.455 1.00 18.34 ? 830  VAL A CG2   1 
ATOM   6844 N  N     . TYR A 1 831 ? 13.598  -17.625 21.824 1.00 18.10 ? 831  TYR A N     1 
ATOM   6845 C  CA    . TYR A 1 831 ? 14.708  -18.361 22.422 1.00 18.01 ? 831  TYR A CA    1 
ATOM   6846 C  C     . TYR A 1 831 ? 15.986  -17.691 21.959 1.00 18.66 ? 831  TYR A C     1 
ATOM   6847 O  O     . TYR A 1 831 ? 16.034  -17.164 20.850 1.00 19.10 ? 831  TYR A O     1 
ATOM   6848 C  CB    . TYR A 1 831 ? 14.742  -19.816 21.955 1.00 17.35 ? 831  TYR A CB    1 
ATOM   6849 C  CG    . TYR A 1 831 ? 13.663  -20.716 22.506 1.00 17.42 ? 831  TYR A CG    1 
ATOM   6850 C  CD1   . TYR A 1 831 ? 13.412  -20.787 23.877 1.00 19.16 ? 831  TYR A CD1   1 
ATOM   6851 C  CD2   . TYR A 1 831 ? 12.929  -21.543 21.655 1.00 21.88 ? 831  TYR A CD2   1 
ATOM   6852 C  CE1   . TYR A 1 831 ? 12.426  -21.624 24.383 1.00 21.56 ? 831  TYR A CE1   1 
ATOM   6853 C  CE2   . TYR A 1 831 ? 11.950  -22.392 22.149 1.00 22.32 ? 831  TYR A CE2   1 
ATOM   6854 C  CZ    . TYR A 1 831 ? 11.703  -22.428 23.513 1.00 23.49 ? 831  TYR A CZ    1 
ATOM   6855 O  OH    . TYR A 1 831 ? 10.728  -23.268 24.005 1.00 22.69 ? 831  TYR A OH    1 
ATOM   6856 N  N     . VAL A 1 832 ? 17.015  -17.733 22.802 1.00 17.97 ? 832  VAL A N     1 
ATOM   6857 C  CA    . VAL A 1 832 ? 18.301  -17.093 22.536 1.00 19.19 ? 832  VAL A CA    1 
ATOM   6858 C  C     . VAL A 1 832 ? 19.441  -18.054 22.887 1.00 20.78 ? 832  VAL A C     1 
ATOM   6859 O  O     . VAL A 1 832 ? 19.450  -18.651 23.968 1.00 20.90 ? 832  VAL A O     1 
ATOM   6860 C  CB    . VAL A 1 832 ? 18.469  -15.772 23.353 1.00 20.56 ? 832  VAL A CB    1 
ATOM   6861 C  CG1   . VAL A 1 832 ? 19.770  -15.057 22.973 1.00 19.44 ? 832  VAL A CG1   1 
ATOM   6862 C  CG2   . VAL A 1 832 ? 17.282  -14.836 23.139 1.00 21.78 ? 832  VAL A CG2   1 
ATOM   6863 N  N     . LEU A 1 833 ? 20.389  -18.206 21.963 1.00 19.78 ? 833  LEU A N     1 
ATOM   6864 C  CA    . LEU A 1 833 ? 21.592  -19.003 22.197 1.00 19.38 ? 833  LEU A CA    1 
ATOM   6865 C  C     . LEU A 1 833 ? 22.848  -18.205 21.845 1.00 19.92 ? 833  LEU A C     1 
ATOM   6866 O  O     . LEU A 1 833 ? 22.869  -17.508 20.833 1.00 21.15 ? 833  LEU A O     1 
ATOM   6867 C  CB    . LEU A 1 833 ? 21.566  -20.306 21.379 1.00 19.66 ? 833  LEU A CB    1 
ATOM   6868 C  CG    . LEU A 1 833 ? 20.683  -21.460 21.876 1.00 21.33 ? 833  LEU A CG    1 
ATOM   6869 C  CD1   . LEU A 1 833 ? 20.700  -22.611 20.876 1.00 21.45 ? 833  LEU A CD1   1 
ATOM   6870 C  CD2   . LEU A 1 833 ? 21.125  -21.953 23.255 1.00 20.83 ? 833  LEU A CD2   1 
ATOM   6871 N  N     . PRO A 1 834 ? 23.899  -18.310 22.679 1.00 20.41 ? 834  PRO A N     1 
ATOM   6872 C  CA    . PRO A 1 834 ? 25.181  -17.713 22.317 1.00 20.92 ? 834  PRO A CA    1 
ATOM   6873 C  C     . PRO A 1 834 ? 25.883  -18.547 21.248 1.00 24.45 ? 834  PRO A C     1 
ATOM   6874 O  O     . PRO A 1 834 ? 25.690  -19.768 21.179 1.00 25.33 ? 834  PRO A O     1 
ATOM   6875 C  CB    . PRO A 1 834 ? 25.971  -17.737 23.630 1.00 21.29 ? 834  PRO A CB    1 
ATOM   6876 C  CG    . PRO A 1 834 ? 25.400  -18.885 24.404 1.00 21.36 ? 834  PRO A CG    1 
ATOM   6877 C  CD    . PRO A 1 834 ? 23.967  -19.068 23.945 1.00 20.80 ? 834  PRO A CD    1 
ATOM   6878 N  N     . LEU A 1 835 ? 26.679  -17.878 20.421 1.00 23.38 ? 835  LEU A N     1 
ATOM   6879 C  CA    . LEU A 1 835 ? 27.411  -18.525 19.332 1.00 26.40 ? 835  LEU A CA    1 
ATOM   6880 C  C     . LEU A 1 835 ? 28.906  -18.374 19.571 1.00 25.54 ? 835  LEU A C     1 
ATOM   6881 O  O     . LEU A 1 835 ? 29.350  -17.340 20.067 1.00 25.50 ? 835  LEU A O     1 
ATOM   6882 C  CB    . LEU A 1 835 ? 27.016  -17.891 17.997 1.00 26.02 ? 835  LEU A CB    1 
ATOM   6883 C  CG    . LEU A 1 835 ? 25.931  -18.507 17.097 1.00 31.96 ? 835  LEU A CG    1 
ATOM   6884 C  CD1   . LEU A 1 835 ? 24.990  -19.469 17.806 1.00 31.19 ? 835  LEU A CD1   1 
ATOM   6885 C  CD2   . LEU A 1 835 ? 25.158  -17.420 16.349 1.00 28.71 ? 835  LEU A CD2   1 
ATOM   6886 N  N     . ARG A 1 836 ? 29.678  -19.402 19.223 1.00 27.27 ? 836  ARG A N     1 
ATOM   6887 C  CA    . ARG A 1 836 ? 31.133  -19.363 19.409 1.00 29.47 ? 836  ARG A CA    1 
ATOM   6888 C  C     . ARG A 1 836 ? 31.838  -18.465 18.398 1.00 30.10 ? 836  ARG A C     1 
ATOM   6889 O  O     . ARG A 1 836 ? 31.356  -18.269 17.282 1.00 30.70 ? 836  ARG A O     1 
ATOM   6890 C  CB    . ARG A 1 836 ? 31.742  -20.765 19.340 1.00 30.06 ? 836  ARG A CB    1 
ATOM   6891 C  CG    . ARG A 1 836 ? 31.422  -21.653 20.526 1.00 32.07 ? 836  ARG A CG    1 
ATOM   6892 C  CD    . ARG A 1 836 ? 32.381  -22.834 20.615 1.00 37.31 ? 836  ARG A CD    1 
ATOM   6893 N  NE    . ARG A 1 836 ? 32.646  -23.444 19.314 1.00 39.34 ? 836  ARG A NE    1 
ATOM   6894 C  CZ    . ARG A 1 836 ? 31.823  -24.283 18.691 1.00 40.71 ? 836  ARG A CZ    1 
ATOM   6895 N  NH1   . ARG A 1 836 ? 30.664  -24.614 19.242 1.00 41.34 ? 836  ARG A NH1   1 
ATOM   6896 N  NH2   . ARG A 1 836 ? 32.157  -24.786 17.510 1.00 40.52 ? 836  ARG A NH2   1 
ATOM   6897 N  N     . GLU A 1 837 ? 32.987  -17.932 18.810 1.00 31.46 ? 837  GLU A N     1 
ATOM   6898 C  CA    . GLU A 1 837 ? 33.861  -17.130 17.954 1.00 35.28 ? 837  GLU A CA    1 
ATOM   6899 C  C     . GLU A 1 837 ? 34.092  -17.824 16.610 1.00 34.91 ? 837  GLU A C     1 
ATOM   6900 O  O     . GLU A 1 837 ? 34.433  -19.008 16.568 1.00 36.29 ? 837  GLU A O     1 
ATOM   6901 C  CB    . GLU A 1 837 ? 35.206  -16.919 18.659 1.00 36.31 ? 837  GLU A CB    1 
ATOM   6902 C  CG    . GLU A 1 837 ? 36.130  -15.891 18.015 1.00 44.63 ? 837  GLU A CG    1 
ATOM   6903 C  CD    . GLU A 1 837 ? 36.189  -14.587 18.792 1.00 50.13 ? 837  GLU A CD    1 
ATOM   6904 O  OE1   . GLU A 1 837 ? 37.303  -14.198 19.208 1.00 50.37 ? 837  GLU A OE1   1 
ATOM   6905 O  OE2   . GLU A 1 837 ? 35.125  -13.960 19.001 1.00 51.29 ? 837  GLU A OE2   1 
ATOM   6906 N  N     . GLY A 1 838 ? 33.891  -17.087 15.520 1.00 35.58 ? 838  GLY A N     1 
ATOM   6907 C  CA    . GLY A 1 838 ? 34.164  -17.595 14.176 1.00 36.34 ? 838  GLY A CA    1 
ATOM   6908 C  C     . GLY A 1 838 ? 33.034  -18.349 13.495 1.00 36.28 ? 838  GLY A C     1 
ATOM   6909 O  O     . GLY A 1 838 ? 33.243  -18.961 12.449 1.00 38.68 ? 838  GLY A O     1 
ATOM   6910 N  N     . ASN A 1 839 ? 31.840  -18.303 14.083 1.00 34.05 ? 839  ASN A N     1 
ATOM   6911 C  CA    . ASN A 1 839 ? 30.650  -18.938 13.507 1.00 33.54 ? 839  ASN A CA    1 
ATOM   6912 C  C     . ASN A 1 839 ? 30.210  -18.258 12.200 1.00 33.50 ? 839  ASN A C     1 
ATOM   6913 O  O     . ASN A 1 839 ? 30.486  -17.073 12.004 1.00 33.37 ? 839  ASN A O     1 
ATOM   6914 C  CB    . ASN A 1 839 ? 29.507  -18.937 14.532 1.00 31.79 ? 839  ASN A CB    1 
ATOM   6915 C  CG    . ASN A 1 839 ? 28.937  -17.555 14.761 1.00 31.54 ? 839  ASN A CG    1 
ATOM   6916 O  OD1   . ASN A 1 839 ? 28.084  -17.097 14.004 1.00 32.73 ? 839  ASN A OD1   1 
ATOM   6917 N  ND2   . ASN A 1 839 ? 29.399  -16.885 15.809 1.00 28.35 ? 839  ASN A ND2   1 
ATOM   6918 N  N     . PRO A 1 840 ? 29.523  -19.002 11.305 1.00 34.30 ? 840  PRO A N     1 
ATOM   6919 C  CA    . PRO A 1 840 ? 29.122  -18.462 9.999  1.00 35.31 ? 840  PRO A CA    1 
ATOM   6920 C  C     . PRO A 1 840 ? 27.979  -17.440 10.038 1.00 35.23 ? 840  PRO A C     1 
ATOM   6921 O  O     . PRO A 1 840 ? 27.652  -16.859 9.004  1.00 36.48 ? 840  PRO A O     1 
ATOM   6922 C  CB    . PRO A 1 840 ? 28.685  -19.714 9.229  1.00 36.68 ? 840  PRO A CB    1 
ATOM   6923 C  CG    . PRO A 1 840 ? 28.212  -20.643 10.285 1.00 35.26 ? 840  PRO A CG    1 
ATOM   6924 C  CD    . PRO A 1 840 ? 29.172  -20.429 11.422 1.00 33.39 ? 840  PRO A CD    1 
ATOM   6925 N  N     . PHE A 1 841 ? 27.383  -17.224 11.211 1.00 33.01 ? 841  PHE A N     1 
ATOM   6926 C  CA    . PHE A 1 841 ? 26.295  -16.252 11.360 1.00 33.23 ? 841  PHE A CA    1 
ATOM   6927 C  C     . PHE A 1 841 ? 26.812  -14.829 11.565 1.00 33.26 ? 841  PHE A C     1 
ATOM   6928 O  O     . PHE A 1 841 ? 26.039  -13.866 11.524 1.00 31.79 ? 841  PHE A O     1 
ATOM   6929 C  CB    . PHE A 1 841 ? 25.373  -16.640 12.520 1.00 31.10 ? 841  PHE A CB    1 
ATOM   6930 C  CG    . PHE A 1 841 ? 24.708  -17.973 12.347 1.00 30.68 ? 841  PHE A CG    1 
ATOM   6931 C  CD1   . PHE A 1 841 ? 23.587  -18.106 11.530 1.00 30.41 ? 841  PHE A CD1   1 
ATOM   6932 C  CD2   . PHE A 1 841 ? 25.199  -19.098 13.004 1.00 29.02 ? 841  PHE A CD2   1 
ATOM   6933 C  CE1   . PHE A 1 841 ? 22.964  -19.345 11.366 1.00 33.51 ? 841  PHE A CE1   1 
ATOM   6934 C  CE2   . PHE A 1 841 ? 24.581  -20.342 12.850 1.00 30.39 ? 841  PHE A CE2   1 
ATOM   6935 C  CZ    . PHE A 1 841 ? 23.463  -20.464 12.029 1.00 32.12 ? 841  PHE A CZ    1 
ATOM   6936 N  N     . GLY A 1 842 ? 28.118  -14.713 11.795 1.00 34.45 ? 842  GLY A N     1 
ATOM   6937 C  CA    . GLY A 1 842 ? 28.791  -13.423 11.906 1.00 34.93 ? 842  GLY A CA    1 
ATOM   6938 C  C     . GLY A 1 842 ? 28.500  -12.611 13.154 1.00 34.18 ? 842  GLY A C     1 
ATOM   6939 O  O     . GLY A 1 842 ? 28.767  -11.407 13.177 1.00 35.71 ? 842  GLY A O     1 
ATOM   6940 N  N     . ASP A 1 843 ? 27.960  -13.255 14.190 1.00 32.06 ? 843  ASP A N     1 
ATOM   6941 C  CA    . ASP A 1 843 ? 27.681  -12.571 15.459 1.00 29.64 ? 843  ASP A CA    1 
ATOM   6942 C  C     . ASP A 1 843 ? 27.632  -13.524 16.654 1.00 27.82 ? 843  ASP A C     1 
ATOM   6943 O  O     . ASP A 1 843 ? 27.605  -14.744 16.488 1.00 29.15 ? 843  ASP A O     1 
ATOM   6944 C  CB    . ASP A 1 843 ? 26.391  -11.745 15.367 1.00 30.31 ? 843  ASP A CB    1 
ATOM   6945 C  CG    . ASP A 1 843 ? 26.508  -10.392 16.059 1.00 32.31 ? 843  ASP A CG    1 
ATOM   6946 O  OD1   . ASP A 1 843 ? 27.261  -10.271 17.054 1.00 32.66 ? 843  ASP A OD1   1 
ATOM   6947 O  OD2   . ASP A 1 843 ? 25.842  -9.439  15.599 1.00 34.75 ? 843  ASP A OD2   1 
ATOM   6948 N  N     . LYS A 1 844 ? 27.607  -12.956 17.857 1.00 25.64 ? 844  LYS A N     1 
ATOM   6949 C  CA    . LYS A 1 844 ? 27.807  -13.716 19.098 1.00 25.06 ? 844  LYS A CA    1 
ATOM   6950 C  C     . LYS A 1 844 ? 26.574  -14.439 19.647 1.00 24.48 ? 844  LYS A C     1 
ATOM   6951 O  O     . LYS A 1 844 ? 26.659  -15.127 20.671 1.00 22.63 ? 844  LYS A O     1 
ATOM   6952 C  CB    . LYS A 1 844 ? 28.386  -12.798 20.181 1.00 24.50 ? 844  LYS A CB    1 
ATOM   6953 C  CG    . LYS A 1 844 ? 27.531  -11.582 20.491 1.00 26.09 ? 844  LYS A CG    1 
ATOM   6954 C  CD    . LYS A 1 844 ? 28.121  -10.807 21.654 1.00 29.23 ? 844  LYS A CD    1 
ATOM   6955 C  CE    . LYS A 1 844 ? 27.239  -9.635  22.041 1.00 30.96 ? 844  LYS A CE    1 
ATOM   6956 N  NZ    . LYS A 1 844 ? 27.835  -8.874  23.169 1.00 32.11 ? 844  LYS A NZ    1 
ATOM   6957 N  N     . CYS A 1 845 ? 25.433  -14.277 18.983 1.00 24.49 ? 845  CYS A N     1 
ATOM   6958 C  CA    . CYS A 1 845 ? 24.209  -14.938 19.423 1.00 23.33 ? 845  CYS A CA    1 
ATOM   6959 C  C     . CYS A 1 845 ? 23.161  -15.008 18.326 1.00 23.31 ? 845  CYS A C     1 
ATOM   6960 O  O     . CYS A 1 845 ? 23.214  -14.261 17.343 1.00 23.14 ? 845  CYS A O     1 
ATOM   6961 C  CB    . CYS A 1 845 ? 23.619  -14.236 20.646 1.00 21.41 ? 845  CYS A CB    1 
ATOM   6962 S  SG    . CYS A 1 845 ? 23.092  -12.550 20.305 1.00 25.87 ? 845  CYS A SG    1 
ATOM   6963 N  N     . ILE A 1 846 ? 22.208  -15.916 18.509 1.00 21.92 ? 846  ILE A N     1 
ATOM   6964 C  CA    . ILE A 1 846 ? 21.083  -16.053 17.594 1.00 22.13 ? 846  ILE A CA    1 
ATOM   6965 C  C     . ILE A 1 846 ? 19.792  -16.262 18.389 1.00 22.20 ? 846  ILE A C     1 
ATOM   6966 O  O     . ILE A 1 846 ? 19.812  -16.802 19.503 1.00 20.08 ? 846  ILE A O     1 
ATOM   6967 C  CB    . ILE A 1 846 ? 21.330  -17.181 16.549 1.00 21.91 ? 846  ILE A CB    1 
ATOM   6968 C  CG1   . ILE A 1 846 ? 20.336  -17.075 15.381 1.00 24.36 ? 846  ILE A CG1   1 
ATOM   6969 C  CG2   . ILE A 1 846 ? 21.329  -18.556 17.219 1.00 21.75 ? 846  ILE A CG2   1 
ATOM   6970 C  CD1   . ILE A 1 846 ? 20.793  -17.786 14.102 1.00 23.99 ? 846  ILE A CD1   1 
ATOM   6971 N  N     . ALA A 1 847 ? 18.685  -15.790 17.830 1.00 21.75 ? 847  ALA A N     1 
ATOM   6972 C  CA    . ALA A 1 847 ? 17.389  -15.883 18.493 1.00 21.50 ? 847  ALA A CA    1 
ATOM   6973 C  C     . ALA A 1 847 ? 16.328  -16.281 17.483 1.00 22.75 ? 847  ALA A C     1 
ATOM   6974 O  O     . ALA A 1 847 ? 16.403  -15.895 16.316 1.00 24.63 ? 847  ALA A O     1 
ATOM   6975 C  CB    . ALA A 1 847 ? 17.028  -14.561 19.165 1.00 21.91 ? 847  ALA A CB    1 
ATOM   6976 N  N     . TRP A 1 848 ? 15.347  -17.056 17.930 1.00 21.27 ? 848  TRP A N     1 
ATOM   6977 C  CA    . TRP A 1 848 ? 14.264  -17.496 17.050 1.00 22.17 ? 848  TRP A CA    1 
ATOM   6978 C  C     . TRP A 1 848 ? 12.962  -17.594 17.852 1.00 22.00 ? 848  TRP A C     1 
ATOM   6979 O  O     . TRP A 1 848 ? 12.999  -17.543 19.081 1.00 21.72 ? 848  TRP A O     1 
ATOM   6980 C  CB    . TRP A 1 848 ? 14.629  -18.818 16.356 1.00 20.36 ? 848  TRP A CB    1 
ATOM   6981 C  CG    . TRP A 1 848 ? 14.620  -20.034 17.249 1.00 21.01 ? 848  TRP A CG    1 
ATOM   6982 C  CD1   . TRP A 1 848 ? 13.640  -20.981 17.330 1.00 19.95 ? 848  TRP A CD1   1 
ATOM   6983 C  CD2   . TRP A 1 848 ? 15.647  -20.442 18.166 1.00 21.18 ? 848  TRP A CD2   1 
ATOM   6984 N  NE1   . TRP A 1 848 ? 13.985  -21.947 18.248 1.00 21.50 ? 848  TRP A NE1   1 
ATOM   6985 C  CE2   . TRP A 1 848 ? 15.211  -21.642 18.775 1.00 21.13 ? 848  TRP A CE2   1 
ATOM   6986 C  CE3   . TRP A 1 848 ? 16.886  -19.905 18.542 1.00 20.60 ? 848  TRP A CE3   1 
ATOM   6987 C  CZ2   . TRP A 1 848 ? 15.975  -22.320 19.743 1.00 21.26 ? 848  TRP A CZ2   1 
ATOM   6988 C  CZ3   . TRP A 1 848 ? 17.646  -20.580 19.502 1.00 20.66 ? 848  TRP A CZ3   1 
ATOM   6989 C  CH2   . TRP A 1 848 ? 17.184  -21.773 20.091 1.00 18.96 ? 848  TRP A CH2   1 
ATOM   6990 N  N     . PRO A 1 849 ? 11.806  -17.719 17.170 1.00 23.09 ? 849  PRO A N     1 
ATOM   6991 C  CA    . PRO A 1 849 ? 10.540  -17.691 17.912 1.00 22.45 ? 849  PRO A CA    1 
ATOM   6992 C  C     . PRO A 1 849 ? 10.470  -18.752 19.010 1.00 23.26 ? 849  PRO A C     1 
ATOM   6993 O  O     . PRO A 1 849 ? 10.811  -19.913 18.774 1.00 22.32 ? 849  PRO A O     1 
ATOM   6994 C  CB    . PRO A 1 849 ? 9.492   -17.962 16.829 1.00 23.92 ? 849  PRO A CB    1 
ATOM   6995 C  CG    . PRO A 1 849 ? 10.131  -17.496 15.574 1.00 23.38 ? 849  PRO A CG    1 
ATOM   6996 C  CD    . PRO A 1 849 ? 11.585  -17.824 15.716 1.00 23.56 ? 849  PRO A CD    1 
ATOM   6997 N  N     . SER A 1 850 ? 10.053  -18.343 20.206 1.00 22.11 ? 850  SER A N     1 
ATOM   6998 C  CA    . SER A 1 850 ? 9.955   -19.266 21.339 1.00 23.68 ? 850  SER A CA    1 
ATOM   6999 C  C     . SER A 1 850 ? 8.857   -20.305 21.109 1.00 25.28 ? 850  SER A C     1 
ATOM   7000 O  O     . SER A 1 850 ? 7.938   -20.088 20.310 1.00 24.81 ? 850  SER A O     1 
ATOM   7001 C  CB    . SER A 1 850 ? 9.730   -18.502 22.647 1.00 23.31 ? 850  SER A CB    1 
ATOM   7002 O  OG    . SER A 1 850 ? 8.381   -18.078 22.776 1.00 21.99 ? 850  SER A OG    1 
ATOM   7003 N  N     . GLY A 1 851 ? 8.972   -21.440 21.794 1.00 26.84 ? 851  GLY A N     1 
ATOM   7004 C  CA    . GLY A 1 851 ? 8.028   -22.550 21.637 1.00 27.56 ? 851  GLY A CA    1 
ATOM   7005 C  C     . GLY A 1 851 ? 8.127   -23.284 20.309 1.00 28.46 ? 851  GLY A C     1 
ATOM   7006 O  O     . GLY A 1 851 ? 7.260   -24.098 19.979 1.00 28.59 ? 851  GLY A O     1 
ATOM   7007 N  N     . THR A 1 852 ? 9.178   -23.000 19.542 1.00 27.57 ? 852  THR A N     1 
ATOM   7008 C  CA    . THR A 1 852 ? 9.383   -23.649 18.243 1.00 27.53 ? 852  THR A CA    1 
ATOM   7009 C  C     . THR A 1 852 ? 10.801  -24.199 18.105 1.00 27.04 ? 852  THR A C     1 
ATOM   7010 O  O     . THR A 1 852 ? 11.733  -23.730 18.768 1.00 25.65 ? 852  THR A O     1 
ATOM   7011 C  CB    . THR A 1 852 ? 9.117   -22.691 17.043 1.00 27.20 ? 852  THR A CB    1 
ATOM   7012 O  OG1   . THR A 1 852 ? 10.190  -21.746 16.929 1.00 28.09 ? 852  THR A OG1   1 
ATOM   7013 C  CG2   . THR A 1 852 ? 7.783   -21.954 17.188 1.00 30.77 ? 852  THR A CG2   1 
ATOM   7014 N  N     . GLU A 1 853 ? 10.935  -25.208 17.248 1.00 28.20 ? 853  GLU A N     1 
ATOM   7015 C  CA    . GLU A 1 853 ? 12.227  -25.678 16.762 1.00 29.34 ? 853  GLU A CA    1 
ATOM   7016 C  C     . GLU A 1 853 ? 12.743  -24.646 15.771 1.00 28.96 ? 853  GLU A C     1 
ATOM   7017 O  O     . GLU A 1 853 ? 11.969  -24.116 14.975 1.00 28.44 ? 853  GLU A O     1 
ATOM   7018 C  CB    . GLU A 1 853 ? 12.065  -27.018 16.032 1.00 30.98 ? 853  GLU A CB    1 
ATOM   7019 C  CG    . GLU A 1 853 ? 11.682  -28.202 16.919 1.00 35.64 ? 853  GLU A CG    1 
ATOM   7020 C  CD    . GLU A 1 853 ? 12.879  -28.850 17.611 1.00 38.09 ? 853  GLU A CD    1 
ATOM   7021 O  OE1   . GLU A 1 853 ? 14.027  -28.671 17.146 1.00 35.16 ? 853  GLU A OE1   1 
ATOM   7022 O  OE2   . GLU A 1 853 ? 12.663  -29.556 18.619 1.00 41.65 ? 853  GLU A OE2   1 
ATOM   7023 N  N     . ILE A 1 854 ? 14.040  -24.350 15.815 1.00 27.66 ? 854  ILE A N     1 
ATOM   7024 C  CA    . ILE A 1 854 ? 14.620  -23.439 14.827 1.00 26.86 ? 854  ILE A CA    1 
ATOM   7025 C  C     . ILE A 1 854 ? 14.528  -24.086 13.437 1.00 28.36 ? 854  ILE A C     1 
ATOM   7026 O  O     . ILE A 1 854 ? 14.654  -25.309 13.304 1.00 28.83 ? 854  ILE A O     1 
ATOM   7027 C  CB    . ILE A 1 854 ? 16.065  -23.007 15.204 1.00 27.04 ? 854  ILE A CB    1 
ATOM   7028 C  CG1   . ILE A 1 854 ? 16.466  -21.723 14.467 1.00 27.67 ? 854  ILE A CG1   1 
ATOM   7029 C  CG2   . ILE A 1 854 ? 17.065  -24.146 14.982 1.00 25.75 ? 854  ILE A CG2   1 
ATOM   7030 C  CD1   . ILE A 1 854 ? 17.664  -21.009 15.080 1.00 26.21 ? 854  ILE A CD1   1 
ATOM   7031 N  N     . THR A 1 855 ? 14.259  -23.270 12.421 1.00 27.78 ? 855  THR A N     1 
ATOM   7032 C  CA    . THR A 1 855 ? 14.078  -23.769 11.054 1.00 29.33 ? 855  THR A CA    1 
ATOM   7033 C  C     . THR A 1 855 ? 15.240  -24.666 10.606 1.00 31.45 ? 855  THR A C     1 
ATOM   7034 O  O     . THR A 1 855 ? 16.403  -24.395 10.924 1.00 30.63 ? 855  THR A O     1 
ATOM   7035 C  CB    . THR A 1 855 ? 13.839  -22.619 10.043 1.00 29.97 ? 855  THR A CB    1 
ATOM   7036 O  OG1   . THR A 1 855 ? 13.771  -23.153 8.718  1.00 32.94 ? 855  THR A OG1   1 
ATOM   7037 C  CG2   . THR A 1 855 ? 14.960  -21.580 10.097 1.00 34.19 ? 855  THR A CG2   1 
ATOM   7038 N  N     . ASP A 1 856 ? 14.913  -25.727 9.868  1.00 34.86 ? 856  ASP A N     1 
ATOM   7039 C  CA    . ASP A 1 856 ? 15.911  -26.700 9.406  1.00 39.06 ? 856  ASP A CA    1 
ATOM   7040 C  C     . ASP A 1 856 ? 16.976  -26.085 8.499  1.00 40.38 ? 856  ASP A C     1 
ATOM   7041 O  O     . ASP A 1 856 ? 18.055  -26.655 8.324  1.00 41.73 ? 856  ASP A O     1 
ATOM   7042 C  CB    . ASP A 1 856 ? 15.237  -27.895 8.720  1.00 41.35 ? 856  ASP A CB    1 
ATOM   7043 C  CG    . ASP A 1 856 ? 14.578  -28.844 9.713  1.00 45.92 ? 856  ASP A CG    1 
ATOM   7044 O  OD1   . ASP A 1 856 ? 13.548  -29.451 9.358  1.00 50.49 ? 856  ASP A OD1   1 
ATOM   7045 O  OD2   . ASP A 1 856 ? 15.086  -28.983 10.850 1.00 48.02 ? 856  ASP A OD2   1 
ATOM   7046 N  N     . LEU A 1 857 ? 16.667  -24.916 7.942  1.00 41.15 ? 857  LEU A N     1 
ATOM   7047 C  CA    . LEU A 1 857 ? 17.615  -24.137 7.144  1.00 43.39 ? 857  LEU A CA    1 
ATOM   7048 C  C     . LEU A 1 857 ? 18.938  -23.885 7.879  1.00 42.11 ? 857  LEU A C     1 
ATOM   7049 O  O     . LEU A 1 857 ? 20.006  -23.905 7.263  1.00 44.54 ? 857  LEU A O     1 
ATOM   7050 C  CB    . LEU A 1 857 ? 16.997  -22.788 6.752  1.00 44.13 ? 857  LEU A CB    1 
ATOM   7051 C  CG    . LEU A 1 857 ? 15.695  -22.728 5.944  1.00 46.18 ? 857  LEU A CG    1 
ATOM   7052 C  CD1   . LEU A 1 857 ? 15.103  -21.334 6.040  1.00 45.34 ? 857  LEU A CD1   1 
ATOM   7053 C  CD2   . LEU A 1 857 ? 15.906  -23.124 4.488  1.00 48.21 ? 857  LEU A CD2   1 
ATOM   7054 N  N     . ILE A 1 858 ? 18.858  -23.652 9.189  1.00 37.89 ? 858  ILE A N     1 
ATOM   7055 C  CA    . ILE A 1 858 ? 20.031  -23.256 9.982  1.00 35.10 ? 858  ILE A CA    1 
ATOM   7056 C  C     . ILE A 1 858 ? 20.272  -24.076 11.256 1.00 33.25 ? 858  ILE A C     1 
ATOM   7057 O  O     . ILE A 1 858 ? 21.287  -23.879 11.937 1.00 31.57 ? 858  ILE A O     1 
ATOM   7058 C  CB    . ILE A 1 858 ? 20.005  -21.739 10.335 1.00 34.41 ? 858  ILE A CB    1 
ATOM   7059 C  CG1   . ILE A 1 858 ? 18.711  -21.358 11.068 1.00 33.30 ? 858  ILE A CG1   1 
ATOM   7060 C  CG2   . ILE A 1 858 ? 20.215  -20.888 9.078  1.00 38.44 ? 858  ILE A CG2   1 
ATOM   7061 C  CD1   . ILE A 1 858 ? 18.736  -19.957 11.652 1.00 30.63 ? 858  ILE A CD1   1 
ATOM   7062 N  N     . LYS A 1 859 ? 19.362  -25.002 11.561 1.00 31.74 ? 859  LYS A N     1 
ATOM   7063 C  CA    . LYS A 1 859 ? 19.429  -25.779 12.803 1.00 31.68 ? 859  LYS A CA    1 
ATOM   7064 C  C     . LYS A 1 859 ? 20.773  -26.471 13.018 1.00 30.97 ? 859  LYS A C     1 
ATOM   7065 O  O     . LYS A 1 859 ? 21.351  -26.384 14.106 1.00 29.36 ? 859  LYS A O     1 
ATOM   7066 C  CB    . LYS A 1 859 ? 18.297  -26.809 12.882 1.00 31.97 ? 859  LYS A CB    1 
ATOM   7067 C  CG    . LYS A 1 859 ? 18.323  -27.645 14.159 1.00 31.89 ? 859  LYS A CG    1 
ATOM   7068 C  CD    . LYS A 1 859 ? 17.114  -28.558 14.272 1.00 36.22 ? 859  LYS A CD    1 
ATOM   7069 C  CE    . LYS A 1 859 ? 17.233  -29.452 15.496 1.00 36.00 ? 859  LYS A CE    1 
ATOM   7070 N  NZ    . LYS A 1 859 ? 15.992  -30.242 15.723 1.00 41.54 ? 859  LYS A NZ    1 
ATOM   7071 N  N     . ASP A 1 860 ? 21.254  -27.157 11.982 1.00 31.61 ? 860  ASP A N     1 
ATOM   7072 C  CA    . ASP A 1 860 ? 22.511  -27.893 12.058 1.00 33.78 ? 860  ASP A CA    1 
ATOM   7073 C  C     . ASP A 1 860 ? 23.688  -26.983 12.408 1.00 31.96 ? 860  ASP A C     1 
ATOM   7074 O  O     . ASP A 1 860 ? 24.516  -27.334 13.252 1.00 33.32 ? 860  ASP A O     1 
ATOM   7075 C  CB    . ASP A 1 860 ? 22.772  -28.652 10.752 1.00 37.27 ? 860  ASP A CB    1 
ATOM   7076 C  CG    . ASP A 1 860 ? 21.775  -29.776 10.525 1.00 42.86 ? 860  ASP A CG    1 
ATOM   7077 O  OD1   . ASP A 1 860 ? 21.199  -30.282 11.515 1.00 46.86 ? 860  ASP A OD1   1 
ATOM   7078 O  OD2   . ASP A 1 860 ? 21.568  -30.155 9.354  1.00 48.00 ? 860  ASP A OD2   1 
ATOM   7079 N  N     . ASP A 1 861 ? 23.746  -25.815 11.773 1.00 30.93 ? 861  ASP A N     1 
ATOM   7080 C  CA    . ASP A 1 861 ? 24.790  -24.830 12.060 1.00 31.23 ? 861  ASP A CA    1 
ATOM   7081 C  C     . ASP A 1 861 ? 24.662  -24.225 13.460 1.00 28.76 ? 861  ASP A C     1 
ATOM   7082 O  O     . ASP A 1 861 ? 25.668  -24.028 14.146 1.00 27.50 ? 861  ASP A O     1 
ATOM   7083 C  CB    . ASP A 1 861 ? 24.796  -23.727 11.002 1.00 33.02 ? 861  ASP A CB    1 
ATOM   7084 C  CG    . ASP A 1 861 ? 25.225  -24.233 9.639  1.00 37.99 ? 861  ASP A CG    1 
ATOM   7085 O  OD1   . ASP A 1 861 ? 24.488  -23.994 8.662  1.00 44.32 ? 861  ASP A OD1   1 
ATOM   7086 O  OD2   . ASP A 1 861 ? 26.294  -24.875 9.547  1.00 40.96 ? 861  ASP A OD2   1 
ATOM   7087 N  N     . VAL A 1 862 ? 23.435  -23.936 13.888 1.00 28.57 ? 862  VAL A N     1 
ATOM   7088 C  CA    . VAL A 1 862 ? 23.220  -23.424 15.248 1.00 27.54 ? 862  VAL A CA    1 
ATOM   7089 C  C     . VAL A 1 862 ? 23.745  -24.443 16.260 1.00 26.91 ? 862  VAL A C     1 
ATOM   7090 O  O     . VAL A 1 862 ? 24.515  -24.092 17.153 1.00 27.10 ? 862  VAL A O     1 
ATOM   7091 C  CB    . VAL A 1 862 ? 21.729  -23.065 15.523 1.00 27.20 ? 862  VAL A CB    1 
ATOM   7092 C  CG1   . VAL A 1 862 ? 21.490  -22.767 17.009 1.00 26.56 ? 862  VAL A CG1   1 
ATOM   7093 C  CG2   . VAL A 1 862 ? 21.306  -21.870 14.679 1.00 29.18 ? 862  VAL A CG2   1 
ATOM   7094 N  N     . LEU A 1 863 ? 23.348  -25.702 16.093 1.00 28.15 ? 863  LEU A N     1 
ATOM   7095 C  CA    . LEU A 1 863 ? 23.792  -26.784 16.975 1.00 30.01 ? 863  LEU A CA    1 
ATOM   7096 C  C     . LEU A 1 863 ? 25.311  -26.940 16.995 1.00 31.48 ? 863  LEU A C     1 
ATOM   7097 O  O     . LEU A 1 863 ? 25.908  -27.144 18.056 1.00 30.66 ? 863  LEU A O     1 
ATOM   7098 C  CB    . LEU A 1 863 ? 23.122  -28.111 16.596 1.00 30.70 ? 863  LEU A CB    1 
ATOM   7099 C  CG    . LEU A 1 863 ? 21.640  -28.286 16.947 1.00 33.18 ? 863  LEU A CG    1 
ATOM   7100 C  CD1   . LEU A 1 863 ? 21.118  -29.623 16.437 1.00 35.05 ? 863  LEU A CD1   1 
ATOM   7101 C  CD2   . LEU A 1 863 ? 21.417  -28.174 18.437 1.00 33.88 ? 863  LEU A CD2   1 
ATOM   7102 N  N     . HIS A 1 864 ? 25.929  -26.826 15.822 1.00 31.39 ? 864  HIS A N     1 
ATOM   7103 C  CA    . HIS A 1 864 ? 27.376  -26.969 15.699 1.00 32.77 ? 864  HIS A CA    1 
ATOM   7104 C  C     . HIS A 1 864 ? 28.140  -25.834 16.386 1.00 32.07 ? 864  HIS A C     1 
ATOM   7105 O  O     . HIS A 1 864 ? 29.218  -26.057 16.936 1.00 32.56 ? 864  HIS A O     1 
ATOM   7106 C  CB    . HIS A 1 864 ? 27.787  -27.072 14.227 1.00 34.54 ? 864  HIS A CB    1 
ATOM   7107 C  CG    . HIS A 1 864 ? 29.239  -27.380 14.031 1.00 37.92 ? 864  HIS A CG    1 
ATOM   7108 N  ND1   . HIS A 1 864 ? 30.195  -26.397 13.891 1.00 40.24 ? 864  HIS A ND1   1 
ATOM   7109 C  CD2   . HIS A 1 864 ? 29.900  -28.559 13.974 1.00 41.37 ? 864  HIS A CD2   1 
ATOM   7110 C  CE1   . HIS A 1 864 ? 31.382  -26.957 13.748 1.00 41.95 ? 864  HIS A CE1   1 
ATOM   7111 N  NE2   . HIS A 1 864 ? 31.230  -28.269 13.790 1.00 45.29 ? 864  HIS A NE2   1 
ATOM   7112 N  N     . TRP A 1 865 ? 27.564  -24.634 16.374 1.00 29.23 ? 865  TRP A N     1 
ATOM   7113 C  CA    . TRP A 1 865 ? 28.261  -23.433 16.838 1.00 28.47 ? 865  TRP A CA    1 
ATOM   7114 C  C     . TRP A 1 865 ? 27.800  -22.876 18.195 1.00 27.17 ? 865  TRP A C     1 
ATOM   7115 O  O     . TRP A 1 865 ? 28.359  -21.890 18.682 1.00 28.35 ? 865  TRP A O     1 
ATOM   7116 C  CB    . TRP A 1 865 ? 28.206  -22.351 15.758 1.00 28.30 ? 865  TRP A CB    1 
ATOM   7117 C  CG    . TRP A 1 865 ? 29.108  -22.659 14.604 1.00 31.04 ? 865  TRP A CG    1 
ATOM   7118 C  CD1   . TRP A 1 865 ? 28.759  -23.237 13.418 1.00 33.13 ? 865  TRP A CD1   1 
ATOM   7119 C  CD2   . TRP A 1 865 ? 30.520  -22.429 14.541 1.00 32.28 ? 865  TRP A CD2   1 
ATOM   7120 N  NE1   . TRP A 1 865 ? 29.867  -23.369 12.612 1.00 34.74 ? 865  TRP A NE1   1 
ATOM   7121 C  CE2   . TRP A 1 865 ? 30.961  -22.883 13.281 1.00 33.94 ? 865  TRP A CE2   1 
ATOM   7122 C  CE3   . TRP A 1 865 ? 31.456  -21.883 15.431 1.00 32.34 ? 865  TRP A CE3   1 
ATOM   7123 C  CZ2   . TRP A 1 865 ? 32.299  -22.801 12.881 1.00 34.01 ? 865  TRP A CZ2   1 
ATOM   7124 C  CZ3   . TRP A 1 865 ? 32.787  -21.801 15.033 1.00 34.18 ? 865  TRP A CZ3   1 
ATOM   7125 C  CH2   . TRP A 1 865 ? 33.194  -22.257 13.767 1.00 34.04 ? 865  TRP A CH2   1 
ATOM   7126 N  N     . MET A 1 866 ? 26.795  -23.515 18.795 1.00 26.05 ? 866  MET A N     1 
ATOM   7127 C  CA    . MET A 1 866 ? 26.297  -23.175 20.138 1.00 26.45 ? 866  MET A CA    1 
ATOM   7128 C  C     . MET A 1 866 ? 27.421  -23.067 21.146 1.00 26.09 ? 866  MET A C     1 
ATOM   7129 O  O     . MET A 1 866 ? 28.242  -23.984 21.253 1.00 26.45 ? 866  MET A O     1 
ATOM   7130 C  CB    . MET A 1 866 ? 25.402  -24.294 20.645 1.00 26.16 ? 866  MET A CB    1 
ATOM   7131 C  CG    . MET A 1 866 ? 24.011  -24.303 20.155 1.00 30.61 ? 866  MET A CG    1 
ATOM   7132 S  SD    . MET A 1 866 ? 23.308  -25.807 20.826 1.00 27.43 ? 866  MET A SD    1 
ATOM   7133 C  CE    . MET A 1 866 ? 22.940  -25.304 22.504 1.00 25.74 ? 866  MET A CE    1 
ATOM   7134 N  N     . ASP A 1 867 ? 27.451  -21.974 21.907 1.00 24.17 ? 867  ASP A N     1 
ATOM   7135 C  CA    . ASP A 1 867 ? 28.513  -21.799 22.890 1.00 24.18 ? 867  ASP A CA    1 
ATOM   7136 C  C     . ASP A 1 867 ? 28.073  -22.321 24.248 1.00 22.77 ? 867  ASP A C     1 
ATOM   7137 O  O     . ASP A 1 867 ? 27.540  -21.575 25.075 1.00 20.99 ? 867  ASP A O     1 
ATOM   7138 C  CB    . ASP A 1 867 ? 28.958  -20.337 22.987 1.00 22.65 ? 867  ASP A CB    1 
ATOM   7139 C  CG    . ASP A 1 867 ? 30.321  -20.182 23.654 1.00 23.68 ? 867  ASP A CG    1 
ATOM   7140 O  OD1   . ASP A 1 867 ? 30.669  -20.997 24.542 1.00 24.01 ? 867  ASP A OD1   1 
ATOM   7141 O  OD2   . ASP A 1 867 ? 31.052  -19.239 23.284 1.00 22.74 ? 867  ASP A OD2   1 
ATOM   7142 N  N     . TYR A 1 868 ? 28.311  -23.613 24.461 1.00 23.11 ? 868  TYR A N     1 
ATOM   7143 C  CA    . TYR A 1 868 ? 27.975  -24.280 25.714 1.00 22.77 ? 868  TYR A CA    1 
ATOM   7144 C  C     . TYR A 1 868 ? 28.682  -23.655 26.917 1.00 22.06 ? 868  TYR A C     1 
ATOM   7145 O  O     . TYR A 1 868 ? 28.091  -23.538 27.988 1.00 22.87 ? 868  TYR A O     1 
ATOM   7146 C  CB    . TYR A 1 868 ? 28.328  -25.766 25.634 1.00 25.12 ? 868  TYR A CB    1 
ATOM   7147 C  CG    . TYR A 1 868 ? 27.436  -26.580 24.719 1.00 23.79 ? 868  TYR A CG    1 
ATOM   7148 C  CD1   . TYR A 1 868 ? 26.202  -27.057 25.164 1.00 25.61 ? 868  TYR A CD1   1 
ATOM   7149 C  CD2   . TYR A 1 868 ? 27.829  -26.881 23.415 1.00 29.26 ? 868  TYR A CD2   1 
ATOM   7150 C  CE1   . TYR A 1 868 ? 25.378  -27.812 24.327 1.00 27.58 ? 868  TYR A CE1   1 
ATOM   7151 C  CE2   . TYR A 1 868 ? 27.013  -27.636 22.572 1.00 32.12 ? 868  TYR A CE2   1 
ATOM   7152 C  CZ    . TYR A 1 868 ? 25.790  -28.096 23.037 1.00 31.97 ? 868  TYR A CZ    1 
ATOM   7153 O  OH    . TYR A 1 868 ? 24.977  -28.844 22.214 1.00 33.53 ? 868  TYR A OH    1 
ATOM   7154 N  N     . THR A 1 869 ? 29.946  -23.273 26.743 1.00 22.46 ? 869  THR A N     1 
ATOM   7155 C  CA    . THR A 1 869 ? 30.738  -22.703 27.839 1.00 21.87 ? 869  THR A CA    1 
ATOM   7156 C  C     . THR A 1 869 ? 30.114  -21.396 28.359 1.00 21.04 ? 869  THR A C     1 
ATOM   7157 O  O     . THR A 1 869 ? 29.938  -21.213 29.571 1.00 20.62 ? 869  THR A O     1 
ATOM   7158 C  CB    . THR A 1 869 ? 32.216  -22.508 27.421 1.00 23.14 ? 869  THR A CB    1 
ATOM   7159 O  OG1   . THR A 1 869 ? 32.763  -23.772 27.012 1.00 23.89 ? 869  THR A OG1   1 
ATOM   7160 C  CG2   . THR A 1 869 ? 33.047  -21.957 28.576 1.00 23.66 ? 869  THR A CG2   1 
ATOM   7161 N  N     . VAL A 1 870 ? 29.749  -20.511 27.437 1.00 19.60 ? 870  VAL A N     1 
ATOM   7162 C  CA    . VAL A 1 870 ? 29.120  -19.233 27.783 1.00 20.75 ? 870  VAL A CA    1 
ATOM   7163 C  C     . VAL A 1 870 ? 27.736  -19.454 28.412 1.00 21.87 ? 870  VAL A C     1 
ATOM   7164 O  O     . VAL A 1 870 ? 27.389  -18.843 29.432 1.00 21.06 ? 870  VAL A O     1 
ATOM   7165 C  CB    . VAL A 1 870 ? 29.028  -18.320 26.540 1.00 19.17 ? 870  VAL A CB    1 
ATOM   7166 C  CG1   . VAL A 1 870 ? 28.051  -17.179 26.760 1.00 22.52 ? 870  VAL A CG1   1 
ATOM   7167 C  CG2   . VAL A 1 870 ? 30.411  -17.767 26.189 1.00 20.38 ? 870  VAL A CG2   1 
ATOM   7168 N  N     . LEU A 1 871 ? 26.963  -20.343 27.795 1.00 21.14 ? 871  LEU A N     1 
ATOM   7169 C  CA    . LEU A 1 871 ? 25.639  -20.721 28.274 1.00 23.49 ? 871  LEU A CA    1 
ATOM   7170 C  C     . LEU A 1 871 ? 25.688  -21.156 29.746 1.00 23.53 ? 871  LEU A C     1 
ATOM   7171 O  O     . LEU A 1 871 ? 24.933  -20.643 30.582 1.00 23.40 ? 871  LEU A O     1 
ATOM   7172 C  CB    . LEU A 1 871 ? 25.111  -21.845 27.372 1.00 25.71 ? 871  LEU A CB    1 
ATOM   7173 C  CG    . LEU A 1 871 ? 23.738  -22.488 27.495 1.00 32.06 ? 871  LEU A CG    1 
ATOM   7174 C  CD1   . LEU A 1 871 ? 23.335  -22.981 26.108 1.00 30.68 ? 871  LEU A CD1   1 
ATOM   7175 C  CD2   . LEU A 1 871 ? 23.765  -23.635 28.499 1.00 32.14 ? 871  LEU A CD2   1 
ATOM   7176 N  N     . LEU A 1 872 ? 26.596  -22.082 30.053 1.00 23.62 ? 872  LEU A N     1 
ATOM   7177 C  CA    . LEU A 1 872 ? 26.752  -22.599 31.410 1.00 24.29 ? 872  LEU A CA    1 
ATOM   7178 C  C     . LEU A 1 872 ? 27.154  -21.510 32.393 1.00 24.67 ? 872  LEU A C     1 
ATOM   7179 O  O     . LEU A 1 872 ? 26.602  -21.425 33.489 1.00 22.45 ? 872  LEU A O     1 
ATOM   7180 C  CB    . LEU A 1 872 ? 27.797  -23.717 31.444 1.00 24.83 ? 872  LEU A CB    1 
ATOM   7181 C  CG    . LEU A 1 872 ? 27.934  -24.459 32.777 1.00 27.02 ? 872  LEU A CG    1 
ATOM   7182 C  CD1   . LEU A 1 872 ? 26.724  -25.359 33.036 1.00 26.17 ? 872  LEU A CD1   1 
ATOM   7183 C  CD2   . LEU A 1 872 ? 29.229  -25.256 32.813 1.00 29.72 ? 872  LEU A CD2   1 
ATOM   7184 N  N     . GLU A 1 873 ? 28.124  -20.692 32.001 1.00 23.36 ? 873  GLU A N     1 
ATOM   7185 C  CA    . GLU A 1 873 ? 28.616  -19.629 32.874 1.00 25.83 ? 873  GLU A CA    1 
ATOM   7186 C  C     . GLU A 1 873 ? 27.511  -18.629 33.198 1.00 24.56 ? 873  GLU A C     1 
ATOM   7187 O  O     . GLU A 1 873 ? 27.285  -18.298 34.367 1.00 26.79 ? 873  GLU A O     1 
ATOM   7188 C  CB    . GLU A 1 873 ? 29.818  -18.922 32.238 1.00 27.91 ? 873  GLU A CB    1 
ATOM   7189 C  CG    . GLU A 1 873 ? 30.456  -17.833 33.109 1.00 34.87 ? 873  GLU A CG    1 
ATOM   7190 C  CD    . GLU A 1 873 ? 31.138  -18.375 34.367 1.00 42.15 ? 873  GLU A CD    1 
ATOM   7191 O  OE1   . GLU A 1 873 ? 31.557  -19.556 34.377 1.00 46.31 ? 873  GLU A OE1   1 
ATOM   7192 O  OE2   . GLU A 1 873 ? 31.262  -17.605 35.347 1.00 47.00 ? 873  GLU A OE2   1 
ATOM   7193 N  N     . LYS A 1 874 ? 26.817  -18.168 32.164 1.00 23.14 ? 874  LYS A N     1 
ATOM   7194 C  CA    . LYS A 1 874 ? 25.826  -17.107 32.316 1.00 24.38 ? 874  LYS A CA    1 
ATOM   7195 C  C     . LYS A 1 874 ? 24.550  -17.537 33.031 1.00 22.53 ? 874  LYS A C     1 
ATOM   7196 O  O     . LYS A 1 874 ? 24.073  -16.823 33.918 1.00 23.44 ? 874  LYS A O     1 
ATOM   7197 C  CB    . LYS A 1 874 ? 25.504  -16.473 30.956 1.00 26.53 ? 874  LYS A CB    1 
ATOM   7198 C  CG    . LYS A 1 874 ? 26.477  -15.352 30.586 1.00 30.01 ? 874  LYS A CG    1 
ATOM   7199 C  CD    . LYS A 1 874 ? 26.577  -15.079 29.091 1.00 32.95 ? 874  LYS A CD    1 
ATOM   7200 C  CE    . LYS A 1 874 ? 25.228  -14.934 28.431 1.00 33.04 ? 874  LYS A CE    1 
ATOM   7201 N  NZ    . LYS A 1 874 ? 25.340  -14.259 27.100 1.00 32.21 ? 874  LYS A NZ    1 
ATOM   7202 N  N     . THR A 1 875 ? 24.006  -18.690 32.652 1.00 20.33 ? 875  THR A N     1 
ATOM   7203 C  CA    . THR A 1 875 ? 22.683  -19.104 33.136 1.00 20.95 ? 875  THR A CA    1 
ATOM   7204 C  C     . THR A 1 875 ? 22.740  -19.987 34.378 1.00 21.33 ? 875  THR A C     1 
ATOM   7205 O  O     . THR A 1 875 ? 21.778  -20.032 35.148 1.00 20.59 ? 875  THR A O     1 
ATOM   7206 C  CB    . THR A 1 875 ? 21.828  -19.815 32.045 1.00 21.47 ? 875  THR A CB    1 
ATOM   7207 O  OG1   . THR A 1 875 ? 22.416  -21.078 31.704 1.00 22.11 ? 875  THR A OG1   1 
ATOM   7208 C  CG2   . THR A 1 875 ? 21.709  -18.949 30.789 1.00 22.04 ? 875  THR A CG2   1 
ATOM   7209 N  N     . PHE A 1 876 ? 23.857  -20.682 34.568 1.00 20.46 ? 876  PHE A N     1 
ATOM   7210 C  CA    . PHE A 1 876 ? 23.971  -21.635 35.673 1.00 20.63 ? 876  PHE A CA    1 
ATOM   7211 C  C     . PHE A 1 876 ? 25.006  -21.242 36.731 1.00 21.22 ? 876  PHE A C     1 
ATOM   7212 O  O     . PHE A 1 876 ? 24.654  -21.060 37.899 1.00 22.91 ? 876  PHE A O     1 
ATOM   7213 C  CB    . PHE A 1 876 ? 24.242  -23.054 35.141 1.00 20.70 ? 876  PHE A CB    1 
ATOM   7214 C  CG    . PHE A 1 876 ? 24.285  -24.107 36.214 1.00 19.68 ? 876  PHE A CG    1 
ATOM   7215 C  CD1   . PHE A 1 876 ? 23.111  -24.529 36.840 1.00 21.28 ? 876  PHE A CD1   1 
ATOM   7216 C  CD2   . PHE A 1 876 ? 25.496  -24.678 36.602 1.00 21.01 ? 876  PHE A CD2   1 
ATOM   7217 C  CE1   . PHE A 1 876 ? 23.142  -25.502 37.843 1.00 22.14 ? 876  PHE A CE1   1 
ATOM   7218 C  CE2   . PHE A 1 876 ? 25.537  -25.650 37.594 1.00 22.76 ? 876  PHE A CE2   1 
ATOM   7219 C  CZ    . PHE A 1 876 ? 24.356  -26.061 38.221 1.00 22.58 ? 876  PHE A CZ    1 
ATOM   7220 N  N     . ILE A 1 877 ? 26.274  -21.111 36.335 1.00 21.88 ? 877  ILE A N     1 
ATOM   7221 C  CA    . ILE A 1 877 ? 27.338  -20.857 37.316 1.00 22.31 ? 877  ILE A CA    1 
ATOM   7222 C  C     . ILE A 1 877 ? 27.177  -19.510 38.016 1.00 22.47 ? 877  ILE A C     1 
ATOM   7223 O  O     . ILE A 1 877 ? 27.240  -19.440 39.243 1.00 21.61 ? 877  ILE A O     1 
ATOM   7224 C  CB    . ILE A 1 877 ? 28.768  -21.018 36.722 1.00 23.64 ? 877  ILE A CB    1 
ATOM   7225 C  CG1   . ILE A 1 877 ? 28.963  -22.454 36.213 1.00 26.08 ? 877  ILE A CG1   1 
ATOM   7226 C  CG2   . ILE A 1 877 ? 29.836  -20.663 37.776 1.00 22.59 ? 877  ILE A CG2   1 
ATOM   7227 C  CD1   . ILE A 1 877 ? 30.288  -22.712 35.482 1.00 30.10 ? 877  ILE A CD1   1 
ATOM   7228 N  N     . LYS A 1 878 ? 26.949  -18.450 37.242 1.00 22.66 ? 878  LYS A N     1 
ATOM   7229 C  CA    . LYS A 1 878 ? 26.777  -17.115 37.815 1.00 24.68 ? 878  LYS A CA    1 
ATOM   7230 C  C     . LYS A 1 878 ? 25.653  -17.061 38.872 1.00 21.61 ? 878  LYS A C     1 
ATOM   7231 O  O     . LYS A 1 878 ? 25.894  -16.582 39.985 1.00 20.63 ? 878  LYS A O     1 
ATOM   7232 C  CB    . LYS A 1 878 ? 26.593  -16.053 36.719 1.00 26.50 ? 878  LYS A CB    1 
ATOM   7233 C  CG    . LYS A 1 878 ? 26.944  -14.632 37.150 1.00 36.06 ? 878  LYS A CG    1 
ATOM   7234 C  CD    . LYS A 1 878 ? 26.813  -13.670 35.978 1.00 39.66 ? 878  LYS A CD    1 
ATOM   7235 C  CE    . LYS A 1 878 ? 26.977  -12.222 36.405 1.00 44.52 ? 878  LYS A CE    1 
ATOM   7236 N  NZ    . LYS A 1 878 ? 26.777  -11.296 35.248 1.00 48.10 ? 878  LYS A NZ    1 
ATOM   7237 N  N     . PRO A 1 879 ? 24.440  -17.571 38.548 1.00 21.62 ? 879  PRO A N     1 
ATOM   7238 C  CA    . PRO A 1 879 ? 23.394  -17.595 39.577 1.00 21.04 ? 879  PRO A CA    1 
ATOM   7239 C  C     . PRO A 1 879 ? 23.733  -18.492 40.765 1.00 20.90 ? 879  PRO A C     1 
ATOM   7240 O  O     . PRO A 1 879 ? 23.457  -18.116 41.907 1.00 19.74 ? 879  PRO A O     1 
ATOM   7241 C  CB    . PRO A 1 879 ? 22.171  -18.143 38.832 1.00 22.30 ? 879  PRO A CB    1 
ATOM   7242 C  CG    . PRO A 1 879 ? 22.407  -17.771 37.416 1.00 23.12 ? 879  PRO A CG    1 
ATOM   7243 C  CD    . PRO A 1 879 ? 23.892  -17.910 37.219 1.00 21.45 ? 879  PRO A CD    1 
ATOM   7244 N  N     . LEU A 1 880 ? 24.328  -19.656 40.506 1.00 19.41 ? 880  LEU A N     1 
ATOM   7245 C  CA    . LEU A 1 880 ? 24.709  -20.564 41.592 1.00 21.35 ? 880  LEU A CA    1 
ATOM   7246 C  C     . LEU A 1 880 ? 25.757  -19.948 42.527 1.00 22.01 ? 880  LEU A C     1 
ATOM   7247 O  O     . LEU A 1 880 ? 25.663  -20.086 43.754 1.00 21.66 ? 880  LEU A O     1 
ATOM   7248 C  CB    . LEU A 1 880 ? 25.187  -21.916 41.053 1.00 20.82 ? 880  LEU A CB    1 
ATOM   7249 C  CG    . LEU A 1 880 ? 25.456  -23.008 42.098 1.00 21.64 ? 880  LEU A CG    1 
ATOM   7250 C  CD1   . LEU A 1 880 ? 24.184  -23.372 42.855 1.00 19.78 ? 880  LEU A CD1   1 
ATOM   7251 C  CD2   . LEU A 1 880 ? 26.056  -24.238 41.445 1.00 22.96 ? 880  LEU A CD2   1 
ATOM   7252 N  N     . GLU A 1 881 ? 26.742  -19.259 41.953 1.00 22.60 ? 881  GLU A N     1 
ATOM   7253 C  CA    . GLU A 1 881 ? 27.735  -18.555 42.761 1.00 24.82 ? 881  GLU A CA    1 
ATOM   7254 C  C     . GLU A 1 881 ? 27.069  -17.505 43.656 1.00 22.49 ? 881  GLU A C     1 
ATOM   7255 O  O     . GLU A 1 881 ? 27.493  -17.290 44.794 1.00 22.32 ? 881  GLU A O     1 
ATOM   7256 C  CB    . GLU A 1 881 ? 28.826  -17.933 41.882 1.00 28.50 ? 881  GLU A CB    1 
ATOM   7257 C  CG    . GLU A 1 881 ? 30.211  -17.900 42.536 1.00 37.55 ? 881  GLU A CG    1 
ATOM   7258 C  CD    . GLU A 1 881 ? 30.403  -16.722 43.477 1.00 45.53 ? 881  GLU A CD    1 
ATOM   7259 O  OE1   . GLU A 1 881 ? 31.224  -16.836 44.416 1.00 46.64 ? 881  GLU A OE1   1 
ATOM   7260 O  OE2   . GLU A 1 881 ? 29.737  -15.680 43.281 1.00 49.83 ? 881  GLU A OE2   1 
ATOM   7261 N  N     . GLY A 1 882 ? 26.027  -16.858 43.135 1.00 21.73 ? 882  GLY A N     1 
ATOM   7262 C  CA    . GLY A 1 882 ? 25.184  -15.973 43.936 1.00 21.83 ? 882  GLY A CA    1 
ATOM   7263 C  C     . GLY A 1 882 ? 24.521  -16.675 45.116 1.00 20.87 ? 882  GLY A C     1 
ATOM   7264 O  O     . GLY A 1 882 ? 24.568  -16.168 46.237 1.00 20.23 ? 882  GLY A O     1 
ATOM   7265 N  N     . PHE A 1 883 ? 23.910  -17.839 44.875 1.00 19.58 ? 883  PHE A N     1 
ATOM   7266 C  CA    . PHE A 1 883 ? 23.218  -18.577 45.947 1.00 20.45 ? 883  PHE A CA    1 
ATOM   7267 C  C     . PHE A 1 883 ? 24.199  -19.014 47.017 1.00 19.51 ? 883  PHE A C     1 
ATOM   7268 O  O     . PHE A 1 883 ? 23.944  -18.850 48.209 1.00 21.76 ? 883  PHE A O     1 
ATOM   7269 C  CB    . PHE A 1 883 ? 22.518  -19.852 45.454 1.00 18.98 ? 883  PHE A CB    1 
ATOM   7270 C  CG    . PHE A 1 883 ? 21.559  -19.651 44.308 1.00 21.05 ? 883  PHE A CG    1 
ATOM   7271 C  CD1   . PHE A 1 883 ? 21.015  -18.399 44.015 1.00 21.08 ? 883  PHE A CD1   1 
ATOM   7272 C  CD2   . PHE A 1 883 ? 21.173  -20.746 43.538 1.00 21.14 ? 883  PHE A CD2   1 
ATOM   7273 C  CE1   . PHE A 1 883 ? 20.135  -18.239 42.953 1.00 19.55 ? 883  PHE A CE1   1 
ATOM   7274 C  CE2   . PHE A 1 883 ? 20.281  -20.593 42.472 1.00 20.09 ? 883  PHE A CE2   1 
ATOM   7275 C  CZ    . PHE A 1 883 ? 19.764  -19.335 42.183 1.00 20.34 ? 883  PHE A CZ    1 
ATOM   7276 N  N     . THR A 1 884 ? 25.306  -19.603 46.578 1.00 17.53 ? 884  THR A N     1 
ATOM   7277 C  CA    . THR A 1 884 ? 26.252  -20.234 47.494 1.00 20.37 ? 884  THR A CA    1 
ATOM   7278 C  C     . THR A 1 884 ? 27.053  -19.218 48.306 1.00 21.69 ? 884  THR A C     1 
ATOM   7279 O  O     . THR A 1 884 ? 27.323  -19.445 49.484 1.00 23.02 ? 884  THR A O     1 
ATOM   7280 C  CB    . THR A 1 884 ? 27.201  -21.223 46.770 1.00 19.81 ? 884  THR A CB    1 
ATOM   7281 O  OG1   . THR A 1 884 ? 27.919  -20.540 45.737 1.00 21.11 ? 884  THR A OG1   1 
ATOM   7282 C  CG2   . THR A 1 884 ? 26.412  -22.373 46.159 1.00 21.18 ? 884  THR A CG2   1 
ATOM   7283 N  N     . SER A 1 885 ? 27.427  -18.100 47.685 1.00 22.43 ? 885  SER A N     1 
ATOM   7284 C  CA    . SER A 1 885 ? 28.137  -17.051 48.411 1.00 24.63 ? 885  SER A CA    1 
ATOM   7285 C  C     . SER A 1 885 ? 27.231  -16.429 49.470 1.00 23.67 ? 885  SER A C     1 
ATOM   7286 O  O     . SER A 1 885 ? 27.684  -16.131 50.570 1.00 22.62 ? 885  SER A O     1 
ATOM   7287 C  CB    . SER A 1 885 ? 28.727  -15.988 47.475 1.00 27.42 ? 885  SER A CB    1 
ATOM   7288 O  OG    . SER A 1 885 ? 27.727  -15.361 46.692 1.00 31.73 ? 885  SER A OG    1 
ATOM   7289 N  N     . ALA A 1 886 ? 25.947  -16.267 49.146 1.00 22.24 ? 886  ALA A N     1 
ATOM   7290 C  CA    . ALA A 1 886 ? 24.979  -15.786 50.126 1.00 21.48 ? 886  ALA A CA    1 
ATOM   7291 C  C     . ALA A 1 886 ? 24.844  -16.785 51.275 1.00 21.37 ? 886  ALA A C     1 
ATOM   7292 O  O     . ALA A 1 886 ? 24.819  -16.390 52.436 1.00 20.80 ? 886  ALA A O     1 
ATOM   7293 C  CB    . ALA A 1 886 ? 23.622  -15.529 49.476 1.00 20.62 ? 886  ALA A CB    1 
ATOM   7294 N  N     . ALA A 1 887 ? 24.783  -18.074 50.941 1.00 21.18 ? 887  ALA A N     1 
ATOM   7295 C  CA    . ALA A 1 887 ? 24.591  -19.134 51.934 1.00 22.56 ? 887  ALA A CA    1 
ATOM   7296 C  C     . ALA A 1 887 ? 25.885  -19.527 52.661 1.00 24.49 ? 887  ALA A C     1 
ATOM   7297 O  O     . ALA A 1 887 ? 25.863  -20.357 53.573 1.00 23.46 ? 887  ALA A O     1 
ATOM   7298 C  CB    . ALA A 1 887 ? 23.948  -20.354 51.281 1.00 23.78 ? 887  ALA A CB    1 
ATOM   7299 N  N     . LYS A 1 888 ? 26.998  -18.915 52.251 1.00 24.28 ? 888  LYS A N     1 
ATOM   7300 C  CA    . LYS A 1 888 ? 28.327  -19.152 52.830 1.00 26.79 ? 888  LYS A CA    1 
ATOM   7301 C  C     . LYS A 1 888 ? 28.781  -20.605 52.673 1.00 27.60 ? 888  LYS A C     1 
ATOM   7302 O  O     . LYS A 1 888 ? 29.297  -21.216 53.613 1.00 28.90 ? 888  LYS A O     1 
ATOM   7303 C  CB    . LYS A 1 888 ? 28.386  -18.708 54.305 1.00 27.02 ? 888  LYS A CB    1 
ATOM   7304 C  CG    . LYS A 1 888 ? 28.058  -17.242 54.543 1.00 27.60 ? 888  LYS A CG    1 
ATOM   7305 C  CD    . LYS A 1 888 ? 28.378  -16.838 55.989 1.00 30.88 ? 888  LYS A CD    1 
ATOM   7306 C  CE    . LYS A 1 888 ? 27.814  -15.466 56.338 1.00 31.78 ? 888  LYS A CE    1 
ATOM   7307 N  NZ    . LYS A 1 888 ? 28.340  -14.380 55.452 1.00 35.14 ? 888  LYS A NZ    1 
ATOM   7308 N  N     . LEU A 1 889 ? 28.571  -21.162 51.487 1.00 26.57 ? 889  LEU A N     1 
ATOM   7309 C  CA    . LEU A 1 889 ? 29.101  -22.486 51.187 1.00 29.41 ? 889  LEU A CA    1 
