data_3QFS
# 
_entry.id   3QFS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QFS         
RCSB  RCSB063589   
WWPDB D_1000063589 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QE2 'full-length wild type'         unspecified 
PDB 3QFC 'full-length V492E mutant'      unspecified 
PDB 3QFR 'full-length R457H mutant'      unspecified 
PDB 3QFT 'FAD/NADPH domain R457H mutant' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QFS 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, C.'       1 
'Marohnic, C.'  2 
'Panda, S.P.'   3 
'Masters, B.S.' 4 
'Kim, J.-J.P.'  5 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for human NADPH-cytochrome P450 oxidoreductase deficiency.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                13486 
_citation.page_last                 13491 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21808038 
_citation.pdbx_database_id_DOI      10.1073/pnas.1106632108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, C.'        1 
primary 'Panda, S.P.'    2 
primary 'Marohnic, C.C.' 3 
primary 'Martasek, P.'   4 
primary 'Masters, B.S.'  5 
primary 'Kim, J.J.'      6 
# 
_cell.entry_id           3QFS 
_cell.length_a           54.640 
_cell.length_b           58.540 
_cell.length_c           130.280 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QFS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NADPH--cytochrome P450 reductase'                 52003.070 1   1.6.2.4 ? 
'FAD/NADPH domain (UNP residues 241-677)' ? 
2 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                      785.550   1   ?       ? ? ? 
3 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   1   ?       ? ? ? 
4 water       nat water                                              18.015    424 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CPR, P450R' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERH
LMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITN
PPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIA
SSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAP
FIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKL
IEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERH
LMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITN
PPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIA
SSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAP
FIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKL
IEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  ILE n 
1 24  ARG n 
1 25  GLN n 
1 26  TYR n 
1 27  GLU n 
1 28  LEU n 
1 29  VAL n 
1 30  VAL n 
1 31  HIS n 
1 32  THR n 
1 33  ASP n 
1 34  ILE n 
1 35  ASP n 
1 36  ALA n 
1 37  ALA n 
1 38  LYS n 
1 39  VAL n 
1 40  TYR n 
1 41  MET n 
1 42  GLY n 
1 43  GLU n 
1 44  MET n 
1 45  GLY n 
1 46  ARG n 
1 47  LEU n 
1 48  LYS n 
1 49  SER n 
1 50  TYR n 
1 51  GLU n 
1 52  ASN n 
1 53  GLN n 
1 54  LYS n 
1 55  PRO n 
1 56  PRO n 
1 57  PHE n 
1 58  ASP n 
1 59  ALA n 
1 60  LYS n 
1 61  ASN n 
1 62  PRO n 
1 63  PHE n 
1 64  LEU n 
1 65  ALA n 
1 66  ALA n 
1 67  VAL n 
1 68  THR n 
1 69  THR n 
1 70  ASN n 
1 71  ARG n 
1 72  LYS n 
1 73  LEU n 
1 74  ASN n 
1 75  GLN n 
1 76  GLY n 
1 77  THR n 
1 78  GLU n 
1 79  ARG n 
1 80  HIS n 
1 81  LEU n 
1 82  MET n 
1 83  HIS n 
1 84  LEU n 
1 85  GLU n 
1 86  LEU n 
1 87  ASP n 
1 88  ILE n 
1 89  SER n 
1 90  ASP n 
1 91  SER n 
1 92  LYS n 
1 93  ILE n 
1 94  ARG n 
1 95  TYR n 
1 96  GLU n 
1 97  SER n 
1 98  GLY n 
1 99  ASP n 
1 100 HIS n 
1 101 VAL n 
1 102 ALA n 
1 103 VAL n 
1 104 TYR n 
1 105 PRO n 
1 106 ALA n 
1 107 ASN n 
1 108 ASP n 
1 109 SER n 
1 110 ALA n 
1 111 LEU n 
1 112 VAL n 
1 113 ASN n 
1 114 GLN n 
1 115 LEU n 
1 116 GLY n 
1 117 LYS n 
1 118 ILE n 
1 119 LEU n 
1 120 GLY n 
1 121 ALA n 
1 122 ASP n 
1 123 LEU n 
1 124 ASP n 
1 125 VAL n 
1 126 VAL n 
1 127 MET n 
1 128 SER n 
1 129 LEU n 
1 130 ASN n 
1 131 ASN n 
1 132 LEU n 
1 133 ASP n 
1 134 GLU n 
1 135 GLU n 
1 136 SER n 
1 137 ASN n 
1 138 LYS n 
1 139 LYS n 
1 140 HIS n 
1 141 PRO n 
1 142 PHE n 
1 143 PRO n 
1 144 CYS n 
1 145 PRO n 
1 146 THR n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 THR n 
1 151 ALA n 
1 152 LEU n 
1 153 THR n 
1 154 TYR n 
1 155 TYR n 
1 156 LEU n 
1 157 ASP n 
1 158 ILE n 
1 159 THR n 
1 160 ASN n 
1 161 PRO n 
1 162 PRO n 
1 163 ARG n 
1 164 THR n 
1 165 ASN n 
1 166 VAL n 
1 167 LEU n 
1 168 TYR n 
1 169 GLU n 
1 170 LEU n 
1 171 ALA n 
1 172 GLN n 
1 173 TYR n 
1 174 ALA n 
1 175 SER n 
1 176 GLU n 
1 177 PRO n 
1 178 SER n 
1 179 GLU n 
1 180 GLN n 
1 181 GLU n 
1 182 LEU n 
1 183 LEU n 
1 184 ARG n 
1 185 LYS n 
1 186 MET n 
1 187 ALA n 
1 188 SER n 
1 189 SER n 
1 190 SER n 
1 191 GLY n 
1 192 GLU n 
1 193 GLY n 
1 194 LYS n 
1 195 GLU n 
1 196 LEU n 
1 197 TYR n 
1 198 LEU n 
1 199 SER n 
1 200 TRP n 
1 201 VAL n 
1 202 VAL n 
1 203 GLU n 
1 204 ALA n 
1 205 ARG n 
1 206 ARG n 
1 207 HIS n 
1 208 ILE n 
1 209 LEU n 
1 210 ALA n 
1 211 ILE n 
1 212 LEU n 
1 213 GLN n 
1 214 ASP n 
1 215 CYS n 
1 216 PRO n 
1 217 SER n 
1 218 LEU n 
1 219 ARG n 
1 220 PRO n 
1 221 PRO n 
1 222 ILE n 
1 223 ASP n 
1 224 HIS n 
1 225 LEU n 
1 226 CYS n 
1 227 GLU n 
1 228 LEU n 
1 229 LEU n 
1 230 PRO n 
1 231 ARG n 
1 232 LEU n 
1 233 GLN n 
1 234 ALA n 
1 235 ARG n 
1 236 TYR n 
1 237 TYR n 
1 238 SER n 
1 239 ILE n 
1 240 ALA n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 LYS n 
1 245 VAL n 
1 246 HIS n 
1 247 PRO n 
1 248 ASN n 
1 249 SER n 
1 250 VAL n 
1 251 HIS n 
1 252 ILE n 
1 253 CYS n 
1 254 ALA n 
1 255 VAL n 
1 256 VAL n 
1 257 VAL n 
1 258 GLU n 
1 259 TYR n 
1 260 GLU n 
1 261 THR n 
1 262 LYS n 
1 263 ALA n 
1 264 GLY n 
1 265 ARG n 
1 266 ILE n 
1 267 ASN n 
1 268 LYS n 
1 269 GLY n 
1 270 VAL n 
1 271 ALA n 
1 272 THR n 
1 273 ASN n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 ALA n 
1 278 LYS n 
1 279 GLU n 
1 280 PRO n 
1 281 VAL n 
1 282 GLY n 
1 283 GLU n 
1 284 ASN n 
1 285 GLY n 
1 286 GLY n 
1 287 ARG n 
1 288 ALA n 
1 289 LEU n 
1 290 VAL n 
1 291 PRO n 
1 292 MET n 
1 293 PHE n 
1 294 VAL n 
1 295 ARG n 
1 296 LYS n 
1 297 SER n 
1 298 GLN n 
1 299 PHE n 
1 300 ARG n 
1 301 LEU n 
1 302 PRO n 
1 303 PHE n 
1 304 LYS n 
1 305 ALA n 
1 306 THR n 
1 307 THR n 
1 308 PRO n 
1 309 VAL n 
1 310 ILE n 
1 311 MET n 
1 312 VAL n 
1 313 GLY n 
1 314 PRO n 
1 315 GLY n 
1 316 THR n 
1 317 GLY n 
1 318 VAL n 
1 319 ALA n 
1 320 PRO n 
1 321 PHE n 
1 322 ILE n 
1 323 GLY n 
1 324 PHE n 
1 325 ILE n 
1 326 GLN n 
1 327 GLU n 
1 328 ARG n 
1 329 ALA n 
1 330 TRP n 
1 331 LEU n 
1 332 ARG n 
1 333 GLN n 
1 334 GLN n 
1 335 GLY n 
1 336 LYS n 
1 337 GLU n 
1 338 VAL n 
1 339 GLY n 
1 340 GLU n 
1 341 THR n 
1 342 LEU n 
1 343 LEU n 
1 344 TYR n 
1 345 TYR n 
1 346 GLY n 
1 347 CYS n 
1 348 ARG n 
1 349 ARG n 
1 350 SER n 
1 351 ASP n 
1 352 GLU n 
1 353 ASP n 
1 354 TYR n 
1 355 LEU n 
1 356 TYR n 
1 357 ARG n 
1 358 GLU n 
1 359 GLU n 
1 360 LEU n 
1 361 ALA n 
1 362 GLN n 
1 363 PHE n 
1 364 HIS n 
1 365 ARG n 
1 366 ASP n 
1 367 GLY n 
1 368 ALA n 
1 369 LEU n 
1 370 THR n 
1 371 GLN n 
1 372 LEU n 
1 373 ASN n 
1 374 VAL n 
1 375 ALA n 
1 376 PHE n 
1 377 SER n 
1 378 ARG n 
1 379 GLU n 
1 380 GLN n 
1 381 SER n 
1 382 HIS n 
1 383 LYS n 
1 384 VAL n 
1 385 TYR n 
1 386 VAL n 
1 387 GLN n 
1 388 HIS n 
1 389 LEU n 
1 390 LEU n 
1 391 LYS n 
1 392 GLN n 
1 393 ASP n 
1 394 ARG n 
1 395 GLU n 
1 396 HIS n 
1 397 LEU n 
1 398 TRP n 
1 399 LYS n 
1 400 LEU n 
1 401 ILE n 
1 402 GLU n 
1 403 GLY n 
1 404 GLY n 
1 405 ALA n 
1 406 HIS n 
1 407 ILE n 
1 408 TYR n 
1 409 VAL n 
1 410 CYS n 
1 411 GLY n 
1 412 ASP n 
1 413 ALA n 
1 414 ARG n 
1 415 ASN n 
1 416 MET n 
1 417 ALA n 
1 418 ARG n 
1 419 ASP n 
1 420 VAL n 
1 421 GLN n 
1 422 ASN n 
1 423 THR n 
1 424 PHE n 
1 425 TYR n 
1 426 ASP n 
1 427 ILE n 
1 428 VAL n 
1 429 ALA n 
1 430 GLU n 
1 431 LEU n 
1 432 GLY n 
1 433 ALA n 
1 434 MET n 
1 435 GLU n 
1 436 HIS n 
1 437 ALA n 
1 438 GLN n 
1 439 ALA n 
1 440 VAL n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 LYS n 
1 445 LYS n 
1 446 LEU n 
1 447 MET n 
1 448 THR n 
1 449 LYS n 
1 450 GLY n 
1 451 ARG n 
1 452 TYR n 
1 453 SER n 
1 454 LEU n 
1 455 ASP n 
1 456 VAL n 
1 457 TRP n 
1 458 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POR, CYPOR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NCPR_HUMAN 
_struct_ref.pdbx_db_accession          P16435 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHV
AVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQE
LLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYET
KAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGET
LLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQ
NTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
;
_struct_ref.pdbx_align_begin           241 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3QFS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 22 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 458 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16435 
_struct_ref_seq.db_align_beg                  241 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  677 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       244 
_struct_ref_seq.pdbx_auth_seq_align_end       680 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QFS MET A 1   ? UNP P16435 ?   ?   'EXPRESSION TAG' 223 1  
1 3QFS GLY A 2   ? UNP P16435 ?   ?   'EXPRESSION TAG' 224 2  
1 3QFS SER A 3   ? UNP P16435 ?   ?   'EXPRESSION TAG' 225 3  
1 3QFS SER A 4   ? UNP P16435 ?   ?   'EXPRESSION TAG' 226 4  
1 3QFS HIS A 5   ? UNP P16435 ?   ?   'EXPRESSION TAG' 227 5  
1 3QFS HIS A 6   ? UNP P16435 ?   ?   'EXPRESSION TAG' 228 6  
1 3QFS HIS A 7   ? UNP P16435 ?   ?   'EXPRESSION TAG' 229 7  
1 3QFS HIS A 8   ? UNP P16435 ?   ?   'EXPRESSION TAG' 230 8  
1 3QFS HIS A 9   ? UNP P16435 ?   ?   'EXPRESSION TAG' 231 9  
1 3QFS HIS A 10  ? UNP P16435 ?   ?   'EXPRESSION TAG' 232 10 
1 3QFS SER A 11  ? UNP P16435 ?   ?   'EXPRESSION TAG' 233 11 
1 3QFS SER A 12  ? UNP P16435 ?   ?   'EXPRESSION TAG' 234 12 
1 3QFS GLY A 13  ? UNP P16435 ?   ?   'EXPRESSION TAG' 235 13 
1 3QFS LEU A 14  ? UNP P16435 ?   ?   'EXPRESSION TAG' 236 14 
1 3QFS VAL A 15  ? UNP P16435 ?   ?   'EXPRESSION TAG' 237 15 
1 3QFS PRO A 16  ? UNP P16435 ?   ?   'EXPRESSION TAG' 238 16 
1 3QFS ARG A 17  ? UNP P16435 ?   ?   'EXPRESSION TAG' 239 17 
1 3QFS GLY A 18  ? UNP P16435 ?   ?   'EXPRESSION TAG' 240 18 
1 3QFS SER A 19  ? UNP P16435 ?   ?   'EXPRESSION TAG' 241 19 
1 3QFS HIS A 20  ? UNP P16435 ?   ?   'EXPRESSION TAG' 242 20 
1 3QFS MET A 21  ? UNP P16435 ?   ?   'EXPRESSION TAG' 243 21 
1 3QFS VAL A 281 ? UNP P16435 ALA 500 'SEE REMARK 999' 503 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'                      ?                                            
'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3QFS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.60 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'100 mM magnesium chloride, 15% PEG5000 MME, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-11-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0083 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.0083 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3QFS 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.4 
_reflns.number_obs                   73930 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.064 
_reflns.pdbx_netI_over_sigmaI        32.5 
_reflns.B_iso_Wilson_estimate        17.2 
_reflns.pdbx_redundancy              9.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.45 
_reflns_shell.percent_possible_all   82.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.711 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        9.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3QFS 
_refine.ls_number_reflns_obs                     69748 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               228591.16 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.71 
_refine.ls_d_res_high                            1.40 
_refine.ls_percent_reflns_obs                    84.4 
_refine.ls_R_factor_obs                          0.211 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.231 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3544 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               19.8 
_refine.aniso_B[1][1]                            1.03 
_refine.aniso_B[2][2]                            2.40 
_refine.aniso_B[3][3]                            -3.43 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.45 
_refine.solvent_model_param_bsol                 53.9943 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1AMO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3QFS 
_refine_analyze.Luzzati_coordinate_error_obs    0.17 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           50.00 
_refine_analyze.Luzzati_coordinate_error_free   0.19 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3476 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         84 
_refine_hist.number_atoms_solvent             424 
_refine_hist.number_atoms_total               3984 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        19.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.98  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.41  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.63  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.38  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.40 
_refine_ls_shell.d_res_low                        1.49 
_refine_ls_shell.number_reflns_R_work             8876 
_refine_ls_shell.R_factor_R_work                  0.262 
_refine_ls_shell.percent_reflns_obs               68.4 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             447 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top   'X-RAY DIFFRACTION' 
2 cofac_human       cofac_human   'X-RAY DIFFRACTION' 
3 water_rep.param   water_rep.top 'X-RAY DIFFRACTION' 
4 ion.param         ion.top       'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3QFS 
_struct.title                     'Crystal Structure of NADPH-Cytochrome P450 Reductase (FAD/NADPH domain)' 
_struct.pdbx_descriptor           'NADPH--cytochrome P450 reductase (E.C.1.6.2.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QFS 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'NADPH-Cytochrome P450 Reductase, flavoprotein, FAD, NADPH, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 35  ? VAL A 39  ? ASP A 257 VAL A 261 5 ? 5  
HELX_P HELX_P2  2  ASP A 108 ? GLY A 120 ? ASP A 330 GLY A 342 1 ? 13 
HELX_P HELX_P3  3  TYR A 148 ? TYR A 155 ? TYR A 370 TYR A 377 1 ? 8  
HELX_P HELX_P4  4  ARG A 163 ? ALA A 171 ? ARG A 385 ALA A 393 1 ? 9  
HELX_P HELX_P5  5  GLN A 172 ? ALA A 174 ? GLN A 394 ALA A 396 5 ? 3  
HELX_P HELX_P6  6  GLU A 176 ? SER A 188 ? GLU A 398 SER A 410 1 ? 13 
HELX_P HELX_P7  7  SER A 190 ? VAL A 201 ? SER A 412 VAL A 423 1 ? 12 
HELX_P HELX_P8  8  HIS A 207 ? CYS A 215 ? HIS A 429 CYS A 437 1 ? 9  
HELX_P HELX_P9  9  PRO A 221 ? LEU A 229 ? PRO A 443 LEU A 451 1 ? 9  
HELX_P HELX_P10 10 GLY A 269 ? ALA A 277 ? GLY A 491 ALA A 499 1 ? 9  
HELX_P HELX_P11 11 PRO A 314 ? GLY A 317 ? PRO A 536 GLY A 539 5 ? 4  
HELX_P HELX_P12 12 VAL A 318 ? GLY A 335 ? VAL A 540 GLY A 557 1 ? 18 
HELX_P HELX_P13 13 TYR A 356 ? ASP A 366 ? TYR A 578 ASP A 588 1 ? 11 
HELX_P HELX_P14 14 TYR A 385 ? ASP A 393 ? TYR A 607 ASP A 615 1 ? 9  
HELX_P HELX_P15 15 ASP A 393 ? GLY A 403 ? ASP A 615 GLY A 625 1 ? 11 
HELX_P HELX_P16 16 ASN A 415 ? GLY A 432 ? ASN A 637 GLY A 654 1 ? 18 
HELX_P HELX_P17 17 GLU A 435 ? LYS A 449 ? GLU A 657 LYS A 671 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 55  A . ? PRO 277 A PRO 56  A ? PRO 278 A 1 0.08  
2 CYS 144 A . ? CYS 366 A PRO 145 A ? PRO 367 A 1 -0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 6 ? 
C ? 2 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 26  ? VAL A 30  ? TYR A 248 VAL A 252 
A 2 VAL A 126 ? ASN A 131 ? VAL A 348 ASN A 353 
A 3 THR A 146 ? SER A 147 ? THR A 368 SER A 369 
B 1 ARG A 235 ? SER A 238 ? ARG A 457 SER A 460 
B 2 HIS A 100 ? VAL A 103 ? HIS A 322 VAL A 325 
B 3 LEU A 289 ? ARG A 295 ? LEU A 511 ARG A 517 
B 4 PHE A 63  ? LYS A 72  ? PHE A 285 LYS A 294 
B 5 LEU A 81  ? ASP A 87  ? LEU A 303 ASP A 309 
B 6 SER A 249 ? VAL A 255 ? SER A 471 VAL A 477 
C 1 GLU A 258 ? GLU A 260 ? GLU A 480 GLU A 482 
C 2 ILE A 266 ? LYS A 268 ? ILE A 488 LYS A 490 
D 1 GLN A 371 ? PHE A 376 ? GLN A 593 PHE A 598 
D 2 THR A 341 ? CYS A 347 ? THR A 563 CYS A 569 
D 3 VAL A 309 ? VAL A 312 ? VAL A 531 VAL A 534 
D 4 HIS A 406 ? ASP A 412 ? HIS A 628 ASP A 634 
D 5 TYR A 452 ? TRP A 457 ? TYR A 674 TRP A 679 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 27  ? N GLU A 249 O ASN A 130 ? O ASN A 352 
A 2 3 N MET A 127 ? N MET A 349 O THR A 146 ? O THR A 368 
B 1 2 O TYR A 237 ? O TYR A 459 N VAL A 101 ? N VAL A 323 
B 2 3 N ALA A 102 ? N ALA A 324 O PHE A 293 ? O PHE A 515 
B 3 4 O MET A 292 ? O MET A 514 N PHE A 63  ? N PHE A 285 
B 4 5 N ALA A 66  ? N ALA A 288 O ASP A 87  ? O ASP A 309 
B 5 6 N MET A 82  ? N MET A 304 O ALA A 254 ? O ALA A 476 
C 1 2 N TYR A 259 ? N TYR A 481 O ASN A 267 ? O ASN A 489 
D 1 2 O ASN A 373 ? O ASN A 595 N LEU A 343 ? N LEU A 565 
D 2 3 O TYR A 344 ? O TYR A 566 N MET A 311 ? N MET A 533 
D 3 4 N VAL A 312 ? N VAL A 534 O TYR A 408 ? O TYR A 630 
D 4 5 N ILE A 407 ? N ILE A 629 O SER A 453 ? O SER A 675 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE FAD A 752' 
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE NAP A 753' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 HOH D .   ? HOH A 5   . ? 1_555 ? 
2  AC1 26 HOH D .   ? HOH A 6   . ? 1_555 ? 
3  AC1 26 HOH D .   ? HOH A 23  . ? 1_555 ? 
4  AC1 26 HOH D .   ? HOH A 29  . ? 1_555 ? 
5  AC1 26 HOH D .   ? HOH A 36  . ? 1_555 ? 
6  AC1 26 HOH D .   ? HOH A 37  . ? 1_555 ? 
7  AC1 26 HOH D .   ? HOH A 42  . ? 1_555 ? 
8  AC1 26 HIS A 100 ? HIS A 322 . ? 1_555 ? 
9  AC1 26 ARG A 205 ? ARG A 427 . ? 1_555 ? 
10 AC1 26 ARG A 235 ? ARG A 457 . ? 1_555 ? 
11 AC1 26 TYR A 236 ? TYR A 458 . ? 1_555 ? 
12 AC1 26 TYR A 237 ? TYR A 459 . ? 1_555 ? 
13 AC1 26 SER A 238 ? SER A 460 . ? 1_555 ? 
14 AC1 26 CYS A 253 ? CYS A 475 . ? 1_555 ? 
15 AC1 26 ALA A 254 ? ALA A 476 . ? 1_555 ? 
16 AC1 26 VAL A 255 ? VAL A 477 . ? 1_555 ? 
17 AC1 26 VAL A 257 ? VAL A 479 . ? 1_555 ? 
18 AC1 26 TYR A 259 ? TYR A 481 . ? 1_555 ? 
19 AC1 26 GLY A 269 ? GLY A 491 . ? 1_555 ? 
20 AC1 26 VAL A 270 ? VAL A 492 . ? 1_555 ? 
21 AC1 26 ALA A 271 ? ALA A 493 . ? 1_555 ? 
22 AC1 26 THR A 272 ? THR A 494 . ? 1_555 ? 
23 AC1 26 ARG A 295 ? ARG A 517 . ? 1_555 ? 
24 AC1 26 TRP A 457 ? TRP A 679 . ? 1_555 ? 
25 AC1 26 HOH D .   ? HOH A 748 . ? 1_555 ? 
26 AC1 26 HOH D .   ? HOH A 854 . ? 1_555 ? 
27 AC2 20 HOH D .   ? HOH A 10  . ? 1_555 ? 
28 AC2 20 HOH D .   ? HOH A 11  . ? 1_555 ? 
29 AC2 20 HOH D .   ? HOH A 89  . ? 1_555 ? 
30 AC2 20 ARG A 79  ? ARG A 301 . ? 1_555 ? 
31 AC2 20 GLY A 315 ? GLY A 537 . ? 1_555 ? 
32 AC2 20 THR A 316 ? THR A 538 . ? 1_555 ? 
33 AC2 20 CYS A 347 ? CYS A 569 . ? 1_555 ? 
34 AC2 20 ARG A 348 ? ARG A 570 . ? 1_555 ? 
35 AC2 20 SER A 377 ? SER A 599 . ? 1_555 ? 
36 AC2 20 ARG A 378 ? ARG A 600 . ? 1_555 ? 
37 AC2 20 LYS A 383 ? LYS A 605 . ? 1_555 ? 
38 AC2 20 TYR A 385 ? TYR A 607 . ? 1_555 ? 
39 AC2 20 GLN A 387 ? GLN A 609 . ? 1_555 ? 
40 AC2 20 ASN A 415 ? ASN A 637 . ? 1_555 ? 
41 AC2 20 MET A 416 ? MET A 638 . ? 1_555 ? 
42 AC2 20 ASP A 419 ? ASP A 641 . ? 1_555 ? 
43 AC2 20 HOH D .   ? HOH A 719 . ? 1_555 ? 
44 AC2 20 HOH D .   ? HOH A 775 . ? 1_555 ? 
45 AC2 20 HOH D .   ? HOH A 826 . ? 1_555 ? 
46 AC2 20 HOH D .   ? HOH A 879 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QFS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QFS 
_atom_sites.fract_transf_matrix[1][1]   0.018302 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017082 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007676 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 24  ? 13.732 10.717 36.425  1.00 28.04 ? 246 ARG A N     1 
ATOM   2    C CA    . ARG A 1 24  ? 14.571 11.369 35.376  1.00 26.82 ? 246 ARG A CA    1 
ATOM   3    C C     . ARG A 1 24  ? 13.749 12.275 34.464  1.00 26.16 ? 246 ARG A C     1 
ATOM   4    O O     . ARG A 1 24  ? 12.520 12.291 34.537  1.00 27.09 ? 246 ARG A O     1 
ATOM   5    C CB    . ARG A 1 24  ? 15.311 10.308 34.562  1.00 27.39 ? 246 ARG A CB    1 
ATOM   6    C CG    . ARG A 1 24  ? 14.637 8.954  34.549  1.00 25.84 ? 246 ARG A CG    1 
ATOM   7    C CD    . ARG A 1 24  ? 15.557 7.902  33.960  1.00 24.40 ? 246 ARG A CD    1 
ATOM   8    N NE    . ARG A 1 24  ? 15.898 8.201  32.574  1.00 22.09 ? 246 ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 24  ? 16.357 7.301  31.714  1.00 22.25 ? 246 ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 24  ? 16.532 6.046  32.101  1.00 22.38 ? 246 ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 24  ? 16.617 7.652  30.461  1.00 21.73 ? 246 ARG A NH2   1 
ATOM   12   N N     . GLN A 1 25  ? 14.432 13.022 33.600  1.00 24.00 ? 247 GLN A N     1 
ATOM   13   C CA    . GLN A 1 25  ? 13.766 13.972 32.713  1.00 22.70 ? 247 GLN A CA    1 
ATOM   14   C C     . GLN A 1 25  ? 13.110 13.408 31.456  1.00 21.85 ? 247 GLN A C     1 
ATOM   15   O O     . GLN A 1 25  ? 12.157 13.992 30.943  1.00 21.04 ? 247 GLN A O     1 
ATOM   16   C CB    . GLN A 1 25  ? 14.747 15.076 32.309  1.00 24.52 ? 247 GLN A CB    1 
ATOM   17   C CG    . GLN A 1 25  ? 14.071 16.316 31.740  1.00 27.10 ? 247 GLN A CG    1 
ATOM   18   C CD    . GLN A 1 25  ? 13.163 16.992 32.754  1.00 29.04 ? 247 GLN A CD    1 
ATOM   19   O OE1   . GLN A 1 25  ? 13.615 17.434 33.811  1.00 30.02 ? 247 GLN A OE1   1 
ATOM   20   N NE2   . GLN A 1 25  ? 11.873 17.073 32.437  1.00 28.28 ? 247 GLN A NE2   1 
ATOM   21   N N     . TYR A 1 26  ? 13.613 12.285 30.957  1.00 20.02 ? 248 TYR A N     1 
ATOM   22   C CA    . TYR A 1 26  ? 13.062 11.681 29.748  1.00 18.22 ? 248 TYR A CA    1 
ATOM   23   C C     . TYR A 1 26  ? 12.635 10.242 29.962  1.00 19.69 ? 248 TYR A C     1 
ATOM   24   O O     . TYR A 1 26  ? 13.152 9.555  30.843  1.00 21.49 ? 248 TYR A O     1 
ATOM   25   C CB    . TYR A 1 26  ? 14.103 11.695 28.626  1.00 17.90 ? 248 TYR A CB    1 
ATOM   26   C CG    . TYR A 1 26  ? 14.644 13.061 28.284  1.00 16.75 ? 248 TYR A CG    1 
ATOM   27   C CD1   . TYR A 1 26  ? 13.929 13.934 27.465  1.00 16.41 ? 248 TYR A CD1   1 
ATOM   28   C CD2   . TYR A 1 26  ? 15.874 13.486 28.785  1.00 18.83 ? 248 TYR A CD2   1 
ATOM   29   C CE1   . TYR A 1 26  ? 14.428 15.201 27.152  1.00 17.13 ? 248 TYR A CE1   1 
ATOM   30   C CE2   . TYR A 1 26  ? 16.381 14.744 28.478  1.00 19.35 ? 248 TYR A CE2   1 
ATOM   31   C CZ    . TYR A 1 26  ? 15.656 15.596 27.662  1.00 19.19 ? 248 TYR A CZ    1 
ATOM   32   O OH    . TYR A 1 26  ? 16.171 16.836 27.356  1.00 19.96 ? 248 TYR A OH    1 
ATOM   33   N N     . GLU A 1 27  ? 11.687 9.791  29.149  1.00 19.92 ? 249 GLU A N     1 
ATOM   34   C CA    . GLU A 1 27  ? 11.243 8.411  29.208  1.00 20.47 ? 249 GLU A CA    1 
ATOM   35   C C     . GLU A 1 27  ? 11.681 7.784  27.892  1.00 20.21 ? 249 GLU A C     1 
ATOM   36   O O     . GLU A 1 27  ? 11.687 8.441  26.843  1.00 18.19 ? 249 GLU A O     1 
ATOM   37   C CB    . GLU A 1 27  ? 9.723  8.310  29.378  1.00 24.18 ? 249 GLU A CB    1 
ATOM   38   C CG    . GLU A 1 27  ? 8.898  8.763  28.194  1.00 27.88 ? 249 GLU A CG    1 
ATOM   39   C CD    . GLU A 1 27  ? 7.416  8.501  28.402  1.00 30.95 ? 249 GLU A CD    1 
ATOM   40   O OE1   . GLU A 1 27  ? 6.620  8.798  27.488  1.00 31.65 ? 249 GLU A OE1   1 
ATOM   41   O OE2   . GLU A 1 27  ? 7.048  7.995  29.484  1.00 32.68 ? 249 GLU A OE2   1 
ATOM   42   N N     . LEU A 1 28  ? 12.069 6.518  27.960  1.00 19.65 ? 250 LEU A N     1 
ATOM   43   C CA    . LEU A 1 28  ? 12.535 5.780  26.796  1.00 18.55 ? 250 LEU A CA    1 
ATOM   44   C C     . LEU A 1 28  ? 11.417 5.115  26.004  1.00 18.21 ? 250 LEU A C     1 
ATOM   45   O O     . LEU A 1 28  ? 10.549 4.449  26.567  1.00 18.76 ? 250 LEU A O     1 
ATOM   46   C CB    . LEU A 1 28  ? 13.532 4.706  27.237  1.00 17.75 ? 250 LEU A CB    1 
ATOM   47   C CG    . LEU A 1 28  ? 14.057 3.753  26.162  1.00 17.39 ? 250 LEU A CG    1 
ATOM   48   C CD1   . LEU A 1 28  ? 14.890 4.531  25.157  1.00 16.42 ? 250 LEU A CD1   1 
ATOM   49   C CD2   . LEU A 1 28  ? 14.893 2.657  26.810  1.00 20.05 ? 250 LEU A CD2   1 
ATOM   50   N N     . VAL A 1 29  ? 11.445 5.302  24.691  1.00 18.81 ? 251 VAL A N     1 
ATOM   51   C CA    . VAL A 1 29  ? 10.475 4.678  23.808  1.00 19.90 ? 251 VAL A CA    1 
ATOM   52   C C     . VAL A 1 29  ? 11.293 3.974  22.734  1.00 20.51 ? 251 VAL A C     1 
ATOM   53   O O     . VAL A 1 29  ? 11.897 4.619  21.874  1.00 19.76 ? 251 VAL A O     1 
ATOM   54   C CB    . VAL A 1 29  ? 9.534  5.710  23.143  1.00 20.99 ? 251 VAL A CB    1 
ATOM   55   C CG1   . VAL A 1 29  ? 8.551  4.993  22.225  1.00 22.28 ? 251 VAL A CG1   1 
ATOM   56   C CG2   . VAL A 1 29  ? 8.778  6.494  24.210  1.00 21.14 ? 251 VAL A CG2   1 
ATOM   57   N N     . VAL A 1 30  ? 11.339 2.649  22.802  1.00 20.14 ? 252 VAL A N     1 
ATOM   58   C CA    . VAL A 1 30  ? 12.092 1.870  21.833  1.00 21.46 ? 252 VAL A CA    1 
ATOM   59   C C     . VAL A 1 30  ? 11.262 1.642  20.580  1.00 22.10 ? 252 VAL A C     1 
ATOM   60   O O     . VAL A 1 30  ? 10.097 1.244  20.656  1.00 23.18 ? 252 VAL A O     1 
ATOM   61   C CB    . VAL A 1 30  ? 12.510 0.504  22.420  1.00 22.13 ? 252 VAL A CB    1 
ATOM   62   C CG1   . VAL A 1 30  ? 13.275 -0.303 21.380  1.00 22.33 ? 252 VAL A CG1   1 
ATOM   63   C CG2   . VAL A 1 30  ? 13.364 0.718  23.654  1.00 22.74 ? 252 VAL A CG2   1 
ATOM   64   N N     . HIS A 1 31  ? 11.866 1.910  19.429  1.00 20.48 ? 253 HIS A N     1 
ATOM   65   C CA    . HIS A 1 31  ? 11.204 1.728  18.147  1.00 22.07 ? 253 HIS A CA    1 
ATOM   66   C C     . HIS A 1 31  ? 11.821 0.499  17.495  1.00 22.75 ? 253 HIS A C     1 
ATOM   67   O O     . HIS A 1 31  ? 12.817 0.593  16.780  1.00 24.05 ? 253 HIS A O     1 
ATOM   68   C CB    . HIS A 1 31  ? 11.414 2.968  17.276  1.00 22.96 ? 253 HIS A CB    1 
ATOM   69   C CG    . HIS A 1 31  ? 10.934 4.233  17.914  1.00 22.88 ? 253 HIS A CG    1 
ATOM   70   N ND1   . HIS A 1 31  ? 11.739 5.341  18.070  1.00 25.20 ? 253 HIS A ND1   1 
ATOM   71   C CD2   . HIS A 1 31  ? 9.737  4.558  18.457  1.00 23.73 ? 253 HIS A CD2   1 
ATOM   72   C CE1   . HIS A 1 31  ? 11.058 6.293  18.684  1.00 22.59 ? 253 HIS A CE1   1 
ATOM   73   N NE2   . HIS A 1 31  ? 9.841  5.843  18.930  1.00 24.25 ? 253 HIS A NE2   1 
ATOM   74   N N     . THR A 1 32  ? 11.221 -0.658 17.754  1.00 23.94 ? 254 THR A N     1 
ATOM   75   C CA    . THR A 1 32  ? 11.724 -1.918 17.225  1.00 24.62 ? 254 THR A CA    1 
ATOM   76   C C     . THR A 1 32  ? 11.488 -2.135 15.733  1.00 24.55 ? 254 THR A C     1 
ATOM   77   O O     . THR A 1 32  ? 12.188 -2.928 15.112  1.00 25.80 ? 254 THR A O     1 
ATOM   78   C CB    . THR A 1 32  ? 11.122 -3.117 17.991  1.00 25.82 ? 254 THR A CB    1 
ATOM   79   O OG1   . THR A 1 32  ? 9.698  -3.125 17.828  1.00 27.48 ? 254 THR A OG1   1 
ATOM   80   C CG2   . THR A 1 32  ? 11.455 -3.021 19.474  1.00 26.13 ? 254 THR A CG2   1 
ATOM   81   N N     . ASP A 1 33  ? 10.519 -1.434 15.154  1.00 25.65 ? 255 ASP A N     1 
ATOM   82   C CA    . ASP A 1 33  ? 10.225 -1.600 13.731  1.00 26.45 ? 255 ASP A CA    1 
ATOM   83   C C     . ASP A 1 33  ? 9.873  -0.291 13.033  1.00 26.30 ? 255 ASP A C     1 
ATOM   84   O O     . ASP A 1 33  ? 8.796  -0.148 12.451  1.00 26.82 ? 255 ASP A O     1 
ATOM   85   C CB    . ASP A 1 33  ? 9.089  -2.609 13.561  1.00 29.32 ? 255 ASP A CB    1 
ATOM   86   C CG    . ASP A 1 33  ? 7.879  -2.273 14.410  1.00 31.89 ? 255 ASP A CG    1 
ATOM   87   O OD1   . ASP A 1 33  ? 7.003  -3.150 14.563  1.00 34.39 ? 255 ASP A OD1   1 
ATOM   88   O OD2   . ASP A 1 33  ? 7.799  -1.135 14.923  1.00 33.17 ? 255 ASP A OD2   1 
ATOM   89   N N     . ILE A 1 34  ? 10.802 0.656  13.072  1.00 25.15 ? 256 ILE A N     1 
ATOM   90   C CA    . ILE A 1 34  ? 10.597 1.963  12.465  1.00 23.89 ? 256 ILE A CA    1 
ATOM   91   C C     . ILE A 1 34  ? 11.182 2.040  11.054  1.00 22.88 ? 256 ILE A C     1 
ATOM   92   O O     . ILE A 1 34  ? 12.168 1.369  10.744  1.00 23.21 ? 256 ILE A O     1 
ATOM   93   C CB    . ILE A 1 34  ? 11.239 3.057  13.345  1.00 23.90 ? 256 ILE A CB    1 
ATOM   94   C CG1   . ILE A 1 34  ? 10.886 4.445  12.812  1.00 24.75 ? 256 ILE A CG1   1 
ATOM   95   C CG2   . ILE A 1 34  ? 12.753 2.865  13.386  1.00 24.64 ? 256 ILE A CG2   1 
ATOM   96   C CD1   . ILE A 1 34  ? 11.351 5.572  13.709  1.00 24.44 ? 256 ILE A CD1   1 
ATOM   97   N N     . ASP A 1 35  ? 10.567 2.851  10.198  1.00 22.89 ? 257 ASP A N     1 
ATOM   98   C CA    . ASP A 1 35  ? 11.054 3.014  8.829   1.00 22.50 ? 257 ASP A CA    1 
ATOM   99   C C     . ASP A 1 35  ? 12.391 3.745  8.846   1.00 23.14 ? 257 ASP A C     1 
ATOM   100  O O     . ASP A 1 35  ? 12.556 4.733  9.562   1.00 23.08 ? 257 ASP A O     1 
ATOM   101  C CB    . ASP A 1 35  ? 10.062 3.819  7.983   1.00 23.63 ? 257 ASP A CB    1 
ATOM   102  C CG    . ASP A 1 35  ? 8.705  3.156  7.876   1.00 25.86 ? 257 ASP A CG    1 
ATOM   103  O OD1   . ASP A 1 35  ? 8.647  1.910  7.846   1.00 26.92 ? 257 ASP A OD1   1 
ATOM   104  O OD2   . ASP A 1 35  ? 7.697  3.888  7.802   1.00 25.41 ? 257 ASP A OD2   1 
ATOM   105  N N     . ALA A 1 36  ? 13.338 3.266  8.047   1.00 22.43 ? 258 ALA A N     1 
ATOM   106  C CA    . ALA A 1 36  ? 14.660 3.873  7.981   1.00 23.36 ? 258 ALA A CA    1 
ATOM   107  C C     . ALA A 1 36  ? 14.604 5.368  7.672   1.00 23.14 ? 258 ALA A C     1 
ATOM   108  O O     . ALA A 1 36  ? 15.386 6.151  8.212   1.00 22.37 ? 258 ALA A O     1 
ATOM   109  C CB    . ALA A 1 36  ? 15.505 3.158  6.938   1.00 25.23 ? 258 ALA A CB    1 
ATOM   110  N N     . ALA A 1 37  ? 13.674 5.760  6.808   1.00 22.34 ? 259 ALA A N     1 
ATOM   111  C CA    . ALA A 1 37  ? 13.527 7.159  6.413   1.00 20.96 ? 259 ALA A CA    1 
ATOM   112  C C     . ALA A 1 37  ? 13.188 8.106  7.567   1.00 20.89 ? 259 ALA A C     1 
ATOM   113  O O     . ALA A 1 37  ? 13.364 9.318  7.445   1.00 21.40 ? 259 ALA A O     1 
ATOM   114  C CB    . ALA A 1 37  ? 12.465 7.273  5.326   1.00 22.17 ? 259 ALA A CB    1 
ATOM   115  N N     . LYS A 1 38  ? 12.704 7.557  8.679   1.00 18.69 ? 260 LYS A N     1 
ATOM   116  C CA    . LYS A 1 38  ? 12.329 8.367  9.836   1.00 17.68 ? 260 LYS A CA    1 
ATOM   117  C C     . LYS A 1 38  ? 13.428 8.449  10.892  1.00 16.97 ? 260 LYS A C     1 
ATOM   118  O O     . LYS A 1 38  ? 13.257 9.113  11.909  1.00 17.08 ? 260 LYS A O     1 
ATOM   119  C CB    . LYS A 1 38  ? 11.088 7.784  10.521  1.00 20.39 ? 260 LYS A CB    1 
ATOM   120  C CG    . LYS A 1 38  ? 9.838  7.680  9.671   1.00 23.27 ? 260 LYS A CG    1 
ATOM   121  C CD    . LYS A 1 38  ? 8.732  7.007  10.474  1.00 25.17 ? 260 LYS A CD    1 
ATOM   122  C CE    . LYS A 1 38  ? 7.412  6.993  9.729   1.00 28.95 ? 260 LYS A CE    1 
ATOM   123  N NZ    . LYS A 1 38  ? 6.338  6.351  10.542  1.00 29.32 ? 260 LYS A NZ    1 
ATOM   124  N N     . VAL A 1 39  ? 14.552 7.788  10.649  1.00 16.25 ? 261 VAL A N     1 
ATOM   125  C CA    . VAL A 1 39  ? 15.625 7.749  11.639  1.00 15.89 ? 261 VAL A CA    1 
ATOM   126  C C     . VAL A 1 39  ? 16.793 8.704  11.431  1.00 15.94 ? 261 VAL A C     1 
ATOM   127  O O     . VAL A 1 39  ? 17.384 8.754  10.356  1.00 16.43 ? 261 VAL A O     1 
ATOM   128  C CB    . VAL A 1 39  ? 16.178 6.315  11.750  1.00 16.41 ? 261 VAL A CB    1 
ATOM   129  C CG1   . VAL A 1 39  ? 17.193 6.226  12.883  1.00 16.26 ? 261 VAL A CG1   1 
ATOM   130  C CG2   . VAL A 1 39  ? 15.030 5.340  11.980  1.00 15.62 ? 261 VAL A CG2   1 
ATOM   131  N N     . TYR A 1 40  ? 17.119 9.461  12.476  1.00 14.50 ? 262 TYR A N     1 
ATOM   132  C CA    . TYR A 1 40  ? 18.241 10.390 12.418  1.00 14.59 ? 262 TYR A CA    1 
ATOM   133  C C     . TYR A 1 40  ? 19.555 9.615  12.376  1.00 15.18 ? 262 TYR A C     1 
ATOM   134  O O     . TYR A 1 40  ? 19.728 8.625  13.098  1.00 14.14 ? 262 TYR A O     1 
ATOM   135  C CB    . TYR A 1 40  ? 18.241 11.320 13.633  1.00 14.76 ? 262 TYR A CB    1 
ATOM   136  C CG    . TYR A 1 40  ? 17.380 12.549 13.466  1.00 15.18 ? 262 TYR A CG    1 
ATOM   137  C CD1   . TYR A 1 40  ? 16.054 12.569 13.898  1.00 14.90 ? 262 TYR A CD1   1 
ATOM   138  C CD2   . TYR A 1 40  ? 17.898 13.699 12.868  1.00 15.38 ? 262 TYR A CD2   1 
ATOM   139  C CE1   . TYR A 1 40  ? 15.265 13.710 13.739  1.00 17.18 ? 262 TYR A CE1   1 
ATOM   140  C CE2   . TYR A 1 40  ? 17.124 14.837 12.707  1.00 17.80 ? 262 TYR A CE2   1 
ATOM   141  C CZ    . TYR A 1 40  ? 15.812 14.840 13.143  1.00 16.46 ? 262 TYR A CZ    1 
ATOM   142  O OH    . TYR A 1 40  ? 15.057 15.981 12.992  1.00 19.78 ? 262 TYR A OH    1 
ATOM   143  N N     . MET A 1 41  ? 20.477 10.078 11.534  1.00 13.48 ? 263 MET A N     1 
ATOM   144  C CA    . MET A 1 41  ? 21.777 9.434  11.363  1.00 14.89 ? 263 MET A CA    1 
ATOM   145  C C     . MET A 1 41  ? 22.949 10.371 11.642  1.00 14.20 ? 263 MET A C     1 
ATOM   146  O O     . MET A 1 41  ? 24.065 10.126 11.181  1.00 17.35 ? 263 MET A O     1 
ATOM   147  C CB    . MET A 1 41  ? 21.909 8.886  9.935   1.00 16.24 ? 263 MET A CB    1 
ATOM   148  C CG    . MET A 1 41  ? 20.883 7.827  9.567   1.00 18.59 ? 263 MET A CG    1 
ATOM   149  S SD    . MET A 1 41  ? 20.934 6.382  10.644  1.00 22.45 ? 263 MET A SD    1 
ATOM   150  C CE    . MET A 1 41  ? 22.397 5.568  10.051  1.00 23.40 ? 263 MET A CE    1 
ATOM   151  N N     . GLY A 1 42  ? 22.702 11.436 12.396  1.00 14.75 ? 264 GLY A N     1 
ATOM   152  C CA    . GLY A 1 42  ? 23.769 12.371 12.703  1.00 14.38 ? 264 GLY A CA    1 
ATOM   153  C C     . GLY A 1 42  ? 23.486 13.825 12.375  1.00 15.52 ? 264 GLY A C     1 
ATOM   154  O O     . GLY A 1 42  ? 24.235 14.706 12.795  1.00 15.33 ? 264 GLY A O     1 
ATOM   155  N N     . GLU A 1 43  ? 22.420 14.091 11.621  1.00 15.70 ? 265 GLU A N     1 
ATOM   156  C CA    . GLU A 1 43  ? 22.071 15.471 11.275  1.00 15.24 ? 265 GLU A CA    1 
ATOM   157  C C     . GLU A 1 43  ? 21.811 16.277 12.542  1.00 15.21 ? 265 GLU A C     1 
ATOM   158  O O     . GLU A 1 43  ? 21.257 15.764 13.514  1.00 14.53 ? 265 GLU A O     1 
ATOM   159  C CB    . GLU A 1 43  ? 20.812 15.527 10.402  1.00 18.61 ? 265 GLU A CB    1 
ATOM   160  C CG    . GLU A 1 43  ? 20.807 14.588 9.215   1.00 19.28 ? 265 GLU A CG    1 
ATOM   161  C CD    . GLU A 1 43  ? 20.072 13.294 9.505   1.00 21.32 ? 265 GLU A CD    1 
ATOM   162  O OE1   . GLU A 1 43  ? 20.412 12.618 10.495  1.00 15.66 ? 265 GLU A OE1   1 
ATOM   163  O OE2   . GLU A 1 43  ? 19.150 12.948 8.739   1.00 21.66 ? 265 GLU A OE2   1 
ATOM   164  N N     . MET A 1 44  ? 22.202 17.547 12.525  1.00 16.04 ? 266 MET A N     1 
ATOM   165  C CA    . MET A 1 44  ? 22.017 18.419 13.678  1.00 17.20 ? 266 MET A CA    1 
ATOM   166  C C     . MET A 1 44  ? 20.656 19.104 13.721  1.00 18.05 ? 266 MET A C     1 
ATOM   167  O O     . MET A 1 44  ? 20.184 19.480 14.792  1.00 19.52 ? 266 MET A O     1 
ATOM   168  C CB    . MET A 1 44  ? 23.115 19.488 13.714  1.00 17.35 ? 266 MET A CB    1 
ATOM   169  C CG    . MET A 1 44  ? 24.480 18.968 14.118  1.00 21.19 ? 266 MET A CG    1 
ATOM   170  S SD    . MET A 1 44  ? 24.453 18.235 15.766  1.00 22.25 ? 266 MET A SD    1 
ATOM   171  C CE    . MET A 1 44  ? 24.760 19.658 16.784  1.00 23.65 ? 266 MET A CE    1 
ATOM   172  N N     . GLY A 1 45  ? 20.028 19.256 12.557  1.00 17.78 ? 267 GLY A N     1 
ATOM   173  C CA    . GLY A 1 45  ? 18.740 19.920 12.495  1.00 17.34 ? 267 GLY A CA    1 
ATOM   174  C C     . GLY A 1 45  ? 17.615 19.070 11.941  1.00 18.24 ? 267 GLY A C     1 
ATOM   175  O O     . GLY A 1 45  ? 17.163 18.129 12.592  1.00 18.65 ? 267 GLY A O     1 
ATOM   176  N N     . ARG A 1 46  ? 17.163 19.399 10.734  1.00 16.92 ? 268 ARG A N     1 
ATOM   177  C CA    . ARG A 1 46  ? 16.067 18.667 10.114  1.00 16.65 ? 268 ARG A CA    1 