ATOM   7310 C  C     . LEU A 1 889 ? 29.726  -22.529 49.795 1.00 28.99 ? 889  LEU A C     1 
ATOM   7311 O  O     . LEU A 1 889 ? 29.606  -21.573 49.029 1.00 27.52 ? 889  LEU A O     1 
ATOM   7312 C  CB    . LEU A 1 889 ? 28.042  -23.580 51.404 1.00 32.08 ? 889  LEU A CB    1 
ATOM   7313 C  CG    . LEU A 1 889 ? 26.686  -23.522 50.705 1.00 31.76 ? 889  LEU A CG    1 
ATOM   7314 C  CD1   . LEU A 1 889 ? 26.785  -24.123 49.321 1.00 34.14 ? 889  LEU A CD1   1 
ATOM   7315 C  CD2   . LEU A 1 889 ? 25.649  -24.278 51.522 1.00 34.51 ? 889  LEU A CD2   1 
ATOM   7316 N  N     . ASP A 1 890 ? 30.417  -23.623 49.485 1.00 28.22 ? 890  ASP A N     1 
ATOM   7317 C  CA    . ASP A 1 890 ? 31.125  -23.743 48.211 1.00 29.17 ? 890  ASP A CA    1 
ATOM   7318 C  C     . ASP A 1 890 ? 30.512  -24.827 47.335 1.00 27.45 ? 890  ASP A C     1 
ATOM   7319 O  O     . ASP A 1 890 ? 30.193  -25.911 47.816 1.00 24.57 ? 890  ASP A O     1 
ATOM   7320 C  CB    . ASP A 1 890 ? 32.613  -24.028 48.450 1.00 32.45 ? 890  ASP A CB    1 
ATOM   7321 C  CG    . ASP A 1 890 ? 33.323  -22.887 49.163 1.00 36.01 ? 890  ASP A CG    1 
ATOM   7322 O  OD1   . ASP A 1 890 ? 33.159  -21.719 48.746 1.00 39.47 ? 890  ASP A OD1   1 
ATOM   7323 O  OD2   . ASP A 1 890 ? 34.053  -23.162 50.138 1.00 40.20 ? 890  ASP A OD2   1 
ATOM   7324 N  N     . TYR A 1 891 ? 30.338  -24.523 46.050 1.00 25.35 ? 891  TYR A N     1 
ATOM   7325 C  CA    . TYR A 1 891 ? 29.798  -25.504 45.113 1.00 26.64 ? 891  TYR A CA    1 
ATOM   7326 C  C     . TYR A 1 891 ? 30.889  -26.431 44.573 1.00 27.30 ? 891  TYR A C     1 
ATOM   7327 O  O     . TYR A 1 891 ? 30.595  -27.436 43.920 1.00 27.56 ? 891  TYR A O     1 
ATOM   7328 C  CB    . TYR A 1 891 ? 29.000  -24.833 43.981 1.00 25.98 ? 891  TYR A CB    1 
ATOM   7329 C  CG    . TYR A 1 891 ? 29.770  -23.852 43.141 1.00 28.23 ? 891  TYR A CG    1 
ATOM   7330 C  CD1   . TYR A 1 891 ? 29.835  -22.503 43.490 1.00 29.56 ? 891  TYR A CD1   1 
ATOM   7331 C  CD2   . TYR A 1 891 ? 30.415  -24.264 41.975 1.00 26.21 ? 891  TYR A CD2   1 
ATOM   7332 C  CE1   . TYR A 1 891 ? 30.536  -21.594 42.703 1.00 29.60 ? 891  TYR A CE1   1 
ATOM   7333 C  CE2   . TYR A 1 891 ? 31.116  -23.368 41.188 1.00 27.76 ? 891  TYR A CE2   1 
ATOM   7334 C  CZ    . TYR A 1 891 ? 31.175  -22.037 41.555 1.00 31.62 ? 891  TYR A CZ    1 
ATOM   7335 O  OH    . TYR A 1 891 ? 31.872  -21.150 40.771 1.00 31.22 ? 891  TYR A OH    1 
ATOM   7336 N  N     . GLU A 1 892 ? 32.141  -26.082 44.864 1.00 29.52 ? 892  GLU A N     1 
ATOM   7337 C  CA    . GLU A 1 892 ? 33.297  -26.918 44.540 1.00 32.59 ? 892  GLU A CA    1 
ATOM   7338 C  C     . GLU A 1 892 ? 34.111  -27.161 45.802 1.00 34.77 ? 892  GLU A C     1 
ATOM   7339 O  O     . GLU A 1 892 ? 34.328  -26.240 46.594 1.00 34.95 ? 892  GLU A O     1 
ATOM   7340 C  CB    . GLU A 1 892 ? 34.169  -26.253 43.471 1.00 34.04 ? 892  GLU A CB    1 
ATOM   7341 C  CG    . GLU A 1 892 ? 33.504  -26.153 42.104 1.00 36.81 ? 892  GLU A CG    1 
ATOM   7342 C  CD    . GLU A 1 892 ? 34.415  -25.575 41.034 1.00 40.53 ? 892  GLU A CD    1 
ATOM   7343 O  OE1   . GLU A 1 892 ? 34.617  -26.252 40.006 1.00 44.69 ? 892  GLU A OE1   1 
ATOM   7344 O  OE2   . GLU A 1 892 ? 34.928  -24.449 41.215 1.00 43.44 ? 892  GLU A OE2   1 
ATOM   7345 N  N     . LYS A 1 893 ? 34.560  -28.400 45.987 1.00 35.85 ? 893  LYS A N     1 
ATOM   7346 C  CA    . LYS A 1 893 ? 35.310  -28.776 47.184 1.00 39.09 ? 893  LYS A CA    1 
ATOM   7347 C  C     . LYS A 1 893 ? 36.672  -28.079 47.251 1.00 40.95 ? 893  LYS A C     1 
ATOM   7348 O  O     . LYS A 1 893 ? 37.492  -28.202 46.338 1.00 40.49 ? 893  LYS A O     1 
ATOM   7349 C  CB    . LYS A 1 893 ? 35.475  -30.297 47.269 1.00 39.89 ? 893  LYS A CB    1 
ATOM   7350 C  CG    . LYS A 1 893 ? 36.045  -30.786 48.598 1.00 43.11 ? 893  LYS A CG    1 
ATOM   7351 C  CD    . LYS A 1 893 ? 35.993  -32.301 48.705 1.00 45.35 ? 893  LYS A CD    1 
ATOM   7352 C  CE    . LYS A 1 893 ? 36.612  -32.778 50.010 1.00 47.58 ? 893  LYS A CE    1 
ATOM   7353 N  NZ    . LYS A 1 893 ? 36.325  -34.216 50.264 1.00 47.79 ? 893  LYS A NZ    1 
ATOM   7354 N  N     . LYS A 1 894 ? 36.887  -27.340 48.337 1.00 42.30 ? 894  LYS A N     1 
ATOM   7355 C  CA    . LYS A 1 894 ? 38.156  -26.658 48.591 1.00 45.03 ? 894  LYS A CA    1 
ATOM   7356 C  C     . LYS A 1 894 ? 39.231  -27.656 49.030 1.00 46.22 ? 894  LYS A C     1 
ATOM   7357 O  O     . LYS A 1 894 ? 38.929  -28.659 49.683 1.00 46.52 ? 894  LYS A O     1 
ATOM   7358 C  CB    . LYS A 1 894 ? 37.977  -25.566 49.656 1.00 45.73 ? 894  LYS A CB    1 
ATOM   7359 C  CG    . LYS A 1 894 ? 37.263  -26.037 50.925 1.00 47.82 ? 894  LYS A CG    1 
ATOM   7360 C  CD    . LYS A 1 894 ? 37.491  -25.105 52.106 1.00 49.51 ? 894  LYS A CD    1 
ATOM   7361 C  CE    . LYS A 1 894 ? 37.023  -25.757 53.400 1.00 50.08 ? 894  LYS A CE    1 
ATOM   7362 N  NZ    . LYS A 1 894 ? 37.360  -24.951 54.604 1.00 50.63 ? 894  LYS A NZ    1 
ATOM   7363 N  N     . ALA A 1 895 ? 40.480  -27.379 48.665 1.00 46.78 ? 895  ALA A N     1 
ATOM   7364 C  CA    . ALA A 1 895 ? 41.610  -28.219 49.064 1.00 48.47 ? 895  ALA A CA    1 
ATOM   7365 C  C     . ALA A 1 895 ? 41.760  -28.256 50.586 1.00 49.32 ? 895  ALA A C     1 
ATOM   7366 O  O     . ALA A 1 895 ? 41.504  -27.259 51.268 1.00 49.58 ? 895  ALA A O     1 
ATOM   7367 C  CB    . ALA A 1 895 ? 42.893  -27.725 48.413 1.00 48.64 ? 895  ALA A CB    1 
ATOM   7368 N  N     . SER A 1 896 ? 42.159  -29.413 51.108 1.00 50.30 ? 896  SER A N     1 
ATOM   7369 C  CA    . SER A 1 896 ? 42.394  -29.580 52.544 1.00 51.76 ? 896  SER A CA    1 
ATOM   7370 C  C     . SER A 1 896 ? 43.673  -30.381 52.803 1.00 53.03 ? 896  SER A C     1 
ATOM   7371 O  O     . SER A 1 896 ? 44.283  -30.912 51.870 1.00 52.49 ? 896  SER A O     1 
ATOM   7372 C  CB    . SER A 1 896 ? 41.191  -30.251 53.217 1.00 51.10 ? 896  SER A CB    1 
ATOM   7373 O  OG    . SER A 1 896 ? 41.059  -31.600 52.805 1.00 52.79 ? 896  SER A OG    1 
ATOM   7374 N  N     . LEU A 1 897 ? 44.065  -30.467 54.073 1.00 54.97 ? 897  LEU A N     1 
ATOM   7375 C  CA    . LEU A 1 897 ? 45.280  -31.184 54.471 1.00 57.09 ? 897  LEU A CA    1 
ATOM   7376 C  C     . LEU A 1 897 ? 45.210  -32.698 54.242 1.00 57.92 ? 897  LEU A C     1 
ATOM   7377 O  O     . LEU A 1 897 ? 46.245  -33.358 54.130 1.00 59.11 ? 897  LEU A O     1 
ATOM   7378 C  CB    . LEU A 1 897 ? 45.638  -30.872 55.932 1.00 58.43 ? 897  LEU A CB    1 
ATOM   7379 C  CG    . LEU A 1 897 ? 46.617  -29.721 56.210 1.00 59.04 ? 897  LEU A CG    1 
ATOM   7380 C  CD1   . LEU A 1 897 ? 46.095  -28.363 55.741 1.00 58.59 ? 897  LEU A CD1   1 
ATOM   7381 C  CD2   . LEU A 1 897 ? 46.961  -29.669 57.692 1.00 60.48 ? 897  LEU A CD2   1 
ATOM   7382 N  N     . PHE A 1 898 ? 43.993  -33.236 54.160 1.00 58.45 ? 898  PHE A N     1 
ATOM   7383 C  CA    . PHE A 1 898 ? 43.784  -34.674 53.961 1.00 60.05 ? 898  PHE A CA    1 
ATOM   7384 C  C     . PHE A 1 898 ? 44.185  -35.193 52.582 1.00 61.12 ? 898  PHE A C     1 
ATOM   7385 O  O     . PHE A 1 898 ? 44.513  -36.375 52.432 1.00 61.97 ? 898  PHE A O     1 
ATOM   7386 C  CB    . PHE A 1 898 ? 42.340  -35.060 54.282 1.00 60.07 ? 898  PHE A CB    1 
ATOM   7387 C  CG    . PHE A 1 898 ? 42.130  -35.428 55.717 1.00 61.21 ? 898  PHE A CG    1 
ATOM   7388 C  CD1   . PHE A 1 898 ? 42.092  -36.764 56.105 1.00 62.78 ? 898  PHE A CD1   1 
ATOM   7389 C  CD2   . PHE A 1 898 ? 42.000  -34.441 56.688 1.00 61.18 ? 898  PHE A CD2   1 
ATOM   7390 C  CE1   . PHE A 1 898 ? 41.911  -37.113 57.436 1.00 62.49 ? 898  PHE A CE1   1 
ATOM   7391 C  CE2   . PHE A 1 898 ? 41.824  -34.780 58.021 1.00 63.02 ? 898  PHE A CE2   1 
ATOM   7392 C  CZ    . PHE A 1 898 ? 41.777  -36.119 58.395 1.00 62.95 ? 898  PHE A CZ    1 
ATOM   7393 N  N     . ASP A 1 899 ? 44.170  -34.301 51.591 1.00 60.95 ? 899  ASP A N     1 
ATOM   7394 C  CA    . ASP A 1 899 ? 44.578  -34.625 50.221 1.00 62.17 ? 899  ASP A CA    1 
ATOM   7395 C  C     . ASP A 1 899 ? 46.005  -35.194 50.131 1.00 64.16 ? 899  ASP A C     1 
ATOM   7396 O  O     . ASP A 1 899 ? 46.394  -35.749 49.101 1.00 64.87 ? 899  ASP A O     1 
ATOM   7397 C  CB    . ASP A 1 899 ? 44.441  -33.388 49.319 1.00 61.69 ? 899  ASP A CB    1 
ATOM   7398 C  CG    . ASP A 1 899 ? 43.035  -32.793 49.334 1.00 61.34 ? 899  ASP A CG    1 
ATOM   7399 O  OD1   . ASP A 1 899 ? 42.087  -33.474 49.782 1.00 61.73 ? 899  ASP A OD1   1 
ATOM   7400 O  OD2   . ASP A 1 899 ? 42.878  -31.633 48.892 1.00 60.65 ? 899  ASP A OD2   1 
ATOM   7401 N  N     . MET A 1 900 ? 46.766  -35.065 51.218 1.00 65.19 ? 900  MET A N     1 
ATOM   7402 C  CA    . MET A 1 900 ? 48.158  -35.531 51.276 1.00 67.31 ? 900  MET A CA    1 
ATOM   7403 C  C     . MET A 1 900 ? 48.290  -37.022 51.612 1.00 68.28 ? 900  MET A C     1 
ATOM   7404 O  O     . MET A 1 900 ? 49.403  -37.527 51.795 1.00 69.44 ? 900  MET A O     1 
ATOM   7405 C  CB    . MET A 1 900 ? 48.959  -34.695 52.283 1.00 68.05 ? 900  MET A CB    1 
ATOM   7406 C  CG    . MET A 1 900 ? 49.017  -33.205 51.965 1.00 68.50 ? 900  MET A CG    1 
ATOM   7407 S  SD    . MET A 1 900 ? 49.976  -32.262 53.168 1.00 69.88 ? 900  MET A SD    1 
ATOM   7408 C  CE    . MET A 1 900 ? 51.649  -32.573 52.603 1.00 71.26 ? 900  MET A CE    1 
ATOM   7409 N  N     . PHE A 1 901 ? 47.158  -37.721 51.685 1.00 67.84 ? 901  PHE A N     1 
ATOM   7410 C  CA    . PHE A 1 901 ? 47.143  -39.141 52.035 1.00 69.05 ? 901  PHE A CA    1 
ATOM   7411 C  C     . PHE A 1 901 ? 46.650  -40.023 50.891 1.00 69.51 ? 901  PHE A C     1 
ATOM   7412 O  O     . PHE A 1 901 ? 47.158  -41.128 50.688 1.00 70.55 ? 901  PHE A O     1 
ATOM   7413 C  CB    . PHE A 1 901 ? 46.299  -39.374 53.293 1.00 68.44 ? 901  PHE A CB    1 
ATOM   7414 C  CG    . PHE A 1 901 ? 46.933  -38.849 54.549 1.00 67.68 ? 901  PHE A CG    1 
ATOM   7415 C  CD1   . PHE A 1 901 ? 47.750  -39.667 55.326 1.00 68.25 ? 901  PHE A CD1   1 
ATOM   7416 C  CD2   . PHE A 1 901 ? 46.724  -37.534 54.953 1.00 65.60 ? 901  PHE A CD2   1 
ATOM   7417 C  CE1   . PHE A 1 901 ? 48.344  -39.187 56.487 1.00 67.51 ? 901  PHE A CE1   1 
ATOM   7418 C  CE2   . PHE A 1 901 ? 47.315  -37.044 56.109 1.00 65.98 ? 901  PHE A CE2   1 
ATOM   7419 C  CZ    . PHE A 1 901 ? 48.127  -37.873 56.880 1.00 66.87 ? 901  PHE A CZ    1 
ATOM   7420 O  "O5'" . DT  B 2 1   ? -1.462  -5.677  27.699 1.00 41.39 ? 1    DT  T "O5'" 1 
ATOM   7421 C  "C5'" . DT  B 2 1   ? -0.048  -5.617  27.481 1.00 41.72 ? 1    DT  T "C5'" 1 
ATOM   7422 C  "C4'" . DT  B 2 1   ? 0.289   -5.174  26.059 1.00 38.84 ? 1    DT  T "C4'" 1 
ATOM   7423 O  "O4'" . DT  B 2 1   ? 1.729   -5.055  25.891 1.00 38.46 ? 1    DT  T "O4'" 1 
ATOM   7424 C  "C3'" . DT  B 2 1   ? -0.133  -6.115  24.938 1.00 36.44 ? 1    DT  T "C3'" 1 
ATOM   7425 O  "O3'" . DT  B 2 1   ? -0.341  -5.354  23.752 1.00 34.45 ? 1    DT  T "O3'" 1 
ATOM   7426 C  "C2'" . DT  B 2 1   ? 1.090   -7.015  24.791 1.00 35.77 ? 1    DT  T "C2'" 1 
ATOM   7427 C  "C1'" . DT  B 2 1   ? 2.158   -5.930  24.858 1.00 36.72 ? 1    DT  T "C1'" 1 
ATOM   7428 N  N1    . DT  B 2 1   ? 3.551   -6.365  25.164 1.00 35.75 ? 1    DT  T N1    1 
ATOM   7429 C  C2    . DT  B 2 1   ? 4.559   -6.073  24.256 1.00 35.90 ? 1    DT  T C2    1 
ATOM   7430 O  O2    . DT  B 2 1   ? 4.384   -5.495  23.194 1.00 35.17 ? 1    DT  T O2    1 
ATOM   7431 N  N3    . DT  B 2 1   ? 5.805   -6.500  24.639 1.00 35.11 ? 1    DT  T N3    1 
ATOM   7432 C  C4    . DT  B 2 1   ? 6.140   -7.162  25.815 1.00 36.45 ? 1    DT  T C4    1 
ATOM   7433 O  O4    . DT  B 2 1   ? 7.298   -7.488  26.058 1.00 31.22 ? 1    DT  T O4    1 
ATOM   7434 C  C5    . DT  B 2 1   ? 5.043   -7.430  26.721 1.00 36.38 ? 1    DT  T C5    1 
ATOM   7435 C  C7    . DT  B 2 1   ? 5.270   -8.142  28.022 1.00 36.09 ? 1    DT  T C7    1 
ATOM   7436 C  C6    . DT  B 2 1   ? 3.817   -7.019  26.359 1.00 37.38 ? 1    DT  T C6    1 
ATOM   7437 P  P     . DC  B 2 2   ? -1.762  -5.347  23.022 1.00 32.26 ? 2    DC  T P     1 
ATOM   7438 O  OP1   . DC  B 2 2   ? -2.358  -6.699  23.124 1.00 31.95 ? 2    DC  T OP1   1 
ATOM   7439 O  OP2   . DC  B 2 2   ? -1.573  -4.719  21.693 1.00 30.01 ? 2    DC  T OP2   1 
ATOM   7440 O  "O5'" . DC  B 2 2   ? -2.636  -4.373  23.947 1.00 32.51 ? 2    DC  T "O5'" 1 
ATOM   7441 C  "C5'" . DC  B 2 2   ? -2.316  -2.989  24.029 1.00 30.23 ? 2    DC  T "C5'" 1 
ATOM   7442 C  "C4'" . DC  B 2 2   ? -3.249  -2.270  24.986 1.00 26.89 ? 2    DC  T "C4'" 1 
ATOM   7443 O  "O4'" . DC  B 2 2   ? -4.625  -2.358  24.532 1.00 26.63 ? 2    DC  T "O4'" 1 
ATOM   7444 C  "C3'" . DC  B 2 2   ? -3.235  -2.777  26.426 1.00 28.00 ? 2    DC  T "C3'" 1 
ATOM   7445 O  "O3'" . DC  B 2 2   ? -3.233  -1.624  27.265 1.00 30.60 ? 2    DC  T "O3'" 1 
ATOM   7446 C  "C2'" . DC  B 2 2   ? -4.514  -3.609  26.538 1.00 26.69 ? 2    DC  T "C2'" 1 
ATOM   7447 C  "C1'" . DC  B 2 2   ? -5.444  -2.908  25.547 1.00 26.04 ? 2    DC  T "C1'" 1 
ATOM   7448 N  N1    . DC  B 2 2   ? -6.475  -3.749  24.843 1.00 26.45 ? 2    DC  T N1    1 
ATOM   7449 C  C2    . DC  B 2 2   ? -7.808  -3.301  24.787 1.00 27.28 ? 2    DC  T C2    1 
ATOM   7450 O  O2    . DC  B 2 2   ? -8.121  -2.235  25.334 1.00 27.71 ? 2    DC  T O2    1 
ATOM   7451 N  N3    . DC  B 2 2   ? -8.732  -4.056  24.129 1.00 24.26 ? 2    DC  T N3    1 
ATOM   7452 C  C4    . DC  B 2 2   ? -8.358  -5.204  23.540 1.00 26.57 ? 2    DC  T C4    1 
ATOM   7453 N  N4    . DC  B 2 2   ? -9.299  -5.911  22.904 1.00 24.74 ? 2    DC  T N4    1 
ATOM   7454 C  C5    . DC  B 2 2   ? -7.007  -5.674  23.581 1.00 24.03 ? 2    DC  T C5    1 
ATOM   7455 C  C6    . DC  B 2 2   ? -6.111  -4.920  24.227 1.00 26.86 ? 2    DC  T C6    1 
ATOM   7456 P  P     . DG  B 2 3   ? -2.864  -1.690  28.821 1.00 32.90 ? 3    DG  T P     1 
ATOM   7457 O  OP1   . DG  B 2 3   ? -2.450  -0.335  29.246 1.00 35.29 ? 3    DG  T OP1   1 
ATOM   7458 O  OP2   . DG  B 2 3   ? -1.997  -2.864  29.071 1.00 32.53 ? 3    DG  T OP2   1 
ATOM   7459 O  "O5'" . DG  B 2 3   ? -4.280  -2.016  29.476 1.00 29.88 ? 3    DG  T "O5'" 1 
ATOM   7460 C  "C5'" . DG  B 2 3   ? -5.390  -1.119  29.385 1.00 31.05 ? 3    DG  T "C5'" 1 
ATOM   7461 C  "C4'" . DG  B 2 3   ? -6.577  -1.808  30.030 1.00 31.89 ? 3    DG  T "C4'" 1 
ATOM   7462 O  "O4'" . DG  B 2 3   ? -6.959  -2.932  29.196 1.00 32.41 ? 3    DG  T "O4'" 1 
ATOM   7463 C  "C3'" . DG  B 2 3   ? -6.259  -2.378  31.417 1.00 31.33 ? 3    DG  T "C3'" 1 
ATOM   7464 O  "O3'" . DG  B 2 3   ? -7.347  -2.306  32.304 1.00 34.58 ? 3    DG  T "O3'" 1 
ATOM   7465 C  "C2'" . DG  B 2 3   ? -6.007  -3.854  31.153 1.00 32.02 ? 3    DG  T "C2'" 1 
ATOM   7466 C  "C1'" . DG  B 2 3   ? -6.951  -4.109  29.983 1.00 33.09 ? 3    DG  T "C1'" 1 
ATOM   7467 N  N9    . DG  B 2 3   ? -6.513  -5.253  29.197 1.00 31.85 ? 3    DG  T N9    1 
ATOM   7468 C  C8    . DG  B 2 3   ? -5.293  -5.877  29.296 1.00 32.69 ? 3    DG  T C8    1 
ATOM   7469 N  N7    . DG  B 2 3   ? -5.156  -6.883  28.484 1.00 32.79 ? 3    DG  T N7    1 
ATOM   7470 C  C5    . DG  B 2 3   ? -6.365  -6.934  27.810 1.00 30.79 ? 3    DG  T C5    1 
ATOM   7471 C  C6    . DG  B 2 3   ? -6.789  -7.831  26.801 1.00 31.29 ? 3    DG  T C6    1 
ATOM   7472 O  O6    . DG  B 2 3   ? -6.147  -8.766  26.314 1.00 35.09 ? 3    DG  T O6    1 
ATOM   7473 N  N1    . DG  B 2 3   ? -8.082  -7.560  26.363 1.00 28.43 ? 3    DG  T N1    1 
ATOM   7474 C  C2    . DG  B 2 3   ? -8.865  -6.533  26.838 1.00 28.68 ? 3    DG  T C2    1 
ATOM   7475 N  N2    . DG  B 2 3   ? -10.083 -6.432  26.291 1.00 28.61 ? 3    DG  T N2    1 
ATOM   7476 N  N3    . DG  B 2 3   ? -8.475  -5.677  27.785 1.00 28.60 ? 3    DG  T N3    1 
ATOM   7477 C  C4    . DG  B 2 3   ? -7.219  -5.939  28.230 1.00 29.05 ? 3    DG  T C4    1 
ATOM   7478 P  P     . DT  B 2 4   ? -7.642  -1.061  33.236 1.00 28.50 ? 4    DT  T P     1 
ATOM   7479 O  OP1   . DT  B 2 4   ? -9.083  -1.180  33.544 1.00 28.22 ? 4    DT  T OP1   1 
ATOM   7480 O  OP2   . DT  B 2 4   ? -7.151  0.183   32.586 1.00 30.63 ? 4    DT  T OP2   1 
ATOM   7481 O  "O5'" . DT  B 2 4   ? -6.828  -1.305  34.576 1.00 29.72 ? 4    DT  T "O5'" 1 
ATOM   7482 C  "C5'" . DT  B 2 4   ? -5.551  -0.706  34.810 1.00 23.63 ? 4    DT  T "C5'" 1 
ATOM   7483 C  "C4'" . DT  B 2 4   ? -5.451  -0.307  36.270 1.00 20.68 ? 4    DT  T "C4'" 1 
ATOM   7484 O  "O4'" . DT  B 2 4   ? -6.077  -1.318  37.104 1.00 20.41 ? 4    DT  T "O4'" 1 
ATOM   7485 C  "C3'" . DT  B 2 4   ? -4.032  -0.204  36.799 1.00 17.26 ? 4    DT  T "C3'" 1 
ATOM   7486 O  "O3'" . DT  B 2 4   ? -3.509  1.057   36.462 1.00 19.58 ? 4    DT  T "O3'" 1 
ATOM   7487 C  "C2'" . DT  B 2 4   ? -4.310  -0.352  38.289 1.00 19.94 ? 4    DT  T "C2'" 1 
ATOM   7488 C  "C1'" . DT  B 2 4   ? -5.293  -1.524  38.266 1.00 18.82 ? 4    DT  T "C1'" 1 
ATOM   7489 N  N1    . DT  B 2 4   ? -4.588  -2.850  38.201 1.00 21.15 ? 4    DT  T N1    1 
ATOM   7490 C  C2    . DT  B 2 4   ? -3.883  -3.282  39.310 1.00 21.46 ? 4    DT  T C2    1 
ATOM   7491 O  O2    . DT  B 2 4   ? -3.830  -2.634  40.342 1.00 19.64 ? 4    DT  T O2    1 
ATOM   7492 N  N3    . DT  B 2 4   ? -3.250  -4.500  39.154 1.00 22.92 ? 4    DT  T N3    1 
ATOM   7493 C  C4    . DT  B 2 4   ? -3.266  -5.294  38.010 1.00 26.07 ? 4    DT  T C4    1 
ATOM   7494 O  O4    . DT  B 2 4   ? -2.679  -6.369  37.941 1.00 27.27 ? 4    DT  T O4    1 
ATOM   7495 C  C5    . DT  B 2 4   ? -4.023  -4.779  36.888 1.00 26.79 ? 4    DT  T C5    1 
ATOM   7496 C  C7    . DT  B 2 4   ? -4.119  -5.547  35.597 1.00 28.25 ? 4    DT  T C7    1 
ATOM   7497 C  C6    . DT  B 2 4   ? -4.636  -3.601  37.039 1.00 22.37 ? 4    DT  T C6    1 
ATOM   7498 P  P     . DG  B 2 5   ? -1.948  1.279   36.226 1.00 21.26 ? 5    DG  T P     1 
ATOM   7499 O  OP1   . DG  B 2 5   ? -1.805  2.659   35.711 1.00 20.36 ? 5    DG  T OP1   1 
ATOM   7500 O  OP2   . DG  B 2 5   ? -1.362  0.120   35.519 1.00 21.62 ? 5    DG  T OP2   1 
ATOM   7501 O  "O5'" . DG  B 2 5   ? -1.380  1.209   37.719 1.00 19.24 ? 5    DG  T "O5'" 1 
ATOM   7502 C  "C5'" . DG  B 2 5   ? -1.729  2.212   38.668 1.00 16.87 ? 5    DG  T "C5'" 1 
ATOM   7503 C  "C4'" . DG  B 2 5   ? -1.164  1.830   40.024 1.00 14.66 ? 5    DG  T "C4'" 1 
ATOM   7504 O  "O4'" . DG  B 2 5   ? -1.653  0.526   40.420 1.00 13.70 ? 5    DG  T "O4'" 1 
ATOM   7505 C  "C3'" . DG  B 2 5   ? 0.344   1.661   40.078 1.00 14.79 ? 5    DG  T "C3'" 1 
ATOM   7506 O  "O3'" . DG  B 2 5   ? 0.960   2.941   40.166 1.00 15.22 ? 5    DG  T "O3'" 1 
ATOM   7507 C  "C2'" . DG  B 2 5   ? 0.487   0.871   41.377 1.00 15.12 ? 5    DG  T "C2'" 1 
ATOM   7508 C  "C1'" . DG  B 2 5   ? -0.683  -0.096  41.253 1.00 15.88 ? 5    DG  T "C1'" 1 
ATOM   7509 N  N9    . DG  B 2 5   ? -0.298  -1.397  40.695 1.00 15.63 ? 5    DG  T N9    1 
ATOM   7510 C  C8    . DG  B 2 5   ? -0.595  -1.895  39.448 1.00 16.82 ? 5    DG  T C8    1 
ATOM   7511 N  N7    . DG  B 2 5   ? -0.116  -3.093  39.237 1.00 17.16 ? 5    DG  T N7    1 
ATOM   7512 C  C5    . DG  B 2 5   ? 0.545   -3.412  40.416 1.00 17.33 ? 5    DG  T C5    1 
ATOM   7513 C  C6    . DG  B 2 5   ? 1.251   -4.588  40.788 1.00 18.14 ? 5    DG  T C6    1 
ATOM   7514 O  O6    . DG  B 2 5   ? 1.452   -5.616  40.116 1.00 18.59 ? 5    DG  T O6    1 
ATOM   7515 N  N1    . DG  B 2 5   ? 1.773   -4.503  42.080 1.00 16.21 ? 5    DG  T N1    1 
ATOM   7516 C  C2    . DG  B 2 5   ? 1.610   -3.413  42.917 1.00 17.90 ? 5    DG  T C2    1 
ATOM   7517 N  N2    . DG  B 2 5   ? 2.167   -3.494  44.132 1.00 16.51 ? 5    DG  T N2    1 
ATOM   7518 N  N3    . DG  B 2 5   ? 0.943   -2.315  42.580 1.00 16.37 ? 5    DG  T N3    1 
ATOM   7519 C  C4    . DG  B 2 5   ? 0.438   -2.376  41.324 1.00 16.00 ? 5    DG  T C4    1 
ATOM   7520 P  P     . DT  B 2 6   ? 2.512   3.174   39.889 1.00 18.12 ? 6    DT  T P     1 
ATOM   7521 O  OP1   . DT  B 2 6   ? 2.746   4.630   39.840 1.00 19.26 ? 6    DT  T OP1   1 
ATOM   7522 O  OP2   . DT  B 2 6   ? 2.971   2.310   38.766 1.00 16.69 ? 6    DT  T OP2   1 
ATOM   7523 O  "O5'" . DT  B 2 6   ? 3.202   2.573   41.186 1.00 17.92 ? 6    DT  T "O5'" 1 
ATOM   7524 C  "C5'" . DT  B 2 6   ? 3.011   3.146   42.488 1.00 15.10 ? 6    DT  T "C5'" 1 
ATOM   7525 C  "C4'" . DT  B 2 6   ? 3.937   2.439   43.455 1.00 16.93 ? 6    DT  T "C4'" 1 
ATOM   7526 O  "O4'" . DT  B 2 6   ? 3.732   1.003   43.380 1.00 17.81 ? 6    DT  T "O4'" 1 
ATOM   7527 C  "C3'" . DT  B 2 6   ? 5.423   2.674   43.200 1.00 15.61 ? 6    DT  T "C3'" 1 
ATOM   7528 O  "O3'" . DT  B 2 6   ? 6.083   2.700   44.462 1.00 17.55 ? 6    DT  T "O3'" 1 
ATOM   7529 C  "C2'" . DT  B 2 6   ? 5.839   1.448   42.394 1.00 16.84 ? 6    DT  T "C2'" 1 
ATOM   7530 C  "C1'" . DT  B 2 6   ? 4.952   0.380   43.029 1.00 17.29 ? 6    DT  T "C1'" 1 
ATOM   7531 N  N1    . DT  B 2 6   ? 4.694   -0.765  42.116 1.00 15.94 ? 6    DT  T N1    1 
ATOM   7532 C  C2    . DT  B 2 6   ? 5.131   -2.029  42.487 1.00 16.89 ? 6    DT  T C2    1 
ATOM   7533 O  O2    . DT  B 2 6   ? 5.706   -2.284  43.536 1.00 17.00 ? 6    DT  T O2    1 
ATOM   7534 N  N3    . DT  B 2 6   ? 4.862   -3.019  41.569 1.00 14.55 ? 6    DT  T N3    1 
ATOM   7535 C  C4    . DT  B 2 6   ? 4.227   -2.871  40.344 1.00 17.44 ? 6    DT  T C4    1 
ATOM   7536 O  O4    . DT  B 2 6   ? 4.045   -3.831  39.600 1.00 16.66 ? 6    DT  T O4    1 
ATOM   7537 C  C5    . DT  B 2 6   ? 3.801   -1.525  40.011 1.00 16.18 ? 6    DT  T C5    1 
ATOM   7538 C  C7    . DT  B 2 6   ? 3.100   -1.250  38.707 1.00 14.29 ? 6    DT  T C7    1 
ATOM   7539 C  C6    . DT  B 2 6   ? 4.053   -0.548  40.896 1.00 17.78 ? 6    DT  T C6    1 
ATOM   7540 P  P     . DA  B 2 7   ? 7.659   2.837   44.684 1.00 18.59 ? 7    DA  T P     1 
ATOM   7541 O  OP1   . DA  B 2 7   ? 7.795   3.565   45.970 1.00 18.17 ? 7    DA  T OP1   1 
ATOM   7542 O  OP2   . DA  B 2 7   ? 8.313   3.383   43.458 1.00 16.43 ? 7    DA  T OP2   1 
ATOM   7543 O  "O5'" . DA  B 2 7   ? 8.187   1.351   44.874 1.00 17.67 ? 7    DA  T "O5'" 1 
ATOM   7544 C  "C5'" . DA  B 2 7   ? 7.817   0.565   46.029 1.00 17.35 ? 7    DA  T "C5'" 1 
ATOM   7545 C  "C4'" . DA  B 2 7   ? 8.779   -0.608  46.206 1.00 17.43 ? 7    DA  T "C4'" 1 
ATOM   7546 O  "O4'" . DA  B 2 7   ? 8.505   -1.642  45.215 1.00 15.46 ? 7    DA  T "O4'" 1 
ATOM   7547 C  "C3'" . DA  B 2 7   ? 10.259  -0.276  46.063 1.00 18.18 ? 7    DA  T "C3'" 1 
ATOM   7548 O  "O3'" . DA  B 2 7   ? 10.983  -1.033  47.035 1.00 17.31 ? 7    DA  T "O3'" 1 
ATOM   7549 C  "C2'" . DA  B 2 7   ? 10.593  -0.690  44.623 1.00 16.80 ? 7    DA  T "C2'" 1 
ATOM   7550 C  "C1'" . DA  B 2 7   ? 9.651   -1.869  44.408 1.00 16.90 ? 7    DA  T "C1'" 1 
ATOM   7551 N  N9    . DA  B 2 7   ? 9.096   -2.031  43.077 1.00 13.88 ? 7    DA  T N9    1 
ATOM   7552 C  C8    . DA  B 2 7   ? 8.482   -1.080  42.314 1.00 17.23 ? 7    DA  T C8    1 
ATOM   7553 N  N7    . DA  B 2 7   ? 8.045   -1.536  41.163 1.00 16.53 ? 7    DA  T N7    1 
ATOM   7554 C  C5    . DA  B 2 7   ? 8.380   -2.872  41.178 1.00 15.26 ? 7    DA  T C5    1 
ATOM   7555 C  C6    . DA  B 2 7   ? 8.196   -3.908  40.239 1.00 17.64 ? 7    DA  T C6    1 
ATOM   7556 N  N6    . DA  B 2 7   ? 7.583   -3.732  39.057 1.00 16.79 ? 7    DA  T N6    1 
ATOM   7557 N  N1    . DA  B 2 7   ? 8.661   -5.136  40.562 1.00 16.07 ? 7    DA  T N1    1 
ATOM   7558 C  C2    . DA  B 2 7   ? 9.272   -5.312  41.743 1.00 18.32 ? 7    DA  T C2    1 
ATOM   7559 N  N3    . DA  B 2 7   ? 9.505   -4.411  42.704 1.00 16.29 ? 7    DA  T N3    1 
ATOM   7560 C  C4    . DA  B 2 7   ? 9.030   -3.201  42.355 1.00 16.17 ? 7    DA  T C4    1 
ATOM   7561 P  P     . DA  B 2 8   ? 12.571  -0.948  47.209 1.00 19.75 ? 8    DA  T P     1 
ATOM   7562 O  OP1   . DA  B 2 8   ? 12.883  -1.448  48.566 1.00 19.66 ? 8    DA  T OP1   1 
ATOM   7563 O  OP2   . DA  B 2 8   ? 13.060  0.377   46.770 1.00 17.00 ? 8    DA  T OP2   1 
ATOM   7564 O  "O5'" . DA  B 2 8   ? 13.085  -1.992  46.124 1.00 21.88 ? 8    DA  T "O5'" 1 
ATOM   7565 C  "C5'" . DA  B 2 8   ? 12.866  -3.380  46.305 1.00 20.63 ? 8    DA  T "C5'" 1 
ATOM   7566 C  "C4'" . DA  B 2 8   ? 13.453  -4.107  45.114 1.00 17.79 ? 8    DA  T "C4'" 1 
ATOM   7567 O  "O4'" . DA  B 2 8   ? 12.542  -3.945  44.000 1.00 18.56 ? 8    DA  T "O4'" 1 
ATOM   7568 C  "C3'" . DA  B 2 8   ? 14.810  -3.578  44.645 1.00 19.13 ? 8    DA  T "C3'" 1 
ATOM   7569 O  "O3'" . DA  B 2 8   ? 15.710  -4.664  44.531 1.00 22.08 ? 8    DA  T "O3'" 1 
ATOM   7570 C  "C2'" . DA  B 2 8   ? 14.520  -2.979  43.272 1.00 18.63 ? 8    DA  T "C2'" 1 
ATOM   7571 C  "C1'" . DA  B 2 8   ? 13.362  -3.883  42.857 1.00 20.48 ? 8    DA  T "C1'" 1 
ATOM   7572 N  N9    . DA  B 2 8   ? 12.645  -3.421  41.675 1.00 20.24 ? 8    DA  T N9    1 
ATOM   7573 C  C8    . DA  B 2 8   ? 12.267  -2.141  41.362 1.00 21.72 ? 8    DA  T C8    1 
ATOM   7574 N  N7    . DA  B 2 8   ? 11.664  -2.047  40.199 1.00 20.37 ? 8    DA  T N7    1 
ATOM   7575 C  C5    . DA  B 2 8   ? 11.658  -3.349  39.719 1.00 19.47 ? 8    DA  T C5    1 
ATOM   7576 C  C6    . DA  B 2 8   ? 11.165  -3.940  38.534 1.00 20.52 ? 8    DA  T C6    1 
ATOM   7577 N  N6    . DA  B 2 8   ? 10.553  -3.260  37.565 1.00 21.09 ? 8    DA  T N6    1 
ATOM   7578 N  N1    . DA  B 2 8   ? 11.330  -5.273  38.376 1.00 21.70 ? 8    DA  T N1    1 
ATOM   7579 C  C2    . DA  B 2 8   ? 11.937  -5.982  39.338 1.00 21.16 ? 8    DA  T C2    1 
ATOM   7580 N  N3    . DA  B 2 8   ? 12.437  -5.537  40.490 1.00 18.84 ? 8    DA  T N3    1 
ATOM   7581 C  C4    . DA  B 2 8   ? 12.263  -4.207  40.617 1.00 20.04 ? 8    DA  T C4    1 
ATOM   7582 P  P     . DG  B 2 9   ? 17.286  -4.519  44.774 1.00 20.59 ? 9    DG  T P     1 
ATOM   7583 O  OP1   . DG  B 2 9   ? 17.561  -4.572  46.224 1.00 22.09 ? 9    DG  T OP1   1 
ATOM   7584 O  OP2   . DG  B 2 9   ? 17.806  -3.382  43.975 1.00 21.26 ? 9    DG  T OP2   1 
ATOM   7585 O  "O5'" . DG  B 2 9   ? 17.803  -5.852  44.078 1.00 21.90 ? 9    DG  T "O5'" 1 
ATOM   7586 C  "C5'" . DG  B 2 9   ? 17.281  -7.118  44.476 1.00 22.40 ? 9    DG  T "C5'" 1 
ATOM   7587 C  "C4'" . DG  B 2 9   ? 17.109  -7.968  43.237 1.00 24.12 ? 9    DG  T "C4'" 1 
ATOM   7588 O  "O4'" . DG  B 2 9   ? 16.056  -7.385  42.459 1.00 20.95 ? 9    DG  T "O4'" 1 
ATOM   7589 C  "C3'" . DG  B 2 9   ? 18.313  -7.922  42.316 1.00 25.47 ? 9    DG  T "C3'" 1 
ATOM   7590 O  "O3'" . DG  B 2 9   ? 19.112  -9.030  42.604 1.00 25.12 ? 9    DG  T "O3'" 1 
ATOM   7591 C  "C2'" . DG  B 2 9   ? 17.737  -8.026  40.910 1.00 25.58 ? 9    DG  T "C2'" 1 
ATOM   7592 C  "C1'" . DG  B 2 9   ? 16.281  -7.666  41.093 1.00 25.10 ? 9    DG  T "C1'" 1 
ATOM   7593 N  N9    . DG  B 2 9   ? 15.883  -6.485  40.343 1.00 23.81 ? 9    DG  T N9    1 
ATOM   7594 C  C8    . DG  B 2 9   ? 15.822  -5.197  40.808 1.00 23.78 ? 9    DG  T C8    1 
ATOM   7595 N  N7    . DG  B 2 9   ? 15.404  -4.350  39.911 1.00 22.04 ? 9    DG  T N7    1 
ATOM   7596 C  C5    . DG  B 2 9   ? 15.178  -5.135  38.786 1.00 22.34 ? 9    DG  T C5    1 
ATOM   7597 C  C6    . DG  B 2 9   ? 14.710  -4.778  37.502 1.00 19.57 ? 9    DG  T C6    1 
ATOM   7598 O  O6    . DG  B 2 9   ? 14.398  -3.652  37.112 1.00 21.09 ? 9    DG  T O6    1 
ATOM   7599 N  N1    . DG  B 2 9   ? 14.618  -5.872  36.635 1.00 18.36 ? 9    DG  T N1    1 
ATOM   7600 C  C2    . DG  B 2 9   ? 14.941  -7.163  36.991 1.00 22.03 ? 9    DG  T C2    1 
ATOM   7601 N  N2    . DG  B 2 9   ? 14.808  -8.104  36.049 1.00 22.38 ? 9    DG  T N2    1 
ATOM   7602 N  N3    . DG  B 2 9   ? 15.375  -7.513  38.196 1.00 23.56 ? 9    DG  T N3    1 
ATOM   7603 C  C4    . DG  B 2 9   ? 15.465  -6.452  39.038 1.00 23.57 ? 9    DG  T C4    1 
ATOM   7604 P  P     . DC  B 2 10  ? 20.612  -9.133  42.075 1.00 28.27 ? 10   DC  T P     1 
ATOM   7605 O  OP1   . DC  B 2 10  ? 21.172  -10.298 42.787 1.00 26.09 ? 10   DC  T OP1   1 
ATOM   7606 O  OP2   . DC  B 2 10  ? 21.269  -7.807  42.151 1.00 27.11 ? 10   DC  T OP2   1 
ATOM   7607 O  "O5'" . DC  B 2 10  ? 20.434  -9.464  40.523 1.00 25.67 ? 10   DC  T "O5'" 1 
ATOM   7608 C  "C5'" . DC  B 2 10  ? 19.958  -10.746 40.126 1.00 25.35 ? 10   DC  T "C5'" 1 
ATOM   7609 C  "C4'" . DC  B 2 10  ? 19.998  -10.835 38.615 1.00 25.65 ? 10   DC  T "C4'" 1 
ATOM   7610 O  "O4'" . DC  B 2 10  ? 19.105  -9.846  38.043 1.00 25.87 ? 10   DC  T "O4'" 1 
ATOM   7611 C  "C3'" . DC  B 2 10  ? 21.374  -10.591 37.997 1.00 25.89 ? 10   DC  T "C3'" 1 
ATOM   7612 O  "O3'" . DC  B 2 10  ? 21.564  -11.580 37.002 1.00 26.63 ? 10   DC  T "O3'" 1 
ATOM   7613 C  "C2'" . DC  B 2 10  ? 21.280  -9.188  37.408 1.00 24.79 ? 10   DC  T "C2'" 1 
ATOM   7614 C  "C1'" . DC  B 2 10  ? 19.798  -9.090  37.062 1.00 24.74 ? 10   DC  T "C1'" 1 
ATOM   7615 N  N1    . DC  B 2 10  ? 19.268  -7.685  37.039 1.00 24.93 ? 10   DC  T N1    1 
ATOM   7616 C  C2    . DC  B 2 10  ? 18.547  -7.222  35.921 1.00 23.17 ? 10   DC  T C2    1 
ATOM   7617 O  O2    . DC  B 2 10  ? 18.355  -7.975  34.961 1.00 24.99 ? 10   DC  T O2    1 
ATOM   7618 N  N3    . DC  B 2 10  ? 18.070  -5.947  35.919 1.00 22.48 ? 10   DC  T N3    1 
ATOM   7619 C  C4    . DC  B 2 10  ? 18.289  -5.149  36.967 1.00 24.73 ? 10   DC  T C4    1 
ATOM   7620 N  N4    . DC  B 2 10  ? 17.801  -3.903  36.916 1.00 22.93 ? 10   DC  T N4    1 
ATOM   7621 C  C5    . DC  B 2 10  ? 19.022  -5.594  38.114 1.00 24.95 ? 10   DC  T C5    1 
ATOM   7622 C  C6    . DC  B 2 10  ? 19.491  -6.851  38.104 1.00 24.62 ? 10   DC  T C6    1 
ATOM   7623 P  P     . DA  B 2 11  ? 22.861  -11.668 36.078 1.00 28.25 ? 11   DA  T P     1 
ATOM   7624 O  OP1   . DA  B 2 11  ? 23.149  -13.115 35.945 1.00 27.71 ? 11   DA  T OP1   1 
ATOM   7625 O  OP2   . DA  B 2 11  ? 23.912  -10.747 36.569 1.00 28.32 ? 11   DA  T OP2   1 
ATOM   7626 O  "O5'" . DA  B 2 11  ? 22.361  -11.081 34.684 1.00 23.64 ? 11   DA  T "O5'" 1 
ATOM   7627 C  "C5'" . DA  B 2 11  ? 21.448  -11.800 33.860 1.00 22.28 ? 11   DA  T "C5'" 1 
ATOM   7628 C  "C4'" . DA  B 2 11  ? 21.455  -11.225 32.451 1.00 23.35 ? 11   DA  T "C4'" 1 
ATOM   7629 O  "O4'" . DA  B 2 11  ? 20.843  -9.909  32.426 1.00 25.46 ? 11   DA  T "O4'" 1 
ATOM   7630 C  "C3'" . DA  B 2 11  ? 22.839  -11.056 31.841 1.00 24.36 ? 11   DA  T "C3'" 1 
ATOM   7631 O  "O3'" . DA  B 2 11  ? 22.772  -11.523 30.495 1.00 27.59 ? 11   DA  T "O3'" 1 
ATOM   7632 C  "C2'" . DA  B 2 11  ? 23.115  -9.556  31.951 1.00 23.95 ? 11   DA  T "C2'" 1 
ATOM   7633 C  "C1'" . DA  B 2 11  ? 21.717  -8.947  31.869 1.00 23.83 ? 11   DA  T "C1'" 1 
ATOM   7634 N  N9    . DA  B 2 11  ? 21.489  -7.765  32.691 1.00 25.01 ? 11   DA  T N9    1 
ATOM   7635 C  C8    . DA  B 2 11  ? 21.788  -7.630  34.024 1.00 24.33 ? 11   DA  T C8    1 
ATOM   7636 N  N7    . DA  B 2 11  ? 21.446  -6.470  34.533 1.00 23.86 ? 11   DA  T N7    1 
ATOM   7637 C  C5    . DA  B 2 11  ? 20.862  -5.808  33.461 1.00 23.19 ? 11   DA  T C5    1 
ATOM   7638 C  C6    . DA  B 2 11  ? 20.287  -4.525  33.343 1.00 23.81 ? 11   DA  T C6    1 
ATOM   7639 N  N6    . DA  B 2 11  ? 20.214  -3.664  34.368 1.00 21.85 ? 11   DA  T N6    1 
ATOM   7640 N  N1    . DA  B 2 11  ? 19.796  -4.159  32.140 1.00 22.60 ? 11   DA  T N1    1 
ATOM   7641 C  C2    . DA  B 2 11  ? 19.873  -5.018  31.110 1.00 24.67 ? 11   DA  T C2    1 
ATOM   7642 N  N3    . DA  B 2 11  ? 20.383  -6.251  31.102 1.00 23.54 ? 11   DA  T N3    1 
ATOM   7643 C  C4    . DA  B 2 11  ? 20.870  -6.589  32.318 1.00 23.73 ? 11   DA  T C4    1 
ATOM   7644 P  P     . DG  B 2 12  ? 24.055  -11.527 29.542 1.00 30.90 ? 12   DG  T P     1 
ATOM   7645 O  OP1   . DG  B 2 12  ? 23.730  -12.432 28.411 1.00 28.44 ? 12   DG  T OP1   1 
ATOM   7646 O  OP2   . DG  B 2 12  ? 25.279  -11.690 30.355 1.00 24.91 ? 12   DG  T OP2   1 
ATOM   7647 O  "O5'" . DG  B 2 12  ? 24.105  -10.037 28.974 1.00 28.05 ? 12   DG  T "O5'" 1 
ATOM   7648 C  "C5'" . DG  B 2 12  ? 23.118  -9.622  28.056 1.00 25.98 ? 12   DG  T "C5'" 1 
ATOM   7649 C  "C4'" . DG  B 2 12  ? 23.300  -8.149  27.801 1.00 26.40 ? 12   DG  T "C4'" 1 
ATOM   7650 O  "O4'" . DG  B 2 12  ? 22.973  -7.425  29.009 1.00 24.36 ? 12   DG  T "O4'" 1 
ATOM   7651 C  "C3'" . DG  B 2 12  ? 24.729  -7.755  27.442 1.00 27.50 ? 12   DG  T "C3'" 1 
ATOM   7652 O  "O3'" . DG  B 2 12  ? 24.743  -7.381  26.076 1.00 27.74 ? 12   DG  T "O3'" 1 
ATOM   7653 C  "C2'" . DG  B 2 12  ? 25.048  -6.599  28.390 1.00 27.12 ? 12   DG  T "C2'" 1 
ATOM   7654 C  "C1'" . DG  B 2 12  ? 23.671  -6.213  28.919 1.00 26.27 ? 12   DG  T "C1'" 1 
ATOM   7655 N  N9    . DG  B 2 12  ? 23.680  -5.595  30.236 1.00 26.20 ? 12   DG  T N9    1 
ATOM   7656 C  C8    . DG  B 2 12  ? 24.101  -6.141  31.423 1.00 26.39 ? 12   DG  T C8    1 
ATOM   7657 N  N7    . DG  B 2 12  ? 23.983  -5.325  32.436 1.00 25.86 ? 12   DG  T N7    1 
ATOM   7658 C  C5    . DG  B 2 12  ? 23.445  -4.172  31.878 1.00 25.18 ? 12   DG  T C5    1 
ATOM   7659 C  C6    . DG  B 2 12  ? 23.098  -2.938  32.479 1.00 25.95 ? 12   DG  T C6    1 
ATOM   7660 O  O6    . DG  B 2 12  ? 23.197  -2.626  33.671 1.00 25.26 ? 12   DG  T O6    1 
ATOM   7661 N  N1    . DG  B 2 12  ? 22.586  -2.026  31.553 1.00 25.02 ? 12   DG  T N1    1 
ATOM   7662 C  C2    . DG  B 2 12  ? 22.429  -2.270  30.208 1.00 27.54 ? 12   DG  T C2    1 
ATOM   7663 N  N2    . DG  B 2 12  ? 21.925  -1.271  29.466 1.00 26.85 ? 12   DG  T N2    1 
ATOM   7664 N  N3    . DG  B 2 12  ? 22.754  -3.424  29.632 1.00 26.85 ? 12   DG  T N3    1 
ATOM   7665 C  C4    . DG  B 2 12  ? 23.257  -4.320  30.523 1.00 26.99 ? 12   DG  T C4    1 
ATOM   7666 P  P     . DT  B 2 13  ? 26.024  -6.740  25.357 1.00 26.93 ? 13   DT  T P     1 
ATOM   7667 O  OP1   . DT  B 2 13  ? 25.934  -7.160  23.937 1.00 26.95 ? 13   DT  T OP1   1 
ATOM   7668 O  OP2   . DT  B 2 13  ? 27.254  -7.036  26.119 1.00 24.57 ? 13   DT  T OP2   1 
ATOM   7669 O  "O5'" . DT  B 2 13  ? 25.747  -5.172  25.482 1.00 26.23 ? 13   DT  T "O5'" 1 
ATOM   7670 C  "C5'" . DT  B 2 13  ? 24.637  -4.566  24.824 1.00 24.59 ? 13   DT  T "C5'" 1 
ATOM   7671 C  "C4'" . DT  B 2 13  ? 24.761  -3.052  24.846 1.00 27.26 ? 13   DT  T "C4'" 1 
ATOM   7672 O  "O4'" . DT  B 2 13  ? 24.562  -2.567  26.197 1.00 28.95 ? 13   DT  T "O4'" 1 
ATOM   7673 C  "C3'" . DT  B 2 13  ? 26.113  -2.502  24.389 1.00 28.22 ? 13   DT  T "C3'" 1 
ATOM   7674 O  "O3'" . DT  B 2 13  ? 25.877  -1.399  23.529 1.00 29.79 ? 13   DT  T "O3'" 1 
ATOM   7675 C  "C2'" . DT  B 2 13  ? 26.820  -2.088  25.682 1.00 27.95 ? 13   DT  T "C2'" 1 
ATOM   7676 C  "C1'" . DT  B 2 13  ? 25.639  -1.719  26.571 1.00 26.38 ? 13   DT  T "C1'" 1 
ATOM   7677 N  N1    . DT  B 2 13  ? 25.825  -1.895  28.044 1.00 26.48 ? 13   DT  T N1    1 
ATOM   7678 C  C2    . DT  B 2 13  ? 25.467  -0.853  28.876 1.00 25.06 ? 13   DT  T C2    1 
ATOM   7679 O  O2    . DT  B 2 13  ? 25.019  0.217   28.486 1.00 28.20 ? 13   DT  T O2    1 
ATOM   7680 N  N3    . DT  B 2 13  ? 25.649  -1.108  30.211 1.00 25.30 ? 13   DT  T N3    1 
ATOM   7681 C  C4    . DT  B 2 13  ? 26.134  -2.262  30.792 1.00 25.41 ? 13   DT  T C4    1 
ATOM   7682 O  O4    . DT  B 2 13  ? 26.256  -2.366  32.008 1.00 28.97 ? 13   DT  T O4    1 
ATOM   7683 C  C5    . DT  B 2 13  ? 26.497  -3.314  29.875 1.00 26.68 ? 13   DT  T C5    1 
ATOM   7684 C  C7    . DT  B 2 13  ? 27.046  -4.609  30.405 1.00 29.17 ? 13   DT  T C7    1 
ATOM   7685 C  C6    . DT  B 2 13  ? 26.323  -3.089  28.559 1.00 27.23 ? 13   DT  T C6    1 
ATOM   7686 P  P     . DC  B 2 14  ? 27.046  -0.757  22.649 1.00 31.84 ? 14   DC  T P     1 
ATOM   7687 O  OP1   . DC  B 2 14  ? 26.397  -0.132  21.477 1.00 31.51 ? 14   DC  T OP1   1 
ATOM   7688 O  OP2   . DC  B 2 14  ? 28.140  -1.742  22.483 1.00 30.10 ? 14   DC  T OP2   1 
ATOM   7689 O  "O5'" . DC  B 2 14  ? 27.603  0.393   23.603 1.00 30.35 ? 14   DC  T "O5'" 1 
ATOM   7690 C  "C5'" . DC  B 2 14  ? 26.816  1.540   23.880 1.00 31.96 ? 14   DC  T "C5'" 1 
ATOM   7691 C  "C4'" . DC  B 2 14  ? 27.507  2.390   24.925 1.00 33.84 ? 14   DC  T "C4'" 1 
ATOM   7692 O  "O4'" . DC  B 2 14  ? 27.457  1.707   26.199 1.00 33.43 ? 14   DC  T "O4'" 1 
ATOM   7693 C  "C3'" . DC  B 2 14  ? 28.984  2.669   24.643 1.00 34.76 ? 14   DC  T "C3'" 1 
ATOM   7694 O  "O3'" . DC  B 2 14  ? 29.168  4.078   24.564 1.00 37.09 ? 14   DC  T "O3'" 1 
ATOM   7695 C  "C2'" . DC  B 2 14  ? 29.729  2.032   25.819 1.00 33.96 ? 14   DC  T "C2'" 1 
ATOM   7696 C  "C1'" . DC  B 2 14  ? 28.647  2.021   26.891 1.00 34.78 ? 14   DC  T "C1'" 1 
ATOM   7697 N  N1    . DC  B 2 14  ? 28.833  1.027   27.994 1.00 31.95 ? 14   DC  T N1    1 
ATOM   7698 C  C2    . DC  B 2 14  ? 28.582  1.419   29.319 1.00 31.85 ? 14   DC  T C2    1 
ATOM   7699 O  O2    . DC  B 2 14  ? 28.220  2.580   29.567 1.00 30.08 ? 14   DC  T O2    1 
ATOM   7700 N  N3    . DC  B 2 14  ? 28.754  0.505   30.309 1.00 31.97 ? 14   DC  T N3    1 
ATOM   7701 C  C4    . DC  B 2 14  ? 29.143  -0.742  30.020 1.00 30.51 ? 14   DC  T C4    1 
ATOM   7702 N  N4    . DC  B 2 14  ? 29.299  -1.594  31.036 1.00 30.57 ? 14   DC  T N4    1 
ATOM   7703 C  C5    . DC  B 2 14  ? 29.397  -1.164  28.679 1.00 31.95 ? 14   DC  T C5    1 
ATOM   7704 C  C6    . DC  B 2 14  ? 29.233  -0.254  27.708 1.00 31.41 ? 14   DC  T C6    1 
ATOM   7705 P  P     . DC  B 2 15  ? 30.537  4.750   24.063 1.00 39.77 ? 15   DC  T P     1 
ATOM   7706 O  OP1   . DC  B 2 15  ? 30.181  6.091   23.548 1.00 40.16 ? 15   DC  T OP1   1 
ATOM   7707 O  OP2   . DC  B 2 15  ? 31.306  3.800   23.226 1.00 36.76 ? 15   DC  T OP2   1 
ATOM   7708 O  "O5'" . DC  B 2 15  ? 31.326  4.935   25.438 1.00 37.85 ? 15   DC  T "O5'" 1 
ATOM   7709 C  "C5'" . DC  B 2 15  ? 30.715  5.670   26.496 1.00 38.22 ? 15   DC  T "C5'" 1 
ATOM   7710 C  "C4'" . DC  B 2 15  ? 31.505  5.481   27.768 1.00 38.15 ? 15   DC  T "C4'" 1 
ATOM   7711 O  "O4'" . DC  B 2 15  ? 31.223  4.175   28.331 1.00 38.29 ? 15   DC  T "O4'" 1 
ATOM   7712 C  "C3'" . DC  B 2 15  ? 33.021  5.560   27.573 1.00 38.45 ? 15   DC  T "C3'" 1 
ATOM   7713 O  "O3'" . DC  B 2 15  ? 33.506  6.534   28.458 1.00 41.04 ? 15   DC  T "O3'" 1 
ATOM   7714 C  "C2'" . DC  B 2 15  ? 33.507  4.168   27.966 1.00 39.70 ? 15   DC  T "C2'" 1 
ATOM   7715 C  "C1'" . DC  B 2 15  ? 32.418  3.759   28.954 1.00 38.61 ? 15   DC  T "C1'" 1 
ATOM   7716 N  N1    . DC  B 2 15  ? 32.405  2.301   29.315 1.00 36.79 ? 15   DC  T N1    1 
ATOM   7717 C  C2    . DC  B 2 15  ? 32.110  1.925   30.637 1.00 34.56 ? 15   DC  T C2    1 
ATOM   7718 O  O2    . DC  B 2 15  ? 31.847  2.793   31.476 1.00 33.30 ? 15   DC  T O2    1 
ATOM   7719 N  N3    . DC  B 2 15  ? 32.115  0.606   30.964 1.00 34.13 ? 15   DC  T N3    1 
ATOM   7720 C  C4    . DC  B 2 15  ? 32.406  -0.312  30.042 1.00 35.51 ? 15   DC  T C4    1 
ATOM   7721 N  N4    . DC  B 2 15  ? 32.391  -1.594  30.422 1.00 35.34 ? 15   DC  T N4    1 
ATOM   7722 C  C5    . DC  B 2 15  ? 32.712  0.043   28.690 1.00 36.66 ? 15   DC  T C5    1 
ATOM   7723 C  C6    . DC  B 2 15  ? 32.704  1.346   28.376 1.00 37.32 ? 15   DC  T C6    1 
ATOM   7724 P  P     . DG  B 2 16  ? 34.905  7.299   28.285 1.00 38.86 ? 16   DG  T P     1 
ATOM   7725 O  OP1   . DG  B 2 16  ? 34.616  8.543   27.537 1.00 38.89 ? 16   DG  T OP1   1 
ATOM   7726 O  OP2   . DG  B 2 16  ? 35.974  6.368   27.841 1.00 37.61 ? 16   DG  T OP2   1 
ATOM   7727 O  "O5'" . DG  B 2 16  ? 35.184  7.672   29.816 1.00 38.81 ? 16   DG  T "O5'" 1 
ATOM   7728 C  "C5'" . DG  B 2 16  ? 34.092  8.112   30.629 1.00 36.68 ? 16   DG  T "C5'" 1 
ATOM   7729 C  "C4'" . DG  B 2 16  ? 34.221  7.595   32.053 1.00 36.18 ? 16   DG  T "C4'" 1 
ATOM   7730 O  "O4'" . DG  B 2 16  ? 34.014  6.161   32.113 1.00 33.48 ? 16   DG  T "O4'" 1 
ATOM   7731 C  "C3'" . DG  B 2 16  ? 35.574  7.839   32.701 1.00 35.62 ? 16   DG  T "C3'" 1 
ATOM   7732 O  "O3'" . DG  B 2 16  ? 35.326  8.266   34.024 1.00 37.03 ? 16   DG  T "O3'" 1 
ATOM   7733 C  "C2'" . DG  B 2 16  ? 36.273  6.481   32.651 1.00 34.54 ? 16   DG  T "C2'" 1 
ATOM   7734 C  "C1'" . DG  B 2 16  ? 35.082  5.551   32.812 1.00 33.88 ? 16   DG  T "C1'" 1 
ATOM   7735 N  N9    . DG  B 2 16  ? 35.242  4.224   32.238 1.00 31.49 ? 16   DG  T N9    1 
ATOM   7736 C  C8    . DG  B 2 16  ? 35.481  3.909   30.924 1.00 32.58 ? 16   DG  T C8    1 
ATOM   7737 N  N7    . DG  B 2 16  ? 35.555  2.626   30.706 1.00 31.72 ? 16   DG  T N7    1 
ATOM   7738 C  C5    . DG  B 2 16  ? 35.341  2.059   31.955 1.00 31.59 ? 16   DG  T C5    1 
ATOM   7739 C  C6    . DG  B 2 16  ? 35.303  0.699   32.346 1.00 32.86 ? 16   DG  T C6    1 
ATOM   7740 O  O6    . DG  B 2 16  ? 35.458  -0.294  31.624 1.00 33.84 ? 16   DG  T O6    1 
ATOM   7741 N  N1    . DG  B 2 16  ? 35.058  0.548   33.713 1.00 32.49 ? 16   DG  T N1    1 
ATOM   7742 C  C2    . DG  B 2 16  ? 34.870  1.592   34.592 1.00 31.95 ? 16   DG  T C2    1 
ATOM   7743 N  N2    . DG  B 2 16  ? 34.641  1.275   35.876 1.00 33.66 ? 16   DG  T N2    1 
ATOM   7744 N  N3    . DG  B 2 16  ? 34.903  2.870   34.236 1.00 29.60 ? 16   DG  T N3    1 
ATOM   7745 C  C4    . DG  B 2 16  ? 35.142  3.028   32.909 1.00 31.27 ? 16   DG  T C4    1 
ATOM   7746 P  P     . DC  B 2 17  ? 36.477  8.978   34.865 1.00 38.55 ? 17   DC  T P     1 
ATOM   7747 O  OP1   . DC  B 2 17  ? 35.820  9.842   35.869 1.00 34.57 ? 17   DC  T OP1   1 
ATOM   7748 O  OP2   . DC  B 2 17  ? 37.489  9.547   33.941 1.00 38.22 ? 17   DC  T OP2   1 
ATOM   7749 O  "O5'" . DC  B 2 17  ? 37.160  7.737   35.590 1.00 36.39 ? 17   DC  T "O5'" 1 
ATOM   7750 C  "C5'" . DC  B 2 17  ? 36.587  7.114   36.725 1.00 34.89 ? 17   DC  T "C5'" 1 
ATOM   7751 C  "C4'" . DC  B 2 17  ? 37.506  5.989   37.152 1.00 33.34 ? 17   DC  T "C4'" 1 
ATOM   7752 O  "O4'" . DC  B 2 17  ? 37.399  4.910   36.194 1.00 33.28 ? 17   DC  T "O4'" 1 
ATOM   7753 C  "C3'" . DC  B 2 17  ? 38.988  6.366   37.203 1.00 34.78 ? 17   DC  T "C3'" 1 
ATOM   7754 O  "O3'" . DC  B 2 17  ? 39.519  5.954   38.444 1.00 33.28 ? 17   DC  T "O3'" 1 
ATOM   7755 C  "C2'" . DC  B 2 17  ? 39.609  5.567   36.059 1.00 33.64 ? 17   DC  T "C2'" 1 
ATOM   7756 C  "C1'" . DC  B 2 17  ? 38.683  4.360   36.030 1.00 33.94 ? 17   DC  T "C1'" 1 
ATOM   7757 N  N1    . DC  B 2 17  ? 38.717  3.548   34.781 1.00 32.35 ? 17   DC  T N1    1 
ATOM   7758 C  C2    . DC  B 2 17  ? 38.460  2.169   34.857 1.00 32.90 ? 17   DC  T C2    1 
ATOM   7759 O  O2    . DC  B 2 17  ? 38.211  1.651   35.958 1.00 35.14 ? 17   DC  T O2    1 
ATOM   7760 N  N3    . DC  B 2 17  ? 38.497  1.432   33.714 1.00 33.62 ? 17   DC  T N3    1 
ATOM   7761 C  C4    . DC  B 2 17  ? 38.768  2.022   32.541 1.00 32.83 ? 17   DC  T C4    1 
ATOM   7762 N  N4    . DC  B 2 17  ? 38.790  1.255   31.445 1.00 31.56 ? 17   DC  T N4    1 
ATOM   7763 C  C5    . DC  B 2 17  ? 39.029  3.425   32.442 1.00 30.49 ? 17   DC  T C5    1 
ATOM   7764 C  C6    . DC  B 2 17  ? 38.993  4.141   33.576 1.00 31.17 ? 17   DC  T C6    1 
ATOM   7765 P  P     . DG  B 2 18  ? 40.554  6.833   39.280 1.00 30.51 ? 18   DG  T P     1 
ATOM   7766 O  OP1   . DG  B 2 18  ? 41.460  5.868   39.937 1.00 31.95 ? 18   DG  T OP1   1 
ATOM   7767 O  OP2   . DG  B 2 18  ? 39.770  7.781   40.098 1.00 33.69 ? 18   DG  T OP2   1 
ATOM   7768 O  "O5'" . DG  B 2 18  ? 41.324  7.728   38.187 1.00 29.55 ? 18   DG  T "O5'" 1 
ATOM   7769 C  "C5'" . DG  B 2 18  ? 42.737  7.660   38.025 1.00 25.44 ? 18   DG  T "C5'" 1 
ATOM   7770 C  "C4'" . DG  B 2 18  ? 43.053  7.457   36.551 1.00 23.17 ? 18   DG  T "C4'" 1 
ATOM   7771 O  "O4'" . DG  B 2 18  ? 44.327  8.059   36.226 1.00 21.90 ? 18   DG  T "O4'" 1 
ATOM   7772 C  "C3'" . DG  B 2 18  ? 43.173  6.003   36.107 1.00 22.65 ? 18   DG  T "C3'" 1 
ATOM   7773 O  "O3'" . DG  B 2 18  ? 42.731  5.875   34.750 1.00 20.96 ? 18   DG  T "O3'" 1 
ATOM   7774 C  "C2'" . DG  B 2 18  ? 44.663  5.724   36.268 1.00 22.33 ? 18   DG  T "C2'" 1 
ATOM   7775 C  "C1'" . DG  B 2 18  ? 45.247  7.061   35.819 1.00 20.27 ? 18   DG  T "C1'" 1 
ATOM   7776 N  N9    . DG  B 2 18  ? 46.542  7.410   36.381 1.00 18.89 ? 18   DG  T N9    1 
ATOM   7777 C  C8    . DG  B 2 18  ? 47.661  7.697   35.637 1.00 19.10 ? 18   DG  T C8    1 
ATOM   7778 N  N7    . DG  B 2 18  ? 48.695  8.004   36.358 1.00 18.87 ? 18   DG  T N7    1 
ATOM   7779 C  C5    . DG  B 2 18  ? 48.239  7.915   37.665 1.00 18.00 ? 18   DG  T C5    1 
ATOM   7780 C  C6    . DG  B 2 18  ? 48.933  8.144   38.878 1.00 16.45 ? 18   DG  T C6    1 
ATOM   7781 O  O6    . DG  B 2 18  ? 50.110  8.476   39.032 1.00 20.32 ? 18   DG  T O6    1 
ATOM   7782 N  N1    . DG  B 2 18  ? 48.125  7.961   40.000 1.00 20.04 ? 18   DG  T N1    1 
ATOM   7783 C  C2    . DG  B 2 18  ? 46.796  7.595   39.947 1.00 19.20 ? 18   DG  T C2    1 
ATOM   7784 N  N2    . DG  B 2 18  ? 46.172  7.470   41.131 1.00 19.80 ? 18   DG  T N2    1 
ATOM   7785 N  N3    . DG  B 2 18  ? 46.127  7.384   38.812 1.00 20.63 ? 18   DG  T N3    1 
ATOM   7786 C  C4    . DG  B 2 18  ? 46.910  7.557   37.706 1.00 19.97 ? 18   DG  T C4    1 
ATOM   7787 O  "O5'" . DG  C 3 1   ? 37.953  -10.896 35.541 1.00 63.10 ? 103  DG  P "O5'" 1 
ATOM   7788 C  "C5'" . DG  C 3 1   ? 37.783  -9.570  35.035 1.00 62.73 ? 103  DG  P "C5'" 1 
ATOM   7789 C  "C4'" . DG  C 3 1   ? 37.700  -8.548  36.159 1.00 61.18 ? 103  DG  P "C4'" 1 
ATOM   7790 O  "O4'" . DG  C 3 1   ? 38.273  -7.269  35.760 1.00 60.21 ? 103  DG  P "O4'" 1 
ATOM   7791 C  "C3'" . DG  C 3 1   ? 36.286  -8.236  36.616 1.00 61.83 ? 103  DG  P "C3'" 1 
ATOM   7792 O  "O3'" . DG  C 3 1   ? 36.292  -8.043  38.022 1.00 64.47 ? 103  DG  P "O3'" 1 
ATOM   7793 C  "C2'" . DG  C 3 1   ? 35.956  -6.952  35.860 1.00 59.16 ? 103  DG  P "C2'" 1 
ATOM   7794 C  "C1'" . DG  C 3 1   ? 37.303  -6.237  35.840 1.00 56.09 ? 103  DG  P "C1'" 1 
ATOM   7795 N  N9    . DG  C 3 1   ? 37.489  -5.300  34.723 1.00 50.95 ? 103  DG  P N9    1 
ATOM   7796 C  C8    . DG  C 3 1   ? 37.583  -5.617  33.385 1.00 48.81 ? 103  DG  P C8    1 
ATOM   7797 N  N7    . DG  C 3 1   ? 37.754  -4.588  32.603 1.00 45.63 ? 103  DG  P N7    1 
ATOM   7798 C  C5    . DG  C 3 1   ? 37.774  -3.507  33.476 1.00 45.58 ? 103  DG  P C5    1 
ATOM   7799 C  C6    . DG  C 3 1   ? 37.933  -2.124  33.206 1.00 44.38 ? 103  DG  P C6    1 
ATOM   7800 O  O6    . DG  C 3 1   ? 38.088  -1.580  32.108 1.00 45.37 ? 103  DG  P O6    1 
ATOM   7801 N  N1    . DG  C 3 1   ? 37.898  -1.343  34.362 1.00 44.45 ? 103  DG  P N1    1 
ATOM   7802 C  C2    . DG  C 3 1   ? 37.730  -1.847  35.633 1.00 45.79 ? 103  DG  P C2    1 
ATOM   7803 N  N2    . DG  C 3 1   ? 37.720  -0.949  36.629 1.00 45.53 ? 103  DG  P N2    1 
ATOM   7804 N  N3    . DG  C 3 1   ? 37.584  -3.144  35.902 1.00 46.60 ? 103  DG  P N3    1 
ATOM   7805 C  C4    . DG  C 3 1   ? 37.614  -3.922  34.783 1.00 46.90 ? 103  DG  P C4    1 
ATOM   7806 P  P     . DC  C 3 2   ? 35.083  -8.566  38.931 1.00 66.65 ? 104  DC  P P     1 
ATOM   7807 O  OP1   . DC  C 3 2   ? 35.673  -9.318  40.062 1.00 66.30 ? 104  DC  P OP1   1 
ATOM   7808 O  OP2   . DC  C 3 2   ? 34.070  -9.210  38.061 1.00 66.61 ? 104  DC  P OP2   1 
ATOM   7809 O  "O5'" . DC  C 3 2   ? 34.445  -7.209  39.482 1.00 64.31 ? 104  DC  P "O5'" 1 
ATOM   7810 C  "C5'" . DC  C 3 2   ? 35.234  -6.264  40.199 1.00 61.98 ? 104  DC  P "C5'" 1 
ATOM   7811 C  "C4'" . DC  C 3 2   ? 34.683  -4.860  40.022 1.00 60.30 ? 104  DC  P "C4'" 1 
ATOM   7812 O  "O4'" . DC  C 3 2   ? 35.025  -4.358  38.705 1.00 57.88 ? 104  DC  P "O4'" 1 
ATOM   7813 C  "C3'" . DC  C 3 2   ? 33.164  -4.734  40.138 1.00 60.51 ? 104  DC  P "C3'" 1 
ATOM   7814 O  "O3'" . DC  C 3 2   ? 32.860  -3.641  40.983 1.00 62.77 ? 104  DC  P "O3'" 1 
ATOM   7815 C  "C2'" . DC  C 3 2   ? 32.716  -4.464  38.703 1.00 58.50 ? 104  DC  P "C2'" 1 
ATOM   7816 C  "C1'" . DC  C 3 2   ? 33.906  -3.651  38.215 1.00 55.39 ? 104  DC  P "C1'" 1 
ATOM   7817 N  N1    . DC  C 3 2   ? 34.044  -3.452  36.732 1.00 51.51 ? 104  DC  P N1    1 
ATOM   7818 C  C2    . DC  C 3 2   ? 34.423  -2.186  36.250 1.00 48.91 ? 104  DC  P C2    1 
ATOM   7819 O  O2    . DC  C 3 2   ? 34.631  -1.263  37.051 1.00 47.08 ? 104  DC  P O2    1 
ATOM   7820 N  N3    . DC  C 3 2   ? 34.553  -2.008  34.907 1.00 46.09 ? 104  DC  P N3    1 
ATOM   7821 C  C4    . DC  C 3 2   ? 34.328  -3.021  34.065 1.00 46.53 ? 104  DC  P C4    1 
ATOM   7822 N  N4    . DC  C 3 2   ? 34.471  -2.789  32.755 1.00 46.07 ? 104  DC  P N4    1 
ATOM   7823 C  C5    . DC  C 3 2   ? 33.939  -4.315  34.533 1.00 47.48 ? 104  DC  P C5    1 
ATOM   7824 C  C6    . DC  C 3 2   ? 33.813  -4.479  35.858 1.00 48.83 ? 104  DC  P C6    1 
ATOM   7825 P  P     . DG  C 3 3   ? 31.482  -3.583  41.793 1.00 65.11 ? 105  DG  P P     1 
ATOM   7826 O  OP1   . DG  C 3 3   ? 31.627  -4.497  42.947 1.00 65.30 ? 105  DG  P OP1   1 
ATOM   7827 O  OP2   . DG  C 3 3   ? 30.359  -3.774  40.844 1.00 64.56 ? 105  DG  P OP2   1 
ATOM   7828 O  "O5'" . DG  C 3 3   ? 31.433  -2.069  42.324 1.00 63.79 ? 105  DG  P "O5'" 1 
ATOM   7829 C  "C5'" . DG  C 3 3   ? 32.288  -1.054  41.784 1.00 61.13 ? 105  DG  P "C5'" 1 
ATOM   7830 C  "C4'" . DG  C 3 3   ? 31.544  -0.050  40.913 1.00 59.02 ? 105  DG  P "C4'" 1 
ATOM   7831 O  "O4'" . DG  C 3 3   ? 31.843  -0.289  39.512 1.00 57.41 ? 105  DG  P "O4'" 1 
ATOM   7832 C  "C3'" . DG  C 3 3   ? 30.018  -0.043  41.021 1.00 58.63 ? 105  DG  P "C3'" 1 
ATOM   7833 O  "O3'" . DG  C 3 3   ? 29.583  1.301   41.151 1.00 58.73 ? 105  DG  P "O3'" 1 
ATOM   7834 C  "C2'" . DG  C 3 3   ? 29.557  -0.647  39.697 1.00 57.65 ? 105  DG  P "C2'" 1 
ATOM   7835 C  "C1'" . DG  C 3 3   ? 30.652  -0.143  38.764 1.00 55.63 ? 105  DG  P "C1'" 1 
ATOM   7836 N  N9    . DG  C 3 3   ? 30.792  -0.869  37.502 1.00 52.52 ? 105  DG  P N9    1 
ATOM   7837 C  C8    . DG  C 3 3   ? 30.670  -2.226  37.305 1.00 51.33 ? 105  DG  P C8    1 
ATOM   7838 N  N7    . DG  C 3 3   ? 30.854  -2.602  36.070 1.00 49.52 ? 105  DG  P N7    1 
ATOM   7839 C  C5    . DG  C 3 3   ? 31.114  -1.413  35.399 1.00 48.41 ? 105  DG  P C5    1 
ATOM   7840 C  C6    . DG  C 3 3   ? 31.393  -1.190  34.028 1.00 46.29 ? 105  DG  P C6    1 
ATOM   7841 O  O6    . DG  C 3 3   ? 31.460  -2.032  33.123 1.00 44.95 ? 105  DG  P O6    1 
ATOM   7842 N  N1    . DG  C 3 3   ? 31.600  0.162   33.746 1.00 45.68 ? 105  DG  P N1    1 
ATOM   7843 C  C2    . DG  C 3 3   ? 31.544  1.174   34.680 1.00 46.85 ? 105  DG  P C2    1 
ATOM   7844 N  N2    . DG  C 3 3   ? 31.770  2.415   34.226 1.00 46.01 ? 105  DG  P N2    1 
ATOM   7845 N  N3    . DG  C 3 3   ? 31.287  0.978   35.972 1.00 48.66 ? 105  DG  P N3    1 
ATOM   7846 C  C4    . DG  C 3 3   ? 31.083  -0.336  36.263 1.00 49.78 ? 105  DG  P C4    1 
ATOM   7847 P  P     . DG  C 3 4   ? 28.222  1.694   41.902 1.00 59.30 ? 106  DG  P P     1 
ATOM   7848 O  OP1   . DG  C 3 4   ? 28.576  2.082   43.285 1.00 59.42 ? 106  DG  P OP1   1 
ATOM   7849 O  OP2   . DG  C 3 4   ? 27.205  0.643   41.658 1.00 58.94 ? 106  DG  P OP2   1 
ATOM   7850 O  "O5'" . DG  C 3 4   ? 27.755  2.998   41.105 1.00 56.70 ? 106  DG  P "O5'" 1 
ATOM   7851 C  "C5'" . DG  C 3 4   ? 28.693  3.994   40.700 1.00 53.71 ? 106  DG  P "C5'" 1 
ATOM   7852 C  "C4'" . DG  C 3 4   ? 28.216  4.719   39.449 1.00 51.27 ? 106  DG  P "C4'" 1 
ATOM   7853 O  "O4'" . DG  C 3 4   ? 28.596  3.977   38.261 1.00 48.43 ? 106  DG  P "O4'" 1 
ATOM   7854 C  "C3'" . DG  C 3 4   ? 26.710  4.949   39.347 1.00 50.54 ? 106  DG  P "C3'" 1 
ATOM   7855 O  "O3'" . DG  C 3 4   ? 26.503  6.304   38.947 1.00 51.94 ? 106  DG  P "O3'" 1 
ATOM   7856 C  "C2'" . DG  C 3 4   ? 26.249  3.926   38.305 1.00 48.54 ? 106  DG  P "C2'" 1 
ATOM   7857 C  "C1'" . DG  C 3 4   ? 27.479  3.805   37.412 1.00 46.21 ? 106  DG  P "C1'" 1 
ATOM   7858 N  N9    . DG  C 3 4   ? 27.664  2.522   36.730 1.00 41.75 ? 106  DG  P N9    1 
ATOM   7859 C  C8    . DG  C 3 4   ? 27.660  1.266   37.292 1.00 39.75 ? 106  DG  P C8    1 
ATOM   7860 N  N7    . DG  C 3 4   ? 27.867  0.306   36.433 1.00 39.23 ? 106  DG  P N7    1 
ATOM   7861 C  C5    . DG  C 3 4   ? 28.025  0.969   35.220 1.00 38.24 ? 106  DG  P C5    1 
ATOM   7862 C  C6    . DG  C 3 4   ? 28.281  0.458   33.921 1.00 36.74 ? 106  DG  P C6    1 
ATOM   7863 O  O6    . DG  C 3 4   ? 28.412  -0.726  33.587 1.00 36.29 ? 106  DG  P O6    1 
ATOM   7864 N  N1    . DG  C 3 4   ? 28.373  1.469   32.959 1.00 35.13 ? 106  DG  P N1    1 
ATOM   7865 C  C2    . DG  C 3 4   ? 28.234  2.814   33.226 1.00 34.91 ? 106  DG  P C2    1 
ATOM   7866 N  N2    . DG  C 3 4   ? 28.350  3.656   32.186 1.00 34.79 ? 106  DG  P N2    1 
ATOM   7867 N  N3    . DG  C 3 4   ? 27.995  3.302   34.438 1.00 36.61 ? 106  DG  P N3    1 
ATOM   7868 C  C4    . DG  C 3 4   ? 27.906  2.332   35.386 1.00 38.70 ? 106  DG  P C4    1 
ATOM   7869 P  P     . DA  C 3 5   ? 25.048  6.961   38.853 1.00 52.90 ? 107  DA  P P     1 
ATOM   7870 O  OP1   . DA  C 3 5   ? 25.184  8.388   39.225 1.00 53.68 ? 107  DA  P OP1   1 
ATOM   7871 O  OP2   . DA  C 3 5   ? 24.067  6.102   39.557 1.00 52.76 ? 107  DA  P OP2   1 
ATOM   7872 O  "O5'" . DA  C 3 5   ? 24.755  6.849   37.287 1.00 49.93 ? 107  DA  P "O5'" 1 
ATOM   7873 C  "C5'" . DA  C 3 5   ? 25.413  7.702   36.352 1.00 47.21 ? 107  DA  P "C5'" 1 
ATOM   7874 C  "C4'" . DA  C 3 5   ? 24.790  7.535   34.978 1.00 45.13 ? 107  DA  P "C4'" 1 
ATOM   7875 O  "O4'" . DA  C 3 5   ? 25.155  6.236   34.446 1.00 42.36 ? 107  DA  P "O4'" 1 
ATOM   7876 C  "C3'" . DA  C 3 5   ? 23.266  7.587   34.947 1.00 44.68 ? 107  DA  P "C3'" 1 
ATOM   7877 O  "O3'" . DA  C 3 5   ? 22.852  8.316   33.799 1.00 45.96 ? 107  DA  P "O3'" 1 
ATOM   7878 C  "C2'" . DA  C 3 5   ? 22.847  6.119   34.876 1.00 41.60 ? 107  DA  P "C2'" 1 
ATOM   7879 C  "C1'" . DA  C 3 5   ? 23.993  5.530   34.064 1.00 39.24 ? 107  DA  P "C1'" 1 
ATOM   7880 N  N9    . DA  C 3 5   ? 24.245  4.112   34.295 1.00 35.97 ? 107  DA  P N9    1 
ATOM   7881 C  C8    . DA  C 3 5   ? 24.204  3.437   35.485 1.00 35.10 ? 107  DA  P C8    1 
ATOM   7882 N  N7    . DA  C 3 5   ? 24.486  2.161   35.381 1.00 32.38 ? 107  DA  P N7    1 
ATOM   7883 C  C5    . DA  C 3 5   ? 24.736  1.988   34.032 1.00 31.13 ? 107  DA  P C5    1 
ATOM   7884 C  C6    . DA  C 3 5   ? 25.085  0.855   33.269 1.00 31.31 ? 107  DA  P C6    1 
ATOM   7885 N  N6    . DA  C 3 5   ? 25.249  -0.358  33.806 1.00 30.78 ? 107  DA  P N6    1 
ATOM   7886 N  N1    . DA  C 3 5   ? 25.259  1.019   31.937 1.00 31.66 ? 107  DA  P N1    1 
ATOM   7887 C  C2    . DA  C 3 5   ? 25.089  2.238   31.403 1.00 31.65 ? 107  DA  P C2    1 
ATOM   7888 N  N3    . DA  C 3 5   ? 24.755  3.375   32.023 1.00 32.19 ? 107  DA  P N3    1 
ATOM   7889 C  C4    . DA  C 3 5   ? 24.590  3.180   33.344 1.00 32.74 ? 107  DA  P C4    1 
ATOM   7890 P  P     . DC  C 3 6   ? 21.318  8.713   33.575 1.00 48.17 ? 108  DC  P P     1 
ATOM   7891 O  OP1   . DC  C 3 6   ? 21.326  9.943   32.752 1.00 49.03 ? 108  DC  P OP1   1 
ATOM   7892 O  OP2   . DC  C 3 6   ? 20.601  8.684   34.871 1.00 46.83 ? 108  DC  P OP2   1 
ATOM   7893 O  "O5'" . DC  C 3 6   ? 20.752  7.497   32.705 1.00 46.30 ? 108  DC  P "O5'" 1 
ATOM   7894 C  "C5'" . DC  C 3 6   ? 21.117  7.369   31.338 1.00 44.75 ? 108  DC  P "C5'" 1 
ATOM   7895 C  "C4'" . DC  C 3 6   ? 20.819  5.972   30.832 1.00 42.11 ? 108  DC  P "C4'" 1 
ATOM   7896 O  "O4'" . DC  C 3 6   ? 21.509  4.996   31.643 1.00 38.71 ? 108  DC  P "O4'" 1 
ATOM   7897 C  "C3'" . DC  C 3 6   ? 19.365  5.521   30.921 1.00 41.58 ? 108  DC  P "C3'" 1 
ATOM   7898 O  "O3'" . DC  C 3 6   ? 18.644  5.878   29.743 1.00 44.12 ? 108  DC  P "O3'" 1 
ATOM   7899 C  "C2'" . DC  C 3 6   ? 19.482  4.004   31.057 1.00 39.52 ? 108  DC  P "C2'" 1 
ATOM   7900 C  "C1'" . DC  C 3 6   ? 20.974  3.760   31.234 1.00 37.45 ? 108  DC  P "C1'" 1 
ATOM   7901 N  N1    . DC  C 3 6   ? 21.237  2.700   32.238 1.00 33.10 ? 108  DC  P N1    1 
ATOM   7902 C  C2    . DC  C 3 6   ? 21.627  1.432   31.784 1.00 31.57 ? 108  DC  P C2    1 
ATOM   7903 O  O2    . DC  C 3 6   ? 21.753  1.233   30.566 1.00 32.90 ? 108  DC  P O2    1 
ATOM   7904 N  N3    . DC  C 3 6   ? 21.853  0.457   32.701 1.00 30.68 ? 108  DC  P N3    1 
ATOM   7905 C  C4    . DC  C 3 6   ? 21.708  0.713   34.006 1.00 30.18 ? 108  DC  P C4    1 
ATOM   7906 N  N4    . DC  C 3 6   ? 21.951  -0.277  34.869 1.00 27.67 ? 108  DC  P N4    1 
ATOM   7907 C  C5    . DC  C 3 6   ? 21.304  1.999   34.485 1.00 31.36 ? 108  DC  P C5    1 
ATOM   7908 C  C6    . DC  C 3 6   ? 21.083  2.954   33.575 1.00 32.10 ? 108  DC  P C6    1 
ATOM   7909 P  P     . DT  C 3 7   ? 17.113  5.428   29.540 1.00 46.25 ? 109  DT  P P     1 
ATOM   7910 O  OP1   . DT  C 3 7   ? 16.509  6.374   28.574 1.00 45.12 ? 109  DT  P OP1   1 
ATOM   7911 O  OP2   . DT  C 3 7   ? 16.489  5.181   30.862 1.00 43.42 ? 109  DT  P OP2   1 
ATOM   7912 O  "O5'" . DT  C 3 7   ? 17.236  3.993   28.845 1.00 42.36 ? 109  DT  P "O5'" 1 
ATOM   7913 C  "C5'" . DT  C 3 7   ? 18.011  3.761   27.675 1.00 39.97 ? 109  DT  P "C5'" 1 
ATOM   7914 C  "C4'" . DT  C 3 7   ? 17.884  2.293   27.294 1.00 37.59 ? 109  DT  P "C4'" 1 
ATOM   7915 O  "O4'" . DT  C 3 7   ? 18.544  1.465   28.288 1.00 35.87 ? 109  DT  P "O4'" 1 
ATOM   7916 C  "C3'" . DT  C 3 7   ? 16.444  1.794   27.203 1.00 34.95 ? 109  DT  P "C3'" 1 
ATOM   7917 O  "O3'" . DT  C 3 7   ? 16.273  1.108   25.959 1.00 34.03 ? 109  DT  P "O3'" 1 
ATOM   7918 C  "C2'" . DT  C 3 7   ? 16.271  0.908   28.442 1.00 33.33 ? 109  DT  P "C2'" 1 
ATOM   7919 C  "C1'" . DT  C 3 7   ? 17.692  0.406   28.670 1.00 31.53 ? 109  DT  P "C1'" 1 
ATOM   7920 N  N1    . DT  C 3 7   ? 18.016  0.018   30.082 1.00 29.85 ? 109  DT  P N1    1 
ATOM   7921 C  C2    . DT  C 3 7   ? 18.573  -1.229  30.312 1.00 26.88 ? 109  DT  P C2    1 
ATOM   7922 O  O2    . DT  C 3 7   ? 18.816  -2.025  29.418 1.00 27.19 ? 109  DT  P O2    1 
ATOM   7923 N  N3    . DT  C 3 7   ? 18.839  -1.502  31.629 1.00 24.36 ? 109  DT  P N3    1 
ATOM   7924 C  C4    . DT  C 3 7   ? 18.607  -0.676  32.720 1.00 25.75 ? 109  DT  P C4    1 
ATOM   7925 O  O4    . DT  C 3 7   ? 18.884  -1.021  33.866 1.00 26.25 ? 109  DT  P O4    1 
ATOM   7926 C  C5    . DT  C 3 7   ? 18.015  0.612   32.412 1.00 27.14 ? 109  DT  P C5    1 
ATOM   7927 C  C7    . DT  C 3 7   ? 17.709  1.607   33.497 1.00 28.14 ? 109  DT  P C7    1 
ATOM   7928 C  C6    . DT  C 3 7   ? 17.753  0.892   31.126 1.00 27.12 ? 109  DT  P C6    1 
ATOM   7929 P  P     . DG  C 3 8   ? 14.844  0.528   25.540 1.00 34.20 ? 110  DG  P P     1 
ATOM   7930 O  OP1   . DG  C 3 8   ? 14.816  0.371   24.062 1.00 32.42 ? 110  DG  P OP1   1 
ATOM   7931 O  OP2   . DG  C 3 8   ? 13.792  1.299   26.242 1.00 31.60 ? 110  DG  P OP2   1 
ATOM   7932 O  "O5'" . DG  C 3 8   ? 14.886  -0.918  26.219 1.00 29.77 ? 110  DG  P "O5'" 1 
ATOM   7933 C  "C5'" . DG  C 3 8   ? 15.839  -1.896  25.819 1.00 26.50 ? 110  DG  P "C5'" 1 
ATOM   7934 C  "C4'" . DG  C 3 8   ? 15.621  -3.174  26.610 1.00 26.62 ? 110  DG  P "C4'" 1 
ATOM   7935 O  "O4'" . DG  C 3 8   ? 16.040  -2.975  27.976 1.00 25.38 ? 110  DG  P "O4'" 1 
ATOM   7936 C  "C3'" . DG  C 3 8   ? 14.166  -3.620  26.696 1.00 25.57 ? 110  DG  P "C3'" 1 
ATOM   7937 O  "O3'" . DG  C 3 8   ? 14.059  -4.818  25.947 1.00 26.58 ? 110  DG  P "O3'" 1 
ATOM   7938 C  "C2'" . DG  C 3 8   ? 13.888  -3.821  28.192 1.00 25.85 ? 110  DG  P "C2'" 1 
ATOM   7939 C  "C1'" . DG  C 3 8   ? 15.292  -3.859  28.779 1.00 25.35 ? 110  DG  P "C1'" 1 
ATOM   7940 N  N9    . DG  C 3 8   ? 15.424  -3.390  30.155 1.00 21.61 ? 110  DG  P N9    1 
ATOM   7941 C  C8    . DG  C 3 8   ? 15.068  -2.162  30.651 1.00 23.36 ? 110  DG  P C8    1 
ATOM   7942 N  N7    . DG  C 3 8   ? 15.322  -2.024  31.920 1.00 21.69 ? 110  DG  P N7    1 
ATOM   7943 C  C5    . DG  C 3 8   ? 15.880  -3.234  32.290 1.00 21.16 ? 110  DG  P C5    1 
ATOM   7944 C  C6    . DG  C 3 8   ? 16.347  -3.676  33.551 1.00 19.94 ? 110  DG  P C6    1 
ATOM   7945 O  O6    . DG  C 3 8   ? 16.354  -3.048  34.614 1.00 21.93 ? 110  DG  P O6    1 
ATOM   7946 N  N1    . DG  C 3 8   ? 16.849  -4.981  33.505 1.00 20.77 ? 110  DG  P N1    1 
ATOM   7947 C  C2    . DG  C 3 8   ? 16.873  -5.759  32.369 1.00 19.15 ? 110  DG  P C2    1 
ATOM   7948 N  N2    . DG  C 3 8   ? 17.383  -6.991  32.495 1.00 21.06 ? 110  DG  P N2    1 
ATOM   7949 N  N3    . DG  C 3 8   ? 16.439  -5.355  31.183 1.00 22.07 ? 110  DG  P N3    1 
ATOM   7950 C  C4    . DG  C 3 8   ? 15.951  -4.088  31.216 1.00 22.85 ? 110  DG  P C4    1 
ATOM   7951 P  P     . DC  C 3 9   ? 12.675  -5.582  25.745 1.00 25.02 ? 111  DC  P P     1 
ATOM   7952 O  OP1   . DC  C 3 9   ? 12.851  -6.399  24.524 1.00 26.13 ? 111  DC  P OP1   1 
ATOM   7953 O  OP2   . DC  C 3 9   ? 11.561  -4.619  25.852 1.00 24.45 ? 111  DC  P OP2   1 
ATOM   7954 O  "O5'" . DC  C 3 9   ? 12.531  -6.511  27.045 1.00 26.47 ? 111  DC  P "O5'" 1 
ATOM   7955 C  "C5'" . DC  C 3 9   ? 13.493  -7.512  27.328 1.00 24.01 ? 111  DC  P "C5'" 1 
ATOM   7956 C  "C4'" . DC  C 3 9   ? 13.334  -8.037  28.740 1.00 22.24 ? 111  DC  P "C4'" 1 
ATOM   7957 O  "O4'" . DC  C 3 9   ? 13.681  -7.020  29.706 1.00 23.90 ? 111  DC  P "O4'" 1 
ATOM   7958 C  "C3'" . DC  C 3 9   ? 11.925  -8.485  29.107 1.00 23.19 ? 111  DC  P "C3'" 1 
ATOM   7959 O  "O3'" . DC  C 3 9   ? 11.934  -9.891  29.184 1.00 24.63 ? 111  DC  P "O3'" 1 
ATOM   7960 C  "C2'" . DC  C 3 9   ? 11.657  -7.862  30.474 1.00 24.28 ? 111  DC  P "C2'" 1 
ATOM   7961 C  "C1'" . DC  C 3 9   ? 13.045  -7.405  30.904 1.00 22.52 ? 111  DC  P "C1'" 1 
ATOM   7962 N  N1    . DC  C 3 9   ? 13.002  -6.263  31.858 1.00 21.68 ? 111  DC  P N1    1 
ATOM   7963 C  C2    . DC  C 3 9   ? 13.546  -6.428  33.143 1.00 22.02 ? 111  DC  P C2    1 
ATOM   7964 O  O2    . DC  C 3 9   ? 14.063  -7.510  33.462 1.00 20.98 ? 111  DC  P O2    1 
ATOM   7965 N  N3    . DC  C 3 9   ? 13.493  -5.384  34.004 1.00 18.53 ? 111  DC  P N3    1 
ATOM   7966 C  C4    . DC  C 3 9   ? 12.931  -4.228  33.633 1.00 21.24 ? 111  DC  P C4    1 
ATOM   7967 N  N4    . DC  C 3 9   ? 12.916  -3.233  34.524 1.00 20.59 ? 111  DC  P N4    1 
ATOM   7968 C  C5    . DC  C 3 9   ? 12.366  -4.037  32.332 1.00 20.07 ? 111  DC  P C5    1 
ATOM   7969 C  C6    . DC  C 3 9   ? 12.422  -5.076  31.487 1.00 21.84 ? 111  DC  P C6    1 
ATOM   7970 P  P     . DT  C 3 10  ? 10.609  -10.748 29.436 1.00 23.20 ? 112  DT  P P     1 
ATOM   7971 O  OP1   . DT  C 3 10  ? 10.832  -12.037 28.758 1.00 24.32 ? 112  DT  P OP1   1 
ATOM   7972 O  OP2   . DT  C 3 10  ? 9.384   -9.963  29.162 1.00 24.40 ? 112  DT  P OP2   1 
ATOM   7973 O  "O5'" . DT  C 3 10  ? 10.703  -10.944 31.019 1.00 21.86 ? 112  DT  P "O5'" 1 
ATOM   7974 C  "C5'" . DT  C 3 10  ? 11.821  -11.628 31.564 1.00 23.87 ? 112  DT  P "C5'" 1 
ATOM   7975 C  "C4'" . DT  C 3 10  ? 11.719  -11.552 33.066 1.00 24.87 ? 112  DT  P "C4'" 1 
ATOM   7976 O  "O4'" . DT  C 3 10  ? 11.946  -10.187 33.482 1.00 27.38 ? 112  DT  P "O4'" 1 
ATOM   7977 C  "C3'" . DT  C 3 10  ? 10.314  -11.915 33.529 1.00 24.83 ? 112  DT  P "C3'" 1 
ATOM   7978 O  "O3'" . DT  C 3 10  ? 10.397  -13.101 34.266 1.00 24.46 ? 112  DT  P "O3'" 1 
ATOM   7979 C  "C2'" . DT  C 3 10  ? 9.849   -10.741 34.370 1.00 28.32 ? 112  DT  P "C2'" 1 
ATOM   7980 C  "C1'" . DT  C 3 10  ? 11.128  -9.959  34.609 1.00 26.51 ? 112  DT  P "C1'" 1 
ATOM   7981 N  N1    . DT  C 3 10  ? 10.803  -8.526  34.756 1.00 24.23 ? 112  DT  P N1    1 
ATOM   7982 C  C2    . DT  C 3 10  ? 11.125  -7.889  35.940 1.00 21.57 ? 112  DT  P C2    1 
ATOM   7983 O  O2    . DT  C 3 10  ? 11.698  -8.436  36.868 1.00 24.92 ? 112  DT  P O2    1 
ATOM   7984 N  N3    . DT  C 3 10  ? 10.767  -6.567  35.986 1.00 20.28 ? 112  DT  P N3    1 
ATOM   7985 C  C4    . DT  C 3 10  ? 10.115  -5.848  34.995 1.00 21.99 ? 112  DT  P C4    1 
ATOM   7986 O  O4    . DT  C 3 10  ? 9.847   -4.665  35.138 1.00 20.57 ? 112  DT  P O4    1 
ATOM   7987 C  C5    . DT  C 3 10  ? 9.796   -6.579  33.786 1.00 24.83 ? 112  DT  P C5    1 
ATOM   7988 C  C7    . DT  C 3 10  ? 9.090   -5.912  32.640 1.00 27.43 ? 112  DT  P C7    1 
ATOM   7989 C  C6    . DT  C 3 10  ? 10.142  -7.871  33.729 1.00 22.67 ? 112  DT  P C6    1 
ATOM   7990 P  P     . DT  C 3 11  ? 9.136   -13.768 34.968 1.00 24.29 ? 113  DT  P P     1 
ATOM   7991 O  OP1   . DT  C 3 11  ? 8.971   -15.123 34.436 1.00 22.44 ? 113  DT  P OP1   1 
ATOM   7992 O  OP2   . DT  C 3 11  ? 7.966   -12.854 34.963 1.00 26.98 ? 113  DT  P OP2   1 
ATOM   7993 O  "O5'" . DT  C 3 11  ? 9.785   -13.928 36.418 1.00 28.18 ? 113  DT  P "O5'" 1 
ATOM   7994 C  "C5'" . DT  C 3 11  ? 9.030   -13.810 37.565 1.00 26.98 ? 113  DT  P "C5'" 1 
ATOM   7995 C  "C4'" . DT  C 3 11  ? 9.867   -13.074 38.576 1.00 25.26 ? 113  DT  P "C4'" 1 
ATOM   7996 O  "O4'" . DT  C 3 11  ? 10.154  -11.742 38.095 1.00 23.96 ? 113  DT  P "O4'" 1 
ATOM   7997 C  "C3'" . DT  C 3 11  ? 9.089   -12.912 39.856 1.00 23.71 ? 113  DT  P "C3'" 1 
ATOM   7998 O  "O3'" . DT  C 3 11  ? 9.562   -13.861 40.773 1.00 19.37 ? 113  DT  P "O3'" 1 
ATOM   7999 C  "C2'" . DT  C 3 11  ? 9.399   -11.514 40.364 1.00 25.87 ? 113  DT  P "C2'" 1 
ATOM   8000 C  "C1'" . DT  C 3 11  ? 9.963   -10.815 39.148 1.00 23.08 ? 113  DT  P "C1'" 1 
ATOM   8001 N  N1    . DT  C 3 11  ? 9.184   -9.620  38.695 1.00 20.31 ? 113  DT  P N1    1 
ATOM   8002 C  C2    . DT  C 3 11  ? 9.224   -8.491  39.495 1.00 19.76 ? 113  DT  P C2    1 
ATOM   8003 O  O2    . DT  C 3 11  ? 9.814   -8.438  40.556 1.00 19.92 ? 113  DT  P O2    1 
ATOM   8004 N  N3    . DT  C 3 11  ? 8.535   -7.411  39.010 1.00 19.05 ? 113  DT  P N3    1 
ATOM   8005 C  C4    . DT  C 3 11  ? 7.840   -7.346  37.814 1.00 18.22 ? 113  DT  P C4    1 
ATOM   8006 O  O4    . DT  C 3 11  ? 7.261   -6.317  37.483 1.00 19.88 ? 113  DT  P O4    1 
ATOM   8007 C  C5    . DT  C 3 11  ? 7.837   -8.555  37.018 1.00 20.12 ? 113  DT  P C5    1 
ATOM   8008 C  C7    . DT  C 3 11  ? 7.103   -8.608  35.708 1.00 22.60 ? 113  DT  P C7    1 
ATOM   8009 C  C6    . DT  C 3 11  ? 8.505   -9.624  37.489 1.00 20.78 ? 113  DT  P C6    1 
ATOM   8010 P  P     . DA  C 3 12  ? 8.542   -14.310 41.897 1.00 19.09 ? 114  DA  P P     1 
ATOM   8011 O  OP1   . DA  C 3 12  ? 9.192   -15.430 42.628 1.00 20.12 ? 114  DA  P OP1   1 
ATOM   8012 O  OP2   . DA  C 3 12  ? 7.202   -14.490 41.294 1.00 18.09 ? 114  DA  P OP2   1 
ATOM   8013 O  "O5'" . DA  C 3 12  ? 8.463   -13.032 42.844 1.00 17.14 ? 114  DA  P "O5'" 1 
ATOM   8014 C  "C5'" . DA  C 3 12  ? 9.608   -12.649 43.603 1.00 15.86 ? 114  DA  P "C5'" 1 
ATOM   8015 C  "C4'" . DA  C 3 12  ? 9.199   -11.677 44.695 1.00 16.57 ? 114  DA  P "C4'" 1 
ATOM   8016 O  "O4'" . DA  C 3 12  ? 8.907   -10.390 44.090 1.00 19.16 ? 114  DA  P "O4'" 1 
ATOM   8017 C  "C3'" . DA  C 3 12  ? 7.960   -12.098 45.477 1.00 18.00 ? 114  DA  P "C3'" 1 
ATOM   8018 O  "O3'" . DA  C 3 12  ? 8.164   -11.882 46.870 1.00 20.45 ? 114  DA  P "O3'" 1 
ATOM   8019 C  "C2'" . DA  C 3 12  ? 6.839   -11.225 44.901 1.00 17.79 ? 114  DA  P "C2'" 1 
ATOM   8020 C  "C1'" . DA  C 3 12  ? 7.592   -9.987  44.402 1.00 18.51 ? 114  DA  P "C1'" 1 
ATOM   8021 N  N9    . DA  C 3 12  ? 7.009   -9.360  43.213 1.00 17.61 ? 114  DA  P N9    1 
ATOM   8022 C  C8    . DA  C 3 12  ? 6.656   -9.967  42.041 1.00 18.34 ? 114  DA  P C8    1 
ATOM   8023 N  N7    . DA  C 3 12  ? 6.155   -9.150  41.142 1.00 18.30 ? 114  DA  P N7    1 
ATOM   8024 C  C5    . DA  C 3 12  ? 6.188   -7.915  41.776 1.00 18.23 ? 114  DA  P C5    1 
ATOM   8025 C  C6    . DA  C 3 12  ? 5.785   -6.625  41.363 1.00 15.75 ? 114  DA  P C6    1 
ATOM   8026 N  N6    . DA  C 3 12  ? 5.262   -6.402  40.159 1.00 15.16 ? 114  DA  P N6    1 
ATOM   8027 N  N1    . DA  C 3 12  ? 5.942   -5.588  42.229 1.00 15.97 ? 114  DA  P N1    1 
ATOM   8028 C  C2    . DA  C 3 12  ? 6.468   -5.839  43.443 1.00 16.55 ? 114  DA  P C2    1 
ATOM   8029 N  N3    . DA  C 3 12  ? 6.882   -7.013  43.938 1.00 17.23 ? 114  DA  P N3    1 
ATOM   8030 C  C4    . DA  C 3 12  ? 6.709   -8.022  43.053 1.00 17.63 ? 114  DA  P C4    1 
HETATM 8031 N  N1    . DOC C 3 13  ? 3.819   -8.009  45.079 1.00 16.88 ? 115  DOC P N1    1 
HETATM 8032 C  C2    . DOC C 3 13  ? 3.434   -6.820  44.411 1.00 17.55 ? 115  DOC P C2    1 
HETATM 8033 N  N3    . DOC C 3 13  ? 2.978   -6.873  43.141 1.00 15.56 ? 115  DOC P N3    1 
HETATM 8034 C  C4    . DOC C 3 13  ? 2.894   -8.059  42.496 1.00 17.87 ? 115  DOC P C4    1 
HETATM 8035 C  C5    . DOC C 3 13  ? 3.263   -9.241  43.135 1.00 16.71 ? 115  DOC P C5    1 
HETATM 8036 C  C6    . DOC C 3 13  ? 3.734   -9.195  44.442 1.00 17.26 ? 115  DOC P C6    1 
HETATM 8037 O  O2    . DOC C 3 13  ? 3.514   -5.714  44.986 1.00 16.27 ? 115  DOC P O2    1 
HETATM 8038 N  N4    . DOC C 3 13  ? 2.443   -8.085  41.223 1.00 17.31 ? 115  DOC P N4    1 
HETATM 8039 C  "C1'" . DOC C 3 13  ? 4.311   -7.907  46.456 1.00 19.21 ? 115  DOC P "C1'" 1 
HETATM 8040 C  "C2'" . DOC C 3 13  ? 3.220   -8.174  47.501 1.00 21.14 ? 115  DOC P "C2'" 1 
HETATM 8041 C  "C3'" . DOC C 3 13  ? 3.867   -9.120  48.502 1.00 22.49 ? 115  DOC P "C3'" 1 
HETATM 8042 C  "C4'" . DOC C 3 13  ? 5.335   -8.962  48.151 1.00 20.77 ? 115  DOC P "C4'" 1 
HETATM 8043 O  "O4'" . DOC C 3 13  ? 5.344   -8.848  46.728 1.00 18.09 ? 115  DOC P "O4'" 1 
HETATM 8044 C  "C5'" . DOC C 3 13  ? 6.252   -10.054 48.698 1.00 25.84 ? 115  DOC P "C5'" 1 
HETATM 8045 O  "O5'" . DOC C 3 13  ? 6.069   -11.278 48.025 1.00 24.64 ? 115  DOC P "O5'" 1 
HETATM 8046 P  P     . DOC C 3 13  ? 7.250   -12.367 47.934 1.00 22.50 ? 115  DOC P P     1 
HETATM 8047 O  OP1   . DOC C 3 13  ? 8.121   -12.313 49.171 1.00 22.01 ? 115  DOC P OP1   1 
HETATM 8048 O  OP2   . DOC C 3 13  ? 6.538   -13.634 47.549 1.00 21.64 ? 115  DOC P OP2   1 
HETATM 8049 N  N1    . DCP D 4 .   ? -0.199  -6.170  45.755 1.00 19.10 ? 904  DCP A N1    1 
HETATM 8050 C  C2    . DCP D 4 .   ? -0.697  -5.568  44.606 1.00 21.07 ? 904  DCP A C2    1 
HETATM 8051 N  N3    . DCP D 4 .   ? -0.820  -6.297  43.448 1.00 22.36 ? 904  DCP A N3    1 
HETATM 8052 C  C4    . DCP D 4 .   ? -0.446  -7.619  43.405 1.00 22.01 ? 904  DCP A C4    1 
HETATM 8053 C  C5    . DCP D 4 .   ? -0.010  -8.249  44.564 1.00 21.03 ? 904  DCP A C5    1 
HETATM 8054 C  C6    . DCP D 4 .   ? 0.140   -7.498  45.725 1.00 18.59 ? 904  DCP A C6    1 
HETATM 8055 O  O2    . DCP D 4 .   ? -1.049  -4.390  44.615 1.00 24.02 ? 904  DCP A O2    1 
HETATM 8056 N  N4    . DCP D 4 .   ? -0.497  -8.290  42.259 1.00 24.20 ? 904  DCP A N4    1 
HETATM 8057 C  "C1'" . DCP D 4 .   ? -0.302  -5.457  47.048 1.00 17.72 ? 904  DCP A "C1'" 1 
HETATM 8058 C  "C2'" . DCP D 4 .   ? -1.747  -5.516  47.542 1.00 17.30 ? 904  DCP A "C2'" 1 
HETATM 8059 C  "C3'" . DCP D 4 .   ? -1.711  -6.611  48.580 1.00 15.36 ? 904  DCP A "C3'" 1 
HETATM 8060 C  "C4'" . DCP D 4 .   ? -0.300  -6.472  49.140 1.00 17.25 ? 904  DCP A "C4'" 1 
HETATM 8061 O  "O4'" . DCP D 4 .   ? 0.499   -6.085  48.029 1.00 18.86 ? 904  DCP A "O4'" 1 
HETATM 8062 O  "O3'" . DCP D 4 .   ? -2.745  -6.451  49.532 1.00 12.93 ? 904  DCP A "O3'" 1 
HETATM 8063 C  "C5'" . DCP D 4 .   ? 0.245   -7.754  49.734 1.00 15.47 ? 904  DCP A "C5'" 1 
HETATM 8064 O  "O5'" . DCP D 4 .   ? 0.281   -8.749  48.727 1.00 17.64 ? 904  DCP A "O5'" 1 
HETATM 8065 P  PA    . DCP D 4 .   ? -0.061  -10.283 49.036 1.00 19.76 ? 904  DCP A PA    1 
HETATM 8066 O  O1A   . DCP D 4 .   ? 0.454   -11.130 47.900 1.00 18.77 ? 904  DCP A O1A   1 
HETATM 8067 O  O2A   . DCP D 4 .   ? 0.446   -10.747 50.382 1.00 21.62 ? 904  DCP A O2A   1 
HETATM 8068 O  O3A   . DCP D 4 .   ? -1.656  -10.397 48.898 1.00 19.54 ? 904  DCP A O3A   1 
HETATM 8069 P  PB    . DCP D 4 .   ? -2.809  -9.996  49.938 1.00 17.59 ? 904  DCP A PB    1 
HETATM 8070 O  O1B   . DCP D 4 .   ? -3.651  -8.955  49.247 1.00 21.23 ? 904  DCP A O1B   1 
HETATM 8071 O  O2B   . DCP D 4 .   ? -2.306  -9.564  51.289 1.00 14.97 ? 904  DCP A O2B   1 
HETATM 8072 O  O3B   . DCP D 4 .   ? -3.706  -11.324 49.983 1.00 19.00 ? 904  DCP A O3B   1 
HETATM 8073 P  PG    . DCP D 4 .   ? -3.457  -12.611 50.914 1.00 19.29 ? 904  DCP A PG    1 
HETATM 8074 O  O1G   . DCP D 4 .   ? -2.131  -12.498 51.628 1.00 18.25 ? 904  DCP A O1G   1 
HETATM 8075 O  O2G   . DCP D 4 .   ? -4.646  -12.629 51.828 1.00 17.60 ? 904  DCP A O2G   1 
HETATM 8076 O  O3G   . DCP D 4 .   ? -3.452  -13.802 49.990 1.00 19.80 ? 904  DCP A O3G   1 
HETATM 8077 CA CA    . CA  E 5 .   ? -0.867  -10.837 52.530 1.00 19.10 ? 905  CA  A CA    1 
HETATM 8078 CA CA    . CA  F 5 .   ? 2.636   -11.291 51.455 1.00 40.38 ? 906  CA  A CA    1 
HETATM 8079 CA CA    . CA  G 5 .   ? -3.632  -48.519 52.600 1.00 30.03 ? 907  CA  A CA    1 
HETATM 8080 CA CA    . CA  H 5 .   ? -2.637  -15.924 55.428 1.00 76.98 ? 908  CA  A CA    1 
HETATM 8081 CA CA    . CA  I 5 .   ? -3.753  -24.554 13.196 1.00 41.24 ? 909  CA  A CA    1 
HETATM 8082 CA CA    . CA  J 5 .   ? 26.626  -4.465  36.070 1.00 55.45 ? 1    CA  P CA    1 
HETATM 8083 O  O     . HOH K 6 .   ? 2.560   -0.539  51.531 1.00 15.60 ? 910  HOH A O     1 
HETATM 8084 O  O     . HOH K 6 .   ? -15.338 -22.106 32.892 1.00 16.13 ? 911  HOH A O     1 
HETATM 8085 O  O     . HOH K 6 .   ? -10.727 -11.093 24.191 1.00 24.99 ? 912  HOH A O     1 
HETATM 8086 O  O     . HOH K 6 .   ? -20.042 -4.608  52.734 1.00 21.52 ? 913  HOH A O     1 
HETATM 8087 O  O     . HOH K 6 .   ? -4.722  -2.607  63.348 1.00 19.19 ? 914  HOH A O     1 
HETATM 8088 O  O     . HOH K 6 .   ? 10.078  -10.452 48.713 1.00 17.77 ? 915  HOH A O     1 
HETATM 8089 O  O     . HOH K 6 .   ? 9.479   -28.612 45.980 1.00 20.96 ? 916  HOH A O     1 
HETATM 8090 O  O     . HOH K 6 .   ? 4.677   -1.851  52.776 1.00 15.38 ? 917  HOH A O     1 
HETATM 8091 O  O     . HOH K 6 .   ? -11.328 11.235  45.688 1.00 19.18 ? 918  HOH A O     1 
HETATM 8092 O  O     . HOH K 6 .   ? -14.388 -22.671 44.311 1.00 22.73 ? 919  HOH A O     1 
HETATM 8093 O  O     . HOH K 6 .   ? -26.357 -6.762  22.117 1.00 20.37 ? 920  HOH A O     1 
HETATM 8094 O  O     . HOH K 6 .   ? -22.334 -21.114 18.396 1.00 19.27 ? 921  HOH A O     1 
HETATM 8095 O  O     . HOH K 6 .   ? -27.020 7.767   32.196 1.00 20.72 ? 922  HOH A O     1 
HETATM 8096 O  O     . HOH K 6 .   ? -19.177 -2.971  30.202 1.00 20.46 ? 923  HOH A O     1 
HETATM 8097 O  O     . HOH K 6 .   ? -11.208 -9.301  16.306 1.00 20.07 ? 924  HOH A O     1 
HETATM 8098 O  O     . HOH K 6 .   ? 12.199  -20.741 30.410 1.00 18.81 ? 925  HOH A O     1 
HETATM 8099 O  O     . HOH K 6 .   ? -8.384  -32.249 55.172 1.00 18.44 ? 926  HOH A O     1 
HETATM 8100 O  O     . HOH K 6 .   ? 14.840  -23.106 27.611 1.00 19.03 ? 927  HOH A O     1 
HETATM 8101 O  O     . HOH K 6 .   ? -1.479  -26.511 4.562  1.00 23.80 ? 928  HOH A O     1 
HETATM 8102 O  O     . HOH K 6 .   ? -10.022 -7.167  53.490 1.00 20.11 ? 929  HOH A O     1 
HETATM 8103 O  O     . HOH K 6 .   ? -7.300  -11.187 37.522 1.00 19.88 ? 930  HOH A O     1 
HETATM 8104 O  O     . HOH K 6 .   ? -25.051 -17.293 3.870  1.00 23.25 ? 931  HOH A O     1 
HETATM 8105 O  O     . HOH K 6 .   ? -5.526  -22.838 13.469 1.00 25.22 ? 932  HOH A O     1 
HETATM 8106 O  O     . HOH K 6 .   ? -0.927  -27.495 1.841  1.00 21.81 ? 933  HOH A O     1 
HETATM 8107 O  O     . HOH K 6 .   ? -5.946  -21.316 38.555 1.00 17.00 ? 934  HOH A O     1 
HETATM 8108 O  O     . HOH K 6 .   ? -14.102 -19.823 38.090 1.00 17.45 ? 935  HOH A O     1 
HETATM 8109 O  O     . HOH K 6 .   ? -22.269 -6.995  25.900 1.00 17.73 ? 936  HOH A O     1 
HETATM 8110 O  O     . HOH K 6 .   ? 7.473   -4.066  46.322 1.00 17.08 ? 937  HOH A O     1 
HETATM 8111 O  O     . HOH K 6 .   ? -13.146 12.911  46.882 1.00 21.70 ? 938  HOH A O     1 
HETATM 8112 O  O     . HOH K 6 .   ? -4.885  -7.746  57.385 1.00 18.65 ? 939  HOH A O     1 
HETATM 8113 O  O     . HOH K 6 .   ? -6.353  -23.728 0.877  1.00 22.60 ? 940  HOH A O     1 
HETATM 8114 O  O     . HOH K 6 .   ? -21.684 -5.116  0.773  1.00 20.83 ? 941  HOH A O     1 
HETATM 8115 O  O     . HOH K 6 .   ? -21.253 -1.481  10.938 1.00 27.24 ? 942  HOH A O     1 
HETATM 8116 O  O     . HOH K 6 .   ? -10.888 8.371   45.675 1.00 17.35 ? 943  HOH A O     1 
HETATM 8117 O  O     . HOH K 6 .   ? -25.184 -20.842 36.085 1.00 30.87 ? 944  HOH A O     1 
HETATM 8118 O  O     . HOH K 6 .   ? -9.477  -33.776 57.348 1.00 22.43 ? 945  HOH A O     1 
HETATM 8119 O  O     . HOH K 6 .   ? -9.134  -28.462 4.175  1.00 19.91 ? 946  HOH A O     1 
HETATM 8120 O  O     . HOH K 6 .   ? -6.319  -8.836  48.616 1.00 19.33 ? 947  HOH A O     1 
HETATM 8121 O  O     . HOH K 6 .   ? -5.876  16.398  63.656 1.00 21.69 ? 948  HOH A O     1 
HETATM 8122 O  O     . HOH K 6 .   ? -20.856 -7.132  23.546 1.00 18.86 ? 949  HOH A O     1 
HETATM 8123 O  O     . HOH K 6 .   ? 5.971   -17.188 53.510 1.00 26.02 ? 950  HOH A O     1 
HETATM 8124 O  O     . HOH K 6 .   ? -13.362 -21.850 39.739 1.00 18.30 ? 951  HOH A O     1 
HETATM 8125 O  O     . HOH K 6 .   ? -17.535 -23.447 24.239 1.00 20.85 ? 952  HOH A O     1 
HETATM 8126 O  O     . HOH K 6 .   ? -23.564 -23.322 27.628 1.00 25.96 ? 953  HOH A O     1 
HETATM 8127 O  O     . HOH K 6 .   ? -21.856 -8.259  0.947  1.00 25.12 ? 954  HOH A O     1 
HETATM 8128 O  O     A HOH K 6 .   ? -3.139  -16.613 46.750 0.50 16.42 ? 955  HOH A O     1 
HETATM 8129 O  O     B HOH K 6 .   ? -3.258  -17.344 48.191 0.50 17.93 ? 955  HOH A O     1 
HETATM 8130 O  O     . HOH K 6 .   ? -18.863 4.810   39.474 1.00 19.78 ? 956  HOH A O     1 
HETATM 8131 O  O     . HOH K 6 .   ? 12.204  -22.168 28.041 1.00 22.33 ? 957  HOH A O     1 
HETATM 8132 O  O     . HOH K 6 .   ? -0.668  6.597   37.537 1.00 24.68 ? 958  HOH A O     1 
HETATM 8133 O  O     . HOH K 6 .   ? 14.915  -30.656 42.636 1.00 22.97 ? 959  HOH A O     1 
HETATM 8134 O  O     . HOH K 6 .   ? -21.932 -9.426  27.511 1.00 16.21 ? 960  HOH A O     1 
HETATM 8135 O  O     . HOH K 6 .   ? -8.565  16.014  64.125 1.00 22.55 ? 961  HOH A O     1 
HETATM 8136 O  O     . HOH K 6 .   ? -19.979 -11.069 49.773 1.00 27.57 ? 962  HOH A O     1 
HETATM 8137 O  O     . HOH K 6 .   ? 16.034  -2.010  55.229 1.00 20.03 ? 963  HOH A O     1 
HETATM 8138 O  O     . HOH K 6 .   ? -5.047  -18.789 38.736 1.00 19.11 ? 964  HOH A O     1 
HETATM 8139 O  O     . HOH K 6 .   ? 9.826   1.663   49.559 1.00 21.51 ? 965  HOH A O     1 
HETATM 8140 O  O     . HOH K 6 .   ? -29.486 6.781   32.482 1.00 20.85 ? 966  HOH A O     1 
HETATM 8141 O  O     . HOH K 6 .   ? -16.830 -39.512 59.980 1.00 24.30 ? 967  HOH A O     1 
HETATM 8142 O  O     . HOH K 6 .   ? -4.652  -47.162 50.923 1.00 26.22 ? 968  HOH A O     1 
HETATM 8143 O  O     . HOH K 6 .   ? -5.620  -21.345 1.916  1.00 23.53 ? 969  HOH A O     1 
HETATM 8144 O  O     . HOH K 6 .   ? 3.594   -30.553 5.791  1.00 36.11 ? 970  HOH A O     1 
HETATM 8145 O  O     . HOH K 6 .   ? 10.016  -21.206 32.121 1.00 31.35 ? 971  HOH A O     1 
HETATM 8146 O  O     . HOH K 6 .   ? -16.138 -8.248  19.294 1.00 26.53 ? 972  HOH A O     1 
HETATM 8147 O  O     . HOH K 6 .   ? -20.590 12.619  43.213 1.00 21.68 ? 973  HOH A O     1 
HETATM 8148 O  O     . HOH K 6 .   ? -27.324 -17.801 24.629 1.00 20.77 ? 974  HOH A O     1 
HETATM 8149 O  O     . HOH K 6 .   ? 20.181  -30.377 20.822 1.00 27.23 ? 975  HOH A O     1 
HETATM 8150 O  O     . HOH K 6 .   ? 21.588  -23.022 58.225 1.00 23.14 ? 976  HOH A O     1 
HETATM 8151 O  O     . HOH K 6 .   ? 8.830   -36.183 60.501 1.00 27.37 ? 977  HOH A O     1 
HETATM 8152 O  O     . HOH K 6 .   ? -13.952 -5.211  20.593 1.00 20.63 ? 978  HOH A O     1 
HETATM 8153 O  O     . HOH K 6 .   ? 22.215  -12.988 59.214 1.00 26.59 ? 979  HOH A O     1 
HETATM 8154 O  O     . HOH K 6 .   ? -3.749  -32.693 55.270 1.00 23.37 ? 980  HOH A O     1 
HETATM 8155 O  O     . HOH K 6 .   ? -15.090 -0.684  19.109 1.00 28.91 ? 981  HOH A O     1 
HETATM 8156 O  O     . HOH K 6 .   ? -2.796  -9.320  63.615 1.00 25.96 ? 982  HOH A O     1 
HETATM 8157 O  O     . HOH K 6 .   ? -9.337  -30.743 31.628 1.00 22.42 ? 983  HOH A O     1 
HETATM 8158 O  O     . HOH K 6 .   ? -0.947  -21.465 18.801 1.00 25.37 ? 984  HOH A O     1 
HETATM 8159 O  O     . HOH K 6 .   ? -25.149 -9.461  2.518  1.00 22.21 ? 985  HOH A O     1 
HETATM 8160 O  O     . HOH K 6 .   ? 22.440  -34.233 55.264 1.00 28.27 ? 986  HOH A O     1 
HETATM 8161 O  O     . HOH K 6 .   ? -3.423  -9.177  43.542 1.00 18.70 ? 987  HOH A O     1 
HETATM 8162 O  O     . HOH K 6 .   ? -4.981  -30.859 46.067 1.00 19.94 ? 988  HOH A O     1 
HETATM 8163 O  O     . HOH K 6 .   ? -10.542 -27.675 37.905 1.00 21.26 ? 989  HOH A O     1 
HETATM 8164 O  O     . HOH K 6 .   ? -3.418  -27.438 0.421  1.00 27.07 ? 990  HOH A O     1 
HETATM 8165 O  O     . HOH K 6 .   ? -6.019  -11.721 21.581 1.00 27.27 ? 991  HOH A O     1 
HETATM 8166 O  O     . HOH K 6 .   ? 15.927  -29.755 61.831 1.00 24.56 ? 992  HOH A O     1 
HETATM 8167 O  O     . HOH K 6 .   ? 20.722  -6.620  26.454 1.00 28.25 ? 993  HOH A O     1 
HETATM 8168 O  O     . HOH K 6 .   ? -2.730  -50.716 44.660 1.00 33.01 ? 994  HOH A O     1 
HETATM 8169 O  O     . HOH K 6 .   ? 23.901  -6.936  21.925 1.00 22.69 ? 995  HOH A O     1 
HETATM 8170 O  O     . HOH K 6 .   ? -15.187 -17.960 39.950 1.00 20.22 ? 996  HOH A O     1 
HETATM 8171 O  O     . HOH K 6 .   ? -11.023 -20.817 -2.531 1.00 22.29 ? 997  HOH A O     1 
HETATM 8172 O  O     . HOH K 6 .   ? -19.923 13.674  25.293 1.00 30.83 ? 998  HOH A O     1 
HETATM 8173 O  O     . HOH K 6 .   ? -29.824 -19.720 22.382 1.00 22.72 ? 999  HOH A O     1 
HETATM 8174 O  O     . HOH K 6 .   ? -23.060 -4.173  40.171 1.00 20.25 ? 1000 HOH A O     1 
HETATM 8175 O  O     . HOH K 6 .   ? 18.521  -20.147 72.134 1.00 29.73 ? 1001 HOH A O     1 
HETATM 8176 O  O     . HOH K 6 .   ? 25.737  -32.747 52.264 1.00 27.24 ? 1002 HOH A O     1 
HETATM 8177 O  O     . HOH K 6 .   ? -9.621  -10.243 38.463 1.00 19.11 ? 1003 HOH A O     1 
HETATM 8178 O  O     . HOH K 6 .   ? -8.421  -8.308  57.325 1.00 21.48 ? 1004 HOH A O     1 
HETATM 8179 O  O     . HOH K 6 .   ? 28.757  -32.352 28.857 1.00 40.57 ? 1005 HOH A O     1 
HETATM 8180 O  O     . HOH K 6 .   ? 15.835  -17.025 66.753 1.00 28.22 ? 1006 HOH A O     1 
HETATM 8181 O  O     . HOH K 6 .   ? -5.012  9.320   65.264 1.00 25.53 ? 1007 HOH A O     1 
HETATM 8182 O  O     . HOH K 6 .   ? -12.482 -23.030 -3.060 1.00 20.39 ? 1008 HOH A O     1 
HETATM 8183 O  O     . HOH K 6 .   ? -0.825  9.269   38.629 1.00 25.60 ? 1009 HOH A O     1 
HETATM 8184 O  O     . HOH K 6 .   ? 26.013  -18.151 58.507 1.00 31.72 ? 1010 HOH A O     1 
HETATM 8185 O  O     . HOH K 6 .   ? -24.368 -1.373  35.364 1.00 20.18 ? 1011 HOH A O     1 
HETATM 8186 O  O     . HOH K 6 .   ? 14.862  -30.024 39.839 1.00 22.18 ? 1012 HOH A O     1 
HETATM 8187 O  O     . HOH K 6 .   ? -33.136 7.685   32.860 1.00 22.92 ? 1013 HOH A O     1 
HETATM 8188 O  O     . HOH K 6 .   ? 12.043  -1.188  70.153 1.00 31.57 ? 1014 HOH A O     1 
HETATM 8189 O  O     . HOH K 6 .   ? 0.964   -21.438 63.311 1.00 25.61 ? 1015 HOH A O     1 
HETATM 8190 O  O     . HOH K 6 .   ? 27.900  -13.547 25.333 1.00 33.50 ? 1016 HOH A O     1 
HETATM 8191 O  O     . HOH K 6 .   ? -13.864 4.663   36.334 1.00 25.82 ? 1017 HOH A O     1 
HETATM 8192 O  O     . HOH K 6 .   ? 16.177  -9.743  27.998 1.00 27.27 ? 1018 HOH A O     1 
HETATM 8193 O  O     . HOH K 6 .   ? 18.387  -9.840  57.738 1.00 23.69 ? 1019 HOH A O     1 
HETATM 8194 O  O     . HOH K 6 .   ? -25.436 21.305  44.799 1.00 29.97 ? 1020 HOH A O     1 
HETATM 8195 O  O     . HOH K 6 .   ? -7.789  -20.104 14.643 1.00 23.84 ? 1021 HOH A O     1 
HETATM 8196 O  O     . HOH K 6 .   ? -5.189  -37.182 3.802  1.00 28.54 ? 1022 HOH A O     1 
HETATM 8197 O  O     . HOH K 6 .   ? -20.969 -35.941 10.849 1.00 27.01 ? 1023 HOH A O     1 
HETATM 8198 O  O     . HOH K 6 .   ? -14.828 0.227   10.933 1.00 33.04 ? 1024 HOH A O     1 
HETATM 8199 O  O     . HOH K 6 .   ? 21.950  -14.175 39.899 1.00 30.31 ? 1025 HOH A O     1 
HETATM 8200 O  O     . HOH K 6 .   ? -3.481  -23.746 45.145 1.00 31.87 ? 1026 HOH A O     1 
HETATM 8201 O  O     . HOH K 6 .   ? 4.046   4.608   50.522 1.00 19.50 ? 1027 HOH A O     1 
HETATM 8202 O  O     . HOH K 6 .   ? 5.590   -31.434 56.494 1.00 23.44 ? 1028 HOH A O     1 
HETATM 8203 O  O     . HOH K 6 .   ? 19.819  -19.163 60.974 1.00 30.44 ? 1029 HOH A O     1 
HETATM 8204 O  O     . HOH K 6 .   ? -4.481  -14.824 63.968 1.00 32.00 ? 1030 HOH A O     1 
HETATM 8205 O  O     . HOH K 6 .   ? -28.984 -1.979  39.476 1.00 39.47 ? 1031 HOH A O     1 
HETATM 8206 O  O     . HOH K 6 .   ? 8.936   10.061  56.252 1.00 37.98 ? 1032 HOH A O     1 
HETATM 8207 O  O     . HOH K 6 .   ? -33.121 15.870  25.037 1.00 28.59 ? 1033 HOH A O     1 
HETATM 8208 O  O     . HOH K 6 .   ? -17.844 -24.107 26.920 1.00 26.87 ? 1034 HOH A O     1 
HETATM 8209 O  O     . HOH K 6 .   ? -19.579 15.029  42.482 1.00 27.11 ? 1035 HOH A O     1 
HETATM 8210 O  O     . HOH K 6 .   ? -19.195 22.137  38.532 1.00 25.38 ? 1036 HOH A O     1 
HETATM 8211 O  O     . HOH K 6 .   ? -15.165 13.980  51.305 1.00 32.86 ? 1037 HOH A O     1 
HETATM 8212 O  O     . HOH K 6 .   ? 4.319   1.175   70.464 1.00 26.18 ? 1038 HOH A O     1 
HETATM 8213 O  O     . HOH K 6 .   ? -6.588  -9.045  20.620 1.00 27.47 ? 1039 HOH A O     1 
HETATM 8214 O  O     . HOH K 6 .   ? -14.978 -31.383 44.952 1.00 26.93 ? 1040 HOH A O     1 
HETATM 8215 O  O     . HOH K 6 .   ? 5.421   -6.743  71.294 1.00 23.70 ? 1041 HOH A O     1 
HETATM 8216 O  O     . HOH K 6 .   ? 20.038  2.883   18.949 1.00 37.55 ? 1042 HOH A O     1 
HETATM 8217 O  O     . HOH K 6 .   ? -9.726  -7.563  37.650 1.00 23.06 ? 1043 HOH A O     1 
HETATM 8218 O  O     . HOH K 6 .   ? 0.281   15.783  63.632 1.00 24.16 ? 1044 HOH A O     1 
HETATM 8219 O  O     . HOH K 6 .   ? -4.862  -10.391 29.169 1.00 22.83 ? 1045 HOH A O     1 
HETATM 8220 O  O     . HOH K 6 .   ? -15.277 -22.281 41.534 1.00 25.20 ? 1046 HOH A O     1 
HETATM 8221 O  O     . HOH K 6 .   ? -19.747 18.523  45.191 1.00 29.28 ? 1047 HOH A O     1 
HETATM 8222 O  O     . HOH K 6 .   ? 2.024   -4.269  71.927 1.00 29.46 ? 1048 HOH A O     1 
HETATM 8223 O  O     . HOH K 6 .   ? -3.582  -12.899 4.048  1.00 24.28 ? 1049 HOH A O     1 
HETATM 8224 O  O     . HOH K 6 .   ? -15.537 -38.923 8.301  1.00 29.09 ? 1050 HOH A O     1 
HETATM 8225 O  O     . HOH K 6 .   ? 13.260  -3.511  66.093 1.00 28.04 ? 1051 HOH A O     1 
HETATM 8226 O  O     . HOH K 6 .   ? 22.373  -15.573 42.351 1.00 32.29 ? 1052 HOH A O     1 
HETATM 8227 O  O     . HOH K 6 .   ? -31.592 6.801   41.556 1.00 24.57 ? 1053 HOH A O     1 
HETATM 8228 O  O     . HOH K 6 .   ? -31.852 6.993   23.083 1.00 26.13 ? 1054 HOH A O     1 
HETATM 8229 O  O     . HOH K 6 .   ? 10.443  -23.588 26.717 1.00 22.61 ? 1055 HOH A O     1 
HETATM 8230 O  O     . HOH K 6 .   ? -27.657 -17.877 20.333 1.00 20.23 ? 1056 HOH A O     1 
HETATM 8231 O  O     . HOH K 6 .   ? 16.920  -18.244 61.022 1.00 26.09 ? 1057 HOH A O     1 
HETATM 8232 O  O     . HOH K 6 .   ? -14.650 -26.799 28.897 1.00 20.59 ? 1058 HOH A O     1 
HETATM 8233 O  O     . HOH K 6 .   ? -6.997  -17.998 16.088 1.00 23.30 ? 1059 HOH A O     1 
HETATM 8234 O  O     . HOH K 6 .   ? -13.872 -38.470 43.884 1.00 27.88 ? 1060 HOH A O     1 
HETATM 8235 O  O     . HOH K 6 .   ? -6.354  17.190  50.929 1.00 26.98 ? 1061 HOH A O     1 
HETATM 8236 O  O     . HOH K 6 .   ? -17.272 3.666   32.787 1.00 32.38 ? 1062 HOH A O     1 
HETATM 8237 O  O     . HOH K 6 .   ? -0.710  -21.221 37.717 1.00 35.16 ? 1063 HOH A O     1 
HETATM 8238 O  O     . HOH K 6 .   ? -2.772  -18.898 40.280 1.00 31.55 ? 1064 HOH A O     1 
HETATM 8239 O  O     . HOH K 6 .   ? 22.486  -21.385 60.191 1.00 28.24 ? 1065 HOH A O     1 
HETATM 8240 O  O     . HOH K 6 .   ? -32.407 -19.764 21.010 1.00 30.27 ? 1066 HOH A O     1 
HETATM 8241 O  O     . HOH K 6 .   ? -2.495  16.184  64.403 1.00 25.24 ? 1067 HOH A O     1 
HETATM 8242 O  O     . HOH K 6 .   ? -24.524 -11.688 40.230 1.00 25.02 ? 1068 HOH A O     1 