ATOM   178  C C     . ARG A 1 46  ? 16.447 17.279 9.631   1.00 15.31 ? 268 ARG A C     1 
ATOM   179  O O     . ARG A 1 46  ? 17.559 17.043 9.159   1.00 15.02 ? 268 ARG A O     1 
ATOM   180  C CB    . ARG A 1 46  ? 15.480 19.473 8.953   1.00 19.47 ? 268 ARG A CB    1 
ATOM   181  C CG    . ARG A 1 46  ? 14.977 20.842 9.371   1.00 23.22 ? 268 ARG A CG    1 
ATOM   182  C CD    . ARG A 1 46  ? 13.836 21.313 8.487   1.00 27.65 ? 268 ARG A CD    1 
ATOM   183  N NE    . ARG A 1 46  ? 14.213 21.397 7.080   1.00 29.68 ? 268 ARG A NE    1 
ATOM   184  C CZ    . ARG A 1 46  ? 13.397 21.806 6.113   1.00 31.23 ? 268 ARG A CZ    1 
ATOM   185  N NH1   . ARG A 1 46  ? 12.153 22.169 6.401   1.00 30.86 ? 268 ARG A NH1   1 
ATOM   186  N NH2   . ARG A 1 46  ? 13.825 21.857 4.859   1.00 31.73 ? 268 ARG A NH2   1 
ATOM   187  N N     . LEU A 1 47  ? 15.501 16.356 9.754   1.00 14.93 ? 269 LEU A N     1 
ATOM   188  C CA    . LEU A 1 47  ? 15.716 14.986 9.326   1.00 15.87 ? 269 LEU A CA    1 
ATOM   189  C C     . LEU A 1 47  ? 16.075 14.950 7.843   1.00 15.38 ? 269 LEU A C     1 
ATOM   190  O O     . LEU A 1 47  ? 15.416 15.595 7.025   1.00 15.58 ? 269 LEU A O     1 
ATOM   191  C CB    . LEU A 1 47  ? 14.447 14.167 9.582   1.00 18.37 ? 269 LEU A CB    1 
ATOM   192  C CG    . LEU A 1 47  ? 14.445 12.693 9.177   1.00 19.66 ? 269 LEU A CG    1 
ATOM   193  C CD1   . LEU A 1 47  ? 15.536 11.940 9.928   1.00 19.38 ? 269 LEU A CD1   1 
ATOM   194  C CD2   . LEU A 1 47  ? 13.072 12.095 9.482   1.00 20.68 ? 269 LEU A CD2   1 
ATOM   195  N N     . LYS A 1 48  ? 17.132 14.209 7.514   1.00 16.11 ? 270 LYS A N     1 
ATOM   196  C CA    . LYS A 1 48  ? 17.601 14.045 6.139   1.00 16.29 ? 270 LYS A CA    1 
ATOM   197  C C     . LYS A 1 48  ? 18.260 15.275 5.505   1.00 15.37 ? 270 LYS A C     1 
ATOM   198  O O     . LYS A 1 48  ? 18.516 15.288 4.296   1.00 16.04 ? 270 LYS A O     1 
ATOM   199  C CB    . LYS A 1 48  ? 16.449 13.566 5.242   1.00 17.24 ? 270 LYS A CB    1 
ATOM   200  C CG    . LYS A 1 48  ? 15.918 12.174 5.572   1.00 21.80 ? 270 LYS A CG    1 
ATOM   201  C CD    . LYS A 1 48  ? 16.932 11.089 5.257   1.00 23.34 ? 270 LYS A CD    1 
ATOM   202  C CE    . LYS A 1 48  ? 16.339 9.706  5.471   1.00 25.00 ? 270 LYS A CE    1 
ATOM   203  N NZ    . LYS A 1 48  ? 17.274 8.632  5.045   1.00 26.71 ? 270 LYS A NZ    1 
ATOM   204  N N     . SER A 1 49  ? 18.553 16.294 6.309   1.00 14.87 ? 271 SER A N     1 
ATOM   205  C CA    . SER A 1 49  ? 19.181 17.510 5.791   1.00 13.90 ? 271 SER A CA    1 
ATOM   206  C C     . SER A 1 49  ? 20.632 17.318 5.352   1.00 13.99 ? 271 SER A C     1 
ATOM   207  O O     . SER A 1 49  ? 21.117 18.052 4.498   1.00 13.40 ? 271 SER A O     1 
ATOM   208  C CB    . SER A 1 49  ? 19.103 18.640 6.822   1.00 15.90 ? 271 SER A CB    1 
ATOM   209  O OG    . SER A 1 49  ? 19.714 18.264 8.045   1.00 15.55 ? 271 SER A OG    1 
ATOM   210  N N     . TYR A 1 50  ? 21.323 16.346 5.940   1.00 14.28 ? 272 TYR A N     1 
ATOM   211  C CA    . TYR A 1 50  ? 22.709 16.063 5.569   1.00 14.89 ? 272 TYR A CA    1 
ATOM   212  C C     . TYR A 1 50  ? 22.761 15.414 4.186   1.00 14.62 ? 272 TYR A C     1 
ATOM   213  O O     . TYR A 1 50  ? 23.639 15.708 3.381   1.00 14.49 ? 272 TYR A O     1 
ATOM   214  C CB    . TYR A 1 50  ? 23.350 15.115 6.589   1.00 13.85 ? 272 TYR A CB    1 
ATOM   215  C CG    . TYR A 1 50  ? 23.970 15.786 7.797   1.00 13.41 ? 272 TYR A CG    1 
ATOM   216  C CD1   . TYR A 1 50  ? 23.552 17.045 8.224   1.00 13.87 ? 272 TYR A CD1   1 
ATOM   217  C CD2   . TYR A 1 50  ? 24.971 15.142 8.527   1.00 13.54 ? 272 TYR A CD2   1 
ATOM   218  C CE1   . TYR A 1 50  ? 24.113 17.651 9.348   1.00 13.08 ? 272 TYR A CE1   1 
ATOM   219  C CE2   . TYR A 1 50  ? 25.542 15.739 9.653   1.00 13.99 ? 272 TYR A CE2   1 
ATOM   220  C CZ    . TYR A 1 50  ? 25.109 16.989 10.056  1.00 12.60 ? 272 TYR A CZ    1 
ATOM   221  O OH    . TYR A 1 50  ? 25.668 17.590 11.156  1.00 13.14 ? 272 TYR A OH    1 
ATOM   222  N N     . GLU A 1 51  ? 21.801 14.533 3.924   1.00 15.48 ? 273 GLU A N     1 
ATOM   223  C CA    . GLU A 1 51  ? 21.717 13.803 2.663   1.00 15.58 ? 273 GLU A CA    1 
ATOM   224  C C     . GLU A 1 51  ? 21.103 14.611 1.524   1.00 15.67 ? 273 GLU A C     1 
ATOM   225  O O     . GLU A 1 51  ? 21.507 14.485 0.368   1.00 16.38 ? 273 GLU A O     1 
ATOM   226  C CB    . GLU A 1 51  ? 20.896 12.535 2.883   1.00 16.80 ? 273 GLU A CB    1 
ATOM   227  C CG    . GLU A 1 51  ? 20.811 11.624 1.683   1.00 22.13 ? 273 GLU A CG    1 
ATOM   228  C CD    . GLU A 1 51  ? 19.899 10.451 1.940   1.00 22.70 ? 273 GLU A CD    1 
ATOM   229  O OE1   . GLU A 1 51  ? 18.693 10.685 2.161   1.00 25.87 ? 273 GLU A OE1   1 
ATOM   230  O OE2   . GLU A 1 51  ? 20.384 9.302  1.930   1.00 26.20 ? 273 GLU A OE2   1 
ATOM   231  N N     . ASN A 1 52  ? 20.111 15.425 1.864   1.00 15.19 ? 274 ASN A N     1 
ATOM   232  C CA    . ASN A 1 52  ? 19.417 16.265 0.897   1.00 15.79 ? 274 ASN A CA    1 
ATOM   233  C C     . ASN A 1 52  ? 19.788 17.696 1.242   1.00 16.37 ? 274 ASN A C     1 
ATOM   234  O O     . ASN A 1 52  ? 19.153 18.352 2.069   1.00 16.26 ? 274 ASN A O     1 
ATOM   235  C CB    . ASN A 1 52  ? 17.917 16.027 1.014   1.00 17.94 ? 274 ASN A CB    1 
ATOM   236  C CG    . ASN A 1 52  ? 17.554 14.577 0.769   1.00 18.95 ? 274 ASN A CG    1 
ATOM   237  O OD1   . ASN A 1 52  ? 17.629 14.092 -0.356  1.00 18.51 ? 274 ASN A OD1   1 
ATOM   238  N ND2   . ASN A 1 52  ? 17.188 13.869 1.830   1.00 22.62 ? 274 ASN A ND2   1 
ATOM   239  N N     . GLN A 1 53  ? 20.849 18.153 0.592   1.00 15.11 ? 275 GLN A N     1 
ATOM   240  C CA    . GLN A 1 53  ? 21.415 19.468 0.818   1.00 14.79 ? 275 GLN A CA    1 
ATOM   241  C C     . GLN A 1 53  ? 20.843 20.589 -0.028  1.00 14.59 ? 275 GLN A C     1 
ATOM   242  O O     . GLN A 1 53  ? 21.002 20.612 -1.249  1.00 15.37 ? 275 GLN A O     1 
ATOM   243  C CB    . GLN A 1 53  ? 22.916 19.366 0.611   1.00 14.44 ? 275 GLN A CB    1 
ATOM   244  C CG    . GLN A 1 53  ? 23.566 18.454 1.622   1.00 15.53 ? 275 GLN A CG    1 
ATOM   245  C CD    . GLN A 1 53  ? 24.284 19.246 2.675   1.00 14.21 ? 275 GLN A CD    1 
ATOM   246  O OE1   . GLN A 1 53  ? 25.353 19.796 2.413   1.00 12.86 ? 275 GLN A OE1   1 
ATOM   247  N NE2   . GLN A 1 53  ? 23.694 19.341 3.863   1.00 13.83 ? 275 GLN A NE2   1 
ATOM   248  N N     . LYS A 1 54  ? 20.192 21.530 0.640   1.00 16.41 ? 276 LYS A N     1 
ATOM   249  C CA    . LYS A 1 54  ? 19.590 22.667 -0.036  1.00 17.91 ? 276 LYS A CA    1 
ATOM   250  C C     . LYS A 1 54  ? 19.910 23.943 0.726   1.00 17.72 ? 276 LYS A C     1 
ATOM   251  O O     . LYS A 1 54  ? 19.753 24.000 1.942   1.00 17.10 ? 276 LYS A O     1 
ATOM   252  C CB    . LYS A 1 54  ? 18.072 22.483 -0.117  1.00 21.14 ? 276 LYS A CB    1 
ATOM   253  C CG    . LYS A 1 54  ? 17.355 23.579 -0.889  1.00 25.87 ? 276 LYS A CG    1 
ATOM   254  C CD    . LYS A 1 54  ? 15.851 23.347 -0.941  1.00 28.80 ? 276 LYS A CD    1 
ATOM   255  C CE    . LYS A 1 54  ? 15.184 23.612 0.402   1.00 29.77 ? 276 LYS A CE    1 
ATOM   256  N NZ    . LYS A 1 54  ? 15.617 22.675 1.473   1.00 30.62 ? 276 LYS A NZ    1 
ATOM   257  N N     . PRO A 1 55  ? 20.382 24.980 0.018   1.00 17.78 ? 277 PRO A N     1 
ATOM   258  C CA    . PRO A 1 55  ? 20.708 26.246 0.679   1.00 17.65 ? 277 PRO A CA    1 
ATOM   259  C C     . PRO A 1 55  ? 19.447 26.971 1.148   1.00 18.67 ? 277 PRO A C     1 
ATOM   260  O O     . PRO A 1 55  ? 18.339 26.665 0.705   1.00 19.62 ? 277 PRO A O     1 
ATOM   261  C CB    . PRO A 1 55  ? 21.462 27.018 -0.402  1.00 18.34 ? 277 PRO A CB    1 
ATOM   262  C CG    . PRO A 1 55  ? 20.855 26.505 -1.668  1.00 19.04 ? 277 PRO A CG    1 
ATOM   263  C CD    . PRO A 1 55  ? 20.735 25.022 -1.411  1.00 17.80 ? 277 PRO A CD    1 
ATOM   264  N N     . PRO A 1 56  ? 19.600 27.951 2.048   1.00 18.49 ? 278 PRO A N     1 
ATOM   265  C CA    . PRO A 1 56  ? 20.862 28.407 2.635   1.00 18.19 ? 278 PRO A CA    1 
ATOM   266  C C     . PRO A 1 56  ? 21.437 27.463 3.690   1.00 16.85 ? 278 PRO A C     1 
ATOM   267  O O     . PRO A 1 56  ? 20.693 26.820 4.434   1.00 16.95 ? 278 PRO A O     1 
ATOM   268  C CB    . PRO A 1 56  ? 20.487 29.761 3.225   1.00 19.13 ? 278 PRO A CB    1 
ATOM   269  C CG    . PRO A 1 56  ? 19.084 29.531 3.673   1.00 20.20 ? 278 PRO A CG    1 
ATOM   270  C CD    . PRO A 1 56  ? 18.480 28.792 2.504   1.00 19.23 ? 278 PRO A CD    1 
ATOM   271  N N     . PHE A 1 57  ? 22.763 27.384 3.752   1.00 16.08 ? 279 PHE A N     1 
ATOM   272  C CA    . PHE A 1 57  ? 23.417 26.537 4.741   1.00 14.95 ? 279 PHE A CA    1 
ATOM   273  C C     . PHE A 1 57  ? 23.886 27.388 5.908   1.00 16.55 ? 279 PHE A C     1 
ATOM   274  O O     . PHE A 1 57  ? 24.460 28.461 5.724   1.00 18.89 ? 279 PHE A O     1 
ATOM   275  C CB    . PHE A 1 57  ? 24.593 25.782 4.121   1.00 14.46 ? 279 PHE A CB    1 
ATOM   276  C CG    . PHE A 1 57  ? 24.185 24.854 3.016   1.00 12.67 ? 279 PHE A CG    1 
ATOM   277  C CD1   . PHE A 1 57  ? 24.288 25.246 1.686   1.00 13.92 ? 279 PHE A CD1   1 
ATOM   278  C CD2   . PHE A 1 57  ? 23.636 23.609 3.308   1.00 12.87 ? 279 PHE A CD2   1 
ATOM   279  C CE1   . PHE A 1 57  ? 23.845 24.411 0.661   1.00 12.96 ? 279 PHE A CE1   1 
ATOM   280  C CE2   . PHE A 1 57  ? 23.188 22.765 2.290   1.00 13.91 ? 279 PHE A CE2   1 
ATOM   281  C CZ    . PHE A 1 57  ? 23.291 23.166 0.964   1.00 11.96 ? 279 PHE A CZ    1 
ATOM   282  N N     . ASP A 1 58  ? 23.620 26.898 7.112   1.00 15.74 ? 280 ASP A N     1 
ATOM   283  C CA    . ASP A 1 58  ? 23.980 27.591 8.335   1.00 17.18 ? 280 ASP A CA    1 
ATOM   284  C C     . ASP A 1 58  ? 24.144 26.583 9.467   1.00 16.10 ? 280 ASP A C     1 
ATOM   285  O O     . ASP A 1 58  ? 24.274 25.383 9.227   1.00 17.33 ? 280 ASP A O     1 
ATOM   286  C CB    . ASP A 1 58  ? 22.904 28.623 8.694   1.00 19.54 ? 280 ASP A CB    1 
ATOM   287  C CG    . ASP A 1 58  ? 21.498 28.055 8.619   1.00 21.62 ? 280 ASP A CG    1 
ATOM   288  O OD1   . ASP A 1 58  ? 21.307 26.867 8.955   1.00 19.30 ? 280 ASP A OD1   1 
ATOM   289  O OD2   . ASP A 1 58  ? 20.573 28.806 8.237   1.00 24.74 ? 280 ASP A OD2   1 
ATOM   290  N N     . ALA A 1 59  ? 24.131 27.066 10.703  1.00 16.41 ? 281 ALA A N     1 
ATOM   291  C CA    . ALA A 1 59  ? 24.306 26.189 11.854  1.00 15.58 ? 281 ALA A CA    1 
ATOM   292  C C     . ALA A 1 59  ? 23.292 25.051 11.946  1.00 15.86 ? 281 ALA A C     1 
ATOM   293  O O     . ALA A 1 59  ? 23.653 23.926 12.290  1.00 16.06 ? 281 ALA A O     1 
ATOM   294  C CB    . ALA A 1 59  ? 24.288 27.008 13.140  1.00 16.59 ? 281 ALA A CB    1 
ATOM   295  N N     . LYS A 1 60  ? 22.026 25.326 11.643  1.00 16.05 ? 282 LYS A N     1 
ATOM   296  C CA    . LYS A 1 60  ? 21.012 24.277 11.722  1.00 17.38 ? 282 LYS A CA    1 
ATOM   297  C C     . LYS A 1 60  ? 20.968 23.394 10.482  1.00 15.36 ? 282 LYS A C     1 
ATOM   298  O O     . LYS A 1 60  ? 20.497 22.259 10.538  1.00 16.71 ? 282 LYS A O     1 
ATOM   299  C CB    . LYS A 1 60  ? 19.634 24.894 11.990  1.00 18.87 ? 282 LYS A CB    1 
ATOM   300  C CG    . LYS A 1 60  ? 19.540 25.543 13.363  1.00 23.79 ? 282 LYS A CG    1 
ATOM   301  C CD    . LYS A 1 60  ? 18.140 26.048 13.682  1.00 25.34 ? 282 LYS A CD    1 
ATOM   302  C CE    . LYS A 1 60  ? 18.105 26.677 15.070  1.00 26.82 ? 282 LYS A CE    1 
ATOM   303  N NZ    . LYS A 1 60  ? 16.745 27.139 15.467  1.00 27.39 ? 282 LYS A NZ    1 
ATOM   304  N N     . ASN A 1 61  ? 21.475 23.918 9.371   1.00 14.11 ? 283 ASN A N     1 
ATOM   305  C CA    . ASN A 1 61  ? 21.520 23.197 8.101   1.00 13.67 ? 283 ASN A CA    1 
ATOM   306  C C     . ASN A 1 61  ? 22.953 23.322 7.580   1.00 13.70 ? 283 ASN A C     1 
ATOM   307  O O     . ASN A 1 61  ? 23.208 24.022 6.602   1.00 13.10 ? 283 ASN A O     1 
ATOM   308  C CB    . ASN A 1 61  ? 20.542 23.838 7.107   1.00 13.38 ? 283 ASN A CB    1 
ATOM   309  C CG    . ASN A 1 61  ? 20.539 23.152 5.753   1.00 13.32 ? 283 ASN A CG    1 
ATOM   310  O OD1   . ASN A 1 61  ? 20.350 23.797 4.717   1.00 15.02 ? 283 ASN A OD1   1 
ATOM   311  N ND2   . ASN A 1 61  ? 20.729 21.843 5.754   1.00 12.02 ? 283 ASN A ND2   1 
ATOM   312  N N     . PRO A 1 62  ? 23.911 22.644 8.231   1.00 12.56 ? 284 PRO A N     1 
ATOM   313  C CA    . PRO A 1 62  ? 25.298 22.745 7.773   1.00 12.32 ? 284 PRO A CA    1 
ATOM   314  C C     . PRO A 1 62  ? 25.541 22.136 6.404   1.00 12.45 ? 284 PRO A C     1 
ATOM   315  O O     . PRO A 1 62  ? 24.835 21.219 5.983   1.00 12.37 ? 284 PRO A O     1 
ATOM   316  C CB    . PRO A 1 62  ? 26.072 22.030 8.874   1.00 13.38 ? 284 PRO A CB    1 
ATOM   317  C CG    . PRO A 1 62  ? 25.114 20.960 9.296   1.00 13.58 ? 284 PRO A CG    1 
ATOM   318  C CD    . PRO A 1 62  ? 23.795 21.696 9.355   1.00 13.26 ? 284 PRO A CD    1 
ATOM   319  N N     . PHE A 1 63  ? 26.533 22.670 5.701   1.00 12.07 ? 285 PHE A N     1 
ATOM   320  C CA    . PHE A 1 63  ? 26.884 22.156 4.391   1.00 12.28 ? 285 PHE A CA    1 
ATOM   321  C C     . PHE A 1 63  ? 27.924 21.062 4.569   1.00 12.34 ? 285 PHE A C     1 
ATOM   322  O O     . PHE A 1 63  ? 28.905 21.248 5.292   1.00 12.14 ? 285 PHE A O     1 
ATOM   323  C CB    . PHE A 1 63  ? 27.467 23.266 3.514   1.00 11.75 ? 285 PHE A CB    1 
ATOM   324  C CG    . PHE A 1 63  ? 27.776 22.821 2.113   1.00 12.94 ? 285 PHE A CG    1 
ATOM   325  C CD1   . PHE A 1 63  ? 29.080 22.520 1.730   1.00 13.49 ? 285 PHE A CD1   1 
ATOM   326  C CD2   . PHE A 1 63  ? 26.755 22.676 1.182   1.00 11.93 ? 285 PHE A CD2   1 
ATOM   327  C CE1   . PHE A 1 63  ? 29.357 22.082 0.437   1.00 13.89 ? 285 PHE A CE1   1 
ATOM   328  C CE2   . PHE A 1 63  ? 27.026 22.238 -0.111  1.00 12.84 ? 285 PHE A CE2   1 
ATOM   329  C CZ    . PHE A 1 63  ? 28.329 21.941 -0.483  1.00 13.08 ? 285 PHE A CZ    1 
ATOM   330  N N     . LEU A 1 64  ? 27.701 19.917 3.931   1.00 10.80 ? 286 LEU A N     1 
ATOM   331  C CA    . LEU A 1 64  ? 28.652 18.816 4.012   1.00 12.34 ? 286 LEU A CA    1 
ATOM   332  C C     . LEU A 1 64  ? 29.683 19.031 2.913   1.00 12.57 ? 286 LEU A C     1 
ATOM   333  O O     . LEU A 1 64  ? 29.474 18.686 1.748   1.00 13.72 ? 286 LEU A O     1 
ATOM   334  C CB    . LEU A 1 64  ? 27.939 17.468 3.861   1.00 11.64 ? 286 LEU A CB    1 
ATOM   335  C CG    . LEU A 1 64  ? 27.547 16.860 5.219   1.00 13.12 ? 286 LEU A CG    1 
ATOM   336  C CD1   . LEU A 1 64  ? 26.556 17.775 5.929   1.00 12.81 ? 286 LEU A CD1   1 
ATOM   337  C CD2   . LEU A 1 64  ? 26.951 15.469 5.020   1.00 13.27 ? 286 LEU A CD2   1 
ATOM   338  N N     . ALA A 1 65  ? 30.794 19.639 3.310   1.00 12.69 ? 287 ALA A N     1 
ATOM   339  C CA    . ALA A 1 65  ? 31.890 19.969 2.405   1.00 11.91 ? 287 ALA A CA    1 
ATOM   340  C C     . ALA A 1 65  ? 32.834 18.793 2.191   1.00 12.38 ? 287 ALA A C     1 
ATOM   341  O O     . ALA A 1 65  ? 33.267 18.149 3.143   1.00 13.08 ? 287 ALA A O     1 
ATOM   342  C CB    . ALA A 1 65  ? 32.668 21.167 2.963   1.00 13.11 ? 287 ALA A CB    1 
ATOM   343  N N     . ALA A 1 66  ? 33.160 18.521 0.934   1.00 14.07 ? 288 ALA A N     1 
ATOM   344  C CA    . ALA A 1 66  ? 34.062 17.426 0.624   1.00 12.98 ? 288 ALA A CA    1 
ATOM   345  C C     . ALA A 1 66  ? 35.493 17.862 0.912   1.00 12.97 ? 288 ALA A C     1 
ATOM   346  O O     . ALA A 1 66  ? 35.897 18.967 0.548   1.00 14.32 ? 288 ALA A O     1 
ATOM   347  C CB    . ALA A 1 66  ? 33.922 17.037 -0.840  1.00 15.59 ? 288 ALA A CB    1 
ATOM   348  N N     . VAL A 1 67  ? 36.247 17.002 1.584   1.00 13.28 ? 289 VAL A N     1 
ATOM   349  C CA    . VAL A 1 67  ? 37.640 17.296 1.894   1.00 13.82 ? 289 VAL A CA    1 
ATOM   350  C C     . VAL A 1 67  ? 38.433 16.970 0.634   1.00 14.61 ? 289 VAL A C     1 
ATOM   351  O O     . VAL A 1 67  ? 38.568 15.803 0.270   1.00 16.44 ? 289 VAL A O     1 
ATOM   352  C CB    . VAL A 1 67  ? 38.150 16.416 3.058   1.00 13.71 ? 289 VAL A CB    1 
ATOM   353  C CG1   . VAL A 1 67  ? 39.619 16.714 3.337   1.00 14.55 ? 289 VAL A CG1   1 
ATOM   354  C CG2   . VAL A 1 67  ? 37.310 16.665 4.303   1.00 14.11 ? 289 VAL A CG2   1 
ATOM   355  N N     . THR A 1 68  ? 38.946 17.994 -0.040  1.00 13.92 ? 290 THR A N     1 
ATOM   356  C CA    . THR A 1 68  ? 39.697 17.750 -1.265  1.00 14.50 ? 290 THR A CA    1 
ATOM   357  C C     . THR A 1 68  ? 41.193 17.613 -1.015  1.00 14.16 ? 290 THR A C     1 
ATOM   358  O O     . THR A 1 68  ? 41.908 17.014 -1.825  1.00 15.74 ? 290 THR A O     1 
ATOM   359  C CB    . THR A 1 68  ? 39.434 18.851 -2.311  1.00 16.64 ? 290 THR A CB    1 
ATOM   360  O OG1   . THR A 1 68  ? 39.716 20.132 -1.744  1.00 17.45 ? 290 THR A OG1   1 
ATOM   361  C CG2   . THR A 1 68  ? 37.976 18.808 -2.764  1.00 18.07 ? 290 THR A CG2   1 
ATOM   362  N N     . THR A 1 69  ? 41.656 18.156 0.107   1.00 13.38 ? 291 THR A N     1 
ATOM   363  C CA    . THR A 1 69  ? 43.061 18.081 0.499   1.00 14.21 ? 291 THR A CA    1 
ATOM   364  C C     . THR A 1 69  ? 43.161 17.914 2.013   1.00 12.72 ? 291 THR A C     1 
ATOM   365  O O     . THR A 1 69  ? 42.448 18.570 2.767   1.00 13.79 ? 291 THR A O     1 
ATOM   366  C CB    . THR A 1 69  ? 43.843 19.369 0.131   1.00 13.79 ? 291 THR A CB    1 
ATOM   367  O OG1   . THR A 1 69  ? 43.949 19.487 -1.291  1.00 19.50 ? 291 THR A OG1   1 
ATOM   368  C CG2   . THR A 1 69  ? 45.243 19.338 0.743   1.00 17.50 ? 291 THR A CG2   1 
ATOM   369  N N     . ASN A 1 70  ? 44.037 17.015 2.447   1.00 13.19 ? 292 ASN A N     1 
ATOM   370  C CA    . ASN A 1 70  ? 44.298 16.786 3.865   1.00 12.40 ? 292 ASN A CA    1 
ATOM   371  C C     . ASN A 1 70  ? 45.775 16.422 3.889   1.00 13.64 ? 292 ASN A C     1 
ATOM   372  O O     . ASN A 1 70  ? 46.148 15.291 3.574   1.00 13.41 ? 292 ASN A O     1 
ATOM   373  C CB    . ASN A 1 70  ? 43.463 15.628 4.419   1.00 13.82 ? 292 ASN A CB    1 
ATOM   374  C CG    . ASN A 1 70  ? 43.626 15.458 5.923   1.00 14.84 ? 292 ASN A CG    1 
ATOM   375  O OD1   . ASN A 1 70  ? 44.531 16.029 6.535   1.00 15.70 ? 292 ASN A OD1   1 
ATOM   376  N ND2   . ASN A 1 70  ? 42.751 14.663 6.522   1.00 16.35 ? 292 ASN A ND2   1 
ATOM   377  N N     . ARG A 1 71  ? 46.620 17.385 4.239   1.00 13.10 ? 293 ARG A N     1 
ATOM   378  C CA    . ARG A 1 71  ? 48.054 17.128 4.249   1.00 14.71 ? 293 ARG A CA    1 
ATOM   379  C C     . ARG A 1 71  ? 48.777 17.589 5.502   1.00 14.59 ? 293 ARG A C     1 
ATOM   380  O O     . ARG A 1 71  ? 48.372 18.550 6.160   1.00 15.19 ? 293 ARG A O     1 
ATOM   381  C CB    . ARG A 1 71  ? 48.706 17.762 3.011   1.00 15.56 ? 293 ARG A CB    1 
ATOM   382  C CG    . ARG A 1 71  ? 48.644 19.287 2.947   1.00 14.73 ? 293 ARG A CG    1 
ATOM   383  C CD    . ARG A 1 71  ? 49.143 19.776 1.587   1.00 14.44 ? 293 ARG A CD    1 
ATOM   384  N NE    . ARG A 1 71  ? 49.097 21.230 1.436   1.00 16.40 ? 293 ARG A NE    1 
ATOM   385  C CZ    . ARG A 1 71  ? 50.022 22.067 1.897   1.00 18.73 ? 293 ARG A CZ    1 
ATOM   386  N NH1   . ARG A 1 71  ? 51.082 21.602 2.542   1.00 18.49 ? 293 ARG A NH1   1 
ATOM   387  N NH2   . ARG A 1 71  ? 49.884 23.372 1.713   1.00 20.01 ? 293 ARG A NH2   1 
ATOM   388  N N     . LYS A 1 72  ? 49.860 16.885 5.816   1.00 15.90 ? 294 LYS A N     1 
ATOM   389  C CA    . LYS A 1 72  ? 50.682 17.186 6.978   1.00 16.78 ? 294 LYS A CA    1 
ATOM   390  C C     . LYS A 1 72  ? 51.556 18.412 6.702   1.00 15.86 ? 294 LYS A C     1 
ATOM   391  O O     . LYS A 1 72  ? 52.255 18.474 5.689   1.00 18.02 ? 294 LYS A O     1 
ATOM   392  C CB    . LYS A 1 72  ? 51.557 15.975 7.312   1.00 16.48 ? 294 LYS A CB    1 
ATOM   393  C CG    . LYS A 1 72  ? 52.489 16.208 8.481   1.00 17.19 ? 294 LYS A CG    1 
ATOM   394  C CD    . LYS A 1 72  ? 53.234 14.941 8.876   1.00 21.51 ? 294 LYS A CD    1 
ATOM   395  C CE    . LYS A 1 72  ? 54.049 15.181 10.141  1.00 22.39 ? 294 LYS A CE    1 
ATOM   396  N NZ    . LYS A 1 72  ? 54.798 13.978 10.583  1.00 26.20 ? 294 LYS A NZ    1 
ATOM   397  N N     . LEU A 1 73  ? 51.518 19.382 7.611   1.00 15.66 ? 295 LEU A N     1 
ATOM   398  C CA    . LEU A 1 73  ? 52.295 20.610 7.460   1.00 18.07 ? 295 LEU A CA    1 
ATOM   399  C C     . LEU A 1 73  ? 53.661 20.583 8.125   1.00 18.79 ? 295 LEU A C     1 
ATOM   400  O O     . LEU A 1 73  ? 54.610 21.175 7.614   1.00 20.17 ? 295 LEU A O     1 
ATOM   401  C CB    . LEU A 1 73  ? 51.524 21.804 8.026   1.00 18.00 ? 295 LEU A CB    1 
ATOM   402  C CG    . LEU A 1 73  ? 50.299 22.307 7.263   1.00 16.22 ? 295 LEU A CG    1 
ATOM   403  C CD1   . LEU A 1 73  ? 49.554 23.317 8.124   1.00 16.16 ? 295 LEU A CD1   1 
ATOM   404  C CD2   . LEU A 1 73  ? 50.726 22.933 5.943   1.00 16.69 ? 295 LEU A CD2   1 
ATOM   405  N N     . ASN A 1 74  ? 53.764 19.921 9.270   1.00 18.77 ? 296 ASN A N     1 
ATOM   406  C CA    . ASN A 1 74  ? 55.034 19.891 9.976   1.00 20.36 ? 296 ASN A CA    1 
ATOM   407  C C     . ASN A 1 74  ? 56.001 18.863 9.423   1.00 20.65 ? 296 ASN A C     1 
ATOM   408  O O     . ASN A 1 74  ? 55.605 17.841 8.857   1.00 20.49 ? 296 ASN A O     1 
ATOM   409  C CB    . ASN A 1 74  ? 54.813 19.687 11.481  1.00 18.93 ? 296 ASN A CB    1 
ATOM   410  C CG    . ASN A 1 74  ? 54.109 18.393 11.805  1.00 19.67 ? 296 ASN A CG    1 
ATOM   411  O OD1   . ASN A 1 74  ? 53.066 18.077 11.233  1.00 18.31 ? 296 ASN A OD1   1 
ATOM   412  N ND2   . ASN A 1 74  ? 54.667 17.638 12.743  1.00 22.62 ? 296 ASN A ND2   1 
ATOM   413  N N     . GLN A 1 75  ? 57.282 19.170 9.579   1.00 21.78 ? 297 GLN A N     1 
ATOM   414  C CA    . GLN A 1 75  ? 58.361 18.328 9.101   1.00 23.69 ? 297 GLN A CA    1 
ATOM   415  C C     . GLN A 1 75  ? 58.649 17.198 10.082  1.00 24.57 ? 297 GLN A C     1 
ATOM   416  O O     . GLN A 1 75  ? 58.934 16.068 9.679   1.00 25.32 ? 297 GLN A O     1 
ATOM   417  C CB    . GLN A 1 75  ? 59.617 19.182 8.896   1.00 24.51 ? 297 GLN A CB    1 
ATOM   418  C CG    . GLN A 1 75  ? 59.433 20.364 7.931   1.00 25.67 ? 297 GLN A CG    1 
ATOM   419  C CD    . GLN A 1 75  ? 58.641 21.530 8.521   1.00 26.37 ? 297 GLN A CD    1 
ATOM   420  O OE1   . GLN A 1 75  ? 58.277 22.470 7.809   1.00 27.42 ? 297 GLN A OE1   1 
ATOM   421  N NE2   . GLN A 1 75  ? 58.385 21.481 9.822   1.00 25.22 ? 297 GLN A NE2   1 
ATOM   422  N N     . GLY A 1 76  ? 58.566 17.509 11.371  1.00 24.83 ? 298 GLY A N     1 
ATOM   423  C CA    . GLY A 1 76  ? 58.833 16.516 12.395  1.00 24.52 ? 298 GLY A CA    1 
ATOM   424  C C     . GLY A 1 76  ? 57.698 15.554 12.693  1.00 25.97 ? 298 GLY A C     1 
ATOM   425  O O     . GLY A 1 76  ? 56.658 15.563 12.027  1.00 25.90 ? 298 GLY A O     1 
ATOM   426  N N     . THR A 1 77  ? 57.904 14.716 13.705  1.00 26.06 ? 299 THR A N     1 
ATOM   427  C CA    . THR A 1 77  ? 56.910 13.730 14.111  1.00 26.96 ? 299 THR A CA    1 
ATOM   428  C C     . THR A 1 77  ? 56.481 13.906 15.568  1.00 26.11 ? 299 THR A C     1 
ATOM   429  O O     . THR A 1 77  ? 55.757 13.072 16.110  1.00 26.99 ? 299 THR A O     1 
ATOM   430  C CB    . THR A 1 77  ? 57.445 12.295 13.925  1.00 28.00 ? 299 THR A CB    1 
ATOM   431  O OG1   . THR A 1 77  ? 58.668 12.140 14.656  1.00 30.70 ? 299 THR A OG1   1 
ATOM   432  C CG2   . THR A 1 77  ? 57.700 12.011 12.455  1.00 29.87 ? 299 THR A CG2   1 
ATOM   433  N N     . GLU A 1 78  ? 56.930 14.986 16.202  1.00 26.09 ? 300 GLU A N     1 
ATOM   434  C CA    . GLU A 1 78  ? 56.568 15.256 17.591  1.00 26.71 ? 300 GLU A CA    1 
ATOM   435  C C     . GLU A 1 78  ? 55.053 15.383 17.699  1.00 26.28 ? 300 GLU A C     1 
ATOM   436  O O     . GLU A 1 78  ? 54.421 14.810 18.590  1.00 26.75 ? 300 GLU A O     1 
ATOM   437  C CB    . GLU A 1 78  ? 57.220 16.559 18.069  1.00 27.70 ? 300 GLU A CB    1 
ATOM   438  C CG    . GLU A 1 78  ? 58.732 16.495 18.223  1.00 30.01 ? 300 GLU A CG    1 
ATOM   439  C CD    . GLU A 1 78  ? 59.166 15.589 19.360  1.00 31.60 ? 300 GLU A CD    1 
ATOM   440  O OE1   . GLU A 1 78  ? 58.852 14.380 19.315  1.00 33.31 ? 300 GLU A OE1   1 
ATOM   441  O OE2   . GLU A 1 78  ? 59.823 16.087 20.299  1.00 34.06 ? 300 GLU A OE2   1 
ATOM   442  N N     . ARG A 1 79  ? 54.480 16.138 16.770  1.00 24.42 ? 301 ARG A N     1 
ATOM   443  C CA    . ARG A 1 79  ? 53.046 16.369 16.733  1.00 22.00 ? 301 ARG A CA    1 
ATOM   444  C C     . ARG A 1 79  ? 52.574 16.235 15.296  1.00 19.82 ? 301 ARG A C     1 
ATOM   445  O O     . ARG A 1 79  ? 53.364 15.949 14.396  1.00 21.15 ? 301 ARG A O     1 
ATOM   446  C CB    . ARG A 1 79  ? 52.733 17.781 17.233  1.00 23.75 ? 301 ARG A CB    1 
ATOM   447  C CG    . ARG A 1 79  ? 53.276 18.097 18.615  1.00 24.39 ? 301 ARG A CG    1 
ATOM   448  C CD    . ARG A 1 79  ? 52.853 19.489 19.051  1.00 25.13 ? 301 ARG A CD    1 
ATOM   449  N NE    . ARG A 1 79  ? 53.497 20.543 18.269  1.00 24.56 ? 301 ARG A NE    1 
ATOM   450  C CZ    . ARG A 1 79  ? 53.108 21.815 18.276  1.00 25.22 ? 301 ARG A CZ    1 
ATOM   451  N NH1   . ARG A 1 79  ? 52.075 22.188 19.019  1.00 26.25 ? 301 ARG A NH1   1 
ATOM   452  N NH2   . ARG A 1 79  ? 53.754 22.717 17.551  1.00 25.06 ? 301 ARG A NH2   1 
ATOM   453  N N     . HIS A 1 80  ? 51.278 16.431 15.084  1.00 16.55 ? 302 HIS A N     1 
ATOM   454  C CA    . HIS A 1 80  ? 50.724 16.376 13.743  1.00 15.67 ? 302 HIS A CA    1 
ATOM   455  C C     . HIS A 1 80  ? 49.954 17.666 13.502  1.00 15.13 ? 302 HIS A C     1 
ATOM   456  O O     . HIS A 1 80  ? 48.956 17.938 14.169  1.00 14.38 ? 302 HIS A O     1 
ATOM   457  C CB    . HIS A 1 80  ? 49.780 15.180 13.575  1.00 14.83 ? 302 HIS A CB    1 
ATOM   458  C CG    . HIS A 1 80  ? 49.302 14.981 12.168  1.00 15.70 ? 302 HIS A CG    1 
ATOM   459  N ND1   . HIS A 1 80  ? 50.013 14.257 11.234  1.00 17.29 ? 302 HIS A ND1   1 
ATOM   460  C CD2   . HIS A 1 80  ? 48.203 15.444 11.525  1.00 15.84 ? 302 HIS A CD2   1 
ATOM   461  C CE1   . HIS A 1 80  ? 49.373 14.281 10.078  1.00 18.34 ? 302 HIS A CE1   1 
ATOM   462  N NE2   . HIS A 1 80  ? 48.271 14.995 10.228  1.00 16.85 ? 302 HIS A NE2   1 
ATOM   463  N N     . LEU A 1 81  ? 50.450 18.477 12.575  1.00 13.75 ? 303 LEU A N     1 
ATOM   464  C CA    . LEU A 1 81  ? 49.786 19.719 12.213  1.00 13.14 ? 303 LEU A CA    1 
ATOM   465  C C     . LEU A 1 81  ? 49.339 19.494 10.778  1.00 14.41 ? 303 LEU A C     1 
ATOM   466  O O     . LEU A 1 81  ? 50.105 19.005 9.945   1.00 14.93 ? 303 LEU A O     1 
ATOM   467  C CB    . LEU A 1 81  ? 50.741 20.909 12.345  1.00 16.29 ? 303 LEU A CB    1 
ATOM   468  C CG    . LEU A 1 81  ? 51.034 21.194 13.826  1.00 17.57 ? 303 LEU A CG    1 
ATOM   469  C CD1   . LEU A 1 81  ? 52.326 20.499 14.216  1.00 20.08 ? 303 LEU A CD1   1 
ATOM   470  C CD2   . LEU A 1 81  ? 51.127 22.689 14.086  1.00 20.84 ? 303 LEU A CD2   1 
ATOM   471  N N     . MET A 1 82  ? 48.093 19.841 10.488  1.00 12.90 ? 304 MET A N     1 
ATOM   472  C CA    . MET A 1 82  ? 47.551 19.583 9.168   1.00 13.58 ? 304 MET A CA    1 
ATOM   473  C C     . MET A 1 82  ? 46.863 20.752 8.489   1.00 12.26 ? 304 MET A C     1 
ATOM   474  O O     . MET A 1 82  ? 46.406 21.702 9.136   1.00 13.03 ? 304 MET A O     1 
ATOM   475  C CB    . MET A 1 82  ? 46.571 18.415 9.271   1.00 15.17 ? 304 MET A CB    1 
ATOM   476  C CG    . MET A 1 82  ? 45.424 18.691 10.229  1.00 14.78 ? 304 MET A CG    1 
ATOM   477  S SD    . MET A 1 82  ? 44.488 17.222 10.699  1.00 15.53 ? 304 MET A SD    1 
ATOM   478  C CE    . MET A 1 82  ? 43.399 17.904 11.956  1.00 14.93 ? 304 MET A CE    1 
ATOM   479  N N     . HIS A 1 83  ? 46.793 20.646 7.168   1.00 12.79 ? 305 HIS A N     1 
ATOM   480  C CA    . HIS A 1 83  ? 46.154 21.632 6.317   1.00 13.24 ? 305 HIS A CA    1 
ATOM   481  C C     . HIS A 1 83  ? 45.053 20.914 5.553   1.00 13.46 ? 305 HIS A C     1 
ATOM   482  O O     . HIS A 1 83  ? 45.312 19.934 4.857   1.00 13.22 ? 305 HIS A O     1 
ATOM   483  C CB    . HIS A 1 83  ? 47.168 22.210 5.325   1.00 13.67 ? 305 HIS A CB    1 
ATOM   484  C CG    . HIS A 1 83  ? 46.577 23.176 4.345   1.00 12.91 ? 305 HIS A CG    1 
ATOM   485  N ND1   . HIS A 1 83  ? 46.196 22.813 3.071   1.00 15.39 ? 305 HIS A ND1   1 
ATOM   486  C CD2   . HIS A 1 83  ? 46.281 24.490 4.465   1.00 12.67 ? 305 HIS A CD2   1 
ATOM   487  C CE1   . HIS A 1 83  ? 45.694 23.865 2.448   1.00 11.08 ? 305 HIS A CE1   1 
ATOM   488  N NE2   . HIS A 1 83  ? 45.735 24.896 3.273   1.00 15.90 ? 305 HIS A NE2   1 
ATOM   489  N N     . LEU A 1 84  ? 43.822 21.386 5.700   1.00 12.65 ? 306 LEU A N     1 
ATOM   490  C CA    . LEU A 1 84  ? 42.702 20.789 4.984   1.00 13.49 ? 306 LEU A CA    1 
ATOM   491  C C     . LEU A 1 84  ? 42.030 21.825 4.101   1.00 12.86 ? 306 LEU A C     1 
ATOM   492  O O     . LEU A 1 84  ? 42.002 23.008 4.424   1.00 12.69 ? 306 LEU A O     1 
ATOM   493  C CB    . LEU A 1 84  ? 41.655 20.214 5.951   1.00 15.02 ? 306 LEU A CB    1 
ATOM   494  C CG    . LEU A 1 84  ? 42.010 18.917 6.687   1.00 17.71 ? 306 LEU A CG    1 
ATOM   495  C CD1   . LEU A 1 84  ? 42.797 19.223 7.944   1.00 19.88 ? 306 LEU A CD1   1 
ATOM   496  C CD2   . LEU A 1 84  ? 40.726 18.186 7.044   1.00 17.83 ? 306 LEU A CD2   1 
ATOM   497  N N     . GLU A 1 85  ? 41.491 21.369 2.979   1.00 11.73 ? 307 GLU A N     1 
ATOM   498  C CA    . GLU A 1 85  ? 40.772 22.245 2.067   1.00 10.88 ? 307 GLU A CA    1 
ATOM   499  C C     . GLU A 1 85  ? 39.390 21.624 1.904   1.00 11.99 ? 307 GLU A C     1 
ATOM   500  O O     . GLU A 1 85  ? 39.265 20.465 1.510   1.00 12.58 ? 307 GLU A O     1 
ATOM   501  C CB    . GLU A 1 85  ? 41.520 22.349 0.728   1.00 12.31 ? 307 GLU A CB    1 
ATOM   502  C CG    . GLU A 1 85  ? 42.914 22.951 0.916   1.00 12.46 ? 307 GLU A CG    1 
ATOM   503  C CD    . GLU A 1 85  ? 43.676 23.198 -0.375  1.00 14.05 ? 307 GLU A CD    1 
ATOM   504  O OE1   . GLU A 1 85  ? 44.829 23.664 -0.282  1.00 14.33 ? 307 GLU A OE1   1 
ATOM   505  O OE2   . GLU A 1 85  ? 43.140 22.941 -1.471  1.00 14.59 ? 307 GLU A OE2   1 
ATOM   506  N N     . LEU A 1 86  ? 38.365 22.398 2.256   1.00 11.35 ? 308 LEU A N     1 
ATOM   507  C CA    . LEU A 1 86  ? 36.976 21.949 2.190   1.00 12.21 ? 308 LEU A CA    1 
ATOM   508  C C     . LEU A 1 86  ? 36.256 22.576 1.003   1.00 12.22 ? 308 LEU A C     1 
ATOM   509  O O     . LEU A 1 86  ? 36.154 23.794 0.892   1.00 13.49 ? 308 LEU A O     1 
ATOM   510  C CB    . LEU A 1 86  ? 36.246 22.317 3.486   1.00 13.55 ? 308 LEU A CB    1 
ATOM   511  C CG    . LEU A 1 86  ? 36.883 21.817 4.786   1.00 13.83 ? 308 LEU A CG    1 
ATOM   512  C CD1   . LEU A 1 86  ? 36.067 22.284 5.977   1.00 14.28 ? 308 LEU A CD1   1 
ATOM   513  C CD2   . LEU A 1 86  ? 36.972 20.301 4.764   1.00 15.31 ? 308 LEU A CD2   1 
ATOM   514  N N     . ASP A 1 87  ? 35.748 21.722 0.124   1.00 12.33 ? 309 ASP A N     1 
ATOM   515  C CA    . ASP A 1 87  ? 35.049 22.156 -1.077  1.00 13.20 ? 309 ASP A CA    1 
ATOM   516  C C     . ASP A 1 87  ? 33.633 22.640 -0.763  1.00 11.72 ? 309 ASP A C     1 
ATOM   517  O O     . ASP A 1 87  ? 32.764 21.844 -0.409  1.00 14.58 ? 309 ASP A O     1 
ATOM   518  C CB    . ASP A 1 87  ? 34.997 20.983 -2.058  1.00 15.32 ? 309 ASP A CB    1 
ATOM   519  C CG    . ASP A 1 87  ? 34.460 21.370 -3.423  1.00 16.30 ? 309 ASP A CG    1 
ATOM   520  O OD1   . ASP A 1 87  ? 33.928 22.485 -3.580  1.00 15.80 ? 309 ASP A OD1   1 
ATOM   521  O OD2   . ASP A 1 87  ? 34.573 20.537 -4.347  1.00 20.74 ? 309 ASP A OD2   1 
ATOM   522  N N     . ILE A 1 88  ? 33.398 23.941 -0.894  1.00 11.97 ? 310 ILE A N     1 
ATOM   523  C CA    . ILE A 1 88  ? 32.068 24.474 -0.631  1.00 13.94 ? 310 ILE A CA    1 
ATOM   524  C C     . ILE A 1 88  ? 31.369 24.880 -1.927  1.00 15.26 ? 310 ILE A C     1 
ATOM   525  O O     . ILE A 1 88  ? 30.448 25.693 -1.923  1.00 14.43 ? 310 ILE A O     1 
ATOM   526  C CB    . ILE A 1 88  ? 32.101 25.675 0.354   1.00 13.06 ? 310 ILE A CB    1 
ATOM   527  C CG1   . ILE A 1 88  ? 32.959 26.818 -0.199  1.00 14.01 ? 310 ILE A CG1   1 
ATOM   528  C CG2   . ILE A 1 88  ? 32.627 25.202 1.713   1.00 12.68 ? 310 ILE A CG2   1 
ATOM   529  C CD1   . ILE A 1 88  ? 32.776 28.126 0.551   1.00 15.00 ? 310 ILE A CD1   1 
ATOM   530  N N     . SER A 1 89  ? 31.815 24.304 -3.039  1.00 15.51 ? 311 SER A N     1 
ATOM   531  C CA    . SER A 1 89  ? 31.198 24.592 -4.328  1.00 16.97 ? 311 SER A CA    1 
ATOM   532  C C     . SER A 1 89  ? 29.702 24.295 -4.259  1.00 17.00 ? 311 SER A C     1 
ATOM   533  O O     . SER A 1 89  ? 29.283 23.318 -3.639  1.00 18.19 ? 311 SER A O     1 
ATOM   534  C CB    . SER A 1 89  ? 31.831 23.734 -5.428  1.00 18.01 ? 311 SER A CB    1 
ATOM   535  O OG    . SER A 1 89  ? 33.181 24.093 -5.637  1.00 22.50 ? 311 SER A OG    1 
ATOM   536  N N     . ASP A 1 90  ? 28.910 25.153 -4.893  1.00 18.95 ? 312 ASP A N     1 
ATOM   537  C CA    . ASP A 1 90  ? 27.456 25.001 -4.942  1.00 21.14 ? 312 ASP A CA    1 
ATOM   538  C C     . ASP A 1 90  ? 26.733 25.202 -3.612  1.00 21.09 ? 312 ASP A C     1 
ATOM   539  O O     . ASP A 1 90  ? 25.533 24.946 -3.515  1.00 22.68 ? 312 ASP A O     1 
ATOM   540  C CB    . ASP A 1 90  ? 27.095 23.625 -5.520  1.00 24.71 ? 312 ASP A CB    1 
ATOM   541  C CG    . ASP A 1 90  ? 27.458 23.495 -6.990  1.00 27.30 ? 312 ASP A CG    1 
ATOM   542  O OD1   . ASP A 1 90  ? 27.452 22.359 -7.510  1.00 30.15 ? 312 ASP A OD1   1 
ATOM   543  O OD2   . ASP A 1 90  ? 27.740 24.530 -7.630  1.00 29.67 ? 312 ASP A OD2   1 
ATOM   544  N N     . SER A 1 91  ? 27.449 25.663 -2.592  1.00 18.93 ? 313 SER A N     1 
ATOM   545  C CA    . SER A 1 91  ? 26.840 25.891 -1.283  1.00 17.79 ? 313 SER A CA    1 
ATOM   546  C C     . SER A 1 91  ? 26.276 27.301 -1.147  1.00 16.60 ? 313 SER A C     1 
ATOM   547  O O     . SER A 1 91  ? 25.431 27.551 -0.292  1.00 16.08 ? 313 SER A O     1 
ATOM   548  C CB    . SER A 1 91  ? 27.872 25.684 -0.173  1.00 16.99 ? 313 SER A CB    1 
ATOM   549  O OG    . SER A 1 91  ? 28.796 26.759 -0.149  1.00 15.52 ? 313 SER A OG    1 
ATOM   550  N N     . LYS A 1 92  ? 26.749 28.213 -1.992  1.00 16.84 ? 314 LYS A N     1 
ATOM   551  C CA    . LYS A 1 92  ? 26.338 29.613 -1.956  1.00 16.64 ? 314 LYS A CA    1 
ATOM   552  C C     . LYS A 1 92  ? 26.870 30.298 -0.694  1.00 16.90 ? 314 LYS A C     1 
ATOM   553  O O     . LYS A 1 92  ? 26.502 31.430 -0.380  1.00 17.94 ? 314 LYS A O     1 
ATOM   554  C CB    . LYS A 1 92  ? 24.811 29.748 -2.026  1.00 18.29 ? 314 LYS A CB    1 
ATOM   555  C CG    . LYS A 1 92  ? 24.227 29.402 -3.386  1.00 21.49 ? 314 LYS A CG    1 
ATOM   556  C CD    . LYS A 1 92  ? 22.813 29.948 -3.527  1.00 25.48 ? 314 LYS A CD    1 
ATOM   557  C CE    . LYS A 1 92  ? 22.334 29.874 -4.967  1.00 28.60 ? 314 LYS A CE    1 
ATOM   558  N NZ    . LYS A 1 92  ? 20.993 30.499 -5.128  1.00 31.71 ? 314 LYS A NZ    1 
ATOM   559  N N     . ILE A 1 93  ? 27.751 29.608 0.027   1.00 15.97 ? 315 ILE A N     1 
ATOM   560  C CA    . ILE A 1 93  ? 28.336 30.167 1.240   1.00 14.84 ? 315 ILE A CA    1 
ATOM   561  C C     . ILE A 1 93  ? 29.370 31.241 0.915   1.00 13.70 ? 315 ILE A C     1 
ATOM   562  O O     . ILE A 1 93  ? 30.227 31.060 0.049   1.00 13.86 ? 315 ILE A O     1 
ATOM   563  C CB    . ILE A 1 93  ? 29.021 29.074 2.095   1.00 15.84 ? 315 ILE A CB    1 
ATOM   564  C CG1   . ILE A 1 93  ? 27.963 28.143 2.692   1.00 14.55 ? 315 ILE A CG1   1 
ATOM   565  C CG2   . ILE A 1 93  ? 29.869 29.719 3.190   1.00 15.30 ? 315 ILE A CG2   1 
ATOM   566  C CD1   . ILE A 1 93  ? 28.544 26.981 3.484   1.00 16.27 ? 315 ILE A CD1   1 
ATOM   567  N N     . ARG A 1 94  ? 29.283 32.352 1.633   1.00 15.33 ? 316 ARG A N     1 
ATOM   568  C CA    . ARG A 1 94  ? 30.196 33.464 1.456   1.00 15.56 ? 316 ARG A CA    1 
ATOM   569  C C     . ARG A 1 94  ? 31.042 33.569 2.718   1.00 14.95 ? 316 ARG A C     1 
ATOM   570  O O     . ARG A 1 94  ? 30.569 33.280 3.819   1.00 14.81 ? 316 ARG A O     1 
ATOM   571  C CB    . ARG A 1 94  ? 29.403 34.757 1.253   1.00 18.99 ? 316 ARG A CB    1 
ATOM   572  C CG    . ARG A 1 94  ? 28.391 34.678 0.118   1.00 22.20 ? 316 ARG A CG    1 
ATOM   573  C CD    . ARG A 1 94  ? 27.396 35.828 0.175   1.00 25.88 ? 316 ARG A CD    1 
ATOM   574  N NE    . ARG A 1 94  ? 28.035 37.122 -0.040  1.00 28.19 ? 316 ARG A NE    1 
ATOM   575  C CZ    . ARG A 1 94  ? 27.429 38.291 0.143   1.00 29.00 ? 316 ARG A CZ    1 
ATOM   576  N NH1   . ARG A 1 94  ? 26.166 38.328 0.545   1.00 29.66 ? 316 ARG A NH1   1 