HETATM 8243 O  O     . HOH K 6 .   ? -0.782  -23.514 51.568 1.00 27.68 ? 1069 HOH A O     1 
HETATM 8244 O  O     . HOH K 6 .   ? -13.348 -7.992  20.718 1.00 30.60 ? 1070 HOH A O     1 
HETATM 8245 O  O     . HOH K 6 .   ? 26.565  -14.125 52.959 1.00 32.42 ? 1071 HOH A O     1 
HETATM 8246 O  O     . HOH K 6 .   ? 14.641  -21.890 56.949 1.00 25.49 ? 1072 HOH A O     1 
HETATM 8247 O  O     . HOH K 6 .   ? -1.202  16.512  55.532 1.00 25.16 ? 1073 HOH A O     1 
HETATM 8248 O  O     . HOH K 6 .   ? -1.648  -42.304 8.642  1.00 30.17 ? 1074 HOH A O     1 
HETATM 8249 O  O     . HOH K 6 .   ? 24.307  -14.208 33.816 1.00 27.06 ? 1075 HOH A O     1 
HETATM 8250 O  O     . HOH K 6 .   ? -4.232  -25.247 54.659 1.00 18.78 ? 1076 HOH A O     1 
HETATM 8251 O  O     . HOH K 6 .   ? -17.088 -23.741 44.723 1.00 22.44 ? 1077 HOH A O     1 
HETATM 8252 O  O     . HOH K 6 .   ? -24.519 -12.755 14.144 1.00 34.48 ? 1078 HOH A O     1 
HETATM 8253 O  O     . HOH K 6 .   ? -3.659  -34.936 1.872  1.00 26.59 ? 1079 HOH A O     1 
HETATM 8254 O  O     . HOH K 6 .   ? 12.917  -20.652 13.208 1.00 31.26 ? 1080 HOH A O     1 
HETATM 8255 O  O     . HOH K 6 .   ? -11.896 11.127  43.161 1.00 30.30 ? 1081 HOH A O     1 
HETATM 8256 O  O     . HOH K 6 .   ? -24.344 8.988   22.549 1.00 30.70 ? 1082 HOH A O     1 
HETATM 8257 O  O     . HOH K 6 .   ? 4.399   12.721  41.413 1.00 47.69 ? 1083 HOH A O     1 
HETATM 8258 O  O     . HOH K 6 .   ? 10.787  -1.576  62.193 1.00 27.09 ? 1084 HOH A O     1 
HETATM 8259 O  O     . HOH K 6 .   ? -27.049 -13.447 14.199 1.00 29.94 ? 1085 HOH A O     1 
HETATM 8260 O  O     . HOH K 6 .   ? 9.816   -21.128 36.780 1.00 27.64 ? 1086 HOH A O     1 
HETATM 8261 O  O     . HOH K 6 .   ? -2.892  -8.242  9.389  1.00 27.63 ? 1087 HOH A O     1 
HETATM 8262 O  O     . HOH K 6 .   ? -4.958  -24.827 15.014 1.00 29.95 ? 1088 HOH A O     1 
HETATM 8263 O  O     . HOH K 6 .   ? 2.638   -39.835 47.797 1.00 35.22 ? 1089 HOH A O     1 
HETATM 8264 O  O     . HOH K 6 .   ? -10.842 -9.333  57.332 1.00 27.64 ? 1090 HOH A O     1 
HETATM 8265 O  O     . HOH K 6 .   ? 27.941  -31.525 53.782 1.00 30.07 ? 1091 HOH A O     1 
HETATM 8266 O  O     . HOH K 6 .   ? 14.726  -0.978  52.489 1.00 29.20 ? 1092 HOH A O     1 
HETATM 8267 O  O     . HOH K 6 .   ? -30.683 -6.717  16.035 1.00 24.66 ? 1093 HOH A O     1 
HETATM 8268 O  O     . HOH K 6 .   ? -2.060  -13.555 35.612 1.00 28.70 ? 1094 HOH A O     1 
HETATM 8269 O  O     . HOH K 6 .   ? -4.134  -51.275 13.618 1.00 34.10 ? 1095 HOH A O     1 
HETATM 8270 O  O     . HOH K 6 .   ? 13.496  1.347   51.924 1.00 28.43 ? 1096 HOH A O     1 
HETATM 8271 O  O     . HOH K 6 .   ? 4.912   -26.856 27.558 1.00 26.26 ? 1097 HOH A O     1 
HETATM 8272 O  O     . HOH K 6 .   ? -8.578  -9.408  24.396 1.00 25.96 ? 1098 HOH A O     1 
HETATM 8273 O  O     . HOH K 6 .   ? 6.891   -12.080 51.550 1.00 28.18 ? 1099 HOH A O     1 
HETATM 8274 O  O     . HOH K 6 .   ? -25.527 -9.009  39.908 1.00 26.26 ? 1100 HOH A O     1 
HETATM 8275 O  O     . HOH K 6 .   ? -13.953 -26.069 53.416 1.00 27.71 ? 1101 HOH A O     1 
HETATM 8276 O  O     . HOH K 6 .   ? -15.701 -1.700  55.453 1.00 33.39 ? 1102 HOH A O     1 
HETATM 8277 O  O     . HOH K 6 .   ? 12.369  -1.470  64.501 1.00 30.21 ? 1103 HOH A O     1 
HETATM 8278 O  O     . HOH K 6 .   ? 15.868  -11.347 41.093 1.00 27.90 ? 1104 HOH A O     1 
HETATM 8279 O  O     . HOH K 6 .   ? -13.317 -9.314  18.131 1.00 26.99 ? 1105 HOH A O     1 
HETATM 8280 O  O     . HOH K 6 .   ? 11.337  -22.305 7.081  1.00 52.69 ? 1106 HOH A O     1 
HETATM 8281 O  O     . HOH K 6 .   ? -4.577  13.026  42.888 1.00 23.99 ? 1107 HOH A O     1 
HETATM 8282 O  O     . HOH K 6 .   ? -11.207 -7.400  3.773  1.00 43.48 ? 1108 HOH A O     1 
HETATM 8283 O  O     . HOH K 6 .   ? -18.196 -38.593 55.886 1.00 29.20 ? 1109 HOH A O     1 
HETATM 8284 O  O     . HOH K 6 .   ? -17.711 19.095  32.499 1.00 25.73 ? 1110 HOH A O     1 
HETATM 8285 O  O     . HOH K 6 .   ? -26.990 -18.152 2.156  1.00 27.58 ? 1111 HOH A O     1 
HETATM 8286 O  O     . HOH K 6 .   ? -4.779  -5.818  73.067 1.00 42.33 ? 1112 HOH A O     1 
HETATM 8287 O  O     . HOH K 6 .   ? -3.009  -46.014 52.690 1.00 29.60 ? 1113 HOH A O     1 
HETATM 8288 O  O     . HOH K 6 .   ? -29.341 -16.089 16.217 1.00 29.88 ? 1114 HOH A O     1 
HETATM 8289 O  O     . HOH K 6 .   ? 13.584  -10.859 42.446 1.00 22.65 ? 1115 HOH A O     1 
HETATM 8290 O  O     . HOH K 6 .   ? -12.191 15.459  47.670 1.00 25.98 ? 1116 HOH A O     1 
HETATM 8291 O  O     . HOH K 6 .   ? 27.910  -15.027 23.152 1.00 29.57 ? 1117 HOH A O     1 
HETATM 8292 O  O     . HOH K 6 .   ? -34.209 -19.875 23.081 1.00 27.56 ? 1118 HOH A O     1 
HETATM 8293 O  O     . HOH K 6 .   ? -28.648 -24.824 19.544 1.00 31.21 ? 1119 HOH A O     1 
HETATM 8294 O  O     . HOH K 6 .   ? -2.123  -45.190 55.293 1.00 32.23 ? 1120 HOH A O     1 
HETATM 8295 O  O     . HOH K 6 .   ? -10.226 9.176   69.770 1.00 27.66 ? 1121 HOH A O     1 
HETATM 8296 O  O     . HOH K 6 .   ? -5.762  18.077  61.555 1.00 22.70 ? 1122 HOH A O     1 
HETATM 8297 O  O     . HOH K 6 .   ? 15.732  -5.387  68.147 1.00 33.37 ? 1123 HOH A O     1 
HETATM 8298 O  O     . HOH K 6 .   ? -10.514 -12.414 57.624 1.00 29.66 ? 1124 HOH A O     1 
HETATM 8299 O  O     . HOH K 6 .   ? 4.420   14.614  65.889 1.00 34.44 ? 1125 HOH A O     1 
HETATM 8300 O  O     . HOH K 6 .   ? -14.732 -36.355 61.188 1.00 32.82 ? 1126 HOH A O     1 
HETATM 8301 O  O     . HOH K 6 .   ? 12.279  -26.372 34.483 1.00 32.20 ? 1127 HOH A O     1 
HETATM 8302 O  O     . HOH K 6 .   ? -11.901 -6.951  36.139 1.00 23.45 ? 1128 HOH A O     1 
HETATM 8303 O  O     . HOH K 6 .   ? -15.433 -24.045 28.206 1.00 30.10 ? 1129 HOH A O     1 
HETATM 8304 O  O     . HOH K 6 .   ? -2.425  -24.143 6.836  1.00 38.11 ? 1130 HOH A O     1 
HETATM 8305 O  O     . HOH K 6 .   ? -16.864 16.261  28.206 1.00 39.40 ? 1131 HOH A O     1 
HETATM 8306 O  O     . HOH K 6 .   ? -0.270  -22.358 6.021  1.00 30.87 ? 1132 HOH A O     1 
HETATM 8307 O  O     . HOH K 6 .   ? -40.750 -16.642 26.166 1.00 28.91 ? 1133 HOH A O     1 
HETATM 8308 O  O     . HOH K 6 .   ? -2.523  -30.439 56.393 1.00 27.61 ? 1134 HOH A O     1 
HETATM 8309 O  O     . HOH K 6 .   ? -5.683  -14.729 53.027 1.00 25.25 ? 1135 HOH A O     1 
HETATM 8310 O  O     . HOH K 6 .   ? -8.262  15.907  66.794 1.00 23.59 ? 1136 HOH A O     1 
HETATM 8311 O  O     . HOH K 6 .   ? -16.502 -8.367  22.170 1.00 27.52 ? 1137 HOH A O     1 
HETATM 8312 O  O     . HOH K 6 .   ? -5.408  -9.109  37.146 1.00 29.27 ? 1138 HOH A O     1 
HETATM 8313 O  O     . HOH K 6 .   ? 23.694  -16.098 26.036 1.00 27.77 ? 1139 HOH A O     1 
HETATM 8314 O  O     . HOH K 6 .   ? -4.278  -7.037  41.442 1.00 24.43 ? 1140 HOH A O     1 
HETATM 8315 O  O     . HOH K 6 .   ? -17.562 5.912   31.365 1.00 29.10 ? 1141 HOH A O     1 
HETATM 8316 O  O     . HOH K 6 .   ? 1.779   -13.561 73.386 1.00 28.78 ? 1142 HOH A O     1 
HETATM 8317 O  O     . HOH K 6 .   ? -10.406 2.546   17.118 1.00 32.89 ? 1143 HOH A O     1 
HETATM 8318 O  O     . HOH K 6 .   ? -13.374 -25.127 44.574 1.00 27.03 ? 1144 HOH A O     1 
HETATM 8319 O  O     . HOH K 6 .   ? 11.996  -26.211 9.417  1.00 39.67 ? 1145 HOH A O     1 
HETATM 8320 O  O     . HOH K 6 .   ? -1.426  -29.128 46.292 1.00 32.48 ? 1146 HOH A O     1 
HETATM 8321 O  O     . HOH K 6 .   ? 0.448   -11.342 42.674 1.00 35.89 ? 1147 HOH A O     1 
HETATM 8322 O  O     . HOH K 6 .   ? 1.114   13.327  64.078 1.00 34.44 ? 1148 HOH A O     1 
HETATM 8323 O  O     . HOH K 6 .   ? -2.054  13.549  38.895 1.00 28.65 ? 1149 HOH A O     1 
HETATM 8324 O  O     . HOH K 6 .   ? -15.474 10.708  62.827 1.00 29.72 ? 1150 HOH A O     1 
HETATM 8325 O  O     . HOH K 6 .   ? 18.723  -30.118 34.472 1.00 25.78 ? 1151 HOH A O     1 
HETATM 8326 O  O     . HOH K 6 .   ? -30.161 -20.329 25.068 1.00 23.89 ? 1152 HOH A O     1 
HETATM 8327 O  O     . HOH K 6 .   ? -18.800 -5.795  21.086 1.00 31.23 ? 1153 HOH A O     1 
HETATM 8328 O  O     . HOH K 6 .   ? -22.349 -13.231 39.504 1.00 22.39 ? 1154 HOH A O     1 
HETATM 8329 O  O     . HOH K 6 .   ? 19.806  -18.167 34.655 1.00 30.34 ? 1155 HOH A O     1 
HETATM 8330 O  O     . HOH K 6 .   ? -15.831 -34.918 54.599 1.00 28.94 ? 1156 HOH A O     1 
HETATM 8331 O  O     . HOH K 6 .   ? 21.609  -14.792 61.170 1.00 28.29 ? 1157 HOH A O     1 
HETATM 8332 O  O     . HOH K 6 .   ? -18.030 10.971  33.352 1.00 29.09 ? 1158 HOH A O     1 
HETATM 8333 O  O     . HOH K 6 .   ? -22.781 -4.596  44.873 1.00 40.11 ? 1159 HOH A O     1 
HETATM 8334 O  O     . HOH K 6 .   ? -34.518 16.005  40.028 1.00 25.95 ? 1160 HOH A O     1 
HETATM 8335 O  O     . HOH K 6 .   ? -23.238 3.095   25.982 1.00 34.32 ? 1161 HOH A O     1 
HETATM 8336 O  O     . HOH K 6 .   ? 30.006  -16.833 22.480 1.00 30.60 ? 1162 HOH A O     1 
HETATM 8337 O  O     . HOH K 6 .   ? -2.796  -48.169 54.802 1.00 38.24 ? 1163 HOH A O     1 
HETATM 8338 O  O     . HOH K 6 .   ? -18.423 -1.594  58.902 1.00 34.04 ? 1164 HOH A O     1 
HETATM 8339 O  O     . HOH K 6 .   ? 11.803  -30.290 46.229 1.00 43.11 ? 1165 HOH A O     1 
HETATM 8340 O  O     . HOH K 6 .   ? 4.626   9.807   57.667 1.00 26.41 ? 1166 HOH A O     1 
HETATM 8341 O  O     . HOH K 6 .   ? -34.964 -8.312  31.125 1.00 24.33 ? 1167 HOH A O     1 
HETATM 8342 O  O     . HOH K 6 .   ? 12.481  -26.396 37.543 1.00 27.09 ? 1168 HOH A O     1 
HETATM 8343 O  O     . HOH K 6 .   ? -8.783  -20.614 18.064 1.00 26.24 ? 1169 HOH A O     1 
HETATM 8344 O  O     . HOH K 6 .   ? -25.360 -7.045  6.954  1.00 29.90 ? 1170 HOH A O     1 
HETATM 8345 O  O     . HOH K 6 .   ? 4.664   -10.535 51.238 1.00 33.71 ? 1171 HOH A O     1 
HETATM 8346 O  O     . HOH K 6 .   ? -1.965  -21.455 40.039 1.00 31.34 ? 1172 HOH A O     1 
HETATM 8347 O  O     . HOH K 6 .   ? 6.167   -1.101  72.017 1.00 28.60 ? 1173 HOH A O     1 
HETATM 8348 O  O     . HOH K 6 .   ? -12.325 -2.701  65.811 1.00 30.95 ? 1174 HOH A O     1 
HETATM 8349 O  O     . HOH K 6 .   ? 13.696  -5.237  69.994 1.00 29.96 ? 1175 HOH A O     1 
HETATM 8350 O  O     . HOH K 6 .   ? 5.952   6.431   51.466 1.00 30.56 ? 1176 HOH A O     1 
HETATM 8351 O  O     . HOH K 6 .   ? -35.687 -3.227  28.299 1.00 29.12 ? 1177 HOH A O     1 
HETATM 8352 O  O     . HOH K 6 .   ? -31.363 17.953  25.553 1.00 38.78 ? 1178 HOH A O     1 
HETATM 8353 O  O     . HOH K 6 .   ? -13.306 -9.057  58.151 1.00 34.04 ? 1179 HOH A O     1 
HETATM 8354 O  O     . HOH K 6 .   ? -11.692 -8.086  24.520 1.00 40.92 ? 1180 HOH A O     1 
HETATM 8355 O  O     . HOH K 6 .   ? -24.695 11.765  49.395 1.00 29.48 ? 1181 HOH A O     1 
HETATM 8356 O  O     . HOH K 6 .   ? -29.258 -16.964 4.476  1.00 33.88 ? 1182 HOH A O     1 
HETATM 8357 O  O     . HOH K 6 .   ? -13.565 -27.924 55.507 1.00 25.69 ? 1183 HOH A O     1 
HETATM 8358 O  O     . HOH K 6 .   ? 10.032  -3.893  15.373 1.00 40.08 ? 1184 HOH A O     1 
HETATM 8359 O  O     . HOH K 6 .   ? 3.392   -14.797 75.810 1.00 39.29 ? 1185 HOH A O     1 
HETATM 8360 O  O     . HOH K 6 .   ? -38.449 5.032   25.504 1.00 37.95 ? 1186 HOH A O     1 
HETATM 8361 O  O     . HOH K 6 .   ? -2.257  6.491   35.472 1.00 28.62 ? 1187 HOH A O     1 
HETATM 8362 O  O     . HOH K 6 .   ? -0.366  12.586  71.047 1.00 33.34 ? 1188 HOH A O     1 
HETATM 8363 O  O     . HOH K 6 .   ? 24.978  -4.035  21.349 1.00 28.87 ? 1189 HOH A O     1 
HETATM 8364 O  O     . HOH K 6 .   ? 8.510   -21.501 44.901 1.00 30.34 ? 1190 HOH A O     1 
HETATM 8365 O  O     . HOH K 6 .   ? -21.352 6.682   50.399 1.00 27.22 ? 1191 HOH A O     1 
HETATM 8366 O  O     . HOH K 6 .   ? 11.443  -31.606 48.605 1.00 27.80 ? 1192 HOH A O     1 
HETATM 8367 O  O     . HOH K 6 .   ? -18.343 20.419  40.464 1.00 33.20 ? 1193 HOH A O     1 
HETATM 8368 O  O     . HOH K 6 .   ? -22.009 -0.365  22.264 1.00 27.42 ? 1194 HOH A O     1 
HETATM 8369 O  O     . HOH K 6 .   ? -2.200  18.348  62.624 1.00 26.72 ? 1195 HOH A O     1 
HETATM 8370 O  O     . HOH K 6 .   ? 10.529  -26.401 26.828 1.00 26.10 ? 1196 HOH A O     1 
HETATM 8371 O  O     . HOH K 6 .   ? -15.082 -34.065 52.146 1.00 26.79 ? 1197 HOH A O     1 
HETATM 8372 O  O     . HOH K 6 .   ? -15.903 -36.790 44.030 1.00 33.32 ? 1198 HOH A O     1 
HETATM 8373 O  O     . HOH K 6 .   ? -14.828 0.598   56.715 1.00 33.01 ? 1199 HOH A O     1 
HETATM 8374 O  O     . HOH K 6 .   ? 7.479   -20.980 38.199 1.00 46.83 ? 1200 HOH A O     1 
HETATM 8375 O  O     . HOH K 6 .   ? -14.703 -21.526 52.619 1.00 25.87 ? 1201 HOH A O     1 
HETATM 8376 O  O     . HOH K 6 .   ? 28.819  -34.109 26.572 1.00 34.28 ? 1202 HOH A O     1 
HETATM 8377 O  O     . HOH K 6 .   ? -3.430  16.799  50.244 1.00 42.29 ? 1203 HOH A O     1 
HETATM 8378 O  O     . HOH K 6 .   ? 18.400  -31.024 37.085 1.00 31.86 ? 1204 HOH A O     1 
HETATM 8379 O  O     . HOH K 6 .   ? 16.424  -7.559  10.479 1.00 37.48 ? 1205 HOH A O     1 
HETATM 8380 O  O     . HOH K 6 .   ? -2.573  2.482   44.977 1.00 32.48 ? 1206 HOH A O     1 
HETATM 8381 O  O     . HOH K 6 .   ? -21.624 -27.849 27.009 1.00 44.96 ? 1207 HOH A O     1 
HETATM 8382 O  O     . HOH K 6 .   ? -1.806  -30.730 48.426 1.00 26.96 ? 1208 HOH A O     1 
HETATM 8383 O  O     . HOH K 6 .   ? 3.744   -33.454 49.670 1.00 30.25 ? 1209 HOH A O     1 
HETATM 8384 O  O     . HOH K 6 .   ? -15.028 -20.391 -3.886 1.00 29.09 ? 1210 HOH A O     1 
HETATM 8385 O  O     . HOH K 6 .   ? 23.924  -14.789 62.806 1.00 47.43 ? 1211 HOH A O     1 
HETATM 8386 O  O     . HOH K 6 .   ? 21.575  -17.278 60.170 1.00 26.84 ? 1212 HOH A O     1 
HETATM 8387 O  O     . HOH K 6 .   ? -3.257  -11.153 73.871 1.00 49.18 ? 1213 HOH A O     1 
HETATM 8388 O  O     . HOH K 6 .   ? -14.679 -43.034 14.499 1.00 31.33 ? 1214 HOH A O     1 
HETATM 8389 O  O     . HOH K 6 .   ? 24.572  -13.437 46.127 1.00 37.21 ? 1215 HOH A O     1 
HETATM 8390 O  O     . HOH K 6 .   ? -22.843 -2.969  42.783 1.00 33.75 ? 1216 HOH A O     1 
HETATM 8391 O  O     . HOH K 6 .   ? -11.777 -29.759 36.896 1.00 40.82 ? 1217 HOH A O     1 
HETATM 8392 O  O     . HOH K 6 .   ? 8.520   -26.159 15.996 1.00 37.24 ? 1218 HOH A O     1 
HETATM 8393 O  O     . HOH K 6 .   ? 13.131  -12.300 39.998 1.00 28.09 ? 1219 HOH A O     1 
HETATM 8394 O  O     . HOH K 6 .   ? -21.637 22.125  39.381 1.00 25.93 ? 1220 HOH A O     1 
HETATM 8395 O  O     . HOH K 6 .   ? -23.388 -13.502 28.665 1.00 24.74 ? 1221 HOH A O     1 
HETATM 8396 O  O     . HOH K 6 .   ? 23.674  -11.257 60.592 1.00 40.52 ? 1222 HOH A O     1 
HETATM 8397 O  O     . HOH K 6 .   ? -12.271 -32.562 40.738 1.00 33.98 ? 1223 HOH A O     1 
HETATM 8398 O  O     . HOH K 6 .   ? 14.520  -6.746  62.384 1.00 21.46 ? 1224 HOH A O     1 
HETATM 8399 O  O     . HOH K 6 .   ? -10.222 -22.856 19.741 1.00 29.77 ? 1225 HOH A O     1 
HETATM 8400 O  O     . HOH K 6 .   ? -17.605 -4.263  0.565  1.00 33.56 ? 1226 HOH A O     1 
HETATM 8401 O  O     . HOH K 6 .   ? -3.907  -11.652 42.615 1.00 27.79 ? 1227 HOH A O     1 
HETATM 8402 O  O     . HOH K 6 .   ? 9.522   -25.394 22.825 1.00 27.65 ? 1228 HOH A O     1 
HETATM 8403 O  O     . HOH K 6 .   ? -2.596  -32.093 46.372 1.00 30.65 ? 1229 HOH A O     1 
HETATM 8404 O  O     . HOH K 6 .   ? -4.676  -20.339 17.225 1.00 37.14 ? 1230 HOH A O     1 
HETATM 8405 O  O     . HOH K 6 .   ? 23.483  -24.839 58.687 1.00 35.27 ? 1231 HOH A O     1 
HETATM 8406 O  O     . HOH K 6 .   ? -13.000 -23.619 -5.655 1.00 46.51 ? 1232 HOH A O     1 
HETATM 8407 O  O     . HOH K 6 .   ? -29.554 -19.293 9.279  1.00 38.21 ? 1233 HOH A O     1 
HETATM 8408 O  O     . HOH K 6 .   ? -2.489  -23.519 14.886 1.00 35.72 ? 1234 HOH A O     1 
HETATM 8409 O  O     . HOH K 6 .   ? -4.469  -1.166  72.358 1.00 47.14 ? 1235 HOH A O     1 
HETATM 8410 O  O     . HOH K 6 .   ? 31.298  -22.295 31.579 1.00 37.79 ? 1236 HOH A O     1 
HETATM 8411 O  O     . HOH K 6 .   ? 16.797  -15.444 33.673 1.00 28.74 ? 1237 HOH A O     1 
HETATM 8412 O  O     . HOH K 6 .   ? -21.229 2.710   52.153 1.00 37.88 ? 1238 HOH A O     1 
HETATM 8413 O  O     . HOH K 6 .   ? -12.763 -5.503  27.159 1.00 34.15 ? 1239 HOH A O     1 
HETATM 8414 O  O     . HOH K 6 .   ? 11.070  8.166   58.110 1.00 33.46 ? 1240 HOH A O     1 
HETATM 8415 O  O     . HOH K 6 .   ? -3.840  -24.477 42.226 1.00 27.83 ? 1241 HOH A O     1 
HETATM 8416 O  O     . HOH K 6 .   ? 19.262  -23.996 75.579 1.00 36.17 ? 1242 HOH A O     1 
HETATM 8417 O  O     . HOH K 6 .   ? -1.624  -12.888 43.160 1.00 32.95 ? 1243 HOH A O     1 
HETATM 8418 O  O     . HOH K 6 .   ? 32.256  -19.911 9.941  1.00 45.15 ? 1244 HOH A O     1 
HETATM 8419 O  O     . HOH K 6 .   ? -6.078  -32.494 56.782 1.00 24.23 ? 1245 HOH A O     1 
HETATM 8420 O  O     . HOH K 6 .   ? 9.091   -23.974 36.975 1.00 53.76 ? 1246 HOH A O     1 
HETATM 8421 O  O     . HOH K 6 .   ? -4.134  -50.011 41.895 1.00 36.05 ? 1247 HOH A O     1 
HETATM 8422 O  O     . HOH K 6 .   ? 11.894  -24.149 38.786 1.00 31.28 ? 1248 HOH A O     1 
HETATM 8423 O  O     . HOH K 6 .   ? -0.004  -51.107 44.488 1.00 39.88 ? 1249 HOH A O     1 
HETATM 8424 O  O     . HOH K 6 .   ? 27.454  -14.524 40.722 1.00 35.79 ? 1250 HOH A O     1 
HETATM 8425 O  O     . HOH K 6 .   ? 16.730  -13.750 28.504 1.00 25.23 ? 1251 HOH A O     1 
HETATM 8426 O  O     . HOH K 6 .   ? -19.468 -37.978 15.026 1.00 29.07 ? 1252 HOH A O     1 
HETATM 8427 O  O     . HOH K 6 .   ? -17.663 -39.950 21.729 1.00 34.03 ? 1253 HOH A O     1 
HETATM 8428 O  O     . HOH K 6 .   ? -37.327 -4.886  19.736 1.00 33.28 ? 1254 HOH A O     1 
HETATM 8429 O  O     . HOH K 6 .   ? 30.857  -15.286 18.777 1.00 28.99 ? 1255 HOH A O     1 
HETATM 8430 O  O     . HOH K 6 .   ? -39.035 -6.186  25.848 1.00 36.54 ? 1256 HOH A O     1 
HETATM 8431 O  O     . HOH K 6 .   ? -2.150  -26.561 42.244 1.00 40.56 ? 1257 HOH A O     1 
HETATM 8432 O  O     . HOH K 6 .   ? 13.629  -29.495 24.865 1.00 34.05 ? 1258 HOH A O     1 
HETATM 8433 O  O     . HOH K 6 .   ? -4.890  -8.782  23.635 1.00 33.27 ? 1259 HOH A O     1 
HETATM 8434 O  O     . HOH K 6 .   ? 27.285  -31.457 22.704 1.00 39.31 ? 1260 HOH A O     1 
HETATM 8435 O  O     . HOH K 6 .   ? 32.577  -31.524 36.591 1.00 35.69 ? 1261 HOH A O     1 
HETATM 8436 O  O     . HOH K 6 .   ? -4.031  -23.042 39.757 1.00 19.99 ? 1262 HOH A O     1 
HETATM 8437 O  O     . HOH K 6 .   ? -6.288  -36.119 0.516  1.00 24.71 ? 1263 HOH A O     1 
HETATM 8438 O  O     . HOH K 6 .   ? -2.772  -24.683 37.757 1.00 31.21 ? 1264 HOH A O     1 
HETATM 8439 O  O     . HOH K 6 .   ? -14.630 -26.825 42.802 1.00 24.73 ? 1265 HOH A O     1 
HETATM 8440 O  O     . HOH K 6 .   ? 12.937  -27.831 26.982 1.00 28.47 ? 1266 HOH A O     1 
HETATM 8441 O  O     . HOH K 6 .   ? -23.611 -15.666 40.355 1.00 39.02 ? 1267 HOH A O     1 
HETATM 8442 O  O     . HOH K 6 .   ? 18.448  -13.077 26.218 1.00 32.35 ? 1268 HOH A O     1 
HETATM 8443 O  O     . HOH K 6 .   ? -13.348 -30.202 39.886 1.00 51.31 ? 1269 HOH A O     1 
HETATM 8444 O  O     . HOH K 6 .   ? -2.655  -2.531  43.589 1.00 35.68 ? 1270 HOH A O     1 
HETATM 8445 O  O     . HOH K 6 .   ? -1.686  -0.290  44.742 1.00 35.05 ? 1271 HOH A O     1 
HETATM 8446 O  O     . HOH K 6 .   ? 2.287   -0.884  46.611 1.00 20.58 ? 1272 HOH A O     1 
HETATM 8447 O  O     A HOH K 6 .   ? -3.364  -5.555  12.216 0.50 14.39 ? 1273 HOH A O     1 
HETATM 8448 O  O     B HOH K 6 .   ? -3.836  -7.433  11.791 0.50 24.51 ? 1273 HOH A O     1 
HETATM 8449 O  O     A HOH K 6 .   ? 23.236  -25.951 7.365  0.50 21.37 ? 1274 HOH A O     1 
HETATM 8450 O  O     B HOH K 6 .   ? 23.088  -24.342 6.339  0.50 38.16 ? 1274 HOH A O     1 
HETATM 8451 O  O     . HOH K 6 .   ? -18.861 -5.330  45.729 1.00 20.08 ? 1275 HOH A O     1 
HETATM 8452 O  O     . HOH K 6 .   ? -38.211 1.463   23.048 1.00 31.44 ? 1276 HOH A O     1 
HETATM 8453 O  O     . HOH K 6 .   ? 6.160   -36.078 65.502 1.00 41.43 ? 1277 HOH A O     1 
HETATM 8454 O  O     . HOH K 6 .   ? 12.559  -35.381 57.995 1.00 31.34 ? 1278 HOH A O     1 
HETATM 8455 O  O     . HOH K 6 .   ? 23.389  -9.429  14.562 1.00 35.19 ? 1279 HOH A O     1 
HETATM 8456 O  O     . HOH K 6 .   ? 0.050   -14.191 50.858 1.00 33.92 ? 1280 HOH A O     1 
HETATM 8457 O  O     . HOH K 6 .   ? 10.621  -21.282 14.384 1.00 33.91 ? 1281 HOH A O     1 
HETATM 8458 O  O     . HOH K 6 .   ? -2.894  -12.298 13.518 1.00 39.44 ? 1282 HOH A O     1 
HETATM 8459 O  O     . HOH K 6 .   ? -14.331 18.526  60.254 1.00 37.43 ? 1283 HOH A O     1 
HETATM 8460 O  O     . HOH K 6 .   ? 13.396  -2.617  58.786 1.00 35.29 ? 1284 HOH A O     1 
HETATM 8461 O  O     . HOH K 6 .   ? -31.278 -12.835 37.032 1.00 35.95 ? 1285 HOH A O     1 
HETATM 8462 O  O     . HOH K 6 .   ? 12.176  -12.551 11.510 1.00 29.32 ? 1286 HOH A O     1 
HETATM 8463 O  O     . HOH K 6 .   ? 4.996   -19.324 77.276 1.00 49.62 ? 1287 HOH A O     1 
HETATM 8464 O  O     . HOH K 6 .   ? 31.447  -29.687 42.841 1.00 28.86 ? 1288 HOH A O     1 
HETATM 8465 O  O     . HOH K 6 .   ? 32.842  -22.950 45.224 1.00 39.77 ? 1289 HOH A O     1 
HETATM 8466 O  O     . HOH K 6 .   ? 30.567  -19.485 46.095 1.00 34.88 ? 1290 HOH A O     1 
HETATM 8467 O  O     . HOH K 6 .   ? -25.400 -25.361 27.692 1.00 32.15 ? 1291 HOH A O     1 
HETATM 8468 O  O     . HOH K 6 .   ? -4.832  -7.791  16.220 1.00 29.24 ? 1292 HOH A O     1 
HETATM 8469 O  O     . HOH K 6 .   ? 0.437   -16.073 31.428 1.00 27.72 ? 1293 HOH A O     1 
HETATM 8470 O  O     . HOH K 6 .   ? -1.668  -22.088 48.104 1.00 30.39 ? 1294 HOH A O     1 
HETATM 8471 O  O     . HOH K 6 .   ? -11.521 -32.688 -3.651 1.00 32.47 ? 1295 HOH A O     1 
HETATM 8472 O  O     . HOH K 6 .   ? -2.502  -11.929 23.593 1.00 29.64 ? 1296 HOH A O     1 
HETATM 8473 O  O     . HOH K 6 .   ? 20.770  -9.163  65.884 1.00 43.62 ? 1297 HOH A O     1 
HETATM 8474 O  O     . HOH K 6 .   ? 2.630   -13.062 33.632 1.00 53.66 ? 1298 HOH A O     1 
HETATM 8475 O  O     . HOH K 6 .   ? -2.135  -13.444 16.460 1.00 44.36 ? 1299 HOH A O     1 
HETATM 8476 O  O     . HOH K 6 .   ? -7.819  -36.471 3.350  1.00 35.33 ? 1300 HOH A O     1 
HETATM 8477 O  O     . HOH K 6 .   ? 21.324  -28.752 59.481 1.00 35.58 ? 1301 HOH A O     1 
HETATM 8478 O  O     . HOH K 6 .   ? -19.511 -0.710  28.766 1.00 29.76 ? 1302 HOH A O     1 
HETATM 8479 O  O     . HOH K 6 .   ? -6.919  11.326  32.292 1.00 44.47 ? 1303 HOH A O     1 
HETATM 8480 O  O     . HOH K 6 .   ? 28.379  -10.884 25.021 1.00 36.98 ? 1304 HOH A O     1 
HETATM 8481 O  O     . HOH K 6 .   ? -5.557  -43.770 38.659 1.00 38.57 ? 1305 HOH A O     1 
HETATM 8482 O  O     . HOH K 6 .   ? -1.966  -17.891 57.272 1.00 40.10 ? 1306 HOH A O     1 
HETATM 8483 O  O     . HOH K 6 .   ? -32.895 4.733   17.862 1.00 34.87 ? 1307 HOH A O     1 
HETATM 8484 O  O     . HOH K 6 .   ? -2.763  -54.812 50.407 1.00 38.19 ? 1308 HOH A O     1 
HETATM 8485 O  O     . HOH K 6 .   ? -25.996 0.279   47.970 1.00 32.83 ? 1309 HOH A O     1 
HETATM 8486 O  O     . HOH K 6 .   ? -23.273 20.804  37.657 1.00 27.28 ? 1310 HOH A O     1 
HETATM 8487 O  O     . HOH K 6 .   ? -24.409 -2.491  50.890 1.00 39.39 ? 1311 HOH A O     1 
HETATM 8488 O  O     . HOH K 6 .   ? -2.695  19.491  57.623 1.00 32.51 ? 1312 HOH A O     1 
HETATM 8489 O  O     . HOH K 6 .   ? -2.098  -27.900 20.555 1.00 38.77 ? 1313 HOH A O     1 
HETATM 8490 O  O     . HOH K 6 .   ? -10.400 -24.114 54.536 1.00 32.28 ? 1314 HOH A O     1 
HETATM 8491 O  O     . HOH K 6 .   ? -1.473  -20.286 59.679 1.00 39.29 ? 1315 HOH A O     1 
HETATM 8492 O  O     . HOH K 6 .   ? -7.848  -23.620 19.372 1.00 31.72 ? 1316 HOH A O     1 
HETATM 8493 O  O     A HOH K 6 .   ? -12.140 -5.508  1.055  0.50 25.69 ? 1317 HOH A O     1 
HETATM 8494 O  O     B HOH K 6 .   ? -10.300 -5.900  1.872  0.50 16.14 ? 1317 HOH A O     1 
HETATM 8495 O  O     . HOH K 6 .   ? -3.823  -40.556 54.779 1.00 33.66 ? 1318 HOH A O     1 
HETATM 8496 O  O     . HOH K 6 .   ? -0.917  -12.331 3.881  1.00 31.39 ? 1319 HOH A O     1 
HETATM 8497 O  O     . HOH K 6 .   ? -15.775 -3.993  56.822 1.00 38.53 ? 1320 HOH A O     1 
HETATM 8498 O  O     . HOH K 6 .   ? 15.070  -11.934 6.848  1.00 37.41 ? 1321 HOH A O     1 
HETATM 8499 O  O     . HOH K 6 .   ? 18.941  -8.609  10.226 1.00 31.10 ? 1322 HOH A O     1 
HETATM 8500 O  O     . HOH K 6 .   ? -1.360  -20.225 62.829 1.00 38.31 ? 1323 HOH A O     1 
HETATM 8501 O  O     . HOH K 6 .   ? -8.094  19.268  58.142 1.00 37.98 ? 1324 HOH A O     1 
HETATM 8502 O  O     . HOH K 6 .   ? -3.694  -12.524 20.802 1.00 35.06 ? 1325 HOH A O     1 
HETATM 8503 O  O     . HOH K 6 .   ? 3.290   -28.511 34.010 1.00 42.48 ? 1326 HOH A O     1 
HETATM 8504 O  O     . HOH K 6 .   ? 6.101   -10.806 25.219 1.00 31.25 ? 1327 HOH A O     1 
HETATM 8505 O  O     . HOH K 6 .   ? -11.431 11.290  37.518 1.00 29.41 ? 1328 HOH A O     1 
HETATM 8506 O  O     . HOH K 6 .   ? -16.500 -15.385 53.499 1.00 33.46 ? 1329 HOH A O     1 
HETATM 8507 O  O     . HOH K 6 .   ? -10.037 -42.104 19.922 1.00 32.94 ? 1330 HOH A O     1 
HETATM 8508 O  O     A HOH K 6 .   ? 5.233   -38.060 54.742 0.50 22.18 ? 1331 HOH A O     1 
HETATM 8509 O  O     B HOH K 6 .   ? 4.199   -37.542 56.694 0.50 24.77 ? 1331 HOH A O     1 
HETATM 8510 O  O     . HOH K 6 .   ? -12.057 -44.322 6.335  1.00 39.10 ? 1332 HOH A O     1 
HETATM 8511 O  O     . HOH K 6 .   ? 13.653  -33.364 32.628 1.00 47.79 ? 1333 HOH A O     1 
HETATM 8512 O  O     . HOH K 6 .   ? 6.001   -15.773 10.310 1.00 41.74 ? 1334 HOH A O     1 
HETATM 8513 O  O     . HOH K 6 .   ? 22.262  -8.398  48.559 1.00 27.11 ? 1335 HOH A O     1 
HETATM 8514 O  O     . HOH K 6 .   ? -2.900  -3.710  72.371 1.00 29.62 ? 1336 HOH A O     1 
HETATM 8515 O  O     . HOH K 6 .   ? 20.284  -26.170 72.106 1.00 40.73 ? 1337 HOH A O     1 
HETATM 8516 O  O     . HOH K 6 .   ? -3.577  -10.273 35.639 1.00 32.01 ? 1338 HOH A O     1 
HETATM 8517 O  O     . HOH K 6 .   ? 6.550   -15.663 18.487 1.00 39.92 ? 1339 HOH A O     1 
HETATM 8518 O  O     . HOH K 6 .   ? -3.368  -39.839 10.324 1.00 30.33 ? 1340 HOH A O     1 
HETATM 8519 O  O     . HOH K 6 .   ? -27.517 -28.197 26.359 1.00 52.39 ? 1341 HOH A O     1 
HETATM 8520 O  O     . HOH K 6 .   ? -28.426 0.185   41.381 1.00 32.36 ? 1342 HOH A O     1 
HETATM 8521 O  O     . HOH K 6 .   ? 8.168   -35.606 54.945 1.00 47.36 ? 1343 HOH A O     1 
HETATM 8522 O  O     . HOH K 6 .   ? 21.534  -18.186 68.419 1.00 36.65 ? 1344 HOH A O     1 
HETATM 8523 O  O     . HOH K 6 .   ? -20.068 -20.010 39.262 1.00 40.25 ? 1345 HOH A O     1 
HETATM 8524 O  O     . HOH K 6 .   ? -30.251 -12.907 20.730 1.00 39.47 ? 1346 HOH A O     1 
HETATM 8525 O  O     . HOH K 6 .   ? -11.363 -35.545 59.873 1.00 37.53 ? 1347 HOH A O     1 
HETATM 8526 O  O     . HOH K 6 .   ? 1.429   -14.070 22.894 1.00 35.68 ? 1348 HOH A O     1 
HETATM 8527 O  O     . HOH K 6 .   ? -22.237 -35.559 16.475 1.00 38.54 ? 1349 HOH A O     1 
HETATM 8528 O  O     . HOH K 6 .   ? -14.365 -2.536  28.981 1.00 36.82 ? 1350 HOH A O     1 
HETATM 8529 O  O     . HOH K 6 .   ? 3.825   -33.475 46.349 1.00 44.14 ? 1351 HOH A O     1 
HETATM 8530 O  O     . HOH K 6 .   ? -5.677  -41.031 37.691 1.00 44.22 ? 1352 HOH A O     1 
HETATM 8531 O  O     . HOH K 6 .   ? -2.752  -13.909 56.754 1.00 40.18 ? 1353 HOH A O     1 
HETATM 8532 O  O     . HOH K 6 .   ? 3.316   -2.781  18.563 1.00 38.67 ? 1354 HOH A O     1 
HETATM 8533 O  O     . HOH K 6 .   ? -12.591 -40.208 27.950 1.00 45.55 ? 1355 HOH A O     1 
HETATM 8534 O  O     . HOH K 6 .   ? 5.953   -32.068 72.571 1.00 51.75 ? 1356 HOH A O     1 
HETATM 8535 O  O     . HOH K 6 .   ? -0.146  -27.286 35.130 1.00 32.70 ? 1357 HOH A O     1 
HETATM 8536 O  O     . HOH K 6 .   ? -17.691 14.800  52.377 1.00 44.50 ? 1358 HOH A O     1 
HETATM 8537 O  O     . HOH K 6 .   ? 2.728   -6.653  70.939 1.00 32.02 ? 1359 HOH A O     1 
HETATM 8538 O  O     . HOH K 6 .   ? -3.414  -23.096 9.097  1.00 39.31 ? 1360 HOH A O     1 
HETATM 8539 O  O     . HOH K 6 .   ? -20.341 14.066  55.944 1.00 46.59 ? 1361 HOH A O     1 
HETATM 8540 O  O     . HOH K 6 .   ? 18.520  -2.595  47.810 1.00 28.23 ? 1362 HOH A O     1 
HETATM 8541 O  O     . HOH K 6 .   ? -19.107 -26.970 27.034 1.00 38.85 ? 1363 HOH A O     1 
HETATM 8542 O  O     . HOH K 6 .   ? -11.623 0.497   30.848 1.00 34.05 ? 1364 HOH A O     1 
HETATM 8543 O  O     . HOH K 6 .   ? -31.544 -9.201  44.489 1.00 36.54 ? 1365 HOH A O     1 
HETATM 8544 O  O     . HOH K 6 .   ? 6.391   -4.376  21.108 1.00 37.67 ? 1366 HOH A O     1 
HETATM 8545 O  O     . HOH K 6 .   ? -3.437  -10.187 26.967 1.00 35.02 ? 1367 HOH A O     1 
HETATM 8546 O  O     . HOH K 6 .   ? 0.812   -14.327 3.201  1.00 41.16 ? 1368 HOH A O     1 
HETATM 8547 O  O     . HOH K 6 .   ? -2.200  3.498   70.854 1.00 32.51 ? 1369 HOH A O     1 
HETATM 8548 O  O     . HOH K 6 .   ? -25.190 -29.463 26.789 1.00 52.45 ? 1370 HOH A O     1 
HETATM 8549 O  O     . HOH K 6 .   ? -1.709  14.437  53.265 1.00 35.39 ? 1371 HOH A O     1 
HETATM 8550 O  O     . HOH K 6 .   ? 14.311  -3.963  23.021 1.00 33.07 ? 1372 HOH A O     1 
HETATM 8551 O  O     . HOH K 6 .   ? -28.961 -28.349 15.503 1.00 41.20 ? 1373 HOH A O     1 
HETATM 8552 O  O     . HOH K 6 .   ? -30.155 5.780   16.228 1.00 40.03 ? 1374 HOH A O     1 
HETATM 8553 O  O     . HOH K 6 .   ? 11.245  -0.358  16.717 1.00 47.03 ? 1375 HOH A O     1 
HETATM 8554 O  O     . HOH K 6 .   ? -36.435 -11.977 20.159 1.00 32.33 ? 1376 HOH A O     1 
HETATM 8555 O  O     . HOH K 6 .   ? -28.461 17.929  24.334 1.00 31.22 ? 1377 HOH A O     1 
HETATM 8556 O  O     . HOH K 6 .   ? 27.723  -26.436 7.880  1.00 46.28 ? 1378 HOH A O     1 
HETATM 8557 O  O     . HOH K 6 .   ? -34.513 -4.012  15.871 1.00 41.07 ? 1379 HOH A O     1 
HETATM 8558 O  O     . HOH K 6 .   ? 30.749  -13.545 16.632 1.00 42.16 ? 1380 HOH A O     1 
HETATM 8559 O  O     . HOH K 6 .   ? 19.639  -27.388 69.739 1.00 40.67 ? 1381 HOH A O     1 
HETATM 8560 O  O     . HOH K 6 .   ? 3.364   21.401  65.762 1.00 49.97 ? 1382 HOH A O     1 
HETATM 8561 O  O     . HOH K 6 .   ? -25.833 -16.999 39.305 1.00 32.64 ? 1383 HOH A O     1 
HETATM 8562 O  O     . HOH K 6 .   ? -4.872  -30.820 -6.288 1.00 37.55 ? 1384 HOH A O     1 
HETATM 8563 O  O     . HOH K 6 .   ? 13.799  -27.796 12.735 1.00 33.57 ? 1385 HOH A O     1 
HETATM 8564 O  O     . HOH K 6 .   ? -12.309 9.271   34.136 1.00 38.75 ? 1386 HOH A O     1 
HETATM 8565 O  O     . HOH K 6 .   ? -0.076  -31.399 44.747 1.00 40.98 ? 1387 HOH A O     1 
HETATM 8566 O  O     . HOH K 6 .   ? -10.067 -47.173 40.385 1.00 33.85 ? 1388 HOH A O     1 
HETATM 8567 O  O     . HOH K 6 .   ? -7.481  -13.325 58.558 1.00 33.84 ? 1389 HOH A O     1 
HETATM 8568 O  O     . HOH K 6 .   ? -28.773 -18.125 17.739 1.00 35.24 ? 1390 HOH A O     1 
HETATM 8569 O  O     . HOH K 6 .   ? 18.841  -30.737 62.343 1.00 44.42 ? 1391 HOH A O     1 
HETATM 8570 O  O     . HOH K 6 .   ? -37.717 -9.214  22.716 1.00 35.51 ? 1392 HOH A O     1 
HETATM 8571 O  O     . HOH K 6 .   ? -30.162 11.876  17.592 1.00 35.68 ? 1393 HOH A O     1 
HETATM 8572 O  O     . HOH K 6 .   ? -35.219 6.494   42.821 1.00 39.48 ? 1394 HOH A O     1 
HETATM 8573 O  O     . HOH K 6 .   ? -20.617 12.000  34.070 1.00 32.19 ? 1395 HOH A O     1 
HETATM 8574 O  O     . HOH K 6 .   ? 4.631   -35.471 48.024 1.00 36.59 ? 1396 HOH A O     1 
HETATM 8575 O  O     . HOH K 6 .   ? 33.862  -30.406 43.917 1.00 36.36 ? 1397 HOH A O     1 
HETATM 8576 O  O     . HOH K 6 .   ? -4.844  -15.005 55.520 1.00 53.42 ? 1398 HOH A O     1 
HETATM 8577 O  O     . HOH K 6 .   ? -15.394 -6.925  -1.439 1.00 45.68 ? 1399 HOH A O     1 
HETATM 8578 O  O     . HOH K 6 .   ? 4.492   -12.860 25.515 1.00 38.48 ? 1400 HOH A O     1 
HETATM 8579 O  O     . HOH K 6 .   ? -23.945 -34.251 24.295 1.00 32.35 ? 1401 HOH A O     1 
HETATM 8580 O  O     . HOH K 6 .   ? -16.473 26.946  35.646 1.00 42.32 ? 1402 HOH A O     1 
HETATM 8581 O  O     . HOH K 6 .   ? -3.028  5.968   70.881 1.00 31.00 ? 1403 HOH A O     1 
HETATM 8582 O  O     . HOH K 6 .   ? -11.092 11.541  40.667 1.00 33.59 ? 1404 HOH A O     1 
HETATM 8583 O  O     . HOH K 6 .   ? -9.270  -41.370 23.557 1.00 33.55 ? 1405 HOH A O     1 
HETATM 8584 O  O     . HOH K 6 .   ? 18.118  -34.701 54.039 1.00 38.22 ? 1406 HOH A O     1 
HETATM 8585 O  O     . HOH K 6 .   ? -29.359 22.803  38.438 1.00 44.41 ? 1407 HOH A O     1 
HETATM 8586 O  O     . HOH K 6 .   ? -13.024 -7.896  -3.000 1.00 44.74 ? 1408 HOH A O     1 
HETATM 8587 O  O     . HOH K 6 .   ? -18.598 -12.965 41.707 1.00 31.34 ? 1409 HOH A O     1 
HETATM 8588 O  O     . HOH K 6 .   ? -21.842 -23.622 29.725 1.00 38.82 ? 1410 HOH A O     1 
HETATM 8589 O  O     . HOH K 6 .   ? -9.983  -44.609 39.058 1.00 39.67 ? 1411 HOH A O     1 
HETATM 8590 O  O     . HOH K 6 .   ? 18.388  -13.582 35.118 1.00 38.62 ? 1412 HOH A O     1 
HETATM 8591 O  O     . HOH K 6 .   ? -4.929  0.836   11.750 1.00 45.42 ? 1413 HOH A O     1 
HETATM 8592 O  O     . HOH K 6 .   ? 6.006   -22.150 0.310  1.00 41.80 ? 1414 HOH A O     1 
HETATM 8593 O  O     . HOH K 6 .   ? -6.056  -34.373 58.792 1.00 34.48 ? 1415 HOH A O     1 
HETATM 8594 O  O     . HOH K 6 .   ? 15.782  -32.706 39.247 1.00 37.96 ? 1416 HOH A O     1 
HETATM 8595 O  O     . HOH K 6 .   ? 0.053   -17.536 20.586 1.00 35.09 ? 1417 HOH A O     1 
HETATM 8596 O  O     . HOH K 6 .   ? 23.452  -14.463 10.248 1.00 31.80 ? 1418 HOH A O     1 
HETATM 8597 O  O     . HOH K 6 .   ? -8.037  -40.104 5.223  1.00 31.64 ? 1419 HOH A O     1 
HETATM 8598 O  O     . HOH K 6 .   ? 7.717   -19.904 32.748 1.00 39.02 ? 1420 HOH A O     1 
HETATM 8599 O  O     . HOH K 6 .   ? -17.628 4.391   64.067 1.00 33.21 ? 1421 HOH A O     1 
HETATM 8600 O  O     . HOH K 6 .   ? 26.311  -11.897 9.290  1.00 42.57 ? 1422 HOH A O     1 
HETATM 8601 O  O     . HOH K 6 .   ? -37.786 -8.073  30.055 1.00 41.82 ? 1423 HOH A O     1 
HETATM 8602 O  O     . HOH K 6 .   ? -8.352  -4.792  5.925  1.00 35.67 ? 1424 HOH A O     1 
HETATM 8603 O  O     . HOH K 6 .   ? -19.743 -15.372 42.510 1.00 42.95 ? 1425 HOH A O     1 
HETATM 8604 O  O     . HOH K 6 .   ? -36.409 6.751   45.571 1.00 43.29 ? 1426 HOH A O     1 
HETATM 8605 O  O     . HOH K 6 .   ? -9.212  4.956   68.561 1.00 37.10 ? 1427 HOH A O     1 
HETATM 8606 O  O     . HOH K 6 .   ? -8.770  -37.001 26.379 1.00 37.19 ? 1428 HOH A O     1 
HETATM 8607 O  O     . HOH K 6 .   ? -11.657 -4.577  7.426  1.00 39.50 ? 1429 HOH A O     1 
HETATM 8608 O  O     . HOH K 6 .   ? -12.284 -48.008 51.286 1.00 35.48 ? 1430 HOH A O     1 
HETATM 8609 O  O     . HOH K 6 .   ? -4.290  -28.235 11.488 1.00 33.65 ? 1431 HOH A O     1 
HETATM 8610 O  O     . HOH K 6 .   ? 6.701   -16.327 21.120 1.00 35.42 ? 1432 HOH A O     1 
HETATM 8611 O  O     . HOH K 6 .   ? 23.979  -11.836 48.116 1.00 32.34 ? 1433 HOH A O     1 
HETATM 8612 O  O     . HOH K 6 .   ? 3.305   -9.366  19.394 1.00 45.09 ? 1434 HOH A O     1 
HETATM 8613 O  O     . HOH K 6 .   ? -6.539  -7.406  11.794 1.00 42.58 ? 1435 HOH A O     1 
HETATM 8614 O  O     . HOH K 6 .   ? -13.394 -18.022 -2.620 1.00 34.88 ? 1436 HOH A O     1 
HETATM 8615 O  O     . HOH K 6 .   ? -30.352 -15.830 6.437  1.00 36.03 ? 1437 HOH A O     1 
HETATM 8616 O  O     . HOH K 6 .   ? 12.819  0.007   58.761 1.00 44.17 ? 1438 HOH A O     1 
HETATM 8617 O  O     . HOH K 6 .   ? 12.667  -36.714 61.030 1.00 39.03 ? 1439 HOH A O     1 
HETATM 8618 O  O     . HOH K 6 .   ? 29.452  -33.945 54.394 1.00 46.41 ? 1440 HOH A O     1 
HETATM 8619 O  O     . HOH K 6 .   ? 13.108  -29.888 14.351 1.00 48.28 ? 1441 HOH A O     1 
HETATM 8620 O  O     . HOH K 6 .   ? 19.777  1.786   16.405 1.00 43.87 ? 1442 HOH A O     1 
HETATM 8621 O  O     . HOH K 6 .   ? 5.993   -23.233 47.662 1.00 43.04 ? 1443 HOH A O     1 
HETATM 8622 O  O     . HOH K 6 .   ? 29.832  -37.247 29.345 1.00 46.34 ? 1444 HOH A O     1 
HETATM 8623 O  O     . HOH K 6 .   ? 11.906  0.907   61.160 1.00 33.11 ? 1445 HOH A O     1 
HETATM 8624 O  O     . HOH K 6 .   ? -6.916  -35.377 -3.915 1.00 52.79 ? 1446 HOH A O     1 
HETATM 8625 O  O     . HOH K 6 .   ? -41.110 4.950   19.201 1.00 52.77 ? 1447 HOH A O     1 
HETATM 8626 O  O     . HOH K 6 .   ? -11.453 -46.107 14.378 1.00 38.69 ? 1448 HOH A O     1 
HETATM 8627 O  O     . HOH K 6 .   ? -1.014  -9.439  25.845 1.00 48.68 ? 1449 HOH A O     1 
HETATM 8628 O  O     . HOH K 6 .   ? -22.260 4.229   49.995 1.00 35.48 ? 1450 HOH A O     1 
HETATM 8629 O  O     . HOH K 6 .   ? 12.212  -6.375  74.346 1.00 32.56 ? 1451 HOH A O     1 
HETATM 8630 O  O     . HOH K 6 .   ? 0.276   -13.252 31.981 1.00 34.47 ? 1452 HOH A O     1 
HETATM 8631 O  O     . HOH K 6 .   ? -39.232 -10.303 27.818 1.00 37.37 ? 1453 HOH A O     1 
HETATM 8632 O  O     . HOH K 6 .   ? 6.438   -22.703 31.974 1.00 40.79 ? 1454 HOH A O     1 
HETATM 8633 O  O     . HOH K 6 .   ? -24.968 -35.395 16.480 1.00 42.17 ? 1455 HOH A O     1 
HETATM 8634 O  O     . HOH K 6 .   ? -22.479 5.927   26.200 1.00 34.87 ? 1456 HOH A O     1 
HETATM 8635 O  O     . HOH K 6 .   ? -8.799  -52.802 50.651 1.00 35.19 ? 1457 HOH A O     1 
HETATM 8636 O  O     . HOH K 6 .   ? -14.100 -8.431  23.360 1.00 43.17 ? 1458 HOH A O     1 
HETATM 8637 O  O     . HOH K 6 .   ? 26.460  -11.820 55.505 1.00 46.20 ? 1459 HOH A O     1 
HETATM 8638 O  O     . HOH K 6 .   ? -14.860 -45.534 57.177 1.00 43.80 ? 1460 HOH A O     1 
HETATM 8639 O  O     . HOH K 6 .   ? 3.044   -9.266  23.261 1.00 47.79 ? 1461 HOH A O     1 
HETATM 8640 O  O     . HOH K 6 .   ? 2.366   -12.805 48.687 1.00 36.57 ? 1462 HOH A O     1 
HETATM 8641 O  O     . HOH K 6 .   ? -1.879  -27.205 37.616 1.00 37.92 ? 1463 HOH A O     1 
HETATM 8642 O  O     . HOH K 6 .   ? -1.893  -8.396  15.674 1.00 41.70 ? 1464 HOH A O     1 
HETATM 8643 O  O     . HOH K 6 .   ? -5.424  14.465  45.015 1.00 39.45 ? 1465 HOH A O     1 
HETATM 8644 O  O     . HOH K 6 .   ? 30.586  -33.050 57.518 1.00 54.18 ? 1466 HOH A O     1 
HETATM 8645 O  O     . HOH K 6 .   ? -21.786 9.625   27.084 1.00 40.32 ? 1467 HOH A O     1 
HETATM 8646 O  O     . HOH K 6 .   ? -14.826 8.074   34.437 1.00 35.11 ? 1468 HOH A O     1 
HETATM 8647 O  O     . HOH K 6 .   ? -23.453 -22.707 1.186  1.00 39.47 ? 1469 HOH A O     1 
HETATM 8648 O  O     . HOH K 6 .   ? -1.658  -2.234  11.966 1.00 44.96 ? 1470 HOH A O     1 
HETATM 8649 O  O     . HOH K 6 .   ? -7.840  15.937  52.876 1.00 37.02 ? 1471 HOH A O     1 
HETATM 8650 O  O     . HOH K 6 .   ? -5.190  -32.504 38.744 1.00 44.36 ? 1472 HOH A O     1 
HETATM 8651 O  O     . HOH K 6 .   ? 7.687   -17.492 38.927 1.00 35.75 ? 1473 HOH A O     1 
HETATM 8652 O  O     . HOH K 6 .   ? 7.297   -19.577 14.740 1.00 41.22 ? 1474 HOH A O     1 
HETATM 8653 O  O     . HOH K 6 .   ? -3.961  -22.867 -8.047 1.00 45.17 ? 1475 HOH A O     1 
HETATM 8654 O  O     . HOH K 6 .   ? -15.838 -24.995 40.308 1.00 45.75 ? 1476 HOH A O     1 
HETATM 8655 O  O     . HOH K 6 .   ? -10.667 18.661  58.772 1.00 37.42 ? 1477 HOH A O     1 
HETATM 8656 O  O     . HOH K 6 .   ? -3.915  -10.682 71.355 1.00 38.19 ? 1478 HOH A O     1 
HETATM 8657 O  O     . HOH K 6 .   ? 21.890  -12.441 4.558  1.00 41.69 ? 1479 HOH A O     1 
HETATM 8658 O  O     . HOH K 6 .   ? 10.753  -23.729 41.197 1.00 39.27 ? 1480 HOH A O     1 
HETATM 8659 O  O     . HOH K 6 .   ? 6.176   -30.210 11.616 1.00 50.39 ? 1481 HOH A O     1 
HETATM 8660 O  O     . HOH K 6 .   ? -33.390 9.048   17.906 1.00 49.21 ? 1482 HOH A O     1 
HETATM 8661 O  O     . HOH K 6 .   ? 17.383  -4.234  57.152 1.00 40.30 ? 1483 HOH A O     1 
HETATM 8662 O  O     . HOH K 6 .   ? -33.594 15.611  20.246 1.00 45.08 ? 1484 HOH A O     1 
HETATM 8663 O  O     . HOH K 6 .   ? -14.707 22.390  31.451 1.00 37.23 ? 1485 HOH A O     1 
HETATM 8664 O  O     . HOH K 6 .   ? -25.506 -4.534  41.272 1.00 36.62 ? 1486 HOH A O     1 
HETATM 8665 O  O     . HOH K 6 .   ? -3.891  -19.519 58.233 1.00 41.77 ? 1487 HOH A O     1 
HETATM 8666 O  O     . HOH K 6 .   ? 17.967  -11.759 61.739 1.00 40.52 ? 1488 HOH A O     1 
HETATM 8667 O  O     . HOH K 6 .   ? -14.908 3.099   29.224 1.00 43.74 ? 1489 HOH A O     1 
HETATM 8668 O  O     . HOH K 6 .   ? -5.126  -21.370 56.755 1.00 41.24 ? 1490 HOH A O     1 
HETATM 8669 O  O     . HOH K 6 .   ? 26.350  -28.306 54.642 1.00 41.87 ? 1491 HOH A O     1 
HETATM 8670 O  O     . HOH K 6 .   ? -16.948 11.296  61.056 1.00 37.46 ? 1492 HOH A O     1 
HETATM 8671 O  O     . HOH K 6 .   ? -6.583  -35.486 25.757 1.00 40.43 ? 1493 HOH A O     1 
HETATM 8672 O  O     . HOH K 6 .   ? -30.827 -23.573 21.092 1.00 40.14 ? 1494 HOH A O     1 
HETATM 8673 O  O     . HOH K 6 .   ? 7.379   13.707  65.482 1.00 41.01 ? 1495 HOH A O     1 
HETATM 8674 O  O     . HOH K 6 .   ? -21.570 2.239   57.515 1.00 44.88 ? 1496 HOH A O     1 
HETATM 8675 O  O     . HOH K 6 .   ? 23.643  -35.470 59.017 1.00 42.67 ? 1497 HOH A O     1 
HETATM 8676 O  O     . HOH K 6 .   ? -8.211  -17.095 -3.325 1.00 37.39 ? 1498 HOH A O     1 
HETATM 8677 O  O     . HOH K 6 .   ? -29.036 -28.411 21.689 1.00 40.77 ? 1499 HOH A O     1 
HETATM 8678 O  O     . HOH K 6 .   ? 29.642  -35.832 41.130 1.00 39.90 ? 1500 HOH A O     1 
HETATM 8679 O  O     . HOH K 6 .   ? -24.607 -7.418  41.710 1.00 37.32 ? 1501 HOH A O     1 
HETATM 8680 O  O     . HOH K 6 .   ? -37.955 -22.961 25.872 1.00 50.37 ? 1502 HOH A O     1 
HETATM 8681 O  O     . HOH K 6 .   ? -32.069 -16.620 36.280 1.00 40.66 ? 1503 HOH A O     1 
HETATM 8682 O  O     . HOH K 6 .   ? -0.093  12.475  31.866 1.00 46.73 ? 1504 HOH A O     1 
HETATM 8683 O  O     . HOH K 6 .   ? -25.240 -3.051  8.553  1.00 36.99 ? 1505 HOH A O     1 
HETATM 8684 O  O     . HOH K 6 .   ? 1.609   -10.446 26.001 1.00 41.99 ? 1506 HOH A O     1 
HETATM 8685 O  O     . HOH K 6 .   ? 1.547   -45.761 45.326 1.00 40.98 ? 1507 HOH A O     1 
HETATM 8686 O  O     . HOH K 6 .   ? -14.011 -47.969 56.262 1.00 44.24 ? 1508 HOH A O     1 
HETATM 8687 O  O     . HOH K 6 .   ? -33.042 -6.165  17.350 1.00 44.31 ? 1509 HOH A O     1 
HETATM 8688 O  O     . HOH K 6 .   ? -14.003 12.155  38.910 1.00 41.48 ? 1510 HOH A O     1 
HETATM 8689 O  O     . HOH K 6 .   ? -13.535 -1.298  4.019  1.00 52.82 ? 1511 HOH A O     1 
HETATM 8690 O  O     . HOH K 6 .   ? -29.681 -24.791 27.166 1.00 33.23 ? 1512 HOH A O     1 
HETATM 8691 O  O     . HOH K 6 .   ? -11.003 -43.336 62.660 1.00 47.57 ? 1513 HOH A O     1 
HETATM 8692 O  O     . HOH K 6 .   ? 9.589   -40.595 63.663 1.00 51.86 ? 1514 HOH A O     1 
HETATM 8693 O  O     . HOH K 6 .   ? -15.151 13.255  42.780 1.00 42.05 ? 1515 HOH A O     1 
HETATM 8694 O  O     . HOH K 6 .   ? -18.432 -31.936 -0.777 1.00 50.90 ? 1516 HOH A O     1 
HETATM 8695 O  O     . HOH K 6 .   ? -11.800 -50.340 50.090 1.00 48.83 ? 1517 HOH A O     1 
HETATM 8696 O  O     . HOH K 6 .   ? 35.841  -23.833 46.340 1.00 48.60 ? 1518 HOH A O     1 
HETATM 8697 O  O     . HOH K 6 .   ? 0.272   -24.550 18.966 1.00 35.59 ? 1519 HOH A O     1 
HETATM 8698 O  O     . HOH K 6 .   ? -11.685 -40.084 2.711  1.00 51.29 ? 1520 HOH A O     1 
HETATM 8699 O  O     . HOH K 6 .   ? -21.520 -30.473 3.828  1.00 41.23 ? 1521 HOH A O     1 
HETATM 8700 O  O     . HOH K 6 .   ? 1.622   -24.185 0.429  1.00 40.40 ? 1522 HOH A O     1 
HETATM 8701 O  O     . HOH K 6 .   ? 6.868   -38.989 56.497 1.00 44.21 ? 1523 HOH A O     1 
HETATM 8702 O  O     . HOH K 6 .   ? -3.020  -44.729 38.748 1.00 46.39 ? 1524 HOH A O     1 
HETATM 8703 O  O     . HOH K 6 .   ? 18.665  -8.997  7.444  1.00 33.51 ? 1525 HOH A O     1 
HETATM 8704 O  O     . HOH K 6 .   ? -23.244 -2.954  5.432  1.00 41.02 ? 1526 HOH A O     1 
HETATM 8705 O  O     . HOH K 6 .   ? -13.094 2.806   31.475 1.00 33.83 ? 1527 HOH A O     1 
HETATM 8706 O  O     . HOH K 6 .   ? -19.287 -23.074 28.982 1.00 47.61 ? 1528 HOH A O     1 
HETATM 8707 O  O     . HOH K 6 .   ? -10.032 -19.071 -4.317 1.00 31.10 ? 1529 HOH A O     1 
HETATM 8708 O  O     . HOH K 6 .   ? -30.972 -23.375 25.313 1.00 36.34 ? 1530 HOH A O     1 
HETATM 8709 O  O     . HOH K 6 .   ? -4.867  -30.033 38.550 1.00 36.66 ? 1531 HOH A O     1 