ATOM   577  N NH2   . ARG A 1 94  ? 28.088 39.423 -0.071  1.00 29.66 ? 316 ARG A NH2   1 
ATOM   578  N N     . TYR A 1 95  ? 32.301 33.959 2.562   1.00 14.89 ? 317 TYR A N     1 
ATOM   579  C CA    . TYR A 1 95  ? 33.182 34.117 3.708   1.00 14.56 ? 317 TYR A CA    1 
ATOM   580  C C     . TYR A 1 95  ? 34.278 35.096 3.346   1.00 12.75 ? 317 TYR A C     1 
ATOM   581  O O     . TYR A 1 95  ? 34.466 35.429 2.173   1.00 15.02 ? 317 TYR A O     1 
ATOM   582  C CB    . TYR A 1 95  ? 33.803 32.770 4.119   1.00 13.96 ? 317 TYR A CB    1 
ATOM   583  C CG    . TYR A 1 95  ? 34.987 32.318 3.280   1.00 11.97 ? 317 TYR A CG    1 
ATOM   584  C CD1   . TYR A 1 95  ? 36.294 32.648 3.646   1.00 11.11 ? 317 TYR A CD1   1 
ATOM   585  C CD2   . TYR A 1 95  ? 34.801 31.543 2.132   1.00 13.53 ? 317 TYR A CD2   1 
ATOM   586  C CE1   . TYR A 1 95  ? 37.384 32.218 2.901   1.00 12.41 ? 317 TYR A CE1   1 
ATOM   587  C CE2   . TYR A 1 95  ? 35.893 31.108 1.373   1.00 11.57 ? 317 TYR A CE2   1 
ATOM   588  C CZ    . TYR A 1 95  ? 37.181 31.449 1.767   1.00 10.85 ? 317 TYR A CZ    1 
ATOM   589  O OH    . TYR A 1 95  ? 38.269 31.011 1.041   1.00 11.89 ? 317 TYR A OH    1 
ATOM   590  N N     . GLU A 1 96  ? 34.980 35.573 4.365   1.00 14.74 ? 318 GLU A N     1 
ATOM   591  C CA    . GLU A 1 96  ? 36.099 36.483 4.168   1.00 15.85 ? 318 GLU A CA    1 
ATOM   592  C C     . GLU A 1 96  ? 37.226 36.031 5.080   1.00 15.52 ? 318 GLU A C     1 
ATOM   593  O O     . GLU A 1 96  ? 36.976 35.441 6.133   1.00 15.74 ? 318 GLU A O     1 
ATOM   594  C CB    . GLU A 1 96  ? 35.718 37.918 4.534   1.00 16.54 ? 318 GLU A CB    1 
ATOM   595  C CG    . GLU A 1 96  ? 34.732 38.595 3.599   1.00 18.54 ? 318 GLU A CG    1 
ATOM   596  C CD    . GLU A 1 96  ? 35.229 38.687 2.165   1.00 21.16 ? 318 GLU A CD    1 
ATOM   597  O OE1   . GLU A 1 96  ? 36.461 38.673 1.944   1.00 19.36 ? 318 GLU A OE1   1 
ATOM   598  O OE2   . GLU A 1 96  ? 34.378 38.788 1.255   1.00 21.52 ? 318 GLU A OE2   1 
ATOM   599  N N     . SER A 1 97  ? 38.464 36.295 4.674   1.00 15.88 ? 319 SER A N     1 
ATOM   600  C CA    . SER A 1 97  ? 39.603 35.941 5.512   1.00 15.31 ? 319 SER A CA    1 
ATOM   601  C C     . SER A 1 97  ? 39.346 36.599 6.859   1.00 13.76 ? 319 SER A C     1 
ATOM   602  O O     . SER A 1 97  ? 38.955 37.763 6.924   1.00 13.98 ? 319 SER A O     1 
ATOM   603  C CB    . SER A 1 97  ? 40.905 36.466 4.904   1.00 16.89 ? 319 SER A CB    1 
ATOM   604  O OG    . SER A 1 97  ? 41.276 35.699 3.772   1.00 19.54 ? 319 SER A OG    1 
ATOM   605  N N     . GLY A 1 98  ? 39.550 35.844 7.931   1.00 14.33 ? 320 GLY A N     1 
ATOM   606  C CA    . GLY A 1 98  ? 39.300 36.367 9.260   1.00 13.93 ? 320 GLY A CA    1 
ATOM   607  C C     . GLY A 1 98  ? 38.099 35.689 9.893   1.00 13.79 ? 320 GLY A C     1 
ATOM   608  O O     . GLY A 1 98  ? 37.978 35.651 11.116  1.00 14.55 ? 320 GLY A O     1 
ATOM   609  N N     . ASP A 1 99  ? 37.198 35.165 9.062   1.00 12.93 ? 321 ASP A N     1 
ATOM   610  C CA    . ASP A 1 99  ? 36.011 34.471 9.559   1.00 12.49 ? 321 ASP A CA    1 
ATOM   611  C C     . ASP A 1 99  ? 36.391 33.117 10.139  1.00 13.53 ? 321 ASP A C     1 
ATOM   612  O O     . ASP A 1 99  ? 37.511 32.634 9.950   1.00 13.75 ? 321 ASP A O     1 
ATOM   613  C CB    . ASP A 1 99  ? 34.989 34.233 8.437   1.00 13.41 ? 321 ASP A CB    1 
ATOM   614  C CG    . ASP A 1 99  ? 34.216 35.480 8.067   1.00 13.27 ? 321 ASP A CG    1 
ATOM   615  O OD1   . ASP A 1 99  ? 34.134 36.397 8.906   1.00 14.61 ? 321 ASP A OD1   1 
ATOM   616  O OD2   . ASP A 1 99  ? 33.674 35.530 6.942   1.00 13.77 ? 321 ASP A OD2   1 
ATOM   617  N N     . HIS A 1 100 ? 35.450 32.502 10.847  1.00 13.55 ? 322 HIS A N     1 
ATOM   618  C CA    . HIS A 1 100 ? 35.688 31.185 11.417  1.00 12.60 ? 322 HIS A CA    1 
ATOM   619  C C     . HIS A 1 100 ? 34.810 30.150 10.739  1.00 12.29 ? 322 HIS A C     1 
ATOM   620  O O     . HIS A 1 100 ? 33.717 30.462 10.263  1.00 13.95 ? 322 HIS A O     1 
ATOM   621  C CB    . HIS A 1 100 ? 35.368 31.163 12.912  1.00 13.11 ? 322 HIS A CB    1 
ATOM   622  C CG    . HIS A 1 100 ? 36.218 32.083 13.728  1.00 13.83 ? 322 HIS A CG    1 
ATOM   623  N ND1   . HIS A 1 100 ? 37.570 31.889 13.905  1.00 18.01 ? 322 HIS A ND1   1 
ATOM   624  C CD2   . HIS A 1 100 ? 35.910 33.221 14.393  1.00 16.12 ? 322 HIS A CD2   1 
ATOM   625  C CE1   . HIS A 1 100 ? 38.060 32.871 14.642  1.00 16.64 ? 322 HIS A CE1   1 
ATOM   626  N NE2   . HIS A 1 100 ? 37.073 33.693 14.949  1.00 17.57 ? 322 HIS A NE2   1 
ATOM   627  N N     . VAL A 1 101 ? 35.302 28.920 10.678  1.00 12.10 ? 323 VAL A N     1 
ATOM   628  C CA    . VAL A 1 101 ? 34.506 27.844 10.123  1.00 10.82 ? 323 VAL A CA    1 
ATOM   629  C C     . VAL A 1 101 ? 34.252 26.871 11.267  1.00 12.88 ? 323 VAL A C     1 
ATOM   630  O O     . VAL A 1 101 ? 35.163 26.507 12.011  1.00 13.11 ? 323 VAL A O     1 
ATOM   631  C CB    . VAL A 1 101 ? 35.209 27.129 8.926   1.00 12.17 ? 323 VAL A CB    1 
ATOM   632  C CG1   . VAL A 1 101 ? 36.589 26.618 9.329   1.00 13.63 ? 323 VAL A CG1   1 
ATOM   633  C CG2   . VAL A 1 101 ? 34.332 25.972 8.427   1.00 13.56 ? 323 VAL A CG2   1 
ATOM   634  N N     . ALA A 1 102 ? 32.989 26.501 11.432  1.00 11.88 ? 324 ALA A N     1 
ATOM   635  C CA    . ALA A 1 102 ? 32.591 25.573 12.475  1.00 13.13 ? 324 ALA A CA    1 
ATOM   636  C C     . ALA A 1 102 ? 32.364 24.215 11.832  1.00 11.99 ? 324 ALA A C     1 
ATOM   637  O O     . ALA A 1 102 ? 31.874 24.135 10.710  1.00 12.58 ? 324 ALA A O     1 
ATOM   638  C CB    . ALA A 1 102 ? 31.308 26.050 13.131  1.00 14.27 ? 324 ALA A CB    1 
ATOM   639  N N     . VAL A 1 103 ? 32.737 23.155 12.537  1.00 11.48 ? 325 VAL A N     1 
ATOM   640  C CA    . VAL A 1 103 ? 32.538 21.804 12.046  1.00 11.89 ? 325 VAL A CA    1 
ATOM   641  C C     . VAL A 1 103 ? 31.862 20.969 13.134  1.00 10.80 ? 325 VAL A C     1 
ATOM   642  O O     . VAL A 1 103 ? 32.142 21.133 14.318  1.00 11.21 ? 325 VAL A O     1 
ATOM   643  C CB    . VAL A 1 103 ? 33.880 21.136 11.648  1.00 12.69 ? 325 VAL A CB    1 
ATOM   644  C CG1   . VAL A 1 103 ? 34.625 22.019 10.664  1.00 14.22 ? 325 VAL A CG1   1 
ATOM   645  C CG2   . VAL A 1 103 ? 34.739 20.879 12.886  1.00 13.12 ? 325 VAL A CG2   1 
ATOM   646  N N     . TYR A 1 104 ? 30.933 20.111 12.727  1.00 11.36 ? 326 TYR A N     1 
ATOM   647  C CA    . TYR A 1 104 ? 30.242 19.219 13.661  1.00 11.23 ? 326 TYR A CA    1 
ATOM   648  C C     . TYR A 1 104 ? 30.962 17.889 13.477  1.00 11.92 ? 326 TYR A C     1 
ATOM   649  O O     . TYR A 1 104 ? 30.763 17.196 12.475  1.00 12.18 ? 326 TYR A O     1 
ATOM   650  C CB    . TYR A 1 104 ? 28.764 19.075 13.290  1.00 11.16 ? 326 TYR A CB    1 
ATOM   651  C CG    . TYR A 1 104 ? 27.926 20.310 13.534  1.00 11.24 ? 326 TYR A CG    1 
ATOM   652  C CD1   . TYR A 1 104 ? 27.201 20.896 12.496  1.00 13.21 ? 326 TYR A CD1   1 
ATOM   653  C CD2   . TYR A 1 104 ? 27.803 20.854 14.812  1.00 12.67 ? 326 TYR A CD2   1 
ATOM   654  C CE1   . TYR A 1 104 ? 26.368 21.992 12.727  1.00 13.96 ? 326 TYR A CE1   1 
ATOM   655  C CE2   . TYR A 1 104 ? 26.972 21.949 15.051  1.00 12.69 ? 326 TYR A CE2   1 
ATOM   656  C CZ    . TYR A 1 104 ? 26.257 22.508 14.008  1.00 11.96 ? 326 TYR A CZ    1 
ATOM   657  O OH    . TYR A 1 104 ? 25.404 23.564 14.250  1.00 14.90 ? 326 TYR A OH    1 
ATOM   658  N N     . PRO A 1 105 ? 31.812 17.513 14.444  1.00 11.66 ? 327 PRO A N     1 
ATOM   659  C CA    . PRO A 1 105 ? 32.572 16.266 14.360  1.00 12.58 ? 327 PRO A CA    1 
ATOM   660  C C     . PRO A 1 105 ? 31.833 15.006 14.757  1.00 12.76 ? 327 PRO A C     1 
ATOM   661  O O     . PRO A 1 105 ? 30.661 15.035 15.118  1.00 12.97 ? 327 PRO A O     1 
ATOM   662  C CB    . PRO A 1 105 ? 33.742 16.534 15.291  1.00 14.35 ? 327 PRO A CB    1 
ATOM   663  C CG    . PRO A 1 105 ? 33.054 17.244 16.425  1.00 13.92 ? 327 PRO A CG    1 
ATOM   664  C CD    . PRO A 1 105 ? 32.115 18.222 15.704  1.00 13.17 ? 327 PRO A CD    1 
ATOM   665  N N     . ALA A 1 106 ? 32.550 13.893 14.673  1.00 12.65 ? 328 ALA A N     1 
ATOM   666  C CA    . ALA A 1 106 ? 32.018 12.601 15.059  1.00 13.32 ? 328 ALA A CA    1 
ATOM   667  C C     . ALA A 1 106 ? 33.046 11.952 15.970  1.00 12.36 ? 328 ALA A C     1 
ATOM   668  O O     . ALA A 1 106 ? 34.254 12.088 15.757  1.00 12.68 ? 328 ALA A O     1 
ATOM   669  C CB    . ALA A 1 106 ? 31.794 11.733 13.840  1.00 13.16 ? 328 ALA A CB    1 
ATOM   670  N N     . ASN A 1 107 ? 32.568 11.267 16.998  1.00 11.88 ? 329 ASN A N     1 
ATOM   671  C CA    . ASN A 1 107 ? 33.455 10.573 17.914  1.00 13.01 ? 329 ASN A CA    1 
ATOM   672  C C     . ASN A 1 107 ? 34.065 9.351  17.237  1.00 13.13 ? 329 ASN A C     1 
ATOM   673  O O     . ASN A 1 107 ? 33.529 8.840  16.248  1.00 14.60 ? 329 ASN A O     1 
ATOM   674  C CB    . ASN A 1 107 ? 32.684 10.134 19.157  1.00 12.93 ? 329 ASN A CB    1 
ATOM   675  C CG    . ASN A 1 107 ? 32.437 11.271 20.109  1.00 11.33 ? 329 ASN A CG    1 
ATOM   676  O OD1   . ASN A 1 107 ? 33.365 11.986 20.484  1.00 11.75 ? 329 ASN A OD1   1 
ATOM   677  N ND2   . ASN A 1 107 ? 31.185 11.447 20.517  1.00 11.04 ? 329 ASN A ND2   1 
ATOM   678  N N     . ASP A 1 108 ? 35.190 8.890  17.775  1.00 14.69 ? 330 ASP A N     1 
ATOM   679  C CA    . ASP A 1 108 ? 35.877 7.713  17.252  1.00 14.46 ? 330 ASP A CA    1 
ATOM   680  C C     . ASP A 1 108 ? 34.961 6.492  17.357  1.00 15.56 ? 330 ASP A C     1 
ATOM   681  O O     . ASP A 1 108 ? 34.462 6.172  18.438  1.00 14.52 ? 330 ASP A O     1 
ATOM   682  C CB    . ASP A 1 108 ? 37.164 7.474  18.045  1.00 19.17 ? 330 ASP A CB    1 
ATOM   683  C CG    . ASP A 1 108 ? 37.835 6.159  17.692  1.00 22.24 ? 330 ASP A CG    1 
ATOM   684  O OD1   . ASP A 1 108 ? 38.241 5.986  16.525  1.00 26.62 ? 330 ASP A OD1   1 
ATOM   685  O OD2   . ASP A 1 108 ? 37.954 5.296  18.585  1.00 27.21 ? 330 ASP A OD2   1 
ATOM   686  N N     . SER A 1 109 ? 34.742 5.816  16.232  1.00 16.32 ? 331 SER A N     1 
ATOM   687  C CA    . SER A 1 109 ? 33.868 4.645  16.192  1.00 18.11 ? 331 SER A CA    1 
ATOM   688  C C     . SER A 1 109 ? 34.334 3.527  17.122  1.00 18.01 ? 331 SER A C     1 
ATOM   689  O O     . SER A 1 109 ? 33.515 2.799  17.680  1.00 17.95 ? 331 SER A O     1 
ATOM   690  C CB    . SER A 1 109 ? 33.763 4.107  14.761  1.00 18.98 ? 331 SER A CB    1 
ATOM   691  O OG    . SER A 1 109 ? 35.025 3.670  14.291  1.00 21.95 ? 331 SER A OG    1 
ATOM   692  N N     . ALA A 1 110 ? 35.645 3.392  17.285  1.00 18.10 ? 332 ALA A N     1 
ATOM   693  C CA    . ALA A 1 110 ? 36.198 2.357  18.153  1.00 19.38 ? 332 ALA A CA    1 
ATOM   694  C C     . ALA A 1 110 ? 35.831 2.633  19.609  1.00 18.24 ? 332 ALA A C     1 
ATOM   695  O O     . ALA A 1 110 ? 35.562 1.707  20.379  1.00 19.95 ? 332 ALA A O     1 
ATOM   696  C CB    . ALA A 1 110 ? 37.717 2.290  17.992  1.00 20.93 ? 332 ALA A CB    1 
ATOM   697  N N     . LEU A 1 111 ? 35.820 3.908  19.986  1.00 16.60 ? 333 LEU A N     1 
ATOM   698  C CA    . LEU A 1 111 ? 35.466 4.296  21.347  1.00 15.67 ? 333 LEU A CA    1 
ATOM   699  C C     . LEU A 1 111 ? 33.980 4.034  21.598  1.00 14.56 ? 333 LEU A C     1 
ATOM   700  O O     . LEU A 1 111 ? 33.595 3.549  22.661  1.00 13.81 ? 333 LEU A O     1 
ATOM   701  C CB    . LEU A 1 111 ? 35.790 5.775  21.566  1.00 17.91 ? 333 LEU A CB    1 
ATOM   702  C CG    . LEU A 1 111 ? 35.410 6.379  22.918  1.00 19.77 ? 333 LEU A CG    1 
ATOM   703  C CD1   . LEU A 1 111 ? 35.975 5.526  24.046  1.00 19.78 ? 333 LEU A CD1   1 
ATOM   704  C CD2   . LEU A 1 111 ? 35.935 7.805  23.000  1.00 19.28 ? 333 LEU A CD2   1 
ATOM   705  N N     . VAL A 1 112 ? 33.151 4.362  20.614  1.00 13.39 ? 334 VAL A N     1 
ATOM   706  C CA    . VAL A 1 112 ? 31.717 4.133  20.724  1.00 13.56 ? 334 VAL A CA    1 
ATOM   707  C C     . VAL A 1 112 ? 31.471 2.635  20.895  1.00 13.51 ? 334 VAL A C     1 
ATOM   708  O O     . VAL A 1 112 ? 30.674 2.214  21.741  1.00 14.07 ? 334 VAL A O     1 
ATOM   709  C CB    . VAL A 1 112 ? 30.985 4.671  19.464  1.00 13.12 ? 334 VAL A CB    1 
ATOM   710  C CG1   . VAL A 1 112 ? 29.525 4.250  19.464  1.00 14.64 ? 334 VAL A CG1   1 
ATOM   711  C CG2   . VAL A 1 112 ? 31.092 6.188  19.427  1.00 14.50 ? 334 VAL A CG2   1 
ATOM   712  N N     . ASN A 1 113 ? 32.182 1.832  20.107  1.00 14.84 ? 335 ASN A N     1 
ATOM   713  C CA    . ASN A 1 113 ? 32.042 0.381  20.181  1.00 14.09 ? 335 ASN A CA    1 
ATOM   714  C C     . ASN A 1 113 ? 32.408 -0.143 21.566  1.00 14.52 ? 335 ASN A C     1 
ATOM   715  O O     . ASN A 1 113 ? 31.707 -0.996 22.120  1.00 14.04 ? 335 ASN A O     1 
ATOM   716  C CB    . ASN A 1 113 ? 32.920 -0.296 19.120  1.00 16.73 ? 335 ASN A CB    1 
ATOM   717  C CG    . ASN A 1 113 ? 32.345 -0.175 17.723  1.00 20.95 ? 335 ASN A CG    1 
ATOM   718  O OD1   . ASN A 1 113 ? 32.947 -0.627 16.750  1.00 23.06 ? 335 ASN A OD1   1 
ATOM   719  N ND2   . ASN A 1 113 ? 31.172 0.432  17.618  1.00 21.91 ? 335 ASN A ND2   1 
ATOM   720  N N     . GLN A 1 114 ? 33.501 0.371  22.125  1.00 15.17 ? 336 GLN A N     1 
ATOM   721  C CA    . GLN A 1 114 ? 33.943 -0.047 23.452  1.00 15.19 ? 336 GLN A CA    1 
ATOM   722  C C     . GLN A 1 114 ? 32.900 0.263  24.518  1.00 13.29 ? 336 GLN A C     1 
ATOM   723  O O     . GLN A 1 114 ? 32.709 -0.517 25.449  1.00 14.97 ? 336 GLN A O     1 
ATOM   724  C CB    . GLN A 1 114 ? 35.261 0.630  23.821  1.00 15.22 ? 336 GLN A CB    1 
ATOM   725  C CG    . GLN A 1 114 ? 36.480 -0.026 23.215  1.00 17.84 ? 336 GLN A CG    1 
ATOM   726  C CD    . GLN A 1 114 ? 37.759 0.674  23.618  1.00 20.01 ? 336 GLN A CD    1 
ATOM   727  O OE1   . GLN A 1 114 ? 38.039 1.786  23.173  1.00 22.10 ? 336 GLN A OE1   1 
ATOM   728  N NE2   . GLN A 1 114 ? 38.535 0.032  24.476  1.00 21.56 ? 336 GLN A NE2   1 
ATOM   729  N N     . LEU A 1 115 ? 32.228 1.405  24.387  1.00 14.44 ? 337 LEU A N     1 
ATOM   730  C CA    . LEU A 1 115 ? 31.193 1.785  25.345  1.00 14.30 ? 337 LEU A CA    1 
ATOM   731  C C     . LEU A 1 115 ? 30.010 0.824  25.277  1.00 14.11 ? 337 LEU A C     1 
ATOM   732  O O     . LEU A 1 115 ? 29.510 0.369  26.305  1.00 14.50 ? 337 LEU A O     1 
ATOM   733  C CB    . LEU A 1 115 ? 30.724 3.219  25.080  1.00 16.25 ? 337 LEU A CB    1 
ATOM   734  C CG    . LEU A 1 115 ? 31.665 4.313  25.592  1.00 15.85 ? 337 LEU A CG    1 
ATOM   735  C CD1   . LEU A 1 115 ? 31.243 5.668  25.038  1.00 17.39 ? 337 LEU A CD1   1 
ATOM   736  C CD2   . LEU A 1 115 ? 31.648 4.328  27.115  1.00 16.41 ? 337 LEU A CD2   1 
ATOM   737  N N     . GLY A 1 116 ? 29.570 0.507  24.063  1.00 14.34 ? 338 GLY A N     1 
ATOM   738  C CA    . GLY A 1 116 ? 28.458 -0.413 23.912  1.00 15.26 ? 338 GLY A CA    1 
ATOM   739  C C     . GLY A 1 116 ? 28.803 -1.766 24.506  1.00 15.23 ? 338 GLY A C     1 
ATOM   740  O O     . GLY A 1 116 ? 27.984 -2.392 25.176  1.00 15.41 ? 338 GLY A O     1 
ATOM   741  N N     . LYS A 1 117 ? 30.036 -2.203 24.270  1.00 16.11 ? 339 LYS A N     1 
ATOM   742  C CA    . LYS A 1 117 ? 30.510 -3.488 24.767  1.00 17.75 ? 339 LYS A CA    1 
ATOM   743  C C     . LYS A 1 117 ? 30.525 -3.555 26.292  1.00 16.94 ? 339 LYS A C     1 
ATOM   744  O O     . LYS A 1 117 ? 29.948 -4.468 26.883  1.00 16.42 ? 339 LYS A O     1 
ATOM   745  C CB    . LYS A 1 117 ? 31.906 -3.791 24.216  1.00 17.62 ? 339 LYS A CB    1 
ATOM   746  C CG    . LYS A 1 117 ? 32.410 -5.188 24.538  1.00 24.21 ? 339 LYS A CG    1 
ATOM   747  C CD    . LYS A 1 117 ? 33.482 -5.628 23.555  1.00 27.59 ? 339 LYS A CD    1 
ATOM   748  C CE    . LYS A 1 117 ? 34.322 -6.760 24.123  1.00 28.60 ? 339 LYS A CE    1 
ATOM   749  N NZ    . LYS A 1 117 ? 35.179 -6.303 25.252  1.00 28.65 ? 339 LYS A NZ    1 
ATOM   750  N N     . ILE A 1 118 ? 31.189 -2.593 26.928  1.00 16.09 ? 340 ILE A N     1 
ATOM   751  C CA    . ILE A 1 118 ? 31.317 -2.606 28.378  1.00 15.16 ? 340 ILE A CA    1 
ATOM   752  C C     . ILE A 1 118 ? 29.971 -2.438 29.083  1.00 16.21 ? 340 ILE A C     1 
ATOM   753  O O     . ILE A 1 118 ? 29.799 -2.884 30.217  1.00 16.67 ? 340 ILE A O     1 
ATOM   754  C CB    . ILE A 1 118 ? 32.337 -1.532 28.852  1.00 15.31 ? 340 ILE A CB    1 
ATOM   755  C CG1   . ILE A 1 118 ? 32.866 -1.903 30.238  1.00 15.68 ? 340 ILE A CG1   1 
ATOM   756  C CG2   . ILE A 1 118 ? 31.697 -0.156 28.883  1.00 15.56 ? 340 ILE A CG2   1 
ATOM   757  C CD1   . ILE A 1 118 ? 34.109 -1.128 30.639  1.00 15.27 ? 340 ILE A CD1   1 
ATOM   758  N N     . LEU A 1 119 ? 29.012 -1.814 28.405  1.00 16.85 ? 341 LEU A N     1 
ATOM   759  C CA    . LEU A 1 119 ? 27.687 -1.612 28.980  1.00 18.15 ? 341 LEU A CA    1 
ATOM   760  C C     . LEU A 1 119 ? 26.770 -2.801 28.706  1.00 18.71 ? 341 LEU A C     1 
ATOM   761  O O     . LEU A 1 119 ? 25.720 -2.937 29.336  1.00 20.52 ? 341 LEU A O     1 
ATOM   762  C CB    . LEU A 1 119 ? 27.048 -0.337 28.418  1.00 17.76 ? 341 LEU A CB    1 
ATOM   763  C CG    . LEU A 1 119 ? 27.724 0.984  28.795  1.00 17.16 ? 341 LEU A CG    1 
ATOM   764  C CD1   . LEU A 1 119 ? 27.066 2.132  28.041  1.00 17.50 ? 341 LEU A CD1   1 
ATOM   765  C CD2   . LEU A 1 119 ? 27.634 1.196  30.300  1.00 17.23 ? 341 LEU A CD2   1 
ATOM   766  N N     . GLY A 1 120 ? 27.176 -3.660 27.773  1.00 19.13 ? 342 GLY A N     1 
ATOM   767  C CA    . GLY A 1 120 ? 26.367 -4.814 27.419  1.00 19.93 ? 342 GLY A CA    1 
ATOM   768  C C     . GLY A 1 120 ? 25.130 -4.370 26.663  1.00 19.90 ? 342 GLY A C     1 
ATOM   769  O O     . GLY A 1 120 ? 24.075 -5.004 26.730  1.00 20.86 ? 342 GLY A O     1 
ATOM   770  N N     . ALA A 1 121 ? 25.267 -3.280 25.919  1.00 19.10 ? 343 ALA A N     1 
ATOM   771  C CA    . ALA A 1 121 ? 24.151 -2.726 25.168  1.00 20.10 ? 343 ALA A CA    1 
ATOM   772  C C     . ALA A 1 121 ? 24.231 -2.920 23.662  1.00 19.94 ? 343 ALA A C     1 
ATOM   773  O O     . ALA A 1 121 ? 25.316 -2.969 23.079  1.00 21.32 ? 343 ALA A O     1 
ATOM   774  C CB    . ALA A 1 121 ? 24.017 -1.243 25.484  1.00 20.58 ? 343 ALA A CB    1 
ATOM   775  N N     . ASP A 1 122 ? 23.058 -3.029 23.043  1.00 19.98 ? 344 ASP A N     1 
ATOM   776  C CA    . ASP A 1 122 ? 22.943 -3.174 21.599  1.00 19.02 ? 344 ASP A CA    1 
ATOM   777  C C     . ASP A 1 122 ? 22.837 -1.742 21.086  1.00 18.40 ? 344 ASP A C     1 
ATOM   778  O O     . ASP A 1 122 ? 21.783 -1.115 21.186  1.00 17.79 ? 344 ASP A O     1 
ATOM   779  C CB    . ASP A 1 122 ? 21.680 -3.967 21.254  1.00 19.92 ? 344 ASP A CB    1 
ATOM   780  C CG    . ASP A 1 122 ? 21.464 -4.115 19.757  1.00 21.88 ? 344 ASP A CG    1 
ATOM   781  O OD1   . ASP A 1 122 ? 20.523 -4.840 19.366  1.00 23.10 ? 344 ASP A OD1   1 
ATOM   782  O OD2   . ASP A 1 122 ? 22.221 -3.509 18.969  1.00 21.78 ? 344 ASP A OD2   1 
ATOM   783  N N     . LEU A 1 123 ? 23.944 -1.229 20.556  1.00 18.07 ? 345 LEU A N     1 
ATOM   784  C CA    . LEU A 1 123 ? 24.011 0.145  20.057  1.00 18.50 ? 345 LEU A CA    1 
ATOM   785  C C     . LEU A 1 123 ? 23.136 0.448  18.853  1.00 18.77 ? 345 LEU A C     1 
ATOM   786  O O     . LEU A 1 123 ? 22.857 1.611  18.562  1.00 17.40 ? 345 LEU A O     1 
ATOM   787  C CB    . LEU A 1 123 ? 25.454 0.502  19.699  1.00 18.00 ? 345 LEU A CB    1 
ATOM   788  C CG    . LEU A 1 123 ? 26.487 0.484  20.822  1.00 18.82 ? 345 LEU A CG    1 
ATOM   789  C CD1   . LEU A 1 123 ? 27.856 0.814  20.249  1.00 20.05 ? 345 LEU A CD1   1 
ATOM   790  C CD2   . LEU A 1 123 ? 26.091 1.485  21.898  1.00 19.82 ? 345 LEU A CD2   1 
ATOM   791  N N     . ASP A 1 124 ? 22.699 -0.587 18.146  1.00 18.27 ? 346 ASP A N     1 
ATOM   792  C CA    . ASP A 1 124 ? 21.890 -0.361 16.962  1.00 18.02 ? 346 ASP A CA    1 
ATOM   793  C C     . ASP A 1 124 ? 20.392 -0.257 17.211  1.00 18.27 ? 346 ASP A C     1 
ATOM   794  O O     . ASP A 1 124 ? 19.604 -0.107 16.274  1.00 18.16 ? 346 ASP A O     1 
ATOM   795  C CB    . ASP A 1 124 ? 22.226 -1.427 15.923  1.00 19.85 ? 346 ASP A CB    1 
ATOM   796  C CG    . ASP A 1 124 ? 23.655 -1.304 15.433  1.00 21.04 ? 346 ASP A CG    1 
ATOM   797  O OD1   . ASP A 1 124 ? 24.380 -2.321 15.400  1.00 23.41 ? 346 ASP A OD1   1 
ATOM   798  O OD2   . ASP A 1 124 ? 24.057 -0.171 15.086  1.00 21.77 ? 346 ASP A OD2   1 
ATOM   799  N N     . VAL A 1 125 ? 20.001 -0.326 18.477  1.00 17.69 ? 347 VAL A N     1 
ATOM   800  C CA    . VAL A 1 125 ? 18.598 -0.186 18.837  1.00 17.84 ? 347 VAL A CA    1 
ATOM   801  C C     . VAL A 1 125 ? 18.217 1.265  18.556  1.00 17.46 ? 347 VAL A C     1 
ATOM   802  O O     . VAL A 1 125 ? 18.936 2.188  18.945  1.00 15.96 ? 347 VAL A O     1 
ATOM   803  C CB    . VAL A 1 125 ? 18.365 -0.485 20.335  1.00 18.40 ? 347 VAL A CB    1 
ATOM   804  C CG1   . VAL A 1 125 ? 16.976 -0.024 20.753  1.00 18.71 ? 347 VAL A CG1   1 
ATOM   805  C CG2   . VAL A 1 125 ? 18.521 -1.977 20.593  1.00 19.72 ? 347 VAL A CG2   1 
ATOM   806  N N     . VAL A 1 126 ? 17.107 1.460  17.856  1.00 15.73 ? 348 VAL A N     1 
ATOM   807  C CA    . VAL A 1 126 ? 16.632 2.802  17.537  1.00 17.62 ? 348 VAL A CA    1 
ATOM   808  C C     . VAL A 1 126 ? 15.582 3.178  18.573  1.00 17.28 ? 348 VAL A C     1 
ATOM   809  O O     . VAL A 1 126 ? 14.710 2.371  18.906  1.00 18.88 ? 348 VAL A O     1 
ATOM   810  C CB    . VAL A 1 126 ? 16.018 2.853  16.127  1.00 16.87 ? 348 VAL A CB    1 
ATOM   811  C CG1   . VAL A 1 126 ? 15.403 4.229  15.873  1.00 17.17 ? 348 VAL A CG1   1 
ATOM   812  C CG2   . VAL A 1 126 ? 17.088 2.557  15.090  1.00 17.56 ? 348 VAL A CG2   1 
ATOM   813  N N     . MET A 1 127 ? 15.667 4.399  19.088  1.00 16.95 ? 349 MET A N     1 
ATOM   814  C CA    . MET A 1 127 ? 14.732 4.838  20.114  1.00 16.55 ? 349 MET A CA    1 
ATOM   815  C C     . MET A 1 127 ? 14.583 6.346  20.193  1.00 16.40 ? 349 MET A C     1 
ATOM   816  O O     . MET A 1 127 ? 15.215 7.089  19.444  1.00 14.28 ? 349 MET A O     1 
ATOM   817  C CB    . MET A 1 127 ? 15.197 4.309  21.478  1.00 16.85 ? 349 MET A CB    1 
ATOM   818  C CG    . MET A 1 127 ? 16.601 4.767  21.912  1.00 17.59 ? 349 MET A CG    1 
ATOM   819  S SD    . MET A 1 127 ? 16.705 6.459  22.566  1.00 17.13 ? 349 MET A SD    1 
ATOM   820  C CE    . MET A 1 127 ? 17.982 7.191  21.524  1.00 17.23 ? 349 MET A CE    1 
ATOM   821  N N     . SER A 1 128 ? 13.714 6.781  21.095  1.00 15.96 ? 350 SER A N     1 
ATOM   822  C CA    . SER A 1 128 ? 13.494 8.192  21.348  1.00 15.98 ? 350 SER A CA    1 
ATOM   823  C C     . SER A 1 128 ? 13.462 8.385  22.850  1.00 15.75 ? 350 SER A C     1 
ATOM   824  O O     . SER A 1 128 ? 12.969 7.531  23.593  1.00 16.68 ? 350 SER A O     1 
ATOM   825  C CB    . SER A 1 128 ? 12.158 8.679  20.768  1.00 15.95 ? 350 SER A CB    1 
ATOM   826  O OG    . SER A 1 128 ? 12.178 8.729  19.355  1.00 17.27 ? 350 SER A OG    1 
ATOM   827  N N     . LEU A 1 129 ? 14.029 9.492  23.302  1.00 13.63 ? 351 LEU A N     1 
ATOM   828  C CA    . LEU A 1 129 ? 13.988 9.836  24.709  1.00 14.01 ? 351 LEU A CA    1 
ATOM   829  C C     . LEU A 1 129 ? 13.066 11.051 24.691  1.00 15.06 ? 351 LEU A C     1 
ATOM   830  O O     . LEU A 1 129 ? 13.377 12.071 24.074  1.00 14.94 ? 351 LEU A O     1 
ATOM   831  C CB    . LEU A 1 129 ? 15.393 10.162 25.230  1.00 14.59 ? 351 LEU A CB    1 
ATOM   832  C CG    . LEU A 1 129 ? 16.194 8.902  25.599  1.00 14.48 ? 351 LEU A CG    1 
ATOM   833  C CD1   . LEU A 1 129 ? 17.671 9.229  25.729  1.00 16.36 ? 351 LEU A CD1   1 
ATOM   834  C CD2   . LEU A 1 129 ? 15.651 8.312  26.906  1.00 16.66 ? 351 LEU A CD2   1 
ATOM   835  N N     . ASN A 1 130 ? 11.908 10.914 25.328  1.00 15.65 ? 352 ASN A N     1 
ATOM   836  C CA    . ASN A 1 130 ? 10.913 11.982 25.344  1.00 15.69 ? 352 ASN A CA    1 
ATOM   837  C C     . ASN A 1 130 ? 10.748 12.621 26.714  1.00 17.25 ? 352 ASN A C     1 
ATOM   838  O O     . ASN A 1 130 ? 10.623 11.931 27.722  1.00 17.18 ? 352 ASN A O     1 
ATOM   839  C CB    . ASN A 1 130 ? 9.572  11.432 24.857  1.00 16.80 ? 352 ASN A CB    1 
ATOM   840  C CG    . ASN A 1 130 ? 9.701  10.686 23.545  1.00 19.34 ? 352 ASN A CG    1 
ATOM   841  O OD1   . ASN A 1 130 ? 10.475 11.080 22.675  1.00 18.57 ? 352 ASN A OD1   1 
ATOM   842  N ND2   . ASN A 1 130 ? 8.940  9.607  23.392  1.00 18.96 ? 352 ASN A ND2   1 
ATOM   843  N N     . ASN A 1 131 ? 10.735 13.949 26.736  1.00 16.74 ? 353 ASN A N     1 
ATOM   844  C CA    . ASN A 1 131 ? 10.611 14.704 27.976  1.00 17.49 ? 353 ASN A CA    1 
ATOM   845  C C     . ASN A 1 131 ? 9.326  14.354 28.730  1.00 18.45 ? 353 ASN A C     1 
ATOM   846  O O     . ASN A 1 131 ? 8.233  14.374 28.160  1.00 18.40 ? 353 ASN A O     1 
ATOM   847  C CB    . ASN A 1 131 ? 10.664 16.206 27.663  1.00 17.41 ? 353 ASN A CB    1 
ATOM   848  C CG    . ASN A 1 131 ? 11.048 17.041 28.866  1.00 17.86 ? 353 ASN A CG    1 
ATOM   849  O OD1   . ASN A 1 131 ? 11.737 18.051 28.736  1.00 18.95 ? 353 ASN A OD1   1 
ATOM   850  N ND2   . ASN A 1 131 ? 10.601 16.628 30.044  1.00 18.08 ? 353 ASN A ND2   1 
ATOM   851  N N     . LEU A 1 132 ? 9.468  14.026 30.013  1.00 19.33 ? 354 LEU A N     1 
ATOM   852  C CA    . LEU A 1 132 ? 8.319  13.671 30.840  1.00 22.42 ? 354 LEU A CA    1 
ATOM   853  C C     . LEU A 1 132 ? 7.381  14.864 30.961  1.00 22.82 ? 354 LEU A C     1 
ATOM   854  O O     . LEU A 1 132 ? 6.191  14.709 31.250  1.00 23.59 ? 354 LEU A O     1 
ATOM   855  C CB    . LEU A 1 132 ? 8.778  13.205 32.223  1.00 22.88 ? 354 LEU A CB    1 
ATOM   856  C CG    . LEU A 1 132 ? 9.570  11.892 32.241  1.00 25.50 ? 354 LEU A CG    1 
ATOM   857  C CD1   . LEU A 1 132 ? 9.812  11.459 33.677  1.00 26.58 ? 354 LEU A CD1   1 
ATOM   858  C CD2   . LEU A 1 132 ? 8.798  10.816 31.495  1.00 25.01 ? 354 LEU A CD2   1 
ATOM   859  N N     . ASP A 1 133 ? 7.929  16.055 30.745  1.00 23.56 ? 355 ASP A N     1 
ATOM   860  C CA    . ASP A 1 133 ? 7.137  17.276 30.776  1.00 24.39 ? 355 ASP A CA    1 
ATOM   861  C C     . ASP A 1 133 ? 6.725  17.509 29.325  1.00 24.52 ? 355 ASP A C     1 
ATOM   862  O O     . ASP A 1 133 ? 7.478  18.080 28.536  1.00 21.58 ? 355 ASP A O     1 
ATOM   863  C CB    . ASP A 1 133 ? 7.978  18.448 31.285  1.00 26.07 ? 355 ASP A CB    1 
ATOM   864  C CG    . ASP A 1 133 ? 7.201  19.750 31.327  1.00 27.17 ? 355 ASP A CG    1 
ATOM   865  O OD1   . ASP A 1 133 ? 7.774  20.765 31.775  1.00 28.20 ? 355 ASP A OD1   1 
ATOM   866  O OD2   . ASP A 1 133 ? 6.021  19.759 30.912  1.00 28.74 ? 355 ASP A OD2   1 
ATOM   867  N N     . GLU A 1 134 ? 5.530  17.042 28.977  1.00 24.48 ? 356 GLU A N     1 
ATOM   868  C CA    . GLU A 1 134 ? 5.016  17.160 27.617  1.00 26.73 ? 356 GLU A CA    1 
ATOM   869  C C     . GLU A 1 134 ? 4.874  18.594 27.119  1.00 25.44 ? 356 GLU A C     1 
ATOM   870  O O     . GLU A 1 134 ? 4.729  18.824 25.921  1.00 27.81 ? 356 GLU A O     1 
ATOM   871  C CB    . GLU A 1 134 ? 3.665  16.450 27.507  1.00 28.34 ? 356 GLU A CB    1 
ATOM   872  C CG    . GLU A 1 134 ? 3.717  14.969 27.837  1.00 31.40 ? 356 GLU A CG    1 
ATOM   873  C CD    . GLU A 1 134 ? 2.358  14.306 27.733  1.00 33.65 ? 356 GLU A CD    1 
ATOM   874  O OE1   . GLU A 1 134 ? 1.788  14.289 26.621  1.00 34.85 ? 356 GLU A OE1   1 
ATOM   875  O OE2   . GLU A 1 134 ? 1.860  13.803 28.762  1.00 34.88 ? 356 GLU A OE2   1 
ATOM   876  N N     . GLU A 1 135 ? 4.914  19.557 28.032  1.00 26.13 ? 357 GLU A N     1 
ATOM   877  C CA    . GLU A 1 135 ? 4.783  20.954 27.642  1.00 26.14 ? 357 GLU A CA    1 
ATOM   878  C C     . GLU A 1 135 ? 6.129  21.620 27.372  1.00 25.10 ? 357 GLU A C     1 
ATOM   879  O O     . GLU A 1 135 ? 6.189  22.696 26.781  1.00 25.53 ? 357 GLU A O     1 
ATOM   880  C CB    . GLU A 1 135 ? 4.018  21.732 28.717  1.00 28.33 ? 357 GLU A CB    1 
ATOM   881  C CG    . GLU A 1 135 ? 2.553  21.333 28.822  1.00 30.92 ? 357 GLU A CG    1 
ATOM   882  C CD    . GLU A 1 135 ? 1.789  22.150 29.845  1.00 32.77 ? 357 GLU A CD    1 
ATOM   883  O OE1   . GLU A 1 135 ? 1.829  23.397 29.763  1.00 33.46 ? 357 GLU A OE1   1 
ATOM   884  O OE2   . GLU A 1 135 ? 1.143  21.545 30.728  1.00 33.54 ? 357 GLU A OE2   1 
ATOM   885  N N     . SER A 1 136 ? 7.211  20.975 27.792  1.00 22.56 ? 358 SER A N     1 
ATOM   886  C CA    . SER A 1 136 ? 8.541  21.536 27.589  1.00 21.96 ? 358 SER A CA    1 
ATOM   887  C C     . SER A 1 136 ? 8.936  21.669 26.121  1.00 20.20 ? 358 SER A C     1 
ATOM   888  O O     . SER A 1 136 ? 8.642  20.798 25.302  1.00 21.41 ? 358 SER A O     1 
ATOM   889  C CB    . SER A 1 136 ? 9.590  20.687 28.304  1.00 21.83 ? 358 SER A CB    1 
ATOM   890  O OG    . SER A 1 136 ? 10.891 21.170 28.016  1.00 21.00 ? 358 SER A OG    1 
ATOM   891  N N     . ASN A 1 137 ? 9.618  22.763 25.796  1.00 19.49 ? 359 ASN A N     1 
ATOM   892  C CA    . ASN A 1 137 ? 10.076 23.002 24.434  1.00 19.04 ? 359 ASN A CA    1 
ATOM   893  C C     . ASN A 1 137 ? 11.157 21.990 24.060  1.00 18.91 ? 359 ASN A C     1 
ATOM   894  O O     . ASN A 1 137 ? 11.376 21.702 22.884  1.00 21.20 ? 359 ASN A O     1 
ATOM   895  C CB    . ASN A 1 137 ? 10.634 24.424 24.302  1.00 18.73 ? 359 ASN A CB    1 
ATOM   896  C CG    . ASN A 1 137 ? 9.547  25.487 24.329  1.00 20.54 ? 359 ASN A CG    1 
ATOM   897  O OD1   . ASN A 1 137 ? 8.369  25.185 24.525  1.00 19.27 ? 359 ASN A OD1   1 
ATOM   898  N ND2   . ASN A 1 137 ? 9.943  26.743 24.132  1.00 19.28 ? 359 ASN A ND2   1 
ATOM   899  N N     . LYS A 1 138 ? 11.832 21.454 25.070  1.00 17.96 ? 360 LYS A N     1 
ATOM   900  C CA    . LYS A 1 138 ? 12.890 20.476 24.843  1.00 18.20 ? 360 LYS A CA    1 
ATOM   901  C C     . LYS A 1 138 ? 12.286 19.073 24.862  1.00 16.71 ? 360 LYS A C     1 
ATOM   902  O O     . LYS A 1 138 ? 12.277 18.402 25.893  1.00 18.28 ? 360 LYS A O     1 
ATOM   903  C CB    . LYS A 1 138 ? 13.959 20.610 25.929  1.00 18.68 ? 360 LYS A CB    1 
ATOM   904  C CG    . LYS A 1 138 ? 15.237 19.832 25.646  1.00 20.62 ? 360 LYS A CG    1 
ATOM   905  C CD    . LYS A 1 138 ? 16.298 20.127 26.696  1.00 21.72 ? 360 LYS A CD    1 
ATOM   906  C CE    . LYS A 1 138 ? 17.622 19.478 26.333  1.00 22.28 ? 360 LYS A CE    1 
ATOM   907  N NZ    . LYS A 1 138 ? 18.690 19.845 27.304  1.00 24.61 ? 360 LYS A NZ    1 
ATOM   908  N N     . LYS A 1 139 ? 11.784 18.639 23.710  1.00 17.72 ? 361 LYS A N     1 
ATOM   909  C CA    . LYS A 1 139 ? 11.151 17.328 23.583  1.00 18.69 ? 361 LYS A CA    1 
ATOM   910  C C     . LYS A 1 139 ? 12.111 16.153 23.719  1.00 16.95 ? 361 LYS A C     1 
ATOM   911  O O     . LYS A 1 139 ? 11.737 15.102 24.236  1.00 16.22 ? 361 LYS A O     1 
ATOM   912  C CB    . LYS A 1 139 ? 10.429 17.210 22.237  1.00 19.83 ? 361 LYS A CB    1 
ATOM   913  C CG    . LYS A 1 139 ? 9.231  18.127 22.066  1.00 24.58 ? 361 LYS A CG    1 
ATOM   914  C CD    . LYS A 1 139 ? 8.522  17.861 20.741  1.00 26.14 ? 361 LYS A CD    1 
ATOM   915  C CE    . LYS A 1 139 ? 9.445  18.106 19.553  1.00 28.05 ? 361 LYS A CE    1 
ATOM   916  N NZ    . LYS A 1 139 ? 8.780  17.833 18.246  1.00 29.81 ? 361 LYS A NZ    1 
ATOM   917  N N     . HIS A 1 140 ? 13.340 16.330 23.248  1.00 14.81 ? 362 HIS A N     1 
ATOM   918  C CA    . HIS A 1 140 ? 14.344 15.271 23.297  1.00 15.07 ? 362 HIS A CA    1 
ATOM   919  C C     . HIS A 1 140 ? 15.700 15.839 23.701  1.00 14.08 ? 362 HIS A C     1 
ATOM   920  O O     . HIS A 1 140 ? 15.921 17.043 23.617  1.00 15.47 ? 362 HIS A O     1 
ATOM   921  C CB    . HIS A 1 140 ? 14.494 14.629 21.916  1.00 15.64 ? 362 HIS A CB    1 
ATOM   922  C CG    . HIS A 1 140 ? 13.204 14.187 21.304  1.00 16.09 ? 362 HIS A CG    1 
ATOM   923  N ND1   . HIS A 1 140 ? 12.731 14.695 20.113  1.00 18.74 ? 362 HIS A ND1   1 
ATOM   924  C CD2   . HIS A 1 140 ? 12.296 13.269 21.710  1.00 15.08 ? 362 HIS A CD2   1 
ATOM   925  C CE1   . HIS A 1 140 ? 11.586 14.108 19.812  1.00 15.54 ? 362 HIS A CE1   1 
ATOM   926  N NE2   . HIS A 1 140 ? 11.300 13.240 20.766  1.00 18.49 ? 362 HIS A NE2   1 
ATOM   927  N N     . PRO A 1 141 ? 16.629 14.974 24.145  1.00 13.97 ? 363 PRO A N     1 
ATOM   928  C CA    . PRO A 1 141 ? 17.967 15.433 24.543  1.00 13.87 ? 363 PRO A CA    1 
ATOM   929  C C     . PRO A 1 141 ? 18.851 15.706 23.320  1.00 13.41 ? 363 PRO A C     1 
ATOM   930  O O     . PRO A 1 141 ? 19.842 16.429 23.406  1.00 14.87 ? 363 PRO A O     1 
ATOM   931  C CB    . PRO A 1 141 ? 18.491 14.279 25.388  1.00 13.32 ? 363 PRO A CB    1 
ATOM   932  C CG    . PRO A 1 141 ? 17.834 13.076 24.761  1.00 14.72 ? 363 PRO A CG    1 
ATOM   933  C CD    . PRO A 1 141 ? 16.418 13.566 24.532  1.00 15.44 ? 363 PRO A CD    1 
ATOM   934  N N     . PHE A 1 142 ? 18.477 15.108 22.193  1.00 13.10 ? 364 PHE A N     1 
ATOM   935  C CA    . PHE A 1 142 ? 19.181 15.248 20.920  1.00 13.07 ? 364 PHE A CA    1 
ATOM   936  C C     . PHE A 1 142 ? 18.203 14.743 19.855  1.00 13.61 ? 364 PHE A C     1 
ATOM   937  O O     . PHE A 1 142 ? 17.145 14.217 20.199  1.00 12.76 ? 364 PHE A O     1 
ATOM   938  C CB    . PHE A 1 142 ? 20.480 14.423 20.918  1.00 12.77 ? 364 PHE A CB    1 
ATOM   939  C CG    . PHE A 1 142 ? 20.348 13.071 21.560  1.00 11.53 ? 364 PHE A CG    1 
ATOM   940  C CD1   . PHE A 1 142 ? 20.837 12.846 22.848  1.00 12.40 ? 364 PHE A CD1   1 
ATOM   941  C CD2   . PHE A 1 142 ? 19.728 12.026 20.884  1.00 11.86 ? 364 PHE A CD2   1 
ATOM   942  C CE1   . PHE A 1 142 ? 20.709 11.595 23.455  1.00 12.48 ? 364 PHE A CE1   1 
ATOM   943  C CE2   . PHE A 1 142 ? 19.593 10.771 21.476  1.00 12.98 ? 364 PHE A CE2   1 
ATOM   944  C CZ    . PHE A 1 142 ? 20.085 10.555 22.766  1.00 11.78 ? 364 PHE A CZ    1 
ATOM   945  N N     . PRO A 1 143 ? 18.531 14.885 18.559  1.00 12.52 ? 365 PRO A N     1 
ATOM   946  C CA    . PRO A 1 143 ? 17.601 14.418 17.521  1.00 13.74 ? 365 PRO A CA    1 
ATOM   947  C C     . PRO A 1 143 ? 17.141 12.967 17.651  1.00 13.27 ? 365 PRO A C     1 
ATOM   948  O O     . PRO A 1 143 ? 17.962 12.050 17.701  1.00 14.00 ? 365 PRO A O     1 
ATOM   949  C CB    . PRO A 1 143 ? 18.371 14.670 16.226  1.00 13.06 ? 365 PRO A CB    1 
ATOM   950  C CG    . PRO A 1 143 ? 19.200 15.886 16.566  1.00 13.69 ? 365 PRO A CG    1 
ATOM   951  C CD    . PRO A 1 143 ? 19.704 15.543 17.952  1.00 12.72 ? 365 PRO A CD    1 
ATOM   952  N N     . CYS A 1 144 ? 15.821 12.782 17.687  1.00 13.54 ? 366 CYS A N     1 
ATOM   953  C CA    . CYS A 1 144 ? 15.196 11.463 17.805  1.00 14.59 ? 366 CYS A CA    1 
ATOM   954  C C     . CYS A 1 144 ? 14.075 11.326 16.781  1.00 15.20 ? 366 CYS A C     1 
ATOM   955  O O     . CYS A 1 144 ? 13.493 12.318 16.361  1.00 15.92 ? 366 CYS A O     1 
ATOM   956  C CB    . CYS A 1 144 ? 14.611 11.273 19.207  1.00 16.27 ? 366 CYS A CB    1 
ATOM   957  S SG    . CYS A 1 144 ? 15.838 11.034 20.499  1.00 15.09 ? 366 CYS A SG    1 
ATOM   958  N N     . PRO A 1 145 ? 13.747 10.086 16.377  1.00 14.79 ? 367 PRO A N     1 
ATOM   959  C CA    . PRO A 1 145 ? 14.363 8.833  16.822  1.00 15.50 ? 367 PRO A CA    1 
ATOM   960  C C     . PRO A 1 145 ? 15.750 8.635  16.227  1.00 14.49 ? 367 PRO A C     1 
ATOM   961  O O     . PRO A 1 145 ? 16.051 9.143  15.147  1.00 14.61 ? 367 PRO A O     1 
ATOM   962  C CB    . PRO A 1 145 ? 13.372 7.777  16.340  1.00 16.01 ? 367 PRO A CB    1 
ATOM   963  C CG    . PRO A 1 145 ? 12.852 8.377  15.078  1.00 17.40 ? 367 PRO A CG    1 
ATOM   964  C CD    . PRO A 1 145 ? 12.622 9.819  15.463  1.00 15.66 ? 367 PRO A CD    1 
ATOM   965  N N     . THR A 1 146 ? 16.589 7.889  16.937  1.00 13.68 ? 368 THR A N     1 
ATOM   966  C CA    . THR A 1 146 ? 17.944 7.619  16.485  1.00 13.38 ? 368 THR A CA    1 
ATOM   967  C C     . THR A 1 146 ? 18.475 6.422  17.265  1.00 13.69 ? 368 THR A C     1 
ATOM   968  O O     . THR A 1 146 ? 17.897 6.025  18.276  1.00 13.03 ? 368 THR A O     1 
ATOM   969  C CB    . THR A 1 146 ? 18.860 8.846  16.727  1.00 12.51 ? 368 THR A CB    1 
ATOM   970  O OG1   . THR A 1 146 ? 20.052 8.716  15.949  1.00 12.92 ? 368 THR A OG1   1 
ATOM   971  C CG2   . THR A 1 146 ? 19.239 8.961  18.203  1.00 13.24 ? 368 THR A CG2   1 
ATOM   972  N N     . SER A 1 147 ? 19.566 5.833  16.795  1.00 13.29 ? 369 SER A N     1 
ATOM   973  C CA    . SER A 1 147 ? 20.137 4.695  17.506  1.00 14.47 ? 369 SER A CA    1 
ATOM   974  C C     . SER A 1 147 ? 21.127 5.183  18.555  1.00 14.73 ? 369 SER A C     1 
ATOM   975  O O     . SER A 1 147 ? 21.604 6.318  18.501  1.00 13.92 ? 369 SER A O     1 