HETATM 8710 O  O     . HOH K 6 .   ? -11.683 14.100  40.313 1.00 53.05 ? 1532 HOH A O     1 
HETATM 8711 O  O     . HOH K 6 .   ? -25.472 -2.903  43.828 1.00 40.42 ? 1533 HOH A O     1 
HETATM 8712 O  O     . HOH K 6 .   ? -32.448 -22.000 19.558 1.00 39.50 ? 1534 HOH A O     1 
HETATM 8713 O  O     . HOH K 6 .   ? -2.146  -14.573 48.122 1.00 40.86 ? 1535 HOH A O     1 
HETATM 8714 O  O     . HOH K 6 .   ? 0.383   -15.255 48.482 1.00 45.58 ? 1536 HOH A O     1 
HETATM 8715 O  O     . HOH K 6 .   ? -0.257  -16.727 51.142 1.00 43.44 ? 1537 HOH A O     1 
HETATM 8716 O  O     . HOH K 6 .   ? 6.340   -27.775 25.369 1.00 41.33 ? 1538 HOH A O     1 
HETATM 8717 O  O     . HOH K 6 .   ? 9.009   -27.277 24.738 1.00 35.35 ? 1539 HOH A O     1 
HETATM 8718 O  O     . HOH K 6 .   ? 14.370  -32.373 25.855 1.00 44.46 ? 1540 HOH A O     1 
HETATM 8719 O  O     . HOH K 6 .   ? 14.203  -29.419 31.532 1.00 26.79 ? 1541 HOH A O     1 
HETATM 8720 O  O     . HOH K 6 .   ? 16.417  -31.300 31.694 1.00 31.21 ? 1542 HOH A O     1 
HETATM 8721 O  O     . HOH K 6 .   ? 11.490  -30.646 36.113 1.00 44.18 ? 1543 HOH A O     1 
HETATM 8722 O  O     . HOH K 6 .   ? 12.552  -30.982 43.764 1.00 38.54 ? 1544 HOH A O     1 
HETATM 8723 O  O     . HOH K 6 .   ? 12.906  -33.775 44.262 1.00 50.26 ? 1545 HOH A O     1 
HETATM 8724 O  O     . HOH K 6 .   ? 2.411   -36.413 44.327 1.00 40.32 ? 1546 HOH A O     1 
HETATM 8725 O  O     . HOH K 6 .   ? 3.999   -41.939 47.055 1.00 43.26 ? 1547 HOH A O     1 
HETATM 8726 O  O     . HOH K 6 .   ? 5.326   -31.105 48.676 1.00 35.85 ? 1548 HOH A O     1 
HETATM 8727 O  O     . HOH K 6 .   ? 6.669   -32.408 58.738 1.00 32.93 ? 1549 HOH A O     1 
HETATM 8728 O  O     . HOH K 6 .   ? 7.962   -34.773 58.252 1.00 38.28 ? 1550 HOH A O     1 
HETATM 8729 O  O     . HOH K 6 .   ? 3.348   -35.141 58.215 1.00 53.57 ? 1551 HOH A O     1 
HETATM 8730 O  O     . HOH K 6 .   ? 14.740  1.356   57.483 1.00 46.15 ? 1552 HOH A O     1 
HETATM 8731 O  O     . HOH K 6 .   ? -39.089 2.384   25.659 1.00 38.33 ? 1553 HOH A O     1 
HETATM 8732 O  O     . HOH K 6 .   ? -36.077 2.278   28.582 1.00 37.99 ? 1554 HOH A O     1 
HETATM 8733 O  O     . HOH K 6 .   ? -35.714 7.417   33.170 1.00 38.74 ? 1555 HOH A O     1 
HETATM 8734 O  O     . HOH K 6 .   ? 0.000   2.698   24.724 1.00 49.81 ? 1556 HOH A O     1 
HETATM 8735 O  O     . HOH K 6 .   ? 12.604  -3.245  68.523 1.00 36.93 ? 1557 HOH A O     1 
HETATM 8736 O  O     . HOH K 6 .   ? 6.299   -4.630  72.795 1.00 31.87 ? 1558 HOH A O     1 
HETATM 8737 O  O     . HOH K 6 .   ? 31.498  -24.504 23.809 1.00 19.49 ? 1559 HOH A O     1 
HETATM 8738 O  O     . HOH K 6 .   ? 28.740  -26.220 19.754 1.00 39.29 ? 1560 HOH A O     1 
HETATM 8739 O  O     . HOH K 6 .   ? 33.724  -18.678 21.499 1.00 35.76 ? 1561 HOH A O     1 
HETATM 8740 O  O     . HOH K 6 .   ? 35.556  -20.451 21.332 1.00 41.71 ? 1562 HOH A O     1 
HETATM 8741 O  O     . HOH K 6 .   ? -8.945  -14.541 52.589 1.00 20.53 ? 1563 HOH A O     1 
HETATM 8742 O  O     . HOH K 6 .   ? -9.258  -14.518 55.764 1.00 37.73 ? 1564 HOH A O     1 
HETATM 8743 O  O     . HOH K 6 .   ? -9.891  -17.874 53.434 1.00 38.49 ? 1565 HOH A O     1 
HETATM 8744 O  O     . HOH K 6 .   ? -15.081 -10.670 56.651 1.00 46.37 ? 1566 HOH A O     1 
HETATM 8745 O  O     . HOH K 6 .   ? -20.478 -9.891  52.047 1.00 36.80 ? 1567 HOH A O     1 
HETATM 8746 O  O     . HOH K 6 .   ? -19.909 -13.648 50.685 1.00 43.68 ? 1568 HOH A O     1 
HETATM 8747 O  O     . HOH K 6 .   ? 20.803  -7.566  50.987 1.00 22.53 ? 1569 HOH A O     1 
HETATM 8748 O  O     . HOH K 6 .   ? 22.586  -4.005  48.262 1.00 44.99 ? 1570 HOH A O     1 
HETATM 8749 O  O     A HOH K 6 .   ? 23.182  -6.059  52.293 0.50 21.65 ? 1571 HOH A O     1 
HETATM 8750 O  O     B HOH K 6 .   ? 23.080  -6.299  54.258 0.50 29.49 ? 1571 HOH A O     1 
HETATM 8751 O  O     . HOH K 6 .   ? 30.134  -14.118 27.193 1.00 36.23 ? 1572 HOH A O     1 
HETATM 8752 O  O     . HOH K 6 .   ? 30.126  -16.010 29.791 1.00 33.46 ? 1573 HOH A O     1 
HETATM 8753 O  O     . HOH K 6 .   ? 23.259  -18.107 27.602 1.00 30.28 ? 1574 HOH A O     1 
HETATM 8754 O  O     . HOH K 6 .   ? 20.509  -14.680 26.322 1.00 33.50 ? 1575 HOH A O     1 
HETATM 8755 O  O     . HOH K 6 .   ? -20.007 -27.510 -1.306 1.00 34.27 ? 1576 HOH A O     1 
HETATM 8756 O  O     . HOH K 6 .   ? -13.379 -37.849 -0.439 1.00 36.07 ? 1577 HOH A O     1 
HETATM 8757 O  O     . HOH K 6 .   ? -15.429 -36.284 -1.899 1.00 48.55 ? 1578 HOH A O     1 
HETATM 8758 O  O     . HOH K 6 .   ? -17.677 -34.673 -0.401 1.00 47.18 ? 1579 HOH A O     1 
HETATM 8759 O  O     . HOH K 6 .   ? -15.964 -41.592 4.794  1.00 38.81 ? 1580 HOH A O     1 
HETATM 8760 O  O     . HOH K 6 .   ? -17.860 -38.220 9.659  1.00 31.99 ? 1581 HOH A O     1 
HETATM 8761 O  O     . HOH K 6 .   ? -5.312  -27.578 -7.661 1.00 48.72 ? 1582 HOH A O     1 
HETATM 8762 O  O     . HOH K 6 .   ? -9.631  -26.515 -7.048 1.00 35.63 ? 1583 HOH A O     1 
HETATM 8763 O  O     . HOH K 6 .   ? -10.222 -24.104 -6.075 1.00 42.31 ? 1584 HOH A O     1 
HETATM 8764 O  O     . HOH K 6 .   ? -11.966 19.072  61.059 1.00 36.05 ? 1585 HOH A O     1 
HETATM 8765 O  O     . HOH K 6 .   ? -27.451 -18.077 -2.228 1.00 30.79 ? 1586 HOH A O     1 
HETATM 8766 O  O     . HOH K 6 .   ? 34.271  -22.623 43.062 1.00 49.60 ? 1587 HOH A O     1 
HETATM 8767 O  O     . HOH K 6 .   ? -17.123 -32.573 25.047 1.00 41.71 ? 1588 HOH A O     1 
HETATM 8768 O  O     . HOH K 6 .   ? -15.981 -30.692 26.317 1.00 33.76 ? 1589 HOH A O     1 
HETATM 8769 O  O     . HOH K 6 .   ? -14.006 -31.503 28.902 1.00 38.36 ? 1590 HOH A O     1 
HETATM 8770 O  O     . HOH K 6 .   ? 0.714   -3.033  12.987 1.00 30.21 ? 1591 HOH A O     1 
HETATM 8771 O  O     . HOH K 6 .   ? -22.152 9.962   50.561 1.00 36.82 ? 1592 HOH A O     1 
HETATM 8772 O  O     . HOH K 6 .   ? -3.128  -39.648 7.680  1.00 28.45 ? 1593 HOH A O     1 
HETATM 8773 O  O     . HOH K 6 .   ? -4.742  -41.293 6.494  1.00 30.66 ? 1594 HOH A O     1 
HETATM 8774 O  O     . HOH K 6 .   ? -5.462  -39.999 4.499  1.00 38.48 ? 1595 HOH A O     1 
HETATM 8775 O  O     . HOH K 6 .   ? -5.144  -42.299 2.919  1.00 43.17 ? 1596 HOH A O     1 
HETATM 8776 O  O     . HOH K 6 .   ? -8.609  -40.637 1.052  1.00 34.94 ? 1597 HOH A O     1 
HETATM 8777 O  O     . HOH K 6 .   ? -25.098 24.476  41.822 1.00 35.15 ? 1598 HOH A O     1 
HETATM 8778 O  O     . HOH K 6 .   ? -22.484 24.009  41.401 1.00 35.69 ? 1599 HOH A O     1 
HETATM 8779 O  O     . HOH K 6 .   ? -22.728 22.183  44.549 1.00 36.25 ? 1600 HOH A O     1 
HETATM 8780 O  O     . HOH K 6 .   ? -20.334 21.023  44.441 1.00 40.76 ? 1601 HOH A O     1 
HETATM 8781 O  O     . HOH K 6 .   ? -15.617 17.804  47.005 1.00 46.02 ? 1602 HOH A O     1 
HETATM 8782 O  O     . HOH K 6 .   ? -12.319 15.939  44.039 1.00 49.52 ? 1603 HOH A O     1 
HETATM 8783 O  O     . HOH K 6 .   ? -10.203 14.535  43.557 1.00 40.02 ? 1604 HOH A O     1 
HETATM 8784 O  O     . HOH K 6 .   ? -10.629 -9.275  65.630 1.00 45.84 ? 1605 HOH A O     1 
HETATM 8785 O  O     . HOH K 6 .   ? -11.343 -6.710  64.576 1.00 31.66 ? 1606 HOH A O     1 
HETATM 8786 O  O     A HOH K 6 .   ? -9.052  0.924   67.427 0.50 32.69 ? 1607 HOH A O     1 
HETATM 8787 O  O     B HOH K 6 .   ? -9.488  2.897   66.878 0.50 19.48 ? 1607 HOH A O     1 
HETATM 8788 O  O     A HOH K 6 .   ? -12.242 3.013   67.128 0.50 20.74 ? 1608 HOH A O     1 
HETATM 8789 O  O     B HOH K 6 .   ? -13.580 3.018   65.863 0.50 21.18 ? 1608 HOH A O     1 
HETATM 8790 O  O     . HOH K 6 .   ? 21.116  -0.828  75.694 1.00 39.53 ? 1609 HOH A O     1 
HETATM 8791 O  O     . HOH K 6 .   ? 25.105  -37.043 44.984 1.00 40.65 ? 1610 HOH A O     1 
HETATM 8792 O  O     . HOH K 6 .   ? -19.673 -23.435 34.242 1.00 47.07 ? 1611 HOH A O     1 
HETATM 8793 O  O     . HOH K 6 .   ? -17.288 -19.999 41.191 1.00 48.60 ? 1612 HOH A O     1 
HETATM 8794 O  O     . HOH K 6 .   ? -19.163 -21.926 44.681 1.00 37.24 ? 1613 HOH A O     1 
HETATM 8795 O  O     . HOH K 6 .   ? -18.943 -33.056 44.518 1.00 51.93 ? 1614 HOH A O     1 
HETATM 8796 O  O     . HOH K 6 .   ? -20.305 -35.592 46.967 1.00 58.04 ? 1615 HOH A O     1 
HETATM 8797 O  O     . HOH K 6 .   ? -20.490 -30.936 49.990 1.00 38.33 ? 1616 HOH A O     1 
HETATM 8798 O  O     . HOH K 6 .   ? -17.624 -35.065 50.750 1.00 39.15 ? 1617 HOH A O     1 
HETATM 8799 O  O     . HOH K 6 .   ? -19.088 -37.036 51.752 1.00 42.67 ? 1618 HOH A O     1 
HETATM 8800 O  O     . HOH K 6 .   ? -18.011 -43.221 47.832 1.00 44.40 ? 1619 HOH A O     1 
HETATM 8801 O  O     . HOH K 6 .   ? -8.159  -6.154  10.050 1.00 41.11 ? 1620 HOH A O     1 
HETATM 8802 O  O     . HOH K 6 .   ? -33.321 2.046   38.220 1.00 35.62 ? 1621 HOH A O     1 
HETATM 8803 O  O     . HOH K 6 .   ? -34.955 -0.081  37.806 1.00 39.08 ? 1622 HOH A O     1 
HETATM 8804 O  O     . HOH K 6 .   ? -7.589  4.801   75.039 1.00 45.45 ? 1623 HOH A O     1 
HETATM 8805 O  O     . HOH K 6 .   ? -8.474  9.587   72.880 1.00 47.11 ? 1624 HOH A O     1 
HETATM 8806 O  O     A HOH K 6 .   ? 24.957  -19.529 7.957  0.50 32.93 ? 1625 HOH A O     1 
HETATM 8807 O  O     B HOH K 6 .   ? 24.498  -17.669 7.219  0.50 27.51 ? 1625 HOH A O     1 
HETATM 8808 O  O     . HOH K 6 .   ? 21.953  -9.826  70.543 1.00 61.22 ? 1626 HOH A O     1 
HETATM 8809 O  O     . HOH K 6 .   ? 23.395  -12.549 68.160 1.00 51.32 ? 1627 HOH A O     1 
HETATM 8810 O  O     . HOH K 6 .   ? 0.483   -30.070 23.435 1.00 37.26 ? 1628 HOH A O     1 
HETATM 8811 O  O     . HOH K 6 .   ? -0.541  19.552  64.566 1.00 40.39 ? 1629 HOH A O     1 
HETATM 8812 O  O     . HOH K 6 .   ? 25.344  -25.837 5.884  1.00 59.90 ? 1630 HOH A O     1 
HETATM 8813 O  O     . HOH K 6 .   ? -0.999  -27.728 59.852 1.00 29.59 ? 1631 HOH A O     1 
HETATM 8814 O  O     . HOH K 6 .   ? -0.025  -16.836 16.124 1.00 42.10 ? 1632 HOH A O     1 
HETATM 8815 O  O     . HOH K 6 .   ? -15.867 -3.357  7.315  1.00 34.19 ? 1633 HOH A O     1 
HETATM 8816 O  O     . HOH K 6 .   ? -2.189  7.536   30.658 1.00 37.23 ? 1634 HOH A O     1 
HETATM 8817 O  O     . HOH K 6 .   ? 0.045   -42.720 21.314 1.00 48.70 ? 1635 HOH A O     1 
HETATM 8818 O  O     . HOH K 6 .   ? -10.014 -4.743  3.995  1.00 44.43 ? 1636 HOH A O     1 
HETATM 8819 O  O     . HOH K 6 .   ? 46.338  -39.054 47.350 1.00 57.17 ? 1637 HOH A O     1 
HETATM 8820 O  O     . HOH K 6 .   ? -18.367 17.472  30.289 1.00 36.29 ? 1638 HOH A O     1 
HETATM 8821 O  O     . HOH K 6 .   ? 31.676  -14.803 23.071 1.00 43.97 ? 1639 HOH A O     1 
HETATM 8822 O  O     . HOH K 6 .   ? 11.991  4.207   59.944 1.00 51.62 ? 1640 HOH A O     1 
HETATM 8823 O  O     . HOH K 6 .   ? -1.482  -15.119 53.193 1.00 45.16 ? 1641 HOH A O     1 
HETATM 8824 O  O     . HOH K 6 .   ? 8.595   6.125   49.956 1.00 45.72 ? 1642 HOH A O     1 
HETATM 8825 O  O     . HOH K 6 .   ? -17.703 15.038  60.162 1.00 38.36 ? 1643 HOH A O     1 
HETATM 8826 O  O     . HOH K 6 .   ? 27.231  -14.318 8.467  1.00 46.09 ? 1644 HOH A O     1 
HETATM 8827 O  O     . HOH K 6 .   ? 6.261   -26.138 29.907 1.00 43.02 ? 1645 HOH A O     1 
HETATM 8828 O  O     . HOH K 6 .   ? 5.327   -28.440 31.020 1.00 50.71 ? 1646 HOH A O     1 
HETATM 8829 O  O     . HOH K 6 .   ? 8.995   -27.300 28.860 1.00 38.18 ? 1647 HOH A O     1 
HETATM 8830 O  O     . HOH K 6 .   ? 12.980  -29.507 29.138 1.00 33.24 ? 1648 HOH A O     1 
HETATM 8831 O  O     A HOH K 6 .   ? -37.218 1.406   17.332 0.50 30.63 ? 1649 HOH A O     1 
HETATM 8832 O  O     B HOH K 6 .   ? -37.162 0.733   18.599 0.50 33.28 ? 1649 HOH A O     1 
HETATM 8833 O  O     . HOH K 6 .   ? 1.129   -11.550 45.402 1.00 41.26 ? 1650 HOH A O     1 
HETATM 8834 O  O     . HOH K 6 .   ? 1.774   -18.211 40.125 1.00 37.47 ? 1651 HOH A O     1 
HETATM 8835 O  O     . HOH K 6 .   ? 0.009   -22.547 41.816 1.00 37.06 ? 1652 HOH A O     1 
HETATM 8836 O  O     . HOH K 6 .   ? 0.956   -33.700 -2.381 1.00 53.96 ? 1653 HOH A O     1 
HETATM 8837 O  O     . HOH K 6 .   ? 20.381  -35.898 54.724 1.00 39.54 ? 1654 HOH A O     1 
HETATM 8838 O  O     . HOH K 6 .   ? 13.261  -34.560 53.631 1.00 43.39 ? 1655 HOH A O     1 
HETATM 8839 O  O     . HOH K 6 .   ? 5.495   -23.516 50.465 1.00 42.32 ? 1656 HOH A O     1 
HETATM 8840 O  O     . HOH K 6 .   ? -29.402 -14.940 18.439 1.00 36.10 ? 1657 HOH A O     1 
HETATM 8841 O  O     . HOH K 6 .   ? 27.437  -21.810 60.336 1.00 46.08 ? 1658 HOH A O     1 
HETATM 8842 O  O     . HOH K 6 .   ? -2.380  3.528   14.741 1.00 42.56 ? 1659 HOH A O     1 
HETATM 8843 O  O     . HOH K 6 .   ? 14.852  -39.268 69.026 1.00 46.25 ? 1660 HOH A O     1 
HETATM 8844 O  O     . HOH K 6 .   ? 11.059  -30.355 41.505 1.00 39.00 ? 1661 HOH A O     1 
HETATM 8845 O  O     . HOH K 6 .   ? -35.233 -1.509  30.256 1.00 37.37 ? 1662 HOH A O     1 
HETATM 8846 O  O     A HOH K 6 .   ? -25.092 -25.956 9.171  0.50 31.68 ? 1663 HOH A O     1 
HETATM 8847 O  O     B HOH K 6 .   ? -25.445 -24.358 7.832  0.50 24.98 ? 1663 HOH A O     1 
HETATM 8848 O  O     . HOH K 6 .   ? 18.977  -14.475 62.400 1.00 40.92 ? 1664 HOH A O     1 
HETATM 8849 O  O     . HOH K 6 .   ? 16.540  -31.426 18.132 1.00 50.13 ? 1665 HOH A O     1 
HETATM 8850 O  O     . HOH K 6 .   ? -29.890 -24.209 16.976 1.00 41.23 ? 1666 HOH A O     1 
HETATM 8851 O  O     . HOH K 6 .   ? -22.894 5.715   19.403 1.00 46.20 ? 1667 HOH A O     1 
HETATM 8852 O  O     . HOH K 6 .   ? -20.492 20.983  22.443 1.00 48.83 ? 1668 HOH A O     1 
HETATM 8853 O  O     . HOH K 6 .   ? -42.728 -14.906 25.685 1.00 48.24 ? 1669 HOH A O     1 
HETATM 8854 O  O     . HOH K 6 .   ? 28.444  -18.606 62.183 1.00 41.13 ? 1670 HOH A O     1 
HETATM 8855 O  O     . HOH K 6 .   ? -11.827 -33.118 38.202 1.00 52.76 ? 1671 HOH A O     1 
HETATM 8856 O  O     . HOH K 6 .   ? 4.857   -49.663 69.476 1.00 49.09 ? 1672 HOH A O     1 
HETATM 8857 O  O     . HOH K 6 .   ? 2.925   -34.114 6.136  1.00 35.15 ? 1673 HOH A O     1 
HETATM 8858 O  O     . HOH K 6 .   ? -19.413 -19.943 -7.169 1.00 49.99 ? 1674 HOH A O     1 
HETATM 8859 O  O     . HOH K 6 .   ? 1.716   6.060   71.053 1.00 45.88 ? 1675 HOH A O     1 
HETATM 8860 O  O     . HOH K 6 .   ? 2.390   9.502   70.979 1.00 57.56 ? 1676 HOH A O     1 
HETATM 8861 O  O     . HOH K 6 .   ? -3.658  -27.847 15.920 1.00 38.06 ? 1677 HOH A O     1 
HETATM 8862 O  O     . HOH K 6 .   ? -23.456 -28.630 4.337  1.00 49.39 ? 1678 HOH A O     1 
HETATM 8863 O  O     . HOH K 6 .   ? 24.052  -19.142 60.318 1.00 43.03 ? 1679 HOH A O     1 
HETATM 8864 O  O     . HOH K 6 .   ? 27.123  -34.136 24.251 1.00 39.21 ? 1680 HOH A O     1 
HETATM 8865 O  O     . HOH K 6 .   ? -10.498 -51.632 48.287 1.00 41.64 ? 1681 HOH A O     1 
HETATM 8866 O  O     . HOH K 6 .   ? -6.572  -54.734 51.536 1.00 47.94 ? 1682 HOH A O     1 
HETATM 8867 O  O     . HOH K 6 .   ? 25.458  -29.151 19.623 1.00 37.37 ? 1683 HOH A O     1 
HETATM 8868 O  O     . HOH K 6 .   ? -36.030 2.715   41.372 1.00 45.91 ? 1684 HOH A O     1 
HETATM 8869 O  O     . HOH K 6 .   ? -4.741  13.798  68.345 1.00 35.87 ? 1685 HOH A O     1 
HETATM 8870 O  O     . HOH K 6 .   ? 2.471   -14.156 37.639 1.00 36.53 ? 1686 HOH A O     1 
HETATM 8871 O  O     . HOH K 6 .   ? -2.866  -10.053 31.020 1.00 36.40 ? 1687 HOH A O     1 
HETATM 8872 O  O     . HOH K 6 .   ? 8.715   -14.420 17.938 1.00 35.18 ? 1688 HOH A O     1 
HETATM 8873 O  O     . HOH K 6 .   ? -6.346  -41.135 55.569 1.00 35.37 ? 1689 HOH A O     1 
HETATM 8874 O  O     . HOH K 6 .   ? -15.470 -25.734 31.468 1.00 37.64 ? 1690 HOH A O     1 
HETATM 8875 O  O     . HOH K 6 .   ? -3.866  -31.589 -3.013 1.00 37.52 ? 1691 HOH A O     1 
HETATM 8876 O  O     . HOH K 6 .   ? -21.543 6.516   53.327 1.00 42.13 ? 1692 HOH A O     1 
HETATM 8877 O  O     . HOH K 6 .   ? 1.797   -38.647 45.501 1.00 43.71 ? 1693 HOH A O     1 
HETATM 8878 O  O     . HOH K 6 .   ? -12.816 -16.142 -4.298 1.00 39.59 ? 1694 HOH A O     1 
HETATM 8879 O  O     . HOH K 6 .   ? -9.001  -12.234 -2.020 1.00 46.24 ? 1695 HOH A O     1 
HETATM 8880 O  O     . HOH K 6 .   ? -18.737 -46.657 20.439 1.00 50.99 ? 1696 HOH A O     1 
HETATM 8881 O  O     . HOH L 6 .   ? 11.644  -0.177  50.508 1.00 19.44 ? 501  HOH T O     1 
HETATM 8882 O  O     . HOH L 6 .   ? 4.858   -1.646  46.036 1.00 17.84 ? 502  HOH T O     1 
HETATM 8883 O  O     . HOH L 6 .   ? 18.827  -6.444  47.687 1.00 19.41 ? 503  HOH T O     1 
HETATM 8884 O  O     . HOH L 6 .   ? 5.527   1.356   38.312 1.00 20.33 ? 504  HOH T O     1 
HETATM 8885 O  O     . HOH L 6 .   ? 16.304  -10.210 38.317 1.00 30.23 ? 505  HOH T O     1 
HETATM 8886 O  O     . HOH L 6 .   ? -2.578  -4.838  41.818 1.00 22.93 ? 506  HOH T O     1 
HETATM 8887 O  O     . HOH L 6 .   ? 5.159   5.532   40.631 1.00 23.22 ? 507  HOH T O     1 
HETATM 8888 O  O     . HOH L 6 .   ? 20.638  -10.535 45.456 1.00 22.23 ? 508  HOH T O     1 
HETATM 8889 O  O     . HOH L 6 .   ? 20.740  -7.707  46.325 1.00 24.61 ? 509  HOH T O     1 
HETATM 8890 O  O     . HOH L 6 .   ? 3.799   -4.099  36.993 1.00 35.54 ? 510  HOH T O     1 
HETATM 8891 O  O     . HOH L 6 .   ? 26.171  -12.703 32.636 1.00 26.54 ? 511  HOH T O     1 
HETATM 8892 O  O     . HOH L 6 .   ? -0.112  -4.008  36.815 1.00 29.66 ? 512  HOH T O     1 
HETATM 8893 O  O     . HOH L 6 .   ? 6.748   -1.003  38.492 1.00 29.89 ? 513  HOH T O     1 
HETATM 8894 O  O     . HOH L 6 .   ? 23.919  -14.228 38.192 1.00 33.03 ? 514  HOH T O     1 
HETATM 8895 O  O     . HOH L 6 .   ? 0.416   4.204   35.796 1.00 32.84 ? 515  HOH T O     1 
HETATM 8896 O  O     . HOH L 6 .   ? 19.706  -7.872  28.943 1.00 32.29 ? 516  HOH T O     1 
HETATM 8897 O  O     . HOH L 6 .   ? -0.895  -7.163  39.690 1.00 32.09 ? 517  HOH T O     1 
HETATM 8898 O  O     . HOH L 6 .   ? 15.489  -1.597  39.974 1.00 33.90 ? 518  HOH T O     1 
HETATM 8899 O  O     . HOH L 6 .   ? 1.276   -0.415  35.527 1.00 33.48 ? 519  HOH T O     1 
HETATM 8900 O  O     . HOH L 6 .   ? 18.541  -2.316  39.276 1.00 35.31 ? 520  HOH T O     1 
HETATM 8901 O  O     . HOH L 6 .   ? 1.896   6.548   38.277 1.00 30.16 ? 521  HOH T O     1 
HETATM 8902 O  O     . HOH L 6 .   ? 4.071   6.853   36.578 1.00 36.93 ? 522  HOH T O     1 
HETATM 8903 O  O     . HOH L 6 .   ? 13.503  -1.113  37.525 1.00 33.66 ? 523  HOH T O     1 
HETATM 8904 O  O     . HOH L 6 .   ? 21.616  -4.095  27.137 1.00 33.16 ? 524  HOH T O     1 
HETATM 8905 O  O     . HOH L 6 .   ? 25.593  -1.945  19.684 1.00 29.78 ? 525  HOH T O     1 
HETATM 8906 O  O     . HOH L 6 .   ? -1.767  -9.263  22.867 1.00 30.32 ? 526  HOH T O     1 
HETATM 8907 O  O     . HOH L 6 .   ? 2.334   2.166   36.322 1.00 25.97 ? 527  HOH T O     1 
HETATM 8908 O  O     . HOH L 6 .   ? 36.401  -1.258  29.413 1.00 40.93 ? 528  HOH T O     1 
HETATM 8909 O  O     . HOH L 6 .   ? -11.998 -4.722  22.618 1.00 28.42 ? 529  HOH T O     1 
HETATM 8910 O  O     . HOH L 6 .   ? 36.504  1.360   28.323 1.00 33.87 ? 530  HOH T O     1 
HETATM 8911 O  O     . HOH L 6 .   ? 7.450   5.539   42.139 1.00 36.34 ? 531  HOH T O     1 
HETATM 8912 O  O     . HOH L 6 .   ? 29.892  6.621   30.580 1.00 45.17 ? 532  HOH T O     1 
HETATM 8913 O  O     . HOH L 6 .   ? -10.005 -1.259  26.944 1.00 50.19 ? 533  HOH T O     1 
HETATM 8914 O  O     . HOH L 6 .   ? 1.128   -0.174  44.409 1.00 28.57 ? 534  HOH T O     1 
HETATM 8915 O  O     . HOH L 6 .   ? 9.829   3.470   47.660 1.00 29.38 ? 535  HOH T O     1 
HETATM 8916 O  O     . HOH L 6 .   ? 21.108  -5.520  40.924 1.00 39.84 ? 536  HOH T O     1 
HETATM 8917 O  O     . HOH L 6 .   ? 8.618   -7.100  28.557 1.00 33.09 ? 537  HOH T O     1 
HETATM 8918 O  O     . HOH L 6 .   ? -5.472  2.317   31.897 1.00 39.44 ? 538  HOH T O     1 
HETATM 8919 O  O     . HOH L 6 .   ? -1.068  -2.887  19.870 1.00 32.87 ? 539  HOH T O     1 
HETATM 8920 O  O     . HOH L 6 .   ? 22.050  -6.615  44.432 1.00 32.62 ? 540  HOH T O     1 
HETATM 8921 O  O     . HOH L 6 .   ? 22.655  -12.238 41.717 1.00 35.80 ? 541  HOH T O     1 
HETATM 8922 O  O     . HOH L 6 .   ? -3.482  1.747   27.903 1.00 44.95 ? 542  HOH T O     1 
HETATM 8923 O  O     . HOH L 6 .   ? 28.626  -4.885  27.019 1.00 33.96 ? 543  HOH T O     1 
HETATM 8924 O  O     . HOH L 6 .   ? -11.359 -3.924  28.502 1.00 40.68 ? 544  HOH T O     1 
HETATM 8925 O  O     . HOH L 6 .   ? 27.504  -3.698  33.917 1.00 38.68 ? 545  HOH T O     1 
HETATM 8926 O  O     . HOH L 6 .   ? 17.256  -0.769  44.117 1.00 36.05 ? 546  HOH T O     1 
HETATM 8927 O  O     . HOH L 6 .   ? 10.823  0.538   39.530 1.00 45.02 ? 547  HOH T O     1 
HETATM 8928 O  O     . HOH L 6 .   ? 38.630  5.054   28.513 1.00 32.66 ? 548  HOH T O     1 
HETATM 8929 O  O     . HOH L 6 .   ? 19.046  -3.976  41.654 1.00 42.48 ? 549  HOH T O     1 
HETATM 8930 O  O     . HOH L 6 .   ? -1.823  -2.638  35.240 1.00 36.27 ? 550  HOH T O     1 
HETATM 8931 O  O     . HOH L 6 .   ? -9.826  -0.449  24.460 1.00 47.59 ? 551  HOH T O     1 
HETATM 8932 O  O     . HOH L 6 .   ? 0.825   -3.613  17.968 1.00 38.70 ? 552  HOH T O     1 
HETATM 8933 O  O     . HOH L 6 .   ? 17.560  -10.426 34.433 1.00 40.26 ? 553  HOH T O     1 
HETATM 8934 O  O     . HOH L 6 .   ? -2.678  -4.840  31.315 1.00 42.12 ? 554  HOH T O     1 
HETATM 8935 O  O     . HOH L 6 .   ? 22.270  -0.752  26.661 1.00 44.52 ? 555  HOH T O     1 
HETATM 8936 O  O     . HOH L 6 .   ? 27.604  -10.394 29.372 1.00 44.19 ? 556  HOH T O     1 
HETATM 8937 O  O     . HOH L 6 .   ? -13.248 -5.836  24.598 1.00 31.23 ? 557  HOH T O     1 
HETATM 8938 O  O     . HOH L 6 .   ? -3.817  -7.156  25.476 1.00 47.68 ? 558  HOH T O     1 
HETATM 8939 O  O     . HOH L 6 .   ? 39.435  6.303   30.776 1.00 31.26 ? 559  HOH T O     1 
HETATM 8940 O  O     . HOH L 6 .   ? -3.446  -3.179  33.228 1.00 34.25 ? 560  HOH T O     1 
HETATM 8941 O  O     . HOH L 6 .   ? -0.020  -1.116  26.170 1.00 52.35 ? 561  HOH T O     1 
HETATM 8942 O  O     . HOH L 6 .   ? 24.347  -3.289  35.897 1.00 35.30 ? 562  HOH T O     1 
HETATM 8943 O  O     . HOH L 6 .   ? 25.232  -6.239  37.349 1.00 47.13 ? 563  HOH T O     1 
HETATM 8944 O  O     . HOH L 6 .   ? 25.039  -5.982  34.745 1.00 37.29 ? 564  HOH T O     1 
HETATM 8945 O  O     . HOH L 6 .   ? 26.355  -8.596  31.353 1.00 38.95 ? 565  HOH T O     1 
HETATM 8946 O  O     . HOH L 6 .   ? -2.294  -9.974  20.272 1.00 44.94 ? 566  HOH T O     1 
HETATM 8947 O  O     . HOH L 6 .   ? -1.179  -10.161 17.472 1.00 38.41 ? 567  HOH T O     1 
HETATM 8948 O  O     . HOH L 6 .   ? 1.034   -6.245  17.844 1.00 41.76 ? 568  HOH T O     1 
HETATM 8949 O  O     . HOH L 6 .   ? 1.057   5.150   33.337 1.00 39.89 ? 569  HOH T O     1 
HETATM 8950 O  O     . HOH L 6 .   ? 6.278   5.861   37.829 1.00 35.69 ? 570  HOH T O     1 
HETATM 8951 O  O     . HOH L 6 .   ? 9.229   6.750   40.621 1.00 32.89 ? 571  HOH T O     1 
HETATM 8952 O  O     . HOH L 6 .   ? 8.827   7.214   38.154 1.00 35.42 ? 572  HOH T O     1 
HETATM 8953 O  O     . HOH L 6 .   ? 7.315   8.267   44.230 1.00 49.21 ? 573  HOH T O     1 
HETATM 8954 O  O     . HOH L 6 .   ? 13.186  0.792   42.771 1.00 35.50 ? 574  HOH T O     1 
HETATM 8955 O  O     . HOH L 6 .   ? -3.107  -8.964  39.950 1.00 41.04 ? 575  HOH T O     1 
HETATM 8956 O  O     . HOH L 6 .   ? -4.614  -7.452  32.534 1.00 42.73 ? 576  HOH T O     1 
HETATM 8957 O  O     . HOH L 6 .   ? 1.998   -3.001  35.434 1.00 42.24 ? 577  HOH T O     1 
HETATM 8958 O  O     . HOH L 6 .   ? 30.291  -1.448  24.925 1.00 39.72 ? 578  HOH T O     1 
HETATM 8959 O  O     . HOH L 6 .   ? 0.115   -6.260  20.316 1.00 39.39 ? 579  HOH T O     1 
HETATM 8960 O  O     . HOH L 6 .   ? 33.194  4.314   38.000 1.00 40.28 ? 580  HOH T O     1 
HETATM 8961 O  O     . HOH M 6 .   ? 39.787  -7.649  33.686 1.00 34.44 ? 501  HOH P O     1 
HETATM 8962 O  O     . HOH M 6 .   ? 8.067   -17.884 42.434 1.00 26.12 ? 502  HOH P O     1 
HETATM 8963 O  O     . HOH M 6 .   ? 4.813   -4.357  46.888 1.00 17.18 ? 503  HOH P O     1 
HETATM 8964 O  O     . HOH M 6 .   ? 15.374  -0.792  35.616 1.00 35.21 ? 504  HOH P O     1 
HETATM 8965 O  O     . HOH M 6 .   ? 5.677   -5.248  35.619 1.00 25.65 ? 505  HOH P O     1 
HETATM 8966 O  O     . HOH M 6 .   ? 12.211  -8.523  41.767 1.00 28.77 ? 506  HOH P O     1 
HETATM 8967 O  O     . HOH M 6 .   ? 11.840  -0.540  33.928 1.00 29.37 ? 507  HOH P O     1 
HETATM 8968 O  O     . HOH M 6 .   ? 16.933  -7.167  29.032 1.00 29.55 ? 508  HOH P O     1 
HETATM 8969 O  O     . HOH M 6 .   ? 1.851   -10.911 40.205 1.00 25.59 ? 509  HOH P O     1 
HETATM 8970 O  O     . HOH M 6 .   ? 18.413  -0.134  36.458 1.00 37.93 ? 510  HOH P O     1 
HETATM 8971 O  O     . HOH M 6 .   ? 14.326  0.107   33.210 1.00 34.62 ? 511  HOH P O     1 
HETATM 8972 O  O     . HOH M 6 .   ? 11.000  -1.990  25.395 1.00 40.28 ? 512  HOH P O     1 
HETATM 8973 O  O     . HOH M 6 .   ? 17.850  -5.865  27.083 1.00 34.49 ? 513  HOH P O     1 
HETATM 8974 O  O     . HOH M 6 .   ? 10.070  -14.518 29.254 1.00 34.23 ? 514  HOH P O     1 
HETATM 8975 O  O     . HOH M 6 .   ? 40.112  -3.938  37.073 1.00 30.95 ? 515  HOH P O     1 
HETATM 8976 O  O     . HOH M 6 .   ? 5.188   -14.971 49.486 1.00 33.80 ? 516  HOH P O     1 
HETATM 8977 O  O     . HOH M 6 .   ? 5.369   -6.305  33.251 1.00 38.33 ? 517  HOH P O     1 
HETATM 8978 O  O     . HOH M 6 .   ? 5.779   -12.160 36.521 1.00 35.95 ? 518  HOH P O     1 
HETATM 8979 O  O     . HOH M 6 .   ? 10.373  -4.758  28.846 1.00 30.50 ? 519  HOH P O     1 
HETATM 8980 O  O     . HOH M 6 .   ? 4.385   -13.888 46.209 1.00 34.97 ? 520  HOH P O     1 
HETATM 8981 O  O     . HOH M 6 .   ? 13.277  -10.529 37.732 1.00 35.46 ? 521  HOH P O     1 
HETATM 8982 O  O     . HOH M 6 .   ? 25.182  5.534   30.374 1.00 38.76 ? 522  HOH P O     1 
HETATM 8983 O  O     . HOH M 6 .   ? 13.077  -0.055  28.804 1.00 46.21 ? 523  HOH P O     1 
HETATM 8984 O  O     . HOH M 6 .   ? 3.321   -12.529 44.238 1.00 32.95 ? 524  HOH P O     1 
HETATM 8985 O  O     . HOH M 6 .   ? 31.557  3.330   42.412 1.00 50.49 ? 525  HOH P O     1 
HETATM 8986 O  O     . HOH M 6 .   ? 23.929  0.639   37.657 1.00 50.85 ? 526  HOH P O     1 
HETATM 8987 O  O     A HOH M 6 .   ? 4.759   -9.111  38.577 0.50 15.50 ? 527  HOH P O     1 
HETATM 8988 O  O     B HOH M 6 .   ? 5.218   -10.676 38.912 0.50 24.08 ? 528  HOH P O     1 
HETATM 8989 O  O     . HOH M 6 .   ? 7.757   -17.271 35.434 1.00 32.28 ? 529  HOH P O     1 
HETATM 8990 O  O     . HOH M 6 .   ? 18.975  -3.528  27.155 1.00 45.56 ? 530  HOH P O     1 
HETATM 8991 O  O     . HOH M 6 .   ? 5.003   -13.332 42.474 1.00 40.22 ? 531  HOH P O     1 
HETATM 8992 O  O     . HOH M 6 .   ? 15.050  -9.950  32.981 1.00 41.27 ? 532  HOH P O     1 
HETATM 8993 O  O     . HOH M 6 .   ? 13.878  9.955   40.627 1.00 51.39 ? 533  HOH P O     1 
HETATM 8994 O  O     . HOH M 6 .   ? 20.190  11.355  46.915 1.00 54.76 ? 534  HOH P O     1 
HETATM 8995 O  O     . HOH M 6 .   ? 2.769   -8.448  30.628 1.00 43.23 ? 535  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.5228 0.5664 0.6208 -0.0357 0.0531  -0.0449 1    MET A N     
2    C CA    . MET A 1   ? 0.5100 0.5467 0.5872 -0.0322 0.0513  -0.0387 1    MET A CA    
3    C C     . MET A 1   ? 0.4819 0.5254 0.5628 -0.0281 0.0453  -0.0377 1    MET A C     
4    O O     . MET A 1   ? 0.4545 0.5078 0.5509 -0.0269 0.0394  -0.0408 1    MET A O     
5    C CB    . MET A 1   ? 0.5353 0.5679 0.5983 -0.0305 0.0454  -0.0350 1    MET A CB    
6    C CG    . MET A 1   ? 0.5829 0.6234 0.6551 -0.0296 0.0363  -0.0368 1    MET A CG    
7    S SD    . MET A 1   ? 0.6403 0.6776 0.6954 -0.0258 0.0278  -0.0315 1    MET A SD    
8    C CE    . MET A 1   ? 0.6114 0.6528 0.6644 -0.0212 0.0225  -0.0289 1    MET A CE    
9    N N     . LYS A 2   ? 0.4580 0.4955 0.5243 -0.0258 0.0465  -0.0335 2    LYS A N     
10   C CA    . LYS A 2   ? 0.4084 0.4508 0.4755 -0.0219 0.0411  -0.0320 2    LYS A CA    
11   C C     . LYS A 2   ? 0.3534 0.3995 0.4166 -0.0186 0.0307  -0.0295 2    LYS A C     
12   O O     . LYS A 2   ? 0.3283 0.3695 0.3798 -0.0184 0.0289  -0.0268 2    LYS A O     
13   C CB    . LYS A 2   ? 0.4375 0.4715 0.4899 -0.0207 0.0454  -0.0286 2    LYS A CB    
14   C CG    . LYS A 2   ? 0.4771 0.5076 0.5335 -0.0230 0.0551  -0.0310 2    LYS A CG    
15   C CD    . LYS A 2   ? 0.5369 0.5767 0.6085 -0.0215 0.0533  -0.0335 2    LYS A CD    
16   C CE    . LYS A 2   ? 0.5903 0.6256 0.6642 -0.0235 0.0635  -0.0357 2    LYS A CE    
17   N NZ    . LYS A 2   ? 0.6021 0.6274 0.6575 -0.0215 0.0657  -0.0317 2    LYS A NZ    
18   N N     . GLU A 3   ? 0.3190 0.3726 0.3912 -0.0160 0.0243  -0.0305 3    GLU A N     
19   C CA    . GLU A 3   ? 0.2948 0.3504 0.3624 -0.0128 0.0150  -0.0284 3    GLU A CA    
20   C C     . GLU A 3   ? 0.2719 0.3223 0.3235 -0.0104 0.0140  -0.0234 3    GLU A C     
21   O O     . GLU A 3   ? 0.2585 0.3059 0.3054 -0.0101 0.0182  -0.0220 3    GLU A O     
22   C CB    . GLU A 3   ? 0.3117 0.3748 0.3920 -0.0104 0.0085  -0.0311 3    GLU A CB    
23   C CG    . GLU A 3   ? 0.3828 0.4520 0.4819 -0.0125 0.0089  -0.0370 3    GLU A CG    
24   C CD    . GLU A 3   ? 0.4421 0.5176 0.5522 -0.0094 -0.0005 -0.0399 3    GLU A CD    
25   O OE1   . GLU A 3   ? 0.4717 0.5524 0.5974 -0.0106 -0.0025 -0.0452 3    GLU A OE1   
26   O OE2   . GLU A 3   ? 0.4718 0.5464 0.5748 -0.0057 -0.0061 -0.0372 3    GLU A OE2   
27   N N     . PHE A 4   ? 0.2301 0.2790 0.2737 -0.0088 0.0085  -0.0211 4    PHE A N     
28   C CA    . PHE A 4   ? 0.2082 0.2535 0.2396 -0.0064 0.0069  -0.0171 4    PHE A CA    
29   C C     . PHE A 4   ? 0.1955 0.2416 0.2238 -0.0040 0.0000  -0.0159 4    PHE A C     
30   O O     . PHE A 4   ? 0.2101 0.2567 0.2401 -0.0044 -0.0033 -0.0171 4    PHE A O     
31   C CB    . PHE A 4   ? 0.2248 0.2632 0.2444 -0.0073 0.0110  -0.0149 4    PHE A CB    
32   C CG    . PHE A 4   ? 0.2297 0.2656 0.2458 -0.0088 0.0105  -0.0150 4    PHE A CG    
33   C CD1   . PHE A 4   ? 0.2499 0.2850 0.2710 -0.0118 0.0143  -0.0176 4    PHE A CD1   
34   C CD2   . PHE A 4   ? 0.2531 0.2867 0.2608 -0.0072 0.0068  -0.0128 4    PHE A CD2   
35   C CE1   . PHE A 4   ? 0.2848 0.3170 0.3022 -0.0132 0.0138  -0.0177 4    PHE A CE1   
36   C CE2   . PHE A 4   ? 0.2440 0.2748 0.2480 -0.0084 0.0065  -0.0129 4    PHE A CE2   
37   C CZ    . PHE A 4   ? 0.2576 0.2876 0.2661 -0.0113 0.0097  -0.0153 4    PHE A CZ    
38   N N     . TYR A 5   ? 0.2048 0.2501 0.2278 -0.0017 -0.0018 -0.0136 5    TYR A N     
39   C CA    . TYR A 5   ? 0.1945 0.2384 0.2126 0.0003  -0.0072 -0.0122 5    TYR A CA    
40   C C     . TYR A 5   ? 0.1838 0.2234 0.1924 0.0000  -0.0070 -0.0104 5    TYR A C     
41   O O     . TYR A 5   ? 0.1869 0.2243 0.1914 -0.0011 -0.0031 -0.0095 5    TYR A O     
42   C CB    . TYR A 5   ? 0.1955 0.2390 0.2107 0.0026  -0.0083 -0.0105 5    TYR A CB    
43   C CG    . TYR A 5   ? 0.1893 0.2302 0.1977 0.0026  -0.0047 -0.0082 5    TYR A CG    
44   C CD1   . TYR A 5   ? 0.2041 0.2456 0.2144 0.0021  -0.0009 -0.0084 5    TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2027 0.2401 0.2030 0.0033  -0.0054 -0.0062 5    TYR A CD2   
46   C CE1   . TYR A 5   ? 0.1959 0.2344 0.1998 0.0026  0.0011  -0.0068 5    TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2031 0.2387 0.1992 0.0036  -0.0029 -0.0049 5    TYR A CE2   
48   C CZ    . TYR A 5   ? 0.2118 0.2479 0.2096 0.0034  -0.0002 -0.0052 5    TYR A CZ    
49   O OH    . TYR A 5   ? 0.2176 0.2514 0.2112 0.0041  0.0011  -0.0044 5    TYR A OH    
50   N N     . LEU A 6   ? 0.1754 0.2127 0.1799 0.0011  -0.0112 -0.0100 6    LEU A N     
51   C CA    . LEU A 6   ? 0.1924 0.2252 0.1877 0.0010  -0.0108 -0.0083 6    LEU A CA    
52   C C     . LEU A 6   ? 0.1924 0.2221 0.1811 0.0029  -0.0115 -0.0062 6    LEU A C     
53   O O     . LEU A 6   ? 0.1954 0.2235 0.1798 0.0029  -0.0086 -0.0047 6    LEU A O     
54   C CB    . LEU A 6   ? 0.1760 0.2069 0.1702 0.0007  -0.0143 -0.0096 6    LEU A CB    
55   C CG    . LEU A 6   ? 0.1851 0.2186 0.1863 -0.0016 -0.0131 -0.0120 6    LEU A CG    
56   C CD1   . LEU A 6   ? 0.1824 0.2148 0.1848 -0.0016 -0.0181 -0.0141 6    LEU A CD1   
57   C CD2   . LEU A 6   ? 0.1903 0.2214 0.1868 -0.0033 -0.0083 -0.0109 6    LEU A CD2   
58   N N     . THR A 7   ? 0.2059 0.2345 0.1943 0.0046  -0.0152 -0.0064 7    THR A N     
59   C CA    . THR A 7   ? 0.1949 0.2193 0.1767 0.0062  -0.0154 -0.0045 7    THR A CA    
60   C C     . THR A 7   ? 0.2111 0.2366 0.1964 0.0080  -0.0184 -0.0051 7    THR A C     
61   O O     . THR A 7   ? 0.2195 0.2479 0.2116 0.0084  -0.0218 -0.0073 7    THR A O     
62   C CB    . THR A 7   ? 0.2177 0.2345 0.1892 0.0070  -0.0171 -0.0037 7    THR A CB    
63   O OG1   . THR A 7   ? 0.2408 0.2555 0.2120 0.0082  -0.0228 -0.0053 7    THR A OG1   
64   C CG2   . THR A 7   ? 0.2208 0.2362 0.1888 0.0055  -0.0144 -0.0034 7    THR A CG2   
65   N N     . VAL A 8   ? 0.2145 0.2373 0.1959 0.0090  -0.0171 -0.0036 8    VAL A N     
66   C CA    . VAL A 8   ? 0.2367 0.2588 0.2194 0.0110  -0.0200 -0.0038 8    VAL A CA    
67   C C     . VAL A 8   ? 0.2357 0.2497 0.2080 0.0121  -0.0194 -0.0019 8    VAL A C     
68   O O     . VAL A 8   ? 0.2339 0.2460 0.2023 0.0109  -0.0150 -0.0005 8    VAL A O     
69   C CB    . VAL A 8   ? 0.2503 0.2790 0.2421 0.0107  -0.0179 -0.0044 8    VAL A CB    
70   C CG1   . VAL A 8   ? 0.2490 0.2776 0.2386 0.0098  -0.0131 -0.0028 8    VAL A CG1   
71   C CG2   . VAL A 8   ? 0.2872 0.3159 0.2822 0.0129  -0.0216 -0.0053 8    VAL A CG2   
72   N N     . GLU A 9   ? 0.2434 0.2517 0.2109 0.0145  -0.0239 -0.0021 9    GLU A N     
73   C CA    . GLU A 9   ? 0.2653 0.2637 0.2212 0.0157  -0.0230 -0.0002 9    GLU A CA    
74   C C     . GLU A 9   ? 0.2838 0.2795 0.2393 0.0184  -0.0271 -0.0006 9    GLU A C     
75   O O     . GLU A 9   ? 0.2963 0.2957 0.2585 0.0201  -0.0326 -0.0027 9    GLU A O     
76   C CB    . GLU A 9   ? 0.2746 0.2626 0.2177 0.0162  -0.0244 0.0002  9    GLU A CB    
77   C CG    . GLU A 9   ? 0.2811 0.2706 0.2236 0.0138  -0.0207 0.0004  9    GLU A CG    
78   C CD    . GLU A 9   ? 0.2850 0.2741 0.2263 0.0118  -0.0134 0.0017  9    GLU A CD    
79   O OE1   . GLU A 9   ? 0.2858 0.2733 0.2265 0.0119  -0.0107 0.0026  9    GLU A OE1   
80   O OE2   . GLU A 9   ? 0.2623 0.2527 0.2037 0.0102  -0.0105 0.0017  9    GLU A OE2   
81   N N     . GLN A 10  ? 0.2958 0.2852 0.2445 0.0188  -0.0244 0.0010  10   GLN A N     
82   C CA    . GLN A 10  ? 0.3120 0.2945 0.2554 0.0219  -0.0285 0.0010  10   GLN A CA    
83   C C     . GLN A 10  ? 0.3552 0.3221 0.2809 0.0234  -0.0300 0.0022  10   GLN A C     
84   O O     . GLN A 10  ? 0.3716 0.3317 0.2885 0.0215  -0.0240 0.0039  10   GLN A O     
85   C CB    . GLN A 10  ? 0.2987 0.2824 0.2444 0.0214  -0.0245 0.0021  10   GLN A CB    
86   C CG    . GLN A 10  ? 0.3276 0.3032 0.2671 0.0247  -0.0287 0.0022  10   GLN A CG    
87   C CD    . GLN A 10  ? 0.3293 0.3041 0.2691 0.0241  -0.0243 0.0034  10   GLN A CD    
88   O OE1   . GLN A 10  ? 0.3473 0.3302 0.2954 0.0215  -0.0193 0.0035  10   GLN A OE1   
89   N NE2   . GLN A 10  ? 0.3734 0.3375 0.3035 0.0267  -0.0267 0.0041  10   GLN A NE2   
90   N N     . ILE A 11  ? 0.3531 0.3138 0.2736 0.0269  -0.0379 0.0010  11   ILE A N     
91   C CA    . ILE A 11  ? 0.4082 0.3512 0.3091 0.0293  -0.0405 0.0021  11   ILE A CA    
92   C C     . ILE A 11  ? 0.4118 0.3478 0.3082 0.0337  -0.0474 0.0014  11   ILE A C     
93   O O     . ILE A 11  ? 0.4252 0.3646 0.3280 0.0367  -0.0559 -0.0011 11   ILE A O     
94   C CB    . ILE A 11  ? 0.3989 0.3379 0.2944 0.0300  -0.0451 0.0009  11   ILE A CB    
95   C CG1   . ILE A 11  ? 0.4200 0.3657 0.3199 0.0259  -0.0383 0.0015  11   ILE A CG1   
96   C CG2   . ILE A 11  ? 0.4777 0.3958 0.3502 0.0331  -0.0484 0.0019  11   ILE A CG2   
97   C CD1   . ILE A 11  ? 0.4304 0.3752 0.3284 0.0261  -0.0426 0.0000  11   ILE A CD1   
98   N N     . GLY A 12  ? 0.4403 0.3665 0.3265 0.0340  -0.0435 0.0035  12   GLY A N     
99   C CA    . GLY A 12  ? 0.4627 0.3822 0.3448 0.0381  -0.0492 0.0031  12   GLY A CA    
100  C C     . GLY A 12  ? 0.4315 0.3677 0.3343 0.0385  -0.0518 0.0010  12   GLY A C     
101  O O     . GLY A 12  ? 0.4335 0.3817 0.3485 0.0351  -0.0452 0.0014  12   GLY A O     
102  N N     . ASP A 13  ? 0.4136 0.3504 0.3208 0.0428  -0.0613 -0.0016 13   ASP A N     
103  C CA    . ASP A 13  ? 0.3904 0.3423 0.3177 0.0434  -0.0635 -0.0041 13   ASP A CA    
104  C C     . ASP A 13  ? 0.3524 0.3193 0.2974 0.0419  -0.0654 -0.0072 13   ASP A C     
105  O O     . ASP A 13  ? 0.3406 0.3185 0.3022 0.0429  -0.0683 -0.0102 13   ASP A O     
106  C CB    . ASP A 13  ? 0.4032 0.3481 0.3278 0.0490  -0.0721 -0.0058 13   ASP A CB    
107  C CG    . ASP A 13  ? 0.4517 0.3840 0.3620 0.0499  -0.0687 -0.0029 13   ASP A CG    
108  O OD1   . ASP A 13  ? 0.4780 0.3951 0.3739 0.0546  -0.0753 -0.0029 13   ASP A OD1   
109  O OD2   . ASP A 13  ? 0.4130 0.3498 0.3259 0.0460  -0.0596 -0.0007 13   ASP A OD2   
110  N N     . SER A 14  ? 0.3596 0.3263 0.3010 0.0393  -0.0629 -0.0065 14   SER A N     
111  C CA    . SER A 14  ? 0.3282 0.3073 0.2843 0.0374  -0.0639 -0.0092 14   SER A CA    
112  C C     . SER A 14  ? 0.2967 0.2840 0.2576 0.0322  -0.0546 -0.0074 14   SER A C     
113  O O     . SER A 14  ? 0.2911 0.2719 0.2406 0.0303  -0.0489 -0.0044 14   SER A O     
114  C CB    . SER A 14  ? 0.3769 0.3483 0.3252 0.0394  -0.0711 -0.0108 14   SER A CB    
115  O OG    . SER A 14  ? 0.3900 0.3562 0.3380 0.0446  -0.0817 -0.0137 14   SER A OG    
116  N N     . ILE A 15  ? 0.2697 0.2705 0.2474 0.0302  -0.0529 -0.0095 15   ILE A N     
117  C CA    . ILE A 15  ? 0.2459 0.2535 0.2277 0.0259  -0.0461 -0.0086 15   ILE A CA    
118  C C     . ILE A 15  ? 0.2641 0.2717 0.2464 0.0256  -0.0499 -0.0105 15   ILE A C     
119  O O     . ILE A 15  ? 0.2566 0.2681 0.2484 0.0272  -0.0559 -0.0140 15   ILE A O     
120  C CB    . ILE A 15  ? 0.2269 0.2470 0.2245 0.0238  -0.0416 -0.0099 15   ILE A CB    
121  C CG1   . ILE A 15  ? 0.2189 0.2387 0.2151 0.0238  -0.0374 -0.0079 15   ILE A CG1   
122  C CG2   . ILE A 15  ? 0.2300 0.2559 0.2315 0.0200  -0.0363 -0.0097 15   ILE A CG2   
123  C CD1   . ILE A 15  ? 0.2292 0.2444 0.2153 0.0217  -0.0314 -0.0046 15   ILE A CD1   
124  N N     . PHE A 16  ? 0.2727 0.2756 0.2454 0.0236  -0.0464 -0.0084 16   PHE A N     
125  C CA    . PHE A 16  ? 0.2674 0.2709 0.2407 0.0226  -0.0486 -0.0099 16   PHE A CA    
126  C C     . PHE A 16  ? 0.2450 0.2578 0.2269 0.0186  -0.0419 -0.0097 16   PHE A C     
127  O O     . PHE A 16  ? 0.2397 0.2519 0.2169 0.0166  -0.0355 -0.0071 16   PHE A O     
128  C CB    . PHE A 16  ? 0.3002 0.2906 0.2556 0.0234  -0.0497 -0.0080 16   PHE A CB    
129  C CG    . PHE A 16  ? 0.3490 0.3280 0.2941 0.0278  -0.0581 -0.0090 16   PHE A CG    
130  C CD1   . PHE A 16  ? 0.3923 0.3689 0.3375 0.0297  -0.0661 -0.0119 16   PHE A CD1   
131  C CD2   . PHE A 16  ? 0.3679 0.3377 0.3027 0.0301  -0.0584 -0.0072 16   PHE A CD2   
132  C CE1   . PHE A 16  ? 0.4443 0.4089 0.3787 0.0343  -0.0750 -0.0131 16   PHE A CE1   
133  C CE2   . PHE A 16  ? 0.4377 0.3949 0.3608 0.0347  -0.0666 -0.0080 16   PHE A CE2   
134  C CZ    . PHE A 16  ? 0.4299 0.3842 0.3525 0.0370  -0.0753 -0.0110 16   PHE A CZ    
135  N N     . GLU A 17  ? 0.2272 0.2479 0.2217 0.0175  -0.0434 -0.0127 17   GLU A N     
136  C CA    . GLU A 17  ? 0.2263 0.2544 0.2282 0.0139  -0.0371 -0.0128 17   GLU A CA    
137  C C     . GLU A 17  ? 0.2400 0.2689 0.2439 0.0124  -0.0386 -0.0146 17   GLU A C     
138  O O     . GLU A 17  ? 0.2746 0.3047 0.2849 0.0135  -0.0445 -0.0179 17   GLU A O     
139  C CB    . GLU A 17  ? 0.2151 0.2521 0.2311 0.0131  -0.0346 -0.0147 17   GLU A CB    
140  C CG    . GLU A 17  ? 0.2340 0.2755 0.2535 0.0097  -0.0272 -0.0140 17   GLU A CG    
141  C CD    . GLU A 17  ? 0.2477 0.2966 0.2812 0.0083  -0.0244 -0.0167 17   GLU A CD    
142  O OE1   . GLU A 17  ? 0.2609 0.3114 0.2952 0.0057  -0.0184 -0.0162 17   GLU A OE1   
143  O OE2   . GLU A 17  ? 0.2661 0.3185 0.3094 0.0098  -0.0279 -0.0197 17   GLU A OE2   
144  N N     . ARG A 18  ? 0.2228 0.2507 0.2215 0.0100  -0.0336 -0.0128 18   ARG A N     
145  C CA    . ARG A 18  ? 0.2216 0.2514 0.2239 0.0078  -0.0333 -0.0145 18   ARG A CA    
146  C C     . ARG A 18  ? 0.1905 0.2273 0.2020 0.0050  -0.0271 -0.0150 18   ARG A C     
147  O O     . ARG A 18  ? 0.2017 0.2388 0.2104 0.0045  -0.0223 -0.0127 18   ARG A O     
148  C CB    . ARG A 18  ? 0.2125 0.2356 0.2022 0.0072  -0.0319 -0.0122 18   ARG A CB    
149  C CG    . ARG A 18  ? 0.2260 0.2396 0.2035 0.0099  -0.0369 -0.0114 18   ARG A CG    
150  C CD    . ARG A 18  ? 0.2573 0.2640 0.2224 0.0091  -0.0335 -0.0091 18   ARG A CD    
151  N NE    . ARG A 18  ? 0.2194 0.2268 0.1856 0.0073  -0.0335 -0.0103 18   ARG A NE    
152  C CZ    . ARG A 18  ? 0.2174 0.2211 0.1760 0.0060  -0.0297 -0.0088 18   ARG A CZ    
153  N NH1   . ARG A 18  ? 0.2358 0.2355 0.1867 0.0063  -0.0254 -0.0062 18   ARG A NH1   
154  N NH2   . ARG A 18  ? 0.2486 0.2527 0.2084 0.0045  -0.0301 -0.0101 18   ARG A NH2   
155  N N     . TYR A 19  ? 0.1975 0.2389 0.2196 0.0031  -0.0272 -0.0183 19   TYR A N     
156  C CA    . TYR A 19  ? 0.1993 0.2452 0.2290 0.0004  -0.0206 -0.0190 19   TYR A CA    
157  C C     . TYR A 19  ? 0.1991 0.2469 0.2357 -0.0024 -0.0193 -0.0220 19   TYR A C     
158  O O     . TYR A 19  ? 0.2109 0.2582 0.2495 -0.0020 -0.0246 -0.0241 19   TYR A O     
159  C CB    . TYR A 19  ? 0.1829 0.2341 0.2231 0.0010  -0.0198 -0.0207 19   TYR A CB    
160  C CG    . TYR A 19  ? 0.2110 0.2668 0.2647 0.0018  -0.0250 -0.0254 19   TYR A CG    
161  C CD1   . TYR A 19  ? 0.2254 0.2791 0.2773 0.0053  -0.0333 -0.0261 19   TYR A CD1   
162  C CD2   . TYR A 19  ? 0.2039 0.2655 0.2723 -0.0007 -0.0215 -0.0293 19   TYR A CD2   
163  C CE1   . TYR A 19  ? 0.2342 0.2921 0.2994 0.0067  -0.0393 -0.0310 19   TYR A CE1   
164  C CE2   . TYR A 19  ? 0.2283 0.2951 0.3117 0.0000  -0.0264 -0.0344 19   TYR A CE2   
165  C CZ    . TYR A 19  ? 0.2261 0.2914 0.3082 0.0040  -0.0360 -0.0353 19   TYR A CZ    
166  O OH    . TYR A 19  ? 0.2257 0.2960 0.3234 0.0054  -0.0421 -0.0409 19   TYR A OH    
167  N N     . ILE A 20  ? 0.2108 0.2596 0.2499 -0.0052 -0.0123 -0.0220 20   ILE A N     
168  C CA    . ILE A 20  ? 0.2183 0.2685 0.2651 -0.0084 -0.0094 -0.0251 20   ILE A CA    
169  C C     . ILE A 20  ? 0.2205 0.2768 0.2829 -0.0097 -0.0070 -0.0290 20   ILE A C     
170  O O     . ILE A 20  ? 0.2148 0.2715 0.2776 -0.0098 -0.0021 -0.0280 20   ILE A O     
171  C CB    . ILE A 20  ? 0.2378 0.2831 0.2757 -0.0108 -0.0026 -0.0229 20   ILE A CB    
172  C CG1   . ILE A 20  ? 0.2396 0.2794 0.2636 -0.0095 -0.0050 -0.0197 20   ILE A CG1   
173  C CG2   . ILE A 20  ? 0.2451 0.2907 0.2908 -0.0147 0.0016  -0.0263 20   ILE A CG2   
174  C CD1   . ILE A 20  ? 0.2428 0.2815 0.2665 -0.0096 -0.0101 -0.0212 20   ILE A CD1   
175  N N     . ASP A 21  ? 0.2195 0.2803 0.2953 -0.0104 -0.0105 -0.0337 21   ASP A N     
176  C CA    . ASP A 21  ? 0.2328 0.3002 0.3263 -0.0115 -0.0083 -0.0383 21   ASP A CA    
177  C C     . ASP A 21  ? 0.2419 0.3089 0.3410 -0.0162 0.0018  -0.0401 21   ASP A C     
178  O O     . ASP A 21  ? 0.2448 0.3057 0.3326 -0.0183 0.0065  -0.0375 21   ASP A O     
179  C CB    . ASP A 21  ? 0.2321 0.3049 0.3397 -0.0099 -0.0170 -0.0434 21   ASP A CB    
180  C CG    . ASP A 21  ? 0.2469 0.3198 0.3601 -0.0125 -0.0184 -0.0468 21   ASP A CG    
181  O OD1   . ASP A 21  ? 0.2403 0.3102 0.3496 -0.0163 -0.0111 -0.0459 21   ASP A OD1   
182  O OD2   . ASP A 21  ? 0.2559 0.3316 0.3774 -0.0106 -0.0273 -0.0506 21   ASP A OD2   
183  N N     . SER A 22  ? 0.2638 0.3365 0.3800 -0.0179 0.0054  -0.0448 22   SER A N     
184  C CA    . SER A 22  ? 0.2996 0.3705 0.4208 -0.0225 0.0166  -0.0468 22   SER A CA    
185  C C     . SER A 22  ? 0.3314 0.4004 0.4555 -0.0264 0.0192  -0.0492 22   SER A C     
186  O O     . SER A 22  ? 0.3311 0.3954 0.4541 -0.0305 0.0291  -0.0498 22   SER A O     