ATOM   976  C CB    . SER A 1 147 ? 20.861 3.766  16.536  1.00 14.34 ? 369 SER A CB    1 
ATOM   977  O OG    . SER A 1 147 ? 22.083 4.340  16.106  1.00 14.34 ? 369 SER A OG    1 
ATOM   978  N N     . TYR A 1 148 ? 21.434 4.324  19.521  1.00 12.97 ? 370 TYR A N     1 
ATOM   979  C CA    . TYR A 1 148 ? 22.390 4.694  20.550  1.00 13.10 ? 370 TYR A CA    1 
ATOM   980  C C     . TYR A 1 148 ? 23.745 4.946  19.897  1.00 13.31 ? 370 TYR A C     1 
ATOM   981  O O     . TYR A 1 148 ? 24.482 5.845  20.306  1.00 13.61 ? 370 TYR A O     1 
ATOM   982  C CB    . TYR A 1 148 ? 22.519 3.575  21.581  1.00 14.21 ? 370 TYR A CB    1 
ATOM   983  C CG    . TYR A 1 148 ? 21.269 3.351  22.396  1.00 14.05 ? 370 TYR A CG    1 
ATOM   984  C CD1   . TYR A 1 148 ? 20.716 4.384  23.156  1.00 13.51 ? 370 TYR A CD1   1 
ATOM   985  C CD2   . TYR A 1 148 ? 20.653 2.099  22.436  1.00 14.58 ? 370 TYR A CD2   1 
ATOM   986  C CE1   . TYR A 1 148 ? 19.583 4.174  23.938  1.00 14.83 ? 370 TYR A CE1   1 
ATOM   987  C CE2   . TYR A 1 148 ? 19.519 1.879  23.217  1.00 14.38 ? 370 TYR A CE2   1 
ATOM   988  C CZ    . TYR A 1 148 ? 18.994 2.919  23.964  1.00 14.67 ? 370 TYR A CZ    1 
ATOM   989  O OH    . TYR A 1 148 ? 17.884 2.707  24.743  1.00 16.41 ? 370 TYR A OH    1 
ATOM   990  N N     . ARG A 1 149 ? 24.069 4.153  18.878  1.00 13.09 ? 371 ARG A N     1 
ATOM   991  C CA    . ARG A 1 149 ? 25.343 4.312  18.182  1.00 13.07 ? 371 ARG A CA    1 
ATOM   992  C C     . ARG A 1 149 ? 25.434 5.713  17.586  1.00 12.73 ? 371 ARG A C     1 
ATOM   993  O O     . ARG A 1 149 ? 26.446 6.396  17.729  1.00 12.59 ? 371 ARG A O     1 
ATOM   994  C CB    . ARG A 1 149 ? 25.483 3.267  17.068  1.00 14.29 ? 371 ARG A CB    1 
ATOM   995  C CG    . ARG A 1 149 ? 26.860 3.252  16.406  1.00 15.68 ? 371 ARG A CG    1 
ATOM   996  C CD    . ARG A 1 149 ? 26.915 2.263  15.243  1.00 17.33 ? 371 ARG A CD    1 
ATOM   997  N NE    . ARG A 1 149 ? 26.607 0.893  15.654  1.00 17.86 ? 371 ARG A NE    1 
ATOM   998  C CZ    . ARG A 1 149 ? 27.437 0.104  16.333  1.00 19.92 ? 371 ARG A CZ    1 
ATOM   999  N NH1   . ARG A 1 149 ? 28.640 0.537  16.683  1.00 19.33 ? 371 ARG A NH1   1 
ATOM   1000 N NH2   . ARG A 1 149 ? 27.060 -1.124 16.667  1.00 20.98 ? 371 ARG A NH2   1 
ATOM   1001 N N     . THR A 1 150 ? 24.366 6.141  16.923  1.00 13.20 ? 372 THR A N     1 
ATOM   1002 C CA    . THR A 1 150 ? 24.341 7.462  16.314  1.00 12.24 ? 372 THR A CA    1 
ATOM   1003 C C     . THR A 1 150 ? 24.431 8.557  17.373  1.00 11.92 ? 372 THR A C     1 
ATOM   1004 O O     . THR A 1 150 ? 25.158 9.532  17.201  1.00 12.02 ? 372 THR A O     1 
ATOM   1005 C CB    . THR A 1 150 ? 23.066 7.660  15.474  1.00 14.42 ? 372 THR A CB    1 
ATOM   1006 O OG1   . THR A 1 150 ? 23.077 6.735  14.379  1.00 14.44 ? 372 THR A OG1   1 
ATOM   1007 C CG2   . THR A 1 150 ? 22.997 9.077  14.933  1.00 13.04 ? 372 THR A CG2   1 
ATOM   1008 N N     . ALA A 1 151 ? 23.704 8.400  18.471  1.00 11.74 ? 373 ALA A N     1 
ATOM   1009 C CA    . ALA A 1 151 ? 23.736 9.400  19.531  1.00 12.45 ? 373 ALA A CA    1 
ATOM   1010 C C     . ALA A 1 151 ? 25.142 9.534  20.116  1.00 12.20 ? 373 ALA A C     1 
ATOM   1011 O O     . ALA A 1 151 ? 25.648 10.644 20.289  1.00 13.50 ? 373 ALA A O     1 
ATOM   1012 C CB    . ALA A 1 151 ? 22.741 9.031  20.626  1.00 12.36 ? 373 ALA A CB    1 
ATOM   1013 N N     . LEU A 1 152 ? 25.774 8.401  20.407  1.00 12.17 ? 374 LEU A N     1 
ATOM   1014 C CA    . LEU A 1 152 ? 27.117 8.418  20.973  1.00 13.25 ? 374 LEU A CA    1 
ATOM   1015 C C     . LEU A 1 152 ? 28.171 8.899  19.985  1.00 12.64 ? 374 LEU A C     1 
ATOM   1016 O O     . LEU A 1 152 ? 29.227 9.404  20.378  1.00 11.57 ? 374 LEU A O     1 
ATOM   1017 C CB    . LEU A 1 152 ? 27.486 7.022  21.476  1.00 13.22 ? 374 LEU A CB    1 
ATOM   1018 C CG    . LEU A 1 152 ? 26.702 6.550  22.704  1.00 13.63 ? 374 LEU A CG    1 
ATOM   1019 C CD1   . LEU A 1 152 ? 26.909 5.058  22.916  1.00 15.59 ? 374 LEU A CD1   1 
ATOM   1020 C CD2   . LEU A 1 152 ? 27.145 7.341  23.928  1.00 14.62 ? 374 LEU A CD2   1 
ATOM   1021 N N     . THR A 1 153 ? 27.892 8.748  18.699  1.00 11.35 ? 375 THR A N     1 
ATOM   1022 C CA    . THR A 1 153 ? 28.847 9.165  17.691  1.00 12.24 ? 375 THR A CA    1 
ATOM   1023 C C     . THR A 1 153 ? 28.766 10.642 17.323  1.00 12.13 ? 375 THR A C     1 
ATOM   1024 O O     . THR A 1 153 ? 29.792 11.322 17.243  1.00 12.39 ? 375 THR A O     1 
ATOM   1025 C CB    . THR A 1 153 ? 28.671 8.330  16.399  1.00 12.96 ? 375 THR A CB    1 
ATOM   1026 O OG1   . THR A 1 153 ? 28.882 6.945  16.697  1.00 13.67 ? 375 THR A OG1   1 
ATOM   1027 C CG2   . THR A 1 153 ? 29.664 8.777  15.323  1.00 14.08 ? 375 THR A CG2   1 
ATOM   1028 N N     . TYR A 1 154 ? 27.546 11.140 17.134  1.00 11.78 ? 376 TYR A N     1 
ATOM   1029 C CA    . TYR A 1 154 ? 27.335 12.512 16.683  1.00 11.29 ? 376 TYR A CA    1 
ATOM   1030 C C     . TYR A 1 154 ? 26.692 13.499 17.634  1.00 10.84 ? 376 TYR A C     1 
ATOM   1031 O O     . TYR A 1 154 ? 26.835 14.708 17.451  1.00 11.01 ? 376 TYR A O     1 
ATOM   1032 C CB    . TYR A 1 154 ? 26.467 12.500 15.422  1.00 12.56 ? 376 TYR A CB    1 
ATOM   1033 C CG    . TYR A 1 154 ? 27.024 11.689 14.286  1.00 11.94 ? 376 TYR A CG    1 
ATOM   1034 C CD1   . TYR A 1 154 ? 28.012 12.210 13.451  1.00 14.52 ? 376 TYR A CD1   1 
ATOM   1035 C CD2   . TYR A 1 154 ? 26.564 10.396 14.041  1.00 13.49 ? 376 TYR A CD2   1 
ATOM   1036 C CE1   . TYR A 1 154 ? 28.526 11.467 12.398  1.00 14.51 ? 376 TYR A CE1   1 
ATOM   1037 C CE2   . TYR A 1 154 ? 27.072 9.641  12.992  1.00 12.25 ? 376 TYR A CE2   1 
ATOM   1038 C CZ    . TYR A 1 154 ? 28.052 10.186 12.174  1.00 14.07 ? 376 TYR A CZ    1 
ATOM   1039 O OH    . TYR A 1 154 ? 28.559 9.445  11.134  1.00 17.93 ? 376 TYR A OH    1 
ATOM   1040 N N     . TYR A 1 155 ? 25.975 13.009 18.634  1.00 10.52 ? 377 TYR A N     1 
ATOM   1041 C CA    . TYR A 1 155 ? 25.265 13.930 19.511  1.00 10.85 ? 377 TYR A CA    1 
ATOM   1042 C C     . TYR A 1 155 ? 25.747 14.100 20.936  1.00 10.93 ? 377 TYR A C     1 
ATOM   1043 O O     . TYR A 1 155 ? 25.365 15.063 21.592  1.00 10.91 ? 377 TYR A O     1 
ATOM   1044 C CB    . TYR A 1 155 ? 23.774 13.561 19.555  1.00 11.06 ? 377 TYR A CB    1 
ATOM   1045 C CG    . TYR A 1 155 ? 23.102 13.465 18.200  1.00 10.65 ? 377 TYR A CG    1 
ATOM   1046 C CD1   . TYR A 1 155 ? 23.380 14.386 17.191  1.00 11.69 ? 377 TYR A CD1   1 
ATOM   1047 C CD2   . TYR A 1 155 ? 22.161 12.467 17.941  1.00 10.74 ? 377 TYR A CD2   1 
ATOM   1048 C CE1   . TYR A 1 155 ? 22.741 14.318 15.958  1.00 12.07 ? 377 TYR A CE1   1 
ATOM   1049 C CE2   . TYR A 1 155 ? 21.513 12.392 16.708  1.00 11.38 ? 377 TYR A CE2   1 
ATOM   1050 C CZ    . TYR A 1 155 ? 21.810 13.322 15.723  1.00 12.55 ? 377 TYR A CZ    1 
ATOM   1051 O OH    . TYR A 1 155 ? 21.174 13.263 14.504  1.00 13.60 ? 377 TYR A OH    1 
ATOM   1052 N N     . LEU A 1 156 ? 26.584 13.185 21.417  1.00 10.15 ? 378 LEU A N     1 
ATOM   1053 C CA    . LEU A 1 156 ? 27.035 13.247 22.803  1.00 10.36 ? 378 LEU A CA    1 
ATOM   1054 C C     . LEU A 1 156 ? 28.538 13.366 22.992  1.00 10.57 ? 378 LEU A C     1 
ATOM   1055 O O     . LEU A 1 156 ? 29.320 12.820 22.222  1.00 10.55 ? 378 LEU A O     1 
ATOM   1056 C CB    . LEU A 1 156 ? 26.540 12.004 23.545  1.00 12.69 ? 378 LEU A CB    1 
ATOM   1057 C CG    . LEU A 1 156 ? 25.021 11.826 23.556  1.00 12.63 ? 378 LEU A CG    1 
ATOM   1058 C CD1   . LEU A 1 156 ? 24.661 10.454 24.114  1.00 13.04 ? 378 LEU A CD1   1 
ATOM   1059 C CD2   . LEU A 1 156 ? 24.387 12.927 24.393  1.00 12.60 ? 378 LEU A CD2   1 
ATOM   1060 N N     . ASP A 1 157 ? 28.916 14.080 24.047  1.00 10.50 ? 379 ASP A N     1 
ATOM   1061 C CA    . ASP A 1 157 ? 30.314 14.282 24.431  1.00 12.73 ? 379 ASP A CA    1 
ATOM   1062 C C     . ASP A 1 157 ? 30.657 13.084 25.316  1.00 12.62 ? 379 ASP A C     1 
ATOM   1063 O O     . ASP A 1 157 ? 30.105 12.934 26.403  1.00 12.83 ? 379 ASP A O     1 
ATOM   1064 C CB    . ASP A 1 157 ? 30.427 15.600 25.214  1.00 13.07 ? 379 ASP A CB    1 
ATOM   1065 C CG    . ASP A 1 157 ? 31.779 15.802 25.892  1.00 14.06 ? 379 ASP A CG    1 
ATOM   1066 O OD1   . ASP A 1 157 ? 31.942 16.867 26.527  1.00 17.92 ? 379 ASP A OD1   1 
ATOM   1067 O OD2   . ASP A 1 157 ? 32.673 14.936 25.817  1.00 13.68 ? 379 ASP A OD2   1 
ATOM   1068 N N     . ILE A 1 158 ? 31.547 12.224 24.831  1.00 13.06 ? 380 ILE A N     1 
ATOM   1069 C CA    . ILE A 1 158 ? 31.962 11.031 25.569  1.00 13.29 ? 380 ILE A CA    1 
ATOM   1070 C C     . ILE A 1 158 ? 33.463 11.050 25.844  1.00 13.49 ? 380 ILE A C     1 
ATOM   1071 O O     . ILE A 1 158 ? 34.048 10.029 26.204  1.00 16.12 ? 380 ILE A O     1 
ATOM   1072 C CB    . ILE A 1 158 ? 31.634 9.744  24.768  1.00 12.73 ? 380 ILE A CB    1 
ATOM   1073 C CG1   . ILE A 1 158 ? 32.424 9.722  23.451  1.00 13.22 ? 380 ILE A CG1   1 
ATOM   1074 C CG2   . ILE A 1 158 ? 30.143 9.684  24.470  1.00 12.84 ? 380 ILE A CG2   1 
ATOM   1075 C CD1   . ILE A 1 158 ? 32.158 8.490  22.587  1.00 12.27 ? 380 ILE A CD1   1 
ATOM   1076 N N     . THR A 1 159 ? 34.085 12.212 25.682  1.00 13.43 ? 381 THR A N     1 
ATOM   1077 C CA    . THR A 1 159 ? 35.529 12.322 25.860  1.00 13.30 ? 381 THR A CA    1 
ATOM   1078 C C     . THR A 1 159 ? 36.008 13.278 26.943  1.00 14.42 ? 381 THR A C     1 
ATOM   1079 O O     . THR A 1 159 ? 37.131 13.150 27.425  1.00 16.26 ? 381 THR A O     1 
ATOM   1080 C CB    . THR A 1 159 ? 36.180 12.719 24.539  1.00 13.79 ? 381 THR A CB    1 
ATOM   1081 O OG1   . THR A 1 159 ? 35.517 13.882 24.026  1.00 14.11 ? 381 THR A OG1   1 
ATOM   1082 C CG2   . THR A 1 159 ? 36.068 11.582 23.529  1.00 13.69 ? 381 THR A CG2   1 
ATOM   1083 N N     . ASN A 1 160 ? 35.181 14.242 27.323  1.00 14.28 ? 382 ASN A N     1 
ATOM   1084 C CA    . ASN A 1 160 ? 35.590 15.168 28.367  1.00 14.47 ? 382 ASN A CA    1 
ATOM   1085 C C     . ASN A 1 160 ? 35.218 14.590 29.727  1.00 15.33 ? 382 ASN A C     1 
ATOM   1086 O O     . ASN A 1 160 ? 34.331 13.748 29.830  1.00 16.45 ? 382 ASN A O     1 
ATOM   1087 C CB    . ASN A 1 160 ? 34.944 16.535 28.151  1.00 13.42 ? 382 ASN A CB    1 
ATOM   1088 C CG    . ASN A 1 160 ? 35.497 17.243 26.929  1.00 14.43 ? 382 ASN A CG    1 
ATOM   1089 O OD1   . ASN A 1 160 ? 36.712 17.247 26.700  1.00 15.16 ? 382 ASN A OD1   1 
ATOM   1090 N ND2   . ASN A 1 160 ? 34.617 17.849 26.141  1.00 15.69 ? 382 ASN A ND2   1 
ATOM   1091 N N     . PRO A 1 161 ? 35.902 15.026 30.792  1.00 14.56 ? 383 PRO A N     1 
ATOM   1092 C CA    . PRO A 1 161 ? 35.601 14.508 32.129  1.00 15.03 ? 383 PRO A CA    1 
ATOM   1093 C C     . PRO A 1 161 ? 34.160 14.773 32.544  1.00 15.27 ? 383 PRO A C     1 
ATOM   1094 O O     . PRO A 1 161 ? 33.682 15.904 32.466  1.00 15.87 ? 383 PRO A O     1 
ATOM   1095 C CB    . PRO A 1 161 ? 36.594 15.252 33.023  1.00 15.78 ? 383 PRO A CB    1 
ATOM   1096 C CG    . PRO A 1 161 ? 37.734 15.551 32.096  1.00 16.70 ? 383 PRO A CG    1 
ATOM   1097 C CD    . PRO A 1 161 ? 37.029 15.971 30.834  1.00 14.94 ? 383 PRO A CD    1 
ATOM   1098 N N     . PRO A 1 162 ? 33.441 13.726 32.979  1.00 14.59 ? 384 PRO A N     1 
ATOM   1099 C CA    . PRO A 1 162 ? 32.049 13.897 33.402  1.00 14.97 ? 384 PRO A CA    1 
ATOM   1100 C C     . PRO A 1 162 ? 31.948 14.843 34.594  1.00 15.91 ? 384 PRO A C     1 
ATOM   1101 O O     . PRO A 1 162 ? 32.824 14.860 35.458  1.00 17.30 ? 384 PRO A O     1 
ATOM   1102 C CB    . PRO A 1 162 ? 31.623 12.478 33.771  1.00 16.89 ? 384 PRO A CB    1 
ATOM   1103 C CG    . PRO A 1 162 ? 32.446 11.632 32.846  1.00 16.09 ? 384 PRO A CG    1 
ATOM   1104 C CD    . PRO A 1 162 ? 33.801 12.298 32.922  1.00 14.92 ? 384 PRO A CD    1 
ATOM   1105 N N     . ARG A 1 163 ? 30.876 15.625 34.636  1.00 17.95 ? 385 ARG A N     1 
ATOM   1106 C CA    . ARG A 1 163 ? 30.659 16.559 35.735  1.00 19.74 ? 385 ARG A CA    1 
ATOM   1107 C C     . ARG A 1 163 ? 30.215 15.772 36.963  1.00 19.53 ? 385 ARG A C     1 
ATOM   1108 O O     . ARG A 1 163 ? 29.751 14.638 36.847  1.00 18.69 ? 385 ARG A O     1 
ATOM   1109 C CB    . ARG A 1 163 ? 29.592 17.583 35.345  1.00 20.23 ? 385 ARG A CB    1 
ATOM   1110 C CG    . ARG A 1 163 ? 29.924 18.333 34.063  1.00 22.73 ? 385 ARG A CG    1 
ATOM   1111 C CD    . ARG A 1 163 ? 28.760 19.180 33.579  1.00 25.96 ? 385 ARG A CD    1 
ATOM   1112 N NE    . ARG A 1 163 ? 28.990 19.676 32.224  1.00 28.53 ? 385 ARG A NE    1 
ATOM   1113 C CZ    . ARG A 1 163 ? 28.097 20.354 31.510  1.00 29.57 ? 385 ARG A CZ    1 
ATOM   1114 N NH1   . ARG A 1 163 ? 26.902 20.624 32.019  1.00 31.13 ? 385 ARG A NH1   1 
ATOM   1115 N NH2   . ARG A 1 163 ? 28.393 20.750 30.281  1.00 31.35 ? 385 ARG A NH2   1 
ATOM   1116 N N     . THR A 1 164 ? 30.352 16.375 38.138  1.00 20.62 ? 386 THR A N     1 
ATOM   1117 C CA    . THR A 1 164 ? 29.973 15.711 39.380  1.00 21.16 ? 386 THR A CA    1 
ATOM   1118 C C     . THR A 1 164 ? 28.528 15.215 39.387  1.00 22.15 ? 386 THR A C     1 
ATOM   1119 O O     . THR A 1 164 ? 28.234 14.154 39.942  1.00 22.01 ? 386 THR A O     1 
ATOM   1120 C CB    . THR A 1 164 ? 30.185 16.640 40.595  1.00 21.54 ? 386 THR A CB    1 
ATOM   1121 O OG1   . THR A 1 164 ? 29.468 17.864 40.396  1.00 21.98 ? 386 THR A OG1   1 
ATOM   1122 C CG2   . THR A 1 164 ? 31.668 16.940 40.784  1.00 21.05 ? 386 THR A CG2   1 
ATOM   1123 N N     . ASN A 1 165 ? 27.626 15.971 38.768  1.00 22.69 ? 387 ASN A N     1 
ATOM   1124 C CA    . ASN A 1 165 ? 26.222 15.575 38.731  1.00 23.62 ? 387 ASN A CA    1 
ATOM   1125 C C     . ASN A 1 165 ? 26.034 14.251 37.993  1.00 22.96 ? 387 ASN A C     1 
ATOM   1126 O O     . ASN A 1 165 ? 25.181 13.442 38.359  1.00 22.80 ? 387 ASN A O     1 
ATOM   1127 C CB    . ASN A 1 165 ? 25.372 16.668 38.074  1.00 26.84 ? 387 ASN A CB    1 
ATOM   1128 C CG    . ASN A 1 165 ? 25.624 16.792 36.585  1.00 29.02 ? 387 ASN A CG    1 
ATOM   1129 O OD1   . ASN A 1 165 ? 25.241 15.921 35.802  1.00 30.86 ? 387 ASN A OD1   1 
ATOM   1130 N ND2   . ASN A 1 165 ? 26.274 17.878 36.186  1.00 29.06 ? 387 ASN A ND2   1 
ATOM   1131 N N     . VAL A 1 166 ? 26.829 14.028 36.953  1.00 20.98 ? 388 VAL A N     1 
ATOM   1132 C CA    . VAL A 1 166 ? 26.734 12.782 36.200  1.00 19.65 ? 388 VAL A CA    1 
ATOM   1133 C C     . VAL A 1 166 ? 27.183 11.632 37.100  1.00 18.14 ? 388 VAL A C     1 
ATOM   1134 O O     . VAL A 1 166 ? 26.538 10.584 37.155  1.00 18.34 ? 388 VAL A O     1 
ATOM   1135 C CB    . VAL A 1 166 ? 27.616 12.822 34.928  1.00 17.84 ? 388 VAL A CB    1 
ATOM   1136 C CG1   . VAL A 1 166 ? 27.633 11.458 34.256  1.00 17.46 ? 388 VAL A CG1   1 
ATOM   1137 C CG2   . VAL A 1 166 ? 27.081 13.869 33.960  1.00 19.90 ? 388 VAL A CG2   1 
ATOM   1138 N N     . LEU A 1 167 ? 28.285 11.837 37.812  1.00 17.13 ? 389 LEU A N     1 
ATOM   1139 C CA    . LEU A 1 167 ? 28.807 10.817 38.714  1.00 17.73 ? 389 LEU A CA    1 
ATOM   1140 C C     . LEU A 1 167 ? 27.788 10.510 39.805  1.00 18.72 ? 389 LEU A C     1 
ATOM   1141 O O     . LEU A 1 167 ? 27.654 9.366  40.244  1.00 19.09 ? 389 LEU A O     1 
ATOM   1142 C CB    . LEU A 1 167 ? 30.113 11.288 39.356  1.00 17.83 ? 389 LEU A CB    1 
ATOM   1143 C CG    . LEU A 1 167 ? 31.269 11.650 38.420  1.00 21.31 ? 389 LEU A CG    1 
ATOM   1144 C CD1   . LEU A 1 167 ? 32.464 12.083 39.255  1.00 21.64 ? 389 LEU A CD1   1 
ATOM   1145 C CD2   . LEU A 1 167 ? 31.633 10.465 37.541  1.00 21.63 ? 389 LEU A CD2   1 
ATOM   1146 N N     . TYR A 1 168 ? 27.073 11.543 40.240  1.00 19.86 ? 390 TYR A N     1 
ATOM   1147 C CA    . TYR A 1 168 ? 26.059 11.396 41.276  1.00 20.79 ? 390 TYR A CA    1 
ATOM   1148 C C     . TYR A 1 168 ? 24.979 10.415 40.835  1.00 22.02 ? 390 TYR A C     1 
ATOM   1149 O O     . TYR A 1 168 ? 24.631 9.493  41.568  1.00 21.76 ? 390 TYR A O     1 
ATOM   1150 C CB    . TYR A 1 168 ? 25.440 12.762 41.591  1.00 22.95 ? 390 TYR A CB    1 
ATOM   1151 C CG    . TYR A 1 168 ? 24.320 12.727 42.608  1.00 25.03 ? 390 TYR A CG    1 
ATOM   1152 C CD1   . TYR A 1 168 ? 22.996 12.518 42.216  1.00 25.67 ? 390 TYR A CD1   1 
ATOM   1153 C CD2   . TYR A 1 168 ? 24.584 12.900 43.967  1.00 26.14 ? 390 TYR A CD2   1 
ATOM   1154 C CE1   . TYR A 1 168 ? 21.962 12.485 43.153  1.00 28.67 ? 390 TYR A CE1   1 
ATOM   1155 C CE2   . TYR A 1 168 ? 23.559 12.868 44.911  1.00 28.06 ? 390 TYR A CE2   1 
ATOM   1156 C CZ    . TYR A 1 168 ? 22.254 12.662 44.498  1.00 29.11 ? 390 TYR A CZ    1 
ATOM   1157 O OH    . TYR A 1 168 ? 21.242 12.646 45.431  1.00 31.82 ? 390 TYR A OH    1 
ATOM   1158 N N     . GLU A 1 169 ? 24.462 10.613 39.627  1.00 21.08 ? 391 GLU A N     1 
ATOM   1159 C CA    . GLU A 1 169 ? 23.421 9.747  39.086  1.00 21.24 ? 391 GLU A CA    1 
ATOM   1160 C C     . GLU A 1 169 ? 23.919 8.352  38.714  1.00 20.07 ? 391 GLU A C     1 
ATOM   1161 O O     . GLU A 1 169 ? 23.157 7.387  38.739  1.00 20.66 ? 391 GLU A O     1 
ATOM   1162 C CB    . GLU A 1 169 ? 22.786 10.402 37.856  1.00 22.89 ? 391 GLU A CB    1 
ATOM   1163 C CG    . GLU A 1 169 ? 21.974 11.640 38.174  1.00 26.39 ? 391 GLU A CG    1 
ATOM   1164 C CD    . GLU A 1 169 ? 20.825 11.346 39.115  1.00 29.31 ? 391 GLU A CD    1 
ATOM   1165 O OE1   . GLU A 1 169 ? 19.975 10.498 38.771  1.00 30.98 ? 391 GLU A OE1   1 
ATOM   1166 O OE2   . GLU A 1 169 ? 20.774 11.960 40.200  1.00 31.34 ? 391 GLU A OE2   1 
ATOM   1167 N N     . LEU A 1 170 ? 25.197 8.243  38.371  1.00 19.39 ? 392 LEU A N     1 
ATOM   1168 C CA    . LEU A 1 170 ? 25.769 6.957  37.983  1.00 19.57 ? 392 LEU A CA    1 
ATOM   1169 C C     . LEU A 1 170 ? 26.071 6.030  39.162  1.00 17.62 ? 392 LEU A C     1 
ATOM   1170 O O     . LEU A 1 170 ? 26.042 4.806  39.018  1.00 17.90 ? 392 LEU A O     1 
ATOM   1171 C CB    . LEU A 1 170 ? 27.052 7.178  37.173  1.00 20.98 ? 392 LEU A CB    1 
ATOM   1172 C CG    . LEU A 1 170 ? 26.883 7.781  35.776  1.00 23.75 ? 392 LEU A CG    1 
ATOM   1173 C CD1   . LEU A 1 170 ? 28.250 8.001  35.145  1.00 24.88 ? 392 LEU A CD1   1 
ATOM   1174 C CD2   . LEU A 1 170 ? 26.041 6.849  34.914  1.00 24.03 ? 392 LEU A CD2   1 
ATOM   1175 N N     . ALA A 1 171 ? 26.349 6.611  40.324  1.00 18.39 ? 393 ALA A N     1 
ATOM   1176 C CA    . ALA A 1 171 ? 26.687 5.824  41.508  1.00 18.88 ? 393 ALA A CA    1 
ATOM   1177 C C     . ALA A 1 171 ? 25.733 4.669  41.804  1.00 18.72 ? 393 ALA A C     1 
ATOM   1178 O O     . ALA A 1 171 ? 26.170 3.576  42.163  1.00 19.24 ? 393 ALA A O     1 
ATOM   1179 C CB    . ALA A 1 171 ? 26.792 6.736  42.725  1.00 18.48 ? 393 ALA A CB    1 
ATOM   1180 N N     . GLN A 1 172 ? 24.436 4.910  41.648  1.00 18.84 ? 394 GLN A N     1 
ATOM   1181 C CA    . GLN A 1 172 ? 23.421 3.891  41.911  1.00 19.69 ? 394 GLN A CA    1 
ATOM   1182 C C     . GLN A 1 172 ? 23.603 2.618  41.088  1.00 19.32 ? 394 GLN A C     1 
ATOM   1183 O O     . GLN A 1 172 ? 23.132 1.552  41.474  1.00 21.45 ? 394 GLN A O     1 
ATOM   1184 C CB    . GLN A 1 172 ? 22.026 4.462  41.640  1.00 20.81 ? 394 GLN A CB    1 
ATOM   1185 C CG    . GLN A 1 172 ? 21.889 5.085  40.258  1.00 22.00 ? 394 GLN A CG    1 
ATOM   1186 C CD    . GLN A 1 172 ? 20.493 5.611  39.962  1.00 23.79 ? 394 GLN A CD    1 
ATOM   1187 O OE1   . GLN A 1 172 ? 20.330 6.554  39.187  1.00 27.02 ? 394 GLN A OE1   1 
ATOM   1188 N NE2   . GLN A 1 172 ? 19.481 4.997  40.564  1.00 24.65 ? 394 GLN A NE2   1 
ATOM   1189 N N     . TYR A 1 173 ? 24.298 2.725  39.961  1.00 17.28 ? 395 TYR A N     1 
ATOM   1190 C CA    . TYR A 1 173 ? 24.487 1.576  39.085  1.00 15.56 ? 395 TYR A CA    1 
ATOM   1191 C C     . TYR A 1 173 ? 25.773 0.781  39.292  1.00 14.32 ? 395 TYR A C     1 
ATOM   1192 O O     . TYR A 1 173 ? 26.079 -0.123 38.509  1.00 15.81 ? 395 TYR A O     1 
ATOM   1193 C CB    . TYR A 1 173 ? 24.388 2.030  37.631  1.00 16.10 ? 395 TYR A CB    1 
ATOM   1194 C CG    . TYR A 1 173 ? 23.070 2.692  37.287  1.00 16.60 ? 395 TYR A CG    1 
ATOM   1195 C CD1   . TYR A 1 173 ? 21.875 1.976  37.323  1.00 18.28 ? 395 TYR A CD1   1 
ATOM   1196 C CD2   . TYR A 1 173 ? 23.024 4.031  36.899  1.00 17.75 ? 395 TYR A CD2   1 
ATOM   1197 C CE1   . TYR A 1 173 ? 20.662 2.579  36.975  1.00 18.05 ? 395 TYR A CE1   1 
ATOM   1198 C CE2   . TYR A 1 173 ? 21.825 4.641  36.549  1.00 18.18 ? 395 TYR A CE2   1 
ATOM   1199 C CZ    . TYR A 1 173 ? 20.650 3.910  36.586  1.00 18.16 ? 395 TYR A CZ    1 
ATOM   1200 O OH    . TYR A 1 173 ? 19.468 4.505  36.211  1.00 19.50 ? 395 TYR A OH    1 
ATOM   1201 N N     . ALA A 1 174 ? 26.528 1.122  40.329  1.00 14.19 ? 396 ALA A N     1 
ATOM   1202 C CA    . ALA A 1 174 ? 27.759 0.405  40.643  1.00 14.24 ? 396 ALA A CA    1 
ATOM   1203 C C     . ALA A 1 174 ? 27.388 -0.587 41.744  1.00 14.84 ? 396 ALA A C     1 
ATOM   1204 O O     . ALA A 1 174 ? 27.084 -0.189 42.865  1.00 16.20 ? 396 ALA A O     1 
ATOM   1205 C CB    . ALA A 1 174 ? 28.827 1.371  41.135  1.00 14.11 ? 396 ALA A CB    1 
ATOM   1206 N N     . SER A 1 175 ? 27.408 -1.875 41.414  1.00 15.07 ? 397 SER A N     1 
ATOM   1207 C CA    . SER A 1 175 ? 27.031 -2.920 42.363  1.00 16.52 ? 397 SER A CA    1 
ATOM   1208 C C     . SER A 1 175 ? 28.078 -3.271 43.418  1.00 17.94 ? 397 SER A C     1 
ATOM   1209 O O     . SER A 1 175 ? 27.759 -3.924 44.412  1.00 18.04 ? 397 SER A O     1 
ATOM   1210 C CB    . SER A 1 175 ? 26.614 -4.181 41.605  1.00 19.03 ? 397 SER A CB    1 
ATOM   1211 O OG    . SER A 1 175 ? 27.648 -4.634 40.754  1.00 20.51 ? 397 SER A OG    1 
ATOM   1212 N N     . GLU A 1 176 ? 29.323 -2.862 43.200  1.00 15.35 ? 398 GLU A N     1 
ATOM   1213 C CA    . GLU A 1 176 ? 30.382 -3.108 44.170  1.00 17.58 ? 398 GLU A CA    1 
ATOM   1214 C C     . GLU A 1 176 ? 30.320 -1.918 45.123  1.00 16.38 ? 398 GLU A C     1 
ATOM   1215 O O     . GLU A 1 176 ? 30.558 -0.783 44.722  1.00 16.56 ? 398 GLU A O     1 
ATOM   1216 C CB    . GLU A 1 176 ? 31.742 -3.171 43.469  1.00 19.50 ? 398 GLU A CB    1 
ATOM   1217 C CG    . GLU A 1 176 ? 32.954 -3.051 44.389  1.00 26.56 ? 398 GLU A CG    1 
ATOM   1218 C CD    . GLU A 1 176 ? 32.930 -4.032 45.542  1.00 29.65 ? 398 GLU A CD    1 
ATOM   1219 O OE1   . GLU A 1 176 ? 32.762 -5.245 45.296  1.00 32.10 ? 398 GLU A OE1   1 
ATOM   1220 O OE2   . GLU A 1 176 ? 33.087 -3.585 46.697  1.00 31.91 ? 398 GLU A OE2   1 
ATOM   1221 N N     . PRO A 1 177 ? 29.981 -2.161 46.397  1.00 16.55 ? 399 PRO A N     1 
ATOM   1222 C CA    . PRO A 1 177 ? 29.896 -1.062 47.360  1.00 16.84 ? 399 PRO A CA    1 
ATOM   1223 C C     . PRO A 1 177 ? 31.058 -0.075 47.362  1.00 16.47 ? 399 PRO A C     1 
ATOM   1224 O O     . PRO A 1 177 ? 30.836 1.132  47.379  1.00 17.39 ? 399 PRO A O     1 
ATOM   1225 C CB    . PRO A 1 177 ? 29.740 -1.791 48.689  1.00 16.36 ? 399 PRO A CB    1 
ATOM   1226 C CG    . PRO A 1 177 ? 28.902 -2.971 48.293  1.00 17.45 ? 399 PRO A CG    1 
ATOM   1227 C CD    . PRO A 1 177 ? 29.581 -3.436 47.022  1.00 16.91 ? 399 PRO A CD    1 
ATOM   1228 N N     . SER A 1 178 ? 32.289 -0.576 47.344  1.00 16.77 ? 400 SER A N     1 
ATOM   1229 C CA    . SER A 1 178 ? 33.449 0.309  47.359  1.00 18.21 ? 400 SER A CA    1 
ATOM   1230 C C     . SER A 1 178 ? 33.443 1.265  46.169  1.00 17.69 ? 400 SER A C     1 
ATOM   1231 O O     . SER A 1 178 ? 33.820 2.429  46.303  1.00 17.61 ? 400 SER A O     1 
ATOM   1232 C CB    . SER A 1 178 ? 34.747 -0.502 47.370  1.00 19.70 ? 400 SER A CB    1 
ATOM   1233 O OG    . SER A 1 178 ? 34.857 -1.319 46.222  1.00 24.25 ? 400 SER A OG    1 
ATOM   1234 N N     . GLU A 1 179 ? 33.017 0.777  45.007  1.00 16.94 ? 401 GLU A N     1 
ATOM   1235 C CA    . GLU A 1 179 ? 32.973 1.616  43.813  1.00 16.82 ? 401 GLU A CA    1 
ATOM   1236 C C     . GLU A 1 179 ? 31.839 2.631  43.889  1.00 17.33 ? 401 GLU A C     1 
ATOM   1237 O O     . GLU A 1 179 ? 32.000 3.778  43.481  1.00 18.21 ? 401 GLU A O     1 
ATOM   1238 C CB    . GLU A 1 179 ? 32.849 0.745  42.564  1.00 16.59 ? 401 GLU A CB    1 
ATOM   1239 C CG    . GLU A 1 179 ? 34.076 -0.135 42.369  1.00 16.20 ? 401 GLU A CG    1 
ATOM   1240 C CD    . GLU A 1 179 ? 34.017 -1.003 41.131  1.00 19.51 ? 401 GLU A CD    1 
ATOM   1241 O OE1   . GLU A 1 179 ? 34.953 -1.808 40.933  1.00 21.44 ? 401 GLU A OE1   1 
ATOM   1242 O OE2   . GLU A 1 179 ? 33.050 -0.886 40.356  1.00 17.88 ? 401 GLU A OE2   1 
ATOM   1243 N N     . GLN A 1 180 ? 30.695 2.215  44.423  1.00 16.92 ? 402 GLN A N     1 
ATOM   1244 C CA    . GLN A 1 180 ? 29.575 3.130  44.565  1.00 16.34 ? 402 GLN A CA    1 
ATOM   1245 C C     . GLN A 1 180 ? 29.998 4.236  45.532  1.00 17.49 ? 402 GLN A C     1 
ATOM   1246 O O     . GLN A 1 180 ? 29.683 5.410  45.329  1.00 16.40 ? 402 GLN A O     1 
ATOM   1247 C CB    . GLN A 1 180 ? 28.351 2.394  45.113  1.00 17.62 ? 402 GLN A CB    1 
ATOM   1248 C CG    . GLN A 1 180 ? 27.080 3.223  45.093  1.00 21.26 ? 402 GLN A CG    1 
ATOM   1249 C CD    . GLN A 1 180 ? 25.869 2.440  45.548  1.00 23.47 ? 402 GLN A CD    1 
ATOM   1250 O OE1   . GLN A 1 180 ? 25.682 2.202  46.740  1.00 23.24 ? 402 GLN A OE1   1 
ATOM   1251 N NE2   . GLN A 1 180 ? 25.043 2.021  44.595  1.00 23.60 ? 402 GLN A NE2   1 
ATOM   1252 N N     . GLU A 1 181 ? 30.718 3.846  46.581  1.00 18.04 ? 403 GLU A N     1 
ATOM   1253 C CA    . GLU A 1 181 ? 31.205 4.789  47.583  1.00 19.34 ? 403 GLU A CA    1 
ATOM   1254 C C     . GLU A 1 181 ? 32.162 5.793  46.950  1.00 18.54 ? 403 GLU A C     1 
ATOM   1255 O O     . GLU A 1 181 ? 32.086 6.991  47.227  1.00 18.04 ? 403 GLU A O     1 
ATOM   1256 C CB    . GLU A 1 181 ? 31.933 4.043  48.706  1.00 21.45 ? 403 GLU A CB    1 
ATOM   1257 C CG    . GLU A 1 181 ? 31.050 3.129  49.534  1.00 27.49 ? 403 GLU A CG    1 
ATOM   1258 C CD    . GLU A 1 181 ? 31.821 2.415  50.629  1.00 31.68 ? 403 GLU A CD    1 
ATOM   1259 O OE1   . GLU A 1 181 ? 32.468 3.106  51.447  1.00 33.47 ? 403 GLU A OE1   1 
ATOM   1260 O OE2   . GLU A 1 181 ? 31.780 1.164  50.673  1.00 32.94 ? 403 GLU A OE2   1 
ATOM   1261 N N     . LEU A 1 182 ? 33.059 5.296  46.103  1.00 17.51 ? 404 LEU A N     1 
ATOM   1262 C CA    . LEU A 1 182 ? 34.036 6.145  45.428  1.00 17.47 ? 404 LEU A CA    1 
ATOM   1263 C C     . LEU A 1 182 ? 33.330 7.184  44.563  1.00 17.18 ? 404 LEU A C     1 
ATOM   1264 O O     . LEU A 1 182 ? 33.650 8.369  44.613  1.00 16.94 ? 404 LEU A O     1 
ATOM   1265 C CB    . LEU A 1 182 ? 34.959 5.295  44.549  1.00 19.04 ? 404 LEU A CB    1 
ATOM   1266 C CG    . LEU A 1 182 ? 36.142 6.020  43.901  1.00 20.81 ? 404 LEU A CG    1 
ATOM   1267 C CD1   . LEU A 1 182 ? 37.162 6.373  44.975  1.00 22.07 ? 404 LEU A CD1   1 
ATOM   1268 C CD2   . LEU A 1 182 ? 36.784 5.130  42.842  1.00 21.05 ? 404 LEU A CD2   1 
ATOM   1269 N N     . LEU A 1 183 ? 32.362 6.733  43.771  1.00 15.80 ? 405 LEU A N     1 
ATOM   1270 C CA    . LEU A 1 183 ? 31.624 7.634  42.894  1.00 16.52 ? 405 LEU A CA    1 
ATOM   1271 C C     . LEU A 1 183 ? 30.819 8.666  43.681  1.00 17.46 ? 405 LEU A C     1 
ATOM   1272 O O     . LEU A 1 183 ? 30.795 9.848  43.322  1.00 17.66 ? 405 LEU A O     1 
ATOM   1273 C CB    . LEU A 1 183 ? 30.708 6.829  41.965  1.00 16.37 ? 405 LEU A CB    1 
ATOM   1274 C CG    . LEU A 1 183 ? 31.460 5.925  40.977  1.00 14.97 ? 405 LEU A CG    1 
ATOM   1275 C CD1   . LEU A 1 183 ? 30.493 4.976  40.302  1.00 16.90 ? 405 LEU A CD1   1 
ATOM   1276 C CD2   . LEU A 1 183 ? 32.190 6.779  39.941  1.00 16.99 ? 405 LEU A CD2   1 
ATOM   1277 N N     . ARG A 1 184 ? 30.164 8.232  44.755  1.00 16.34 ? 406 ARG A N     1 
ATOM   1278 C CA    . ARG A 1 184 ? 29.383 9.152  45.574  1.00 17.19 ? 406 ARG A CA    1 
ATOM   1279 C C     . ARG A 1 184 ? 30.296 10.179 46.230  1.00 17.01 ? 406 ARG A C     1 
ATOM   1280 O O     . ARG A 1 184 ? 29.940 11.351 46.340  1.00 18.31 ? 406 ARG A O     1 
ATOM   1281 C CB    . ARG A 1 184 ? 28.602 8.398  46.653  1.00 18.81 ? 406 ARG A CB    1 
ATOM   1282 C CG    . ARG A 1 184 ? 27.459 7.556  46.116  1.00 24.24 ? 406 ARG A CG    1 
ATOM   1283 C CD    . ARG A 1 184 ? 26.430 7.279  47.204  1.00 27.63 ? 406 ARG A CD    1 
ATOM   1284 N NE    . ARG A 1 184 ? 27.040 6.719  48.406  1.00 30.48 ? 406 ARG A NE    1 
ATOM   1285 C CZ    . ARG A 1 184 ? 26.378 6.453  49.528  1.00 31.67 ? 406 ARG A CZ    1 
ATOM   1286 N NH1   . ARG A 1 184 ? 25.077 6.697  49.609  1.00 31.39 ? 406 ARG A NH1   1 
ATOM   1287 N NH2   . ARG A 1 184 ? 27.020 5.945  50.572  1.00 31.81 ? 406 ARG A NH2   1 
ATOM   1288 N N     . LYS A 1 185 ? 31.474 9.734  46.654  1.00 17.00 ? 407 LYS A N     1 
ATOM   1289 C CA    . LYS A 1 185 ? 32.443 10.612 47.294  1.00 17.51 ? 407 LYS A CA    1 
ATOM   1290 C C     . LYS A 1 185 ? 32.922 11.707 46.342  1.00 17.92 ? 407 LYS A C     1 
ATOM   1291 O O     . LYS A 1 185 ? 32.933 12.884 46.697  1.00 17.72 ? 407 LYS A O     1 
ATOM   1292 C CB    . LYS A 1 185 ? 33.637 9.795  47.800  1.00 18.16 ? 407 LYS A CB    1 
ATOM   1293 C CG    . LYS A 1 185 ? 34.748 10.630 48.428  1.00 19.57 ? 407 LYS A CG    1 
ATOM   1294 C CD    . LYS A 1 185 ? 35.869 9.755  48.978  1.00 22.40 ? 407 LYS A CD    1 
ATOM   1295 C CE    . LYS A 1 185 ? 36.987 10.594 49.581  1.00 24.06 ? 407 LYS A CE    1 
ATOM   1296 N NZ    . LYS A 1 185 ? 38.085 9.739  50.119  1.00 26.53 ? 407 LYS A NZ    1 
ATOM   1297 N N     . MET A 1 186 ? 33.311 11.326 45.129  1.00 18.25 ? 408 MET A N     1 
ATOM   1298 C CA    . MET A 1 186 ? 33.791 12.307 44.161  1.00 18.25 ? 408 MET A CA    1 
ATOM   1299 C C     . MET A 1 186 ? 32.699 13.242 43.669  1.00 18.42 ? 408 MET A C     1 
ATOM   1300 O O     . MET A 1 186 ? 32.991 14.320 43.154  1.00 19.65 ? 408 MET A O     1 
ATOM   1301 C CB    . MET A 1 186 ? 34.430 11.606 42.968  1.00 19.16 ? 408 MET A CB    1 
ATOM   1302 C CG    . MET A 1 186 ? 35.630 10.775 43.339  1.00 19.48 ? 408 MET A CG    1 
ATOM   1303 S SD    . MET A 1 186 ? 36.475 10.185 41.881  1.00 20.63 ? 408 MET A SD    1 
ATOM   1304 C CE    . MET A 1 186 ? 35.297 8.991  41.291  1.00 19.07 ? 408 MET A CE    1 
ATOM   1305 N N     . ALA A 1 187 ? 31.445 12.833 43.827  1.00 18.45 ? 409 ALA A N     1 
ATOM   1306 C CA    . ALA A 1 187 ? 30.322 13.653 43.397  1.00 19.48 ? 409 ALA A CA    1 
ATOM   1307 C C     . ALA A 1 187 ? 29.832 14.550 44.527  1.00 20.66 ? 409 ALA A C     1 
ATOM   1308 O O     . ALA A 1 187 ? 29.039 15.465 44.304  1.00 22.48 ? 409 ALA A O     1 
ATOM   1309 C CB    . ALA A 1 187 ? 29.187 12.763 42.906  1.00 18.61 ? 409 ALA A CB    1 
ATOM   1310 N N     . SER A 1 188 ? 30.311 14.289 45.738  1.00 21.15 ? 410 SER A N     1 
ATOM   1311 C CA    . SER A 1 188 ? 29.898 15.064 46.904  1.00 22.68 ? 410 SER A CA    1 
ATOM   1312 C C     . SER A 1 188 ? 30.680 16.356 47.058  1.00 22.77 ? 410 SER A C     1 
ATOM   1313 O O     . SER A 1 188 ? 31.630 16.622 46.322  1.00 21.42 ? 410 SER A O     1 
ATOM   1314 C CB    . SER A 1 188 ? 30.075 14.243 48.179  1.00 21.72 ? 410 SER A CB    1 
ATOM   1315 O OG    . SER A 1 188 ? 31.444 14.178 48.536  1.00 22.82 ? 410 SER A OG    1 
ATOM   1316 N N     . SER A 1 189 ? 30.274 17.147 48.043  1.00 23.14 ? 411 SER A N     1 
ATOM   1317 C CA    . SER A 1 189 ? 30.921 18.418 48.322  1.00 23.53 ? 411 SER A CA    1 
ATOM   1318 C C     . SER A 1 189 ? 31.854 18.317 49.525  1.00 22.96 ? 411 SER A C     1 
ATOM   1319 O O     . SER A 1 189 ? 32.243 19.334 50.096  1.00 23.87 ? 411 SER A O     1 
ATOM   1320 C CB    . SER A 1 189 ? 29.863 19.495 48.571  1.00 24.87 ? 411 SER A CB    1 
ATOM   1321 O OG    . SER A 1 189 ? 28.964 19.093 49.591  1.00 28.75 ? 411 SER A OG    1 
ATOM   1322 N N     . SER A 1 190 ? 32.215 17.096 49.911  1.00 21.95 ? 412 SER A N     1 
ATOM   1323 C CA    . SER A 1 190 ? 33.113 16.921 51.046  1.00 20.89 ? 412 SER A CA    1 
ATOM   1324 C C     . SER A 1 190 ? 34.505 17.377 50.632  1.00 20.77 ? 412 SER A C     1 
ATOM   1325 O O     . SER A 1 190 ? 34.832 17.399 49.443  1.00 20.17 ? 412 SER A O     1 
ATOM   1326 C CB    . SER A 1 190 ? 33.163 15.456 51.489  1.00 20.28 ? 412 SER A CB    1 
ATOM   1327 O OG    . SER A 1 190 ? 33.875 14.657 50.557  1.00 20.06 ? 412 SER A OG    1 
ATOM   1328 N N     . GLY A 1 191 ? 35.320 17.745 51.614  1.00 20.87 ? 413 GLY A N     1 
ATOM   1329 C CA    . GLY A 1 191 ? 36.665 18.204 51.321  1.00 22.09 ? 413 GLY A CA    1 
ATOM   1330 C C     . GLY A 1 191 ? 37.490 17.202 50.537  1.00 21.87 ? 413 GLY A C     1 
ATOM   1331 O O     . GLY A 1 191 ? 38.045 17.531 49.485  1.00 21.03 ? 413 GLY A O     1 
ATOM   1332 N N     . GLU A 1 192 ? 37.576 15.976 51.044  1.00 20.89 ? 414 GLU A N     1 
ATOM   1333 C CA    . GLU A 1 192 ? 38.350 14.941 50.375  1.00 20.89 ? 414 GLU A CA    1 
ATOM   1334 C C     . GLU A 1 192 ? 37.694 14.529 49.061  1.00 20.97 ? 414 GLU A C     1 
ATOM   1335 O O     . GLU A 1 192 ? 38.377 14.111 48.126  1.00 20.48 ? 414 GLU A O     1 
ATOM   1336 C CB    . GLU A 1 192 ? 38.508 13.721 51.285  1.00 22.05 ? 414 GLU A CB    1 
ATOM   1337 C CG    . GLU A 1 192 ? 39.124 14.044 52.638  1.00 23.87 ? 414 GLU A CG    1 
ATOM   1338 C CD    . GLU A 1 192 ? 39.494 12.802 53.420  1.00 24.97 ? 414 GLU A CD    1 
ATOM   1339 O OE1   . GLU A 1 192 ? 38.766 11.795 53.312  1.00 26.38 ? 414 GLU A OE1   1 
ATOM   1340 O OE2   . GLU A 1 192 ? 40.505 12.836 54.152  1.00 27.08 ? 414 GLU A OE2   1 
ATOM   1341 N N     . GLY A 1 193 ? 36.370 14.650 48.997  1.00 19.62 ? 415 GLY A N     1 
ATOM   1342 C CA    . GLY A 1 193 ? 35.651 14.293 47.787  1.00 19.90 ? 415 GLY A CA    1 
ATOM   1343 C C     . GLY A 1 193 ? 36.030 15.206 46.639  1.00 19.55 ? 415 GLY A C     1 
ATOM   1344 O O     . GLY A 1 193 ? 36.257 14.750 45.517  1.00 20.59 ? 415 GLY A O     1 
ATOM   1345 N N     . LYS A 1 194 ? 36.099 16.504 46.915  1.00 20.16 ? 416 LYS A N     1 
ATOM   1346 C CA    . LYS A 1 194 ? 36.463 17.475 45.889  1.00 19.72 ? 416 LYS A CA    1 
ATOM   1347 C C     . LYS A 1 194 ? 37.891 17.256 45.398  1.00 19.99 ? 416 LYS A C     1 
ATOM   1348 O O     . LYS A 1 194 ? 38.166 17.388 44.206  1.00 18.83 ? 416 LYS A O     1 
ATOM   1349 C CB    . LYS A 1 194 ? 36.302 18.901 46.428  1.00 21.31 ? 416 LYS A CB    1 
ATOM   1350 C CG    . LYS A 1 194 ? 34.856 19.285 46.711  1.00 21.98 ? 416 LYS A CG    1 
ATOM   1351 C CD    . LYS A 1 194 ? 34.747 20.702 47.264  1.00 23.98 ? 416 LYS A CD    1 
ATOM   1352 C CE    . LYS A 1 194 ? 33.301 21.062 47.572  1.00 26.73 ? 416 LYS A CE    1 
ATOM   1353 N NZ    . LYS A 1 194 ? 33.155 22.450 48.101  1.00 28.31 ? 416 LYS A NZ    1 
ATOM   1354 N N     . GLU A 1 195 ? 38.797 16.916 46.310  1.00 19.67 ? 417 GLU A N     1 
ATOM   1355 C CA    . GLU A 1 195 ? 40.184 16.674 45.928  1.00 21.17 ? 417 GLU A CA    1 
ATOM   1356 C C     . GLU A 1 195 ? 40.307 15.404 45.090  1.00 20.27 ? 417 GLU A C     1 
ATOM   1357 O O     . GLU A 1 195 ? 41.118 15.339 44.167  1.00 19.48 ? 417 GLU A O     1 
ATOM   1358 C CB    . GLU A 1 195 ? 41.077 16.568 47.168  1.00 22.62 ? 417 GLU A CB    1 
ATOM   1359 C CG    . GLU A 1 195 ? 41.400 17.902 47.833  1.00 26.25 ? 417 GLU A CG    1 
ATOM   1360 C CD    . GLU A 1 195 ? 42.134 18.862 46.909  1.00 28.54 ? 417 GLU A CD    1 
ATOM   1361 O OE1   . GLU A 1 195 ? 43.156 18.460 46.309  1.00 29.62 ? 417 GLU A OE1   1 
ATOM   1362 O OE2   . GLU A 1 195 ? 41.695 20.027 46.786  1.00 30.08 ? 417 GLU A OE2   1 
ATOM   1363 N N     . LEU A 1 196 ? 39.500 14.397 45.407  1.00 18.84 ? 418 LEU A N     1 
ATOM   1364 C CA    . LEU A 1 196 ? 39.542 13.144 44.663  1.00 19.07 ? 418 LEU A CA    1 
ATOM   1365 C C     . LEU A 1 196 ? 38.994 13.352 43.255  1.00 18.57 ? 418 LEU A C     1 
ATOM   1366 O O     . LEU A 1 196 ? 39.542 12.832 42.281  1.00 18.59 ? 418 LEU A O     1 
ATOM   1367 C CB    . LEU A 1 196 ? 38.736 12.064 45.386  1.00 18.58 ? 418 LEU A CB    1 
ATOM   1368 C CG    . LEU A 1 196 ? 38.773 10.665 44.758  1.00 19.57 ? 418 LEU A CG    1 
ATOM   1369 C CD1   . LEU A 1 196 ? 40.212 10.188 44.624  1.00 19.77 ? 418 LEU A CD1   1 
ATOM   1370 C CD2   . LEU A 1 196 ? 37.972 9.699  45.619  1.00 20.78 ? 418 LEU A CD2   1 
ATOM   1371 N N     . TYR A 1 197 ? 37.910 14.112 43.147  1.00 16.76 ? 419 TYR A N     1 
ATOM   1372 C CA    . TYR A 1 197 ? 37.316 14.391 41.848  1.00 17.38 ? 419 TYR A CA    1 
ATOM   1373 C C     . TYR A 1 197 ? 38.327 15.150 40.990  1.00 18.27 ? 419 TYR A C     1 
ATOM   1374 O O     . TYR A 1 197 ? 38.534 14.827 39.819  1.00 17.50 ? 419 TYR A O     1 