187  C CB    . SER A 22  ? 0.3213 0.3991 0.4620 -0.0234 0.0202  -0.0518 22   SER A CB    
188  O OG    . SER A 22  ? 0.3332 0.4195 0.4923 -0.0222 0.0123  -0.0574 22   SER A OG    
189  N N     . ASN A 23  ? 0.3135 0.3848 0.4401 -0.0251 0.0104  -0.0506 23   ASN A N     
190  C CA    . ASN A 23  ? 0.3360 0.4055 0.4649 -0.0285 0.0115  -0.0529 23   ASN A CA    
191  C C     . ASN A 23  ? 0.3324 0.3938 0.4406 -0.0277 0.0098  -0.0476 23   ASN A C     
192  O O     . ASN A 23  ? 0.3561 0.4149 0.4634 -0.0300 0.0098  -0.0489 23   ASN A O     
193  C CB    . ASN A 23  ? 0.3352 0.4123 0.4824 -0.0279 0.0030  -0.0591 23   ASN A CB    
194  C CG    . ASN A 23  ? 0.3653 0.4507 0.5365 -0.0298 0.0065  -0.0657 23   ASN A CG    
195  O OD1   . ASN A 23  ? 0.3829 0.4673 0.5602 -0.0343 0.0178  -0.0676 23   ASN A OD1   
196  N ND2   . ASN A 23  ? 0.3468 0.4397 0.5316 -0.0263 -0.0029 -0.0695 23   ASN A ND2   
197  N N     . GLY A 24  ? 0.3205 0.3780 0.4129 -0.0245 0.0084  -0.0421 24   GLY A N     
198  C CA    . GLY A 24  ? 0.2942 0.3445 0.3680 -0.0234 0.0071  -0.0372 24   GLY A CA    
199  C C     . GLY A 24  ? 0.2887 0.3393 0.3584 -0.0205 -0.0027 -0.0367 24   GLY A C     
200  O O     . GLY A 24  ? 0.3027 0.3476 0.3596 -0.0202 -0.0036 -0.0339 24   GLY A O     
201  N N     . ARG A 25  ? 0.2555 0.3115 0.3349 -0.0180 -0.0100 -0.0394 25   ARG A N     
202  C CA    . ARG A 25  ? 0.2649 0.3192 0.3387 -0.0148 -0.0198 -0.0391 25   ARG A CA    
203  C C     . ARG A 25  ? 0.2488 0.3004 0.3105 -0.0107 -0.0231 -0.0347 25   ARG A C     
204  O O     . ARG A 25  ? 0.2334 0.2879 0.2983 -0.0096 -0.0212 -0.0340 25   ARG A O     
205  C CB    . ARG A 25  ? 0.2640 0.3241 0.3542 -0.0139 -0.0273 -0.0450 25   ARG A CB    
206  C CG    . ARG A 25  ? 0.2993 0.3603 0.3985 -0.0170 -0.0281 -0.0495 25   ARG A CG    
207  C CD    . ARG A 25  ? 0.3174 0.3850 0.4363 -0.0211 -0.0215 -0.0547 25   ARG A CD    
208  N NE    . ARG A 25  ? 0.2962 0.3657 0.4269 -0.0236 -0.0242 -0.0602 25   ARG A NE    
209  C CZ    . ARG A 25  ? 0.2492 0.3258 0.4001 -0.0234 -0.0301 -0.0671 25   ARG A CZ    
210  N NH1   . ARG A 25  ? 0.2398 0.3225 0.4019 -0.0205 -0.0339 -0.0694 25   ARG A NH1   
211  N NH2   . ARG A 25  ? 0.2553 0.3331 0.4161 -0.0259 -0.0325 -0.0721 25   ARG A NH2   
212  N N     . GLU A 26  ? 0.2315 0.2771 0.2795 -0.0086 -0.0278 -0.0320 26   GLU A N     
213  C CA    . GLU A 26  ? 0.2188 0.2609 0.2558 -0.0049 -0.0310 -0.0285 26   GLU A CA    
214  C C     . GLU A 26  ? 0.2404 0.2839 0.2830 -0.0016 -0.0397 -0.0312 26   GLU A C     
215  O O     . GLU A 26  ? 0.2368 0.2794 0.2829 -0.0009 -0.0463 -0.0345 26   GLU A O     
216  C CB    . GLU A 26  ? 0.2268 0.2610 0.2469 -0.0039 -0.0315 -0.0248 26   GLU A CB    
217  C CG    . GLU A 26  ? 0.2460 0.2759 0.2552 -0.0006 -0.0338 -0.0215 26   GLU A CG    
218  C CD    . GLU A 26  ? 0.2959 0.3180 0.2894 0.0000  -0.0327 -0.0181 26   GLU A CD    
219  O OE1   . GLU A 26  ? 0.2678 0.2888 0.2582 -0.0020 -0.0282 -0.0171 26   GLU A OE1   
220  O OE2   . GLU A 26  ? 0.3264 0.3427 0.3104 0.0027  -0.0360 -0.0166 26   GLU A OE2   
221  N N     . ARG A 27  ? 0.2312 0.2761 0.2743 0.0005  -0.0399 -0.0299 27   ARG A N     
222  C CA    . ARG A 27  ? 0.2538 0.2990 0.3010 0.0043  -0.0482 -0.0322 27   ARG A CA    
223  C C     . ARG A 27  ? 0.2536 0.2925 0.2866 0.0075  -0.0493 -0.0279 27   ARG A C     
224  O O     . ARG A 27  ? 0.2453 0.2824 0.2698 0.0064  -0.0430 -0.0239 27   ARG A O     
225  C CB    . ARG A 27  ? 0.2679 0.3223 0.3343 0.0037  -0.0471 -0.0362 27   ARG A CB    
226  C CG    . ARG A 27  ? 0.3427 0.4037 0.4253 -0.0002 -0.0435 -0.0408 27   ARG A CG    
227  C CD    . ARG A 27  ? 0.4176 0.4800 0.5099 0.0007  -0.0523 -0.0463 27   ARG A CD    
228  N NE    . ARG A 27  ? 0.4845 0.5506 0.5883 0.0044  -0.0602 -0.0503 27   ARG A NE    
229  C CZ    . ARG A 27  ? 0.5227 0.5979 0.6474 0.0034  -0.0586 -0.0553 27   ARG A CZ    
230  N NH1   . ARG A 27  ? 0.5235 0.6043 0.6591 -0.0014 -0.0484 -0.0566 27   ARG A NH1   
231  N NH2   . ARG A 27  ? 0.5088 0.5867 0.6432 0.0074  -0.0669 -0.0590 27   ARG A NH2   
232  N N     . THR A 28  ? 0.2637 0.2986 0.2940 0.0114  -0.0577 -0.0292 28   THR A N     
233  C CA    . THR A 28  ? 0.2813 0.3098 0.2995 0.0144  -0.0587 -0.0258 28   THR A CA    
234  C C     . THR A 28  ? 0.2929 0.3240 0.3203 0.0177  -0.0649 -0.0288 28   THR A C     
235  O O     . THR A 28  ? 0.2891 0.3226 0.3268 0.0193  -0.0722 -0.0335 28   THR A O     
236  C CB    . THR A 28  ? 0.3294 0.3451 0.3279 0.0166  -0.0624 -0.0233 28   THR A CB    
237  O OG1   . THR A 28  ? 0.3836 0.3976 0.3758 0.0136  -0.0572 -0.0214 28   THR A OG1   
238  C CG2   . THR A 28  ? 0.3177 0.3261 0.3030 0.0187  -0.0608 -0.0194 28   THR A CG2   
239  N N     . ARG A 29  ? 0.2918 0.3227 0.3166 0.0189  -0.0621 -0.0263 29   ARG A N     
240  C CA    . ARG A 29  ? 0.3043 0.3367 0.3363 0.0225  -0.0679 -0.0288 29   ARG A CA    
241  C C     . ARG A 29  ? 0.3199 0.3440 0.3375 0.0251  -0.0677 -0.0248 29   ARG A C     
242  O O     . ARG A 29  ? 0.3070 0.3284 0.3148 0.0232  -0.0607 -0.0205 29   ARG A O     
243  C CB    . ARG A 29  ? 0.2926 0.3374 0.3451 0.0205  -0.0637 -0.0319 29   ARG A CB    
244  C CG    . ARG A 29  ? 0.2921 0.3404 0.3438 0.0174  -0.0533 -0.0284 29   ARG A CG    
245  C CD    . ARG A 29  ? 0.3026 0.3611 0.3731 0.0156  -0.0491 -0.0318 29   ARG A CD    
246  N NE    . ARG A 29  ? 0.2929 0.3536 0.3618 0.0121  -0.0390 -0.0291 29   ARG A NE    
247  C CZ    . ARG A 29  ? 0.2773 0.3444 0.3584 0.0089  -0.0326 -0.0314 29   ARG A CZ    
248  N NH1   . ARG A 29  ? 0.2528 0.3263 0.3511 0.0084  -0.0344 -0.0369 29   ARG A NH1   
249  N NH2   . ARG A 29  ? 0.2812 0.3476 0.3571 0.0063  -0.0243 -0.0286 29   ARG A NH2   
250  N N     . GLU A 30  ? 0.3288 0.3486 0.3458 0.0296  -0.0758 -0.0267 30   GLU A N     
251  C CA    . GLU A 30  ? 0.3297 0.3413 0.3345 0.0324  -0.0761 -0.0236 30   GLU A CA    
252  C C     . GLU A 30  ? 0.3315 0.3511 0.3511 0.0339  -0.0770 -0.0260 30   GLU A C     
253  O O     . GLU A 30  ? 0.3199 0.3436 0.3521 0.0365  -0.0843 -0.0309 30   GLU A O     
254  C CB    . GLU A 30  ? 0.3591 0.3558 0.3471 0.0370  -0.0853 -0.0235 30   GLU A CB    
255  C CG    . GLU A 30  ? 0.3938 0.3791 0.3660 0.0397  -0.0849 -0.0200 30   GLU A CG    
256  C CD    . GLU A 30  ? 0.4239 0.3924 0.3783 0.0449  -0.0945 -0.0204 30   GLU A CD    
257  O OE1   . GLU A 30  ? 0.4266 0.3906 0.3776 0.0461  -0.1010 -0.0226 30   GLU A OE1   
258  O OE2   . GLU A 30  ? 0.4475 0.4059 0.3901 0.0477  -0.0955 -0.0184 30   GLU A OE2   
259  N N     . VAL A 31  ? 0.3237 0.3457 0.3425 0.0323  -0.0695 -0.0230 31   VAL A N     
260  C CA    . VAL A 31  ? 0.2971 0.3267 0.3296 0.0332  -0.0687 -0.0250 31   VAL A CA    
261  C C     . VAL A 31  ? 0.3062 0.3274 0.3270 0.0362  -0.0697 -0.0222 31   VAL A C     
262  O O     . VAL A 31  ? 0.2855 0.3002 0.2924 0.0348  -0.0644 -0.0178 31   VAL A O     
263  C CB    . VAL A 31  ? 0.2960 0.3362 0.3395 0.0286  -0.0586 -0.0245 31   VAL A CB    
264  C CG1   . VAL A 31  ? 0.2925 0.3402 0.3505 0.0295  -0.0575 -0.0271 31   VAL A CG1   
265  C CG2   . VAL A 31  ? 0.3283 0.3749 0.3808 0.0252  -0.0565 -0.0268 31   VAL A CG2   
266  N N     . GLU A 32  ? 0.3087 0.3297 0.3357 0.0404  -0.0764 -0.0251 32   GLU A N     
267  C CA    . GLU A 32  ? 0.3254 0.3381 0.3421 0.0436  -0.0778 -0.0229 32   GLU A CA    
268  C C     . GLU A 32  ? 0.3027 0.3237 0.3284 0.0413  -0.0698 -0.0219 32   GLU A C     
269  O O     . GLU A 32  ? 0.2993 0.3248 0.3361 0.0436  -0.0719 -0.0245 32   GLU A O     
270  C CB    . GLU A 32  ? 0.3561 0.3638 0.3746 0.0496  -0.0893 -0.0266 32   GLU A CB    
271  C CG    . GLU A 32  ? 0.4072 0.4048 0.4150 0.0526  -0.0984 -0.0278 32   GLU A CG    
272  C CD    . GLU A 32  ? 0.4888 0.4800 0.4973 0.0593  -0.1110 -0.0318 32   GLU A CD    
273  O OE1   . GLU A 32  ? 0.5199 0.4994 0.5143 0.0629  -0.1135 -0.0296 32   GLU A OE1   
274  O OE2   . GLU A 32  ? 0.5192 0.5168 0.5425 0.0612  -0.1187 -0.0373 32   GLU A OE2   
275  N N     . TYR A 33  ? 0.2872 0.3096 0.3080 0.0370  -0.0608 -0.0183 33   TYR A N     
276  C CA    . TYR A 33  ? 0.2769 0.3067 0.3050 0.0343  -0.0529 -0.0174 33   TYR A CA    
277  C C     . TYR A 33  ? 0.2898 0.3143 0.3121 0.0365  -0.0527 -0.0157 33   TYR A C     
278  O O     . TYR A 33  ? 0.3040 0.3179 0.3107 0.0375  -0.0530 -0.0126 33   TYR A O     
279  C CB    . TYR A 33  ? 0.2693 0.2997 0.2914 0.0298  -0.0450 -0.0142 33   TYR A CB    
280  C CG    . TYR A 33  ? 0.2589 0.2953 0.2864 0.0272  -0.0374 -0.0133 33   TYR A CG    
281  C CD1   . TYR A 33  ? 0.2507 0.2964 0.2928 0.0257  -0.0344 -0.0161 33   TYR A CD1   
282  C CD2   . TYR A 33  ? 0.2523 0.2842 0.2699 0.0260  -0.0328 -0.0098 33   TYR A CD2   
283  C CE1   . TYR A 33  ? 0.2182 0.2672 0.2626 0.0236  -0.0275 -0.0152 33   TYR A CE1   
284  C CE2   . TYR A 33  ? 0.2188 0.2552 0.2404 0.0239  -0.0268 -0.0092 33   TYR A CE2   
285  C CZ    . TYR A 33  ? 0.2290 0.2732 0.2629 0.0229  -0.0243 -0.0117 33   TYR A CZ    
286  O OH    . TYR A 33  ? 0.2034 0.2500 0.2389 0.0211  -0.0185 -0.0111 33   TYR A OH    
287  N N     . LYS A 34  ? 0.2913 0.3229 0.3263 0.0373  -0.0517 -0.0180 34   LYS A N     
288  C CA    . LYS A 34  ? 0.2797 0.3075 0.3109 0.0393  -0.0511 -0.0166 34   LYS A CA    
289  C C     . LYS A 34  ? 0.2416 0.2733 0.2733 0.0355  -0.0420 -0.0144 34   LYS A C     
290  O O     . LYS A 34  ? 0.2491 0.2896 0.2930 0.0336  -0.0378 -0.0163 34   LYS A O     
291  C CB    . LYS A 34  ? 0.2892 0.3214 0.3338 0.0430  -0.0562 -0.0209 34   LYS A CB    
292  C CG    . LYS A 34  ? 0.3416 0.3709 0.3884 0.0471  -0.0665 -0.0242 34   LYS A CG    
293  C CD    . LYS A 34  ? 0.4515 0.4755 0.4983 0.0528  -0.0742 -0.0261 34   LYS A CD    
294  C CE    . LYS A 34  ? 0.4867 0.5219 0.5543 0.0538  -0.0735 -0.0306 34   LYS A CE    
295  N NZ    . LYS A 34  ? 0.5205 0.5531 0.5940 0.0602  -0.0844 -0.0348 34   LYS A NZ    
296  N N     . PRO A 35  ? 0.2586 0.2830 0.2768 0.0343  -0.0388 -0.0106 35   PRO A N     
297  C CA    . PRO A 35  ? 0.2423 0.2699 0.2609 0.0310  -0.0312 -0.0089 35   PRO A CA    
298  C C     . PRO A 35  ? 0.2375 0.2663 0.2602 0.0323  -0.0297 -0.0094 35   PRO A C     
299  O O     . PRO A 35  ? 0.2296 0.2542 0.2513 0.0358  -0.0343 -0.0101 35   PRO A O     
300  C CB    . PRO A 35  ? 0.2645 0.2838 0.2688 0.0296  -0.0291 -0.0055 35   PRO A CB    
301  C CG    . PRO A 35  ? 0.2786 0.2877 0.2731 0.0330  -0.0347 -0.0049 35   PRO A CG    
302  C CD    . PRO A 35  ? 0.2730 0.2851 0.2752 0.0361  -0.0418 -0.0081 35   PRO A CD    
303  N N     . SER A 36  ? 0.2061 0.2395 0.2326 0.0297  -0.0238 -0.0091 36   SER A N     
304  C CA    . SER A 36  ? 0.2224 0.2555 0.2504 0.0305  -0.0215 -0.0091 36   SER A CA    
305  C C     . SER A 36  ? 0.2192 0.2483 0.2386 0.0283  -0.0173 -0.0064 36   SER A C     
306  O O     . SER A 36  ? 0.2177 0.2479 0.2345 0.0256  -0.0144 -0.0054 36   SER A O     
307  C CB    . SER A 36  ? 0.2209 0.2617 0.2609 0.0297  -0.0181 -0.0118 36   SER A CB    
308  O OG    . SER A 36  ? 0.2377 0.2829 0.2887 0.0319  -0.0217 -0.0151 36   SER A OG    
309  N N     . LEU A 37  ? 0.2222 0.2467 0.2378 0.0296  -0.0174 -0.0056 37   LEU A N     
310  C CA    . LEU A 37  ? 0.2055 0.2272 0.2159 0.0276  -0.0134 -0.0040 37   LEU A CA    
311  C C     . LEU A 37  ? 0.1974 0.2199 0.2116 0.0288  -0.0121 -0.0050 37   LEU A C     
312  O O     . LEU A 37  ? 0.2526 0.2780 0.2737 0.0310  -0.0138 -0.0069 37   LEU A O     
313  C CB    . LEU A 37  ? 0.2113 0.2245 0.2112 0.0274  -0.0138 -0.0018 37   LEU A CB    
314  C CG    . LEU A 37  ? 0.1921 0.2033 0.1869 0.0260  -0.0141 -0.0008 37   LEU A CG    
315  C CD1   . LEU A 37  ? 0.2680 0.2686 0.2516 0.0265  -0.0144 0.0009  37   LEU A CD1   
316  C CD2   . LEU A 37  ? 0.2324 0.2483 0.2294 0.0228  -0.0102 -0.0007 37   LEU A CD2   
317  N N     . PHE A 38  ? 0.1986 0.2185 0.2091 0.0274  -0.0091 -0.0041 38   PHE A N     
318  C CA    . PHE A 38  ? 0.2181 0.2389 0.2318 0.0281  -0.0073 -0.0051 38   PHE A CA    
319  C C     . PHE A 38  ? 0.2387 0.2531 0.2465 0.0281  -0.0067 -0.0040 38   PHE A C     
320  O O     . PHE A 38  ? 0.2269 0.2377 0.2293 0.0263  -0.0057 -0.0027 38   PHE A O     
321  C CB    . PHE A 38  ? 0.2114 0.2361 0.2276 0.0260  -0.0037 -0.0060 38   PHE A CB    
322  C CG    . PHE A 38  ? 0.2218 0.2520 0.2439 0.0256  -0.0032 -0.0073 38   PHE A CG    
323  C CD1   . PHE A 38  ? 0.2281 0.2597 0.2489 0.0242  -0.0039 -0.0066 38   PHE A CD1   
324  C CD2   . PHE A 38  ? 0.2194 0.2528 0.2485 0.0266  -0.0015 -0.0094 38   PHE A CD2   
325  C CE1   . PHE A 38  ? 0.2465 0.2828 0.2729 0.0236  -0.0032 -0.0080 38   PHE A CE1   
326  C CE2   . PHE A 38  ? 0.2504 0.2885 0.2858 0.0258  -0.0001 -0.0111 38   PHE A CE2   
327  C CZ    . PHE A 38  ? 0.2356 0.2751 0.2695 0.0242  -0.0011 -0.0103 38   PHE A CZ    
328  N N     . ALA A 39  ? 0.2407 0.2539 0.2503 0.0300  -0.0068 -0.0049 39   ALA A N     
329  C CA    . ALA A 39  ? 0.2533 0.2609 0.2583 0.0298  -0.0056 -0.0043 39   ALA A CA    
330  C C     . ALA A 39  ? 0.2733 0.2830 0.2818 0.0299  -0.0034 -0.0058 39   ALA A C     
331  O O     . ALA A 39  ? 0.2850 0.2989 0.2993 0.0312  -0.0029 -0.0073 39   ALA A O     
332  C CB    . ALA A 39  ? 0.2601 0.2611 0.2610 0.0325  -0.0083 -0.0036 39   ALA A CB    
333  N N     . HIS A 40  ? 0.2650 0.2711 0.2702 0.0286  -0.0017 -0.0056 40   HIS A N     
334  C CA    . HIS A 40  ? 0.2818 0.2878 0.2883 0.0292  0.0000  -0.0071 40   HIS A CA    
335  C C     . HIS A 40  ? 0.2937 0.2981 0.3023 0.0322  -0.0009 -0.0077 40   HIS A C     
336  O O     . HIS A 40  ? 0.2992 0.3001 0.3057 0.0338  -0.0032 -0.0068 40   HIS A O     
337  C CB    . HIS A 40  ? 0.2750 0.2769 0.2777 0.0274  0.0009  -0.0072 40   HIS A CB    
338  C CG    . HIS A 40  ? 0.2794 0.2833 0.2817 0.0250  0.0014  -0.0076 40   HIS A CG    
339  N ND1   . HIS A 40  ? 0.3062 0.3086 0.3074 0.0228  0.0012  -0.0073 40   HIS A ND1   
340  C CD2   . HIS A 40  ? 0.2858 0.2924 0.2885 0.0245  0.0021  -0.0084 40   HIS A CD2   
341  C CE1   . HIS A 40  ? 0.2825 0.2874 0.2844 0.0215  0.0010  -0.0081 40   HIS A CE1   
342  N NE2   . HIS A 40  ? 0.2850 0.2917 0.2867 0.0226  0.0014  -0.0087 40   HIS A NE2   
343  N N     . CYS A 41  ? 0.3172 0.3237 0.3295 0.0332  0.0010  -0.0094 41   CYS A N     
344  C CA    . CYS A 41  ? 0.3519 0.3578 0.3681 0.0363  0.0004  -0.0106 41   CYS A CA    
345  C C     . CYS A 41  ? 0.3837 0.3867 0.3985 0.0366  0.0033  -0.0118 41   CYS A C     
346  O O     . CYS A 41  ? 0.3758 0.3776 0.3868 0.0345  0.0054  -0.0120 41   CYS A O     
347  C CB    . CYS A 41  ? 0.3418 0.3540 0.3668 0.0378  0.0001  -0.0123 41   CYS A CB    
348  S SG    . CYS A 41  ? 0.3713 0.3880 0.4003 0.0358  0.0054  -0.0141 41   CYS A SG    
349  N N     . PRO A 42  ? 0.4340 0.4352 0.4513 0.0394  0.0030  -0.0129 42   PRO A N     
350  C CA    . PRO A 42  ? 0.4735 0.4713 0.4889 0.0398  0.0060  -0.0142 42   PRO A CA    
351  C C     . PRO A 42  ? 0.5196 0.5196 0.5372 0.0389  0.0106  -0.0160 42   PRO A C     
352  O O     . PRO A 42  ? 0.5001 0.5056 0.5244 0.0389  0.0117  -0.0170 42   PRO A O     
353  C CB    . PRO A 42  ? 0.4673 0.4638 0.4868 0.0434  0.0046  -0.0153 42   PRO A CB    
354  C CG    . PRO A 42  ? 0.4766 0.4725 0.4957 0.0447  0.0000  -0.0138 42   PRO A CG    
355  C CD    . PRO A 42  ? 0.4373 0.4382 0.4580 0.0426  -0.0005 -0.0131 42   PRO A CD    
356  N N     . GLU A 43  ? 0.5844 0.5792 0.5957 0.0381  0.0131  -0.0165 43   GLU A N     
357  C CA    . GLU A 43  ? 0.6497 0.6432 0.6592 0.0372  0.0180  -0.0181 43   GLU A CA    
358  C C     . GLU A 43  ? 0.6751 0.6710 0.6927 0.0391  0.0220  -0.0205 43   GLU A C     
359  O O     . GLU A 43  ? 0.6919 0.6883 0.7110 0.0382  0.0269  -0.0219 43   GLU A O     
360  C CB    . GLU A 43  ? 0.6808 0.6662 0.6800 0.0366  0.0188  -0.0183 43   GLU A CB    
361  C CG    . GLU A 43  ? 0.7264 0.7076 0.7186 0.0353  0.0224  -0.0191 43   GLU A CG    
362  C CD    . GLU A 43  ? 0.7630 0.7454 0.7517 0.0332  0.0197  -0.0178 43   GLU A CD    
363  O OE1   . GLU A 43  ? 0.7626 0.7459 0.7508 0.0323  0.0225  -0.0181 43   GLU A OE1   
364  O OE2   . GLU A 43  ? 0.7814 0.7637 0.7683 0.0325  0.0153  -0.0168 43   GLU A OE2   
365  N N     . SER A 44  ? 0.6940 0.6908 0.7171 0.0418  0.0202  -0.0211 44   SER A N     
366  C CA    . SER A 44  ? 0.7114 0.7112 0.7446 0.0441  0.0233  -0.0240 44   SER A CA    
367  C C     . SER A 44  ? 0.7072 0.7157 0.7527 0.0446  0.0222  -0.0253 44   SER A C     
368  O O     . SER A 44  ? 0.7184 0.7310 0.7751 0.0459  0.0253  -0.0285 44   SER A O     
369  C CB    . SER A 44  ? 0.7186 0.7158 0.7532 0.0473  0.0208  -0.0245 44   SER A CB    
370  O OG    . SER A 44  ? 0.7301 0.7282 0.7648 0.0485  0.0142  -0.0226 44   SER A OG    
371  N N     . GLN A 45  ? 0.6952 0.7064 0.7392 0.0434  0.0178  -0.0232 45   GLN A N     
372  C CA    . GLN A 45  ? 0.6782 0.6970 0.7326 0.0438  0.0157  -0.0243 45   GLN A CA    
373  C C     . GLN A 45  ? 0.6603 0.6819 0.7163 0.0407  0.0207  -0.0251 45   GLN A C     
374  O O     . GLN A 45  ? 0.6529 0.6714 0.6991 0.0381  0.0214  -0.0229 45   GLN A O     
375  C CB    . GLN A 45  ? 0.6797 0.6986 0.7304 0.0442  0.0087  -0.0216 45   GLN A CB    
376  C CG    . GLN A 45  ? 0.7006 0.7260 0.7610 0.0453  0.0051  -0.0229 45   GLN A CG    
377  C CD    . GLN A 45  ? 0.7295 0.7525 0.7836 0.0460  -0.0014 -0.0202 45   GLN A CD    
378  O OE1   . GLN A 45  ? 0.7427 0.7600 0.7908 0.0480  -0.0048 -0.0188 45   GLN A OE1   
379  N NE2   . GLN A 45  ? 0.7327 0.7590 0.7873 0.0443  -0.0028 -0.0195 45   GLN A NE2   
380  N N     . ALA A 46  ? 0.6413 0.6684 0.7100 0.0412  0.0242  -0.0285 46   ALA A N     
381  C CA    . ALA A 46  ? 0.6122 0.6412 0.6834 0.0381  0.0300  -0.0298 46   ALA A CA    
382  C C     . ALA A 46  ? 0.5798 0.6133 0.6517 0.0367  0.0259  -0.0283 46   ALA A C     
383  O O     . ALA A 46  ? 0.5799 0.6190 0.6605 0.0385  0.0203  -0.0290 46   ALA A O     
384  C CB    . ALA A 46  ? 0.6267 0.6606 0.7135 0.0388  0.0356  -0.0346 46   ALA A CB    
385  N N     . THR A 47  ? 0.5331 0.5630 0.5947 0.0336  0.0282  -0.0262 47   THR A N     
386  C CA    . THR A 47  ? 0.4816 0.5148 0.5426 0.0320  0.0251  -0.0247 47   THR A CA    
387  C C     . THR A 47  ? 0.4518 0.4818 0.5065 0.0287  0.0309  -0.0244 47   THR A C     
388  O O     . THR A 47  ? 0.4441 0.4671 0.4905 0.0279  0.0361  -0.0246 47   THR A O     
389  C CB    . THR A 47  ? 0.4761 0.5071 0.5278 0.0324  0.0183  -0.0210 47   THR A CB    
390  O OG1   . THR A 47  ? 0.4497 0.4839 0.5014 0.0309  0.0155  -0.0198 47   THR A OG1   
391  C CG2   . THR A 47  ? 0.4776 0.5011 0.5160 0.0313  0.0197  -0.0190 47   THR A CG2   
392  N N     . LYS A 48  ? 0.3971 0.4311 0.4547 0.0271  0.0298  -0.0242 48   LYS A N     
393  C CA    . LYS A 48  ? 0.3870 0.4169 0.4368 0.0241  0.0343  -0.0235 48   LYS A CA    
394  C C     . LYS A 48  ? 0.3527 0.3803 0.3916 0.0234  0.0293  -0.0201 48   LYS A C     
395  O O     . LYS A 48  ? 0.3331 0.3563 0.3637 0.0215  0.0317  -0.0192 48   LYS A O     
396  C CB    . LYS A 48  ? 0.3976 0.4327 0.4584 0.0223  0.0382  -0.0262 48   LYS A CB    
397  C CG    . LYS A 48  ? 0.3917 0.4345 0.4604 0.0225  0.0321  -0.0260 48   LYS A CG    
398  C CD    . LYS A 48  ? 0.4220 0.4695 0.5022 0.0204  0.0365  -0.0293 48   LYS A CD    
399  C CE    . LYS A 48  ? 0.4335 0.4879 0.5208 0.0207  0.0299  -0.0293 48   LYS A CE    
400  N NZ    . LYS A 48  ? 0.4350 0.4950 0.5365 0.0188  0.0336  -0.0333 48   LYS A NZ    
401  N N     . TYR A 49  ? 0.3053 0.3351 0.3442 0.0249  0.0228  -0.0183 49   TYR A N     
402  C CA    . TYR A 49  ? 0.2943 0.3225 0.3248 0.0241  0.0186  -0.0155 49   TYR A CA    
403  C C     . TYR A 49  ? 0.2883 0.3103 0.3092 0.0247  0.0174  -0.0142 49   TYR A C     
404  O O     . TYR A 49  ? 0.2908 0.3118 0.3128 0.0264  0.0162  -0.0144 49   TYR A O     
405  C CB    . TYR A 49  ? 0.2755 0.3085 0.3107 0.0250  0.0128  -0.0145 49   TYR A CB    
406  C CG    . TYR A 49  ? 0.2553 0.2945 0.3009 0.0250  0.0125  -0.0164 49   TYR A CG    
407  C CD1   . TYR A 49  ? 0.2740 0.3172 0.3298 0.0274  0.0102  -0.0185 49   TYR A CD1   
408  C CD2   . TYR A 49  ? 0.2578 0.2988 0.3036 0.0228  0.0139  -0.0164 49   TYR A CD2   
409  C CE1   . TYR A 49  ? 0.2863 0.3355 0.3531 0.0276  0.0090  -0.0208 49   TYR A CE1   
410  C CE2   . TYR A 49  ? 0.2814 0.3282 0.3377 0.0227  0.0134  -0.0186 49   TYR A CE2   
411  C CZ    . TYR A 49  ? 0.2978 0.3489 0.3651 0.0251  0.0108  -0.0209 49   TYR A CZ    
412  O OH    . TYR A 49  ? 0.3704 0.4275 0.4496 0.0251  0.0094  -0.0237 49   TYR A OH    
413  N N     . PHE A 50  ? 0.2739 0.2916 0.2859 0.0234  0.0173  -0.0131 50   PHE A N     
414  C CA    . PHE A 50  ? 0.2864 0.2985 0.2903 0.0238  0.0155  -0.0125 50   PHE A CA    
415  C C     . PHE A 50  ? 0.2622 0.2746 0.2626 0.0227  0.0117  -0.0111 50   PHE A C     
416  O O     . PHE A 50  ? 0.2741 0.2882 0.2742 0.0216  0.0120  -0.0108 50   PHE A O     
417  C CB    . PHE A 50  ? 0.3079 0.3122 0.3035 0.0238  0.0193  -0.0136 50   PHE A CB    
418  C CG    . PHE A 50  ? 0.3452 0.3483 0.3441 0.0248  0.0240  -0.0153 50   PHE A CG    
419  C CD1   . PHE A 50  ? 0.3781 0.3833 0.3826 0.0240  0.0291  -0.0168 50   PHE A CD1   
420  C CD2   . PHE A 50  ? 0.3607 0.3605 0.3580 0.0263  0.0235  -0.0157 50   PHE A CD2   
421  C CE1   . PHE A 50  ? 0.3908 0.3953 0.4002 0.0248  0.0341  -0.0189 50   PHE A CE1   
422  C CE2   . PHE A 50  ? 0.3891 0.3878 0.3899 0.0273  0.0281  -0.0175 50   PHE A CE2   
423  C CZ    . PHE A 50  ? 0.3838 0.3851 0.3911 0.0266  0.0335  -0.0192 50   PHE A CZ    
424  N N     . ASP A 51  ? 0.2595 0.2705 0.2581 0.0230  0.0086  -0.0106 51   ASP A N     
425  C CA    . ASP A 51  ? 0.2454 0.2565 0.2419 0.0219  0.0056  -0.0100 51   ASP A CA    
426  C C     . ASP A 51  ? 0.2626 0.2681 0.2516 0.0220  0.0055  -0.0111 51   ASP A C     
427  O O     . ASP A 51  ? 0.2740 0.2743 0.2578 0.0227  0.0080  -0.0119 51   ASP A O     
428  C CB    . ASP A 51  ? 0.2601 0.2714 0.2585 0.0218  0.0031  -0.0096 51   ASP A CB    
429  C CG    . ASP A 51  ? 0.2930 0.2992 0.2881 0.0224  0.0023  -0.0109 51   ASP A CG    
430  O OD1   . ASP A 51  ? 0.2850 0.2866 0.2747 0.0232  0.0030  -0.0121 51   ASP A OD1   
431  O OD2   . ASP A 51  ? 0.3306 0.3366 0.3278 0.0221  0.0011  -0.0108 51   ASP A OD2   
432  N N     . ILE A 52  ? 0.2479 0.2533 0.2356 0.0214  0.0025  -0.0112 52   ILE A N     
433  C CA    . ILE A 52  ? 0.2702 0.2697 0.2502 0.0219  0.0013  -0.0124 52   ILE A CA    
434  C C     . ILE A 52  ? 0.2920 0.2841 0.2657 0.0234  -0.0002 -0.0140 52   ILE A C     
435  O O     . ILE A 52  ? 0.3083 0.2926 0.2727 0.0245  -0.0009 -0.0151 52   ILE A O     
436  C CB    . ILE A 52  ? 0.2657 0.2673 0.2472 0.0213  -0.0020 -0.0126 52   ILE A CB    
437  C CG1   . ILE A 52  ? 0.2513 0.2555 0.2387 0.0209  -0.0050 -0.0135 52   ILE A CG1   
438  C CG2   . ILE A 52  ? 0.2601 0.2674 0.2455 0.0200  -0.0003 -0.0110 52   ILE A CG2   
439  C CD1   . ILE A 52  ? 0.2830 0.2889 0.2730 0.0204  -0.0082 -0.0147 52   ILE A CD1   
440  N N     . TYR A 53  ? 0.2866 0.2799 0.2642 0.0235  -0.0007 -0.0143 53   TYR A N     
441  C CA    . TYR A 53  ? 0.3031 0.2896 0.2755 0.0249  -0.0023 -0.0159 53   TYR A CA    
442  C C     . TYR A 53  ? 0.3330 0.3155 0.3015 0.0258  0.0019  -0.0157 53   TYR A C     
443  O O     . TYR A 53  ? 0.3319 0.3083 0.2955 0.0269  0.0012  -0.0170 53   TYR A O     
444  C CB    . TYR A 53  ? 0.3260 0.3155 0.3052 0.0242  -0.0050 -0.0167 53   TYR A CB    
445  C CG    . TYR A 53  ? 0.3252 0.3192 0.3103 0.0230  -0.0078 -0.0172 53   TYR A CG    
446  C CD1   . TYR A 53  ? 0.3215 0.3222 0.3141 0.0213  -0.0062 -0.0156 53   TYR A CD1   
447  C CD2   . TYR A 53  ? 0.3198 0.3108 0.3026 0.0237  -0.0121 -0.0195 53   TYR A CD2   
448  C CE1   . TYR A 53  ? 0.3310 0.3352 0.3289 0.0199  -0.0079 -0.0163 53   TYR A CE1   
449  C CE2   . TYR A 53  ? 0.3267 0.3224 0.3166 0.0226  -0.0144 -0.0205 53   TYR A CE2   
450  C CZ    . TYR A 53  ? 0.3151 0.3175 0.3126 0.0205  -0.0117 -0.0188 53   TYR A CZ    
451  O OH    . TYR A 53  ? 0.3297 0.3361 0.3340 0.0193  -0.0130 -0.0199 53   TYR A OH    
452  N N     . GLY A 54  ? 0.3226 0.3088 0.2941 0.0252  0.0062  -0.0145 54   GLY A N     
453  C CA    . GLY A 54  ? 0.3225 0.3060 0.2926 0.0259  0.0111  -0.0148 54   GLY A CA    
454  C C     . GLY A 54  ? 0.3266 0.3145 0.3044 0.0264  0.0116  -0.0146 54   GLY A C     
455  O O     . GLY A 54  ? 0.3416 0.3270 0.3190 0.0273  0.0152  -0.0153 54   GLY A O     
456  N N     . LYS A 55  ? 0.2931 0.2865 0.2773 0.0259  0.0084  -0.0136 55   LYS A N     
457  C CA    . LYS A 55  ? 0.3090 0.3052 0.2989 0.0266  0.0085  -0.0132 55   LYS A CA    
458  C C     . LYS A 55  ? 0.2876 0.2901 0.2849 0.0268  0.0101  -0.0125 55   LYS A C     
459  O O     . LYS A 55  ? 0.2764 0.2829 0.2760 0.0257  0.0094  -0.0117 55   LYS A O     
460  C CB    . LYS A 55  ? 0.3405 0.3374 0.3323 0.0259  0.0050  -0.0127 55   LYS A CB    
461  C CG    . LYS A 55  ? 0.4176 0.4097 0.4047 0.0255  0.0024  -0.0141 55   LYS A CG    
462  C CD    . LYS A 55  ? 0.5195 0.5092 0.5077 0.0256  0.0011  -0.0148 55   LYS A CD    
463  C CE    . LYS A 55  ? 0.5641 0.5479 0.5475 0.0272  0.0024  -0.0159 55   LYS A CE    
464  N NZ    . LYS A 55  ? 0.6090 0.5894 0.5925 0.0271  0.0006  -0.0169 55   LYS A NZ    
465  N N     . PRO A 56  ? 0.2819 0.2850 0.2832 0.0283  0.0120  -0.0132 56   PRO A N     
466  C CA    . PRO A 56  ? 0.2743 0.2833 0.2840 0.0289  0.0130  -0.0134 56   PRO A CA    
467  C C     . PRO A 56  ? 0.2705 0.2835 0.2841 0.0291  0.0090  -0.0120 56   PRO A C     
468  O O     . PRO A 56  ? 0.2612 0.2717 0.2720 0.0293  0.0065  -0.0109 56   PRO A O     
469  C CB    . PRO A 56  ? 0.2817 0.2897 0.2950 0.0309  0.0155  -0.0150 56   PRO A CB    
470  C CG    . PRO A 56  ? 0.2953 0.2976 0.3026 0.0315  0.0142  -0.0147 56   PRO A CG    
471  C CD    . PRO A 56  ? 0.3004 0.2988 0.2996 0.0297  0.0130  -0.0141 56   PRO A CD    
472  N N     . CYS A 57  ? 0.2562 0.2744 0.2754 0.0290  0.0086  -0.0121 57   CYS A N     
473  C CA    . CYS A 57  ? 0.2697 0.2902 0.2908 0.0294  0.0047  -0.0108 57   CYS A CA    
474  C C     . CYS A 57  ? 0.2723 0.2972 0.3022 0.0314  0.0035  -0.0122 57   CYS A C     
475  O O     . CYS A 57  ? 0.2811 0.3095 0.3172 0.0313  0.0064  -0.0142 57   CYS A O     
476  C CB    . CYS A 57  ? 0.2877 0.3097 0.3063 0.0272  0.0040  -0.0096 57   CYS A CB    
477  S SG    . CYS A 57  ? 0.3201 0.3379 0.3309 0.0252  0.0036  -0.0084 57   CYS A SG    
478  N N     . THR A 58  ? 0.2518 0.2757 0.2818 0.0332  -0.0008 -0.0114 58   THR A N     
479  C CA    . THR A 58  ? 0.2730 0.3008 0.3112 0.0356  -0.0038 -0.0131 58   THR A CA    
480  C C     . THR A 58  ? 0.2606 0.2900 0.2977 0.0347  -0.0067 -0.0121 58   THR A C     
481  O O     . THR A 58  ? 0.2393 0.2647 0.2680 0.0335  -0.0079 -0.0096 58   THR A O     
482  C CB    . THR A 58  ? 0.3132 0.3375 0.3518 0.0392  -0.0076 -0.0135 58   THR A CB    
483  O OG1   . THR A 58  ? 0.3781 0.4063 0.4256 0.0420  -0.0116 -0.0157 58   THR A OG1   
484  C CG2   . THR A 58  ? 0.3346 0.3515 0.3623 0.0393  -0.0104 -0.0106 58   THR A CG2   
485  N N     . ARG A 59  ? 0.2398 0.2749 0.2858 0.0350  -0.0074 -0.0142 59   ARG A N     
486  C CA    . ARG A 59  ? 0.2499 0.2864 0.2952 0.0344  -0.0105 -0.0136 59   ARG A CA    
487  C C     . ARG A 59  ? 0.2676 0.3010 0.3121 0.0379  -0.0173 -0.0137 59   ARG A C     
488  O O     . ARG A 59  ? 0.2745 0.3093 0.3264 0.0411  -0.0200 -0.0162 59   ARG A O     
489  C CB    . ARG A 59  ? 0.2501 0.2935 0.3052 0.0330  -0.0083 -0.0161 59   ARG A CB    
490  C CG    . ARG A 59  ? 0.2551 0.2998 0.3090 0.0320  -0.0112 -0.0155 59   ARG A CG    
491  C CD    . ARG A 59  ? 0.2660 0.3164 0.3273 0.0294  -0.0073 -0.0174 59   ARG A CD    
492  N NE    . ARG A 59  ? 0.2773 0.3335 0.3531 0.0306  -0.0069 -0.0216 59   ARG A NE    
493  C CZ    . ARG A 59  ? 0.2844 0.3446 0.3696 0.0323  -0.0118 -0.0243 59   ARG A CZ    
494  N NH1   . ARG A 59  ? 0.2432 0.3011 0.3227 0.0331  -0.0176 -0.0228 59   ARG A NH1   
495  N NH2   . ARG A 59  ? 0.3075 0.3736 0.4080 0.0333  -0.0109 -0.0287 59   ARG A NH2   
496  N N     . LYS A 60  ? 0.2710 0.2994 0.3059 0.0375  -0.0199 -0.0113 60   LYS A N     
497  C CA    . LYS A 60  ? 0.3188 0.3415 0.3493 0.0408  -0.0265 -0.0112 60   LYS A CA    
498  C C     . LYS A 60  ? 0.3231 0.3479 0.3548 0.0405  -0.0297 -0.0118 60   LYS A C     
499  O O     . LYS A 60  ? 0.2929 0.3169 0.3187 0.0376  -0.0274 -0.0098 60   LYS A O     
500  C CB    . LYS A 60  ? 0.3369 0.3492 0.3530 0.0407  -0.0265 -0.0079 60   LYS A CB    
501  C CG    . LYS A 60  ? 0.4213 0.4305 0.4360 0.0415  -0.0243 -0.0076 60   LYS A CG    
502  C CD    . LYS A 60  ? 0.4932 0.4909 0.4943 0.0418  -0.0247 -0.0049 60   LYS A CD    
503  C CE    . LYS A 60  ? 0.5558 0.5509 0.5559 0.0420  -0.0220 -0.0047 60   LYS A CE    
504  N NZ    . LYS A 60  ? 0.5845 0.5788 0.5893 0.0464  -0.0259 -0.0067 60   LYS A NZ    
505  N N     . LEU A 61  ? 0.3346 0.3620 0.3747 0.0437  -0.0353 -0.0148 61   LEU A N     
506  C CA    . LEU A 61  ? 0.3636 0.3930 0.4061 0.0438  -0.0393 -0.0161 61   LEU A CA    
507  C C     . LEU A 61  ? 0.3568 0.3754 0.3873 0.0474  -0.0467 -0.0150 61   LEU A C     
508  O O     . LEU A 61  ? 0.3759 0.3897 0.4055 0.0517  -0.0519 -0.0161 61   LEU A O     
509  C CB    . LEU A 61  ? 0.3768 0.4162 0.4377 0.0449  -0.0409 -0.0210 61   LEU A CB    
510  C CG    . LEU A 61  ? 0.4273 0.4719 0.4959 0.0442  -0.0436 -0.0235 61   LEU A CG    
511  C CD1   . LEU A 61  ? 0.4746 0.5160 0.5452 0.0491  -0.0540 -0.0262 61   LEU A CD1   
512  C CD2   . LEU A 61  ? 0.3989 0.4416 0.4577 0.0403  -0.0405 -0.0203 61   LEU A CD2   
513  N N     . PHE A 62  ? 0.3323 0.3462 0.3525 0.0457  -0.0469 -0.0128 62   PHE A N     
514  C CA    . PHE A 62  ? 0.3398 0.3408 0.3450 0.0486  -0.0527 -0.0112 62   PHE A CA    
515  C C     . PHE A 62  ? 0.3453 0.3462 0.3533 0.0513  -0.0606 -0.0139 62   PHE A C     
516  O O     . PHE A 62  ? 0.3476 0.3580 0.3665 0.0492  -0.0597 -0.0159 62   PHE A O     
517  C CB    . PHE A 62  ? 0.3294 0.3227 0.3195 0.0452  -0.0474 -0.0071 62   PHE A CB    
518  C CG    . PHE A 62  ? 0.3137 0.3056 0.3007 0.0431  -0.0409 -0.0049 62   PHE A CG    
519  C CD1   . PHE A 62  ? 0.2902 0.2913 0.2849 0.0390  -0.0342 -0.0047 62   PHE A CD1   
520  C CD2   . PHE A 62  ? 0.3275 0.3082 0.3036 0.0453  -0.0419 -0.0034 62   PHE A CD2   
521  C CE1   . PHE A 62  ? 0.2960 0.2956 0.2883 0.0373  -0.0290 -0.0032 62   PHE A CE1   
522  C CE2   . PHE A 62  ? 0.3123 0.2918 0.2865 0.0431  -0.0359 -0.0018 62   PHE A CE2   
523  C CZ    . PHE A 62  ? 0.3011 0.2906 0.2840 0.0392  -0.0299 -0.0019 62   PHE A CZ    
524  N N     . ALA A 63  ? 0.3511 0.3403 0.3486 0.0561  -0.0685 -0.0142 63   ALA A N     
525  C CA    . ALA A 63  ? 0.3578 0.3446 0.3561 0.0595  -0.0777 -0.0170 63   ALA A CA    
526  C C     . ALA A 63  ? 0.3599 0.3445 0.3501 0.0563  -0.0758 -0.0152 63   ALA A C     
527  O O     . ALA A 63  ? 0.3610 0.3490 0.3573 0.0572  -0.0811 -0.0180 63   ALA A O     
528  C CB    . ALA A 63  ? 0.3717 0.3429 0.3559 0.0657  -0.0867 -0.0171 63   ALA A CB    
529  N N     . ASN A 64  ? 0.3533 0.3324 0.3308 0.0526  -0.0681 -0.0109 64   ASN A N     
530  C CA    . ASN A 64  ? 0.3468 0.3229 0.3157 0.0494  -0.0652 -0.0089 64   ASN A CA    
531  C C     . ASN A 64  ? 0.3413 0.3159 0.3030 0.0447  -0.0552 -0.0050 64   ASN A C     
532  O O     . ASN A 64  ? 0.3466 0.3204 0.3077 0.0442  -0.0512 -0.0037 64   ASN A O     
533  C CB    . ASN A 64  ? 0.3693 0.3294 0.3205 0.0531  -0.0725 -0.0084 64   ASN A CB    
534  C CG    . ASN A 64  ? 0.3939 0.3374 0.3276 0.0563  -0.0740 -0.0063 64   ASN A CG    
535  O OD1   . ASN A 64  ? 0.3823 0.3195 0.3057 0.0535  -0.0663 -0.0028 64   ASN A OD1   
536  N ND2   . ASN A 64  ? 0.4354 0.3715 0.3660 0.0623  -0.0840 -0.0086 64   ASN A ND2   
537  N N     . MET A 65  ? 0.3202 0.2944 0.2772 0.0415  -0.0515 -0.0036 65   MET A N     
538  C CA    . MET A 65  ? 0.3271 0.3020 0.2807 0.0370  -0.0424 -0.0009 65   MET A CA    
539  C C     . MET A 65  ? 0.3441 0.3046 0.2813 0.0371  -0.0393 0.0018  65   MET A C     
540  O O     . MET A 65  ? 0.3657 0.3276 0.3037 0.0343  -0.0326 0.0032  65   MET A O     
541  C CB    . MET A 65  ? 0.3280 0.3067 0.2822 0.0338  -0.0397 -0.0006 65   MET A CB    
542  C CG    . MET A 65  ? 0.2981 0.2920 0.2694 0.0322  -0.0394 -0.0029 65   MET A CG    
543  S SD    . MET A 65  ? 0.3101 0.3083 0.2821 0.0285  -0.0359 -0.0025 65   MET A SD    
544  C CE    . MET A 65  ? 0.3167 0.3080 0.2826 0.0315  -0.0444 -0.0041 65   MET A CE    
545  N N     . ARG A 66  ? 0.3794 0.3251 0.3013 0.0404  -0.0442 0.0023  66   ARG A N     
546  C CA    . ARG A 66  ? 0.4221 0.3515 0.3265 0.0406  -0.0409 0.0049  66   ARG A CA    
547  C C     . ARG A 66  ? 0.3945 0.3238 0.3019 0.0420  -0.0404 0.0049  66   ARG A C     
548  O O     . ARG A 66  ? 0.3710 0.2954 0.2732 0.0395  -0.0335 0.0067  66   ARG A O     
549  C CB    . ARG A 66  ? 0.4756 0.3867 0.3605 0.0443  -0.0465 0.0054  66   ARG A CB    
550  C CG    . ARG A 66  ? 0.5765 0.4820 0.4519 0.0418  -0.0429 0.0066  66   ARG A CG    
551  C CD    . ARG A 66  ? 0.6738 0.5652 0.5341 0.0461  -0.0514 0.0059  66   ARG A CD    
552  N NE    . ARG A 66  ? 0.7304 0.6157 0.5809 0.0437  -0.0477 0.0070  66   ARG A NE    
553  C CZ    . ARG A 66  ? 0.7602 0.6349 0.5986 0.0466  -0.0544 0.0063  66   ARG A CZ    
554  N NH1   . ARG A 66  ? 0.7805 0.6497 0.6157 0.0523  -0.0658 0.0042  66   ARG A NH1   
555  N NH2   . ARG A 66  ? 0.7824 0.6517 0.6120 0.0441  -0.0499 0.0073  66   ARG A NH2   
556  N N     . ASP A 67  ? 0.3892 0.3244 0.3061 0.0458  -0.0475 0.0026  67   ASP A N     
557  C CA    . ASP A 67  ? 0.3859 0.3225 0.3075 0.0473  -0.0473 0.0023  67   ASP A CA    
558  C C     . ASP A 67  ? 0.3602 0.3085 0.2932 0.0426  -0.0390 0.0028  67   ASP A C     
559  O O     . ASP A 67  ? 0.3368 0.2804 0.2659 0.0418  -0.0349 0.0041  67   ASP A O     
560  C CB    . ASP A 67  ? 0.3959 0.3397 0.3298 0.0518  -0.0559 -0.0010 67   ASP A CB    
561  C CG    . ASP A 67  ? 0.4654 0.3946 0.3866 0.0578  -0.0654 -0.0019 67   ASP A CG    
562  O OD1   . ASP A 67  ? 0.4880 0.3999 0.3887 0.0585  -0.0653 0.0004  67   ASP A OD1   
563  O OD2   . ASP A 67  ? 0.4697 0.4041 0.4015 0.0621  -0.0731 -0.0052 67   ASP A OD2   
564  N N     . ALA A 68  ? 0.3240 0.2862 0.2701 0.0398  -0.0368 0.0017  68   ALA A N     
565  C CA    . ALA A 68  ? 0.3119 0.2843 0.2677 0.0358  -0.0298 0.0020  68   ALA A CA    
566  C C     . ALA A 68  ? 0.3069 0.2725 0.2536 0.0323  -0.0229 0.0043  68   ALA A C     
567  O O     . ALA A 68  ? 0.2722 0.2389 0.2213 0.0305  -0.0184 0.0047  68   ALA A O     
568  C CB    . ALA A 68  ? 0.2947 0.2806 0.2633 0.0337  -0.0291 0.0005  68   ALA A CB    
569  N N     . SER A 69  ? 0.3417 0.3000 0.2786 0.0312  -0.0219 0.0054  69   SER A N     
570  C CA    . SER A 69  ? 0.3634 0.3142 0.2920 0.0279  -0.0147 0.0070  69   SER A CA    
571  C C     . SER A 69  ? 0.3805 0.3181 0.2981 0.0286  -0.0126 0.0083  69   SER A C     
572  O O     . SER A 69  ? 0.3888 0.3258 0.3076 0.0254  -0.0060 0.0087  69   SER A O     
573  C CB    . SER A 69  ? 0.3866 0.3307 0.3057 0.0270  -0.0140 0.0078  69   SER A CB    
574  O OG    . SER A 69  ? 0.4331 0.3896 0.3631 0.0248  -0.0131 0.0068  69   SER A OG    
575  N N     . GLN A 70  ? 0.3919 0.3190 0.2995 0.0330  -0.0184 0.0086  70   GLN A N     
576  C CA    A GLN A 70  ? 0.4083 0.3208 0.3035 0.0344  -0.0173 0.0098  70   GLN A CA    
577  C CA    B GLN A 70  ? 0.4055 0.3182 0.3008 0.0342  -0.0169 0.0098  70   GLN A CA    
578  C C     . GLN A 70  ? 0.3906 0.3109 0.2965 0.0339  -0.0157 0.0091  70   GLN A C     
579  O O     . GLN A 70  ? 0.3871 0.2996 0.2874 0.0324  -0.0107 0.0100  70   GLN A O     
580  C CB    A GLN A 70  ? 0.4309 0.3312 0.3140 0.0402  -0.0260 0.0098  70   GLN A CB    
581  C CB    B GLN A 70  ? 0.4261 0.3241 0.3066 0.0396  -0.0247 0.0102  70   GLN A CB    
582  C CG    A GLN A 70  ? 0.4899 0.3763 0.3563 0.0415  -0.0280 0.0108  70   GLN A CG    
583  C CG    B GLN A 70  ? 0.4736 0.3580 0.3376 0.0399  -0.0248 0.0113  70   GLN A CG    
584  C CD    A GLN A 70  ? 0.5280 0.4039 0.3844 0.0480  -0.0387 0.0100  70   GLN A CD    
585  C CD    B GLN A 70  ? 0.4908 0.3642 0.3437 0.0354  -0.0144 0.0132  70   GLN A CD    
586  O OE1   A GLN A 70  ? 0.5867 0.4551 0.4336 0.0501  -0.0435 0.0098  70   GLN A OE1   
587  O OE1   B GLN A 70  ? 0.5120 0.3753 0.3574 0.0345  -0.0096 0.0142  70   GLN A OE1   
588  N NE2   A GLN A 70  ? 0.5453 0.4201 0.4040 0.0515  -0.0430 0.0092  70   GLN A NE2   
589  N NE2   B GLN A 70  ? 0.4928 0.3678 0.3452 0.0324  -0.0105 0.0134  70   GLN A NE2   
590  N N     . TRP A 71  ? 0.3647 0.2998 0.2859 0.0352  -0.0197 0.0073  71   TRP A N     
591  C CA    . TRP A 71  ? 0.3427 0.2852 0.2740 0.0350  -0.0185 0.0064  71   TRP A CA    
592  C C     . TRP A 71  ? 0.3331 0.2811 0.2702 0.0301  -0.0108 0.0066  71   TRP A C     
593  O O     . TRP A 71  ? 0.3250 0.2705 0.2623 0.0292  -0.0078 0.0066  71   TRP A O     
594  C CB    . TRP A 71  ? 0.3409 0.2971 0.2868 0.0372  -0.0234 0.0042  71   TRP A CB    
595  C CG    . TRP A 71  ? 0.2975 0.2608 0.2531 0.0371  -0.0218 0.0031  71   TRP A CG    
596  C CD1   . TRP A 71  ? 0.3287 0.2868 0.2823 0.0401  -0.0240 0.0028  71   TRP A CD1   
597  C CD2   . TRP A 71  ? 0.2975 0.2729 0.2650 0.0341  -0.0178 0.0022  71   TRP A CD2   
598  N NE1   . TRP A 71  ? 0.3261 0.2929 0.2901 0.0389  -0.0213 0.0018  71   TRP A NE1   
599  C CE2   . TRP A 71  ? 0.2990 0.2758 0.2709 0.0353  -0.0175 0.0014  71   TRP A CE2   
600  C CE3   . TRP A 71  ? 0.2936 0.2775 0.2673 0.0307  -0.0147 0.0019  71   TRP A CE3   
601  C CZ2   . TRP A 71  ? 0.2742 0.2600 0.2555 0.0333  -0.0142 0.0003  71   TRP A CZ2   
602  C CZ3   . TRP A 71  ? 0.2775 0.2701 0.2602 0.0289  -0.0118 0.0008  71   TRP A CZ3   
603  C CH2   . TRP A 71  ? 0.2798 0.2729 0.2657 0.0302  -0.0116 0.0000  71   TRP A CH2   
604  N N     . ILE A 72  ? 0.3105 0.2655 0.2525 0.0271  -0.0082 0.0063  72   ILE A N     
605  C CA    . ILE A 72  ? 0.3148 0.2746 0.2626 0.0228  -0.0018 0.0059  72   ILE A CA    
606  C C     . ILE A 72  ? 0.3274 0.2748 0.2657 0.0207  0.0037  0.0069  72   ILE A C     
607  O O     . ILE A 72  ? 0.3320 0.2810 0.2752 0.0186  0.0074  0.0061  72   ILE A O     
608  C CB    . ILE A 72  ? 0.3099 0.2767 0.2621 0.0205  -0.0004 0.0055  72   ILE A CB    
609  C CG1   . ILE A 72  ? 0.2828 0.2624 0.2459 0.0215  -0.0042 0.0043  72   ILE A CG1   
610  C CG2   . ILE A 72  ? 0.3431 0.3120 0.2997 0.0163  0.0058  0.0048  72   ILE A CG2   
611  C CD1   . ILE A 72  ? 0.3258 0.3111 0.2919 0.0199  -0.0037 0.0040  72   ILE A CD1   
612  N N     . LYS A 73  ? 0.3725 0.3068 0.2969 0.0212  0.0045  0.0083  73   LYS A N     
613  C CA    . LYS A 73  ? 0.4165 0.3361 0.3295 0.0192  0.0107  0.0093  73   LYS A CA    
614  C C     . LYS A 73  ? 0.4045 0.3177 0.3143 0.0206  0.0106  0.0095  73   LYS A C     
615  O O     . LYS A 73  ? 0.4209 0.3312 0.3322 0.0174  0.0168  0.0090  73   LYS A O     
616  C CB    . LYS A 73  ? 0.4485 0.3523 0.3438 0.0205  0.0107  0.0110  73   LYS A CB    
617  C CG    . LYS A 73  ? 0.5130 0.4196 0.4088 0.0183  0.0130  0.0108  73   LYS A CG    
618  C CD    . LYS A 73  ? 0.6028 0.4919 0.4788 0.0203  0.0123  0.0125  73   LYS A CD    
619  C CE    . LYS A 73  ? 0.6261 0.5194 0.5030 0.0194  0.0119  0.0123  73   LYS A CE    
620  N NZ    . LYS A 73  ? 0.6647 0.5608 0.5472 0.0143  0.0210  0.0115  73   LYS A NZ    
621  N N     . ARG A 74  ? 0.4002 0.3112 0.3063 0.0253  0.0035  0.0100  74   ARG A N     
622  C CA    . ARG A 74  ? 0.4107 0.3157 0.3138 0.0272  0.0026  0.0101  74   ARG A CA    
623  C C     . ARG A 74  ? 0.3756 0.2934 0.2940 0.0251  0.0046  0.0085  74   ARG A C     
624  O O     . ARG A 74  ? 0.3709 0.2833 0.2876 0.0239  0.0082  0.0084  74   ARG A O     
625  C CB    . ARG A 74  ? 0.4237 0.3248 0.3216 0.0333  -0.0061 0.0103  74   ARG A CB    
626  C CG    . ARG A 74  ? 0.5106 0.3926 0.3883 0.0361  -0.0085 0.0120  74   ARG A CG    
627  C CD    . ARG A 74  ? 0.5742 0.4508 0.4469 0.0427  -0.0179 0.0116  74   ARG A CD    
628  N NE    . ARG A 74  ? 0.6037 0.4973 0.4927 0.0450  -0.0246 0.0095  74   ARG A NE    
629  C CZ    . ARG A 74  ? 0.6133 0.5094 0.5027 0.0473  -0.0305 0.0087  74   ARG A CZ    
630  N NH1   . ARG A 74  ? 0.6290 0.5111 0.5021 0.0479  -0.0312 0.0101  74   ARG A NH1   
631  N NH2   . ARG A 74  ? 0.5840 0.4960 0.4900 0.0488  -0.0353 0.0064  74   ARG A NH2   
632  N N     . MET A 75  ? 0.3353 0.2691 0.2676 0.0246  0.0026  0.0071  75   MET A N     
633  C CA    . MET A 75  ? 0.3314 0.2760 0.2765 0.0227  0.0044  0.0055  75   MET A CA    
634  C C     . MET A 75  ? 0.3595 0.3024 0.3067 0.0180  0.0114  0.0047  75   MET A C     
635  O O     . MET A 75  ? 0.3710 0.3148 0.3227 0.0168  0.0134  0.0036  75   MET A O     
636  C CB    . MET A 75  ? 0.3066 0.2660 0.2635 0.0231  0.0014  0.0042  75   MET A CB    
637  C CG    . MET A 75  ? 0.2865 0.2494 0.2456 0.0274  -0.0046 0.0039  75   MET A CG    
638  S SD    . MET A 75  ? 0.3388 0.3014 0.3010 0.0298  -0.0059 0.0031  75   MET A SD    
639  C CE    . MET A 75  ? 0.3445 0.3206 0.3198 0.0275  -0.0038 0.0012  75   MET A CE    
640  N N     . GLU A 76  ? 0.3953 0.3356 0.3398 0.0153  0.0152  0.0049  76   GLU A N     
641  C CA    . GLU A 76  ? 0.4251 0.3625 0.3720 0.0108  0.0225  0.0037  76   GLU A CA    
642  C C     . GLU A 76  ? 0.4344 0.3570 0.3711 0.0100  0.0267  0.0044  76   GLU A C     
643  O O     . GLU A 76  ? 0.4429 0.3656 0.3855 0.0072  0.0309  0.0027  76   GLU A O     
644  C CB    . GLU A 76  ? 0.4510 0.3874 0.3964 0.0084  0.0260  0.0037  76   GLU A CB    
645  C CG    . GLU A 76  ? 0.5311 0.4662 0.4823 0.0035  0.0340  0.0016  76   GLU A CG    
646  C CD    . GLU A 76  ? 0.6002 0.5326 0.5489 0.0012  0.0384  0.0015  76   GLU A CD    
647  O OE1   . GLU A 76  ? 0.6378 0.5614 0.5839 -0.0022 0.0463  0.0006  76   GLU A OE1   
648  O OE2   . GLU A 76  ? 0.6312 0.5699 0.5808 0.0028  0.0345  0.0021  76   GLU A OE2   
649  N N     . ASP A 77  ? 0.4307 0.3397 0.3516 0.0127  0.0253  0.0068  77   ASP A N     
650  C CA    . ASP A 77  ? 0.4621 0.3543 0.3700 0.0128  0.0287  0.0079  77   ASP A CA    
651  C C     . ASP A 77  ? 0.4539 0.3490 0.3674 0.0139  0.0268  0.0070  77   ASP A C     
652  O O     . ASP A 77  ? 0.4697 0.3567 0.3808 0.0114  0.0322  0.0065  77   ASP A O     
653  C CB    . ASP A 77  ? 0.4764 0.3536 0.3656 0.0172  0.0247  0.0104  77   ASP A CB    
654  C CG    . ASP A 77  ? 0.5081 0.3771 0.3871 0.0160  0.0276  0.0115  77   ASP A CG    
655  O OD1   . ASP A 77  ? 0.5049 0.3773 0.3900 0.0113  0.0346  0.0103  77   ASP A OD1   
656  O OD2   . ASP A 77  ? 0.5360 0.3946 0.4007 0.0200  0.0227  0.0132  77   ASP A OD2   
657  N N     . ILE A 78  ? 0.3936 0.3001 0.3148 0.0174  0.0197  0.0067  78   ILE A N     
658  C CA    . ILE A 78  ? 0.3867 0.2964 0.3132 0.0188  0.0175  0.0058  78   ILE A CA    
659  C C     . ILE A 78  ? 0.3846 0.3052 0.3256 0.0150  0.0208  0.0033  78   ILE A C     
660  O O     . ILE A 78  ? 0.4024 0.3204 0.3452 0.0140  0.0226  0.0023  78   ILE A O     
661  C CB    . ILE A 78  ? 0.3681 0.2854 0.2981 0.0240  0.0095  0.0060  78   ILE A CB    
662  C CG1   . ILE A 78  ? 0.4110 0.3164 0.3271 0.0285  0.0050  0.0078  78   ILE A CG1   
663  C CG2   . ILE A 78  ? 0.3489 0.2703 0.2853 0.0252  0.0080  0.0048  78   ILE A CG2   
664  C CD1   . ILE A 78  ? 0.4029 0.3169 0.3244 0.0331  -0.0028 0.0073  78   ILE A CD1   
665  N N     . GLY A 79  ? 0.3690 0.3008 0.3196 0.0130  0.0210  0.0020  79   GLY A N     
666  C CA    . GLY A 79  ? 0.3616 0.3033 0.3255 0.0099  0.0228  -0.0007 79   GLY A CA    
667  C C     . GLY A 79  ? 0.3573 0.3115 0.3299 0.0122  0.0174  -0.0016 79   GLY A C     
668  O O     . GLY A 79  ? 0.3387 0.2980 0.3189 0.0114  0.0171  -0.0037 79   GLY A O     
669  N N     . LEU A 80  ? 0.3258 0.2839 0.2966 0.0151  0.0133  -0.0002 80   LEU A N     