ATOM   1375 C CB    . TYR A 1 197 ? 36.044 15.229 42.011  1.00 17.18 ? 419 TYR A CB    1 
ATOM   1376 C CG    . TYR A 1 197 ? 35.425 15.651 40.699  1.00 17.60 ? 419 TYR A CG    1 
ATOM   1377 C CD1   . TYR A 1 197 ? 34.696 14.747 39.922  1.00 17.67 ? 419 TYR A CD1   1 
ATOM   1378 C CD2   . TYR A 1 197 ? 35.610 16.942 40.208  1.00 17.48 ? 419 TYR A CD2   1 
ATOM   1379 C CE1   . TYR A 1 197 ? 34.173 15.120 38.688  1.00 17.43 ? 419 TYR A CE1   1 
ATOM   1380 C CE2   . TYR A 1 197 ? 35.093 17.323 38.974  1.00 18.49 ? 419 TYR A CE2   1 
ATOM   1381 C CZ    . TYR A 1 197 ? 34.380 16.408 38.218  1.00 18.76 ? 419 TYR A CZ    1 
ATOM   1382 O OH    . TYR A 1 197 ? 33.898 16.775 36.983  1.00 19.65 ? 419 TYR A OH    1 
ATOM   1383 N N     . LEU A 1 198 ? 38.965 16.152 41.586  1.00 18.62 ? 420 LEU A N     1 
ATOM   1384 C CA    . LEU A 1 198 ? 39.952 16.960 40.879  1.00 19.02 ? 420 LEU A CA    1 
ATOM   1385 C C     . LEU A 1 198 ? 41.118 16.128 40.360  1.00 19.34 ? 420 LEU A C     1 
ATOM   1386 O O     . LEU A 1 198 ? 41.551 16.289 39.220  1.00 19.69 ? 420 LEU A O     1 
ATOM   1387 C CB    . LEU A 1 198 ? 40.487 18.057 41.804  1.00 20.14 ? 420 LEU A CB    1 
ATOM   1388 C CG    . LEU A 1 198 ? 41.618 18.912 41.227  1.00 21.41 ? 420 LEU A CG    1 
ATOM   1389 C CD1   . LEU A 1 198 ? 41.118 19.660 39.997  1.00 21.68 ? 420 LEU A CD1   1 
ATOM   1390 C CD2   . LEU A 1 198 ? 42.116 19.887 42.284  1.00 22.62 ? 420 LEU A CD2   1 
ATOM   1391 N N     . SER A 1 199 ? 41.622 15.232 41.199  1.00 19.07 ? 421 SER A N     1 
ATOM   1392 C CA    . SER A 1 199 ? 42.747 14.390 40.828  1.00 19.55 ? 421 SER A CA    1 
ATOM   1393 C C     . SER A 1 199 ? 42.379 13.188 39.957  1.00 19.00 ? 421 SER A C     1 
ATOM   1394 O O     . SER A 1 199 ? 43.012 12.939 38.932  1.00 19.35 ? 421 SER A O     1 
ATOM   1395 C CB    . SER A 1 199 ? 43.457 13.898 42.095  1.00 22.16 ? 421 SER A CB    1 
ATOM   1396 O OG    . SER A 1 199 ? 44.461 12.948 41.783  1.00 24.95 ? 421 SER A OG    1 
ATOM   1397 N N     . TRP A 1 200 ? 41.341 12.465 40.364  1.00 17.90 ? 422 TRP A N     1 
ATOM   1398 C CA    . TRP A 1 200 ? 40.913 11.251 39.677  1.00 16.49 ? 422 TRP A CA    1 
ATOM   1399 C C     . TRP A 1 200 ? 40.126 11.437 38.378  1.00 14.84 ? 422 TRP A C     1 
ATOM   1400 O O     . TRP A 1 200 ? 40.298 10.662 37.436  1.00 15.52 ? 422 TRP A O     1 
ATOM   1401 C CB    . TRP A 1 200 ? 40.098 10.393 40.651  1.00 16.86 ? 422 TRP A CB    1 
ATOM   1402 C CG    . TRP A 1 200 ? 40.105 8.931  40.330  1.00 17.98 ? 422 TRP A CG    1 
ATOM   1403 C CD1   . TRP A 1 200 ? 41.093 8.032  40.615  1.00 18.94 ? 422 TRP A CD1   1 
ATOM   1404 C CD2   . TRP A 1 200 ? 39.076 8.199  39.658  1.00 17.06 ? 422 TRP A CD2   1 
ATOM   1405 N NE1   . TRP A 1 200 ? 40.742 6.783  40.162  1.00 20.58 ? 422 TRP A NE1   1 
ATOM   1406 C CE2   . TRP A 1 200 ? 39.507 6.856  39.570  1.00 18.40 ? 422 TRP A CE2   1 
ATOM   1407 C CE3   . TRP A 1 200 ? 37.829 8.547  39.119  1.00 16.83 ? 422 TRP A CE3   1 
ATOM   1408 C CZ2   . TRP A 1 200 ? 38.736 5.859  38.966  1.00 18.52 ? 422 TRP A CZ2   1 
ATOM   1409 C CZ3   . TRP A 1 200 ? 37.061 7.554  38.517  1.00 15.61 ? 422 TRP A CZ3   1 
ATOM   1410 C CH2   . TRP A 1 200 ? 37.520 6.225  38.447  1.00 17.81 ? 422 TRP A CH2   1 
ATOM   1411 N N     . VAL A 1 201 ? 39.265 12.448 38.322  1.00 14.20 ? 423 VAL A N     1 
ATOM   1412 C CA    . VAL A 1 201 ? 38.467 12.676 37.118  1.00 14.68 ? 423 VAL A CA    1 
ATOM   1413 C C     . VAL A 1 201 ? 39.016 13.790 36.229  1.00 15.87 ? 423 VAL A C     1 
ATOM   1414 O O     . VAL A 1 201 ? 39.371 13.556 35.074  1.00 15.23 ? 423 VAL A O     1 
ATOM   1415 C CB    . VAL A 1 201 ? 36.992 13.010 37.472  1.00 14.85 ? 423 VAL A CB    1 
ATOM   1416 C CG1   . VAL A 1 201 ? 36.199 13.311 36.207  1.00 15.20 ? 423 VAL A CG1   1 
ATOM   1417 C CG2   . VAL A 1 201 ? 36.354 11.842 38.221  1.00 15.15 ? 423 VAL A CG2   1 
ATOM   1418 N N     . VAL A 1 202 ? 39.096 14.999 36.772  1.00 17.63 ? 424 VAL A N     1 
ATOM   1419 C CA    . VAL A 1 202 ? 39.564 16.148 36.000  1.00 19.38 ? 424 VAL A CA    1 
ATOM   1420 C C     . VAL A 1 202 ? 41.024 16.121 35.551  1.00 19.18 ? 424 VAL A C     1 
ATOM   1421 O O     . VAL A 1 202 ? 41.305 16.161 34.351  1.00 18.41 ? 424 VAL A O     1 
ATOM   1422 C CB    . VAL A 1 202 ? 39.311 17.461 36.769  1.00 21.21 ? 424 VAL A CB    1 
ATOM   1423 C CG1   . VAL A 1 202 ? 39.837 18.645 35.972  1.00 22.14 ? 424 VAL A CG1   1 
ATOM   1424 C CG2   . VAL A 1 202 ? 37.821 17.622 37.031  1.00 22.96 ? 424 VAL A CG2   1 
ATOM   1425 N N     . GLU A 1 203 ? 41.954 16.067 36.500  1.00 19.89 ? 425 GLU A N     1 
ATOM   1426 C CA    . GLU A 1 203 ? 43.371 16.063 36.153  1.00 20.03 ? 425 GLU A CA    1 
ATOM   1427 C C     . GLU A 1 203 ? 43.830 14.802 35.428  1.00 20.01 ? 425 GLU A C     1 
ATOM   1428 O O     . GLU A 1 203 ? 44.702 14.865 34.556  1.00 19.82 ? 425 GLU A O     1 
ATOM   1429 C CB    . GLU A 1 203 ? 44.216 16.318 37.406  1.00 22.35 ? 425 GLU A CB    1 
ATOM   1430 C CG    . GLU A 1 203 ? 44.052 17.747 37.923  1.00 26.49 ? 425 GLU A CG    1 
ATOM   1431 C CD    . GLU A 1 203 ? 44.907 18.054 39.135  1.00 29.21 ? 425 GLU A CD    1 
ATOM   1432 O OE1   . GLU A 1 203 ? 45.005 19.247 39.500  1.00 29.55 ? 425 GLU A OE1   1 
ATOM   1433 O OE2   . GLU A 1 203 ? 45.474 17.112 39.724  1.00 30.91 ? 425 GLU A OE2   1 
ATOM   1434 N N     . ALA A 1 204 ? 43.238 13.662 35.771  1.00 18.72 ? 426 ALA A N     1 
ATOM   1435 C CA    . ALA A 1 204 ? 43.586 12.404 35.119  1.00 17.09 ? 426 ALA A CA    1 
ATOM   1436 C C     . ALA A 1 204 ? 42.881 12.328 33.769  1.00 16.11 ? 426 ALA A C     1 
ATOM   1437 O O     . ALA A 1 204 ? 43.109 11.399 32.994  1.00 17.18 ? 426 ALA A O     1 
ATOM   1438 C CB    . ALA A 1 204 ? 43.169 11.223 35.987  1.00 19.02 ? 426 ALA A CB    1 
ATOM   1439 N N     . ARG A 1 205 ? 42.028 13.316 33.504  1.00 14.84 ? 427 ARG A N     1 
ATOM   1440 C CA    . ARG A 1 205 ? 41.265 13.394 32.261  1.00 15.34 ? 427 ARG A CA    1 
ATOM   1441 C C     . ARG A 1 205 ? 40.527 12.091 31.949  1.00 14.83 ? 427 ARG A C     1 
ATOM   1442 O O     . ARG A 1 205 ? 40.562 11.596 30.820  1.00 14.65 ? 427 ARG A O     1 
ATOM   1443 C CB    . ARG A 1 205 ? 42.185 13.775 31.093  1.00 15.95 ? 427 ARG A CB    1 
ATOM   1444 C CG    . ARG A 1 205 ? 42.740 15.202 31.154  1.00 17.45 ? 427 ARG A CG    1 
ATOM   1445 C CD    . ARG A 1 205 ? 41.657 16.263 30.966  1.00 20.07 ? 427 ARG A CD    1 
ATOM   1446 N NE    . ARG A 1 205 ? 40.942 16.113 29.699  1.00 23.99 ? 427 ARG A NE    1 
ATOM   1447 C CZ    . ARG A 1 205 ? 39.981 16.930 29.275  1.00 25.73 ? 427 ARG A CZ    1 
ATOM   1448 N NH1   . ARG A 1 205 ? 39.384 16.709 28.109  1.00 24.27 ? 427 ARG A NH1   1 
ATOM   1449 N NH2   . ARG A 1 205 ? 39.614 17.972 30.011  1.00 26.06 ? 427 ARG A NH2   1 
ATOM   1450 N N     . ARG A 1 206 ? 39.858 11.537 32.955  1.00 14.71 ? 428 ARG A N     1 
ATOM   1451 C CA    . ARG A 1 206 ? 39.103 10.307 32.765  1.00 14.54 ? 428 ARG A CA    1 
ATOM   1452 C C     . ARG A 1 206 ? 37.761 10.579 32.095  1.00 14.43 ? 428 ARG A C     1 
ATOM   1453 O O     . ARG A 1 206 ? 36.921 11.310 32.634  1.00 15.02 ? 428 ARG A O     1 
ATOM   1454 C CB    . ARG A 1 206 ? 38.845 9.605  34.106  1.00 15.36 ? 428 ARG A CB    1 
ATOM   1455 C CG    . ARG A 1 206 ? 40.009 8.768  34.634  1.00 14.74 ? 428 ARG A CG    1 
ATOM   1456 C CD    . ARG A 1 206 ? 39.539 7.884  35.787  1.00 16.33 ? 428 ARG A CD    1 
ATOM   1457 N NE    . ARG A 1 206 ? 40.526 6.881  36.193  1.00 14.30 ? 428 ARG A NE    1 
ATOM   1458 C CZ    . ARG A 1 206 ? 41.599 7.127  36.939  1.00 17.32 ? 428 ARG A CZ    1 
ATOM   1459 N NH1   . ARG A 1 206 ? 41.851 8.354  37.381  1.00 18.99 ? 428 ARG A NH1   1 
ATOM   1460 N NH2   . ARG A 1 206 ? 42.421 6.134  37.248  1.00 18.53 ? 428 ARG A NH2   1 
ATOM   1461 N N     . HIS A 1 207 ? 37.568 9.992  30.919  1.00 13.28 ? 429 HIS A N     1 
ATOM   1462 C CA    . HIS A 1 207 ? 36.310 10.137 30.198  1.00 12.88 ? 429 HIS A CA    1 
ATOM   1463 C C     . HIS A 1 207 ? 35.370 9.033  30.682  1.00 13.11 ? 429 HIS A C     1 
ATOM   1464 O O     . HIS A 1 207 ? 35.757 8.197  31.513  1.00 12.73 ? 429 HIS A O     1 
ATOM   1465 C CB    . HIS A 1 207 ? 36.545 10.055 28.686  1.00 13.79 ? 429 HIS A CB    1 
ATOM   1466 C CG    . HIS A 1 207 ? 37.453 8.941  28.277  1.00 14.33 ? 429 HIS A CG    1 
ATOM   1467 N ND1   . HIS A 1 207 ? 38.629 9.151  27.590  1.00 17.18 ? 429 HIS A ND1   1 
ATOM   1468 C CD2   . HIS A 1 207 ? 37.358 7.604  28.462  1.00 12.74 ? 429 HIS A CD2   1 
ATOM   1469 C CE1   . HIS A 1 207 ? 39.220 7.990  27.369  1.00 14.32 ? 429 HIS A CE1   1 
ATOM   1470 N NE2   . HIS A 1 207 ? 38.469 7.035  27.889  1.00 15.73 ? 429 HIS A NE2   1 
ATOM   1471 N N     . ILE A 1 208 ? 34.144 9.012  30.173  1.00 12.76 ? 430 ILE A N     1 
ATOM   1472 C CA    . ILE A 1 208 ? 33.185 8.024  30.639  1.00 13.32 ? 430 ILE A CA    1 
ATOM   1473 C C     . ILE A 1 208 ? 33.663 6.573  30.498  1.00 12.39 ? 430 ILE A C     1 
ATOM   1474 O O     . ILE A 1 208 ? 33.466 5.771  31.418  1.00 11.99 ? 430 ILE A O     1 
ATOM   1475 C CB    . ILE A 1 208 ? 31.799 8.244  29.968  1.00 13.57 ? 430 ILE A CB    1 
ATOM   1476 C CG1   . ILE A 1 208 ? 30.764 7.294  30.577  1.00 15.31 ? 430 ILE A CG1   1 
ATOM   1477 C CG2   . ILE A 1 208 ? 31.906 8.086  28.459  1.00 13.14 ? 430 ILE A CG2   1 
ATOM   1478 C CD1   . ILE A 1 208 ? 30.500 7.544  32.051  1.00 15.32 ? 430 ILE A CD1   1 
ATOM   1479 N N     . LEU A 1 209 ? 34.311 6.225  29.390  1.00 12.56 ? 431 LEU A N     1 
ATOM   1480 C CA    . LEU A 1 209 ? 34.800 4.852  29.242  1.00 13.58 ? 431 LEU A CA    1 
ATOM   1481 C C     . LEU A 1 209 ? 35.850 4.516  30.302  1.00 14.11 ? 431 LEU A C     1 
ATOM   1482 O O     . LEU A 1 209 ? 35.837 3.424  30.871  1.00 13.60 ? 431 LEU A O     1 
ATOM   1483 C CB    . LEU A 1 209 ? 35.399 4.613  27.852  1.00 12.84 ? 431 LEU A CB    1 
ATOM   1484 C CG    . LEU A 1 209 ? 36.044 3.228  27.679  1.00 14.65 ? 431 LEU A CG    1 
ATOM   1485 C CD1   . LEU A 1 209 ? 34.983 2.137  27.820  1.00 14.68 ? 431 LEU A CD1   1 
ATOM   1486 C CD2   . LEU A 1 209 ? 36.723 3.140  26.319  1.00 16.05 ? 431 LEU A CD2   1 
ATOM   1487 N N     . ALA A 1 210 ? 36.759 5.450  30.564  1.00 12.92 ? 432 ALA A N     1 
ATOM   1488 C CA    . ALA A 1 210 ? 37.803 5.230  31.563  1.00 13.62 ? 432 ALA A CA    1 
ATOM   1489 C C     . ALA A 1 210 ? 37.186 4.968  32.939  1.00 13.83 ? 432 ALA A C     1 
ATOM   1490 O O     . ALA A 1 210 ? 37.664 4.117  33.690  1.00 13.92 ? 432 ALA A O     1 
ATOM   1491 C CB    . ALA A 1 210 ? 38.737 6.442  31.625  1.00 13.48 ? 432 ALA A CB    1 
ATOM   1492 N N     . ILE A 1 211 ? 36.127 5.702  33.272  1.00 13.68 ? 433 ILE A N     1 
ATOM   1493 C CA    . ILE A 1 211 ? 35.463 5.518  34.557  1.00 12.84 ? 433 ILE A CA    1 
ATOM   1494 C C     . ILE A 1 211 ? 34.785 4.150  34.609  1.00 13.35 ? 433 ILE A C     1 
ATOM   1495 O O     . ILE A 1 211 ? 34.857 3.454  35.622  1.00 13.43 ? 433 ILE A O     1 
ATOM   1496 C CB    . ILE A 1 211 ? 34.433 6.643  34.809  1.00 13.07 ? 433 ILE A CB    1 
ATOM   1497 C CG1   . ILE A 1 211 ? 35.180 7.973  34.955  1.00 16.09 ? 433 ILE A CG1   1 
ATOM   1498 C CG2   . ILE A 1 211 ? 33.618 6.355  36.069  1.00 14.05 ? 433 ILE A CG2   1 
ATOM   1499 C CD1   . ILE A 1 211 ? 34.291 9.174  35.195  1.00 15.25 ? 433 ILE A CD1   1 
ATOM   1500 N N     . LEU A 1 212 ? 34.149 3.757  33.509  1.00 13.29 ? 434 LEU A N     1 
ATOM   1501 C CA    . LEU A 1 212 ? 33.487 2.458  33.442  1.00 13.70 ? 434 LEU A CA    1 
ATOM   1502 C C     . LEU A 1 212 ? 34.508 1.325  33.558  1.00 13.50 ? 434 LEU A C     1 
ATOM   1503 O O     . LEU A 1 212 ? 34.225 0.276  34.142  1.00 15.22 ? 434 LEU A O     1 
ATOM   1504 C CB    . LEU A 1 212 ? 32.711 2.325  32.129  1.00 13.26 ? 434 LEU A CB    1 
ATOM   1505 C CG    . LEU A 1 212 ? 31.479 3.227  32.011  1.00 12.81 ? 434 LEU A CG    1 
ATOM   1506 C CD1   . LEU A 1 212 ? 31.009 3.279  30.571  1.00 14.46 ? 434 LEU A CD1   1 
ATOM   1507 C CD2   . LEU A 1 212 ? 30.383 2.716  32.937  1.00 15.22 ? 434 LEU A CD2   1 
ATOM   1508 N N     . GLN A 1 213 ? 35.699 1.535  33.010  1.00 13.85 ? 435 GLN A N     1 
ATOM   1509 C CA    . GLN A 1 213 ? 36.734 0.510  33.073  1.00 14.46 ? 435 GLN A CA    1 
ATOM   1510 C C     . GLN A 1 213 ? 37.354 0.419  34.462  1.00 15.44 ? 435 GLN A C     1 
ATOM   1511 O O     . GLN A 1 213 ? 37.630 -0.677 34.958  1.00 15.75 ? 435 GLN A O     1 
ATOM   1512 C CB    . GLN A 1 213 ? 37.834 0.792  32.052  1.00 16.10 ? 435 GLN A CB    1 
ATOM   1513 C CG    . GLN A 1 213 ? 37.373 0.717  30.608  1.00 14.87 ? 435 GLN A CG    1 
ATOM   1514 C CD    . GLN A 1 213 ? 38.489 1.014  29.626  1.00 16.91 ? 435 GLN A CD    1 
ATOM   1515 O OE1   . GLN A 1 213 ? 39.347 1.854  29.886  1.00 16.15 ? 435 GLN A OE1   1 
ATOM   1516 N NE2   . GLN A 1 213 ? 38.474 0.335  28.482  1.00 16.58 ? 435 GLN A NE2   1 
ATOM   1517 N N     . ASP A 1 214 ? 37.565 1.573  35.088  1.00 14.68 ? 436 ASP A N     1 
ATOM   1518 C CA    . ASP A 1 214 ? 38.178 1.619  36.413  1.00 15.15 ? 436 ASP A CA    1 
ATOM   1519 C C     . ASP A 1 214 ? 37.235 1.291  37.564  1.00 15.67 ? 436 ASP A C     1 
ATOM   1520 O O     . ASP A 1 214 ? 37.680 1.037  38.681  1.00 16.16 ? 436 ASP A O     1 
ATOM   1521 C CB    . ASP A 1 214 ? 38.851 2.976  36.619  1.00 14.88 ? 436 ASP A CB    1 
ATOM   1522 C CG    . ASP A 1 214 ? 40.099 3.136  35.759  1.00 16.29 ? 436 ASP A CG    1 
ATOM   1523 O OD1   . ASP A 1 214 ? 40.654 4.251  35.692  1.00 17.71 ? 436 ASP A OD1   1 
ATOM   1524 O OD2   . ASP A 1 214 ? 40.530 2.133  35.150  1.00 15.43 ? 436 ASP A OD2   1 
ATOM   1525 N N     . CYS A 1 215 ? 35.935 1.308  37.280  1.00 15.68 ? 437 CYS A N     1 
ATOM   1526 C CA    . CYS A 1 215 ? 34.894 0.950  38.247  1.00 16.36 ? 437 CYS A CA    1 
ATOM   1527 C C     . CYS A 1 215 ? 34.054 -0.047 37.455  1.00 16.24 ? 437 CYS A C     1 
ATOM   1528 O O     . CYS A 1 215 ? 32.925 0.247  37.063  1.00 15.07 ? 437 CYS A O     1 
ATOM   1529 C CB    . CYS A 1 215 ? 34.043 2.166  38.622  1.00 16.30 ? 437 CYS A CB    1 
ATOM   1530 S SG    . CYS A 1 215 ? 34.880 3.389  39.660  1.00 21.53 ? 437 CYS A SG    1 
ATOM   1531 N N     . PRO A 1 216 ? 34.604 -1.249 37.212  1.00 14.81 ? 438 PRO A N     1 
ATOM   1532 C CA    . PRO A 1 216 ? 33.933 -2.306 36.448  1.00 14.27 ? 438 PRO A CA    1 
ATOM   1533 C C     . PRO A 1 216 ? 32.555 -2.786 36.892  1.00 14.91 ? 438 PRO A C     1 
ATOM   1534 O O     . PRO A 1 216 ? 31.869 -3.466 36.128  1.00 16.79 ? 438 PRO A O     1 
ATOM   1535 C CB    . PRO A 1 216 ? 34.975 -3.428 36.422  1.00 17.23 ? 438 PRO A CB    1 
ATOM   1536 C CG    . PRO A 1 216 ? 35.711 -3.230 37.706  1.00 18.32 ? 438 PRO A CG    1 
ATOM   1537 C CD    . PRO A 1 216 ? 35.890 -1.733 37.751  1.00 16.14 ? 438 PRO A CD    1 
ATOM   1538 N N     . SER A 1 217 ? 32.141 -2.448 38.109  1.00 14.37 ? 439 SER A N     1 
ATOM   1539 C CA    . SER A 1 217 ? 30.823 -2.873 38.572  1.00 14.68 ? 439 SER A CA    1 
ATOM   1540 C C     . SER A 1 217 ? 29.754 -1.885 38.115  1.00 15.07 ? 439 SER A C     1 
ATOM   1541 O O     . SER A 1 217 ? 28.563 -2.143 38.253  1.00 16.35 ? 439 SER A O     1 
ATOM   1542 C CB    . SER A 1 217 ? 30.785 -2.990 40.102  1.00 15.11 ? 439 SER A CB    1 
ATOM   1543 O OG    . SER A 1 217 ? 30.606 -1.728 40.730  1.00 14.36 ? 439 SER A OG    1 
ATOM   1544 N N     . LEU A 1 218 ? 30.192 -0.757 37.564  1.00 15.38 ? 440 LEU A N     1 
ATOM   1545 C CA    . LEU A 1 218 ? 29.276 0.277  37.089  1.00 16.24 ? 440 LEU A CA    1 
ATOM   1546 C C     . LEU A 1 218 ? 28.597 -0.192 35.807  1.00 16.16 ? 440 LEU A C     1 
ATOM   1547 O O     . LEU A 1 218 ? 29.246 -0.334 34.772  1.00 16.57 ? 440 LEU A O     1 
ATOM   1548 C CB    . LEU A 1 218 ? 30.058 1.573  36.841  1.00 15.71 ? 440 LEU A CB    1 
ATOM   1549 C CG    . LEU A 1 218 ? 29.333 2.861  36.453  1.00 18.20 ? 440 LEU A CG    1 
ATOM   1550 C CD1   . LEU A 1 218 ? 28.242 3.174  37.459  1.00 15.40 ? 440 LEU A CD1   1 
ATOM   1551 C CD2   . LEU A 1 218 ? 30.343 3.991  36.402  1.00 15.91 ? 440 LEU A CD2   1 
ATOM   1552 N N     . ARG A 1 219 ? 27.291 -0.427 35.879  1.00 17.00 ? 441 ARG A N     1 
ATOM   1553 C CA    . ARG A 1 219 ? 26.534 -0.905 34.725  1.00 17.28 ? 441 ARG A CA    1 
ATOM   1554 C C     . ARG A 1 219 ? 25.246 -0.105 34.545  1.00 17.33 ? 441 ARG A C     1 
ATOM   1555 O O     . ARG A 1 219 ? 24.145 -0.606 34.782  1.00 17.27 ? 441 ARG A O     1 
ATOM   1556 C CB    . ARG A 1 219 ? 26.205 -2.391 34.908  1.00 20.54 ? 441 ARG A CB    1 
ATOM   1557 C CG    . ARG A 1 219 ? 25.782 -3.125 33.643  1.00 23.63 ? 441 ARG A CG    1 
ATOM   1558 C CD    . ARG A 1 219 ? 25.559 -4.602 33.943  1.00 27.06 ? 441 ARG A CD    1 
ATOM   1559 N NE    . ARG A 1 219 ? 25.304 -5.396 32.743  1.00 28.84 ? 441 ARG A NE    1 
ATOM   1560 C CZ    . ARG A 1 219 ? 26.196 -5.608 31.779  1.00 29.11 ? 441 ARG A CZ    1 
ATOM   1561 N NH1   . ARG A 1 219 ? 27.410 -5.084 31.864  1.00 29.16 ? 441 ARG A NH1   1 
ATOM   1562 N NH2   . ARG A 1 219 ? 25.875 -6.353 30.730  1.00 28.64 ? 441 ARG A NH2   1 
ATOM   1563 N N     . PRO A 1 220 ? 25.366 1.156  34.116  1.00 15.61 ? 442 PRO A N     1 
ATOM   1564 C CA    . PRO A 1 220 ? 24.169 1.977  33.925  1.00 16.16 ? 442 PRO A CA    1 
ATOM   1565 C C     . PRO A 1 220 ? 23.447 1.615  32.637  1.00 15.76 ? 442 PRO A C     1 
ATOM   1566 O O     . PRO A 1 220 ? 24.065 1.128  31.691  1.00 15.54 ? 442 PRO A O     1 
ATOM   1567 C CB    . PRO A 1 220 ? 24.737 3.387  33.865  1.00 16.37 ? 442 PRO A CB    1 
ATOM   1568 C CG    . PRO A 1 220 ? 26.038 3.171  33.143  1.00 16.64 ? 442 PRO A CG    1 
ATOM   1569 C CD    . PRO A 1 220 ? 26.589 1.927  33.826  1.00 15.36 ? 442 PRO A CD    1 
ATOM   1570 N N     . PRO A 1 221 ? 22.120 1.814  32.595  1.00 15.36 ? 443 PRO A N     1 
ATOM   1571 C CA    . PRO A 1 221 ? 21.377 1.503  31.372  1.00 15.96 ? 443 PRO A CA    1 
ATOM   1572 C C     . PRO A 1 221 ? 21.826 2.556  30.363  1.00 15.14 ? 443 PRO A C     1 
ATOM   1573 O O     . PRO A 1 221 ? 21.969 3.728  30.709  1.00 15.53 ? 443 PRO A O     1 
ATOM   1574 C CB    . PRO A 1 221 ? 19.921 1.674  31.798  1.00 17.48 ? 443 PRO A CB    1 
ATOM   1575 C CG    . PRO A 1 221 ? 20.002 2.707  32.871  1.00 19.50 ? 443 PRO A CG    1 
ATOM   1576 C CD    . PRO A 1 221 ? 21.214 2.281  33.657  1.00 17.80 ? 443 PRO A CD    1 
ATOM   1577 N N     . ILE A 1 222 ? 22.060 2.149  29.127  1.00 13.96 ? 444 ILE A N     1 
ATOM   1578 C CA    . ILE A 1 222 ? 22.533 3.088  28.122  1.00 14.20 ? 444 ILE A CA    1 
ATOM   1579 C C     . ILE A 1 222 ? 21.609 4.282  27.878  1.00 15.35 ? 444 ILE A C     1 
ATOM   1580 O O     . ILE A 1 222 ? 22.087 5.388  27.621  1.00 14.53 ? 444 ILE A O     1 
ATOM   1581 C CB    . ILE A 1 222 ? 22.809 2.357  26.800  1.00 15.86 ? 444 ILE A CB    1 
ATOM   1582 C CG1   . ILE A 1 222 ? 23.493 3.300  25.806  1.00 16.34 ? 444 ILE A CG1   1 
ATOM   1583 C CG2   . ILE A 1 222 ? 21.518 1.807  26.246  1.00 15.15 ? 444 ILE A CG2   1 
ATOM   1584 C CD1   . ILE A 1 222 ? 24.029 2.592  24.573  1.00 21.76 ? 444 ILE A CD1   1 
ATOM   1585 N N     . ASP A 1 223 ? 20.296 4.090  27.969  1.00 16.36 ? 445 ASP A N     1 
ATOM   1586 C CA    . ASP A 1 223 ? 19.400 5.216  27.730  1.00 16.18 ? 445 ASP A CA    1 
ATOM   1587 C C     . ASP A 1 223 ? 19.547 6.290  28.811  1.00 15.68 ? 445 ASP A C     1 
ATOM   1588 O O     . ASP A 1 223 ? 19.458 7.481  28.515  1.00 16.53 ? 445 ASP A O     1 
ATOM   1589 C CB    . ASP A 1 223 ? 17.942 4.749  27.626  1.00 16.23 ? 445 ASP A CB    1 
ATOM   1590 C CG    . ASP A 1 223 ? 17.384 4.271  28.944  1.00 18.96 ? 445 ASP A CG    1 
ATOM   1591 O OD1   . ASP A 1 223 ? 17.857 3.234  29.454  1.00 19.42 ? 445 ASP A OD1   1 
ATOM   1592 O OD2   . ASP A 1 223 ? 16.469 4.935  29.469  1.00 20.12 ? 445 ASP A OD2   1 
ATOM   1593 N N     . HIS A 1 224 ? 19.780 5.884  30.058  1.00 14.23 ? 446 HIS A N     1 
ATOM   1594 C CA    . HIS A 1 224 ? 19.947 6.872  31.118  1.00 15.17 ? 446 HIS A CA    1 
ATOM   1595 C C     . HIS A 1 224 ? 21.265 7.599  30.879  1.00 14.16 ? 446 HIS A C     1 
ATOM   1596 O O     . HIS A 1 224 ? 21.357 8.811  31.049  1.00 14.32 ? 446 HIS A O     1 
ATOM   1597 C CB    . HIS A 1 224 ? 19.954 6.219  32.505  1.00 16.28 ? 446 HIS A CB    1 
ATOM   1598 C CG    . HIS A 1 224 ? 19.789 7.197  33.629  1.00 15.34 ? 446 HIS A CG    1 
ATOM   1599 N ND1   . HIS A 1 224 ? 19.760 6.815  34.953  1.00 17.16 ? 446 HIS A ND1   1 
ATOM   1600 C CD2   . HIS A 1 224 ? 19.628 8.542  33.623  1.00 16.62 ? 446 HIS A CD2   1 
ATOM   1601 C CE1   . HIS A 1 224 ? 19.589 7.882  35.714  1.00 17.64 ? 446 HIS A CE1   1 
ATOM   1602 N NE2   . HIS A 1 224 ? 19.506 8.943  34.931  1.00 17.87 ? 446 HIS A NE2   1 
ATOM   1603 N N     . LEU A 1 225 ? 22.291 6.857  30.473  1.00 14.78 ? 447 LEU A N     1 
ATOM   1604 C CA    . LEU A 1 225 ? 23.576 7.483  30.204  1.00 14.41 ? 447 LEU A CA    1 
ATOM   1605 C C     . LEU A 1 225 ? 23.431 8.545  29.112  1.00 14.33 ? 447 LEU A C     1 
ATOM   1606 O O     . LEU A 1 225 ? 24.004 9.627  29.213  1.00 14.82 ? 447 LEU A O     1 
ATOM   1607 C CB    . LEU A 1 225 ? 24.607 6.439  29.770  1.00 14.86 ? 447 LEU A CB    1 
ATOM   1608 C CG    . LEU A 1 225 ? 26.020 6.985  29.557  1.00 14.52 ? 447 LEU A CG    1 
ATOM   1609 C CD1   . LEU A 1 225 ? 26.555 7.536  30.862  1.00 15.40 ? 447 LEU A CD1   1 
ATOM   1610 C CD2   . LEU A 1 225 ? 26.925 5.883  29.037  1.00 16.05 ? 447 LEU A CD2   1 
ATOM   1611 N N     . CYS A 1 226 ? 22.655 8.240  28.074  1.00 14.52 ? 448 CYS A N     1 
ATOM   1612 C CA    . CYS A 1 226 ? 22.456 9.186  26.981  1.00 15.29 ? 448 CYS A CA    1 
ATOM   1613 C C     . CYS A 1 226 ? 21.735 10.456 27.428  1.00 15.28 ? 448 CYS A C     1 
ATOM   1614 O O     . CYS A 1 226 ? 21.850 11.498 26.784  1.00 16.42 ? 448 CYS A O     1 
ATOM   1615 C CB    . CYS A 1 226 ? 21.690 8.518  25.837  1.00 15.23 ? 448 CYS A CB    1 
ATOM   1616 S SG    . CYS A 1 226 ? 22.676 7.328  24.907  1.00 17.32 ? 448 CYS A SG    1 
ATOM   1617 N N     . GLU A 1 227 ? 20.994 10.369 28.527  1.00 16.78 ? 449 GLU A N     1 
ATOM   1618 C CA    . GLU A 1 227 ? 20.287 11.527 29.063  1.00 17.30 ? 449 GLU A CA    1 
ATOM   1619 C C     . GLU A 1 227 ? 21.221 12.372 29.937  1.00 18.08 ? 449 GLU A C     1 
ATOM   1620 O O     . GLU A 1 227 ? 21.043 13.583 30.063  1.00 19.85 ? 449 GLU A O     1 
ATOM   1621 C CB    . GLU A 1 227 ? 19.074 11.068 29.893  1.00 19.21 ? 449 GLU A CB    1 
ATOM   1622 C CG    . GLU A 1 227 ? 18.579 12.107 30.906  1.00 22.44 ? 449 GLU A CG    1 
ATOM   1623 C CD    . GLU A 1 227 ? 17.339 11.672 31.675  1.00 23.38 ? 449 GLU A CD    1 
ATOM   1624 O OE1   . GLU A 1 227 ? 17.102 12.229 32.768  1.00 25.89 ? 449 GLU A OE1   1 
ATOM   1625 O OE2   . GLU A 1 227 ? 16.598 10.789 31.193  1.00 21.24 ? 449 GLU A OE2   1 
ATOM   1626 N N     . LEU A 1 228 ? 22.227 11.731 30.525  1.00 16.05 ? 450 LEU A N     1 
ATOM   1627 C CA    . LEU A 1 228 ? 23.159 12.414 31.416  1.00 16.50 ? 450 LEU A CA    1 
ATOM   1628 C C     . LEU A 1 228 ? 24.327 13.140 30.761  1.00 15.82 ? 450 LEU A C     1 
ATOM   1629 O O     . LEU A 1 228 ? 24.782 14.166 31.266  1.00 16.38 ? 450 LEU A O     1 
ATOM   1630 C CB    . LEU A 1 228 ? 23.716 11.422 32.436  1.00 17.44 ? 450 LEU A CB    1 
ATOM   1631 C CG    . LEU A 1 228 ? 22.726 10.801 33.422  1.00 19.30 ? 450 LEU A CG    1 
ATOM   1632 C CD1   . LEU A 1 228 ? 23.399 9.647  34.152  1.00 19.54 ? 450 LEU A CD1   1 
ATOM   1633 C CD2   . LEU A 1 228 ? 22.253 11.854 34.402  1.00 19.88 ? 450 LEU A CD2   1 
ATOM   1634 N N     . LEU A 1 229 ? 24.819 12.610 29.649  1.00 14.67 ? 451 LEU A N     1 
ATOM   1635 C CA    . LEU A 1 229 ? 25.965 13.212 28.976  1.00 14.42 ? 451 LEU A CA    1 
ATOM   1636 C C     . LEU A 1 229 ? 25.656 14.515 28.247  1.00 14.27 ? 451 LEU A C     1 
ATOM   1637 O O     . LEU A 1 229 ? 24.539 14.730 27.770  1.00 14.98 ? 451 LEU A O     1 
ATOM   1638 C CB    . LEU A 1 229 ? 26.573 12.209 27.996  1.00 15.29 ? 451 LEU A CB    1 
ATOM   1639 C CG    . LEU A 1 229 ? 27.089 10.912 28.625  1.00 15.71 ? 451 LEU A CG    1 
ATOM   1640 C CD1   . LEU A 1 229 ? 27.610 9.988  27.539  1.00 19.21 ? 451 LEU A CD1   1 
ATOM   1641 C CD2   . LEU A 1 229 ? 28.190 11.236 29.633  1.00 19.57 ? 451 LEU A CD2   1 
ATOM   1642 N N     . PRO A 1 230 ? 26.651 15.410 28.158  1.00 14.21 ? 452 PRO A N     1 
ATOM   1643 C CA    . PRO A 1 230 ? 26.456 16.692 27.470  1.00 13.47 ? 452 PRO A CA    1 
ATOM   1644 C C     . PRO A 1 230 ? 26.423 16.472 25.960  1.00 13.32 ? 452 PRO A C     1 
ATOM   1645 O O     . PRO A 1 230 ? 26.845 15.423 25.470  1.00 13.92 ? 452 PRO A O     1 
ATOM   1646 C CB    . PRO A 1 230 ? 27.693 17.507 27.865  1.00 14.82 ? 452 PRO A CB    1 
ATOM   1647 C CG    . PRO A 1 230 ? 28.302 16.758 29.030  1.00 17.49 ? 452 PRO A CG    1 
ATOM   1648 C CD    . PRO A 1 230 ? 28.004 15.319 28.728  1.00 14.97 ? 452 PRO A CD    1 
ATOM   1649 N N     . ARG A 1 231 ? 25.935 17.468 25.230  1.00 10.90 ? 453 ARG A N     1 
ATOM   1650 C CA    . ARG A 1 231 ? 25.890 17.390 23.780  1.00 12.45 ? 453 ARG A CA    1 
ATOM   1651 C C     . ARG A 1 231 ? 27.288 17.587 23.200  1.00 12.76 ? 453 ARG A C     1 
ATOM   1652 O O     . ARG A 1 231 ? 28.133 18.269 23.788  1.00 13.05 ? 453 ARG A O     1 
ATOM   1653 C CB    . ARG A 1 231 ? 24.970 18.475 23.205  1.00 12.64 ? 453 ARG A CB    1 
ATOM   1654 C CG    . ARG A 1 231 ? 23.478 18.250 23.448  1.00 13.55 ? 453 ARG A CG    1 
ATOM   1655 C CD    . ARG A 1 231 ? 22.994 16.983 22.755  1.00 14.52 ? 453 ARG A CD    1 
ATOM   1656 N NE    . ARG A 1 231 ? 23.261 17.003 21.320  1.00 13.22 ? 453 ARG A NE    1 
ATOM   1657 C CZ    . ARG A 1 231 ? 22.512 17.627 20.416  1.00 13.65 ? 453 ARG A CZ    1 
ATOM   1658 N NH1   . ARG A 1 231 ? 21.421 18.293 20.786  1.00 15.16 ? 453 ARG A NH1   1 
ATOM   1659 N NH2   . ARG A 1 231 ? 22.864 17.592 19.135  1.00 13.86 ? 453 ARG A NH2   1 
ATOM   1660 N N     . LEU A 1 232 ? 27.520 16.979 22.043  1.00 11.75 ? 454 LEU A N     1 
ATOM   1661 C CA    . LEU A 1 232 ? 28.791 17.105 21.340  1.00 11.88 ? 454 LEU A CA    1 
ATOM   1662 C C     . LEU A 1 232 ? 28.739 18.442 20.603  1.00 12.73 ? 454 LEU A C     1 
ATOM   1663 O O     . LEU A 1 232 ? 27.876 18.664 19.750  1.00 13.51 ? 454 LEU A O     1 
ATOM   1664 C CB    . LEU A 1 232 ? 28.961 15.963 20.339  1.00 11.31 ? 454 LEU A CB    1 
ATOM   1665 C CG    . LEU A 1 232 ? 30.276 15.935 19.558  1.00 12.11 ? 454 LEU A CG    1 
ATOM   1666 C CD1   . LEU A 1 232 ? 31.440 15.678 20.504  1.00 11.79 ? 454 LEU A CD1   1 
ATOM   1667 C CD2   . LEU A 1 232 ? 30.203 14.844 18.499  1.00 12.88 ? 454 LEU A CD2   1 
ATOM   1668 N N     . GLN A 1 233 ? 29.673 19.322 20.942  1.00 12.70 ? 455 GLN A N     1 
ATOM   1669 C CA    . GLN A 1 233 ? 29.743 20.664 20.375  1.00 13.52 ? 455 GLN A CA    1 
ATOM   1670 C C     . GLN A 1 233 ? 30.535 20.824 19.090  1.00 11.95 ? 455 GLN A C     1 
ATOM   1671 O O     . GLN A 1 233 ? 31.437 20.047 18.785  1.00 12.10 ? 455 GLN A O     1 
ATOM   1672 C CB    . GLN A 1 233 ? 30.352 21.618 21.401  1.00 14.47 ? 455 GLN A CB    1 
ATOM   1673 C CG    . GLN A 1 233 ? 29.558 21.783 22.670  1.00 16.14 ? 455 GLN A CG    1 
ATOM   1674 C CD    . GLN A 1 233 ? 30.252 22.703 23.645  1.00 16.85 ? 455 GLN A CD    1 
ATOM   1675 O OE1   . GLN A 1 233 ? 30.990 23.606 23.241  1.00 18.31 ? 455 GLN A OE1   1 
ATOM   1676 N NE2   . GLN A 1 233 ? 30.013 22.495 24.932  1.00 17.34 ? 455 GLN A NE2   1 
ATOM   1677 N N     . ALA A 1 234 ? 30.191 21.869 18.348  1.00 12.45 ? 456 ALA A N     1 
ATOM   1678 C CA    . ALA A 1 234 ? 30.904 22.203 17.131  1.00 13.07 ? 456 ALA A CA    1 
ATOM   1679 C C     . ALA A 1 234 ? 32.257 22.761 17.578  1.00 13.25 ? 456 ALA A C     1 
ATOM   1680 O O     . ALA A 1 234 ? 32.386 23.277 18.690  1.00 13.83 ? 456 ALA A O     1 
ATOM   1681 C CB    . ALA A 1 234 ? 30.141 23.270 16.364  1.00 15.05 ? 456 ALA A CB    1 
ATOM   1682 N N     . ARG A 1 235 ? 33.262 22.630 16.721  1.00 12.50 ? 457 ARG A N     1 
ATOM   1683 C CA    . ARG A 1 235 ? 34.590 23.171 16.994  1.00 11.57 ? 457 ARG A CA    1 
ATOM   1684 C C     . ARG A 1 235 ? 34.813 24.237 15.931  1.00 11.89 ? 457 ARG A C     1 
ATOM   1685 O O     . ARG A 1 235 ? 34.404 24.067 14.782  1.00 12.01 ? 457 ARG A O     1 
ATOM   1686 C CB    . ARG A 1 235 ? 35.668 22.093 16.874  1.00 13.62 ? 457 ARG A CB    1 
ATOM   1687 C CG    . ARG A 1 235 ? 36.003 21.365 18.172  1.00 13.82 ? 457 ARG A CG    1 
ATOM   1688 C CD    . ARG A 1 235 ? 34.869 20.478 18.675  1.00 13.52 ? 457 ARG A CD    1 
ATOM   1689 N NE    . ARG A 1 235 ? 35.365 19.565 19.704  1.00 13.15 ? 457 ARG A NE    1 
ATOM   1690 C CZ    . ARG A 1 235 ? 34.602 18.877 20.547  1.00 12.62 ? 457 ARG A CZ    1 
ATOM   1691 N NH1   . ARG A 1 235 ? 35.172 18.077 21.437  1.00 13.36 ? 457 ARG A NH1   1 
ATOM   1692 N NH2   . ARG A 1 235 ? 33.282 18.992 20.507  1.00 14.61 ? 457 ARG A NH2   1 
ATOM   1693 N N     . TYR A 1 236 ? 35.463 25.329 16.314  1.00 12.44 ? 458 TYR A N     1 
ATOM   1694 C CA    . TYR A 1 236 ? 35.726 26.435 15.398  1.00 12.74 ? 458 TYR A CA    1 
ATOM   1695 C C     . TYR A 1 236 ? 37.183 26.525 14.967  1.00 12.37 ? 458 TYR A C     1 
ATOM   1696 O O     . TYR A 1 236 ? 38.089 26.222 15.733  1.00 11.88 ? 458 TYR A O     1 
ATOM   1697 C CB    . TYR A 1 236 ? 35.314 27.756 16.054  1.00 14.31 ? 458 TYR A CB    1 
ATOM   1698 C CG    . TYR A 1 236 ? 33.834 27.837 16.314  1.00 13.00 ? 458 TYR A CG    1 
ATOM   1699 C CD1   . TYR A 1 236 ? 32.972 28.398 15.379  1.00 14.71 ? 458 TYR A CD1   1 
ATOM   1700 C CD2   . TYR A 1 236 ? 33.286 27.272 17.459  1.00 14.80 ? 458 TYR A CD2   1 
ATOM   1701 C CE1   . TYR A 1 236 ? 31.592 28.388 15.574  1.00 16.89 ? 458 TYR A CE1   1 
ATOM   1702 C CE2   . TYR A 1 236 ? 31.908 27.253 17.666  1.00 16.23 ? 458 TYR A CE2   1 
ATOM   1703 C CZ    . TYR A 1 236 ? 31.069 27.809 16.718  1.00 17.59 ? 458 TYR A CZ    1 
ATOM   1704 O OH    . TYR A 1 236 ? 29.705 27.763 16.899  1.00 17.13 ? 458 TYR A OH    1 
ATOM   1705 N N     . TYR A 1 237 ? 37.396 26.950 13.728  1.00 12.26 ? 459 TYR A N     1 
ATOM   1706 C CA    . TYR A 1 237 ? 38.741 27.097 13.193  1.00 12.00 ? 459 TYR A CA    1 
ATOM   1707 C C     . TYR A 1 237 ? 38.821 28.390 12.408  1.00 12.39 ? 459 TYR A C     1 
ATOM   1708 O O     . TYR A 1 237 ? 37.848 28.812 11.780  1.00 12.97 ? 459 TYR A O     1 
ATOM   1709 C CB    . TYR A 1 237 ? 39.092 25.898 12.298  1.00 12.07 ? 459 TYR A CB    1 
ATOM   1710 C CG    . TYR A 1 237 ? 39.153 24.610 13.080  1.00 11.98 ? 459 TYR A CG    1 
ATOM   1711 C CD1   . TYR A 1 237 ? 40.304 24.259 13.783  1.00 10.71 ? 459 TYR A CD1   1 
ATOM   1712 C CD2   . TYR A 1 237 ? 38.017 23.813 13.233  1.00 11.38 ? 459 TYR A CD2   1 
ATOM   1713 C CE1   . TYR A 1 237 ? 40.318 23.161 14.631  1.00 11.30 ? 459 TYR A CE1   1 
ATOM   1714 C CE2   . TYR A 1 237 ? 38.020 22.712 14.075  1.00 12.18 ? 459 TYR A CE2   1 
ATOM   1715 C CZ    . TYR A 1 237 ? 39.172 22.396 14.776  1.00 11.83 ? 459 TYR A CZ    1 
ATOM   1716 O OH    . TYR A 1 237 ? 39.169 21.341 15.654  1.00 13.20 ? 459 TYR A OH    1 
ATOM   1717 N N     . SER A 1 238 ? 39.977 29.035 12.467  1.00 12.69 ? 460 SER A N     1 
ATOM   1718 C CA    . SER A 1 238 ? 40.170 30.276 11.737  1.00 13.28 ? 460 SER A CA    1 
ATOM   1719 C C     . SER A 1 238 ? 40.439 29.927 10.281  1.00 12.12 ? 460 SER A C     1 
ATOM   1720 O O     . SER A 1 238 ? 41.428 29.272 9.966   1.00 13.81 ? 460 SER A O     1 
ATOM   1721 C CB    . SER A 1 238 ? 41.347 31.046 12.328  1.00 14.47 ? 460 SER A CB    1 
ATOM   1722 O OG    . SER A 1 238 ? 41.087 31.379 13.679  1.00 17.71 ? 460 SER A OG    1 
ATOM   1723 N N     . ILE A 1 239 ? 39.553 30.356 9.391   1.00 11.66 ? 461 ILE A N     1 
ATOM   1724 C CA    . ILE A 1 239 ? 39.710 30.063 7.974   1.00 11.36 ? 461 ILE A CA    1 
ATOM   1725 C C     . ILE A 1 239 ? 41.076 30.551 7.482   1.00 12.70 ? 461 ILE A C     1 
ATOM   1726 O O     . ILE A 1 239 ? 41.434 31.715 7.658   1.00 12.50 ? 461 ILE A O     1 
ATOM   1727 C CB    . ILE A 1 239 ? 38.555 30.691 7.176   1.00 11.58 ? 461 ILE A CB    1 
ATOM   1728 C CG1   . ILE A 1 239 ? 37.243 30.033 7.622   1.00 11.87 ? 461 ILE A CG1   1 
ATOM   1729 C CG2   . ILE A 1 239 ? 38.769 30.495 5.683   1.00 12.30 ? 461 ILE A CG2   1 
ATOM   1730 C CD1   . ILE A 1 239 ? 35.990 30.670 7.066   1.00 11.86 ? 461 ILE A CD1   1 
ATOM   1731 N N     . ALA A 1 240 ? 41.832 29.633 6.884   1.00 11.95 ? 462 ALA A N     1 
ATOM   1732 C CA    . ALA A 1 240 ? 43.191 29.905 6.409   1.00 12.27 ? 462 ALA A CA    1 
ATOM   1733 C C     . ALA A 1 240 ? 43.309 30.197 4.915   1.00 12.58 ? 462 ALA A C     1 
ATOM   1734 O O     . ALA A 1 240 ? 44.375 30.018 4.319   1.00 13.61 ? 462 ALA A O     1 
ATOM   1735 C CB    . ALA A 1 240 ? 44.087 28.730 6.779   1.00 12.63 ? 462 ALA A CB    1 
ATOM   1736 N N     . SER A 1 241 ? 42.215 30.649 4.317   1.00 12.96 ? 463 SER A N     1 
ATOM   1737 C CA    . SER A 1 241 ? 42.175 30.983 2.901   1.00 12.33 ? 463 SER A CA    1 
ATOM   1738 C C     . SER A 1 241 ? 41.455 32.310 2.677   1.00 11.77 ? 463 SER A C     1 
ATOM   1739 O O     . SER A 1 241 ? 40.725 32.791 3.545   1.00 11.66 ? 463 SER A O     1 
ATOM   1740 C CB    . SER A 1 241 ? 41.457 29.875 2.122   1.00 13.14 ? 463 SER A CB    1 
ATOM   1741 O OG    . SER A 1 241 ? 40.173 29.610 2.674   1.00 13.27 ? 463 SER A OG    1 
ATOM   1742 N N     . SER A 1 242 ? 41.683 32.900 1.507   1.00 12.84 ? 464 SER A N     1 
ATOM   1743 C CA    . SER A 1 242 ? 41.039 34.150 1.117   1.00 13.84 ? 464 SER A CA    1 
ATOM   1744 C C     . SER A 1 242 ? 39.956 33.798 0.106   1.00 12.98 ? 464 SER A C     1 
ATOM   1745 O O     . SER A 1 242 ? 40.215 33.044 -0.831  1.00 12.53 ? 464 SER A O     1 
ATOM   1746 C CB    . SER A 1 242 ? 42.044 35.087 0.447   1.00 14.98 ? 464 SER A CB    1 
ATOM   1747 O OG    . SER A 1 242 ? 41.359 36.059 -0.329  1.00 14.93 ? 464 SER A OG    1 
ATOM   1748 N N     . SER A 1 243 ? 38.753 34.334 0.288   1.00 13.16 ? 465 SER A N     1 
ATOM   1749 C CA    . SER A 1 243 ? 37.672 34.049 -0.647  1.00 14.00 ? 465 SER A CA    1 
ATOM   1750 C C     . SER A 1 243 ? 37.890 34.737 -1.995  1.00 14.88 ? 465 SER A C     1 
ATOM   1751 O O     . SER A 1 243 ? 37.168 34.469 -2.953  1.00 16.41 ? 465 SER A O     1 
ATOM   1752 C CB    . SER A 1 243 ? 36.319 34.457 -0.054  1.00 15.05 ? 465 SER A CB    1 
ATOM   1753 O OG    . SER A 1 243 ? 36.279 35.833 0.255   1.00 16.56 ? 465 SER A OG    1 
ATOM   1754 N N     . LYS A 1 244 ? 38.880 35.625 -2.068  1.00 14.92 ? 466 LYS A N     1 
ATOM   1755 C CA    . LYS A 1 244 ? 39.193 36.299 -3.328  1.00 16.87 ? 466 LYS A CA    1 
ATOM   1756 C C     . LYS A 1 244 ? 40.000 35.334 -4.195  1.00 16.73 ? 466 LYS A C     1 
ATOM   1757 O O     . LYS A 1 244 ? 40.003 35.435 -5.425  1.00 18.02 ? 466 LYS A O     1 
ATOM   1758 C CB    . LYS A 1 244 ? 40.023 37.565 -3.088  1.00 19.88 ? 466 LYS A CB    1 
ATOM   1759 C CG    . LYS A 1 244 ? 39.368 38.623 -2.208  1.00 24.06 ? 466 LYS A CG    1 
ATOM   1760 C CD    . LYS A 1 244 ? 38.063 39.139 -2.787  1.00 27.16 ? 466 LYS A CD    1 
ATOM   1761 C CE    . LYS A 1 244 ? 37.569 40.351 -2.005  1.00 27.53 ? 466 LYS A CE    1 
ATOM   1762 N NZ    . LYS A 1 244 ? 37.538 40.097 -0.533  1.00 26.44 ? 466 LYS A NZ    1 
ATOM   1763 N N     . VAL A 1 245 ? 40.685 34.399 -3.541  1.00 16.58 ? 467 VAL A N     1 
ATOM   1764 C CA    . VAL A 1 245 ? 41.506 33.401 -4.215  1.00 16.44 ? 467 VAL A CA    1 
ATOM   1765 C C     . VAL A 1 245 ? 40.796 32.045 -4.283  1.00 16.16 ? 467 VAL A C     1 
ATOM   1766 O O     . VAL A 1 245 ? 40.831 31.363 -5.306  1.00 16.74 ? 467 VAL A O     1 
ATOM   1767 C CB    . VAL A 1 245 ? 42.853 33.218 -3.475  1.00 16.48 ? 467 VAL A CB    1 
ATOM   1768 C CG1   . VAL A 1 245 ? 43.724 32.210 -4.208  1.00 17.35 ? 467 VAL A CG1   1 
ATOM   1769 C CG2   . VAL A 1 245 ? 43.561 34.558 -3.354  1.00 17.35 ? 467 VAL A CG2   1 
ATOM   1770 N N     . HIS A 1 246 ? 40.157 31.665 -3.180  1.00 13.98 ? 468 HIS A N     1 
ATOM   1771 C CA    . HIS A 1 246 ? 39.438 30.398 -3.089  1.00 14.47 ? 468 HIS A CA    1 
ATOM   1772 C C     . HIS A 1 246 ? 37.990 30.623 -2.665  1.00 14.90 ? 468 HIS A C     1 
ATOM   1773 O O     . HIS A 1 246 ? 37.601 30.273 -1.552  1.00 14.38 ? 468 HIS A O     1 
ATOM   1774 C CB    . HIS A 1 246 ? 40.112 29.472 -2.074  1.00 16.23 ? 468 HIS A CB    1 
ATOM   1775 C CG    . HIS A 1 246 ? 41.530 29.126 -2.411  1.00 17.20 ? 468 HIS A CG    1 
ATOM   1776 N ND1   . HIS A 1 246 ? 42.607 29.828 -1.918  1.00 17.71 ? 468 HIS A ND1   1 
ATOM   1777 C CD2   . HIS A 1 246 ? 42.044 28.145 -3.188  1.00 18.00 ? 468 HIS A CD2   1 
ATOM   1778 C CE1   . HIS A 1 246 ? 43.725 29.294 -2.376  1.00 17.24 ? 468 HIS A CE1   1 
ATOM   1779 N NE2   . HIS A 1 246 ? 43.411 28.271 -3.149  1.00 20.34 ? 468 HIS A NE2   1 
ATOM   1780 N N     . PRO A 1 247 ? 37.169 31.204 -3.549  1.00 14.24 ? 469 PRO A N     1 
ATOM   1781 C CA    . PRO A 1 247 ? 35.769 31.443 -3.187  1.00 14.55 ? 469 PRO A CA    1 
ATOM   1782 C C     . PRO A 1 247 ? 34.990 30.160 -2.912  1.00 14.78 ? 469 PRO A C     1 
ATOM   1783 O O     . PRO A 1 247 ? 34.013 30.166 -2.163  1.00 15.75 ? 469 PRO A O     1 
ATOM   1784 C CB    . PRO A 1 247 ? 35.227 32.210 -4.396  1.00 16.50 ? 469 PRO A CB    1 
ATOM   1785 C CG    . PRO A 1 247 ? 36.042 31.669 -5.533  1.00 16.21 ? 469 PRO A CG    1 
ATOM   1786 C CD    . PRO A 1 247 ? 37.439 31.623 -4.938  1.00 16.08 ? 469 PRO A CD    1 
ATOM   1787 N N     . ASN A 1 248 ? 35.438 29.057 -3.500  1.00 13.22 ? 470 ASN A N     1 
ATOM   1788 C CA    . ASN A 1 248 ? 34.757 27.783 -3.343  1.00 14.60 ? 470 ASN A CA    1 
ATOM   1789 C C     . ASN A 1 248 ? 35.495 26.766 -2.481  1.00 14.58 ? 470 ASN A C     1 
ATOM   1790 O O     . ASN A 1 248 ? 35.235 25.568 -2.561  1.00 13.28 ? 470 ASN A O     1 
ATOM   1791 C CB    . ASN A 1 248 ? 34.457 27.205 -4.728  1.00 14.97 ? 470 ASN A CB    1 
ATOM   1792 C CG    . ASN A 1 248 ? 33.440 28.039 -5.490  1.00 16.24 ? 470 ASN A CG    1 
ATOM   1793 O OD1   . ASN A 1 248 ? 33.541 28.208 -6.704  1.00 19.29 ? 470 ASN A OD1   1 
ATOM   1794 N ND2   . ASN A 1 248 ? 32.448 28.559 -4.775  1.00 17.67 ? 470 ASN A ND2   1 
ATOM   1795 N N     . SER A 1 249 ? 36.404 27.247 -1.642  1.00 13.04 ? 471 SER A N     1 
ATOM   1796 C CA    . SER A 1 249 ? 37.145 26.357 -0.753  1.00 14.68 ? 471 SER A CA    1 
ATOM   1797 C C     . SER A 1 249 ? 37.477 27.060 0.559   1.00 14.60 ? 471 SER A C     1 
ATOM   1798 O O     . SER A 1 249 ? 37.900 28.214 0.567   1.00 15.63 ? 471 SER A O     1 
ATOM   1799 C CB    . SER A 1 249 ? 38.438 25.877 -1.422  1.00 16.11 ? 471 SER A CB    1 
ATOM   1800 O OG    . SER A 1 249 ? 39.099 24.922 -0.608  1.00 17.59 ? 471 SER A OG    1 
ATOM   1801 N N     . VAL A 1 250 ? 37.261 26.361 1.669   1.00 13.97 ? 472 VAL A N     1 
ATOM   1802 C CA    . VAL A 1 250 ? 37.567 26.900 2.987   1.00 12.94 ? 472 VAL A CA    1 
ATOM   1803 C C     . VAL A 1 250 ? 38.696 26.044 3.547   1.00 12.88 ? 472 VAL A C     1 
ATOM   1804 O O     . VAL A 1 250 ? 38.570 24.828 3.646   1.00 13.51 ? 472 VAL A O     1 
ATOM   1805 C CB    . VAL A 1 250 ? 36.337 26.836 3.914   1.00 12.97 ? 472 VAL A CB    1 
ATOM   1806 C CG1   . VAL A 1 250 ? 36.731 27.189 5.332   1.00 13.66 ? 472 VAL A CG1   1 
ATOM   1807 C CG2   . VAL A 1 250 ? 35.269 27.808 3.411   1.00 13.22 ? 472 VAL A CG2   1 
ATOM   1808 N N     . HIS A 1 251 ? 39.802 26.688 3.898   1.00 11.82 ? 473 HIS A N     1 
ATOM   1809 C CA    . HIS A 1 251 ? 40.961 25.972 4.403   1.00 12.54 ? 473 HIS A CA    1 
ATOM   1810 C C     . HIS A 1 251 ? 41.103 26.044 5.912   1.00 11.78 ? 473 HIS A C     1 
ATOM   1811 O O     . HIS A 1 251 ? 40.766 27.051 6.537   1.00 12.48 ? 473 HIS A O     1 
ATOM   1812 C CB    . HIS A 1 251 ? 42.231 26.512 3.741   1.00 13.03 ? 473 HIS A CB    1 
ATOM   1813 C CG    . HIS A 1 251 ? 42.218 26.416 2.246   1.00 12.74 ? 473 HIS A CG    1 
ATOM   1814 N ND1   . HIS A 1 251 ? 43.290 26.796 1.466   1.00 13.43 ? 473 HIS A ND1   1 
ATOM   1815 C CD2   . HIS A 1 251 ? 41.274 25.958 1.389   1.00 14.25 ? 473 HIS A CD2   1 
ATOM   1816 C CE1   . HIS A 1 251 ? 43.008 26.573 0.195   1.00 12.86 ? 473 HIS A CE1   1 
ATOM   1817 N NE2   . HIS A 1 251 ? 41.790 26.065 0.121   1.00 14.56 ? 473 HIS A NE2   1 
ATOM   1818 N N     . ILE A 1 252 ? 41.619 24.963 6.484   1.00 12.69 ? 474 ILE A N     1 
ATOM   1819 C CA    . ILE A 1 252 ? 41.825 24.861 7.922   1.00 12.49 ? 474 ILE A CA    1 
ATOM   1820 C C     . ILE A 1 252 ? 43.256 24.442 8.220   1.00 12.06 ? 474 ILE A C     1 
ATOM   1821 O O     . ILE A 1 252 ? 43.829 23.598 7.522   1.00 12.42 ? 474 ILE A O     1 
ATOM   1822 C CB    . ILE A 1 252 ? 40.877 23.804 8.545   1.00 12.23 ? 474 ILE A CB    1 
ATOM   1823 C CG1   . ILE A 1 252 ? 39.426 24.282 8.454   1.00 13.87 ? 474 ILE A CG1   1 
ATOM   1824 C CG2   . ILE A 1 252 ? 41.261 23.531 9.998   1.00 13.15 ? 474 ILE A CG2   1 
ATOM   1825 C CD1   . ILE A 1 252 ? 38.422 23.230 8.861   1.00 14.60 ? 474 ILE A CD1   1 
ATOM   1826 N N     . CYS A 1 253 ? 43.815 25.097 9.199   1.00 11.69 ? 475 CYS A N     1 
ATOM   1827 C CA    . CYS A 1 253 ? 45.128 24.769 9.703   1.00 11.27 ? 475 CYS A CA    1 
ATOM   1828 C C     . CYS A 1 253 ? 44.968 24.345 11.207  1.00 10.42 ? 475 CYS A C     1 
ATOM   1829 O O     . CYS A 1 253 ? 44.603 25.135 11.914  1.00 11.98 ? 475 CYS A O     1 
ATOM   1830 C CB    . CYS A 1 253 ? 46.021 26.014 9.604   1.00 11.60 ? 475 CYS A CB    1 
ATOM   1831 S SG    . CYS A 1 253 ? 47.667 25.830 10.490  1.00 14.93 ? 475 CYS A SG    1 
ATOM   1832 N N     . ALA A 1 254 ? 45.227 23.113 11.522  1.00 12.41 ? 476 ALA A N     1 
ATOM   1833 C CA    . ALA A 1 254 ? 45.001 22.678 12.889  1.00 13.52 ? 476 ALA A CA    1 
ATOM   1834 C C     . ALA A 1 254 ? 46.042 21.717 13.413  1.00 12.51 ? 476 ALA A C     1 
ATOM   1835 O O     . ALA A 1 254 ? 46.664 20.967 12.659  1.00 14.22 ? 476 ALA A O     1 
ATOM   1836 C CB    . ALA A 1 254 ? 43.613 22.038 13.008  1.00 13.73 ? 476 ALA A CB    1 
ATOM   1837 N N     . VAL A 1 255 ? 46.224 21.754 14.725  1.00 12.18 ? 477 VAL A N     1 
ATOM   1838 C CA    . VAL A 1 255 ? 47.153 20.854 15.383  1.00 13.32 ? 477 VAL A CA    1 
ATOM   1839 C C     . VAL A 1 255 ? 46.308 19.764 16.032  1.00 13.57 ? 477 VAL A C     1 
ATOM   1840 O O     . VAL A 1 255 ? 45.302 20.046 16.691  1.00 13.75 ? 477 VAL A O     1 
ATOM   1841 C CB    . VAL A 1 255 ? 48.008 21.593 16.452  1.00 14.63 ? 477 VAL A CB    1 
ATOM   1842 C CG1   . VAL A 1 255 ? 47.118 22.319 17.444  1.00 15.84 ? 477 VAL A CG1   1 
ATOM   1843 C CG2   . VAL A 1 255 ? 48.918 20.600 17.163  1.00 16.32 ? 477 VAL A CG2   1 
ATOM   1844 N N     . VAL A 1 256 ? 46.696 18.515 15.819  1.00 12.06 ? 478 VAL A N     1 
ATOM   1845 C CA    . VAL A 1 256 ? 45.951 17.406 16.390  1.00 14.10 ? 478 VAL A CA    1 
ATOM   1846 C C     . VAL A 1 256 ? 46.225 17.243 17.882  1.00 15.08 ? 478 VAL A C     1 
ATOM   1847 O O     . VAL A 1 256 ? 47.373 17.265 18.328  1.00 16.00 ? 478 VAL A O     1 
ATOM   1848 C CB    . VAL A 1 256 ? 46.281 16.081 15.675  1.00 14.03 ? 478 VAL A CB    1 
ATOM   1849 C CG1   . VAL A 1 256 ? 45.536 14.938 16.345  1.00 15.62 ? 478 VAL A CG1   1 
ATOM   1850 C CG2   . VAL A 1 256 ? 45.895 16.170 14.200  1.00 15.18 ? 478 VAL A CG2   1 
ATOM   1851 N N     . VAL A 1 257 ? 45.153 17.087 18.649  1.00 13.81 ? 479 VAL A N     1 
ATOM   1852 C CA    . VAL A 1 257 ? 45.245 16.902 20.088  1.00 14.02 ? 479 VAL A CA    1 
ATOM   1853 C C     . VAL A 1 257 ? 45.314 15.409 20.388  1.00 14.28 ? 479 VAL A C     1 
ATOM   1854 O O     . VAL A 1 257 ? 44.411 14.654 20.033  1.00 13.41 ? 479 VAL A O     1 
ATOM   1855 C CB    . VAL A 1 257 ? 44.018 17.512 20.801  1.00 15.03 ? 479 VAL A CB    1 
ATOM   1856 C CG1   . VAL A 1 257 ? 44.040 17.163 22.279  1.00 15.72 ? 479 VAL A CG1   1 
ATOM   1857 C CG2   . VAL A 1 257 ? 44.014 19.026 20.614  1.00 16.04 ? 479 VAL A CG2   1 
ATOM   1858 N N     . GLU A 1 258 ? 46.403 14.987 21.021  1.00 13.71 ? 480 GLU A N     1 
ATOM   1859 C CA    . GLU A 1 258 ? 46.607 13.586 21.386  1.00 15.75 ? 480 GLU A CA    1 
ATOM   1860 C C     . GLU A 1 258 ? 47.660 13.572 22.487  1.00 16.43 ? 480 GLU A C     1 
ATOM   1861 O O     . GLU A 1 258 ? 48.765 14.071 22.298  1.00 17.82 ? 480 GLU A O     1 
ATOM   1862 C CB    . GLU A 1 258 ? 47.092 12.773 20.180  1.00 18.73 ? 480 GLU A CB    1 
ATOM   1863 C CG    . GLU A 1 258 ? 47.299 11.297 20.480  1.00 23.18 ? 480 GLU A CG    1 
ATOM   1864 C CD    . GLU A 1 258 ? 47.677 10.490 19.252  1.00 26.85 ? 480 GLU A CD    1 
ATOM   1865 O OE1   . GLU A 1 258 ? 47.904 9.270  19.398  1.00 30.38 ? 480 GLU A OE1   1 
ATOM   1866 O OE2   . GLU A 1 258 ? 47.748 11.071 18.147  1.00 28.96 ? 480 GLU A OE2   1 
ATOM   1867 N N     . TYR A 1 259 ? 47.314 13.002 23.635  1.00 16.41 ? 481 TYR A N     1 
ATOM   1868 C CA    . TYR A 1 259 ? 48.231 12.974 24.769  1.00 17.40 ? 481 TYR A CA    1 
ATOM   1869 C C     . TYR A 1 259 ? 48.010 11.770 25.677  1.00 19.22 ? 481 TYR A C     1 
ATOM   1870 O O     . TYR A 1 259 ? 46.934 11.178 25.693  1.00 15.78 ? 481 TYR A O     1 
ATOM   1871 C CB    . TYR A 1 259 ? 48.055 14.248 25.599  1.00 18.03 ? 481 TYR A CB    1 
ATOM   1872 C CG    . TYR A 1 259 ? 46.637 14.457 26.101  1.00 17.05 ? 481 TYR A CG    1 
ATOM   1873 C CD1   . TYR A 1 259 ? 45.644 14.966 25.261  1.00 17.15 ? 481 TYR A CD1   1 
ATOM   1874 C CD2   . TYR A 1 259 ? 46.283 14.127 27.410  1.00 17.68 ? 481 TYR A CD2   1 
ATOM   1875 C CE1   . TYR A 1 259 ? 44.335 15.140 25.710  1.00 16.90 ? 481 TYR A CE1   1 
ATOM   1876 C CE2   . TYR A 1 259 ? 44.978 14.298 27.871  1.00 17.67 ? 481 TYR A CE2   1 
ATOM   1877 C CZ    . TYR A 1 259 ? 44.009 14.804 27.017  1.00 16.64 ? 481 TYR A CZ    1 
ATOM   1878 O OH    . TYR A 1 259 ? 42.723 14.979 27.474  1.00 17.78 ? 481 TYR A OH    1 
ATOM   1879 N N     . GLU A 1 260 ? 49.041 11.411 26.436  1.00 19.08 ? 482 GLU A N     1 
ATOM   1880 C CA    . GLU A 1 260 ? 48.933 10.301 27.370  1.00 21.70 ? 482 GLU A CA    1 
ATOM   1881 C C     . GLU A 1 260 ? 48.479 10.893 28.701  1.00 21.70 ? 482 GLU A C     1 
ATOM   1882 O O     . GLU A 1 260 ? 49.002 11.917 29.139  1.00 21.46 ? 482 GLU A O     1 
ATOM   1883 C CB    . GLU A 1 260 ? 50.284 9.599  27.529  1.00 23.69 ? 482 GLU A CB    1 
ATOM   1884 C CG    . GLU A 1 260 ? 50.233 8.366  28.424  1.00 28.67 ? 482 GLU A CG    1 
ATOM   1885 C CD    . GLU A 1 260 ? 51.463 7.487  28.283  1.00 31.34 ? 482 GLU A CD    1 
ATOM   1886 O OE1   . GLU A 1 260 ? 51.569 6.491  29.031  1.00 31.69 ? 482 GLU A OE1   1 
ATOM   1887 O OE2   . GLU A 1 260 ? 52.318 7.789  27.422  1.00 31.61 ? 482 GLU A OE2   1 
ATOM   1888 N N     . THR A 1 261 ? 47.496 10.260 29.333  1.00 22.35 ? 483 THR A N     1 
ATOM   1889 C CA    . THR A 1 261 ? 46.973 10.753 30.601  1.00 23.28 ? 483 THR A CA    1 
ATOM   1890 C C     . THR A 1 261 ? 47.754 10.215 31.786  1.00 23.90 ? 483 THR A C     1 
ATOM   1891 O O     . THR A 1 261 ? 48.580 9.312  31.644  1.00 23.68 ? 483 THR A O     1 
ATOM   1892 C CB    . THR A 1 261 ? 45.502 10.353 30.802  1.00 23.13 ? 483 THR A CB    1 
ATOM   1893 O OG1   . THR A 1 261 ? 45.419 8.940  31.031  1.00 23.44 ? 483 THR A OG1   1 
ATOM   1894 C CG2   . THR A 1 261 ? 44.678 10.721 29.573  1.00 22.20 ? 483 THR A CG2   1 
ATOM   1895 N N     . LYS A 1 262 ? 47.474 10.781 32.954  1.00 24.82 ? 484 LYS A N     1 
ATOM   1896 C CA    . LYS A 1 262 ? 48.124 10.373 34.191  1.00 27.40 ? 484 LYS A CA    1 
ATOM   1897 C C     . LYS A 1 262 ? 47.492 9.082  34.696  1.00 28.14 ? 484 LYS A C     1 
ATOM   1898 O O     . LYS A 1 262 ? 47.716 8.670  35.833  1.00 29.93 ? 484 LYS A O     1 
ATOM   1899 C CB    . LYS A 1 262 ? 47.980 11.478 35.240  1.00 27.52 ? 484 LYS A CB    1 
ATOM   1900 C CG    . LYS A 1 262 ? 48.638 12.789 34.831  1.00 28.03 ? 484 LYS A CG    1 
ATOM   1901 C CD    . LYS A 1 262 ? 48.346 13.905 35.818  1.00 30.18 ? 484 LYS A CD    1 
ATOM   1902 C CE    . LYS A 1 262 ? 49.013 15.201 35.382  1.00 30.38 ? 484 LYS A CE    1 
ATOM   1903 N NZ    . LYS A 1 262 ? 48.626 16.350 36.246  1.00 31.42 ? 484 LYS A NZ    1 
ATOM   1904 N N     . ALA A 1 263 ? 46.696 8.452  33.838  1.00 28.18 ? 485 ALA A N     1 
ATOM   1905 C CA    . ALA A 1 263 ? 46.029 7.202  34.174  1.00 28.16 ? 485 ALA A CA    1 
ATOM   1906 C C     . ALA A 1 263 ? 46.362 6.136  33.134  1.00 28.72 ? 485 ALA A C     1 
ATOM   1907 O O     . ALA A 1 263 ? 45.591 5.197  32.925  1.00 29.33 ? 485 ALA A O     1 
ATOM   1908 C CB    . ALA A 1 263 ? 44.523 7.416  34.246  1.00 28.08 ? 485 ALA A CB    1 
ATOM   1909 N N     . GLY A 1 264 ? 47.507 6.306  32.475  1.00 28.19 ? 486 GLY A N     1 
ATOM   1910 C CA    . GLY A 1 264 ? 47.965 5.355  31.475  1.00 27.42 ? 486 GLY A CA    1 
ATOM   1911 C C     . GLY A 1 264 ? 47.152 5.232  30.201  1.00 26.65 ? 486 GLY A C     1 
ATOM   1912 O O     . GLY A 1 264 ? 47.239 4.222  29.503  1.00 27.90 ? 486 GLY A O     1 
ATOM   1913 N N     . ARG A 1 265 ? 46.369 6.253  29.878  1.00 24.27 ? 487 ARG A N     1 
ATOM   1914 C CA    . ARG A 1 265 ? 45.555 6.203  28.675  1.00 22.43 ? 487 ARG A CA    1 
ATOM   1915 C C     . ARG A 1 265 ? 45.983 7.249  27.659  1.00 20.74 ? 487 ARG A C     1 
ATOM   1916 O O     . ARG A 1 265 ? 46.697 8.196  27.985  1.00 20.52 ? 487 ARG A O     1 
ATOM   1917 C CB    . ARG A 1 265 ? 44.080 6.411  29.030  1.00 22.82 ? 487 ARG A CB    1 
ATOM   1918 C CG    . ARG A 1 265 ? 43.511 5.362  29.973  1.00 22.49 ? 487 ARG A CG    1 
ATOM   1919 C CD    . ARG A 1 265 ? 42.017 5.555  30.160  1.00 20.97 ? 487 ARG A CD    1 
ATOM   1920 N NE    . ARG A 1 265 ? 41.370 4.374  30.723  1.00 19.67 ? 487 ARG A NE    1 
ATOM   1921 C CZ    . ARG A 1 265 ? 41.382 4.038  32.008  1.00 18.50 ? 487 ARG A CZ    1 
ATOM   1922 N NH1   . ARG A 1 265 ? 40.760 2.934  32.401  1.00 18.07 ? 487 ARG A NH1   1 
ATOM   1923 N NH2   . ARG A 1 265 ? 41.994 4.805  32.902  1.00 19.20 ? 487 ARG A NH2   1 
ATOM   1924 N N     . ILE A 1 266 ? 45.557 7.056  26.419  1.00 20.74 ? 488 ILE A N     1 
ATOM   1925 C CA    . ILE A 1 266 ? 45.857 8.006  25.362  1.00 19.09 ? 488 ILE A CA    1 
ATOM   1926 C C     . ILE A 1 266 ? 44.542 8.679  24.989  1.00 17.47 ? 488 ILE A C     1 
ATOM   1927 O O     . ILE A 1 266 ? 43.625 8.027  24.491  1.00 18.23 ? 488 ILE A O     1 
ATOM   1928 C CB    . ILE A 1 266 ? 46.448 7.308  24.118  1.00 21.42 ? 488 ILE A CB    1 
ATOM   1929 C CG1   . ILE A 1 266 ? 47.822 6.722  24.460  1.00 22.69 ? 488 ILE A CG1   1 
ATOM   1930 C CG2   . ILE A 1 266 ? 46.566 8.303  22.965  1.00 21.60 ? 488 ILE A CG2   1 
ATOM   1931 C CD1   . ILE A 1 266 ? 48.466 5.955  23.327  1.00 26.99 ? 488 ILE A CD1   1 
ATOM   1932 N N     . ASN A 1 267 ? 44.443 9.976  25.259  1.00 16.08 ? 489 ASN A N     1 
ATOM   1933 C CA    . ASN A 1 267 ? 43.232 10.724 24.930  1.00 15.36 ? 489 ASN A CA    1 
ATOM   1934 C C     . ASN A 1 267 ? 43.421 11.395 23.579  1.00 15.93 ? 489 ASN A C     1 
ATOM   1935 O O     . ASN A 1 267 ? 44.514 11.848 23.251  1.00 14.78 ? 489 ASN A O     1 
ATOM   1936 C CB    . ASN A 1 267 ? 42.936 11.798 25.986  1.00 14.01 ? 489 ASN A CB    1 
ATOM   1937 C CG    . ASN A 1 267 ? 42.261 11.242 27.237  1.00 14.13 ? 489 ASN A CG    1 
ATOM   1938 O OD1   . ASN A 1 267 ? 41.961 11.990 28.170  1.00 16.90 ? 489 ASN A OD1   1 
ATOM   1939 N ND2   . ASN A 1 267 ? 42.021 9.938  27.261  1.00 12.58 ? 489 ASN A ND2   1 
ATOM   1940 N N     . LYS A 1 268 ? 42.347 11.456 22.801  1.00 14.00 ? 490 LYS A N     1 
ATOM   1941 C CA    . LYS A 1 268 ? 42.387 12.073 21.483  1.00 14.47 ? 490 LYS A CA    1 
ATOM   1942 C C     . LYS A 1 268 ? 41.338 13.167 21.353  1.00 13.74 ? 490 LYS A C     1 
ATOM   1943 O O     . LYS A 1 268 ? 40.185 12.978 21.736  1.00 14.40 ? 490 LYS A O     1 
ATOM   1944 C CB    . LYS A 1 268 ? 42.159 11.015 20.396  1.00 16.16 ? 490 LYS A CB    1 
ATOM   1945 C CG    . LYS A 1 268 ? 43.301 10.016 20.254  1.00 20.20 ? 490 LYS A CG    1 
ATOM   1946 C CD    . LYS A 1 268 ? 43.060 9.046  19.107  1.00 24.41 ? 490 LYS A CD    1 
ATOM   1947 C CE    . LYS A 1 268 ? 44.269 8.148  18.881  1.00 26.99 ? 490 LYS A CE    1 
ATOM   1948 N NZ    . LYS A 1 268 ? 44.099 7.261  17.694  1.00 31.25 ? 490 LYS A NZ    1 
ATOM   1949 N N     . GLY A 1 269 ? 41.751 14.315 20.828  1.00 13.12 ? 491 GLY A N     1 
ATOM   1950 C CA    . GLY A 1 269 ? 40.826 15.416 20.619  1.00 13.07 ? 491 GLY A CA    1 
ATOM   1951 C C     . GLY A 1 269 ? 39.821 14.960 19.577  1.00 13.51 ? 491 GLY A C     1 
ATOM   1952 O O     . GLY A 1 269 ? 40.194 14.419 18.537  1.00 12.47 ? 491 GLY A O     1 
ATOM   1953 N N     . VAL A 1 270 ? 38.542 15.185 19.843  1.00 13.25 ? 492 VAL A N     1 
ATOM   1954 C CA    . VAL A 1 270 ? 37.498 14.735 18.937  1.00 12.31 ? 492 VAL A CA    1 
ATOM   1955 C C     . VAL A 1 270 ? 37.550 15.288 17.512  1.00 11.04 ? 492 VAL A C     1 
ATOM   1956 O O     . VAL A 1 270 ? 37.696 14.527 16.553  1.00 11.11 ? 492 VAL A O     1 
ATOM   1957 C CB    . VAL A 1 270 ? 36.097 15.029 19.519  1.00 13.18 ? 492 VAL A CB    1 
ATOM   1958 C CG1   . VAL A 1 270 ? 35.023 14.460 18.600  1.00 13.16 ? 492 VAL A CG1   1 
ATOM   1959 C CG2   . VAL A 1 270 ? 35.974 14.424 20.910  1.00 13.51 ? 492 VAL A CG2   1 
ATOM   1960 N N     . ALA A 1 271 ? 37.443 16.604 17.367  1.00 10.17 ? 493 ALA A N     1 
ATOM   1961 C CA    . ALA A 1 271 ? 37.431 17.197 16.035  1.00 11.93 ? 493 ALA A CA    1 
ATOM   1962 C C     . ALA A 1 271 ? 38.728 17.031 15.252  1.00 11.57 ? 493 ALA A C     1 
ATOM   1963 O O     . ALA A 1 271 ? 38.701 16.748 14.055  1.00 11.63 ? 493 ALA A O     1 
ATOM   1964 C CB    . ALA A 1 271 ? 37.060 18.677 16.118  1.00 12.12 ? 493 ALA A CB    1 
ATOM   1965 N N     . THR A 1 272 ? 39.869 17.191 15.917  1.00 12.18 ? 494 THR A N     1 
ATOM   1966 C CA    . THR A 1 272 ? 41.126 17.080 15.191  1.00 12.30 ? 494 THR A CA    1 
ATOM   1967 C C     . THR A 1 272 ? 41.475 15.667 14.747  1.00 11.50 ? 494 THR A C     1 
ATOM   1968 O O     . THR A 1 272 ? 42.038 15.485 13.674  1.00 13.15 ? 494 THR A O     1 
ATOM   1969 C CB    . THR A 1 272 ? 42.300 17.706 15.974  1.00 13.55 ? 494 THR A CB    1 
ATOM   1970 O OG1   . THR A 1 272 ? 42.399 17.120 17.277  1.00 12.65 ? 494 THR A OG1   1 
ATOM   1971 C CG2   . THR A 1 272 ? 42.093 19.212 16.089  1.00 13.33 ? 494 THR A CG2   1 
ATOM   1972 N N     . ASN A 1 273 ? 41.144 14.657 15.545  1.00 12.40 ? 495 ASN A N     1 
ATOM   1973 C CA    . ASN A 1 273 ? 41.426 13.296 15.106  1.00 13.21 ? 495 ASN A CA    1 
ATOM   1974 C C     . ASN A 1 273 ? 40.417 12.865 14.043  1.00 12.83 ? 495 ASN A C     1 
ATOM   1975 O O     . ASN A 1 273 ? 40.743 12.089 13.148  1.00 12.63 ? 495 ASN A O     1 
ATOM   1976 C CB    . ASN A 1 273 ? 41.442 12.350 16.303  1.00 14.65 ? 495 ASN A CB    1 
ATOM   1977 C CG    . ASN A 1 273 ? 42.757 12.416 17.052  1.00 15.01 ? 495 ASN A CG    1 
ATOM   1978 O OD1   . ASN A 1 273 ? 43.727 11.752 16.679  1.00 17.44 ? 495 ASN A OD1   1 
ATOM   1979 N ND2   . ASN A 1 273 ? 42.809 13.241 18.088  1.00 15.12 ? 495 ASN A ND2   1 
ATOM   1980 N N     . TRP A 1 274 ? 39.200 13.391 14.132  1.00 12.41 ? 496 TRP A N     1 
ATOM   1981 C CA    . TRP A 1 274 ? 38.158 13.101 13.151  1.00 12.38 ? 496 TRP A CA    1 
ATOM   1982 C C     . TRP A 1 274 ? 38.590 13.715 11.814  1.00 12.44 ? 496 TRP A C     1 
ATOM   1983 O O     . TRP A 1 274 ? 38.502 13.074 10.770  1.00 12.76 ? 496 TRP A O     1 
ATOM   1984 C CB    . TRP A 1 274 ? 36.844 13.713 13.630  1.00 12.53 ? 496 TRP A CB    1 
ATOM   1985 C CG    . TRP A 1 274 ? 35.719 13.725 12.645  1.00 12.37 ? 496 TRP A CG    1 
ATOM   1986 C CD1   . TRP A 1 274 ? 34.991 12.655 12.196  1.00 14.33 ? 496 TRP A CD1   1 
ATOM   1987 C CD2   . TRP A 1 274 ? 35.119 14.889 12.072  1.00 12.02 ? 496 TRP A CD2   1 
ATOM   1988 N NE1   . TRP A 1 274 ? 33.965 13.091 11.384  1.00 12.89 ? 496 TRP A NE1   1 
ATOM   1989 C CE2   . TRP A 1 274 ? 34.022 14.457 11.294  1.00 12.25 ? 496 TRP A CE2   1 
ATOM   1990 C CE3   . TRP A 1 274 ? 35.401 16.259 12.147  1.00 12.05 ? 496 TRP A CE3   1 
ATOM   1991 C CZ2   . TRP A 1 274 ? 33.201 15.349 10.595  1.00 13.26 ? 496 TRP A CZ2   1 
ATOM   1992 C CZ3   . TRP A 1 274 ? 34.584 17.150 11.452  1.00 11.99 ? 496 TRP A CZ3   1 
ATOM   1993 C CH2   . TRP A 1 274 ? 33.497 16.688 10.687  1.00 13.17 ? 496 TRP A CH2   1 
ATOM   1994 N N     . LEU A 1 275 ? 39.076 14.953 11.853  1.00 11.74 ? 497 LEU A N     1 
ATOM   1995 C CA    . LEU A 1 275 ? 39.539 15.616 10.635  1.00 13.28 ? 497 LEU A CA    1 
ATOM   1996 C C     . LEU A 1 275 ? 40.783 14.927 10.079  1.00 14.17 ? 497 LEU A C     1 
ATOM   1997 O O     . LEU A 1 275 ? 40.909 14.744 8.868   1.00 13.83 ? 497 LEU A O     1 
ATOM   1998 C CB    . LEU A 1 275 ? 39.852 17.091 10.910  1.00 13.04 ? 497 LEU A CB    1 
ATOM   1999 C CG    . LEU A 1 275 ? 38.663 18.030 11.152  1.00 14.04 ? 497 LEU A CG    1 
ATOM   2000 C CD1   . LEU A 1 275 ? 39.181 19.386 11.616  1.00 14.62 ? 497 LEU A CD1   1 
ATOM   2001 C CD2   . LEU A 1 275 ? 37.837 18.174 9.876   1.00 16.23 ? 497 LEU A CD2   1 
ATOM   2002 N N     . ARG A 1 276 ? 41.697 14.535 10.959  1.00 12.69 ? 498 ARG A N     1 
ATOM   2003 C CA    . ARG A 1 276 ? 42.911 13.875 10.503  1.00 14.79 ? 498 ARG A CA    1 
ATOM   2004 C C     . ARG A 1 276 ? 42.582 12.597 9.739   1.00 15.23 ? 498 ARG A C     1 
ATOM   2005 O O     . ARG A 1 276 ? 43.289 12.226 8.797   1.00 15.82 ? 498 ARG A O     1 
ATOM   2006 C CB    . ARG A 1 276 ? 43.826 13.546 11.687  1.00 13.56 ? 498 ARG A CB    1 
ATOM   2007 C CG    . ARG A 1 276 ? 45.122 12.874 11.271  1.00 16.51 ? 498 ARG A CG    1 
ATOM   2008 C CD    . ARG A 1 276 ? 45.979 12.469 12.456  1.00 17.69 ? 498 ARG A CD    1 
ATOM   2009 N NE    . ARG A 1 276 ? 47.259 11.935 11.998  1.00 20.60 ? 498 ARG A NE    1 
ATOM   2010 C CZ    . ARG A 1 276 ? 48.269 11.615 12.800  1.00 21.16 ? 498 ARG A CZ    1 
ATOM   2011 N NH1   . ARG A 1 276 ? 48.152 11.772 14.112  1.00 20.98 ? 498 ARG A NH1   1 
ATOM   2012 N NH2   . ARG A 1 276 ? 49.399 11.146 12.285  1.00 20.25 ? 498 ARG A NH2   1 
ATOM   2013 N N     . ALA A 1 277 ? 41.507 11.927 10.146  1.00 14.93 ? 499 ALA A N     1 
ATOM   2014 C CA    . ALA A 1 277 ? 41.093 10.683 9.507   1.00 16.15 ? 499 ALA A CA    1 
ATOM   2015 C C     . ALA A 1 277 ? 40.288 10.873 8.222   1.00 15.74 ? 499 ALA A C     1 
ATOM   2016 O O     . ALA A 1 277 ? 40.000 9.901  7.518   1.00 16.64 ? 499 ALA A O     1 
ATOM   2017 C CB    . ALA A 1 277 ? 40.306 9.837  10.495  1.00 16.06 ? 499 ALA A CB    1 
ATOM   2018 N N     . LYS A 1 278 ? 39.913 12.112 7.913   1.00 15.43 ? 500 LYS A N     1 
ATOM   2019 C CA    . LYS A 1 278 ? 39.155 12.382 6.695   1.00 16.88 ? 500 LYS A CA    1 
ATOM   2020 C C     . LYS A 1 278 ? 40.014 12.171 5.452   1.00 19.49 ? 500 LYS A C     1 
ATOM   2021 O O     . LYS A 1 278 ? 40.848 13.005 5.108   1.00 20.98 ? 500 LYS A O     1 
ATOM   2022 C CB    . LYS A 1 278 ? 38.602 13.812 6.707   1.00 16.95 ? 500 LYS A CB    1 
ATOM   2023 C CG    . LYS A 1 278 ? 37.404 14.007 7.626   1.00 15.87 ? 500 LYS A CG    1 
ATOM   2024 C CD    . LYS A 1 278 ? 36.193 13.231 7.125   1.00 15.91 ? 500 LYS A CD    1 
ATOM   2025 C CE    . LYS A 1 278 ? 35.040 13.287 8.119   1.00 16.52 ? 500 LYS A CE    1 
ATOM   2026 N NZ    . LYS A 1 278 ? 33.872 12.508 7.633   1.00 15.96 ? 500 LYS A NZ    1 
ATOM   2027 N N     . GLU A 1 279 ? 39.797 11.041 4.789   1.00 20.74 ? 501 GLU A N     1 
ATOM   2028 C CA    . GLU A 1 279 ? 40.524 10.687 3.578   1.00 22.11 ? 501 GLU A CA    1 
ATOM   2029 C C     . GLU A 1 279 ? 39.772 11.262 2.381   1.00 20.83 ? 501 GLU A C     1 
ATOM   2030 O O     . GLU A 1 279 ? 38.650 10.848 2.102   1.00 21.78 ? 501 GLU A O     1 
ATOM   2031 C CB    . GLU A 1 279 ? 40.595 9.164  3.452   1.00 23.87 ? 501 GLU A CB    1 
ATOM   2032 C CG    . GLU A 1 279 ? 41.380 8.682  2.252   1.00 26.66 ? 501 GLU A CG    1 
ATOM   2033 C CD    . GLU A 1 279 ? 42.871 8.878  2.427   1.00 28.47 ? 501 GLU A CD    1 
ATOM   2034 O OE1   . GLU A 1 279 ? 43.575 8.997  1.406   1.00 30.43 ? 501 GLU A OE1   1 
ATOM   2035 O OE2   . GLU A 1 279 ? 43.337 8.899  3.585   1.00 29.59 ? 501 GLU A OE2   1 
ATOM   2036 N N     . PRO A 1 280 ? 40.394 12.209 1.686   1.00 20.31 ? 502 PRO A N     1 
ATOM   2037 C CA    . PRO A 1 280 ? 39.773 12.840 0.517   1.00 20.92 ? 502 PRO A CA    1 
ATOM   2038 C C     . PRO A 1 280 ? 39.369 11.813 -0.535  1.00 22.40 ? 502 PRO A C     1 
ATOM   2039 O O     . PRO A 1 280 ? 38.593 12.128 -1.437  1.00 23.07 ? 502 PRO A O     1 
ATOM   2040 C CB    . PRO A 1 280 ? 40.888 13.736 -0.024  1.00 19.17 ? 502 PRO A CB    1 
ATOM   2041 C CG    . PRO A 1 280 ? 41.713 14.062 1.169   1.00 18.11 ? 502 PRO A CG    1 
ATOM   2042 C CD    . PRO A 1 280 ? 41.678 12.839 2.040   1.00 19.88 ? 502 PRO A CD    1 
ATOM   2043 N N     . VAL A 1 281 ? 39.893 10.598 -0.415  1.00 25.36 ? 503 VAL A N     1 
ATOM   2044 C CA    . VAL A 1 281 ? 39.583 9.533  -1.361  1.00 28.18 ? 503 VAL A CA    1 
ATOM   2045 C C     . VAL A 1 281 ? 38.752 8.435  -0.705  1.00 28.84 ? 503 VAL A C     1 
ATOM   2046 O O     . VAL A 1 281 ? 37.529 8.541  -0.613  1.00 30.08 ? 503 VAL A O     1 
ATOM   2047 C CB    . VAL A 1 281 ? 40.863 8.911  -1.951  1.00 29.62 ? 503 VAL A CB    1 
ATOM   2048 C CG1   . VAL A 1 281 ? 40.666 7.423  -2.195  1.00 28.97 ? 503 VAL A CG1   1 
ATOM   2049 C CG2   . VAL A 1 281 ? 41.253 9.623  -3.237  1.00 29.86 ? 503 VAL A CG2   1 
ATOM   2050 N N     . GLY A 1 282 ? 39.424 7.382  -0.251  1.00 30.51 ? 504 GLY A N     1 
ATOM   2051 C CA    . GLY A 1 282 ? 38.752 6.268  0.390   1.00 31.85 ? 504 GLY A CA    1 
ATOM   2052 C C     . GLY A 1 282 ? 38.288 5.223  -0.605  1.00 31.79 ? 504 GLY A C     1 
ATOM   2053 O O     . GLY A 1 282 ? 37.446 5.498  -1.461  1.00 32.06 ? 504 GLY A O     1 
ATOM   2054 N N     . GLU A 1 283 ? 38.720 4.049  -0.448  1.00 33.08 ? 505 GLU A N     1 
ATOM   2055 C CA    . GLU A 1 283 ? 38.378 3.081  -1.452  1.00 33.33 ? 505 GLU A CA    1 
ATOM   2056 C C     . GLU A 1 283 ? 36.903 3.154  -1.792  1.00 33.45 ? 505 GLU A C     1 
ATOM   2057 O O     . GLU A 1 283 ? 36.151 3.931  -1.422  1.00 34.40 ? 505 GLU A O     1 
ATOM   2058 C CB    . GLU A 1 283 ? 38.867 1.703  -1.054  1.00 34.06 ? 505 GLU A CB    1 
ATOM   2059 C CG    . GLU A 1 283 ? 38.367 1.309  0.228   1.00 35.21 ? 505 GLU A CG    1 
ATOM   2060 C CD    . GLU A 1 283 ? 39.238 0.207  0.972   1.00 36.06 ? 505 GLU A CD    1 
ATOM   2061 O OE1   . GLU A 1 283 ? 39.570 -0.857 0.449   1.00 36.41 ? 505 GLU A OE1   1 
ATOM   2062 O OE2   . GLU A 1 283 ? 39.567 0.377  2.176   1.00 36.85 ? 505 GLU A OE2   1 
ATOM   2063 N N     . ASN A 1 284 ? 36.492 2.344  -2.661  1.00 33.41 ? 506 ASN A N     1 
ATOM   2064 C CA    . ASN A 1 284 ? 35.063 2.360  -2.950  1.00 31.23 ? 506 ASN A CA    1 
ATOM   2065 C C     . ASN A 1 284 ? 34.670 3.794  -3.279  1.00 30.61 ? 506 ASN A C     1 
ATOM   2066 O O     . ASN A 1 284 ? 33.487 4.137  -3.311  1.00 30.11 ? 506 ASN A O     1 
ATOM   2067 C CB    . ASN A 1 284 ? 34.278 1.886  -1.725  1.00 30.11 ? 506 ASN A CB    1 
ATOM   2068 C CG    . ASN A 1 284 ? 34.870 0.639  -1.103  1.00 30.17 ? 506 ASN A CG    1 
ATOM   2069 O OD1   . ASN A 1 284 ? 34.630 0.342  0.068   1.00 30.27 ? 506 ASN A OD1   1 
ATOM   2070 N ND2   . ASN A 1 284 ? 35.644 -0.104 -1.888  1.00 30.04 ? 506 ASN A ND2   1 
ATOM   2071 N N     . GLY A 1 285 ? 35.675 4.628  -3.528  1.00 30.88 ? 507 GLY A N     1 
ATOM   2072 C CA    . GLY A 1 285 ? 35.417 6.020  -3.829  1.00 31.24 ? 507 GLY A CA    1 
ATOM   2073 C C     . GLY A 1 285 ? 35.014 6.705  -2.540  1.00 31.03 ? 507 GLY A C     1 
ATOM   2074 O O     . GLY A 1 285 ? 35.770 6.705  -1.571  1.00 32.56 ? 507 GLY A O     1 
ATOM   2075 N N     . GLY A 1 286 ? 33.815 7.274  -2.521  1.00 30.11 ? 508 GLY A N     1 
ATOM   2076 C CA    . GLY A 1 286 ? 33.343 7.945  -1.327  1.00 28.39 ? 508 GLY A CA    1 
ATOM   2077 C C     . GLY A 1 286 ? 34.206 9.131  -0.953  1.00 26.52 ? 508 GLY A C     1 
ATOM   2078 O O     . GLY A 1 286 ? 35.385 8.985  -0.626  1.00 26.26 ? 508 GLY A O     1 
ATOM   2079 N N     . ARG A 1 287 ? 33.616 10.317 -1.011  1.00 24.38 ? 509 ARG A N     1 
ATOM   2080 C CA    . ARG A 1 287 ? 34.333 11.533 -0.664  1.00 22.44 ? 509 ARG A CA    1 
ATOM   2081 C C     . ARG A 1 287 ? 34.128 11.818 0.817   1.00 22.76 ? 509 ARG A C     1 
ATOM   2082 O O     . ARG A 1 287 ? 33.023 11.666 1.342   1.00 24.09 ? 509 ARG A O     1 
ATOM   2083 C CB    . ARG A 1 287 ? 33.821 12.697 -1.499  1.00 22.64 ? 509 ARG A CB    1 
ATOM   2084 N N     . ALA A 1 288 ? 35.202 12.215 1.487   1.00 19.67 ? 510 ALA A N     1 
ATOM   2085 C CA    . ALA A 1 288 ? 35.144 12.532 2.908   1.00 18.15 ? 510 ALA A CA    1 
ATOM   2086 C C     . ALA A 1 288 ? 34.377 13.838 3.073   1.00 17.16 ? 510 ALA A C     1 
ATOM   2087 O O     . ALA A 1 288 ? 34.762 14.865 2.516   1.00 19.13 ? 510 ALA A O     1 
ATOM   2088 C CB    . ALA A 1 288 ? 36.554 12.676 3.464   1.00 17.95 ? 510 ALA A CB    1 
ATOM   2089 N N     . LEU A 1 289 ? 33.291 13.798 3.835   1.00 15.95 ? 511 LEU A N     1 
ATOM   2090 C CA    . LEU A 1 289 ? 32.478 14.990 4.042   1.00 14.34 ? 511 LEU A CA    1 
ATOM   2091 C C     . LEU A 1 289 ? 32.570 15.541 5.458   1.00 13.61 ? 511 LEU A C     1 
ATOM   2092 O O     . LEU A 1 289 ? 32.615 14.790 6.433   1.00 13.99 ? 511 LEU A O     1 
ATOM   2093 C CB    . LEU A 1 289 ? 31.018 14.687 3.701   1.00 15.25 ? 511 LEU A CB    1 
ATOM   2094 C CG    . LEU A 1 289 ? 30.765 14.160 2.287   1.00 14.77 ? 511 LEU A CG    1 
ATOM   2095 C CD1   . LEU A 1 289 ? 29.294 13.818 2.130   1.00 14.43 ? 511 LEU A CD1   1 
ATOM   2096 C CD2   . LEU A 1 289 ? 31.184 15.197 1.267   1.00 16.30 ? 511 LEU A CD2   1 
ATOM   2097 N N     . VAL A 1 290 ? 32.592 16.865 5.558   1.00 13.22 ? 512 VAL A N     1 
ATOM   2098 C CA    . VAL A 1 290 ? 32.671 17.556 6.839   1.00 13.07 ? 512 VAL A CA    1 
ATOM   2099 C C     . VAL A 1 290 ? 31.507 18.534 6.967   1.00 13.00 ? 512 VAL A C     1 
ATOM   2100 O O     . VAL A 1 290 ? 31.421 19.493 6.208   1.00 12.83 ? 512 VAL A O     1 
ATOM   2101 C CB    . VAL A 1 290 ? 34.003 18.345 6.954   1.00 13.41 ? 512 VAL A CB    1 
ATOM   2102 C CG1   . VAL A 1 290 ? 33.981 19.264 8.163   1.00 13.80 ? 512 VAL A CG1   1 
ATOM   2103 C CG2   . VAL A 1 290 ? 35.165 17.373 7.056   1.00 13.32 ? 512 VAL A CG2   1 
ATOM   2104 N N     . PRO A 1 291 ? 30.578 18.285 7.910   1.00 12.13 ? 513 PRO A N     1 
ATOM   2105 C CA    . PRO A 1 291 ? 29.444 19.205 8.081   1.00 11.37 ? 513 PRO A CA    1 
ATOM   2106 C C     . PRO A 1 291 ? 29.993 20.508 8.659   1.00 11.96 ? 513 PRO A C     1 
ATOM   2107 O O     . PRO A 1 291 ? 30.637 20.500 9.713   1.00 12.50 ? 513 PRO A O     1 
ATOM   2108 C CB    . PRO A 1 291 ? 28.537 18.473 9.075   1.00 12.24 ? 513 PRO A CB    1 
ATOM   2109 C CG    . PRO A 1 291 ? 28.890 17.021 8.880   1.00 12.10 ? 513 PRO A CG    1 
ATOM   2110 C CD    . PRO A 1 291 ? 30.397 17.070 8.723   1.00 11.12 ? 513 PRO A CD    1 
ATOM   2111 N N     . MET A 1 292 ? 29.741 21.622 7.982   1.00 12.89 ? 514 MET A N     1 
ATOM   2112 C CA    . MET A 1 292 ? 30.272 22.898 8.436   1.00 12.81 ? 514 MET A CA    1 
ATOM   2113 C C     . MET A 1 292 ? 29.395 24.106 8.153   1.00 12.75 ? 514 MET A C     1 
ATOM   2114 O O     . MET A 1 292 ? 28.394 24.020 7.446   1.00 12.04 ? 514 MET A O     1 
ATOM   2115 C CB    . MET A 1 292 ? 31.651 23.129 7.793   1.00 13.64 ? 514 MET A CB    1 
ATOM   2116 C CG    . MET A 1 292 ? 31.700 22.980 6.258   1.00 13.64 ? 514 MET A CG    1 
ATOM   2117 S SD    . MET A 1 292 ? 30.883 24.293 5.277   1.00 15.72 ? 514 MET A SD    1 
ATOM   2118 C CE    . MET A 1 292 ? 32.044 25.658 5.465   1.00 14.03 ? 514 MET A CE    1 
ATOM   2119 N N     . PHE A 1 293 ? 29.773 25.231 8.749   1.00 13.76 ? 515 PHE A N     1 
ATOM   2120 C CA    . PHE A 1 293 ? 29.105 26.502 8.513   1.00 14.23 ? 515 PHE A CA    1 
ATOM   2121 C C     . PHE A 1 293 ? 30.088 27.610 8.853   1.00 13.82 ? 515 PHE A C     1 
ATOM   2122 O O     . PHE A 1 293 ? 31.067 27.385 9.562   1.00 13.35 ? 515 PHE A O     1 
ATOM   2123 C CB    . PHE A 1 293 ? 27.787 26.653 9.303   1.00 14.58 ? 515 PHE A CB    1 
ATOM   2124 C CG    . PHE A 1 293 ? 27.942 26.674 10.795  1.00 14.23 ? 515 PHE A CG    1 
ATOM   2125 C CD1   . PHE A 1 293 ? 27.858 25.499 11.533  1.00 14.92 ? 515 PHE A CD1   1 
ATOM   2126 C CD2   . PHE A 1 293 ? 28.107 27.881 11.473  1.00 15.36 ? 515 PHE A CD2   1 
ATOM   2127 C CE1   . PHE A 1 293 ? 27.929 25.529 12.928  1.00 16.34 ? 515 PHE A CE1   1 
ATOM   2128 C CE2   . PHE A 1 293 ? 28.182 27.922 12.863  1.00 15.42 ? 515 PHE A CE2   1 
ATOM   2129 C CZ    . PHE A 1 293 ? 28.090 26.744 13.592  1.00 15.89 ? 515 PHE A CZ    1 
ATOM   2130 N N     . VAL A 1 294 ? 29.852 28.794 8.307   1.00 13.88 ? 516 VAL A N     1 
ATOM   2131 C CA    . VAL A 1 294 ? 30.737 29.924 8.547   1.00 13.42 ? 516 VAL A CA    1 
ATOM   2132 C C     . VAL A 1 294 ? 30.158 30.884 9.576   1.00 14.27 ? 516 VAL A C     1 
ATOM   2133 O O     . VAL A 1 294 ? 28.981 31.244 9.510   1.00 15.30 ? 516 VAL A O     1 
ATOM   2134 C CB    . VAL A 1 294 ? 30.998 30.704 7.233   1.00 13.83 ? 516 VAL A CB    1 
ATOM   2135 C CG1   . VAL A 1 294 ? 31.769 31.987 7.524   1.00 14.36 ? 516 VAL A CG1   1 
ATOM   2136 C CG2   . VAL A 1 294 ? 31.763 29.825 6.251   1.00 14.81 ? 516 VAL A CG2   1 
ATOM   2137 N N     . ARG A 1 295 ? 30.983 31.281 10.537  1.00 13.39 ? 517 ARG A N     1 
ATOM   2138 C CA    . ARG A 1 295 ? 30.555 32.240 11.547  1.00 14.52 ? 517 ARG A CA    1 
ATOM   2139 C C     . ARG A 1 295 ? 31.336 33.519 11.276  1.00 13.72 ? 517 ARG A C     1 
ATOM   2140 O O     . ARG A 1 295 ? 32.566 33.545 11.378  1.00 14.99 ? 517 ARG A O     1 
ATOM   2141 C CB    . ARG A 1 295 ? 30.849 31.739 12.962  1.00 15.39 ? 517 ARG A CB    1 
ATOM   2142 C CG    . ARG A 1 295 ? 30.271 32.660 14.035  1.00 15.16 ? 517 ARG A CG    1 
ATOM   2143 C CD    . ARG A 1 295 ? 30.579 32.181 15.440  1.00 16.45 ? 517 ARG A CD    1 
ATOM   2144 N NE    . ARG A 1 295 ? 32.006 32.245 15.733  1.00 17.12 ? 517 ARG A NE    1 
ATOM   2145 C CZ    . ARG A 1 295 ? 32.560 31.784 16.849  1.00 18.49 ? 517 ARG A CZ    1 
ATOM   2146 N NH1   . ARG A 1 295 ? 31.806 31.220 17.785  1.00 19.88 ? 517 ARG A NH1   1 
ATOM   2147 N NH2   . ARG A 1 295 ? 33.869 31.884 17.028  1.00 18.81 ? 517 ARG A NH2   1 
ATOM   2148 N N     . LYS A 1 296 ? 30.612 34.572 10.914  1.00 15.27 ? 518 LYS A N     1 
ATOM   2149 C CA    . LYS A 1 296 ? 31.214 35.858 10.599  1.00 17.19 ? 518 LYS A CA    1 
ATOM   2150 C C     . LYS A 1 296 ? 31.905 36.474 11.809  1.00 17.29 ? 518 LYS A C     1 
ATOM   2151 O O     . LYS A 1 296 ? 31.358 36.477 12.913  1.00 18.00 ? 518 LYS A O     1 
ATOM   2152 C CB    . LYS A 1 296 ? 30.130 36.809 10.079  1.00 19.26 ? 518 LYS A CB    1 
ATOM   2153 C CG    . LYS A 1 296 ? 30.647 38.117 9.514   1.00 23.07 ? 518 LYS A CG    1 
ATOM   2154 C CD    . LYS A 1 296 ? 29.501 39.002 9.034   1.00 25.93 ? 518 LYS A CD    1 
ATOM   2155 C CE    . LYS A 1 296 ? 28.684 38.324 7.942   1.00 26.89 ? 518 LYS A CE    1 
ATOM   2156 N NZ    . LYS A 1 296 ? 27.582 39.197 7.438   1.00 29.22 ? 518 LYS A NZ    1 
ATOM   2157 N N     . SER A 1 297 ? 33.114 36.988 11.594  1.00 16.65 ? 519 SER A N     1 
ATOM   2158 C CA    . SER A 1 297 ? 33.886 37.631 12.654  1.00 17.75 ? 519 SER A CA    1 
ATOM   2159 C C     . SER A 1 297 ? 34.133 39.082 12.258  1.00 17.70 ? 519 SER A C     1 
ATOM   2160 O O     . SER A 1 297 ? 33.740 39.512 11.176  1.00 18.76 ? 519 SER A O     1 
ATOM   2161 C CB    . SER A 1 297 ? 35.236 36.938 12.834  1.00 17.61 ? 519 SER A CB    1 
ATOM   2162 O OG    . SER A 1 297 ? 36.140 37.341 11.818  1.00 19.91 ? 519 SER A OG    1 
ATOM   2163 N N     . GLN A 1 298 ? 34.782 39.833 13.145  1.00 19.57 ? 520 GLN A N     1 
ATOM   2164 C CA    . GLN A 1 298 ? 35.105 41.229 12.871  1.00 20.60 ? 520 GLN A CA    1 
ATOM   2165 C C     . GLN A 1 298 ? 36.606 41.354 12.609  1.00 20.61 ? 520 GLN A C     1 
ATOM   2166 O O     . GLN A 1 298 ? 37.159 42.453 12.587  1.00 22.45 ? 520 GLN A O     1 
ATOM   2167 C CB    . GLN A 1 298 ? 34.709 42.116 14.054  1.00 23.47 ? 520 GLN A CB    1 
ATOM   2168 C CG    . GLN A 1 298 ? 33.216 42.130 14.336  1.00 26.80 ? 520 GLN A CG    1 
ATOM   2169 C CD    . GLN A 1 298 ? 32.399 42.487 13.110  1.00 30.05 ? 520 GLN A CD    1 
ATOM   2170 O OE1   . GLN A 1 298 ? 32.589 43.547 12.510  1.00 32.33 ? 520 GLN A OE1   1 
ATOM   2171 N NE2   . GLN A 1 298 ? 31.485 41.601 12.729  1.00 30.68 ? 520 GLN A NE2   1 
ATOM   2172 N N     . PHE A 1 299 ? 37.257 40.212 12.420  1.00 18.70 ? 521 PHE A N     1 