670  C CA    . LEU A 80  ? 0.3191 0.2877 0.2970 0.0173  0.0091  -0.0010 80   LEU A CA    
671  C C     . LEU A 80  ? 0.3076 0.2841 0.2896 0.0168  0.0079  -0.0011 80   LEU A C     
672  O O     . LEU A 80  ? 0.3262 0.2997 0.3034 0.0165  0.0084  0.0000  80   LEU A O     
673  C CB    . LEU A 80  ? 0.3142 0.2807 0.2882 0.0215  0.0052  0.0000  80   LEU A CB    
674  C CG    . LEU A 80  ? 0.3291 0.2889 0.2998 0.0228  0.0054  0.0000  80   LEU A CG    
675  C CD1   . LEU A 80  ? 0.3461 0.3028 0.3126 0.0274  0.0011  0.0009  80   LEU A CD1   
676  C CD2   . LEU A 80  ? 0.3128 0.2787 0.2912 0.0221  0.0056  -0.0020 80   LEU A CD2   
677  N N     . GLU A 81  ? 0.3049 0.2901 0.2942 0.0168  0.0064  -0.0026 81   GLU A N     
678  C CA    . GLU A 81  ? 0.3015 0.2939 0.2945 0.0164  0.0053  -0.0029 81   GLU A CA    
679  C C     . GLU A 81  ? 0.3007 0.2945 0.2912 0.0189  0.0026  -0.0015 81   GLU A C     
680  O O     . GLU A 81  ? 0.3146 0.3090 0.3055 0.0215  0.0005  -0.0014 81   GLU A O     
681  C CB    . GLU A 81  ? 0.3056 0.3045 0.3046 0.0162  0.0042  -0.0048 81   GLU A CB    
682  C CG    . GLU A 81  ? 0.3161 0.3209 0.3181 0.0155  0.0035  -0.0053 81   GLU A CG    
683  C CD    . GLU A 81  ? 0.3372 0.3456 0.3425 0.0157  0.0021  -0.0073 81   GLU A CD    
684  O OE1   . GLU A 81  ? 0.3546 0.3611 0.3600 0.0164  0.0017  -0.0084 81   GLU A OE1   
685  O OE2   . GLU A 81  ? 0.2885 0.3005 0.2952 0.0153  0.0013  -0.0078 81   GLU A OE2   
686  N N     . ALA A 82  ? 0.2780 0.2721 0.2667 0.0182  0.0027  -0.0006 82   ALA A N     
687  C CA    . ALA A 82  ? 0.2630 0.2597 0.2510 0.0203  -0.0002 0.0000  82   ALA A CA    
688  C C     . ALA A 82  ? 0.2496 0.2546 0.2434 0.0192  -0.0004 -0.0008 82   ALA A C     
689  O O     . ALA A 82  ? 0.2667 0.2727 0.2605 0.0173  0.0009  -0.0008 82   ALA A O     
690  C CB    . ALA A 82  ? 0.2803 0.2700 0.2605 0.0204  -0.0003 0.0015  82   ALA A CB    
691  N N     . LEU A 83  ? 0.2293 0.2393 0.2276 0.0206  -0.0016 -0.0018 83   LEU A N     
692  C CA    . LEU A 83  ? 0.2223 0.2382 0.2244 0.0197  -0.0012 -0.0027 83   LEU A CA    
693  C C     . LEU A 83  ? 0.2224 0.2418 0.2258 0.0201  -0.0026 -0.0025 83   LEU A C     
694  O O     . LEU A 83  ? 0.2276 0.2459 0.2305 0.0218  -0.0047 -0.0021 83   LEU A O     
695  C CB    . LEU A 83  ? 0.2264 0.2441 0.2312 0.0205  -0.0007 -0.0040 83   LEU A CB    
696  C CG    . LEU A 83  ? 0.2372 0.2519 0.2411 0.0200  0.0001  -0.0048 83   LEU A CG    
697  C CD1   . LEU A 83  ? 0.2681 0.2790 0.2708 0.0216  -0.0001 -0.0045 83   LEU A CD1   
698  C CD2   . LEU A 83  ? 0.2141 0.2301 0.2187 0.0201  0.0006  -0.0063 83   LEU A CD2   
699  N N     . GLY A 84  ? 0.2206 0.2435 0.2255 0.0188  -0.0017 -0.0029 84   GLY A N     
700  C CA    . GLY A 84  ? 0.2044 0.2307 0.2110 0.0188  -0.0026 -0.0030 84   GLY A CA    
701  C C     . GLY A 84  ? 0.2140 0.2397 0.2180 0.0174  -0.0027 -0.0021 84   GLY A C     
702  O O     . GLY A 84  ? 0.2330 0.2556 0.2341 0.0163  -0.0017 -0.0016 84   GLY A O     
703  N N     . MET A 85  ? 0.2147 0.2434 0.2202 0.0172  -0.0034 -0.0023 85   MET A N     
704  C CA    . MET A 85  ? 0.2105 0.2389 0.2135 0.0159  -0.0034 -0.0017 85   MET A CA    
705  C C     . MET A 85  ? 0.2241 0.2480 0.2225 0.0166  -0.0050 -0.0006 85   MET A C     
706  O O     . MET A 85  ? 0.2562 0.2800 0.2549 0.0182  -0.0078 -0.0007 85   MET A O     
707  C CB    . MET A 85  ? 0.2079 0.2404 0.2137 0.0154  -0.0034 -0.0024 85   MET A CB    
708  C CG    . MET A 85  ? 0.2024 0.2345 0.2056 0.0142  -0.0037 -0.0019 85   MET A CG    
709  S SD    . MET A 85  ? 0.2404 0.2702 0.2404 0.0128  -0.0018 -0.0014 85   MET A SD    
710  C CE    . MET A 85  ? 0.2389 0.2711 0.2411 0.0124  -0.0008 -0.0027 85   MET A CE    
711  N N     . ASP A 86  ? 0.2323 0.2517 0.2264 0.0155  -0.0032 0.0001  86   ASP A N     
712  C CA    . ASP A 86  ? 0.2690 0.2811 0.2558 0.0160  -0.0036 0.0013  86   ASP A CA    
713  C C     . ASP A 86  ? 0.2645 0.2752 0.2476 0.0154  -0.0041 0.0018  86   ASP A C     
714  O O     . ASP A 86  ? 0.2864 0.2900 0.2619 0.0164  -0.0054 0.0027  86   ASP A O     
715  C CB    . ASP A 86  ? 0.2845 0.2913 0.2683 0.0146  -0.0001 0.0016  86   ASP A CB    
716  C CG    . ASP A 86  ? 0.3419 0.3521 0.3301 0.0122  0.0029  0.0006  86   ASP A CG    
717  O OD1   . ASP A 86  ? 0.4268 0.4324 0.4126 0.0106  0.0063  0.0006  86   ASP A OD1   
718  O OD2   . ASP A 86  ? 0.3244 0.3411 0.3182 0.0120  0.0021  -0.0004 86   ASP A OD2   
719  N N     . ASP A 87  ? 0.2526 0.2688 0.2398 0.0141  -0.0033 0.0011  87   ASP A N     
720  C CA    . ASP A 87  ? 0.2564 0.2723 0.2411 0.0136  -0.0041 0.0013  87   ASP A CA    
721  C C     . ASP A 87  ? 0.2417 0.2615 0.2298 0.0151  -0.0078 0.0006  87   ASP A C     
722  O O     . ASP A 87  ? 0.2375 0.2633 0.2315 0.0144  -0.0075 -0.0003 87   ASP A O     
723  C CB    . ASP A 87  ? 0.2518 0.2713 0.2392 0.0117  -0.0016 0.0008  87   ASP A CB    
724  C CG    . ASP A 87  ? 0.3020 0.3201 0.2859 0.0112  -0.0020 0.0011  87   ASP A CG    
725  O OD1   . ASP A 87  ? 0.3077 0.3228 0.2876 0.0123  -0.0047 0.0015  87   ASP A OD1   
726  O OD2   . ASP A 87  ? 0.2950 0.3147 0.2802 0.0098  0.0000  0.0006  87   ASP A OD2   
727  N N     . PHE A 88  ? 0.2293 0.2447 0.2135 0.0170  -0.0114 0.0008  88   PHE A N     
728  C CA    . PHE A 88  ? 0.2516 0.2711 0.2417 0.0187  -0.0155 -0.0006 88   PHE A CA    
729  C C     . PHE A 88  ? 0.2566 0.2810 0.2510 0.0176  -0.0161 -0.0017 88   PHE A C     
730  O O     . PHE A 88  ? 0.2555 0.2857 0.2582 0.0179  -0.0172 -0.0035 88   PHE A O     
731  C CB    . PHE A 88  ? 0.2531 0.2658 0.2378 0.0217  -0.0204 -0.0006 88   PHE A CB    
732  C CG    . PHE A 88  ? 0.2596 0.2660 0.2389 0.0229  -0.0197 0.0004  88   PHE A CG    
733  C CD1   . PHE A 88  ? 0.2652 0.2760 0.2510 0.0230  -0.0180 0.0000  88   PHE A CD1   
734  C CD2   . PHE A 88  ? 0.3027 0.2977 0.2695 0.0239  -0.0203 0.0019  88   PHE A CD2   
735  C CE1   . PHE A 88  ? 0.2624 0.2671 0.2432 0.0240  -0.0173 0.0009  88   PHE A CE1   
736  C CE2   . PHE A 88  ? 0.3071 0.2951 0.2682 0.0248  -0.0191 0.0029  88   PHE A CE2   
737  C CZ    . PHE A 88  ? 0.2946 0.2879 0.2633 0.0248  -0.0178 0.0024  88   PHE A CZ    
738  N N     . LYS A 89  ? 0.2676 0.2895 0.2567 0.0162  -0.0148 -0.0008 89   LYS A N     
739  C CA    . LYS A 89  ? 0.2728 0.2989 0.2655 0.0150  -0.0151 -0.0019 89   LYS A CA    
740  C C     . LYS A 89  ? 0.2387 0.2711 0.2379 0.0132  -0.0115 -0.0025 89   LYS A C     
741  O O     . LYS A 89  ? 0.2278 0.2643 0.2325 0.0125  -0.0117 -0.0039 89   LYS A O     
742  C CB    . LYS A 89  ? 0.2871 0.3084 0.2721 0.0142  -0.0150 -0.0009 89   LYS A CB    
743  C CG    . LYS A 89  ? 0.3246 0.3433 0.3051 0.0126  -0.0106 0.0003  89   LYS A CG    
744  C CD    . LYS A 89  ? 0.3601 0.3714 0.3313 0.0125  -0.0106 0.0012  89   LYS A CD    
745  C CE    . LYS A 89  ? 0.3986 0.4066 0.3662 0.0110  -0.0056 0.0020  89   LYS A CE    
746  N NZ    . LYS A 89  ? 0.3809 0.3857 0.3472 0.0113  -0.0036 0.0026  89   LYS A NZ    
747  N N     . LEU A 90  ? 0.2177 0.2499 0.2160 0.0126  -0.0085 -0.0017 90   LEU A N     
748  C CA    . LEU A 90  ? 0.2126 0.2485 0.2150 0.0116  -0.0058 -0.0024 90   LEU A CA    
749  C C     . LEU A 90  ? 0.2084 0.2475 0.2170 0.0123  -0.0059 -0.0038 90   LEU A C     
750  O O     . LEU A 90  ? 0.1933 0.2349 0.2054 0.0114  -0.0038 -0.0049 90   LEU A O     
751  C CB    . LEU A 90  ? 0.2371 0.2715 0.2372 0.0112  -0.0036 -0.0018 90   LEU A CB    
752  C CG    . LEU A 90  ? 0.2690 0.3013 0.2655 0.0103  -0.0025 -0.0013 90   LEU A CG    
753  C CD1   . LEU A 90  ? 0.2758 0.3078 0.2732 0.0101  -0.0010 -0.0017 90   LEU A CD1   
754  C CD2   . LEU A 90  ? 0.2911 0.3248 0.2873 0.0094  -0.0022 -0.0017 90   LEU A CD2   
755  N N     . ALA A 91  ? 0.2084 0.2466 0.2181 0.0141  -0.0079 -0.0038 91   ALA A N     
756  C CA    . ALA A 91  ? 0.2156 0.2571 0.2325 0.0151  -0.0082 -0.0055 91   ALA A CA    
757  C C     . ALA A 91  ? 0.1940 0.2390 0.2176 0.0151  -0.0101 -0.0076 91   ALA A C     
758  O O     . ALA A 91  ? 0.1928 0.2416 0.2239 0.0144  -0.0079 -0.0096 91   ALA A O     
759  C CB    . ALA A 91  ? 0.2230 0.2620 0.2391 0.0173  -0.0104 -0.0052 91   ALA A CB    
760  N N     . TYR A 92  ? 0.1907 0.2337 0.2114 0.0157  -0.0139 -0.0074 92   TYR A N     
761  C CA    . TYR A 92  ? 0.1979 0.2441 0.2251 0.0156  -0.0165 -0.0097 92   TYR A CA    
762  C C     . TYR A 92  ? 0.1918 0.2411 0.2222 0.0128  -0.0122 -0.0105 92   TYR A C     
763  O O     . TYR A 92  ? 0.1874 0.2410 0.2273 0.0120  -0.0111 -0.0132 92   TYR A O     
764  C CB    . TYR A 92  ? 0.2005 0.2421 0.2213 0.0168  -0.0214 -0.0091 92   TYR A CB    
765  C CG    . TYR A 92  ? 0.2367 0.2813 0.2638 0.0165  -0.0243 -0.0117 92   TYR A CG    
766  C CD1   . TYR A 92  ? 0.2171 0.2618 0.2420 0.0141  -0.0224 -0.0113 92   TYR A CD1   
767  C CD2   . TYR A 92  ? 0.2346 0.2819 0.2708 0.0186  -0.0293 -0.0149 92   TYR A CD2   
768  C CE1   . TYR A 92  ? 0.2249 0.2724 0.2562 0.0136  -0.0249 -0.0140 92   TYR A CE1   
769  C CE2   . TYR A 92  ? 0.2584 0.3089 0.3023 0.0182  -0.0323 -0.0179 92   TYR A CE2   
770  C CZ    . TYR A 92  ? 0.2310 0.2815 0.2721 0.0155  -0.0300 -0.0174 92   TYR A CZ    
771  O OH    . TYR A 92  ? 0.2259 0.2795 0.2751 0.0149  -0.0328 -0.0207 92   TYR A OH    
772  N N     . LEU A 93  ? 0.1861 0.2327 0.2088 0.0113  -0.0096 -0.0084 93   LEU A N     
773  C CA    . LEU A 93  ? 0.1900 0.2376 0.2134 0.0089  -0.0058 -0.0089 93   LEU A CA    
774  C C     . LEU A 93  ? 0.2005 0.2495 0.2280 0.0080  -0.0012 -0.0100 93   LEU A C     
775  O O     . LEU A 93  ? 0.2018 0.2521 0.2335 0.0062  0.0019  -0.0117 93   LEU A O     
776  C CB    . LEU A 93  ? 0.1872 0.2312 0.2017 0.0081  -0.0045 -0.0068 93   LEU A CB    
777  C CG    . LEU A 93  ? 0.1934 0.2351 0.2030 0.0082  -0.0073 -0.0059 93   LEU A CG    
778  C CD1   . LEU A 93  ? 0.1986 0.2375 0.2015 0.0074  -0.0052 -0.0044 93   LEU A CD1   
779  C CD2   . LEU A 93  ? 0.1936 0.2372 0.2075 0.0072  -0.0088 -0.0077 93   LEU A CD2   
780  N N     . SER A 94  ? 0.1828 0.2306 0.2083 0.0092  -0.0005 -0.0091 94   SER A N     
781  C CA    . SER A 94  ? 0.2266 0.2741 0.2539 0.0087  0.0039  -0.0100 94   SER A CA    
782  C C     . SER A 94  ? 0.2103 0.2619 0.2487 0.0085  0.0052  -0.0130 94   SER A C     
783  O O     . SER A 94  ? 0.2108 0.2619 0.2518 0.0069  0.0104  -0.0145 94   SER A O     
784  C CB    . SER A 94  ? 0.2339 0.2791 0.2570 0.0102  0.0036  -0.0087 94   SER A CB    
785  O OG    . SER A 94  ? 0.2836 0.3267 0.3059 0.0097  0.0079  -0.0094 94   SER A OG    
786  N N     . ASP A 95  ? 0.2089 0.2638 0.2537 0.0103  0.0005  -0.0141 95   ASP A N     
787  C CA    . ASP A 95  ? 0.2229 0.2829 0.2809 0.0107  0.0004  -0.0177 95   ASP A CA    
788  C C     . ASP A 95  ? 0.2315 0.2944 0.2968 0.0086  0.0011  -0.0203 95   ASP A C     
789  O O     . ASP A 95  ? 0.2228 0.2893 0.2991 0.0073  0.0048  -0.0236 95   ASP A O     
790  C CB    . ASP A 95  ? 0.2294 0.2907 0.2908 0.0139  -0.0063 -0.0183 95   ASP A CB    
791  C CG    . ASP A 95  ? 0.2447 0.3041 0.3034 0.0159  -0.0063 -0.0171 95   ASP A CG    
792  O OD1   . ASP A 95  ? 0.2641 0.3215 0.3199 0.0186  -0.0116 -0.0162 95   ASP A OD1   
793  O OD2   . ASP A 95  ? 0.2648 0.3236 0.3233 0.0149  -0.0009 -0.0171 95   ASP A OD2   
794  N N     . THR A 96  ? 0.2136 0.2751 0.2734 0.0083  -0.0021 -0.0189 96   THR A N     
795  C CA    . THR A 96  ? 0.2230 0.2872 0.2896 0.0066  -0.0027 -0.0214 96   THR A CA    
796  C C     . THR A 96  ? 0.2248 0.2869 0.2887 0.0031  0.0042  -0.0213 96   THR A C     
797  O O     . THR A 96  ? 0.2339 0.2985 0.3067 0.0009  0.0067  -0.0244 96   THR A O     
798  C CB    . THR A 96  ? 0.2178 0.2801 0.2784 0.0079  -0.0095 -0.0201 96   THR A CB    
799  O OG1   . THR A 96  ? 0.2400 0.3017 0.3005 0.0114  -0.0157 -0.0201 96   THR A OG1   
800  C CG2   . THR A 96  ? 0.2300 0.2951 0.2984 0.0065  -0.0113 -0.0232 96   THR A CG2   
801  N N     . TYR A 97  ? 0.2300 0.2866 0.2816 0.0028  0.0071  -0.0181 97   TYR A N     
802  C CA    . TYR A 97  ? 0.2545 0.3067 0.3002 0.0002  0.0131  -0.0176 97   TYR A CA    
803  C C     . TYR A 97  ? 0.2886 0.3362 0.3286 0.0002  0.0182  -0.0167 97   TYR A C     
804  O O     . TYR A 97  ? 0.3121 0.3543 0.3405 0.0007  0.0186  -0.0142 97   TYR A O     
805  C CB    . TYR A 97  ? 0.2411 0.2896 0.2761 0.0001  0.0108  -0.0150 97   TYR A CB    
806  C CG    . TYR A 97  ? 0.2114 0.2630 0.2507 0.0000  0.0061  -0.0159 97   TYR A CG    
807  C CD1   . TYR A 97  ? 0.2205 0.2731 0.2580 0.0024  0.0000  -0.0148 97   TYR A CD1   
808  C CD2   . TYR A 97  ? 0.2235 0.2762 0.2685 -0.0023 0.0081  -0.0183 97   TYR A CD2   
809  C CE1   . TYR A 97  ? 0.2060 0.2598 0.2459 0.0027  -0.0048 -0.0159 97   TYR A CE1   
810  C CE2   . TYR A 97  ? 0.2238 0.2790 0.2728 -0.0022 0.0031  -0.0196 97   TYR A CE2   
811  C CZ    . TYR A 97  ? 0.2324 0.2879 0.2783 0.0004  -0.0035 -0.0183 97   TYR A CZ    
812  O OH    . TYR A 97  ? 0.2451 0.3014 0.2931 0.0009  -0.0089 -0.0197 97   TYR A OH    
813  N N     . ASN A 98  ? 0.3249 0.3747 0.3736 -0.0001 0.0218  -0.0193 98   ASN A N     
814  C CA    . ASN A 98  ? 0.3695 0.4143 0.4129 0.0000  0.0269  -0.0188 98   ASN A CA    
815  C C     . ASN A 98  ? 0.3866 0.4238 0.4237 -0.0027 0.0348  -0.0194 98   ASN A C     
816  O O     . ASN A 98  ? 0.3993 0.4345 0.4403 -0.0041 0.0415  -0.0217 98   ASN A O     
817  C CB    . ASN A 98  ? 0.3712 0.4207 0.4259 0.0011  0.0276  -0.0213 98   ASN A CB    
818  C CG    . ASN A 98  ? 0.4205 0.4647 0.4680 0.0020  0.0311  -0.0202 98   ASN A CG    
819  O OD1   . ASN A 98  ? 0.4131 0.4512 0.4475 0.0028  0.0302  -0.0174 98   ASN A OD1   
820  N ND2   . ASN A 98  ? 0.4319 0.4781 0.4884 0.0020  0.0350  -0.0229 98   ASN A ND2   
821  N N     . TYR A 99  ? 0.3808 0.4131 0.4076 -0.0033 0.0341  -0.0175 99   TYR A N     
822  C CA    . TYR A 99  ? 0.4018 0.4245 0.4189 -0.0054 0.0406  -0.0175 99   TYR A CA    
823  C C     . TYR A 99  ? 0.4012 0.4188 0.4053 -0.0044 0.0367  -0.0146 99   TYR A C     
824  O O     . TYR A 99  ? 0.3840 0.4068 0.3895 -0.0028 0.0301  -0.0132 99   TYR A O     
825  C CB    . TYR A 99  ? 0.4219 0.4464 0.4486 -0.0089 0.0458  -0.0206 99   TYR A CB    
826  C CG    . TYR A 99  ? 0.4740 0.5073 0.5111 -0.0093 0.0403  -0.0216 99   TYR A CG    
827  C CD1   . TYR A 99  ? 0.4905 0.5339 0.5435 -0.0086 0.0365  -0.0241 99   TYR A CD1   
828  C CD2   . TYR A 99  ? 0.4944 0.5249 0.5249 -0.0101 0.0385  -0.0203 99   TYR A CD2   
829  C CE1   . TYR A 99  ? 0.5009 0.5507 0.5619 -0.0085 0.0307  -0.0252 99   TYR A CE1   
830  C CE2   . TYR A 99  ? 0.4845 0.5219 0.5234 -0.0104 0.0334  -0.0213 99   TYR A CE2   
831  C CZ    . TYR A 99  ? 0.4986 0.5453 0.5522 -0.0096 0.0294  -0.0238 99   TYR A CZ    
832  O OH    . TYR A 99  ? 0.4599 0.5119 0.5203 -0.0095 0.0236  -0.0250 99   TYR A OH    
833  N N     . GLU A 100 ? 0.4156 0.4222 0.4068 -0.0051 0.0410  -0.0140 100  GLU A N     
834  C CA    . GLU A 100 ? 0.4274 0.4287 0.4073 -0.0041 0.0375  -0.0119 100  GLU A CA    
835  C C     . GLU A 100 ? 0.3970 0.4036 0.3835 -0.0059 0.0360  -0.0124 100  GLU A C     
836  O O     . GLU A 100 ? 0.4124 0.4179 0.4030 -0.0088 0.0412  -0.0143 100  GLU A O     
837  C CB    . GLU A 100 ? 0.4721 0.4587 0.4358 -0.0042 0.0423  -0.0114 100  GLU A CB    
838  C CG    . GLU A 100 ? 0.5534 0.5336 0.5051 -0.0025 0.0381  -0.0097 100  GLU A CG    
839  C CD    . GLU A 100 ? 0.6558 0.6196 0.5891 -0.0014 0.0411  -0.0092 100  GLU A CD    
840  O OE1   . GLU A 100 ? 0.6982 0.6569 0.6217 0.0017  0.0355  -0.0080 100  GLU A OE1   
841  O OE2   . GLU A 100 ? 0.6931 0.6482 0.6214 -0.0036 0.0489  -0.0102 100  GLU A OE2   
842  N N     . ILE A 101 ? 0.3596 0.3716 0.3474 -0.0042 0.0293  -0.0110 101  ILE A N     
843  C CA    . ILE A 101 ? 0.3392 0.3557 0.3323 -0.0056 0.0273  -0.0115 101  ILE A CA    
844  C C     . ILE A 101 ? 0.3589 0.3670 0.3421 -0.0068 0.0299  -0.0111 101  ILE A C     
845  O O     . ILE A 101 ? 0.3517 0.3526 0.3230 -0.0050 0.0286  -0.0094 101  ILE A O     
846  C CB    . ILE A 101 ? 0.3184 0.3412 0.3139 -0.0035 0.0202  -0.0101 101  ILE A CB    
847  C CG1   . ILE A 101 ? 0.3329 0.3635 0.3388 -0.0026 0.0177  -0.0110 101  ILE A CG1   
848  C CG2   . ILE A 101 ? 0.3302 0.3546 0.3270 -0.0046 0.0181  -0.0103 101  ILE A CG2   
849  C CD1   . ILE A 101 ? 0.3216 0.3553 0.3266 -0.0003 0.0120  -0.0093 101  ILE A CD1   
850  N N     . LYS A 102 ? 0.3491 0.3578 0.3379 -0.0098 0.0335  -0.0130 102  LYS A N     
851  C CA    . LYS A 102 ? 0.3965 0.3983 0.3778 -0.0114 0.0356  -0.0129 102  LYS A CA    
852  C C     . LYS A 102 ? 0.3794 0.3888 0.3681 -0.0118 0.0307  -0.0132 102  LYS A C     
853  O O     . LYS A 102 ? 0.3856 0.4025 0.3871 -0.0134 0.0303  -0.0155 102  LYS A O     
854  C CB    . LYS A 102 ? 0.4435 0.4393 0.4256 -0.0150 0.0443  -0.0151 102  LYS A CB    
855  C CG    . LYS A 102 ? 0.5238 0.5150 0.5035 -0.0178 0.0472  -0.0159 102  LYS A CG    
856  C CD    . LYS A 102 ? 0.6009 0.5792 0.5620 -0.0164 0.0475  -0.0136 102  LYS A CD    
857  C CE    . LYS A 102 ? 0.6383 0.6124 0.5973 -0.0190 0.0499  -0.0144 102  LYS A CE    
858  N NZ    . LYS A 102 ? 0.6804 0.6422 0.6214 -0.0170 0.0487  -0.0122 102  LYS A NZ    
859  N N     . TYR A 103 ? 0.3542 0.3614 0.3351 -0.0099 0.0265  -0.0112 103  TYR A N     
860  C CA    . TYR A 103 ? 0.3360 0.3486 0.3215 -0.0101 0.0221  -0.0113 103  TYR A CA    
861  C C     . TYR A 103 ? 0.3393 0.3459 0.3189 -0.0119 0.0242  -0.0116 103  TYR A C     
862  O O     . TYR A 103 ? 0.3368 0.3340 0.3060 -0.0120 0.0277  -0.0109 103  TYR A O     
863  C CB    . TYR A 103 ? 0.3275 0.3432 0.3106 -0.0070 0.0162  -0.0094 103  TYR A CB    
864  C CG    . TYR A 103 ? 0.3080 0.3173 0.2798 -0.0050 0.0152  -0.0076 103  TYR A CG    
865  C CD1   . TYR A 103 ? 0.3434 0.3484 0.3090 -0.0030 0.0156  -0.0067 103  TYR A CD1   
866  C CD2   . TYR A 103 ? 0.3254 0.3328 0.2932 -0.0048 0.0134  -0.0071 103  TYR A CD2   
867  C CE1   . TYR A 103 ? 0.3441 0.3434 0.3008 -0.0006 0.0135  -0.0058 103  TYR A CE1   
868  C CE2   . TYR A 103 ? 0.3349 0.3368 0.2939 -0.0026 0.0120  -0.0061 103  TYR A CE2   
869  C CZ    . TYR A 103 ? 0.3577 0.3558 0.3117 -0.0004 0.0118  -0.0056 103  TYR A CZ    
870  O OH    . TYR A 103 ? 0.3662 0.3592 0.3129 0.0020  0.0094  -0.0052 103  TYR A OH    
871  N N     . ASP A 104 ? 0.3318 0.3428 0.3175 -0.0131 0.0216  -0.0127 104  ASP A N     
872  C CA    . ASP A 104 ? 0.3389 0.3451 0.3202 -0.0148 0.0230  -0.0131 104  ASP A CA    
873  C C     . ASP A 104 ? 0.3094 0.3175 0.2876 -0.0127 0.0172  -0.0116 104  ASP A C     
874  O O     . ASP A 104 ? 0.2973 0.3115 0.2824 -0.0127 0.0132  -0.0125 104  ASP A O     
875  C CB    . ASP A 104 ? 0.3353 0.3448 0.3277 -0.0185 0.0255  -0.0164 104  ASP A CB    
876  C CG    . ASP A 104 ? 0.3547 0.3592 0.3434 -0.0207 0.0269  -0.0171 104  ASP A CG    
877  O OD1   . ASP A 104 ? 0.3157 0.3146 0.2932 -0.0191 0.0254  -0.0149 104  ASP A OD1   
878  O OD2   . ASP A 104 ? 0.3643 0.3707 0.3623 -0.0241 0.0297  -0.0202 104  ASP A OD2   
879  N N     . HIS A 105 ? 0.3052 0.3072 0.2726 -0.0108 0.0166  -0.0097 105  HIS A N     
880  C CA    . HIS A 105 ? 0.2956 0.2988 0.2600 -0.0088 0.0122  -0.0085 105  HIS A CA    
881  C C     . HIS A 105 ? 0.2859 0.2900 0.2523 -0.0105 0.0108  -0.0096 105  HIS A C     
882  O O     . HIS A 105 ? 0.2857 0.2922 0.2522 -0.0092 0.0070  -0.0091 105  HIS A O     
883  C CB    . HIS A 105 ? 0.3086 0.3052 0.2627 -0.0063 0.0120  -0.0071 105  HIS A CB    
884  C CG    . HIS A 105 ? 0.3969 0.3851 0.3431 -0.0073 0.0143  -0.0073 105  HIS A CG    
885  N ND1   . HIS A 105 ? 0.4398 0.4266 0.3833 -0.0072 0.0127  -0.0073 105  HIS A ND1   
886  C CD2   . HIS A 105 ? 0.4296 0.4093 0.3690 -0.0084 0.0186  -0.0076 105  HIS A CD2   
887  C CE1   . HIS A 105 ? 0.4644 0.4427 0.4004 -0.0082 0.0154  -0.0075 105  HIS A CE1   
888  N NE2   . HIS A 105 ? 0.4504 0.4237 0.3832 -0.0090 0.0191  -0.0076 105  HIS A NE2   
889  N N     . THR A 106 ? 0.2590 0.3286 0.2549 -0.0132 0.0249  -0.0051 106  THR A N     
890  C CA    . THR A 106 ? 0.2650 0.3358 0.2651 -0.0179 0.0234  -0.0048 106  THR A CA    
891  C C     . THR A 106 ? 0.2324 0.3110 0.2409 -0.0176 0.0203  -0.0063 106  THR A C     
892  O O     . THR A 106 ? 0.2518 0.3300 0.2625 -0.0207 0.0175  -0.0067 106  THR A O     
893  C CB    . THR A 106 ? 0.2779 0.3506 0.2798 -0.0229 0.0275  -0.0031 106  THR A CB    
894  O OG1   . THR A 106 ? 0.2744 0.3583 0.2846 -0.0229 0.0302  -0.0032 106  THR A OG1   
895  C CG2   . THR A 106 ? 0.3099 0.3744 0.3026 -0.0226 0.0308  -0.0014 106  THR A CG2   
896  N N     . LYS A 107 ? 0.2054 0.2903 0.2175 -0.0135 0.0205  -0.0074 107  LYS A N     
897  C CA    . LYS A 107 ? 0.1974 0.2896 0.2167 -0.0119 0.0174  -0.0088 107  LYS A CA    
898  C C     . LYS A 107 ? 0.1992 0.2859 0.2145 -0.0083 0.0133  -0.0098 107  LYS A C     
899  O O     . LYS A 107 ? 0.2026 0.2932 0.2220 -0.0067 0.0101  -0.0109 107  LYS A O     
900  C CB    . LYS A 107 ? 0.2142 0.3163 0.2395 -0.0087 0.0199  -0.0093 107  LYS A CB    
901  C CG    . LYS A 107 ? 0.2992 0.4078 0.3284 -0.0116 0.0251  -0.0080 107  LYS A CG    
902  C CD    . LYS A 107 ? 0.3494 0.4664 0.3879 -0.0169 0.0245  -0.0077 107  LYS A CD    
903  C CE    . LYS A 107 ? 0.3638 0.4912 0.4090 -0.0187 0.0299  -0.0065 107  LYS A CE    
904  N NZ    . LYS A 107 ? 0.4328 0.5707 0.4891 -0.0238 0.0287  -0.0064 107  LYS A NZ    
905  N N     . ILE A 108 ? 0.1738 0.2518 0.1811 -0.0069 0.0133  -0.0095 108  ILE A N     
906  C CA    . ILE A 108 ? 0.1852 0.2579 0.1886 -0.0040 0.0100  -0.0101 108  ILE A CA    
907  C C     . ILE A 108 ? 0.1856 0.2530 0.1863 -0.0065 0.0074  -0.0096 108  ILE A C     
908  O O     . ILE A 108 ? 0.2122 0.2745 0.2086 -0.0087 0.0085  -0.0086 108  ILE A O     
909  C CB    . ILE A 108 ? 0.1785 0.2454 0.1752 -0.0013 0.0111  -0.0101 108  ILE A CB    
910  C CG1   . ILE A 108 ? 0.1844 0.2557 0.1826 0.0017  0.0137  -0.0108 108  ILE A CG1   
911  C CG2   . ILE A 108 ? 0.1941 0.2557 0.1874 0.0007  0.0077  -0.0105 108  ILE A CG2   
912  C CD1   . ILE A 108 ? 0.1807 0.2460 0.1715 0.0042  0.0149  -0.0110 108  ILE A CD1   
913  N N     . ARG A 109 ? 0.1723 0.2405 0.1749 -0.0057 0.0040  -0.0103 109  ARG A N     
914  C CA    . ARG A 109 ? 0.1931 0.2561 0.1924 -0.0075 0.0016  -0.0099 109  ARG A CA    
915  C C     . ARG A 109 ? 0.1961 0.2522 0.1891 -0.0057 0.0011  -0.0092 109  ARG A C     
916  O O     . ARG A 109 ? 0.2038 0.2588 0.1959 -0.0032 -0.0005 -0.0094 109  ARG A O     
917  C CB    . ARG A 109 ? 0.1902 0.2563 0.1930 -0.0072 -0.0018 -0.0107 109  ARG A CB    
918  C CG    . ARG A 109 ? 0.2026 0.2640 0.2022 -0.0095 -0.0038 -0.0106 109  ARG A CG    
919  C CD    . ARG A 109 ? 0.1954 0.2600 0.1979 -0.0092 -0.0075 -0.0116 109  ARG A CD    
920  N NE    . ARG A 109 ? 0.2271 0.3006 0.2375 -0.0108 -0.0078 -0.0125 109  ARG A NE    
921  C CZ    . ARG A 109 ? 0.2597 0.3353 0.2730 -0.0152 -0.0079 -0.0128 109  ARG A CZ    
922  N NH1   . ARG A 109 ? 0.2353 0.3035 0.2431 -0.0182 -0.0079 -0.0124 109  ARG A NH1   
923  N NH2   . ARG A 109 ? 0.2469 0.3323 0.2687 -0.0168 -0.0081 -0.0135 109  ARG A NH2   
924  N N     . VAL A 110 ? 0.1798 0.2313 0.1684 -0.0072 0.0025  -0.0082 110  VAL A N     
925  C CA    . VAL A 110 ? 0.1952 0.2415 0.1787 -0.0058 0.0020  -0.0075 110  VAL A CA    
926  C C     . VAL A 110 ? 0.1978 0.2406 0.1787 -0.0067 0.0005  -0.0070 110  VAL A C     
927  O O     . VAL A 110 ? 0.2254 0.2660 0.2046 -0.0088 0.0012  -0.0067 110  VAL A O     
928  C CB    . VAL A 110 ? 0.1942 0.2380 0.1741 -0.0058 0.0044  -0.0067 110  VAL A CB    
929  C CG1   . VAL A 110 ? 0.2091 0.2492 0.1850 -0.0044 0.0034  -0.0060 110  VAL A CG1   
930  C CG2   . VAL A 110 ? 0.2036 0.2504 0.1851 -0.0047 0.0062  -0.0073 110  VAL A CG2   
931  N N     . ALA A 111 ? 0.1887 0.2302 0.1685 -0.0052 -0.0013 -0.0068 111  ALA A N     
932  C CA    . ALA A 111 ? 0.1999 0.2380 0.1764 -0.0053 -0.0025 -0.0062 111  ALA A CA    
933  C C     . ALA A 111 ? 0.2032 0.2384 0.1759 -0.0040 -0.0019 -0.0049 111  ALA A C     
934  O O     . ALA A 111 ? 0.1891 0.2252 0.1624 -0.0029 -0.0020 -0.0045 111  ALA A O     
935  C CB    . ALA A 111 ? 0.1950 0.2341 0.1727 -0.0045 -0.0050 -0.0068 111  ALA A CB    
936  N N     . ASN A 112 ? 0.2165 0.2484 0.1854 -0.0041 -0.0013 -0.0044 112  ASN A N     
937  C CA    A ASN A 112 ? 0.2322 0.2624 0.1977 -0.0025 -0.0005 -0.0030 112  ASN A CA    
938  C CA    B ASN A 112 ? 0.2259 0.2562 0.1915 -0.0026 -0.0005 -0.0030 112  ASN A CA    
939  C C     . ASN A 112 ? 0.2255 0.2531 0.1878 -0.0016 -0.0013 -0.0027 112  ASN A C     
940  O O     . ASN A 112 ? 0.2372 0.2614 0.1966 -0.0022 -0.0016 -0.0033 112  ASN A O     
941  C CB    A ASN A 112 ? 0.2552 0.2830 0.2177 -0.0025 0.0010  -0.0026 112  ASN A CB    
942  C CB    B ASN A 112 ? 0.2390 0.2670 0.2018 -0.0026 0.0010  -0.0026 112  ASN A CB    
943  C CG    A ASN A 112 ? 0.2829 0.3127 0.2470 -0.0025 0.0020  -0.0025 112  ASN A CG    
944  C CG    B ASN A 112 ? 0.2556 0.2840 0.2166 -0.0005 0.0017  -0.0013 112  ASN A CG    
945  O OD1   A ASN A 112 ? 0.3066 0.3365 0.2690 -0.0011 0.0024  -0.0016 112  ASN A OD1   
946  O OD1   B ASN A 112 ? 0.2472 0.2752 0.2064 0.0009  0.0016  -0.0004 112  ASN A OD1   
947  N ND2   A ASN A 112 ? 0.2956 0.3273 0.2626 -0.0038 0.0022  -0.0034 112  ASN A ND2   
948  N ND2   B ASN A 112 ? 0.2558 0.2853 0.2172 -0.0003 0.0024  -0.0011 112  ASN A ND2   
949  N N     . PHE A 113 ? 0.2173 0.2460 0.1794 -0.0003 -0.0016 -0.0016 113  PHE A N     
950  C CA    . PHE A 113 ? 0.2294 0.2555 0.1875 0.0010  -0.0019 -0.0011 113  PHE A CA    
951  C C     . PHE A 113 ? 0.2282 0.2553 0.1847 0.0029  -0.0005 0.0007  113  PHE A C     
952  O O     . PHE A 113 ? 0.2048 0.2354 0.1643 0.0027  0.0001  0.0017  113  PHE A O     
953  C CB    . PHE A 113 ? 0.2138 0.2395 0.1722 0.0007  -0.0040 -0.0019 113  PHE A CB    
954  C CG    . PHE A 113 ? 0.2397 0.2670 0.1994 0.0014  -0.0043 -0.0006 113  PHE A CG    
955  C CD1   . PHE A 113 ? 0.2509 0.2809 0.2148 0.0006  -0.0043 -0.0004 113  PHE A CD1   
956  C CD2   . PHE A 113 ? 0.2408 0.2661 0.1969 0.0028  -0.0047 0.0002  113  PHE A CD2   
957  C CE1   . PHE A 113 ? 0.2871 0.3170 0.2513 0.0008  -0.0047 0.0006  113  PHE A CE1   
958  C CE2   . PHE A 113 ? 0.2796 0.3053 0.2361 0.0031  -0.0048 0.0016  113  PHE A CE2   
959  C CZ    . PHE A 113 ? 0.2611 0.2889 0.2218 0.0019  -0.0049 0.0019  113  PHE A CZ    
960  N N     . ASP A 114 ? 0.2319 0.2562 0.1835 0.0047  0.0000  0.0012  114  ASP A N     
961  C CA    . ASP A 114 ? 0.2449 0.2709 0.1949 0.0069  0.0017  0.0032  114  ASP A CA    
962  C C     . ASP A 114 ? 0.2496 0.2721 0.1941 0.0087  0.0016  0.0034  114  ASP A C     
963  O O     . ASP A 114 ? 0.2522 0.2697 0.1924 0.0090  0.0003  0.0017  114  ASP A O     
964  C CB    . ASP A 114 ? 0.2684 0.2944 0.2165 0.0089  0.0033  0.0036  114  ASP A CB    
965  C CG    . ASP A 114 ? 0.3378 0.3680 0.2860 0.0113  0.0055  0.0058  114  ASP A CG    
966  O OD1   . ASP A 114 ? 0.3499 0.3857 0.3033 0.0100  0.0058  0.0072  114  ASP A OD1   
967  O OD2   . ASP A 114 ? 0.4129 0.4406 0.3557 0.0145  0.0068  0.0062  114  ASP A OD2   
968  N N     . ILE A 115 ? 0.2370 0.2618 0.1814 0.0097  0.0028  0.0054  115  ILE A N     
969  C CA    . ILE A 115 ? 0.2297 0.2510 0.1679 0.0118  0.0031  0.0059  115  ILE A CA    
970  C C     . ILE A 115 ? 0.2413 0.2643 0.1765 0.0150  0.0064  0.0079  115  ILE A C     
971  O O     . ILE A 115 ? 0.2351 0.2639 0.1749 0.0149  0.0082  0.0095  115  ILE A O     
972  C CB    . ILE A 115 ? 0.2436 0.2646 0.1823 0.0107  0.0020  0.0067  115  ILE A CB    
973  C CG1   . ILE A 115 ? 0.2490 0.2747 0.1914 0.0099  0.0042  0.0096  115  ILE A CG1   
974  C CG2   . ILE A 115 ? 0.2434 0.2639 0.1858 0.0083  -0.0009 0.0048  115  ILE A CG2   
975  C CD1   . ILE A 115 ? 0.2619 0.2855 0.2024 0.0095  0.0037  0.0110  115  ILE A CD1   
976  N N     . GLU A 116 ? 0.2250 0.2434 0.1525 0.0179  0.0069  0.0078  116  GLU A N     
977  C CA    . GLU A 116 ? 0.2583 0.2786 0.1823 0.0216  0.0104  0.0100  116  GLU A CA    
978  C C     . GLU A 116 ? 0.2632 0.2820 0.1831 0.0224  0.0113  0.0115  116  GLU A C     
979  O O     . GLU A 116 ? 0.2644 0.2775 0.1799 0.0220  0.0086  0.0101  116  GLU A O     
980  C CB    . GLU A 116 ? 0.2672 0.2819 0.1835 0.0255  0.0110  0.0085  116  GLU A CB    
981  C CG    . GLU A 116 ? 0.2786 0.2928 0.1968 0.0252  0.0104  0.0071  116  GLU A CG    
982  C CD    . GLU A 116 ? 0.3492 0.3721 0.2748 0.0253  0.0124  0.0090  116  GLU A CD    
983  O OE1   . GLU A 116 ? 0.3467 0.3763 0.2749 0.0267  0.0151  0.0116  116  GLU A OE1   
984  O OE2   . GLU A 116 ? 0.3486 0.3719 0.2774 0.0239  0.0113  0.0081  116  GLU A OE2   
985  N N     . VAL A 117 ? 0.2639 0.2883 0.1854 0.0235  0.0149  0.0146  117  VAL A N     
986  C CA    . VAL A 117 ? 0.2525 0.2758 0.1697 0.0244  0.0166  0.0169  117  VAL A CA    
987  C C     . VAL A 117 ? 0.2925 0.3203 0.2074 0.0283  0.0215  0.0195  117  VAL A C     
988  O O     . VAL A 117 ? 0.2899 0.3264 0.2122 0.0273  0.0241  0.0217  117  VAL A O     
989  C CB    . VAL A 117 ? 0.2593 0.2864 0.1831 0.0201  0.0165  0.0190  117  VAL A CB    
990  C CG1   . VAL A 117 ? 0.2550 0.2804 0.1737 0.0210  0.0188  0.0219  117  VAL A CG1   
991  C CG2   . VAL A 117 ? 0.2286 0.2522 0.1552 0.0169  0.0120  0.0166  117  VAL A CG2   
992  N N     . THR A 118 ? 0.3117 0.3336 0.2163 0.0328  0.0226  0.0190  118  THR A N     
993  C CA    . THR A 118 ? 0.3344 0.3603 0.2357 0.0373  0.0277  0.0215  118  THR A CA    
994  C C     . THR A 118 ? 0.3407 0.3714 0.2440 0.0357  0.0310  0.0255  118  THR A C     
995  O O     . THR A 118 ? 0.3321 0.3571 0.2307 0.0344  0.0296  0.0258  118  THR A O     
996  C CB    . THR A 118 ? 0.3248 0.3416 0.2128 0.0431  0.0279  0.0196  118  THR A CB    
997  O OG1   . THR A 118 ? 0.3449 0.3570 0.2312 0.0442  0.0252  0.0163  118  THR A OG1   
998  C CG2   . THR A 118 ? 0.3702 0.3912 0.2541 0.0486  0.0337  0.0224  118  THR A CG2   
999  N N     . SER A 119 ? 0.3516 0.3930 0.2621 0.0356  0.0352  0.0287  119  SER A N     
1000 C CA    . SER A 119 ? 0.4194 0.4661 0.3326 0.0334  0.0390  0.0330  119  SER A CA    
1001 C C     . SER A 119 ? 0.4523 0.5085 0.3668 0.0372  0.0451  0.0362  119  SER A C     
1002 O O     . SER A 119 ? 0.4605 0.5266 0.3839 0.0371  0.0463  0.0368  119  SER A O     
1003 C CB    . SER A 119 ? 0.4239 0.4758 0.3483 0.0265  0.0372  0.0341  119  SER A CB    
1004 O OG    . SER A 119 ? 0.4808 0.5382 0.4083 0.0239  0.0412  0.0386  119  SER A OG    
1005 N N     . PRO A 120 ? 0.4910 0.5446 0.3966 0.0408  0.0491  0.0385  120  PRO A N     
1006 C CA    . PRO A 120 ? 0.5241 0.5874 0.4306 0.0449  0.0556  0.0418  120  PRO A CA    
1007 C C     . PRO A 120 ? 0.5499 0.6259 0.4682 0.0397  0.0595  0.0465  120  PRO A C     
1008 O O     . PRO A 120 ? 0.5714 0.6597 0.4959 0.0419  0.0641  0.0490  120  PRO A O     
1009 C CB    . PRO A 120 ? 0.5345 0.5890 0.4262 0.0501  0.0583  0.0424  120  PRO A CB    
1010 C CG    . PRO A 120 ? 0.5207 0.5645 0.4074 0.0462  0.0540  0.0414  120  PRO A CG    
1011 C CD    . PRO A 120 ? 0.5073 0.5490 0.4011 0.0417  0.0477  0.0379  120  PRO A CD    
1012 N N     . ASP A 121 ? 0.5503 0.6236 0.4717 0.0331  0.0575  0.0478  121  ASP A N     
1013 C CA    . ASP A 121 ? 0.5556 0.6387 0.4865 0.0274  0.0610  0.0525  121  ASP A CA    
1014 C C     . ASP A 121 ? 0.5398 0.6290 0.4840 0.0203  0.0574  0.0520  121  ASP A C     
1015 O O     . ASP A 121 ? 0.5423 0.6319 0.4912 0.0137  0.0573  0.0544  121  ASP A O     
1016 C CB    . ASP A 121 ? 0.5781 0.6532 0.5011 0.0252  0.0628  0.0554  121  ASP A CB    
1017 C CG    . ASP A 121 ? 0.5962 0.6572 0.5128 0.0233  0.0566  0.0523  121  ASP A CG    
1018 O OD1   . ASP A 121 ? 0.6396 0.6914 0.5460 0.0241  0.0572  0.0537  121  ASP A OD1   
1019 O OD2   . ASP A 121 ? 0.5972 0.6565 0.5186 0.0213  0.0512  0.0486  121  ASP A OD2   
1020 N N     . GLY A 122 ? 0.5080 0.6012 0.4575 0.0219  0.0546  0.0489  122  GLY A N     
1021 C CA    . GLY A 122 ? 0.4845 0.5841 0.4460 0.0161  0.0512  0.0481  122  GLY A CA    
1022 C C     . GLY A 122 ? 0.4717 0.5610 0.4313 0.0141  0.0447  0.0439  122  GLY A C     
1023 O O     . GLY A 122 ? 0.4552 0.5340 0.4053 0.0177  0.0426  0.0410  122  GLY A O     
1024 N N     . PHE A 123 ? 0.4540 0.5466 0.4226 0.0082  0.0416  0.0435  123  PHE A N     
1025 C CA    . PHE A 123 ? 0.4521 0.5365 0.4200 0.0061  0.0359  0.0396  123  PHE A CA    
1026 C C     . PHE A 123 ? 0.4239 0.4957 0.3834 0.0051  0.0341  0.0391  123  PHE A C     
1027 O O     . PHE A 123 ? 0.4423 0.5125 0.4013 0.0016  0.0357  0.0421  123  PHE A O     
1028 C CB    . PHE A 123 ? 0.4576 0.5479 0.4361 0.0001  0.0333  0.0396  123  PHE A CB    
1029 C CG    . PHE A 123 ? 0.4780 0.5611 0.4561 -0.0013 0.0279  0.0357  123  PHE A CG    
1030 C CD1   . PHE A 123 ? 0.5014 0.5860 0.4807 0.0015  0.0257  0.0327  123  PHE A CD1   
1031 C CD2   . PHE A 123 ? 0.5056 0.5800 0.4815 -0.0052 0.0252  0.0351  123  PHE A CD2   
1032 C CE1   . PHE A 123 ? 0.5216 0.5999 0.5002 0.0002  0.0213  0.0293  123  PHE A CE1   
1033 C CE2   . PHE A 123 ? 0.5029 0.5714 0.4784 -0.0060 0.0206  0.0315  123  PHE A CE2   
1034 C CZ    . PHE A 123 ? 0.5058 0.5765 0.4829 -0.0034 0.0189  0.0287  123  PHE A CZ    
1035 N N     . PRO A 124 ? 0.4024 0.4653 0.3553 0.0080  0.0308  0.0354  124  PRO A N     
1036 C CA    . PRO A 124 ? 0.3909 0.4428 0.3364 0.0076  0.0284  0.0345  124  PRO A CA    
1037 C C     . PRO A 124 ? 0.3912 0.4401 0.3412 0.0023  0.0248  0.0338  124  PRO A C     
1038 O O     . PRO A 124 ? 0.3961 0.4438 0.3490 0.0016  0.0212  0.0306  124  PRO A O     
1039 C CB    . PRO A 124 ? 0.3688 0.4145 0.3078 0.0120  0.0258  0.0306  124  PRO A CB    
1040 C CG    . PRO A 124 ? 0.3763 0.4281 0.3211 0.0129  0.0253  0.0288  124  PRO A CG    
1041 C CD    . PRO A 124 ? 0.3886 0.4514 0.3404 0.0121  0.0291  0.0321  124  PRO A CD    
1042 N N     . GLU A 125 ? 0.3850 0.4323 0.3350 -0.0012 0.0261  0.0369  125  GLU A N     
1043 C CA    . GLU A 125 ? 0.3782 0.4216 0.3316 -0.0061 0.0230  0.0365  125  GLU A CA    
1044 C C     . GLU A 125 ? 0.3528 0.3860 0.3002 -0.0044 0.0188  0.0334  125  GLU A C     
1045 O O     . GLU A 125 ? 0.3303 0.3570 0.2695 -0.0017 0.0190  0.0339  125  GLU A O     
1046 C CB    . GLU A 125 ? 0.4055 0.4480 0.3590 -0.0105 0.0256  0.0408  125  GLU A CB    
1047 C CG    . GLU A 125 ? 0.4616 0.5157 0.4240 -0.0141 0.0290  0.0439  125  GLU A CG    
1048 C CD    . GLU A 125 ? 0.5165 0.5762 0.4885 -0.0180 0.0260  0.0420  125  GLU A CD    
1049 O OE1   . GLU A 125 ? 0.4825 0.5362 0.4538 -0.0184 0.0216  0.0386  125  GLU A OE1   
1050 O OE2   . GLU A 125 ? 0.5556 0.6262 0.5357 -0.0205 0.0281  0.0439  125  GLU A OE2   
1051 N N     . PRO A 126 ? 0.3591 0.3917 0.3107 -0.0058 0.0150  0.0303  126  PRO A N     
1052 C CA    . PRO A 126 ? 0.3746 0.3996 0.3223 -0.0041 0.0111  0.0272  126  PRO A CA    
1053 C C     . PRO A 126 ? 0.3983 0.4147 0.3408 -0.0050 0.0100  0.0286  126  PRO A C     
1054 O O     . PRO A 126 ? 0.4050 0.4155 0.3422 -0.0021 0.0075  0.0269  126  PRO A O     
1055 C CB    . PRO A 126 ? 0.3644 0.3920 0.3187 -0.0061 0.0084  0.0245  126  PRO A CB    
1056 C CG    . PRO A 126 ? 0.3857 0.4205 0.3467 -0.0097 0.0103  0.0264  126  PRO A CG    
1057 C CD    . PRO A 126 ? 0.3488 0.3889 0.3089 -0.0082 0.0144  0.0293  126  PRO A CD    
1058 N N     . SER A 127 ? 0.3785 0.3940 0.3221 -0.0090 0.0116  0.0318  127  SER A N     
1059 C CA    . SER A 127 ? 0.3806 0.3865 0.3182 -0.0098 0.0107  0.0335  127  SER A CA    
1060 C C     . SER A 127 ? 0.4128 0.4146 0.3417 -0.0067 0.0129  0.0360  127  SER A C     
1061 O O     . SER A 127 ? 0.4406 0.4333 0.3622 -0.0053 0.0114  0.0365  127  SER A O     
1062 C CB    . SER A 127 ? 0.3799 0.3847 0.3209 -0.0157 0.0116  0.0361  127  SER A CB    
1063 O OG    . SER A 127 ? 0.3586 0.3696 0.3020 -0.0183 0.0161  0.0400  127  SER A OG    
1064 N N     . GLN A 128 ? 0.3980 0.4061 0.3269 -0.0052 0.0166  0.0374  128  GLN A N     
1065 C CA    . GLN A 128 ? 0.4136 0.4182 0.3335 -0.0017 0.0191  0.0396  128  GLN A CA    
1066 C C     . GLN A 128 ? 0.3878 0.3908 0.3026 0.0037  0.0168  0.0361  128  GLN A C     
1067 O O     . GLN A 128 ? 0.3587 0.3545 0.2643 0.0070  0.0157  0.0363  128  GLN A O     
1068 C CB    . GLN A 128 ? 0.4518 0.4642 0.3738 -0.0027 0.0248  0.0432  128  GLN A CB    
1069 C CG    . GLN A 128 ? 0.5243 0.5393 0.4518 -0.0089 0.0275  0.0472  128  GLN A CG    
1070 C CD    . GLN A 128 ? 0.5968 0.6014 0.5165 -0.0105 0.0281  0.0504  128  GLN A CD    
1071 O OE1   . GLN A 128 ? 0.6400 0.6381 0.5601 -0.0138 0.0252  0.0501  128  GLN A OE1   
1072 N NE2   . GLN A 128 ? 0.6424 0.6446 0.5538 -0.0079 0.0319  0.0536  128  GLN A NE2   
1073 N N     . ALA A 129 ? 0.3419 0.3510 0.2623 0.0045  0.0158  0.0331  129  ALA A N     
1074 C CA    . ALA A 129 ? 0.3289 0.3368 0.2453 0.0088  0.0137  0.0297  129  ALA A CA    
1075 C C     . ALA A 129 ? 0.3423 0.3461 0.2483 0.0130  0.0155  0.0309  129  ALA A C     
1076 O O     . ALA A 129 ? 0.3245 0.3220 0.2236 0.0160  0.0122  0.0288  129  ALA A O     
1077 C CB    . ALA A 129 ? 0.2955 0.2994 0.2126 0.0091  0.0084  0.0261  129  ALA A CB    
1078 N N     . LYS A 130 ? 0.3610 0.3686 0.2657 0.0135  0.0206  0.0341  130  LYS A N     
1079 C CA    . LYS A 130 ? 0.3730 0.3762 0.2668 0.0177  0.0230  0.0358  130  LYS A CA    
1080 C C     . LYS A 130 ? 0.3522 0.3561 0.2416 0.0223  0.0232  0.0332  130  LYS A C     
1081 O O     . LYS A 130 ? 0.3431 0.3423 0.2221 0.0264  0.0246  0.0339  130  LYS A O     
1082 C CB    . LYS A 130 ? 0.4198 0.4258 0.3129 0.0162  0.0289  0.0411  130  LYS A CB    
1083 C CG    . LYS A 130 ? 0.4481 0.4656 0.3503 0.0144  0.0333  0.0429  130  LYS A CG    
1084 C CD    . LYS A 130 ? 0.4991 0.5198 0.4008 0.0125  0.0393  0.0485  130  LYS A CD    
1085 C CE    . LYS A 130 ? 0.5342 0.5678 0.4449 0.0116  0.0440  0.0503  130  LYS A CE    
1086 N NZ    . LYS A 130 ? 0.5702 0.6087 0.4828 0.0084  0.0498  0.0560  130  LYS A NZ    
1087 N N     . HIS A 131 ? 0.3298 0.3385 0.2261 0.0218  0.0216  0.0303  131  HIS A N     
1088 C CA    . HIS A 131 ? 0.3346 0.3428 0.2267 0.0259  0.0216  0.0277  131  HIS A CA    
1089 C C     . HIS A 131 ? 0.3077 0.3115 0.1995 0.0260  0.0159  0.0230  131  HIS A C     
1090 O O     . HIS A 131 ? 0.3059 0.3111 0.2050 0.0225  0.0129  0.0216  131  HIS A O     
1091 C CB    . HIS A 131 ? 0.3435 0.3609 0.2428 0.0259  0.0253  0.0287  131  HIS A CB    
1092 C CG    . HIS A 131 ? 0.3543 0.3780 0.2552 0.0256  0.0312  0.0333  131  HIS A CG    
1093 N ND1   . HIS A 131 ? 0.4139 0.4459 0.3255 0.0210  0.0330  0.0358  131  HIS A ND1   
1094 C CD2   . HIS A 131 ? 0.3756 0.3986 0.2687 0.0292  0.0357  0.0361  131  HIS A CD2   
1095 C CE1   . HIS A 131 ? 0.3781 0.4150 0.2894 0.0213  0.0384  0.0400  131  HIS A CE1   
1096 N NE2   . HIS A 131 ? 0.4320 0.4637 0.3321 0.0264  0.0404  0.0404  131  HIS A NE2   
1097 N N     . PRO A 132 ? 0.3065 0.3049 0.1897 0.0298  0.0145  0.0205  132  PRO A N     
1098 C CA    . PRO A 132 ? 0.3014 0.2958 0.1844 0.0294  0.0091  0.0162  132  PRO A CA    
1099 C C     . PRO A 132 ? 0.2889 0.2884 0.1815 0.0267  0.0084  0.0144  132  PRO A C     
1100 O O     . PRO A 132 ? 0.2850 0.2895 0.1810 0.0273  0.0118  0.0155  132  PRO A O     
1101 C CB    . PRO A 132 ? 0.3110 0.2990 0.1828 0.0339  0.0089  0.0143  132  PRO A CB    
1102 C CG    . PRO A 132 ? 0.3111 0.2974 0.1747 0.0371  0.0130  0.0177  132  PRO A CG    
1103 C CD    . PRO A 132 ? 0.3304 0.3252 0.2027 0.0347  0.0177  0.0218  132  PRO A CD    
1104 N N     . ILE A 133 ? 0.2799 0.2787 0.1770 0.0241  0.0040  0.0118  133  ILE A N     
1105 C CA    . ILE A 133 ? 0.2562 0.2580 0.1602 0.0220  0.0029  0.0096  133  ILE A CA    
1106 C C     . ILE A 133 ? 0.2744 0.2705 0.1713 0.0243  0.0014  0.0068  133  ILE A C     
1107 O O     . ILE A 133 ? 0.2914 0.2821 0.1831 0.0246  -0.0022 0.0046  133  ILE A O     
1108 C CB    . ILE A 133 ? 0.2550 0.2583 0.1660 0.0185  -0.0006 0.0080  133  ILE A CB    
1109 C CG1   . ILE A 133 ? 0.2435 0.2508 0.1603 0.0164  0.0007  0.0106  133  ILE A CG1   
1110 C CG2   . ILE A 133 ? 0.2774 0.2829 0.1941 0.0166  -0.0017 0.0057  133  ILE A CG2   
1111 C CD1   . ILE A 133 ? 0.2507 0.2581 0.1722 0.0142  -0.0027 0.0094  133  ILE A CD1   
1112 N N     . ASP A 134 ? 0.2786 0.2758 0.1750 0.0259  0.0041  0.0069  134  ASP A N     
1113 C CA    . ASP A 134 ? 0.2654 0.2555 0.1533 0.0285  0.0030  0.0044  134  ASP A CA    
1114 C C     . ASP A 134 ? 0.2656 0.2545 0.1569 0.0264  0.0012  0.0019  134  ASP A C     
1115 O O     . ASP A 134 ? 0.3001 0.2819 0.1842 0.0279  0.0000  -0.0001 134  ASP A O     
1116 C CB    . ASP A 134 ? 0.2940 0.2827 0.1743 0.0336  0.0073  0.0061  134  ASP A CB    
1117 C CG    . ASP A 134 ? 0.2966 0.2940 0.1839 0.0342  0.0118  0.0089  134  ASP A CG    
1118 O OD1   . ASP A 134 ? 0.3231 0.3252 0.2188 0.0315  0.0114  0.0086  134  ASP A OD1   
1119 O OD2   . ASP A 134 ? 0.2896 0.2896 0.1738 0.0376  0.0159  0.0115  134  ASP A OD2   
1120 N N     . ALA A 135 ? 0.2447 0.2397 0.1460 0.0228  0.0010  0.0023  135  ALA A N     
1121 C CA    . ALA A 135 ? 0.2496 0.2437 0.1545 0.0203  -0.0006 0.0002  135  ALA A CA    
1122 C C     . ALA A 135 ? 0.2348 0.2353 0.1500 0.0163  -0.0015 0.0004  135  ALA A C     
1123 O O     . ALA A 135 ? 0.2486 0.2551 0.1691 0.0160  0.0003  0.0026  135  ALA A O     
1124 C CB    . ALA A 135 ? 0.2601 0.2538 0.1633 0.0227  0.0022  0.0007  135  ALA A CB    
1125 N N     . ILE A 136 ? 0.2401 0.2393 0.1580 0.0132  -0.0045 -0.0017 136  ILE A N     
1126 C CA    . ILE A 136 ? 0.2347 0.2395 0.1617 0.0100  -0.0049 -0.0018 136  ILE A CA    
1127 C C     . ILE A 136 ? 0.2203 0.2228 0.1480 0.0079  -0.0056 -0.0036 136  ILE A C     
1128 O O     . ILE A 136 ? 0.2294 0.2268 0.1533 0.0068  -0.0079 -0.0056 136  ILE A O     
1129 C CB    . ILE A 136 ? 0.2294 0.2367 0.1605 0.0081  -0.0077 -0.0025 136  ILE A CB    
1130 C CG1   . ILE A 136 ? 0.2297 0.2373 0.1583 0.0102  -0.0073 -0.0006 136  ILE A CG1   
1131 C CG2   . ILE A 136 ? 0.2407 0.2536 0.1805 0.0056  -0.0075 -0.0024 136  ILE A CG2   
1132 C CD1   . ILE A 136 ? 0.2668 0.2750 0.1972 0.0095  -0.0104 -0.0013 136  ILE A CD1   
1133 N N     . THR A 137 ? 0.2262 0.2320 0.1584 0.0071  -0.0037 -0.0028 137  THR A N     
1134 C CA    . THR A 137 ? 0.2159 0.2202 0.1498 0.0045  -0.0041 -0.0040 137  THR A CA    
1135 C C     . THR A 137 ? 0.2161 0.2268 0.1584 0.0019  -0.0043 -0.0040 137  THR A C     
1136 O O     . THR A 137 ? 0.2142 0.2295 0.1601 0.0027  -0.0029 -0.0025 137  THR A O     
1137 C CB    . THR A 137 ? 0.2323 0.2334 0.1624 0.0062  -0.0018 -0.0034 137  THR A CB    
1138 O OG1   . THR A 137 ? 0.2511 0.2451 0.1725 0.0089  -0.0018 -0.0038 137  THR A OG1   
1139 C CG2   . THR A 137 ? 0.2317 0.2308 0.1633 0.0032  -0.0020 -0.0043 137  THR A CG2   
1140 N N     . HIS A 138 ? 0.2120 0.2231 0.1572 -0.0009 -0.0061 -0.0056 138  HIS A N     
1141 C CA    . HIS A 138 ? 0.2035 0.2206 0.1562 -0.0028 -0.0064 -0.0058 138  HIS A CA    
1142 C C     . HIS A 138 ? 0.2013 0.2181 0.1561 -0.0058 -0.0059 -0.0067 138  HIS A C     
1143 O O     . HIS A 138 ? 0.2198 0.2344 0.1740 -0.0082 -0.0075 -0.0080 138  HIS A O     
1144 C CB    . HIS A 138 ? 0.2178 0.2373 0.1728 -0.0031 -0.0092 -0.0067 138  HIS A CB    
1145 C CG    . HIS A 138 ? 0.2206 0.2462 0.1829 -0.0041 -0.0097 -0.0071 138  HIS A CG    
1146 N ND1   . HIS A 138 ? 0.2246 0.2529 0.1890 -0.0024 -0.0103 -0.0065 138  HIS A ND1   
1147 C CD2   . HIS A 138 ? 0.2094 0.2386 0.1769 -0.0065 -0.0094 -0.0080 138  HIS A CD2   
1148 C CE1   . HIS A 138 ? 0.2101 0.2432 0.1804 -0.0032 -0.0106 -0.0072 138  HIS A CE1   
1149 N NE2   . HIS A 138 ? 0.2151 0.2495 0.1877 -0.0056 -0.0099 -0.0081 138  HIS A NE2   
1150 N N     . TYR A 139 ? 0.1855 0.2041 0.1422 -0.0059 -0.0036 -0.0058 139  TYR A N     
1151 C CA    . TYR A 139 ? 0.1998 0.2182 0.1581 -0.0086 -0.0025 -0.0061 139  TYR A CA    
1152 C C     . TYR A 139 ? 0.1968 0.2220 0.1625 -0.0102 -0.0026 -0.0067 139  TYR A C     
1153 O O     . TYR A 139 ? 0.2120 0.2412 0.1806 -0.0084 -0.0024 -0.0063 139  TYR A O     
1154 C CB    . TYR A 139 ? 0.1924 0.2084 0.1477 -0.0073 0.0000  -0.0048 139  TYR A CB    
1155 C CG    . TYR A 139 ? 0.2069 0.2225 0.1633 -0.0099 0.0016  -0.0048 139  TYR A CG    
1156 C CD1   . TYR A 139 ? 0.2186 0.2393 0.1794 -0.0101 0.0029  -0.0045 139  TYR A CD1   
1157 C CD2   . TYR A 139 ? 0.2349 0.2443 0.1873 -0.0123 0.0019  -0.0050 139  TYR A CD2   
1158 C CE1   . TYR A 139 ? 0.2152 0.2356 0.1765 -0.0123 0.0049  -0.0043 139  TYR A CE1   
1159 C CE2   . TYR A 139 ? 0.2465 0.2552 0.1996 -0.0151 0.0039  -0.0046 139  TYR A CE2   
1160 C CZ    . TYR A 139 ? 0.2514 0.2661 0.2091 -0.0150 0.0056  -0.0042 139  TYR A CZ    
1161 O OH    . TYR A 139 ? 0.2914 0.3054 0.2492 -0.0175 0.0080  -0.0035 139  TYR A OH    
1162 N N     . ASP A 140 ? 0.1930 0.2194 0.1615 -0.0134 -0.0030 -0.0076 140  ASP A N     
1163 C CA    . ASP A 140 ? 0.1929 0.2268 0.1689 -0.0147 -0.0028 -0.0082 140  ASP A CA    
1164 C C     . ASP A 140 ? 0.1956 0.2299 0.1726 -0.0170 0.0001  -0.0076 140  ASP A C     
1165 O O     . ASP A 140 ? 0.2148 0.2452 0.1896 -0.0200 0.0006  -0.0076 140  ASP A O     
1166 C CB    . ASP A 140 ? 0.2005 0.2375 0.1803 -0.0167 -0.0057 -0.0096 140  ASP A CB    
1167 C CG    . ASP A 140 ? 0.2123 0.2584 0.2005 -0.0174 -0.0056 -0.0102 140  ASP A CG    
1168 O OD1   . ASP A 140 ? 0.2306 0.2796 0.2222 -0.0201 -0.0033 -0.0100 140  ASP A OD1   
1169 O OD2   . ASP A 140 ? 0.2346 0.2848 0.2257 -0.0150 -0.0076 -0.0108 140  ASP A OD2   
1170 N N     . SER A 141 ? 0.1969 0.2352 0.1766 -0.0156 0.0021  -0.0072 141  SER A N     
1171 C CA    . SER A 141 ? 0.2136 0.2516 0.1927 -0.0170 0.0053  -0.0063 141  SER A CA    
1172 C C     . SER A 141 ? 0.2233 0.2660 0.2080 -0.0209 0.0065  -0.0066 141  SER A C     
1173 O O     . SER A 141 ? 0.2442 0.2848 0.2272 -0.0232 0.0093  -0.0056 141  SER A O     
1174 C CB    . SER A 141 ? 0.2298 0.2703 0.2092 -0.0140 0.0069  -0.0059 141  SER A CB    
1175 O OG    . SER A 141 ? 0.2184 0.2660 0.2040 -0.0132 0.0065  -0.0069 141  SER A OG    
1176 N N     . ILE A 142 ? 0.2193 0.2686 0.2104 -0.0215 0.0044  -0.0078 142  ILE A N     
1177 C CA    . ILE A 142 ? 0.2300 0.2859 0.2280 -0.0254 0.0051  -0.0081 142  ILE A CA    
1178 C C     . ILE A 142 ? 0.2437 0.2948 0.2399 -0.0302 0.0037  -0.0083 142  ILE A C     
1179 O O     . ILE A 142 ? 0.2440 0.2950 0.2414 -0.0345 0.0060  -0.0076 142  ILE A O     
1180 C CB    . ILE A 142 ? 0.2326 0.2986 0.2389 -0.0238 0.0033  -0.0094 142  ILE A CB    
1181 C CG1   . ILE A 142 ? 0.2409 0.3105 0.2482 -0.0195 0.0055  -0.0092 142  ILE A CG1   
1182 C CG2   . ILE A 142 ? 0.2456 0.3199 0.2602 -0.0282 0.0035  -0.0098 142  ILE A CG2   
1183 C CD1   . ILE A 142 ? 0.2059 0.2840 0.2199 -0.0166 0.0038  -0.0103 142  ILE A CD1   
1184 N N     . ASP A 143 ? 0.2409 0.2872 0.2334 -0.0294 0.0001  -0.0093 143  ASP A N     
1185 C CA    . ASP A 143 ? 0.2651 0.3045 0.2536 -0.0334 -0.0016 -0.0098 143  ASP A CA    
1186 C C     . ASP A 143 ? 0.2725 0.3008 0.2517 -0.0336 0.0006  -0.0085 143  ASP A C     
1187 O O     . ASP A 143 ? 0.2695 0.2915 0.2454 -0.0378 0.0005  -0.0085 143  ASP A O     
1188 C CB    . ASP A 143 ? 0.2990 0.3358 0.2848 -0.0316 -0.0060 -0.0112 143  ASP A CB    
1189 C CG    . ASP A 143 ? 0.3282 0.3749 0.3223 -0.0313 -0.0090 -0.0126 143  ASP A CG    
1190 O OD1   . ASP A 143 ? 0.3136 0.3696 0.3163 -0.0335 -0.0079 -0.0126 143  ASP A OD1   
1191 O OD2   . ASP A 143 ? 0.3534 0.3988 0.3451 -0.0286 -0.0123 -0.0135 143  ASP A OD2   
1192 N N     . ASP A 144 ? 0.2386 0.2647 0.2137 -0.0292 0.0025  -0.0074 144  ASP A N     
1193 C CA    . ASP A 144 ? 0.2495 0.2655 0.2153 -0.0278 0.0040  -0.0062 144  ASP A CA    
1194 C C     . ASP A 144 ? 0.2660 0.2735 0.2251 -0.0276 0.0013  -0.0071 144  ASP A C     
1195 O O     . ASP A 144 ? 0.2847 0.2829 0.2370 -0.0294 0.0018  -0.0067 144  ASP A O     
1196 C CB    . ASP A 144 ? 0.2589 0.2716 0.2230 -0.0313 0.0074  -0.0049 144  ASP A CB    
1197 C CG    . ASP A 144 ? 0.2784 0.2813 0.2328 -0.0288 0.0092  -0.0034 144  ASP A CG    
1198 O OD1   . ASP A 144 ? 0.3142 0.3163 0.2655 -0.0239 0.0088  -0.0032 144  ASP A OD1   
1199 O OD2   . ASP A 144 ? 0.3078 0.3038 0.2578 -0.0319 0.0110  -0.0024 144  ASP A OD2   
1200 N N     . ARG A 145 ? 0.2396 0.2497 0.1998 -0.0252 -0.0014 -0.0082 145  ARG A N     
1201 C CA    . ARG A 145 ? 0.2464 0.2488 0.1996 -0.0242 -0.0040 -0.0092 145  ARG A CA    
1202 C C     . ARG A 145 ? 0.2485 0.2514 0.1991 -0.0188 -0.0045 -0.0088 145  ARG A C     
1203 O O     . ARG A 145 ? 0.2478 0.2582 0.2039 -0.0169 -0.0044 -0.0085 145  ARG A O     
1204 C CB    . ARG A 145 ? 0.2537 0.2578 0.2101 -0.0278 -0.0076 -0.0111 145  ARG A CB    
1205 C CG    . ARG A 145 ? 0.2389 0.2423 0.1980 -0.0342 -0.0075 -0.0115 145  ARG A CG    
1206 C CD    . ARG A 145 ? 0.3056 0.2957 0.2548 -0.0360 -0.0069 -0.0113 145  ARG A CD    
1207 N NE    . ARG A 145 ? 0.3182 0.3070 0.2699 -0.0430 -0.0069 -0.0114 145  ARG A NE    
1208 C CZ    . ARG A 145 ? 0.3648 0.3541 0.3183 -0.0458 -0.0031 -0.0097 145  ARG A CZ    
1209 N NH1   . ARG A 145 ? 0.3267 0.3178 0.2796 -0.0419 0.0004  -0.0078 145  ARG A NH1   
1210 N NH2   . ARG A 145 ? 0.4010 0.3890 0.3568 -0.0527 -0.0030 -0.0097 145  ARG A NH2   
1211 N N     . PHE A 146 ? 0.2268 0.2214 0.1689 -0.0163 -0.0049 -0.0088 146  PHE A N     
1212 C CA    . PHE A 146 ? 0.2291 0.2239 0.1681 -0.0115 -0.0051 -0.0084 146  PHE A CA    
1213 C C     . PHE A 146 ? 0.2370 0.2297 0.1737 -0.0116 -0.0084 -0.0100 146  PHE A C     
1214 O O     . PHE A 146 ? 0.2654 0.2498 0.1953 -0.0125 -0.0098 -0.0111 146  PHE A O     
1215 C CB    . PHE A 146 ? 0.2162 0.2037 0.1469 -0.0079 -0.0033 -0.0073 146  PHE A CB    
1216 C CG    . PHE A 146 ? 0.2435 0.2323 0.1752 -0.0071 -0.0004 -0.0057 146  PHE A CG    
1217 C CD1   . PHE A 146 ? 0.2575 0.2421 0.1878 -0.0100 0.0007  -0.0055 146  PHE A CD1   
1218 C CD2   . PHE A 146 ? 0.2387 0.2328 0.1725 -0.0035 0.0008  -0.0043 146  PHE A CD2   
1219 C CE1   . PHE A 146 ? 0.2522 0.2375 0.1823 -0.0088 0.0031  -0.0040 146  PHE A CE1   
1220 C CE2   . PHE A 146 ? 0.2641 0.2594 0.1983 -0.0025 0.0028  -0.0031 146  PHE A CE2   
1221 C CZ    . PHE A 146 ? 0.2544 0.2451 0.1863 -0.0049 0.0040  -0.0029 146  PHE A CZ    
1222 N N     . TYR A 147 ? 0.2294 0.2288 0.1709 -0.0105 -0.0098 -0.0101 147  TYR A N     
1223 C CA    . TYR A 147 ? 0.2531 0.2511 0.1921 -0.0100 -0.0132 -0.0115 147  TYR A CA    
1224 C C     . TYR A 147 ? 0.2532 0.2480 0.1856 -0.0052 -0.0124 -0.0105 147  TYR A C     
1225 O O     . TYR A 147 ? 0.2638 0.2635 0.1990 -0.0027 -0.0107 -0.0089 147  TYR A O     
1226 C CB    . TYR A 147 ? 0.2592 0.2659 0.2065 -0.0112 -0.0152 -0.0121 147  TYR A CB    
1227 C CG    . TYR A 147 ? 0.2339 0.2450 0.1883 -0.0159 -0.0161 -0.0131 147  TYR A CG    
1228 C CD1   . TYR A 147 ? 0.2352 0.2520 0.1961 -0.0172 -0.0133 -0.0121 147  TYR A CD1   
1229 C CD2   . TYR A 147 ? 0.2677 0.2775 0.2221 -0.0193 -0.0197 -0.0151 147  TYR A CD2   
1230 C CE1   . TYR A 147 ? 0.2181 0.2398 0.1857 -0.0215 -0.0135 -0.0128 147  TYR A CE1   
1231 C CE2   . TYR A 147 ? 0.2706 0.2857 0.2325 -0.0242 -0.0202 -0.0158 147  TYR A CE2   
1232 C CZ    . TYR A 147 ? 0.2482 0.2695 0.2168 -0.0252 -0.0169 -0.0146 147  TYR A CZ    
1233 O OH    . TYR A 147 ? 0.2466 0.2740 0.2229 -0.0299 -0.0169 -0.0151 147  TYR A OH    
1234 N N     . VAL A 148 ? 0.2565 0.2427 0.1799 -0.0039 -0.0134 -0.0114 148  VAL A N     
1235 C CA    . VAL A 148 ? 0.2490 0.2317 0.1650 0.0010  -0.0119 -0.0104 148  VAL A CA    
1236 C C     . VAL A 148 ? 0.2642 0.2448 0.1759 0.0024  -0.0148 -0.0115 148  VAL A C     
1237 O O     . VAL A 148 ? 0.2924 0.2671 0.1994 0.0007  -0.0180 -0.0137 148  VAL A O     
1238 C CB    . VAL A 148 ? 0.2769 0.2504 0.1840 0.0030  -0.0103 -0.0105 148  VAL A CB    
1239 C CG1   . VAL A 148 ? 0.2712 0.2422 0.1711 0.0088  -0.0084 -0.0093 148  VAL A CG1   
1240 C CG2   . VAL A 148 ? 0.2704 0.2456 0.1811 0.0021  -0.0076 -0.0092 148  VAL A CG2   
1241 N N     . PHE A 149 ? 0.2533 0.2385 0.1662 0.0053  -0.0138 -0.0099 149  PHE A N     
1242 C CA    . PHE A 149 ? 0.2719 0.2551 0.1798 0.0073  -0.0161 -0.0103 149  PHE A CA    
1243 C C     . PHE A 149 ? 0.2725 0.2516 0.1719 0.0123  -0.0132 -0.0088 149  PHE A C     
1244 O O     . PHE A 149 ? 0.2676 0.2515 0.1697 0.0142  -0.0097 -0.0063 149  PHE A O     
1245 C CB    . PHE A 149 ? 0.2751 0.2659 0.1901 0.0070  -0.0169 -0.0093 149  PHE A CB    
1246 C CG    . PHE A 149 ? 0.2583 0.2547 0.1824 0.0030  -0.0192 -0.0106 149  PHE A CG    
1247 C CD1   . PHE A 149 ? 0.2557 0.2569 0.1872 0.0008  -0.0170 -0.0099 149  PHE A CD1   
1248 C CD2   . PHE A 149 ? 0.3037 0.3013 0.2289 0.0018  -0.0236 -0.0123 149  PHE A CD2   
1249 C CE1   . PHE A 149 ? 0.2624 0.2694 0.2022 -0.0023 -0.0186 -0.0109 149  PHE A CE1   
1250 C CE2   . PHE A 149 ? 0.2912 0.2955 0.2257 -0.0013 -0.0255 -0.0134 149  PHE A CE2   
1251 C CZ    . PHE A 149 ? 0.2856 0.2946 0.2273 -0.0034 -0.0227 -0.0126 149  PHE A CZ    
1252 N N     . ASP A 150 ? 0.2760 0.2464 0.1650 0.0142  -0.0147 -0.0104 150  ASP A N     
1253 C CA    . ASP A 150 ? 0.2832 0.2485 0.1628 0.0194  -0.0116 -0.0093 150  ASP A CA    
1254 C C     . ASP A 150 ? 0.3009 0.2621 0.1717 0.0226  -0.0129 -0.0095 150  ASP A C     
1255 O O     . ASP A 150 ? 0.3320 0.2867 0.1967 0.0218  -0.0171 -0.0122 150  ASP A O     
1256 C CB    . ASP A 150 ? 0.2776 0.2340 0.1502 0.0198  -0.0116 -0.0110 150  ASP A CB    
1257 C CG    . ASP A 150 ? 0.3115 0.2625 0.1740 0.0259  -0.0083 -0.0101 150  ASP A CG    
1258 O OD1   . ASP A 150 ? 0.3254 0.2813 0.1878 0.0296  -0.0051 -0.0077 150  ASP A OD1   
1259 O OD2   . ASP A 150 ? 0.3183 0.2597 0.1726 0.0271  -0.0087 -0.0118 150  ASP A OD2   
1260 N N     . LEU A 151 ? 0.2824 0.2476 0.1526 0.0261  -0.0094 -0.0067 151  LEU A N     
1261 C CA    . LEU A 151 ? 0.2963 0.2574 0.1573 0.0296  -0.0098 -0.0063 151  LEU A CA    
1262 C C     . LEU A 151 ? 0.3310 0.2837 0.1793 0.0347  -0.0079 -0.0069 151  LEU A C     
1263 O O     . LEU A 151 ? 0.3433 0.2984 0.1911 0.0380  -0.0030 -0.0047 151  LEU A O     
1264 C CB    . LEU A 151 ? 0.2984 0.2668 0.1637 0.0307  -0.0067 -0.0027 151  LEU A CB    
1265 C CG    . LEU A 151 ? 0.3151 0.2795 0.1706 0.0345  -0.0064 -0.0017 151  LEU A CG    
1266 C CD1   . LEU A 151 ? 0.3335 0.2933 0.1855 0.0331  -0.0125 -0.0043 151  LEU A CD1   
1267 C CD2   . LEU A 151 ? 0.3165 0.2877 0.1764 0.0350  -0.0025 0.0023  151  LEU A CD2   
1268 N N     . LEU A 152 ? 0.3284 0.2715 0.1664 0.0355  -0.0118 -0.0099 152  LEU A N     
1269 C CA    . LEU A 152 ? 0.3915 0.3243 0.2153 0.0407  -0.0106 -0.0110 152  LEU A CA    
1270 C C     . LEU A 152 ? 0.3933 0.3245 0.2076 0.0464  -0.0079 -0.0092 152  LEU A C     
1271 O O     . LEU A 152 ? 0.3931 0.3194 0.1978 0.0519  -0.0044 -0.0087 152  LEU A O     
1272 C CB    . LEU A 152 ? 0.4020 0.3234 0.2177 0.0387  -0.0163 -0.0154 152  LEU A CB    
1273 C CG    . LEU A 152 ? 0.3913 0.3119 0.2139 0.0329  -0.0191 -0.0175 152  LEU A CG    
1274 C CD1   . LEU A 152 ? 0.4646 0.3721 0.2764 0.0317  -0.0243 -0.0216 152  LEU A CD1   
1275 C CD2   . LEU A 152 ? 0.4236 0.3466 0.2506 0.0337  -0.0145 -0.0158 152  LEU A CD2   
1276 N N     . ASN A 153 ? 0.3929 0.3278 0.2093 0.0453  -0.0093 -0.0080 153  ASN A N     
1277 C CA    . ASN A 153 ? 0.4198 0.3531 0.2271 0.0503  -0.0066 -0.0058 153  ASN A CA    
1278 C C     . ASN A 153 ? 0.4109 0.3545 0.2271 0.0494  -0.0028 -0.0014 153  ASN A C     
1279 O O     . ASN A 153 ? 0.3999 0.3483 0.2248 0.0453  -0.0056 -0.0011 153  ASN A O     
1280 C CB    . ASN A 153 ? 0.4552 0.3796 0.2515 0.0511  -0.0122 -0.0085 153  ASN A CB    
1281 C CG    . ASN A 153 ? 0.5320 0.4447 0.3178 0.0520  -0.0162 -0.0129 153  ASN A CG    
1282 O OD1   . ASN A 153 ? 0.5932 0.4990 0.3684 0.0569  -0.0131 -0.0132 153  ASN A OD1   
1283 N ND2   . ASN A 153 ? 0.5623 0.4724 0.3507 0.0471  -0.0229 -0.0163 153  ASN A ND2   
1284 N N     . SER A 154 ? 0.4095 0.3562 0.2232 0.0535  0.0034  0.0019  154  SER A N     
1285 C CA    . SER A 154 ? 0.4203 0.3768 0.2425 0.0523  0.0079  0.0064  154  SER A CA    
1286 C C     . SER A 154 ? 0.4325 0.3881 0.2453 0.0577  0.0134  0.0096  154  SER A C     
1287 O O     . SER A 154 ? 0.4577 0.4074 0.2596 0.0630  0.0151  0.0085  154  SER A O     
1288 C CB    . SER A 154 ? 0.4116 0.3774 0.2466 0.0500  0.0109  0.0077  154  SER A CB    
1289 O OG    . SER A 154 ? 0.4143 0.3893 0.2565 0.0492  0.0158  0.0121  154  SER A OG    
1290 N N     . PRO A 155 ? 0.4450 0.4063 0.2616 0.0566  0.0164  0.0137  155  PRO A N     
1291 C CA    . PRO A 155 ? 0.4564 0.4189 0.2659 0.0612  0.0230  0.0175  155  PRO A CA    
1292 C C     . PRO A 155 ? 0.4586 0.4288 0.2727 0.0636  0.0290  0.0193  155  PRO A C     
1293 O O     . PRO A 155 ? 0.4604 0.4312 0.2673 0.0687  0.0345  0.0217  155  PRO A O     
1294 C CB    . PRO A 155 ? 0.4673 0.4351 0.2831 0.0576  0.0246  0.0216  155  PRO A CB    
1295 C CG    . PRO A 155 ? 0.4476 0.4195 0.2764 0.0514  0.0202  0.0201  155  PRO A CG    
1296 C CD    . PRO A 155 ? 0.4278 0.3931 0.2535 0.0514  0.0139  0.0149  155  PRO A CD    
1297 N N     . TYR A 156 ? 0.4388 0.4148 0.2644 0.0605  0.0279  0.0181  156  TYR A N     
1298 C CA    . TYR A 156 ? 0.4413 0.4246 0.2716 0.0631  0.0327  0.0194  156  TYR A CA    
1299 C C     . TYR A 156 ? 0.4543 0.4299 0.2768 0.0672  0.0310  0.0155  156  TYR A C     
1300 O O     . TYR A 156 ? 0.4476 0.4282 0.2744 0.0693  0.0336  0.0157  156  TYR A O     
1301 C CB    . TYR A 156 ? 0.4318 0.4267 0.2789 0.0576  0.0332  0.0210  156  TYR A CB    
1302 C CG    . TYR A 156 ? 0.4527 0.4540 0.3069 0.0532  0.0349  0.0248  156  TYR A CG    
1303 C CD1   . TYR A 156 ? 0.4903 0.4932 0.3393 0.0556  0.0399  0.0287  156  TYR A CD1   
1304 C CD2   . TYR A 156 ? 0.4227 0.4275 0.2879 0.0469  0.0316  0.0246  156  TYR A CD2   
1305 C CE1   . TYR A 156 ? 0.5048 0.5119 0.3593 0.0512  0.0415  0.0324  156  TYR A CE1   
1306 C CE2   . TYR A 156 ? 0.4532 0.4620 0.3237 0.0429  0.0329  0.0280  156  TYR A CE2   
1307 C CZ    . TYR A 156 ? 0.4843 0.4940 0.3494 0.0449  0.0378  0.0319  156  TYR A CZ    
1308 O OH    . TYR A 156 ? 0.4972 0.5097 0.3667 0.0406  0.0391  0.0354  156  TYR A OH    
1309 N N     . GLY A 157 ? 0.4519 0.4151 0.2628 0.0684  0.0262  0.0119  157  GLY A N     
1310 C CA    . GLY A 157 ? 0.4810 0.4340 0.2814 0.0725  0.0244  0.0081  157  GLY A CA    
1311 C C     . GLY A 157 ? 0.4752 0.4189 0.2736 0.0685  0.0169  0.0034  157  GLY A C     
1312 O O     . GLY A 157 ? 0.4625 0.4106 0.2720 0.0622  0.0135  0.0030  157  GLY A O     
1313 N N     . ASN A 158 ? 0.4788 0.4095 0.2626 0.0723  0.0144  0.0000  158  ASN A N     
1314 C CA    . ASN A 158 ? 0.4690 0.3901 0.2499 0.0686  0.0073  -0.0045 158  ASN A CA    
1315 C C     . ASN A 158 ? 0.4612 0.3780 0.2413 0.0696  0.0074  -0.0065 158  ASN A C     
1316 O O     . ASN A 158 ? 0.4822 0.3953 0.2537 0.0761  0.0114  -0.0062 158  ASN A O     
1317 C CB    . ASN A 158 ? 0.4766 0.3848 0.2411 0.0713  0.0034  -0.0074 158  ASN A CB    
1318 C CG    . ASN A 158 ? 0.4876 0.3987 0.2517 0.0706  0.0026  -0.0056 158  ASN A CG    
1319 O OD1   . ASN A 158 ? 0.4674 0.3888 0.2443 0.0663  0.0032  -0.0030 158  ASN A OD1   
1320 N ND2   . ASN A 158 ? 0.5563 0.4576 0.3047 0.0751  0.0013  -0.0068 158  ASN A ND2   
1321 N N     . VAL A 159 ? 0.4288 0.3458 0.2174 0.0633  0.0033  -0.0084 159  VAL A N     
1322 C CA    . VAL A 159 ? 0.4188 0.3321 0.2079 0.0634  0.0035  -0.0098 159  VAL A CA    
1323 C C     . VAL A 159 ? 0.4370 0.3390 0.2218 0.0588  -0.0029 -0.0142 159  VAL A C     
1324 O O     . VAL A 159 ? 0.4441 0.3441 0.2293 0.0545  -0.0078 -0.0160 159  VAL A O     
1325 C CB    . VAL A 159 ? 0.3915 0.3179 0.1968 0.0602  0.0062  -0.0071 159  VAL A CB    
1326 C CG1   . VAL A 159 ? 0.3775 0.3152 0.1872 0.0646  0.0127  -0.0028 159  VAL A CG1   
1327 C CG2   . VAL A 159 ? 0.3565 0.2896 0.1743 0.0524  0.0025  -0.0072 159  VAL A CG2   
1328 N N     . GLU A 160 ? 0.4454 0.3400 0.2263 0.0598  -0.0027 -0.0156 160  GLU A N     
1329 C CA    . GLU A 160 ? 0.4700 0.3537 0.2475 0.0547  -0.0083 -0.0194 160  GLU A CA    
1330 C C     . GLU A 160 ? 0.4333 0.3257 0.2265 0.0472  -0.0096 -0.0187 160  GLU A C     
1331 O O     . GLU A 160 ? 0.4178 0.3224 0.2223 0.0472  -0.0058 -0.0155 160  GLU A O     
1332 C CB    . GLU A 160 ? 0.4971 0.3667 0.2612 0.0594  -0.0076 -0.0212 160  GLU A CB    
1333 C CG    . GLU A 160 ? 0.5897 0.4478 0.3358 0.0669  -0.0071 -0.0228 160  GLU A CG    
1334 C CD    . GLU A 160 ? 0.6626 0.5140 0.4017 0.0641  -0.0128 -0.0257 160  GLU A CD    
1335 O OE1   . GLU A 160 ? 0.6881 0.5345 0.4292 0.0570  -0.0188 -0.0286 160  GLU A OE1   
1336 O OE2   . GLU A 160 ? 0.7002 0.5518 0.4320 0.0691  -0.0113 -0.0251 160  GLU A OE2   
1337 N N     . GLU A 161 ? 0.4277 0.3138 0.2213 0.0409  -0.0149 -0.0216 161  GLU A N     
1338 C CA    . GLU A 161 ? 0.4180 0.3112 0.2252 0.0337  -0.0160 -0.0211 161  GLU A CA    
1339 C C     . GLU A 161 ? 0.4034 0.2976 0.2136 0.0352  -0.0120 -0.0193 161  GLU A C     
1340 O O     . GLU A 161 ? 0.4146 0.2988 0.2139 0.0401  -0.0103 -0.0198 161  GLU A O     
1341 C CB    . GLU A 161 ? 0.4499 0.3348 0.2553 0.0270  -0.0220 -0.0246 161  GLU A CB    
1342 C CG    . GLU A 161 ? 0.4833 0.3733 0.2936 0.0228  -0.0267 -0.0260 161  GLU A CG    
1343 C CD    . GLU A 161 ? 0.5359 0.4205 0.3474 0.0152  -0.0326 -0.0292 161  GLU A CD    
1344 O OE1   . GLU A 161 ? 0.5661 0.4488 0.3816 0.0109  -0.0322 -0.0292 161  GLU A OE1   
1345 O OE2   . GLU A 161 ? 0.5725 0.4550 0.3810 0.0134  -0.0378 -0.0315 161  GLU A OE2   
1346 N N     . TRP A 162 ? 0.3763 0.2823 0.2005 0.0314  -0.0106 -0.0172 162  TRP A N     
1347 C CA    . TRP A 162 ? 0.3695 0.2770 0.1977 0.0316  -0.0077 -0.0157 162  TRP A CA    
1348 C C     . TRP A 162 ? 0.3942 0.2893 0.2169 0.0276  -0.0104 -0.0180 162  TRP A C     
1349 O O     . TRP A 162 ? 0.4103 0.3023 0.2342 0.0214  -0.0147 -0.0202 162  TRP A O     
1350 C CB    . TRP A 162 ? 0.3385 0.2610 0.1825 0.0279  -0.0064 -0.0134 162  TRP A CB    
1351 C CG    . TRP A 162 ? 0.3494 0.2741 0.1986 0.0268  -0.0043 -0.0120 162  TRP A CG    
1352 C CD1   . TRP A 162 ? 0.3305 0.2591 0.1804 0.0317  -0.0004 -0.0097 162  TRP A CD1   
1353 C CD2   . TRP A 162 ? 0.3351 0.2595 0.1902 0.0203  -0.0060 -0.0126 162  TRP A CD2   
1354 N NE1   . TRP A 162 ? 0.3157 0.2453 0.1705 0.0289  0.0000  -0.0090 162  TRP A NE1   
1355 C CE2   . TRP A 162 ? 0.3264 0.2532 0.1842 0.0219  -0.0029 -0.0106 162  TRP A CE2   
1356 C CE3   . TRP A 162 ? 0.3461 0.2689 0.2045 0.0133  -0.0097 -0.0145 162  TRP A CE3   
1357 C CZ2   . TRP A 162 ? 0.3153 0.2420 0.1780 0.0169  -0.0032 -0.0104 162  TRP A CZ2   
1358 C CZ3   . TRP A 162 ? 0.3440 0.2676 0.2082 0.0082  -0.0097 -0.0143 162  TRP A CZ3   
1359 C CH2   . TRP A 162 ? 0.3159 0.2411 0.1818 0.0100  -0.0063 -0.0122 162  TRP A CH2   
1360 N N     . SER A 163 ? 0.3920 0.2802 0.2087 0.0311  -0.0080 -0.0173 163  SER A N     
1361 C CA    . SER A 163 ? 0.4103 0.2846 0.2198 0.0278  -0.0100 -0.0191 163  SER A CA    
1362 C C     . SER A 163 ? 0.4111 0.2904 0.2293 0.0245  -0.0081 -0.0171 163  SER A C     
1363 O O     . SER A 163 ? 0.3946 0.2777 0.2138 0.0295  -0.0045 -0.0149 163  SER A O     
1364 C CB    . SER A 163 ? 0.4250 0.2842 0.2179 0.0350  -0.0089 -0.0201 163  SER A CB    
1365 O OG    . SER A 163 ? 0.4671 0.3128 0.2532 0.0326  -0.0098 -0.0210 163  SER A OG    
1366 N N     . ILE A 164 ? 0.4138 0.2935 0.2384 0.0162  -0.0107 -0.0180 164  ILE A N     
1367 C CA    . ILE A 164 ? 0.4101 0.2932 0.2418 0.0126  -0.0089 -0.0162 164  ILE A CA    
1368 C C     . ILE A 164 ? 0.4416 0.3105 0.2619 0.0156  -0.0074 -0.0158 164  ILE A C     
1369 O O     . ILE A 164 ? 0.4249 0.2967 0.2483 0.0166  -0.0047 -0.0136 164  ILE A O     
1370 C CB    . ILE A 164 ? 0.4123 0.2993 0.2532 0.0030  -0.0116 -0.0171 164  ILE A CB    
1371 C CG1   . ILE A 164 ? 0.4188 0.3142 0.2696 0.0003  -0.0089 -0.0147 164  ILE A CG1   
1372 C CG2   . ILE A 164 ? 0.4287 0.3003 0.2606 -0.0020 -0.0152 -0.0197 164  ILE A CG2   
1373 C CD1   . ILE A 164 ? 0.4636 0.3693 0.3271 -0.0071 -0.0103 -0.0149 164  ILE A CD1   
1374 N N     . GLU A 165 ? 0.4578 0.3107 0.2639 0.0174  -0.0093 -0.0181 165  GLU A N     
1375 C CA    . GLU A 165 ? 0.4719 0.3087 0.2650 0.0207  -0.0082 -0.0180 165  GLU A CA    
1376 C C     . GLU A 165 ? 0.4463 0.2863 0.2362 0.0309  -0.0042 -0.0159 165  GLU A C     
1377 O O     . GLU A 165 ? 0.4305 0.2676 0.2186 0.0331  -0.0020 -0.0140 165  GLU A O     
1378 C CB    . GLU A 165 ? 0.5211 0.3390 0.2988 0.0204  -0.0117 -0.0213 165  GLU A CB    
1379 C CG    . GLU A 165 ? 0.5886 0.4028 0.3693 0.0097  -0.0162 -0.0236 165  GLU A CG    
1380 C CD    . GLU A 165 ? 0.6479 0.4723 0.4355 0.0074  -0.0193 -0.0253 165  GLU A CD    
1381 O OE1   . GLU A 165 ? 0.6519 0.4868 0.4427 0.0134  -0.0175 -0.0244 165  GLU A OE1   
1382 O OE2   . GLU A 165 ? 0.6938 0.5159 0.4837 -0.0005 -0.0235 -0.0275 165  GLU A OE2   
1383 N N     . ILE A 166 ? 0.4373 0.2840 0.2268 0.0370  -0.0032 -0.0159 166  ILE A N     
1384 C CA    . ILE A 166 ? 0.4221 0.2752 0.2110 0.0464  0.0007  -0.0137 166  ILE A CA    
1385 C C     . ILE A 166 ? 0.4044 0.2751 0.2085 0.0451  0.0030  -0.0107 166  ILE A C     
1386 O O     . ILE A 166 ? 0.3894 0.2627 0.1935 0.0504  0.0056  -0.0087 166  ILE A O     
1387 C CB    . ILE A 166 ? 0.4164 0.2728 0.2013 0.0527  0.0016  -0.0143 166  ILE A CB    
1388 C CG1   . ILE A 166 ? 0.4487 0.2855 0.2155 0.0560  -0.0002 -0.0172 166  ILE A CG1   
1389 C CG2   . ILE A 166 ? 0.4269 0.2950 0.2155 0.0613  0.0060  -0.0114 166  ILE A CG2   
1390 C CD1   . ILE A 166 ? 0.4503 0.2883 0.2114 0.0616  0.0002  -0.0182 166  ILE A CD1   
1391 N N     . ALA A 167 ? 0.3799 0.2619 0.1966 0.0382  0.0017  -0.0106 167  ALA A N     
1392 C CA    . ALA A 167 ? 0.3638 0.2613 0.1944 0.0362  0.0033  -0.0082 167  ALA A CA    
1393 C C     . ALA A 167 ? 0.3797 0.2735 0.2100 0.0351  0.0043  -0.0069 167  ALA A C     
1394 O O     . ALA A 167 ? 0.3570 0.2599 0.1930 0.0382  0.0064  -0.0047 167  ALA A O     
1395 C CB    . ALA A 167 ? 0.3664 0.2733 0.2082 0.0288  0.0014  -0.0088 167  ALA A CB    
1396 N N     . ALA A 168 ? 0.3864 0.2666 0.2099 0.0305  0.0025  -0.0083 168  ALA A N     
1397 C CA    . ALA A 168 ? 0.4309 0.3052 0.2526 0.0284  0.0034  -0.0070 168  ALA A CA    
1398 C C     . ALA A 168 ? 0.4485 0.3142 0.2595 0.0367  0.0054  -0.0058 168  ALA A C     
1399 O O     . ALA A 168 ? 0.4332 0.2995 0.2451 0.0375  0.0068  -0.0038 168  ALA A O     
1400 C CB    . ALA A 168 ? 0.4254 0.2874 0.2428 0.0204  0.0011  -0.0086 168  ALA A CB    
1401 N N     . LYS A 169 ? 0.4671 0.3246 0.2674 0.0433  0.0054  -0.0069 169  LYS A N     
1402 C CA    . LYS A 169 ? 0.4752 0.3229 0.2637 0.0521  0.0070  -0.0061 169  LYS A CA    
1403 C C     . LYS A 169 ? 0.4505 0.3130 0.2466 0.0586  0.0096  -0.0034 169  LYS A C     
1404 O O     . LYS A 169 ? 0.4406 0.3203 0.2491 0.0580  0.0103  -0.0026 169  LYS A O     
1405 C CB    . LYS A 169 ? 0.5088 0.3461 0.2848 0.0583  0.0067  -0.0081 169  LYS A CB    
1406 C CG    . LYS A 169 ? 0.5797 0.3968 0.3431 0.0539  0.0038  -0.0109 169  LYS A CG    
1407 C CD    . LYS A 169 ? 0.6675 0.4735 0.4169 0.0614  0.0035  -0.0129 169  LYS A CD    
1408 C CE    . LYS A 169 ? 0.7342 0.5155 0.4666 0.0595  0.0010  -0.0154 169  LYS A CE    
1409 N NZ    . LYS A 169 ? 0.7600 0.5369 0.4956 0.0476  -0.0026 -0.0173 169  LYS A NZ    
1410 N N     . LEU A 170 ? 0.4332 0.2882 0.2212 0.0647  0.0108  -0.0021 170  LEU A N     
1411 C CA    . LEU A 170 ? 0.4142 0.2821 0.2077 0.0721  0.0128  0.0002  170  LEU A CA    
1412 C C     . LEU A 170 ? 0.4260 0.3047 0.2223 0.0789  0.0143  0.0002  170  LEU A C     
1413 O O     . LEU A 170 ? 0.4341 0.3041 0.2215 0.0816  0.0142  -0.0015 170  LEU A O     
1414 C CB    . LEU A 170 ? 0.4311 0.2861 0.2121 0.0789  0.0134  0.0012  170  LEU A CB    
1415 C CG    . LEU A 170 ? 0.4242 0.2684 0.2013 0.0736  0.0127  0.0020  170  LEU A CG    
1416 C CD1   . LEU A 170 ? 0.4663 0.2940 0.2277 0.0814  0.0132  0.0029  170  LEU A CD1   
1417 C CD2   . LEU A 170 ? 0.4297 0.2903 0.2208 0.0700  0.0130  0.0040  170  LEU A CD2   
1418 N N     . GLN A 171 ? 0.4260 0.3232 0.2341 0.0816  0.0157  0.0022  171  GLN A N     
1419 C CA    . GLN A 171 ? 0.4466 0.3551 0.2579 0.0884  0.0177  0.0027  171  GLN A CA    
1420 C C     . GLN A 171 ? 0.4674 0.3652 0.2646 0.0991  0.0192  0.0025  171  GLN A C     
1421 O O     . GLN A 171 ? 0.4438 0.3438 0.2379 0.1046  0.0209  0.0022  171  GLN A O     
1422 C CB    . GLN A 171 ? 0.4627 0.3929 0.2894 0.0890  0.0188  0.0051  171  GLN A CB    
1423 C CG    . GLN A 171 ? 0.5075 0.4479 0.3474 0.0791  0.0174  0.0051  171  GLN A CG    
1424 C CD    . GLN A 171 ? 0.5692 0.5287 0.4221 0.0788  0.0187  0.0064  171  GLN A CD    
1425 O OE1   . GLN A 171 ? 0.6163 0.5863 0.4726 0.0853  0.0206  0.0081  171  GLN A OE1   
1426 N NE2   . GLN A 171 ? 0.5721 0.5361 0.4324 0.0711  0.0177  0.0058  171  GLN A NE2   
1427 N N     . GLU A 172 ? 0.4828 0.3678 0.2703 0.1020  0.0186  0.0028  172  GLU A N     
1428 C CA    . GLU A 172 ? 0.5117 0.3834 0.2839 0.1124  0.0196  0.0025  172  GLU A CA    
1429 C C     . GLU A 172 ? 0.5327 0.3828 0.2891 0.1117  0.0186  -0.0003 172  GLU A C     
1430 O O     . GLU A 172 ? 0.5846 0.4223 0.3267 0.1206  0.0195  -0.0010 172  GLU A O     
1431 C CB    . GLU A 172 ? 0.5170 0.3819 0.2840 0.1158  0.0191  0.0040  172  GLU A CB    
1432 C CG    . GLU A 172 ? 0.5235 0.4089 0.3042 0.1182  0.0196  0.0066  172  GLU A CG    
1433 C CD    . GLU A 172 ? 0.5712 0.4645 0.3637 0.1079  0.0180  0.0073  172  GLU A CD    
1434 O OE1   . GLU A 172 ? 0.6035 0.5087 0.4039 0.1096  0.0178  0.0092  172  GLU A OE1   
1435 O OE2   . GLU A 172 ? 0.5771 0.4649 0.3709 0.0985  0.0169  0.0059  172  GLU A OE2   
1436 N N     . GLN A 173 ? 0.5238 0.3695 0.2825 0.1012  0.0165  -0.0019 173  GLN A N     
1437 C CA    . GLN A 173 ? 0.5559 0.3840 0.3021 0.0990  0.0148  -0.0049 173  GLN A CA    
1438 C C     . GLN A 173 ? 0.5127 0.3510 0.2645 0.0981  0.0152  -0.0060 173  GLN A C     
1439 O O     . GLN A 173 ? 0.5385 0.3651 0.2820 0.0952  0.0134  -0.0086 173  GLN A O     
1440 C CB    . GLN A 173 ? 0.5830 0.4001 0.3284 0.0875  0.0118  -0.0062 173  GLN A CB    
1441 C CG    . GLN A 173 ? 0.6076 0.4073 0.3422 0.0873  0.0111  -0.0057 173  GLN A CG    
1442 C CD    . GLN A 173 ? 0.6339 0.4265 0.3708 0.0750  0.0088  -0.0064 173  GLN A CD    
1443 O OE1   . GLN A 173 ? 0.5658 0.3715 0.3164 0.0685  0.0089  -0.0050 173  GLN A OE1   
1444 N NE2   . GLN A 173 ? 0.6714 0.4434 0.3949 0.0716  0.0066  -0.0088 173  GLN A NE2   
1445 N N     . GLY A 174 ? 0.4818 0.3415 0.2473 0.1003  0.0175  -0.0039 174  GLY A N     
1446 C CA    . GLY A 174 ? 0.4513 0.3219 0.2234 0.0987  0.0182  -0.0043 174  GLY A CA    
1447 C C     . GLY A 174 ? 0.4309 0.3090 0.2151 0.0873  0.0159  -0.0046 174  GLY A C     
1448 O O     . GLY A 174 ? 0.4349 0.3193 0.2233 0.0847  0.0158  -0.0052 174  GLY A O     
1449 N N     . GLY A 175 ? 0.4283 0.3055 0.2176 0.0808  0.0143  -0.0042 175  GLY A N     
1450 C CA    . GLY A 175 ? 0.4083 0.2925 0.2091 0.0704  0.0123  -0.0044 175  GLY A CA    
1451 C C     . GLY A 175 ? 0.3936 0.2987 0.2110 0.0687  0.0136  -0.0021 175  GLY A C     
1452 O O     . GLY A 175 ? 0.3760 0.2920 0.1973 0.0751  0.0160  -0.0002 175  GLY A O     
1453 N N     . ASP A 176 ? 0.3744 0.2854 0.2016 0.0599  0.0119  -0.0023 176  ASP A N     
1454 C CA    . ASP A 176 ? 0.3871 0.3163 0.2294 0.0574  0.0127  -0.0005 176  ASP A CA    
1455 C C     . ASP A 176 ? 0.3788 0.3110 0.2273 0.0535  0.0121  0.0005  176  ASP A C     
1456 O O     . ASP A 176 ? 0.3976 0.3436 0.2576 0.0516  0.0125  0.0019  176  ASP A O     
1457 C CB    . ASP A 176 ? 0.3765 0.3115 0.2256 0.0515  0.0113  -0.0014 176  ASP A CB    
1458 C CG    . ASP A 176 ? 0.4022 0.3333 0.2441 0.0552  0.0117  -0.0025 176  ASP A CG    
1459 O OD1   . ASP A 176 ? 0.4410 0.3762 0.2805 0.0625  0.0144  -0.0012 176  ASP A OD1   
1460 O OD2   . ASP A 176 ? 0.3953 0.3196 0.2339 0.0509  0.0093  -0.0046 176  ASP A OD2   
1461 N N     . GLU A 177 ? 0.4062 0.3246 0.2462 0.0523  0.0112  -0.0001 177  GLU A N     
1462 C CA    . GLU A 177 ? 0.4491 0.3677 0.2924 0.0487  0.0110  0.0008  177  GLU A CA    
1463 C C     . GLU A 177 ? 0.4317 0.3601 0.2871 0.0406  0.0100  0.0008  177  GLU A C     
1464 O O     . GLU A 177 ? 0.4225 0.3597 0.2853 0.0397  0.0105  0.0021  177  GLU A O     
1465 C CB    . GLU A 177 ? 0.4774 0.4028 0.3221 0.0553  0.0125  0.0030  177  GLU A CB    
1466 C CG    . GLU A 177 ? 0.5563 0.4678 0.3880 0.0610  0.0129  0.0034  177  GLU A CG    
1467 C CD    . GLU A 177 ? 0.5886 0.5084 0.4218 0.0690  0.0141  0.0054  177  GLU A CD    
1468 O OE1   . GLU A 177 ? 0.6004 0.5334 0.4442 0.0674  0.0139  0.0067  177  GLU A OE1   
1469 O OE2   . GLU A 177 ? 0.5833 0.4965 0.4070 0.0772  0.0150  0.0056  177  GLU A OE2   
1470 N N     . VAL A 178 ? 0.4111 0.3380 0.2681 0.0353  0.0085  -0.0009 178  VAL A N     
1471 C CA    . VAL A 178 ? 0.3830 0.3170 0.2501 0.0277  0.0075  -0.0012 178  VAL A CA    
1472 C C     . VAL A 178 ? 0.3924 0.3188 0.2568 0.0239  0.0076  -0.0008 178  VAL A C     
1473 O O     . VAL A 178 ? 0.4029 0.3153 0.2577 0.0228  0.0071  -0.0016 178  VAL A O     
1474 C CB    . VAL A 178 ? 0.3758 0.3086 0.2441 0.0232  0.0054  -0.0032 178  VAL A CB    
1475 C CG1   . VAL A 178 ? 0.3537 0.2932 0.2320 0.0158  0.0044  -0.0035 178  VAL A CG1   
1476 C CG2   . VAL A 178 ? 0.3432 0.2835 0.2138 0.0270  0.0057  -0.0031 178  VAL A CG2   
1477 N N     . PRO A 179 ? 0.3904 0.3253 0.2624 0.0221  0.0084  0.0005  179  PRO A N     
1478 C CA    . PRO A 179 ? 0.4018 0.3304 0.2708 0.0195  0.0092  0.0014  179  PRO A CA    
1479 C C     . PRO A 179 ? 0.4115 0.3305 0.2775 0.0127  0.0084  0.0002  179  PRO A C     
1480 O O     . PRO A 179 ? 0.3972 0.3214 0.2701 0.0075  0.0071  -0.0010 179  PRO A O     
1481 C CB    . PRO A 179 ? 0.3885 0.3302 0.2683 0.0174  0.0097  0.0023  179  PRO A CB    
1482 C CG    . PRO A 179 ? 0.3799 0.3327 0.2653 0.0219  0.0095  0.0026  179  PRO A CG    
1483 C CD    . PRO A 179 ? 0.3741 0.3244 0.2571 0.0227  0.0086  0.0013  179  PRO A CD    
1484 N N     . SER A 180 ? 0.4251 0.3300 0.2806 0.0127  0.0090  0.0007  180  SER A N     
1485 C CA    . SER A 180 ? 0.4248 0.3189 0.2763 0.0058  0.0082  -0.0002 180  SER A CA    
1486 C C     . SER A 180 ? 0.4228 0.3254 0.2850 -0.0020 0.0084  -0.0002 180  SER A C     
1487 O O     . SER A 180 ? 0.4396 0.3398 0.3036 -0.0082 0.0070  -0.0016 180  SER A O     
1488 C CB    . SER A 180 ? 0.4516 0.3292 0.2902 0.0070  0.0094  0.0009  180  SER A CB    
1489 O OG    . SER A 180 ? 0.4906 0.3714 0.3299 0.0092  0.0115  0.0032  180  SER A OG    
1490 N N     . GLU A 181 ? 0.3864 0.2993 0.2557 -0.0015 0.0101  0.0012  181  GLU A N     
1491 C CA    . GLU A 181 ? 0.3987 0.3200 0.2776 -0.0079 0.0109  0.0014  181  GLU A CA    
1492 C C     . GLU A 181 ? 0.3610 0.2943 0.2509 -0.0107 0.0091  -0.0002 181  GLU A C     
1493 O O     . GLU A 181 ? 0.3582 0.2980 0.2560 -0.0161 0.0094  -0.0004 181  GLU A O     
1494 C CB    . GLU A 181 ? 0.4086 0.3360 0.2901 -0.0059 0.0131  0.0034  181  GLU A CB    
1495 C CG    . GLU A 181 ? 0.4194 0.3589 0.3072 -0.0008 0.0126  0.0034  181  GLU A CG    
1496 C CD    . GLU A 181 ? 0.4631 0.3991 0.3438 0.0066  0.0126  0.0044  181  GLU A CD    
1497 O OE1   . GLU A 181 ? 0.4342 0.3579 0.3045 0.0090  0.0127  0.0046  181  GLU A OE1   
1498 O OE2   . GLU A 181 ? 0.4752 0.4209 0.3608 0.0103  0.0124  0.0048  181  GLU A OE2   
1499 N N     . ILE A 182 ? 0.3308 0.2670 0.2210 -0.0067 0.0073  -0.0014 182  ILE A N     
1500 C CA    . ILE A 182 ? 0.3269 0.2726 0.2259 -0.0090 0.0053  -0.0029 182  ILE A CA    
1501 C C     . ILE A 182 ? 0.3329 0.2717 0.2272 -0.0102 0.0026  -0.0050 182  ILE A C     
1502 O O     . ILE A 182 ? 0.3210 0.2661 0.2214 -0.0125 0.0006  -0.0064 182  ILE A O     
1503 C CB    . ILE A 182 ? 0.3095 0.2666 0.2146 -0.0045 0.0054  -0.0025 182  ILE A CB    
1504 C CG1   . ILE A 182 ? 0.3204 0.2740 0.2190 0.0016  0.0050  -0.0025 182  ILE A CG1   
1505 C CG2   . ILE A 182 ? 0.3008 0.2646 0.2103 -0.0035 0.0074  -0.0009 182  ILE A CG2   
1506 C CD1   . ILE A 182 ? 0.2650 0.2298 0.1702 0.0048  0.0048  -0.0022 182  ILE A CD1   
1507 N N     . ILE A 183 ? 0.3480 0.2732 0.2308 -0.0083 0.0025  -0.0052 183  ILE A N     
1508 C CA    . ILE A 183 ? 0.3699 0.2863 0.2461 -0.0089 -0.0001 -0.0073 183  ILE A CA    
1509 C C     . ILE A 183 ? 0.3756 0.2938 0.2574 -0.0167 -0.0027 -0.0090 183  ILE A C     
1510 O O     . ILE A 183 ? 0.3746 0.2958 0.2584 -0.0171 -0.0054 -0.0109 183  ILE A O     
1511 C CB    . ILE A 183 ? 0.4020 0.3012 0.2637 -0.0063 0.0001  -0.0073 183  ILE A CB    
1512 C CG1   . ILE A 183 ? 0.4056 0.3043 0.2617 0.0027  0.0019  -0.0062 183  ILE A CG1   
1513 C CG2   . ILE A 183 ? 0.4236 0.3116 0.2777 -0.0088 -0.0030 -0.0099 183  ILE A CG2   
1514 C CD1   . ILE A 183 ? 0.4355 0.3391 0.2917 0.0075  0.0008  -0.0072 183  ILE A CD1   
1515 N N     . ASP A 184 ? 0.3778 0.2947 0.2623 -0.0227 -0.0017 -0.0083 184  ASP A N     
1516 C CA    . ASP A 184 ? 0.3966 0.3166 0.2878 -0.0307 -0.0038 -0.0097 184  ASP A CA    
1517 C C     . ASP A 184 ? 0.3615 0.2987 0.2666 -0.0318 -0.0043 -0.0099 184  ASP A C     
1518 O O     . ASP A 184 ? 0.3670 0.3093 0.2790 -0.0375 -0.0065 -0.0112 184  ASP A O     
1519 C CB    . ASP A 184 ? 0.4377 0.3521 0.3282 -0.0369 -0.0019 -0.0084 184  ASP A CB    
1520 C CG    . ASP A 184 ? 0.5369 0.4321 0.4130 -0.0372 -0.0021 -0.0084 184  ASP A CG    
1521 O OD1   . ASP A 184 ? 0.5871 0.4733 0.4542 -0.0336 -0.0045 -0.0102 184  ASP A OD1   
1522 O OD2   . ASP A 184 ? 0.5983 0.4869 0.4713 -0.0408 0.0002  -0.0067 184  ASP A OD2   
1523 N N     . LYS A 185 ? 0.3319 0.2776 0.2407 -0.0265 -0.0026 -0.0088 185  LYS A N     
1524 C CA    . LYS A 185 ? 0.3065 0.2669 0.2271 -0.0268 -0.0029 -0.0089 185  LYS A CA    
1525 C C     . LYS A 185 ? 0.2922 0.2568 0.2135 -0.0228 -0.0053 -0.0100 185  LYS A C     
1526 O O     . LYS A 185 ? 0.2764 0.2518 0.2060 -0.0221 -0.0056 -0.0100 185  LYS A O     
1527 C CB    . LYS A 185 ? 0.2830 0.2503 0.2079 -0.0246 0.0005  -0.0068 185  LYS A CB    
1528 C CG    . LYS A 185 ? 0.3047 0.2687 0.2289 -0.0284 0.0033  -0.0053 185  LYS A CG    
1529 C CD    . LYS A 185 ? 0.2755 0.2467 0.2036 -0.0258 0.0063  -0.0036 185  LYS A CD    
1530 C CE    . LYS A 185 ? 0.3595 0.3265 0.2854 -0.0290 0.0095  -0.0019 185  LYS A CE    
1531 N NZ    . LYS A 185 ? 0.3494 0.3236 0.2789 -0.0266 0.0121  -0.0005 185  LYS A NZ    
1532 N N     . ILE A 186 ? 0.2912 0.2465 0.2031 -0.0199 -0.0068 -0.0109 186  ILE A N     
1533 C CA    . ILE A 186 ? 0.2991 0.2571 0.2100 -0.0159 -0.0087 -0.0118 186  ILE A CA    
1534 C C     . ILE A 186 ? 0.3188 0.2761 0.2305 -0.0195 -0.0129 -0.0142 186  ILE A C     
1535 O O     . ILE A 186 ? 0.3241 0.2720 0.2300 -0.0229 -0.0149 -0.0157 186  ILE A O     
1536 C CB    . ILE A 186 ? 0.3046 0.2541 0.2048 -0.0097 -0.0076 -0.0114 186  ILE A CB    
1537 C CG1   . ILE A 186 ? 0.3106 0.2635 0.2117 -0.0057 -0.0040 -0.0090 186  ILE A CG1   
1538 C CG2   . ILE A 186 ? 0.3025 0.2538 0.2006 -0.0061 -0.0094 -0.0123 186  ILE A CG2   
1539 C CD1   . ILE A 186 ? 0.3152 0.2592 0.2058 -0.0001 -0.0025 -0.0084 186  ILE A CD1   
1540 N N     . ILE A 187 ? 0.2804 0.2472 0.1987 -0.0187 -0.0145 -0.0146 187  ILE A N     
1541 C CA    . ILE A 187 ? 0.2984 0.2656 0.2171 -0.0207 -0.0190 -0.0168 187  ILE A CA    
1542 C C     . ILE A 187 ? 0.2939 0.2595 0.2066 -0.0149 -0.0197 -0.0169 187  ILE A C     
1543 O O     . ILE A 187 ? 0.2921 0.2655 0.2094 -0.0117 -0.0183 -0.0155 187  ILE A O     
1544 C CB    . ILE A 187 ? 0.2860 0.2656 0.2173 -0.0245 -0.0204 -0.0172 187  ILE A CB    
1545 C CG1   . ILE A 187 ? 0.3117 0.2924 0.2482 -0.0306 -0.0194 -0.0170 187  ILE A CG1   
1546 C CG2   . ILE A 187 ? 0.3205 0.3019 0.2523 -0.0252 -0.0254 -0.0193 187  ILE A CG2   
1547 C CD1   . ILE A 187 ? 0.3368 0.3310 0.2863 -0.0333 -0.0192 -0.0167 187  ILE A CD1   
1548 N N     . TYR A 188 ? 0.2918 0.2464 0.1936 -0.0135 -0.0217 -0.0184 188  TYR A N     
1549 C CA    . TYR A 188 ? 0.3145 0.2658 0.2083 -0.0074 -0.0214 -0.0182 188  TYR A CA    
1550 C C     . TYR A 188 ? 0.3178 0.2693 0.2098 -0.0074 -0.0259 -0.0202 188  TYR A C     
1551 O O     . TYR A 188 ? 0.3345 0.2803 0.2232 -0.0111 -0.0300 -0.0227 188  TYR A O     
1552 C CB    . TYR A 188 ? 0.3341 0.2724 0.2152 -0.0042 -0.0200 -0.0185 188  TYR A CB    
1553 C CG    . TYR A 188 ? 0.3359 0.2700 0.2077 0.0022  -0.0195 -0.0185 188  TYR A CG    
1554 C CD1   . TYR A 188 ? 0.3217 0.2627 0.1957 0.0073  -0.0158 -0.0159 188  TYR A CD1   
1555 C CD2   . TYR A 188 ? 0.3461 0.2692 0.2065 0.0032  -0.0228 -0.0210 188  TYR A CD2   
1556 C CE1   . TYR A 188 ? 0.3421 0.2800 0.2078 0.0131  -0.0148 -0.0156 188  TYR A CE1   
1557 C CE2   . TYR A 188 ? 0.3750 0.2942 0.2260 0.0096  -0.0219 -0.0208 188  TYR A CE2   
1558 C CZ    . TYR A 188 ? 0.3344 0.2614 0.1884 0.0146  -0.0177 -0.0180 188  TYR A CZ    
1559 O OH    . TYR A 188 ? 0.3182 0.2422 0.1633 0.0208  -0.0162 -0.0175 188  TYR A OH    
1560 N N     . MET A 189 ? 0.2942 0.2518 0.1878 -0.0035 -0.0252 -0.0189 189  MET A N     
1561 C CA    . MET A 189 ? 0.3200 0.2785 0.2118 -0.0028 -0.0292 -0.0203 189  MET A CA    
1562 C C     . MET A 189 ? 0.3168 0.2717 0.1996 0.0035  -0.0276 -0.0192 189  MET A C     
1563 O O     . MET A 189 ? 0.3002 0.2617 0.1869 0.0064  -0.0244 -0.0167 189  MET A O     
1564 C CB    . MET A 189 ? 0.3121 0.2829 0.2162 -0.0049 -0.0305 -0.0198 189  MET A CB    
1565 C CG    . MET A 189 ? 0.3738 0.3495 0.2873 -0.0111 -0.0322 -0.0209 189  MET A CG    
1566 S SD    . MET A 189 ? 0.3999 0.3905 0.3281 -0.0121 -0.0314 -0.0195 189  MET A SD    
1567 C CE    . MET A 189 ? 0.3082 0.3002 0.2381 -0.0099 -0.0250 -0.0166 189  MET A CE    
1568 N N     . PRO A 190 ? 0.3296 0.2737 0.1999 0.0057  -0.0296 -0.0211 190  PRO A N     
1569 C CA    . PRO A 190 ? 0.3315 0.2724 0.1927 0.0120  -0.0278 -0.0200 190  PRO A CA    
1570 C C     . PRO A 190 ? 0.3461 0.2896 0.2065 0.0129  -0.0313 -0.0204 190  PRO A C     
1571 O O     . PRO A 190 ? 0.3542 0.2983 0.2172 0.0092  -0.0365 -0.0228 190  PRO A O     
1572 C CB    . PRO A 190 ? 0.3467 0.2738 0.1938 0.0142  -0.0284 -0.0220 190  PRO A CB    
1573 C CG    . PRO A 190 ? 0.3654 0.2876 0.2133 0.0081  -0.0333 -0.0251 190  PRO A CG    
1574 C CD    . PRO A 190 ? 0.3497 0.2833 0.2131 0.0025  -0.0333 -0.0242 190  PRO A CD    
1575 N N     . PHE A 191 ? 0.3430 0.2885 0.2002 0.0178  -0.0283 -0.0180 191  PHE A N     
1576 C CA    . PHE A 191 ? 0.3578 0.3053 0.2133 0.0194  -0.0311 -0.0179 191  PHE A CA    
1577 C C     . PHE A 191 ? 0.3884 0.3286 0.2302 0.0253  -0.0296 -0.0172 191  PHE A C     
1578 O O     . PHE A 191 ? 0.3695 0.3085 0.2074 0.0291  -0.0243 -0.0151 191  PHE A O     
1579 C CB    . PHE A 191 ? 0.3502 0.3087 0.2170 0.0187  -0.0291 -0.0151 191  PHE A CB    
1580 C CG    . PHE A 191 ? 0.3413 0.3072 0.2208 0.0134  -0.0312 -0.0161 191  PHE A CG    
1581 C CD1   . PHE A 191 ? 0.3329 0.3033 0.2205 0.0110  -0.0279 -0.0150 191  PHE A CD1   
1582 C CD2   . PHE A 191 ? 0.3633 0.3320 0.2463 0.0112  -0.0367 -0.0180 191  PHE A CD2   
1583 C CE1   . PHE A 191 ? 0.3580 0.3351 0.2566 0.0065  -0.0294 -0.0158 191  PHE A CE1   
1584 C CE2   . PHE A 191 ? 0.3701 0.3468 0.2653 0.0066  -0.0383 -0.0188 191  PHE A CE2   
1585 C CZ    . PHE A 191 ? 0.3433 0.3239 0.2460 0.0043  -0.0344 -0.0177 191  PHE A CZ    
1586 N N     . ASP A 192 ? 0.4116 0.3474 0.2463 0.0263  -0.0344 -0.0190 192  ASP A N     
1587 C CA    . ASP A 192 ? 0.4564 0.3845 0.2766 0.0320  -0.0339 -0.0187 192  ASP A CA    
1588 C C     . ASP A 192 ? 0.4244 0.3580 0.2456 0.0355  -0.0296 -0.0146 192  ASP A C     
1589 O O     . ASP A 192 ? 0.4388 0.3674 0.2490 0.0406  -0.0265 -0.0131 192  ASP A O     
1590 C CB    . ASP A 192 ? 0.4958 0.4179 0.3088 0.0314  -0.0414 -0.0222 192  ASP A CB    
1591 C CG    . ASP A 192 ? 0.6103 0.5208 0.4053 0.0370  -0.0417 -0.0232 192  ASP A CG    
1592 O OD1   . ASP A 192 ? 0.6878 0.5895 0.4741 0.0386  -0.0403 -0.0247 192  ASP A OD1   
1593 O OD2   . ASP A 192 ? 0.6527 0.5620 0.4413 0.0402  -0.0434 -0.0225 192  ASP A OD2   
1594 N N     . ASN A 193 ? 0.3671 0.3103 0.2007 0.0326  -0.0293 -0.0128 193  ASN A N     
1595 C CA    . ASN A 193 ? 0.3611 0.3089 0.1962 0.0349  -0.0256 -0.0088 193  ASN A CA    
1596 C C     . ASN A 193 ? 0.3223 0.2802 0.1723 0.0312  -0.0242 -0.0070 193  ASN A C     
1597 O O     . ASN A 193 ? 0.3300 0.2918 0.1889 0.0272  -0.0273 -0.0091 193  ASN A O     
1598 C CB    . ASN A 193 ? 0.3834 0.3270 0.2098 0.0377  -0.0293 -0.0090 193  ASN A CB    
1599 C CG    . ASN A 193 ? 0.4273 0.3738 0.2598 0.0345  -0.0362 -0.0115 193  ASN A CG    
1600 O OD1   . ASN A 193 ? 0.3867 0.3407 0.2296 0.0326  -0.0364 -0.0101 193  ASN A OD1   
1601 N ND2   . ASN A 193 ? 0.4802 0.4210 0.3064 0.0342  -0.0422 -0.0154 193  ASN A ND2   
1602 N N     . GLU A 194 ? 0.3033 0.2652 0.1557 0.0325  -0.0195 -0.0032 194  GLU A N     
1603 C CA    . GLU A 194 ? 0.3010 0.2713 0.1662 0.0293  -0.0176 -0.0013 194  GLU A CA    
1604 C C     . GLU A 194 ? 0.2950 0.2684 0.1662 0.0274  -0.0222 -0.0022 194  GLU A C     
1605 O O     . GLU A 194 ? 0.2787 0.2583 0.1608 0.0241  -0.0226 -0.0027 194  GLU A O     
1606 C CB    . GLU A 194 ? 0.3148 0.2878 0.1800 0.0309  -0.0117 0.0029  194  GLU A CB    
1607 C CG    . GLU A 194 ? 0.3076 0.2884 0.1852 0.0276  -0.0094 0.0047  194  GLU A CG    
1608 C CD    . GLU A 194 ? 0.3207 0.3036 0.1983 0.0282  -0.0050 0.0090  194  GLU A CD    
1609 O OE1   . GLU A 194 ? 0.2616 0.2503 0.1485 0.0254  -0.0031 0.0105  194  GLU A OE1   
1610 O OE2   . GLU A 194 ? 0.3459 0.3244 0.2142 0.0313  -0.0035 0.0109  194  GLU A OE2   
1611 N N     . LYS A 195 ? 0.3022 0.2714 0.1659 0.0298  -0.0256 -0.0025 195  LYS A N     
1612 C CA    . LYS A 195 ? 0.3027 0.2748 0.1714 0.0289  -0.0303 -0.0034 195  LYS A CA    
1613 C C     . LYS A 195 ? 0.3027 0.2787 0.1791 0.0255  -0.0348 -0.0072 195  LYS A C     
1614 O O     . LYS A 195 ? 0.2960 0.2787 0.1829 0.0232  -0.0360 -0.0076 195  LYS A O     
1615 C CB    . LYS A 195 ? 0.3282 0.2944 0.1861 0.0328  -0.0337 -0.0032 195  LYS A CB    
1616 C CG    . LYS A 195 ? 0.3663 0.3303 0.2195 0.0353  -0.0297 0.0010  195  LYS A CG    
1617 C CD    . LYS A 195 ? 0.4362 0.3928 0.2761 0.0397  -0.0325 0.0014  195  LYS A CD    
1618 C CE    . LYS A 195 ? 0.4884 0.4412 0.3211 0.0421  -0.0269 0.0062  195  LYS A CE    
1619 N NZ    . LYS A 195 ? 0.5179 0.4621 0.3348 0.0468  -0.0277 0.0066  195  LYS A NZ    
1620 N N     . GLU A 196 ? 0.3051 0.2766 0.1761 0.0250  -0.0371 -0.0100 196  GLU A N     
1621 C CA    . GLU A 196 ? 0.3306 0.3051 0.2084 0.0210  -0.0410 -0.0134 196  GLU A CA    
1622 C C     . GLU A 196 ? 0.3062 0.2866 0.1948 0.0174  -0.0373 -0.0128 196  GLU A C     
1623 O O     . GLU A 196 ? 0.2771 0.2641 0.1759 0.0141  -0.0393 -0.0141 196  GLU A O     
1624 C CB    . GLU A 196 ? 0.3809 0.3473 0.2490 0.0210  -0.0436 -0.0163 196  GLU A CB    
1625 C CG    . GLU A 196 ? 0.5047 0.4731 0.3789 0.0161  -0.0483 -0.0199 196  GLU A CG    
1626 C CD    . GLU A 196 ? 0.6148 0.5846 0.4887 0.0158  -0.0556 -0.0224 196  GLU A CD    
1627 O OE1   . GLU A 196 ? 0.6688 0.6344 0.5390 0.0135  -0.0603 -0.0257 196  GLU A OE1   
1628 O OE2   . GLU A 196 ? 0.6376 0.6125 0.5149 0.0179  -0.0569 -0.0211 196  GLU A OE2   
1629 N N     . LEU A 197 ? 0.2855 0.2640 0.1719 0.0183  -0.0318 -0.0108 197  LEU A N     
1630 C CA    . LEU A 197 ? 0.2748 0.2582 0.1701 0.0156  -0.0282 -0.0100 197  LEU A CA    
1631 C C     . LEU A 197 ? 0.2645 0.2559 0.1704 0.0142  -0.0278 -0.0087 197  LEU A C     
1632 O O     . LEU A 197 ? 0.2499 0.2465 0.1647 0.0109  -0.0283 -0.0098 197  LEU A O     
1633 C CB    . LEU A 197 ? 0.2740 0.2549 0.1648 0.0178  -0.0226 -0.0077 197  LEU A CB