ATOM   2173 C CA    . PHE A 1 299 ? 38.695 40.161 12.156  1.00 17.85 ? 521 PHE A CA    1 
ATOM   2174 C C     . PHE A 1 299 ? 38.797 40.361 10.643  1.00 18.15 ? 521 PHE A C     1 
ATOM   2175 O O     . PHE A 1 299 ? 38.476 39.457 9.871   1.00 17.40 ? 521 PHE A O     1 
ATOM   2176 C CB    . PHE A 1 299 ? 39.220 38.787 12.587  1.00 17.32 ? 521 PHE A CB    1 
ATOM   2177 C CG    . PHE A 1 299 ? 40.695 38.746 12.885  1.00 15.61 ? 521 PHE A CG    1 
ATOM   2178 C CD1   . PHE A 1 299 ? 41.582 38.192 11.972  1.00 16.80 ? 521 PHE A CD1   1 
ATOM   2179 C CD2   . PHE A 1 299 ? 41.186 39.203 14.105  1.00 17.28 ? 521 PHE A CD2   1 
ATOM   2180 C CE1   . PHE A 1 299 ? 42.939 38.083 12.274  1.00 18.03 ? 521 PHE A CE1   1 
ATOM   2181 C CE2   . PHE A 1 299 ? 42.542 39.098 14.415  1.00 17.63 ? 521 PHE A CE2   1 
ATOM   2182 C CZ    . PHE A 1 299 ? 43.417 38.536 13.498  1.00 18.08 ? 521 PHE A CZ    1 
ATOM   2183 N N     . ARG A 1 300 ? 39.236 41.546 10.221  1.00 17.16 ? 522 ARG A N     1 
ATOM   2184 C CA    . ARG A 1 300 ? 39.290 41.864 8.794   1.00 17.12 ? 522 ARG A CA    1 
ATOM   2185 C C     . ARG A 1 300 ? 40.460 42.719 8.336   1.00 16.49 ? 522 ARG A C     1 
ATOM   2186 O O     . ARG A 1 300 ? 40.927 43.589 9.064   1.00 17.08 ? 522 ARG A O     1 
ATOM   2187 C CB    . ARG A 1 300 ? 38.016 42.609 8.397   1.00 17.56 ? 522 ARG A CB    1 
ATOM   2188 C CG    . ARG A 1 300 ? 36.748 41.795 8.430   1.00 18.08 ? 522 ARG A CG    1 
ATOM   2189 C CD    . ARG A 1 300 ? 36.608 40.980 7.166   1.00 19.66 ? 522 ARG A CD    1 
ATOM   2190 N NE    . ARG A 1 300 ? 35.302 40.340 7.096   1.00 17.95 ? 522 ARG A NE    1 
ATOM   2191 C CZ    . ARG A 1 300 ? 34.955 39.274 7.805   1.00 19.72 ? 522 ARG A CZ    1 
ATOM   2192 N NH1   . ARG A 1 300 ? 35.823 38.720 8.641   1.00 18.62 ? 522 ARG A NH1   1 
ATOM   2193 N NH2   . ARG A 1 300 ? 33.739 38.762 7.678   1.00 20.13 ? 522 ARG A NH2   1 
ATOM   2194 N N     . LEU A 1 301 ? 40.902 42.481 7.105   1.00 16.61 ? 523 LEU A N     1 
ATOM   2195 C CA    . LEU A 1 301 ? 41.972 43.273 6.506   1.00 16.86 ? 523 LEU A CA    1 
ATOM   2196 C C     . LEU A 1 301 ? 41.418 44.688 6.339   1.00 17.17 ? 523 LEU A C     1 
ATOM   2197 O O     . LEU A 1 301 ? 40.201 44.884 6.306   1.00 17.78 ? 523 LEU A O     1 
ATOM   2198 C CB    . LEU A 1 301 ? 42.344 42.718 5.126   1.00 17.03 ? 523 LEU A CB    1 
ATOM   2199 C CG    . LEU A 1 301 ? 43.278 41.509 5.057   1.00 17.50 ? 523 LEU A CG    1 
ATOM   2200 C CD1   . LEU A 1 301 ? 43.255 40.907 3.665   1.00 17.54 ? 523 LEU A CD1   1 
ATOM   2201 C CD2   . LEU A 1 301 ? 44.688 41.952 5.426   1.00 19.16 ? 523 LEU A CD2   1 
ATOM   2202 N N     . PRO A 1 302 ? 42.302 45.691 6.235   1.00 17.57 ? 524 PRO A N     1 
ATOM   2203 C CA    . PRO A 1 302 ? 41.879 47.086 6.067   1.00 18.52 ? 524 PRO A CA    1 
ATOM   2204 C C     . PRO A 1 302 ? 41.057 47.252 4.794   1.00 18.11 ? 524 PRO A C     1 
ATOM   2205 O O     . PRO A 1 302 ? 41.271 46.538 3.815   1.00 18.22 ? 524 PRO A O     1 
ATOM   2206 C CB    . PRO A 1 302 ? 43.206 47.841 5.983   1.00 18.20 ? 524 PRO A CB    1 
ATOM   2207 C CG    . PRO A 1 302 ? 44.140 46.985 6.773   1.00 19.15 ? 524 PRO A CG    1 
ATOM   2208 C CD    . PRO A 1 302 ? 43.769 45.597 6.324   1.00 17.20 ? 524 PRO A CD    1 
ATOM   2209 N N     . PHE A 1 303 ? 40.123 48.197 4.807   1.00 19.32 ? 525 PHE A N     1 
ATOM   2210 C CA    . PHE A 1 303 ? 39.291 48.446 3.637   1.00 20.06 ? 525 PHE A CA    1 
ATOM   2211 C C     . PHE A 1 303 ? 40.157 48.840 2.442   1.00 20.02 ? 525 PHE A C     1 
ATOM   2212 O O     . PHE A 1 303 ? 39.915 48.399 1.317   1.00 20.50 ? 525 PHE A O     1 
ATOM   2213 C CB    . PHE A 1 303 ? 38.272 49.548 3.941   1.00 22.12 ? 525 PHE A CB    1 
ATOM   2214 C CG    . PHE A 1 303 ? 37.390 49.893 2.775   1.00 23.92 ? 525 PHE A CG    1 
ATOM   2215 C CD1   . PHE A 1 303 ? 37.679 50.989 1.965   1.00 24.53 ? 525 PHE A CD1   1 
ATOM   2216 C CD2   . PHE A 1 303 ? 36.283 49.111 2.474   1.00 24.93 ? 525 PHE A CD2   1 
ATOM   2217 C CE1   . PHE A 1 303 ? 36.872 51.299 0.869   1.00 25.59 ? 525 PHE A CE1   1 
ATOM   2218 C CE2   . PHE A 1 303 ? 35.469 49.413 1.378   1.00 26.01 ? 525 PHE A CE2   1 
ATOM   2219 C CZ    . PHE A 1 303 ? 35.768 50.510 0.576   1.00 24.65 ? 525 PHE A CZ    1 
ATOM   2220 N N     . LYS A 1 304 ? 41.168 49.667 2.690   1.00 21.65 ? 526 LYS A N     1 
ATOM   2221 C CA    . LYS A 1 304 ? 42.073 50.104 1.633   1.00 21.73 ? 526 LYS A CA    1 
ATOM   2222 C C     . LYS A 1 304 ? 43.313 49.223 1.619   1.00 21.74 ? 526 LYS A C     1 
ATOM   2223 O O     . LYS A 1 304 ? 43.999 49.086 2.632   1.00 21.01 ? 526 LYS A O     1 
ATOM   2224 C CB    . LYS A 1 304 ? 42.478 51.564 1.839   1.00 22.95 ? 526 LYS A CB    1 
ATOM   2225 C CG    . LYS A 1 304 ? 41.311 52.537 1.808   1.00 25.66 ? 526 LYS A CG    1 
ATOM   2226 C CD    . LYS A 1 304 ? 41.787 53.976 1.678   1.00 26.40 ? 526 LYS A CD    1 
ATOM   2227 C CE    . LYS A 1 304 ? 42.693 54.382 2.827   1.00 27.76 ? 526 LYS A CE    1 
ATOM   2228 N NZ    . LYS A 1 304 ? 43.139 55.802 2.701   1.00 28.97 ? 526 LYS A NZ    1 
ATOM   2229 N N     . ALA A 1 305 ? 43.593 48.630 0.464   1.00 20.68 ? 527 ALA A N     1 
ATOM   2230 C CA    . ALA A 1 305 ? 44.738 47.741 0.310   1.00 20.33 ? 527 ALA A CA    1 
ATOM   2231 C C     . ALA A 1 305 ? 46.069 48.435 0.568   1.00 20.52 ? 527 ALA A C     1 
ATOM   2232 O O     . ALA A 1 305 ? 47.069 47.778 0.865   1.00 19.18 ? 527 ALA A O     1 
ATOM   2233 C CB    . ALA A 1 305 ? 44.733 47.128 -1.086  1.00 21.95 ? 527 ALA A CB    1 
ATOM   2234 N N     . THR A 1 306 ? 46.082 49.759 0.460   1.00 21.23 ? 528 THR A N     1 
ATOM   2235 C CA    . THR A 1 306 ? 47.305 50.522 0.677   1.00 22.15 ? 528 THR A CA    1 
ATOM   2236 C C     . THR A 1 306 ? 47.669 50.652 2.155   1.00 21.61 ? 528 THR A C     1 
ATOM   2237 O O     . THR A 1 306 ? 48.804 50.988 2.489   1.00 20.73 ? 528 THR A O     1 
ATOM   2238 C CB    . THR A 1 306 ? 47.199 51.932 0.053   1.00 23.42 ? 528 THR A CB    1 
ATOM   2239 O OG1   . THR A 1 306 ? 46.009 52.575 0.520   1.00 24.53 ? 528 THR A OG1   1 
ATOM   2240 C CG2   . THR A 1 306 ? 47.154 51.838 -1.471  1.00 24.18 ? 528 THR A CG2   1 
ATOM   2241 N N     . THR A 1 307 ? 46.709 50.379 3.036   1.00 19.09 ? 529 THR A N     1 
ATOM   2242 C CA    . THR A 1 307 ? 46.947 50.457 4.474   1.00 19.23 ? 529 THR A CA    1 
ATOM   2243 C C     . THR A 1 307 ? 47.832 49.289 4.914   1.00 19.28 ? 529 THR A C     1 
ATOM   2244 O O     . THR A 1 307 ? 47.545 48.135 4.611   1.00 19.10 ? 529 THR A O     1 
ATOM   2245 C CB    . THR A 1 307 ? 45.625 50.398 5.260   1.00 20.22 ? 529 THR A CB    1 
ATOM   2246 O OG1   . THR A 1 307 ? 44.785 51.495 4.873   1.00 20.79 ? 529 THR A OG1   1 
ATOM   2247 C CG2   . THR A 1 307 ? 45.892 50.475 6.755   1.00 20.20 ? 529 THR A CG2   1 
ATOM   2248 N N     . PRO A 1 308 ? 48.930 49.580 5.628   1.00 19.18 ? 530 PRO A N     1 
ATOM   2249 C CA    . PRO A 1 308 ? 49.846 48.535 6.096   1.00 18.96 ? 530 PRO A CA    1 
ATOM   2250 C C     . PRO A 1 308 ? 49.222 47.628 7.155   1.00 18.19 ? 530 PRO A C     1 
ATOM   2251 O O     . PRO A 1 308 ? 48.328 48.041 7.891   1.00 18.09 ? 530 PRO A O     1 
ATOM   2252 C CB    . PRO A 1 308 ? 51.021 49.333 6.663   1.00 19.75 ? 530 PRO A CB    1 
ATOM   2253 C CG    . PRO A 1 308 ? 50.961 50.630 5.910   1.00 20.99 ? 530 PRO A CG    1 
ATOM   2254 C CD    . PRO A 1 308 ? 49.489 50.916 5.886   1.00 20.26 ? 530 PRO A CD    1 
ATOM   2255 N N     . VAL A 1 309 ? 49.702 46.391 7.222   1.00 15.41 ? 531 VAL A N     1 
ATOM   2256 C CA    . VAL A 1 309 ? 49.214 45.437 8.212   1.00 16.03 ? 531 VAL A CA    1 
ATOM   2257 C C     . VAL A 1 309 ? 50.372 44.746 8.929   1.00 15.24 ? 531 VAL A C     1 
ATOM   2258 O O     . VAL A 1 309 ? 51.383 44.381 8.313   1.00 14.88 ? 531 VAL A O     1 
ATOM   2259 C CB    . VAL A 1 309 ? 48.304 44.348 7.576   1.00 17.77 ? 531 VAL A CB    1 
ATOM   2260 C CG1   . VAL A 1 309 ? 47.108 44.996 6.904   1.00 19.19 ? 531 VAL A CG1   1 
ATOM   2261 C CG2   . VAL A 1 309 ? 49.088 43.509 6.589   1.00 18.51 ? 531 VAL A CG2   1 
ATOM   2262 N N     . ILE A 1 310 ? 50.214 44.594 10.240  1.00 14.53 ? 532 ILE A N     1 
ATOM   2263 C CA    . ILE A 1 310 ? 51.195 43.937 11.094  1.00 15.20 ? 532 ILE A CA    1 
ATOM   2264 C C     . ILE A 1 310 ? 50.452 42.740 11.680  1.00 14.77 ? 532 ILE A C     1 
ATOM   2265 O O     . ILE A 1 310 ? 49.478 42.907 12.413  1.00 14.59 ? 532 ILE A O     1 
ATOM   2266 C CB    . ILE A 1 310 ? 51.648 44.867 12.234  1.00 16.00 ? 532 ILE A CB    1 
ATOM   2267 C CG1   . ILE A 1 310 ? 52.344 46.100 11.649  1.00 17.25 ? 532 ILE A CG1   1 
ATOM   2268 C CG2   . ILE A 1 310 ? 52.583 44.124 13.175  1.00 16.54 ? 532 ILE A CG2   1 
ATOM   2269 C CD1   . ILE A 1 310 ? 52.483 47.240 12.635  1.00 16.93 ? 532 ILE A CD1   1 
ATOM   2270 N N     . MET A 1 311 ? 50.904 41.541 11.333  1.00 13.92 ? 533 MET A N     1 
ATOM   2271 C CA    . MET A 1 311 ? 50.262 40.315 11.794  1.00 15.27 ? 533 MET A CA    1 
ATOM   2272 C C     . MET A 1 311 ? 51.153 39.527 12.746  1.00 14.33 ? 533 MET A C     1 
ATOM   2273 O O     . MET A 1 311 ? 52.307 39.240 12.437  1.00 13.70 ? 533 MET A O     1 
ATOM   2274 C CB    . MET A 1 311 ? 49.892 39.445 10.586  1.00 13.88 ? 533 MET A CB    1 
ATOM   2275 C CG    . MET A 1 311 ? 49.026 40.168 9.546   1.00 15.86 ? 533 MET A CG    1 
ATOM   2276 S SD    . MET A 1 311 ? 48.896 39.282 7.972   1.00 14.39 ? 533 MET A SD    1 
ATOM   2277 C CE    . MET A 1 311 ? 50.570 39.566 7.309   1.00 13.27 ? 533 MET A CE    1 
ATOM   2278 N N     . VAL A 1 312 ? 50.604 39.183 13.907  1.00 13.79 ? 534 VAL A N     1 
ATOM   2279 C CA    . VAL A 1 312 ? 51.341 38.423 14.907  1.00 13.88 ? 534 VAL A CA    1 
ATOM   2280 C C     . VAL A 1 312 ? 50.561 37.148 15.192  1.00 13.55 ? 534 VAL A C     1 
ATOM   2281 O O     . VAL A 1 312 ? 49.487 37.191 15.791  1.00 14.66 ? 534 VAL A O     1 
ATOM   2282 C CB    . VAL A 1 312 ? 51.493 39.223 16.212  1.00 14.36 ? 534 VAL A CB    1 
ATOM   2283 C CG1   . VAL A 1 312 ? 52.389 38.466 17.185  1.00 13.89 ? 534 VAL A CG1   1 
ATOM   2284 C CG2   . VAL A 1 312 ? 52.072 40.599 15.913  1.00 14.41 ? 534 VAL A CG2   1 
ATOM   2285 N N     . GLY A 1 313 ? 51.100 36.017 14.751  1.00 13.80 ? 535 GLY A N     1 
ATOM   2286 C CA    . GLY A 1 313 ? 50.412 34.756 14.959  1.00 15.74 ? 535 GLY A CA    1 
ATOM   2287 C C     . GLY A 1 313 ? 51.319 33.547 15.039  1.00 15.05 ? 535 GLY A C     1 
ATOM   2288 O O     . GLY A 1 313 ? 51.588 32.900 14.032  1.00 15.75 ? 535 GLY A O     1 
ATOM   2289 N N     . PRO A 1 314 ? 51.822 33.222 16.238  1.00 15.59 ? 536 PRO A N     1 
ATOM   2290 C CA    . PRO A 1 314 ? 52.698 32.058 16.362  1.00 15.57 ? 536 PRO A CA    1 
ATOM   2291 C C     . PRO A 1 314 ? 51.894 30.756 16.355  1.00 14.72 ? 536 PRO A C     1 
ATOM   2292 O O     . PRO A 1 314 ? 50.705 30.745 16.684  1.00 14.83 ? 536 PRO A O     1 
ATOM   2293 C CB    . PRO A 1 314 ? 53.417 32.310 17.683  1.00 16.53 ? 536 PRO A CB    1 
ATOM   2294 C CG    . PRO A 1 314 ? 52.400 33.036 18.486  1.00 17.61 ? 536 PRO A CG    1 
ATOM   2295 C CD    . PRO A 1 314 ? 51.775 33.994 17.493  1.00 16.10 ? 536 PRO A CD    1 
ATOM   2296 N N     . GLY A 1 315 ? 52.545 29.666 15.964  1.00 14.80 ? 537 GLY A N     1 
ATOM   2297 C CA    . GLY A 1 315 ? 51.866 28.381 15.917  1.00 15.39 ? 537 GLY A CA    1 
ATOM   2298 C C     . GLY A 1 315 ? 50.693 28.400 14.958  1.00 14.78 ? 537 GLY A C     1 
ATOM   2299 O O     . GLY A 1 315 ? 50.753 29.042 13.903  1.00 14.13 ? 537 GLY A O     1 
ATOM   2300 N N     . THR A 1 316 ? 49.624 27.696 15.319  1.00 14.69 ? 538 THR A N     1 
ATOM   2301 C CA    . THR A 1 316 ? 48.438 27.650 14.473  1.00 15.41 ? 538 THR A CA    1 
ATOM   2302 C C     . THR A 1 316 ? 47.779 29.015 14.398  1.00 15.77 ? 538 THR A C     1 
ATOM   2303 O O     . THR A 1 316 ? 46.830 29.210 13.641  1.00 15.84 ? 538 THR A O     1 
ATOM   2304 C CB    . THR A 1 316 ? 47.398 26.616 14.978  1.00 16.80 ? 538 THR A CB    1 
ATOM   2305 O OG1   . THR A 1 316 ? 47.121 26.837 16.368  1.00 18.25 ? 538 THR A OG1   1 
ATOM   2306 C CG2   . THR A 1 316 ? 47.916 25.204 14.763  1.00 17.78 ? 538 THR A CG2   1 
ATOM   2307 N N     . GLY A 1 317 ? 48.283 29.958 15.188  1.00 14.92 ? 539 GLY A N     1 
ATOM   2308 C CA    . GLY A 1 317 ? 47.740 31.302 15.167  1.00 14.07 ? 539 GLY A CA    1 
ATOM   2309 C C     . GLY A 1 317 ? 48.030 31.970 13.832  1.00 13.25 ? 539 GLY A C     1 
ATOM   2310 O O     . GLY A 1 317 ? 47.501 33.042 13.534  1.00 13.16 ? 539 GLY A O     1 
ATOM   2311 N N     . VAL A 1 318 ? 48.872 31.335 13.025  1.00 12.88 ? 540 VAL A N     1 
ATOM   2312 C CA    . VAL A 1 318 ? 49.211 31.877 11.716  1.00 13.35 ? 540 VAL A CA    1 
ATOM   2313 C C     . VAL A 1 318 ? 48.037 31.704 10.741  1.00 14.40 ? 540 VAL A C     1 
ATOM   2314 O O     . VAL A 1 318 ? 47.964 32.379 9.719   1.00 12.67 ? 540 VAL A O     1 
ATOM   2315 C CB    . VAL A 1 318 ? 50.476 31.169 11.151  1.00 12.25 ? 540 VAL A CB    1 
ATOM   2316 C CG1   . VAL A 1 318 ? 50.118 29.796 10.586  1.00 13.59 ? 540 VAL A CG1   1 
ATOM   2317 C CG2   . VAL A 1 318 ? 51.134 32.041 10.092  1.00 13.66 ? 540 VAL A CG2   1 
ATOM   2318 N N     . ALA A 1 319 ? 47.111 30.813 11.088  1.00 13.13 ? 541 ALA A N     1 
ATOM   2319 C CA    . ALA A 1 319 ? 45.945 30.489 10.261  1.00 12.38 ? 541 ALA A CA    1 
ATOM   2320 C C     . ALA A 1 319 ? 45.273 31.608 9.474   1.00 11.87 ? 541 ALA A C     1 
ATOM   2321 O O     . ALA A 1 319 ? 45.305 31.615 8.240   1.00 12.29 ? 541 ALA A O     1 
ATOM   2322 C CB    . ALA A 1 319 ? 44.893 29.793 11.115  1.00 13.07 ? 541 ALA A CB    1 
ATOM   2323 N N     . PRO A 1 320 ? 44.641 32.564 10.170  1.00 11.71 ? 542 PRO A N     1 
ATOM   2324 C CA    . PRO A 1 320 ? 43.983 33.633 9.416   1.00 12.22 ? 542 PRO A CA    1 
ATOM   2325 C C     . PRO A 1 320 ? 44.929 34.437 8.538   1.00 12.78 ? 542 PRO A C     1 
ATOM   2326 O O     . PRO A 1 320 ? 44.533 34.957 7.497   1.00 12.27 ? 542 PRO A O     1 
ATOM   2327 C CB    . PRO A 1 320 ? 43.348 34.481 10.512  1.00 13.65 ? 542 PRO A CB    1 
ATOM   2328 C CG    . PRO A 1 320 ? 44.315 34.343 11.635  1.00 13.36 ? 542 PRO A CG    1 
ATOM   2329 C CD    . PRO A 1 320 ? 44.656 32.868 11.613  1.00 12.47 ? 542 PRO A CD    1 
ATOM   2330 N N     . PHE A 1 321 ? 46.187 34.521 8.949   1.00 12.43 ? 543 PHE A N     1 
ATOM   2331 C CA    . PHE A 1 321 ? 47.156 35.298 8.198   1.00 11.75 ? 543 PHE A CA    1 
ATOM   2332 C C     . PHE A 1 321 ? 47.567 34.661 6.876   1.00 13.16 ? 543 PHE A C     1 
ATOM   2333 O O     . PHE A 1 321 ? 48.013 35.356 5.961   1.00 13.12 ? 543 PHE A O     1 
ATOM   2334 C CB    . PHE A 1 321 ? 48.347 35.612 9.107   1.00 12.42 ? 543 PHE A CB    1 
ATOM   2335 C CG    . PHE A 1 321 ? 47.941 36.314 10.374  1.00 10.95 ? 543 PHE A CG    1 
ATOM   2336 C CD1   . PHE A 1 321 ? 46.975 37.314 10.339  1.00 10.41 ? 543 PHE A CD1   1 
ATOM   2337 C CD2   . PHE A 1 321 ? 48.496 35.964 11.604  1.00 12.46 ? 543 PHE A CD2   1 
ATOM   2338 C CE1   . PHE A 1 321 ? 46.559 37.957 11.501  1.00 12.84 ? 543 PHE A CE1   1 
ATOM   2339 C CE2   . PHE A 1 321 ? 48.088 36.604 12.780  1.00 13.09 ? 543 PHE A CE2   1 
ATOM   2340 C CZ    . PHE A 1 321 ? 47.118 37.602 12.729  1.00 12.41 ? 543 PHE A CZ    1 
ATOM   2341 N N     . ILE A 1 322 ? 47.410 33.347 6.759   1.00 12.94 ? 544 ILE A N     1 
ATOM   2342 C CA    . ILE A 1 322 ? 47.722 32.689 5.496   1.00 13.42 ? 544 ILE A CA    1 
ATOM   2343 C C     . ILE A 1 322 ? 46.697 33.225 4.490   1.00 13.51 ? 544 ILE A C     1 
ATOM   2344 O O     . ILE A 1 322 ? 47.014 33.465 3.320   1.00 14.33 ? 544 ILE A O     1 
ATOM   2345 C CB    . ILE A 1 322 ? 47.604 31.147 5.610   1.00 13.15 ? 544 ILE A CB    1 
ATOM   2346 C CG1   . ILE A 1 322 ? 48.615 30.630 6.637   1.00 13.70 ? 544 ILE A CG1   1 
ATOM   2347 C CG2   . ILE A 1 322 ? 47.841 30.491 4.252   1.00 13.14 ? 544 ILE A CG2   1 
ATOM   2348 C CD1   . ILE A 1 322 ? 50.067 30.972 6.307   1.00 14.03 ? 544 ILE A CD1   1 
ATOM   2349 N N     . GLY A 1 323 ? 45.466 33.422 4.956   1.00 12.55 ? 545 GLY A N     1 
ATOM   2350 C CA    . GLY A 1 323 ? 44.422 33.952 4.092   1.00 12.81 ? 545 GLY A CA    1 
ATOM   2351 C C     . GLY A 1 323 ? 44.677 35.417 3.780   1.00 12.30 ? 545 GLY A C     1 
ATOM   2352 O O     . GLY A 1 323 ? 44.512 35.852 2.640   1.00 12.36 ? 545 GLY A O     1 
ATOM   2353 N N     . PHE A 1 324 ? 45.079 36.180 4.793   1.00 12.73 ? 546 PHE A N     1 
ATOM   2354 C CA    . PHE A 1 324 ? 45.369 37.603 4.615   1.00 12.42 ? 546 PHE A CA    1 
ATOM   2355 C C     . PHE A 1 324 ? 46.446 37.795 3.555   1.00 13.28 ? 546 PHE A C     1 
ATOM   2356 O O     . PHE A 1 324 ? 46.306 38.615 2.650   1.00 13.86 ? 546 PHE A O     1 
ATOM   2357 C CB    . PHE A 1 324 ? 45.892 38.234 5.912   1.00 12.08 ? 546 PHE A CB    1 
ATOM   2358 C CG    . PHE A 1 324 ? 44.825 38.677 6.875   1.00 13.33 ? 546 PHE A CG    1 
ATOM   2359 C CD1   . PHE A 1 324 ? 45.130 39.616 7.857   1.00 12.24 ? 546 PHE A CD1   1 
ATOM   2360 C CD2   . PHE A 1 324 ? 43.538 38.148 6.837   1.00 12.87 ? 546 PHE A CD2   1 
ATOM   2361 C CE1   . PHE A 1 324 ? 44.177 40.022 8.786   1.00 14.19 ? 546 PHE A CE1   1 
ATOM   2362 C CE2   . PHE A 1 324 ? 42.576 38.548 7.769   1.00 13.09 ? 546 PHE A CE2   1 
ATOM   2363 C CZ    . PHE A 1 324 ? 42.897 39.485 8.743   1.00 13.24 ? 546 PHE A CZ    1 
ATOM   2364 N N     . ILE A 1 325 ? 47.527 37.035 3.680   1.00 13.02 ? 547 ILE A N     1 
ATOM   2365 C CA    . ILE A 1 325 ? 48.644 37.140 2.750   1.00 13.99 ? 547 ILE A CA    1 
ATOM   2366 C C     . ILE A 1 325 ? 48.236 36.691 1.352   1.00 14.55 ? 547 ILE A C     1 
ATOM   2367 O O     . ILE A 1 325 ? 48.635 37.291 0.356   1.00 14.06 ? 547 ILE A O     1 
ATOM   2368 C CB    . ILE A 1 325 ? 49.841 36.316 3.254   1.00 14.31 ? 547 ILE A CB    1 
ATOM   2369 C CG1   . ILE A 1 325 ? 50.284 36.862 4.619   1.00 14.40 ? 547 ILE A CG1   1 
ATOM   2370 C CG2   . ILE A 1 325 ? 50.983 36.382 2.248   1.00 14.08 ? 547 ILE A CG2   1 
ATOM   2371 C CD1   . ILE A 1 325 ? 51.265 35.978 5.368   1.00 14.34 ? 547 ILE A CD1   1 
ATOM   2372 N N     . GLN A 1 326 ? 47.440 35.633 1.280   1.00 14.09 ? 548 GLN A N     1 
ATOM   2373 C CA    . GLN A 1 326 ? 46.954 35.135 -0.002  1.00 15.44 ? 548 GLN A CA    1 
ATOM   2374 C C     . GLN A 1 326 ? 46.211 36.260 -0.701  1.00 14.27 ? 548 GLN A C     1 
ATOM   2375 O O     . GLN A 1 326 ? 46.380 36.486 -1.905  1.00 14.89 ? 548 GLN A O     1 
ATOM   2376 C CB    . GLN A 1 326 ? 45.974 33.988 0.215   1.00 15.91 ? 548 GLN A CB    1 
ATOM   2377 C CG    . GLN A 1 326 ? 46.544 32.605 0.080   1.00 18.60 ? 548 GLN A CG    1 
ATOM   2378 C CD    . GLN A 1 326 ? 45.506 31.544 0.392   1.00 18.85 ? 548 GLN A CD    1 
ATOM   2379 O OE1   . GLN A 1 326 ? 44.298 31.792 0.302   1.00 20.04 ? 548 GLN A OE1   1 
ATOM   2380 N NE2   . GLN A 1 326 ? 45.967 30.356 0.749   1.00 18.98 ? 548 GLN A NE2   1 
ATOM   2381 N N     . GLU A 1 327 ? 45.379 36.957 0.067   1.00 13.76 ? 549 GLU A N     1 
ATOM   2382 C CA    . GLU A 1 327 ? 44.578 38.048 -0.463  1.00 16.29 ? 549 GLU A CA    1 
ATOM   2383 C C     . GLU A 1 327 ? 45.434 39.221 -0.920  1.00 16.40 ? 549 GLU A C     1 
ATOM   2384 O O     . GLU A 1 327 ? 45.240 39.735 -2.021  1.00 17.14 ? 549 GLU A O     1 
ATOM   2385 C CB    . GLU A 1 327 ? 43.560 38.516 0.579   1.00 15.77 ? 549 GLU A CB    1 
ATOM   2386 C CG    . GLU A 1 327 ? 42.480 39.416 -0.001  1.00 16.94 ? 549 GLU A CG    1 
ATOM   2387 C CD    . GLU A 1 327 ? 41.188 39.356 0.788   1.00 19.23 ? 549 GLU A CD    1 
ATOM   2388 O OE1   . GLU A 1 327 ? 40.760 38.233 1.128   1.00 18.72 ? 549 GLU A OE1   1 
ATOM   2389 O OE2   . GLU A 1 327 ? 40.594 40.423 1.057   1.00 19.82 ? 549 GLU A OE2   1 
ATOM   2390 N N     . ARG A 1 328 ? 46.375 39.641 -0.078  1.00 15.65 ? 550 ARG A N     1 
ATOM   2391 C CA    . ARG A 1 328 ? 47.256 40.755 -0.417  1.00 17.35 ? 550 ARG A CA    1 
ATOM   2392 C C     . ARG A 1 328 ? 48.088 40.402 -1.658  1.00 17.04 ? 550 ARG A C     1 
ATOM   2393 O O     . ARG A 1 328 ? 48.330 41.255 -2.515  1.00 18.34 ? 550 ARG A O     1 
ATOM   2394 C CB    . ARG A 1 328 ? 48.165 41.083 0.775   1.00 16.97 ? 550 ARG A CB    1 
ATOM   2395 C CG    . ARG A 1 328 ? 47.405 41.378 2.071   1.00 19.69 ? 550 ARG A CG    1 
ATOM   2396 C CD    . ARG A 1 328 ? 46.900 42.817 2.175   1.00 20.01 ? 550 ARG A CD    1 
ATOM   2397 N NE    . ARG A 1 328 ? 47.932 43.737 2.653   1.00 19.75 ? 550 ARG A NE    1 
ATOM   2398 C CZ    . ARG A 1 328 ? 47.695 44.974 3.081   1.00 19.39 ? 550 ARG A CZ    1 
ATOM   2399 N NH1   . ARG A 1 328 ? 46.458 45.456 3.096   1.00 20.68 ? 550 ARG A NH1   1 
ATOM   2400 N NH2   . ARG A 1 328 ? 48.697 45.734 3.499   1.00 17.50 ? 550 ARG A NH2   1 
ATOM   2401 N N     . ALA A 1 329 ? 48.519 39.148 -1.761  1.00 15.89 ? 551 ALA A N     1 
ATOM   2402 C CA    . ALA A 1 329 ? 49.297 38.703 -2.918  1.00 16.32 ? 551 ALA A CA    1 
ATOM   2403 C C     . ALA A 1 329 ? 48.424 38.738 -4.175  1.00 17.85 ? 551 ALA A C     1 
ATOM   2404 O O     . ALA A 1 329 ? 48.869 39.162 -5.246  1.00 17.39 ? 551 ALA A O     1 
ATOM   2405 C CB    . ALA A 1 329 ? 49.828 37.289 -2.685  1.00 16.31 ? 551 ALA A CB    1 
ATOM   2406 N N     . TRP A 1 330 ? 47.180 38.287 -4.040  1.00 17.73 ? 552 TRP A N     1 
ATOM   2407 C CA    . TRP A 1 330 ? 46.237 38.275 -5.154  1.00 17.01 ? 552 TRP A CA    1 
ATOM   2408 C C     . TRP A 1 330 ? 46.015 39.700 -5.654  1.00 16.43 ? 552 TRP A C     1 
ATOM   2409 O O     . TRP A 1 330 ? 46.026 39.947 -6.862  1.00 15.90 ? 552 TRP A O     1 
ATOM   2410 C CB    . TRP A 1 330 ? 44.901 37.671 -4.707  1.00 17.63 ? 552 TRP A CB    1 
ATOM   2411 C CG    . TRP A 1 330 ? 43.824 37.713 -5.758  1.00 19.64 ? 552 TRP A CG    1 
ATOM   2412 C CD1   . TRP A 1 330 ? 43.662 36.854 -6.806  1.00 21.86 ? 552 TRP A CD1   1 
ATOM   2413 C CD2   . TRP A 1 330 ? 42.771 38.678 -5.863  1.00 20.04 ? 552 TRP A CD2   1 
ATOM   2414 N NE1   . TRP A 1 330 ? 42.571 37.224 -7.559  1.00 21.59 ? 552 TRP A NE1   1 
ATOM   2415 C CE2   . TRP A 1 330 ? 42.006 38.341 -7.002  1.00 20.43 ? 552 TRP A CE2   1 
ATOM   2416 C CE3   . TRP A 1 330 ? 42.400 39.797 -5.104  1.00 19.61 ? 552 TRP A CE3   1 
ATOM   2417 C CZ2   . TRP A 1 330 ? 40.889 39.084 -7.401  1.00 22.37 ? 552 TRP A CZ2   1 
ATOM   2418 C CZ3   . TRP A 1 330 ? 41.289 40.536 -5.502  1.00 22.86 ? 552 TRP A CZ3   1 
ATOM   2419 C CH2   . TRP A 1 330 ? 40.548 40.174 -6.641  1.00 22.06 ? 552 TRP A CH2   1 
ATOM   2420 N N     . LEU A 1 331 ? 45.811 40.630 -4.724  1.00 15.61 ? 553 LEU A N     1 
ATOM   2421 C CA    . LEU A 1 331 ? 45.598 42.032 -5.070  1.00 17.43 ? 553 LEU A CA    1 
ATOM   2422 C C     . LEU A 1 331 ? 46.790 42.583 -5.848  1.00 17.03 ? 553 LEU A C     1 
ATOM   2423 O O     . LEU A 1 331 ? 46.615 43.294 -6.838  1.00 17.63 ? 553 LEU A O     1 
ATOM   2424 C CB    . LEU A 1 331 ? 45.368 42.863 -3.804  1.00 15.71 ? 553 LEU A CB    1 
ATOM   2425 C CG    . LEU A 1 331 ? 44.048 42.654 -3.050  1.00 18.51 ? 553 LEU A CG    1 
ATOM   2426 C CD1   . LEU A 1 331 ? 44.110 43.346 -1.696  1.00 18.99 ? 553 LEU A CD1   1 
ATOM   2427 C CD2   . LEU A 1 331 ? 42.891 43.195 -3.880  1.00 19.15 ? 553 LEU A CD2   1 
ATOM   2428 N N     . ARG A 1 332 ? 48.000 42.256 -5.406  1.00 17.87 ? 554 ARG A N     1 
ATOM   2429 C CA    . ARG A 1 332 ? 49.197 42.718 -6.102  1.00 19.23 ? 554 ARG A CA    1 
ATOM   2430 C C     . ARG A 1 332 ? 49.219 42.103 -7.498  1.00 20.13 ? 554 ARG A C     1 
ATOM   2431 O O     . ARG A 1 332 ? 49.512 42.781 -8.485  1.00 19.88 ? 554 ARG A O     1 
ATOM   2432 C CB    . ARG A 1 332 ? 50.454 42.301 -5.338  1.00 19.00 ? 554 ARG A CB    1 
ATOM   2433 C CG    . ARG A 1 332 ? 50.682 43.049 -4.039  1.00 20.60 ? 554 ARG A CG    1 
ATOM   2434 C CD    . ARG A 1 332 ? 51.733 42.338 -3.199  1.00 24.72 ? 554 ARG A CD    1 
ATOM   2435 N NE    . ARG A 1 332 ? 52.973 42.124 -3.939  1.00 27.74 ? 554 ARG A NE    1 
ATOM   2436 C CZ    . ARG A 1 332 ? 53.835 43.086 -4.248  1.00 28.72 ? 554 ARG A CZ    1 
ATOM   2437 N NH1   . ARG A 1 332 ? 53.595 44.337 -3.880  1.00 30.78 ? 554 ARG A NH1   1 
ATOM   2438 N NH2   . ARG A 1 332 ? 54.938 42.796 -4.926  1.00 29.11 ? 554 ARG A NH2   1 
ATOM   2439 N N     . GLN A 1 333 ? 48.900 40.813 -7.573  1.00 20.25 ? 555 GLN A N     1 
ATOM   2440 C CA    . GLN A 1 333 ? 48.872 40.095 -8.843  1.00 21.77 ? 555 GLN A CA    1 
ATOM   2441 C C     . GLN A 1 333 ? 47.868 40.716 -9.812  1.00 20.63 ? 555 GLN A C     1 
ATOM   2442 O O     . GLN A 1 333 ? 48.089 40.728 -11.025 1.00 21.21 ? 555 GLN A O     1 
ATOM   2443 C CB    . GLN A 1 333 ? 48.519 38.626 -8.604  1.00 24.01 ? 555 GLN A CB    1 
ATOM   2444 C CG    . GLN A 1 333 ? 49.617 37.817 -7.929  1.00 27.46 ? 555 GLN A CG    1 
ATOM   2445 C CD    . GLN A 1 333 ? 49.095 36.525 -7.320  1.00 30.00 ? 555 GLN A CD    1 
ATOM   2446 O OE1   . GLN A 1 333 ? 48.371 35.765 -7.966  1.00 30.67 ? 555 GLN A OE1   1 
ATOM   2447 N NE2   . GLN A 1 333 ? 49.467 36.268 -6.070  1.00 32.04 ? 555 GLN A NE2   1 
ATOM   2448 N N     . GLN A 1 334 ? 46.765 41.230 -9.277  1.00 20.43 ? 556 GLN A N     1 
ATOM   2449 C CA    . GLN A 1 334 ? 45.733 41.859 -10.097 1.00 20.38 ? 556 GLN A CA    1 
ATOM   2450 C C     . GLN A 1 334 ? 46.228 43.184 -10.660 1.00 19.63 ? 556 GLN A C     1 
ATOM   2451 O O     . GLN A 1 334 ? 45.720 43.666 -11.674 1.00 20.22 ? 556 GLN A O     1 
ATOM   2452 C CB    . GLN A 1 334 ? 44.468 42.112 -9.271  1.00 19.85 ? 556 GLN A CB    1 
ATOM   2453 C CG    . GLN A 1 334 ? 43.628 40.878 -8.976  1.00 20.66 ? 556 GLN A CG    1 
ATOM   2454 C CD    . GLN A 1 334 ? 43.117 40.209 -10.238 1.00 22.66 ? 556 GLN A CD    1 
ATOM   2455 O OE1   . GLN A 1 334 ? 43.684 39.223 -10.707 1.00 24.24 ? 556 GLN A OE1   1 
ATOM   2456 N NE2   . GLN A 1 334 ? 42.048 40.755 -10.804 1.00 24.83 ? 556 GLN A NE2   1 
ATOM   2457 N N     . GLY A 1 335 ? 47.219 43.768 -9.992  1.00 20.51 ? 557 GLY A N     1 
ATOM   2458 C CA    . GLY A 1 335 ? 47.768 45.039 -10.429 1.00 22.11 ? 557 GLY A CA    1 
ATOM   2459 C C     . GLY A 1 335 ? 47.455 46.172 -9.468  1.00 23.04 ? 557 GLY A C     1 
ATOM   2460 O O     . GLY A 1 335 ? 47.750 47.333 -9.747  1.00 22.75 ? 557 GLY A O     1 
ATOM   2461 N N     . LYS A 1 336 ? 46.855 45.837 -8.331  1.00 22.20 ? 558 LYS A N     1 
ATOM   2462 C CA    . LYS A 1 336 ? 46.506 46.833 -7.326  1.00 23.21 ? 558 LYS A CA    1 
ATOM   2463 C C     . LYS A 1 336 ? 47.720 47.206 -6.483  1.00 22.95 ? 558 LYS A C     1 
ATOM   2464 O O     . LYS A 1 336 ? 48.664 46.424 -6.347  1.00 21.93 ? 558 LYS A O     1 
ATOM   2465 C CB    . LYS A 1 336 ? 45.406 46.295 -6.404  1.00 24.82 ? 558 LYS A CB    1 
ATOM   2466 C CG    . LYS A 1 336 ? 44.042 46.096 -7.053  1.00 26.84 ? 558 LYS A CG    1 
ATOM   2467 C CD    . LYS A 1 336 ? 43.437 47.418 -7.495  1.00 27.65 ? 558 LYS A CD    1 
ATOM   2468 C CE    . LYS A 1 336 ? 41.916 47.346 -7.561  1.00 28.41 ? 558 LYS A CE    1 
ATOM   2469 N NZ    . LYS A 1 336 ? 41.419 46.301 -8.495  1.00 31.16 ? 558 LYS A NZ    1 
ATOM   2470 N N     . GLU A 1 337 ? 47.686 48.407 -5.918  1.00 22.16 ? 559 GLU A N     1 
ATOM   2471 C CA    . GLU A 1 337 ? 48.765 48.888 -5.067  1.00 23.23 ? 559 GLU A CA    1 
ATOM   2472 C C     . GLU A 1 337 ? 48.459 48.379 -3.661  1.00 21.45 ? 559 GLU A C     1 
ATOM   2473 O O     . GLU A 1 337 ? 47.349 48.561 -3.163  1.00 19.52 ? 559 GLU A O     1 
ATOM   2474 C CB    . GLU A 1 337 ? 48.802 50.418 -5.091  1.00 25.68 ? 559 GLU A CB    1 
ATOM   2475 C CG    . GLU A 1 337 ? 50.170 51.018 -4.811  1.00 31.26 ? 559 GLU A CG    1 
ATOM   2476 C CD    . GLU A 1 337 ? 50.344 51.454 -3.373  1.00 34.34 ? 559 GLU A CD    1 
ATOM   2477 O OE1   . GLU A 1 337 ? 50.162 50.616 -2.463  1.00 36.17 ? 559 GLU A OE1   1 
ATOM   2478 O OE2   . GLU A 1 337 ? 50.670 52.642 -3.156  1.00 33.89 ? 559 GLU A OE2   1 
ATOM   2479 N N     . VAL A 1 338 ? 49.437 47.737 -3.029  1.00 19.90 ? 560 VAL A N     1 
ATOM   2480 C CA    . VAL A 1 338 ? 49.245 47.187 -1.690  1.00 19.71 ? 560 VAL A CA    1 
ATOM   2481 C C     . VAL A 1 338 ? 50.306 47.688 -0.708  1.00 19.20 ? 560 VAL A C     1 
ATOM   2482 O O     . VAL A 1 338 ? 51.488 47.763 -1.042  1.00 20.88 ? 560 VAL A O     1 
ATOM   2483 C CB    . VAL A 1 338 ? 49.269 45.641 -1.739  1.00 19.10 ? 560 VAL A CB    1 
ATOM   2484 C CG1   . VAL A 1 338 ? 48.988 45.066 -0.360  1.00 18.26 ? 560 VAL A CG1   1 
ATOM   2485 C CG2   . VAL A 1 338 ? 48.234 45.142 -2.740  1.00 19.64 ? 560 VAL A CG2   1 
ATOM   2486 N N     . GLY A 1 339 ? 49.868 48.036 0.499   1.00 19.19 ? 561 GLY A N     1 
ATOM   2487 C CA    . GLY A 1 339 ? 50.777 48.533 1.517   1.00 18.26 ? 561 GLY A CA    1 
ATOM   2488 C C     . GLY A 1 339 ? 51.655 47.456 2.125   1.00 17.82 ? 561 GLY A C     1 
ATOM   2489 O O     . GLY A 1 339 ? 51.526 46.278 1.792   1.00 17.31 ? 561 GLY A O     1 
ATOM   2490 N N     . GLU A 1 340 ? 52.562 47.858 3.009   1.00 16.93 ? 562 GLU A N     1 
ATOM   2491 C CA    . GLU A 1 340 ? 53.450 46.902 3.657   1.00 16.86 ? 562 GLU A CA    1 
ATOM   2492 C C     . GLU A 1 340 ? 52.631 45.834 4.366   1.00 15.99 ? 562 GLU A C     1 
ATOM   2493 O O     . GLU A 1 340 ? 51.596 46.125 4.968   1.00 16.36 ? 562 GLU A O     1 
ATOM   2494 C CB    . GLU A 1 340 ? 54.363 47.605 4.662   1.00 18.12 ? 562 GLU A CB    1 
ATOM   2495 C CG    . GLU A 1 340 ? 55.492 48.399 4.020   1.00 22.79 ? 562 GLU A CG    1 
ATOM   2496 C CD    . GLU A 1 340 ? 56.500 48.898 5.036   1.00 26.79 ? 562 GLU A CD    1 
ATOM   2497 O OE1   . GLU A 1 340 ? 56.992 48.076 5.836   1.00 28.48 ? 562 GLU A OE1   1 
ATOM   2498 O OE2   . GLU A 1 340 ? 56.806 50.108 5.031   1.00 29.73 ? 562 GLU A OE2   1 
ATOM   2499 N N     . THR A 1 341 ? 53.104 44.598 4.277   1.00 14.82 ? 563 THR A N     1 
ATOM   2500 C CA    . THR A 1 341 ? 52.436 43.455 4.888   1.00 15.78 ? 563 THR A CA    1 
ATOM   2501 C C     . THR A 1 341 ? 53.493 42.675 5.671   1.00 15.10 ? 563 THR A C     1 
ATOM   2502 O O     . THR A 1 341 ? 54.345 42.006 5.084   1.00 14.88 ? 563 THR A O     1 
ATOM   2503 C CB    . THR A 1 341 ? 51.803 42.574 3.790   1.00 16.02 ? 563 THR A CB    1 
ATOM   2504 O OG1   . THR A 1 341 ? 50.832 43.345 3.068   1.00 16.98 ? 563 THR A OG1   1 
ATOM   2505 C CG2   . THR A 1 341 ? 51.124 41.360 4.392   1.00 16.78 ? 563 THR A CG2   1 
ATOM   2506 N N     . LEU A 1 342 ? 53.433 42.765 6.997   1.00 14.80 ? 564 LEU A N     1 
ATOM   2507 C CA    . LEU A 1 342 ? 54.413 42.097 7.852   1.00 15.31 ? 564 LEU A CA    1 
ATOM   2508 C C     . LEU A 1 342 ? 53.858 40.954 8.683   1.00 13.93 ? 564 LEU A C     1 
ATOM   2509 O O     . LEU A 1 342 ? 52.787 41.067 9.279   1.00 13.75 ? 564 LEU A O     1 
ATOM   2510 C CB    . LEU A 1 342 ? 55.056 43.097 8.818   1.00 16.68 ? 564 LEU A CB    1 
ATOM   2511 C CG    . LEU A 1 342 ? 55.888 44.268 8.293   1.00 19.02 ? 564 LEU A CG    1 
ATOM   2512 C CD1   . LEU A 1 342 ? 55.015 45.219 7.500   1.00 21.44 ? 564 LEU A CD1   1 
ATOM   2513 C CD2   . LEU A 1 342 ? 56.522 44.991 9.476   1.00 19.94 ? 564 LEU A CD2   1 
ATOM   2514 N N     . LEU A 1 343 ? 54.605 39.858 8.732   1.00 13.80 ? 565 LEU A N     1 
ATOM   2515 C CA    . LEU A 1 343 ? 54.194 38.716 9.535   1.00 14.33 ? 565 LEU A CA    1 
ATOM   2516 C C     . LEU A 1 343 ? 55.237 38.365 10.584  1.00 14.11 ? 565 LEU A C     1 
ATOM   2517 O O     . LEU A 1 343 ? 56.431 38.249 10.288  1.00 15.68 ? 565 LEU A O     1 
ATOM   2518 C CB    . LEU A 1 343 ? 53.946 37.478 8.667   1.00 13.73 ? 565 LEU A CB    1 
ATOM   2519 C CG    . LEU A 1 343 ? 53.600 36.221 9.480   1.00 13.35 ? 565 LEU A CG    1 
ATOM   2520 C CD1   . LEU A 1 343 ? 52.228 36.387 10.140  1.00 13.18 ? 565 LEU A CD1   1 
ATOM   2521 C CD2   . LEU A 1 343 ? 53.608 34.994 8.574   1.00 12.74 ? 565 LEU A CD2   1 
ATOM   2522 N N     . TYR A 1 344 ? 54.766 38.226 11.815  1.00 14.15 ? 566 TYR A N     1 
ATOM   2523 C CA    . TYR A 1 344 ? 55.595 37.820 12.938  1.00 13.97 ? 566 TYR A CA    1 
ATOM   2524 C C     . TYR A 1 344 ? 55.001 36.470 13.294  1.00 13.48 ? 566 TYR A C     1 
ATOM   2525 O O     . TYR A 1 344 ? 53.896 36.382 13.835  1.00 13.80 ? 566 TYR A O     1 
ATOM   2526 C CB    . TYR A 1 344 ? 55.468 38.809 14.096  1.00 14.32 ? 566 TYR A CB    1 
ATOM   2527 C CG    . TYR A 1 344 ? 56.213 40.095 13.827  1.00 14.72 ? 566 TYR A CG    1 
ATOM   2528 C CD1   . TYR A 1 344 ? 57.550 40.243 14.199  1.00 14.63 ? 566 TYR A CD1   1 
ATOM   2529 C CD2   . TYR A 1 344 ? 55.603 41.135 13.129  1.00 15.81 ? 566 TYR A CD2   1 
ATOM   2530 C CE1   . TYR A 1 344 ? 58.263 41.401 13.875  1.00 16.06 ? 566 TYR A CE1   1 
ATOM   2531 C CE2   . TYR A 1 344 ? 56.301 42.294 12.799  1.00 17.18 ? 566 TYR A CE2   1 
ATOM   2532 C CZ    . TYR A 1 344 ? 57.630 42.419 13.173  1.00 15.88 ? 566 TYR A CZ    1 
ATOM   2533 O OH    . TYR A 1 344 ? 58.321 43.558 12.828  1.00 17.49 ? 566 TYR A OH    1 
ATOM   2534 N N     . TYR A 1 345 ? 55.734 35.426 12.934  1.00 14.03 ? 567 TYR A N     1 
ATOM   2535 C CA    . TYR A 1 345 ? 55.320 34.053 13.162  1.00 14.88 ? 567 TYR A CA    1 
ATOM   2536 C C     . TYR A 1 345 ? 56.320 33.398 14.102  1.00 15.80 ? 567 TYR A C     1 
ATOM   2537 O O     . TYR A 1 345 ? 57.415 33.919 14.318  1.00 14.93 ? 567 TYR A O     1 
ATOM   2538 C CB    . TYR A 1 345 ? 55.263 33.317 11.810  1.00 14.35 ? 567 TYR A CB    1 
ATOM   2539 C CG    . TYR A 1 345 ? 55.079 31.821 11.901  1.00 14.92 ? 567 TYR A CG    1 
ATOM   2540 C CD1   . TYR A 1 345 ? 53.896 31.269 12.394  1.00 14.11 ? 567 TYR A CD1   1 
ATOM   2541 C CD2   . TYR A 1 345 ? 56.109 30.956 11.537  1.00 16.14 ? 567 TYR A CD2   1 
ATOM   2542 C CE1   . TYR A 1 345 ? 53.750 29.890 12.527  1.00 12.96 ? 567 TYR A CE1   1 
ATOM   2543 C CE2   . TYR A 1 345 ? 55.976 29.579 11.666  1.00 14.07 ? 567 TYR A CE2   1 
ATOM   2544 C CZ    . TYR A 1 345 ? 54.794 29.053 12.165  1.00 16.10 ? 567 TYR A CZ    1 
ATOM   2545 O OH    . TYR A 1 345 ? 54.682 27.693 12.330  1.00 15.96 ? 567 TYR A OH    1 
ATOM   2546 N N     . GLY A 1 346 ? 55.931 32.271 14.682  1.00 13.92 ? 568 GLY A N     1 
ATOM   2547 C CA    . GLY A 1 346 ? 56.826 31.568 15.579  1.00 16.06 ? 568 GLY A CA    1 
ATOM   2548 C C     . GLY A 1 346 ? 56.517 30.089 15.658  1.00 16.10 ? 568 GLY A C     1 
ATOM   2549 O O     . GLY A 1 346 ? 55.362 29.676 15.528  1.00 15.88 ? 568 GLY A O     1 
ATOM   2550 N N     . CYS A 1 347 ? 57.558 29.285 15.837  1.00 15.50 ? 569 CYS A N     1 
ATOM   2551 C CA    . CYS A 1 347 ? 57.405 27.845 15.979  1.00 16.16 ? 569 CYS A CA    1 
ATOM   2552 C C     . CYS A 1 347 ? 58.568 27.363 16.832  1.00 14.89 ? 569 CYS A C     1 
ATOM   2553 O O     . CYS A 1 347 ? 59.451 28.145 17.176  1.00 15.33 ? 569 CYS A O     1 
ATOM   2554 C CB    . CYS A 1 347 ? 57.399 27.149 14.612  1.00 16.44 ? 569 CYS A CB    1 
ATOM   2555 S SG    . CYS A 1 347 ? 58.878 27.365 13.622  1.00 17.52 ? 569 CYS A SG    1 
ATOM   2556 N N     . ARG A 1 348 ? 58.566 26.085 17.182  1.00 15.11 ? 570 ARG A N     1 
ATOM   2557 C CA    . ARG A 1 348 ? 59.621 25.536 18.024  1.00 15.89 ? 570 ARG A CA    1 
ATOM   2558 C C     . ARG A 1 348 ? 60.957 25.406 17.302  1.00 16.68 ? 570 ARG A C     1 
ATOM   2559 O O     . ARG A 1 348 ? 61.977 25.922 17.771  1.00 15.44 ? 570 ARG A O     1 
ATOM   2560 C CB    . ARG A 1 348 ? 59.175 24.182 18.585  1.00 14.89 ? 570 ARG A CB    1 
ATOM   2561 C CG    . ARG A 1 348 ? 57.868 24.284 19.363  1.00 16.96 ? 570 ARG A CG    1 
ATOM   2562 C CD    . ARG A 1 348 ? 57.361 22.954 19.906  1.00 17.59 ? 570 ARG A CD    1 
ATOM   2563 N NE    . ARG A 1 348 ? 56.044 23.129 20.515  1.00 21.30 ? 570 ARG A NE    1 
ATOM   2564 C CZ    . ARG A 1 348 ? 55.359 22.171 21.133  1.00 22.78 ? 570 ARG A CZ    1 
ATOM   2565 N NH1   . ARG A 1 348 ? 55.860 20.950 21.233  1.00 21.13 ? 570 ARG A NH1   1 
ATOM   2566 N NH2   . ARG A 1 348 ? 54.168 22.438 21.651  1.00 24.56 ? 570 ARG A NH2   1 
ATOM   2567 N N     . ARG A 1 349 ? 60.950 24.728 16.158  1.00 16.59 ? 571 ARG A N     1 
ATOM   2568 C CA    . ARG A 1 349 ? 62.167 24.528 15.373  1.00 18.27 ? 571 ARG A CA    1 
ATOM   2569 C C     . ARG A 1 349 ? 61.865 24.636 13.881  1.00 19.37 ? 571 ARG A C     1 
ATOM   2570 O O     . ARG A 1 349 ? 60.844 24.130 13.406  1.00 19.65 ? 571 ARG A O     1 
ATOM   2571 C CB    . ARG A 1 349 ? 62.774 23.158 15.683  1.00 18.98 ? 571 ARG A CB    1 
ATOM   2572 C CG    . ARG A 1 349 ? 63.137 22.971 17.148  1.00 20.15 ? 571 ARG A CG    1 
ATOM   2573 C CD    . ARG A 1 349 ? 63.719 21.594 17.420  1.00 22.04 ? 571 ARG A CD    1 
ATOM   2574 N NE    . ARG A 1 349 ? 64.054 21.424 18.833  1.00 25.00 ? 571 ARG A NE    1 
ATOM   2575 C CZ    . ARG A 1 349 ? 63.160 21.369 19.817  1.00 26.22 ? 571 ARG A CZ    1 
ATOM   2576 N NH1   . ARG A 1 349 ? 61.864 21.467 19.549  1.00 28.10 ? 571 ARG A NH1   1 
ATOM   2577 N NH2   . ARG A 1 349 ? 63.562 21.223 21.072  1.00 26.36 ? 571 ARG A NH2   1 
ATOM   2578 N N     . SER A 1 350 ? 62.760 25.289 13.147  1.00 20.30 ? 572 SER A N     1 
ATOM   2579 C CA    . SER A 1 350 ? 62.582 25.485 11.713  1.00 22.02 ? 572 SER A CA    1 
ATOM   2580 C C     . SER A 1 350 ? 62.360 24.189 10.939  1.00 21.59 ? 572 SER A C     1 
ATOM   2581 O O     . SER A 1 350 ? 61.647 24.181 9.939   1.00 21.70 ? 572 SER A O     1 
ATOM   2582 C CB    . SER A 1 350 ? 63.784 26.231 11.124  1.00 22.89 ? 572 SER A CB    1 
ATOM   2583 O OG    . SER A 1 350 ? 64.984 25.498 11.298  1.00 23.80 ? 572 SER A OG    1 
ATOM   2584 N N     . ASP A 1 351 ? 62.965 23.098 11.400  1.00 22.78 ? 573 ASP A N     1 
ATOM   2585 C CA    . ASP A 1 351 ? 62.818 21.810 10.729  1.00 24.38 ? 573 ASP A CA    1 
ATOM   2586 C C     . ASP A 1 351 ? 61.904 20.857 11.497  1.00 24.13 ? 573 ASP A C     1 
ATOM   2587 O O     . ASP A 1 351 ? 61.992 19.636 11.348  1.00 23.60 ? 573 ASP A O     1 
ATOM   2588 C CB    . ASP A 1 351 ? 64.191 21.158 10.525  1.00 27.51 ? 573 ASP A CB    1 
ATOM   2589 C CG    . ASP A 1 351 ? 64.929 20.917 11.830  1.00 30.66 ? 573 ASP A CG    1 
ATOM   2590 O OD1   . ASP A 1 351 ? 66.017 20.301 11.790  1.00 32.82 ? 573 ASP A OD1   1 
ATOM   2591 O OD2   . ASP A 1 351 ? 64.431 21.341 12.895  1.00 32.44 ? 573 ASP A OD2   1 
ATOM   2592 N N     . GLU A 1 352 ? 61.023 21.416 12.318  1.00 21.74 ? 574 GLU A N     1 
ATOM   2593 C CA    . GLU A 1 352 ? 60.102 20.602 13.095  1.00 22.01 ? 574 GLU A CA    1 
ATOM   2594 C C     . GLU A 1 352 ? 58.648 20.977 12.840  1.00 20.26 ? 574 GLU A C     1 
ATOM   2595 O O     . GLU A 1 352 ? 57.861 20.150 12.379  1.00 21.15 ? 574 GLU A O     1 
ATOM   2596 C CB    . GLU A 1 352 ? 60.391 20.735 14.595  1.00 23.30 ? 574 GLU A CB    1 
ATOM   2597 C CG    . GLU A 1 352 ? 59.389 19.994 15.479  1.00 27.75 ? 574 GLU A CG    1 
ATOM   2598 C CD    . GLU A 1 352 ? 59.499 18.483 15.362  1.00 30.29 ? 574 GLU A CD    1 
ATOM   2599 O OE1   . GLU A 1 352 ? 58.462 17.797 15.491  1.00 31.18 ? 574 GLU A OE1   1 
ATOM   2600 O OE2   . GLU A 1 352 ? 60.624 17.978 15.154  1.00 31.81 ? 574 GLU A OE2   1 
ATOM   2601 N N     . ASP A 1 353 ? 58.300 22.227 13.134  1.00 18.44 ? 575 ASP A N     1 
ATOM   2602 C CA    . ASP A 1 353 ? 56.923 22.680 12.975  1.00 17.31 ? 575 ASP A CA    1 
ATOM   2603 C C     . ASP A 1 353 ? 56.738 24.070 12.371  1.00 16.53 ? 575 ASP A C     1 
ATOM   2604 O O     . ASP A 1 353 ? 55.898 24.842 12.830  1.00 15.61 ? 575 ASP A O     1 
ATOM   2605 C CB    . ASP A 1 353 ? 56.203 22.604 14.331  1.00 17.85 ? 575 ASP A CB    1 
ATOM   2606 C CG    . ASP A 1 353 ? 56.918 23.386 15.430  1.00 19.08 ? 575 ASP A CG    1 
ATOM   2607 O OD1   . ASP A 1 353 ? 58.044 23.873 15.197  1.00 18.86 ? 575 ASP A OD1   1 
ATOM   2608 O OD2   . ASP A 1 353 ? 56.347 23.501 16.538  1.00 19.72 ? 575 ASP A OD2   1 
ATOM   2609 N N     . TYR A 1 354 ? 57.514 24.379 11.338  1.00 15.93 ? 576 TYR A N     1 
ATOM   2610 C CA    . TYR A 1 354 ? 57.415 25.669 10.665  1.00 14.65 ? 576 TYR A CA    1 
ATOM   2611 C C     . TYR A 1 354 ? 56.280 25.542 9.641   1.00 15.03 ? 576 TYR A C     1 
ATOM   2612 O O     . TYR A 1 354 ? 56.479 25.086 8.520   1.00 15.51 ? 576 TYR A O     1 
ATOM   2613 C CB    . TYR A 1 354 ? 58.762 25.987 9.995   1.00 15.50 ? 576 TYR A CB    1 
ATOM   2614 C CG    . TYR A 1 354 ? 58.922 27.380 9.414   1.00 16.23 ? 576 TYR A CG    1 
ATOM   2615 C CD1   . TYR A 1 354 ? 60.197 27.897 9.165   1.00 17.33 ? 576 TYR A CD1   1 
ATOM   2616 C CD2   . TYR A 1 354 ? 57.818 28.158 9.060   1.00 16.57 ? 576 TYR A CD2   1 
ATOM   2617 C CE1   . TYR A 1 354 ? 60.370 29.144 8.577   1.00 17.97 ? 576 TYR A CE1   1 
ATOM   2618 C CE2   . TYR A 1 354 ? 57.983 29.412 8.465   1.00 18.60 ? 576 TYR A CE2   1 
ATOM   2619 C CZ    . TYR A 1 354 ? 59.263 29.895 8.228   1.00 18.57 ? 576 TYR A CZ    1 
ATOM   2620 O OH    . TYR A 1 354 ? 59.444 31.118 7.630   1.00 19.44 ? 576 TYR A OH    1 
ATOM   2621 N N     . LEU A 1 355 ? 55.084 25.953 10.045  1.00 14.92 ? 577 LEU A N     1 
ATOM   2622 C CA    . LEU A 1 355 ? 53.906 25.858 9.186   1.00 14.70 ? 577 LEU A CA    1 
ATOM   2623 C C     . LEU A 1 355 ? 53.973 26.738 7.944   1.00 14.74 ? 577 LEU A C     1 
ATOM   2624 O O     . LEU A 1 355 ? 54.371 27.902 8.018   1.00 14.74 ? 577 LEU A O     1 
ATOM   2625 C CB    . LEU A 1 355 ? 52.652 26.215 9.986   1.00 14.76 ? 577 LEU A CB    1 
ATOM   2626 C CG    . LEU A 1 355 ? 52.456 25.438 11.289  1.00 17.22 ? 577 LEU A CG    1 
ATOM   2627 C CD1   . LEU A 1 355 ? 51.217 25.945 12.000  1.00 15.09 ? 577 LEU A CD1   1 
ATOM   2628 C CD2   . LEU A 1 355 ? 52.337 23.949 10.989  1.00 17.79 ? 577 LEU A CD2   1 
ATOM   2629 N N     . TYR A 1 356 ? 53.578 26.167 6.807   1.00 12.89 ? 578 TYR A N     1 
ATOM   2630 C CA    . TYR A 1 356 ? 53.564 26.880 5.528   1.00 14.37 ? 578 TYR A CA    1 
ATOM   2631 C C     . TYR A 1 356 ? 54.905 27.518 5.203   1.00 15.12 ? 578 TYR A C     1 
ATOM   2632 O O     . TYR A 1 356 ? 54.961 28.584 4.585   1.00 15.22 ? 578 TYR A O     1 
ATOM   2633 C CB    . TYR A 1 356 ? 52.478 27.958 5.544   1.00 14.54 ? 578 TYR A CB    1 
ATOM   2634 C CG    . TYR A 1 356 ? 51.089 27.422 5.804   1.00 14.94 ? 578 TYR A CG    1 
ATOM   2635 C CD1   . TYR A 1 356 ? 50.404 26.684 4.834   1.00 14.21 ? 578 TYR A CD1   1 
ATOM   2636 C CD2   . TYR A 1 356 ? 50.467 27.626 7.036   1.00 15.15 ? 578 TYR A CD2   1 
ATOM   2637 C CE1   . TYR A 1 356 ? 49.133 26.161 5.090   1.00 14.93 ? 578 TYR A CE1   1 
ATOM   2638 C CE2   . TYR A 1 356 ? 49.203 27.109 7.300   1.00 14.47 ? 578 TYR A CE2   1 
ATOM   2639 C CZ    . TYR A 1 356 ? 48.543 26.380 6.329   1.00 15.50 ? 578 TYR A CZ    1 
ATOM   2640 O OH    . TYR A 1 356 ? 47.303 25.868 6.616   1.00 15.56 ? 578 TYR A OH    1 
ATOM   2641 N N     . ARG A 1 357 ? 55.987 26.860 5.605   1.00 16.00 ? 579 ARG A N     1 
ATOM   2642 C CA    . ARG A 1 357 ? 57.317 27.395 5.350   1.00 16.33 ? 579 ARG A CA    1 
ATOM   2643 C C     . ARG A 1 357 ? 57.530 27.683 3.866   1.00 16.38 ? 579 ARG A C     1 
ATOM   2644 O O     . ARG A 1 357 ? 58.051 28.738 3.503   1.00 16.39 ? 579 ARG A O     1 
ATOM   2645 C CB    . ARG A 1 357 ? 58.389 26.425 5.846   1.00 18.52 ? 579 ARG A CB    1 
ATOM   2646 C CG    . ARG A 1 357 ? 59.798 26.983 5.719   1.00 20.15 ? 579 ARG A CG    1 
ATOM   2647 C CD    . ARG A 1 357 ? 60.826 26.035 6.304   1.00 23.50 ? 579 ARG A CD    1 
ATOM   2648 N NE    . ARG A 1 357 ? 62.180 26.553 6.137   1.00 25.58 ? 579 ARG A NE    1 
ATOM   2649 C CZ    . ARG A 1 357 ? 63.275 25.928 6.555   1.00 26.60 ? 579 ARG A CZ    1 
ATOM   2650 N NH1   . ARG A 1 357 ? 63.178 24.757 7.168   1.00 26.49 ? 579 ARG A NH1   1 
ATOM   2651 N NH2   . ARG A 1 357 ? 64.467 26.475 6.359   1.00 29.60 ? 579 ARG A NH2   1 
ATOM   2652 N N     . GLU A 1 358 ? 57.126 26.752 3.008   1.00 17.37 ? 580 GLU A N     1 
ATOM   2653 C CA    . GLU A 1 358 ? 57.297 26.944 1.572   1.00 18.50 ? 580 GLU A CA    1 
ATOM   2654 C C     . GLU A 1 358 ? 56.448 28.089 1.031   1.00 17.17 ? 580 GLU A C     1 
ATOM   2655 O O     . GLU A 1 358 ? 56.952 28.963 0.322   1.00 17.13 ? 580 GLU A O     1 
ATOM   2656 C CB    . GLU A 1 358 ? 56.964 25.658 0.813   1.00 21.36 ? 580 GLU A CB    1 
ATOM   2657 C CG    . GLU A 1 358 ? 58.026 24.576 0.935   1.00 27.04 ? 580 GLU A CG    1 
ATOM   2658 C CD    . GLU A 1 358 ? 57.813 23.436 -0.044  1.00 30.27 ? 580 GLU A CD    1 
ATOM   2659 O OE1   . GLU A 1 358 ? 57.730 23.705 -1.263  1.00 32.89 ? 580 GLU A OE1   1 
ATOM   2660 O OE2   . GLU A 1 358 ? 57.734 22.272 0.400   1.00 31.52 ? 580 GLU A OE2   1 
ATOM   2661 N N     . GLU A 1 359 ? 55.162 28.081 1.360   1.00 16.55 ? 581 GLU A N     1 
ATOM   2662 C CA    . GLU A 1 359 ? 54.254 29.121 0.896   1.00 15.18 ? 581 GLU A CA    1 
ATOM   2663 C C     . GLU A 1 359 ? 54.691 30.511 1.356   1.00 14.57 ? 581 GLU A C     1 
ATOM   2664 O O     . GLU A 1 359 ? 54.694 31.462 0.571   1.00 14.48 ? 581 GLU A O     1 
ATOM   2665 C CB    . GLU A 1 359 ? 52.824 28.848 1.382   1.00 16.00 ? 581 GLU A CB    1 
ATOM   2666 C CG    . GLU A 1 359 ? 52.130 27.671 0.695   1.00 18.33 ? 581 GLU A CG    1 
ATOM   2667 C CD    . GLU A 1 359 ? 52.475 26.318 1.306   1.00 19.49 ? 581 GLU A CD    1 
ATOM   2668 O OE1   . GLU A 1 359 ? 53.310 26.255 2.235   1.00 18.69 ? 581 GLU A OE1   1 
ATOM   2669 O OE2   . GLU A 1 359 ? 51.900 25.306 0.848   1.00 20.29 ? 581 GLU A OE2   1 
ATOM   2670 N N     . LEU A 1 360 ? 55.059 30.629 2.627   1.00 13.70 ? 582 LEU A N     1 
ATOM   2671 C CA    . LEU A 1 360 ? 55.482 31.915 3.172   1.00 14.08 ? 582 LEU A CA    1 
ATOM   2672 C C     . LEU A 1 360 ? 56.764 32.410 2.514   1.00 14.65 ? 582 LEU A C     1 
ATOM   2673 O O     . LEU A 1 360 ? 56.911 33.600 2.243   1.00 15.36 ? 582 LEU A O     1 
ATOM   2674 C CB    . LEU A 1 360 ? 55.656 31.811 4.689   1.00 13.44 ? 582 LEU A CB    1 
ATOM   2675 C CG    . LEU A 1 360 ? 54.336 31.633 5.453   1.00 12.68 ? 582 LEU A CG    1 
ATOM   2676 C CD1   . LEU A 1 360 ? 54.610 31.337 6.917   1.00 13.34 ? 582 LEU A CD1   1 
ATOM   2677 C CD2   . LEU A 1 360 ? 53.502 32.890 5.313   1.00 13.86 ? 582 LEU A CD2   1 
ATOM   2678 N N     . ALA A 1 361 ? 57.685 31.493 2.251   1.00 15.44 ? 583 ALA A N     1 
ATOM   2679 C CA    . ALA A 1 361 ? 58.939 31.853 1.606   1.00 17.41 ? 583 ALA A CA    1 
ATOM   2680 C C     . ALA A 1 361 ? 58.651 32.424 0.220   1.00 18.44 ? 583 ALA A C     1 
ATOM   2681 O O     . ALA A 1 361 ? 59.253 33.418 -0.185  1.00 18.48 ? 583 ALA A O     1 
ATOM   2682 C CB    . ALA A 1 361 ? 59.834 30.633 1.494   1.00 17.79 ? 583 ALA A CB    1 
ATOM   2683 N N     . GLN A 1 362 ? 57.724 31.799 -0.502  1.00 17.73 ? 584 GLN A N     1 
ATOM   2684 C CA    . GLN A 1 362 ? 57.365 32.264 -1.837  1.00 17.72 ? 584 GLN A CA    1 
ATOM   2685 C C     . GLN A 1 362 ? 56.693 33.635 -1.774  1.00 17.35 ? 584 GLN A C     1 
ATOM   2686 O O     . GLN A 1 362 ? 57.015 34.526 -2.560  1.00 17.32 ? 584 GLN A O     1 
ATOM   2687 C CB    . GLN A 1 362 ? 56.436 31.262 -2.527  1.00 19.40 ? 584 GLN A CB    1 
ATOM   2688 C CG    . GLN A 1 362 ? 56.115 31.635 -3.966  1.00 23.49 ? 584 GLN A CG    1 
ATOM   2689 C CD    . GLN A 1 362 ? 57.345 31.630 -4.861  1.00 26.49 ? 584 GLN A CD    1 
ATOM   2690 O OE1   . GLN A 1 362 ? 57.373 32.293 -5.897  1.00 27.57 ? 584 GLN A OE1   1 
ATOM   2691 N NE2   . GLN A 1 362 ? 58.362 30.870 -4.471  1.00 27.08 ? 584 GLN A NE2   1 
ATOM   2692 N N     . PHE A 1 363 ? 55.760 33.809 -0.841  1.00 16.12 ? 585 PHE A N     1 
ATOM   2693 C CA    . PHE A 1 363 ? 55.084 35.095 -0.697  1.00 16.55 ? 585 PHE A CA    1 
ATOM   2694 C C     . PHE A 1 363 ? 56.111 36.187 -0.412  1.00 17.19 ? 585 PHE A C     1 
ATOM   2695 O O     . PHE A 1 363 ? 55.970 37.316 -0.880  1.00 17.77 ? 585 PHE A O     1 
ATOM   2696 C CB    . PHE A 1 363 ? 54.066 35.067 0.449   1.00 16.51 ? 585 PHE A CB    1 
ATOM   2697 C CG    . PHE A 1 363 ? 52.780 34.361 0.116   1.00 17.43 ? 585 PHE A CG    1 
ATOM   2698 C CD1   . PHE A 1 363 ? 52.071 34.680 -1.037  1.00 18.07 ? 585 PHE A CD1   1 
ATOM   2699 C CD2   . PHE A 1 363 ? 52.251 33.410 0.986   1.00 17.15 ? 585 PHE A CD2   1 
ATOM   2700 C CE1   . PHE A 1 363 ? 50.852 34.067 -1.321  1.00 20.04 ? 585 PHE A CE1   1 
ATOM   2701 C CE2   . PHE A 1 363 ? 51.034 32.792 0.713   1.00 17.83 ? 585 PHE A CE2   1 
ATOM   2702 C CZ    . PHE A 1 363 ? 50.332 33.122 -0.443  1.00 19.03 ? 585 PHE A CZ    1 
ATOM   2703 N N     . HIS A 1 364 ? 57.135 35.846 0.367   1.00 17.27 ? 586 HIS A N     1 
ATOM   2704 C CA    . HIS A 1 364 ? 58.188 36.798 0.709   1.00 18.21 ? 586 HIS A CA    1 
ATOM   2705 C C     . HIS A 1 364 ? 59.025 37.130 -0.526  1.00 19.19 ? 586 HIS A C     1 
ATOM   2706 O O     . HIS A 1 364 ? 59.265 38.300 -0.827  1.00 18.41 ? 586 HIS A O     1 
ATOM   2707 C CB    . HIS A 1 364 ? 59.093 36.219 1.801   1.00 18.98 ? 586 HIS A CB    1 
ATOM   2708 C CG    . HIS A 1 364 ? 60.101 37.193 2.330   1.00 20.49 ? 586 HIS A CG    1 
ATOM   2709 N ND1   . HIS A 1 364 ? 61.315 36.799 2.850   1.00 24.46 ? 586 HIS A ND1   1 
ATOM   2710 C CD2   . HIS A 1 364 ? 60.064 38.542 2.442   1.00 21.24 ? 586 HIS A CD2   1 
ATOM   2711 C CE1   . HIS A 1 364 ? 61.984 37.864 3.257   1.00 23.94 ? 586 HIS A CE1   1 
ATOM   2712 N NE2   . HIS A 1 364 ? 61.247 38.934 3.022   1.00 22.59 ? 586 HIS A NE2   1 
ATOM   2713 N N     . ARG A 1 365 ? 59.468 36.095 -1.233  1.00 18.70 ? 587 ARG A N     1 
ATOM   2714 C CA    . ARG A 1 365 ? 60.271 36.285 -2.437  1.00 21.11 ? 587 ARG A CA    1 
ATOM   2715 C C     . ARG A 1 365 ? 59.533 37.094 -3.496  1.00 20.76 ? 587 ARG A C     1 
ATOM   2716 O O     . ARG A 1 365 ? 60.131 37.940 -4.158  1.00 21.97 ? 587 ARG A O     1 
ATOM   2717 C CB    . ARG A 1 365 ? 60.689 34.934 -3.022  1.00 22.03 ? 587 ARG A CB    1 
ATOM   2718 C CG    . ARG A 1 365 ? 61.908 34.321 -2.355  1.00 25.84 ? 587 ARG A CG    1 
ATOM   2719 C CD    . ARG A 1 365 ? 62.203 32.937 -2.914  1.00 28.72 ? 587 ARG A CD    1 
ATOM   2720 N NE    . ARG A 1 365 ? 61.174 31.971 -2.539  1.00 31.71 ? 587 ARG A NE    1 
ATOM   2721 C CZ    . ARG A 1 365 ? 61.120 30.722 -2.990  1.00 32.03 ? 587 ARG A CZ    1 
ATOM   2722 N NH1   . ARG A 1 365 ? 62.037 30.279 -3.840  1.00 32.48 ? 587 ARG A NH1   1 
ATOM   2723 N NH2   . ARG A 1 365 ? 60.149 29.914 -2.589  1.00 32.51 ? 587 ARG A NH2   1 
ATOM   2724 N N     . ASP A 1 366 ? 58.236 36.849 -3.652  1.00 20.08 ? 588 ASP A N     1 
ATOM   2725 C CA    . ASP A 1 366 ? 57.455 37.577 -4.650  1.00 21.34 ? 588 ASP A CA    1 
ATOM   2726 C C     . ASP A 1 366 ? 57.096 39.001 -4.231  1.00 20.67 ? 588 ASP A C     1 
ATOM   2727 O O     . ASP A 1 366 ? 56.623 39.788 -5.049  1.00 21.22 ? 588 ASP A O     1 
ATOM   2728 C CB    . ASP A 1 366 ? 56.175 36.813 -5.002  1.00 22.17 ? 588 ASP A CB    1 
ATOM   2729 C CG    . ASP A 1 366 ? 56.446 35.547 -5.794  1.00 23.63 ? 588 ASP A CG    1 
ATOM   2730 O OD1   . ASP A 1 366 ? 57.427 35.523 -6.569  1.00 27.19 ? 588 ASP A OD1   1 
ATOM   2731 O OD2   . ASP A 1 366 ? 55.668 34.582 -5.655  1.00 24.45 ? 588 ASP A OD2   1 
ATOM   2732 N N     . GLY A 1 367 ? 57.313 39.328 -2.961  1.00 20.29 ? 589 GLY A N     1 
ATOM   2733 C CA    . GLY A 1 367 ? 57.014 40.668 -2.491  1.00 19.70 ? 589 GLY A CA    1 
ATOM   2734 C C     . GLY A 1 367 ? 55.666 40.843 -1.816  1.00 19.49 ? 589 GLY A C     1 
ATOM   2735 O O     . GLY A 1 367 ? 55.353 41.930 -1.335  1.00 21.83 ? 589 GLY A O     1 
ATOM   2736 N N     . ALA A 1 368 ? 54.863 39.785 -1.782  1.00 20.10 ? 590 ALA A N     1 
ATOM   2737 C CA    . ALA A 1 368 ? 53.550 39.848 -1.144  1.00 19.96 ? 590 ALA A CA    1 
ATOM   2738 C C     . ALA A 1 368 ? 53.739 40.088 0.353   1.00 19.73 ? 590 ALA A C     1 
ATOM   2739 O O     . ALA A 1 368 ? 53.025 40.883 0.969   1.00 21.44 ? 590 ALA A O     1 
ATOM   2740 C CB    . ALA A 1 368 ? 52.793 38.553 -1.383  1.00 21.06 ? 590 ALA A CB    1 
ATOM   2741 N N     . LEU A 1 369 ? 54.705 39.383 0.928   1.00 18.48 ? 591 LEU A N     1 
ATOM   2742 C CA    . LEU A 1 369 ? 55.033 39.525 2.339   1.00 19.00 ? 591 LEU A CA    1 
ATOM   2743 C C     . LEU A 1 369 ? 56.244 40.440 2.394   1.00 19.49 ? 591 LEU A C     1 
ATOM   2744 O O     . LEU A 1 369 ? 57.329 40.047 1.973   1.00 20.86 ? 591 LEU A O     1 
ATOM   2745 C CB    . LEU A 1 369 ? 55.405 38.173 2.947   1.00 20.27 ? 591 LEU A CB    1 
ATOM   2746 C CG    . LEU A 1 369 ? 54.484 37.579 4.011   1.00 21.65 ? 591 LEU A CG    1 
ATOM   2747 C CD1   . LEU A 1 369 ? 55.166 36.369 4.635   1.00 20.18 ? 591 LEU A CD1   1 
ATOM   2748 C CD2   . LEU A 1 369 ? 54.165 38.619 5.075   1.00 19.61 ? 591 LEU A CD2   1 
ATOM   2749 N N     . THR A 1 370 ? 56.054 41.657 2.893   1.00 18.57 ? 592 THR A N     1 
ATOM   2750 C CA    . THR A 1 370 ? 57.141 42.630 2.989   1.00 20.42 ? 592 THR A CA    1 
ATOM   2751 C C     . THR A 1 370 ? 58.230 42.107 3.919   1.00 20.81 ? 592 THR A C     1 
ATOM   2752 O O     . THR A 1 370 ? 59.422 42.196 3.618   1.00 20.11 ? 592 THR A O     1 
ATOM   2753 C CB    . THR A 1 370 ? 56.628 43.975 3.528   1.00 22.51 ? 592 THR A CB    1 
ATOM   2754 O OG1   . THR A 1 370 ? 55.415 44.326 2.851   1.00 23.03 ? 592 THR A OG1   1 
ATOM   2755 C CG2   . THR A 1 370 ? 57.661 45.070 3.294   1.00 24.39 ? 592 THR A CG2   1 
ATOM   2756 N N     . GLN A 1 371 ? 57.810 41.572 5.060   1.00 20.45 ? 593 GLN A N     1 
ATOM   2757 C CA    . GLN A 1 371 ? 58.740 41.013 6.026   1.00 19.06 ? 593 GLN A CA    1 
ATOM   2758 C C     . GLN A 1 371 ? 58.184 39.711 6.581   1.00 18.01 ? 593 GLN A C     1 
ATOM   2759 O O     . GLN A 1 371 ? 56.980 39.592 6.840   1.00 17.29 ? 593 GLN A O     1 
ATOM   2760 C CB    . GLN A 1 371 ? 58.979 41.984 7.188   1.00 19.64 ? 593 GLN A CB    1 
ATOM   2761 C CG    . GLN A 1 371 ? 59.598 43.312 6.787   1.00 22.54 ? 593 GLN A CG    1 
ATOM   2762 C CD    . GLN A 1 371 ? 60.024 44.148 7.983   1.00 24.18 ? 593 GLN A CD    1 
ATOM   2763 O OE1   . GLN A 1 371 ? 60.429 45.303 7.832   1.00 27.08 ? 593 GLN A OE1   1 
ATOM   2764 N NE2   . GLN A 1 371 ? 59.943 43.569 9.178   1.00 23.84 ? 593 GLN A NE2   1 
ATOM   2765 N N     . LEU A 1 372 ? 59.070 38.736 6.740   1.00 17.71 ? 594 LEU A N     1 
ATOM   2766 C CA    . LEU A 1 372 ? 58.719 37.439 7.300   1.00 16.70 ? 594 LEU A CA    1 
ATOM   2767 C C     . LEU A 1 372 ? 59.666 37.262 8.476   1.00 16.47 ? 594 LEU A C     1 
ATOM   2768 O O     . LEU A 1 372 ? 60.818 36.848 8.315   1.00 17.95 ? 594 LEU A O     1 
ATOM   2769 C CB    . LEU A 1 372 ? 58.922 36.328 6.265   1.00 16.30 ? 594 LEU A CB    1 
ATOM   2770 C CG    . LEU A 1 372 ? 58.762 34.870 6.720   1.00 17.16 ? 594 LEU A CG    1 
ATOM   2771 C CD1   . LEU A 1 372 ? 57.415 34.667 7.402   1.00 15.72 ? 594 LEU A CD1   1 
ATOM   2772 C CD2   . LEU A 1 372 ? 58.890 33.950 5.519   1.00 17.03 ? 594 LEU A CD2   1 
ATOM   2773 N N     . ASN A 1 373 ? 59.176 37.605 9.660   1.00 16.98 ? 595 ASN A N     1 
ATOM   2774 C CA    . ASN A 1 373 ? 59.974 37.520 10.875  1.00 17.84 ? 595 ASN A CA    1 
ATOM   2775 C C     . ASN A 1 373 ? 59.522 36.321 11.690  1.00 17.40 ? 595 ASN A C     1 
ATOM   2776 O O     . ASN A 1 373 ? 58.397 36.283 12.182  1.00 16.99 ? 595 ASN A O     1 
ATOM   2777 C CB    . ASN A 1 373 ? 59.821 38.822 11.658  1.00 19.26 ? 595 ASN A CB    1 
ATOM   2778 C CG    . ASN A 1 373 ? 60.136 40.040 10.807  1.00 20.72 ? 595 ASN A CG    1 
ATOM   2779 O OD1   . ASN A 1 373 ? 61.172 40.089 10.144  1.00 22.45 ? 595 ASN A OD1   1 
ATOM   2780 N ND2   . ASN A 1 373 ? 59.245 41.023 10.816  1.00 20.88 ? 595 ASN A ND2   1 
ATOM   2781 N N     . VAL A 1 374 ? 60.411 35.343 11.829  1.00 16.59 ? 596 VAL A N     1 
ATOM   2782 C CA    . VAL A 1 374 ? 60.088 34.114 12.539  1.00 15.38 ? 596 VAL A CA    1 
ATOM   2783 C C     . VAL A 1 374 ? 60.939 33.848 13.775  1.00 15.97 ? 596 VAL A C     1 
ATOM   2784 O O     . VAL A 1 374 ? 62.168 33.873 13.722  1.00 17.03 ? 596 VAL A O     1 
ATOM   2785 C CB    . VAL A 1 374 ? 60.208 32.905 11.586  1.00 16.03 ? 596 VAL A CB    1 
ATOM   2786 C CG1   . VAL A 1 374 ? 59.668 31.652 12.254  1.00 16.66 ? 596 VAL A CG1   1 
ATOM   2787 C CG2   . VAL A 1 374 ? 59.464 33.193 10.297  1.00 15.90 ? 596 VAL A CG2   1 
ATOM   2788 N N     . ALA A 1 375 ? 60.258 33.587 14.883  1.00 15.01 ? 597 ALA A N     1 
ATOM   2789 C CA    . ALA A 1 375 ? 60.910 33.299 16.153  1.00 14.61 ? 597 ALA A CA    1 
ATOM   2790 C C     . ALA A 1 375 ? 60.919 31.792 16.385  1.00 15.92 ? 597 ALA A C     1 
ATOM   2791 O O     . ALA A 1 375 ? 59.862 31.177 16.538  1.00 15.05 ? 597 ALA A O     1 
ATOM   2792 C CB    . ALA A 1 375 ? 60.165 33.995 17.288  1.00 15.95 ? 597 ALA A CB    1 
ATOM   2793 N N     . PHE A 1 376 ? 62.109 31.200 16.385  1.00 16.08 ? 598 PHE A N     1 
ATOM   2794 C CA    . PHE A 1 376 ? 62.259 29.768 16.621  1.00 14.10 ? 598 PHE A CA    1 
ATOM   2795 C C     . PHE A 1 376 ? 62.549 29.640 18.111  1.00 15.46 ? 598 PHE A C     1 
ATOM   2796 O O     . PHE A 1 376 ? 63.681 29.840 18.561  1.00 15.42 ? 598 PHE A O     1 
ATOM   2797 C CB    . PHE A 1 376 ? 63.408 29.219 15.773  1.00 15.23 ? 598 PHE A CB    1 
ATOM   2798 C CG    . PHE A 1 376 ? 63.215 29.431 14.302  1.00 15.51 ? 598 PHE A CG    1 
ATOM   2799 C CD1   . PHE A 1 376 ? 62.182 28.786 13.626  1.00 16.38 ? 598 PHE A CD1   1 
ATOM   2800 C CD2   . PHE A 1 376 ? 64.033 30.302 13.598  1.00 16.28 ? 598 PHE A CD2   1 
ATOM   2801 C CE1   . PHE A 1 376 ? 61.967 29.010 12.269  1.00 16.28 ? 598 PHE A CE1   1 
ATOM   2802 C CE2   . PHE A 1 376 ? 63.825 30.534 12.238  1.00 17.50 ? 598 PHE A CE2   1 
ATOM   2803 C CZ    . PHE A 1 376 ? 62.789 29.886 11.575  1.00 16.29 ? 598 PHE A CZ    1 
ATOM   2804 N N     . SER A 1 377 ? 61.511 29.308 18.872  1.00 15.76 ? 599 SER A N     1 
ATOM   2805 C CA    . SER A 1 377 ? 61.601 29.222 20.325  1.00 14.78 ? 599 SER A CA    1 
ATOM   2806 C C     . SER A 1 377 ? 62.503 28.170 20.961  1.00 15.94 ? 599 SER A C     1 
ATOM   2807 O O     . SER A 1 377 ? 62.912 28.346 22.108  1.00 15.97 ? 599 SER A O     1 
ATOM   2808 C CB    . SER A 1 377 ? 60.198 29.077 20.922  1.00 14.89 ? 599 SER A CB    1 
ATOM   2809 O OG    . SER A 1 377 ? 59.619 27.827 20.584  1.00 15.55 ? 599 SER A OG    1 
ATOM   2810 N N     . ARG A 1 378 ? 62.819 27.093 20.249  1.00 15.64 ? 600 ARG A N     1 
ATOM   2811 C CA    . ARG A 1 378 ? 63.655 26.053 20.847  1.00 15.66 ? 600 ARG A CA    1 
ATOM   2812 C C     . ARG A 1 378 ? 64.950 25.750 20.106  1.00 17.17 ? 600 ARG A C     1 
ATOM   2813 O O     . ARG A 1 378 ? 65.539 24.683 20.291  1.00 18.38 ? 600 ARG A O     1 
ATOM   2814 C CB    . ARG A 1 378 ? 62.836 24.764 21.021  1.00 15.32 ? 600 ARG A CB    1 
ATOM   2815 C CG    . ARG A 1 378 ? 61.494 24.992 21.704  1.00 14.63 ? 600 ARG A CG    1 
ATOM   2816 C CD    . ARG A 1 378 ? 60.828 23.698 22.152  1.00 15.36 ? 600 ARG A CD    1 
ATOM   2817 N NE    . ARG A 1 378 ? 59.491 23.952 22.681  1.00 14.60 ? 600 ARG A NE    1 
ATOM   2818 C CZ    . ARG A 1 378 ? 58.710 23.034 23.239  1.00 18.02 ? 600 ARG A CZ    1 
ATOM   2819 N NH1   . ARG A 1 378 ? 59.125 21.777 23.351  1.00 18.25 ? 600 ARG A NH1   1 
ATOM   2820 N NH2   . ARG A 1 378 ? 57.508 23.376 23.680  1.00 18.20 ? 600 ARG A NH2   1 
ATOM   2821 N N     . GLU A 1 379 ? 65.408 26.687 19.281  1.00 17.97 ? 601 GLU A N     1 
ATOM   2822 C CA    . GLU A 1 379 ? 66.650 26.478 18.545  1.00 20.43 ? 601 GLU A CA    1 
ATOM   2823 C C     . GLU A 1 379 ? 67.879 26.945 19.315  1.00 19.78 ? 601 GLU A C     1 
ATOM   2824 O O     . GLU A 1 379 ? 69.002 26.875 18.818  1.00 22.23 ? 601 GLU A O     1 
ATOM   2825 C CB    . GLU A 1 379 ? 66.583 27.154 17.176  1.00 20.96 ? 601 GLU A CB    1 
ATOM   2826 C CG    . GLU A 1 379 ? 65.726 26.370 16.197  1.00 22.90 ? 601 GLU A CG    1 
ATOM   2827 C CD    . GLU A 1 379 ? 65.785 26.912 14.788  1.00 25.46 ? 601 GLU A CD    1 
ATOM   2828 O OE1   . GLU A 1 379 ? 65.136 26.318 13.903  1.00 25.27 ? 601 GLU A OE1   1 
ATOM   2829 O OE2   . GLU A 1 379 ? 66.477 27.927 14.561  1.00 26.43 ? 601 GLU A OE2   1 
ATOM   2830 N N     . GLN A 1 380 ? 67.649 27.424 20.531  1.00 18.87 ? 602 GLN A N     1 
ATOM   2831 C CA    . GLN A 1 380 ? 68.717 27.867 21.415  1.00 20.21 ? 602 GLN A CA    1 
ATOM   2832 C C     . GLN A 1 380 ? 68.279 27.496 22.821  1.00 20.81 ? 602 GLN A C     1 
ATOM   2833 O O     . GLN A 1 380 ? 67.144 27.063 23.024  1.00 21.23 ? 602 GLN A O     1 
ATOM   2834 C CB    . GLN A 1 380 ? 68.950 29.377 21.302  1.00 19.20 ? 602 GLN A CB    1 
ATOM   2835 C CG    . GLN A 1 380 ? 67.736 30.242 21.574  1.00 18.93 ? 602 GLN A CG    1 
ATOM   2836 C CD    . GLN A 1 380 ? 66.688 30.117 20.490  1.00 18.75 ? 602 GLN A CD    1 
ATOM   2837 O OE1   . GLN A 1 380 ? 66.984 30.282 19.306  1.00 20.35 ? 602 GLN A OE1   1 
ATOM   2838 N NE2   . GLN A 1 380 ? 65.453 29.829 20.888  1.00 18.03 ? 602 GLN A NE2   1 
ATOM   2839 N N     . SER A 1 381 ? 69.167 27.657 23.793  1.00 21.24 ? 603 SER A N     1 
ATOM   2840 C CA    . SER A 1 381 ? 68.844 27.298 25.166  1.00 22.26 ? 603 SER A CA    1 
ATOM   2841 C C     . SER A 1 381 ? 67.668 28.077 25.746  1.00 21.67 ? 603 SER A C     1 
ATOM   2842 O O     . SER A 1 381 ? 66.827 27.513 26.450  1.00 23.05 ? 603 SER A O     1 
ATOM   2843 C CB    . SER A 1 381 ? 70.072 27.484 26.060  1.00 23.73 ? 603 SER A CB    1 
ATOM   2844 O OG    . SER A 1 381 ? 69.774 27.128 27.399  1.00 29.32 ? 603 SER A OG    1 
ATOM   2845 N N     . HIS A 1 382 ? 67.610 29.369 25.444  1.00 19.17 ? 604 HIS A N     1 
ATOM   2846 C CA    . HIS A 1 382 ? 66.547 30.233 25.943  1.00 18.24 ? 604 HIS A CA    1 
ATOM   2847 C C     . HIS A 1 382 ? 65.400 30.361 24.943  1.00 17.90 ? 604 HIS A C     1 
ATOM   2848 O O     . HIS A 1 382 ? 65.500 29.905 23.802  1.00 17.04 ? 604 HIS A O     1 
ATOM   2849 C CB    . HIS A 1 382 ? 67.110 31.624 26.241  1.00 16.69 ? 604 HIS A CB    1 
ATOM   2850 C CG    . HIS A 1 382 ? 67.799 32.254 25.072  1.00 18.12 ? 604 HIS A CG    1 
ATOM   2851 N ND1   . HIS A 1 382 ? 69.073 31.902 24.679  1.00 18.42 ? 604 HIS A ND1   1 
ATOM   2852 C CD2   . HIS A 1 382 ? 67.374 33.181 24.181  1.00 17.35 ? 604 HIS A CD2   1 
ATOM   2853 C CE1   . HIS A 1 382 ? 69.402 32.584 23.597  1.00 16.68 ? 604 HIS A CE1   1 
ATOM   2854 N NE2   . HIS A 1 382 ? 68.388 33.367 23.273  1.00 18.07 ? 604 HIS A NE2   1 
ATOM   2855 N N     . LYS A 1 383 ? 64.317 30.993 25.381  1.00 17.65 ? 605 LYS A N     1 
ATOM   2856 C CA    . LYS A 1 383 ? 63.149 31.195 24.530  1.00 18.05 ? 605 LYS A CA    1 
ATOM   2857 C C     . LYS A 1 383 ? 63.272 32.457 23.689  1.00 18.55 ? 605 LYS A C     1 
ATOM   2858 O O     . LYS A 1 383 ? 63.738 33.495 24.163  1.00 18.12 ? 605 LYS A O     1 
ATOM   2859 C CB    . LYS A 1 383 ? 61.874 31.310 25.375  1.00 17.16 ? 605 LYS A CB    1 
ATOM   2860 C CG    . LYS A 1 383 ? 61.494 30.067 26.163  1.00 19.38 ? 605 LYS A CG    1 
ATOM   2861 C CD    . LYS A 1 383 ? 61.182 28.893 25.247  1.00 16.87 ? 605 LYS A CD    1 
ATOM   2862 C CE    . LYS A 1 383 ? 60.578 27.743 26.034  1.00 16.66 ? 605 LYS A CE    1 
ATOM   2863 N NZ    . LYS A 1 383 ? 60.466 26.509 25.217  1.00 16.65 ? 605 LYS A NZ    1 
ATOM   2864 N N     . VAL A 1 384 ? 62.857 32.341 22.432  1.00 17.50 ? 606 VAL A N     1 
ATOM   2865 C CA    . VAL A 1 384 ? 62.829 33.454 21.493  1.00 16.91 ? 606 VAL A CA    1 
ATOM   2866 C C     . VAL A 1 384 ? 61.400 33.402 20.956  1.00 16.59 ? 606 VAL A C     1 
ATOM   2867 O O     . VAL A 1 384 ? 61.011 32.428 20.306  1.00 16.43 ? 606 VAL A O     1 
ATOM   2868 C CB    . VAL A 1 384 ? 63.829 33.274 20.332  1.00 17.27 ? 606 VAL A CB    1 
ATOM   2869 C CG1   . VAL A 1 384 ? 63.659 34.404 19.325  1.00 17.70 ? 606 VAL A CG1   1 
ATOM   2870 C CG2   . VAL A 1 384 ? 65.255 33.267 20.871  1.00 18.84 ? 606 VAL A CG2   1 
ATOM   2871 N N     . TYR A 1 385 ? 60.629 34.441 21.263  1.00 15.53 ? 607 TYR A N     1 
ATOM   2872 C CA    . TYR A 1 385 ? 59.225 34.545 20.874  1.00 15.85 ? 607 TYR A CA    1 
ATOM   2873 C C     . TYR A 1 385 ? 58.969 35.727 19.945  1.00 15.40 ? 607 TYR A C     1 
ATOM   2874 O O     . TYR A 1 385 ? 59.834 36.590 19.769  1.00 16.08 ? 607 TYR A O     1 
ATOM   2875 C CB    . TYR A 1 385 ? 58.363 34.717 22.124  1.00 15.33 ? 607 TYR A CB    1 
ATOM   2876 C CG    . TYR A 1 385 ? 58.306 33.514 23.044  1.00 15.35 ? 607 TYR A CG    1 
ATOM   2877 C CD1   . TYR A 1 385 ? 58.077 33.678 24.408  1.00 15.34 ? 607 TYR A CD1   1 
ATOM   2878 C CD2   . TYR A 1 385 ? 58.421 32.215 22.547  1.00 14.45 ? 607 TYR A CD2   1 
ATOM   2879 C CE1   . TYR A 1 385 ? 57.958 32.578 25.256  1.00 16.18 ? 607 TYR A CE1   1 
ATOM   2880 C CE2   . TYR A 1 385 ? 58.303 31.105 23.392  1.00 15.77 ? 607 TYR A CE2   1 
ATOM   2881 C CZ    . TYR A 1 385 ? 58.071 31.299 24.741  1.00 14.83 ? 607 TYR A CZ    1 
ATOM   2882 O OH    . TYR A 1 385 ? 57.940 30.216 25.577  1.00 16.11 ? 607 TYR A OH    1 
ATOM   2883 N N     . VAL A 1 386 ? 57.770 35.777 19.370  1.00 15.93 ? 608 VAL A N     1 
ATOM   2884 C CA    . VAL A 1 386 ? 57.422 36.863 18.461  1.00 15.79 ? 608 VAL A CA    1 
ATOM   2885 C C     . VAL A 1 386 ? 57.596 38.250 19.082  1.00 15.38 ? 608 VAL A C     1 
ATOM   2886 O O     . VAL A 1 386 ? 58.042 39.176 18.397  1.00 15.96 ? 608 VAL A O     1 
ATOM   2887 C CB    . VAL A 1 386 ? 55.962 36.732 17.922  1.00 14.32 ? 608 VAL A CB    1 
ATOM   2888 C CG1   . VAL A 1 386 ? 55.876 35.589 16.921  1.00 14.23 ? 608 VAL A CG1   1 
ATOM   2889 C CG2   . VAL A 1 386 ? 54.986 36.514 19.072  1.00 15.85 ? 608 VAL A CG2   1 
ATOM   2890 N N     . GLN A 1 387 ? 57.270 38.401 20.366  1.00 15.90 ? 609 GLN A N     1 
ATOM   2891 C CA    . GLN A 1 387 ? 57.405 39.708 21.003  1.00 16.74 ? 609 GLN A CA    1 
ATOM   2892 C C     . GLN A 1 387 ? 58.852 40.187 21.071  1.00 16.78 ? 609 GLN A C     1 
ATOM   2893 O O     . GLN A 1 387 ? 59.106 41.393 21.105  1.00 16.37 ? 609 GLN A O     1 
ATOM   2894 C CB    . GLN A 1 387 ? 56.775 39.725 22.409  1.00 16.10 ? 609 GLN A CB    1 
ATOM   2895 C CG    . GLN A 1 387 ? 57.280 38.693 23.406  1.00 17.88 ? 609 GLN A CG    1 
ATOM   2896 C CD    . GLN A 1 387 ? 56.445 37.426 23.401  1.00 17.44 ? 609 GLN A CD    1 
ATOM   2897 O OE1   . GLN A 1 387 ? 56.303 36.753 24.426  1.00 18.76 ? 609 GLN A OE1   1 
ATOM   2898 N NE2   . GLN A 1 387 ? 55.896 37.092 22.246  1.00 15.35 ? 609 GLN A NE2   1 
ATOM   2899 N N     . HIS A 1 388 ? 59.798 39.255 21.082  1.00 16.56 ? 610 HIS A N     1 
ATOM   2900 C CA    . HIS A 1 388 ? 61.205 39.632 21.113  1.00 16.42 ? 610 HIS A CA    1 
ATOM   2901 C C     . HIS A 1 388 ? 61.544 40.276 19.776  1.00 17.49 ? 610 HIS A C     1 
ATOM   2902 O O     . HIS A 1 388 ? 62.277 41.265 19.718  1.00 17.93 ? 610 HIS A O     1 
ATOM   2903 C CB    . HIS A 1 388 ? 62.094 38.409 21.339  1.00 17.22 ? 610 HIS A CB    1 
ATOM   2904 C CG    . HIS A 1 388 ? 61.930 37.785 22.688  1.00 17.96 ? 610 HIS A CG    1 
ATOM   2905 N ND1   . HIS A 1 388 ? 61.514 36.483 22.862  1.00 19.11 ? 610 HIS A ND1   1 
ATOM   2906 C CD2   . HIS A 1 388 ? 62.112 38.290 23.931  1.00 19.76 ? 610 HIS A CD2   1 
ATOM   2907 C CE1   . HIS A 1 388 ? 61.443 36.214 24.153  1.00 19.30 ? 610 HIS A CE1   1 
ATOM   2908 N NE2   . HIS A 1 388 ? 61.801 37.294 24.823  1.00 20.36 ? 610 HIS A NE2   1 
ATOM   2909 N N     . LEU A 1 389 ? 60.997 39.717 18.698  1.00 16.89 ? 611 LEU A N     1 
ATOM   2910 C CA    . LEU A 1 389 ? 61.245 40.250 17.363  1.00 17.69 ? 611 LEU A CA    1 
ATOM   2911 C C     . LEU A 1 389 ? 60.534 41.586 17.191  1.00 18.64 ? 611 LEU A C     1 
ATOM   2912 O O     . LEU A 1 389 ? 61.061 42.499 16.556  1.00 18.36 ? 611 LEU A O     1 
ATOM   2913 C CB    . LEU A 1 389 ? 60.787 39.253 16.290  1.00 18.96 ? 611 LEU A CB    1 
ATOM   2914 C CG    . LEU A 1 389 ? 61.453 37.874 16.346  1.00 20.16 ? 611 LEU A CG    1 
ATOM   2915 C CD1   . LEU A 1 389 ? 61.018 37.047 15.143  1.00 21.13 ? 611 LEU A CD1   1 
ATOM   2916 C CD2   . LEU A 1 389 ? 62.968 38.027 16.364  1.00 22.30 ? 611 LEU A CD2   1 
ATOM   2917 N N     . LEU A 1 390 ? 59.337 41.701 17.761  1.00 15.98 ? 612 LEU A N     1 
ATOM   2918 C CA    . LEU A 1 390 ? 58.581 42.945 17.683  1.00 16.92 ? 612 LEU A CA    1 
ATOM   2919 C C     . LEU A 1 390 ? 59.383 44.076 18.325  1.00 17.77 ? 612 LEU A C     1 
ATOM   2920 O O     . LEU A 1 390 ? 59.540 45.151 17.739  1.00 18.74 ? 612 LEU A O     1 
ATOM   2921 C CB    . LEU A 1 390 ? 57.237 42.805 18.404  1.00 15.05 ? 612 LEU A CB    1 
ATOM   2922 C CG    . LEU A 1 390 ? 56.154 41.925 17.765  1.00 15.56 ? 612 LEU A CG    1 
ATOM   2923 C CD1   . LEU A 1 390 ? 54.989 41.787 18.731  1.00 15.39 ? 612 LEU A CD1   1 
ATOM   2924 C CD2   . LEU A 1 390 ? 55.680 42.535 16.449  1.00 15.58 ? 612 LEU A CD2   1 
ATOM   2925 N N     . LYS A 1 391 ? 59.898 43.826 19.526  1.00 18.61 ? 613 LYS A N     1 
ATOM   2926 C CA    . LYS A 1 391 ? 60.667 44.838 20.238  1.00 20.14 ? 613 LYS A CA    1 
ATOM   2927 C C     . LYS A 1 391 ? 61.918 45.244 19.468  1.00 20.48 ? 613 LYS A C     1 
ATOM   2928 O O     . LYS A 1 391 ? 62.273 46.420 19.434  1.00 19.90 ? 613 LYS A O     1 
ATOM   2929 C CB    . LYS A 1 391 ? 61.057 44.332 21.630  1.00 21.33 ? 613 LYS A CB    1 
ATOM   2930 C CG    . LYS A 1 391 ? 61.450 45.445 22.590  1.00 24.39 ? 613 LYS A CG    1 
ATOM   2931 C CD    . LYS A 1 391 ? 60.272 46.380 22.841  1.00 24.71 ? 613 LYS A CD    1 
ATOM   2932 C CE    . LYS A 1 391 ? 60.683 47.624 23.611  1.00 27.91 ? 613 LYS A CE    1 
ATOM   2933 N NZ    . LYS A 1 391 ? 61.202 47.302 24.966  1.00 28.70 ? 613 LYS A NZ    1 
ATOM   2934 N N     . GLN A 1 392 ? 62.582 44.275 18.846  1.00 19.09 ? 614 GLN A N     1 
ATOM   2935 C CA    . GLN A 1 392 ? 63.788 44.566 18.083  1.00 20.90 ? 614 GLN A CA    1 
ATOM   2936 C C     . GLN A 1 392 ? 63.461 45.369 16.824  1.00 20.88 ? 614 GLN A C     1 
ATOM   2937 O O     . GLN A 1 392 ? 64.340 46.007 16.242  1.00 22.61 ? 614 GLN A O     1 
ATOM   2938 C CB    . GLN A 1 392 ? 64.521 43.260 17.747  1.00 22.46 ? 614 GLN A CB    1 
ATOM   2939 C CG    . GLN A 1 392 ? 65.021 42.543 19.006  1.00 24.68 ? 614 GLN A CG    1 
ATOM   2940 C CD    . GLN A 1 392 ? 65.732 41.228 18.730  1.00 27.17 ? 614 GLN A CD    1 
ATOM   2941 O OE1   . GLN A 1 392 ? 66.731 41.183 18.012  1.00 28.16 ? 614 GLN A OE1   1 
ATOM   2942 N NE2   . GLN A 1 392 ? 65.223 40.149 19.314  1.00 27.58 ? 614 GLN A NE2   1 
ATOM   2943 N N     . ASP A 1 393 ? 62.191 45.348 16.422  1.00 18.47 ? 615 ASP A N     1 
ATOM   2944 C CA    . ASP A 1 393 ? 61.724 46.092 15.251  1.00 19.09 ? 615 ASP A CA    1 
ATOM   2945 C C     . ASP A 1 393 ? 60.894 47.296 15.698  1.00 17.67 ? 615 ASP A C     1 
ATOM   2946 O O     . ASP A 1 393 ? 60.128 47.856 14.912  1.00 19.35 ? 615 ASP A O     1 
ATOM   2947 C CB    . ASP A 1 393 ? 60.846 45.203 14.360  1.00 20.07 ? 615 ASP A CB    1 
ATOM   2948 C CG    . ASP A 1 393 ? 61.639 44.176 13.579  1.00 21.44 ? 615 ASP A CG    1 
ATOM   2949 O OD1   . ASP A 1 393 ? 61.007 43.315 12.930  1.00 20.56 ? 615 ASP A OD1   1 
ATOM   2950 O OD2   . ASP A 1 393 ? 62.887 44.230 13.599  1.00 22.60 ? 615 ASP A OD2   1 
ATOM   2951 N N     . ARG A 1 394 ? 61.052 47.697 16.955  1.00 18.54 ? 616 ARG A N     1 
ATOM   2952 C CA    . ARG A 1 394 ? 60.284 48.804 17.514  1.00 18.55 ? 616 ARG A CA    1 
ATOM   2953 C C     . ARG A 1 394 ? 60.230 50.077 16.667  1.00 19.38 ? 616 ARG A C     1 
ATOM   2954 O O     . ARG A 1 394 ? 59.177 50.705 16.558  1.00 18.30 ? 616 ARG A O     1 
ATOM   2955 C CB    . ARG A 1 394 ? 60.798 49.129 18.926  1.00 19.61 ? 616 ARG A CB    1 
ATOM   2956 C CG    . ARG A 1 394 ? 62.210 49.685 18.985  1.00 21.47 ? 616 ARG A CG    1 
ATOM   2957 C CD    . ARG A 1 394 ? 62.692 49.802 20.426  1.00 22.80 ? 616 ARG A CD    1 
ATOM   2958 N NE    . ARG A 1 394 ? 63.148 48.522 20.963  1.00 25.54 ? 616 ARG A NE    1 
ATOM   2959 C CZ    . ARG A 1 394 ? 63.580 48.339 22.208  1.00 27.18 ? 616 ARG A CZ    1 
ATOM   2960 N NH1   . ARG A 1 394 ? 63.615 49.356 23.059  1.00 27.18 ? 616 ARG A NH1   1 
ATOM   2961 N NH2   . ARG A 1 394 ? 63.993 47.140 22.602  1.00 27.42 ? 616 ARG A NH2   1 
ATOM   2962 N N     . GLU A 1 395 ? 61.351 50.459 16.065  1.00 19.54 ? 617 GLU A N     1 
ATOM   2963 C CA    . GLU A 1 395 ? 61.387 51.671 15.251  1.00 20.52 ? 617 GLU A CA    1 
ATOM   2964 C C     . GLU A 1 395 ? 60.435 51.643 14.061  1.00 19.81 ? 617 GLU A C     1 
ATOM   2965 O O     . GLU A 1 395 ? 59.593 52.530 13.907  1.00 20.55 ? 617 GLU A O     1 
ATOM   2966 C CB    . GLU A 1 395 ? 62.807 51.934 14.751  1.00 21.83 ? 617 GLU A CB    1 
ATOM   2967 C CG    . GLU A 1 395 ? 63.828 52.100 15.856  1.00 25.35 ? 617 GLU A CG    1 
ATOM   2968 C CD    . GLU A 1 395 ? 65.159 52.601 15.335  1.00 28.67 ? 617 GLU A CD    1 
ATOM   2969 O OE1   . GLU A 1 395 ? 66.130 52.636 16.120  1.00 30.24 ? 617 GLU A OE1   1 
ATOM   2970 O OE2   . GLU A 1 395 ? 65.228 52.964 14.140  1.00 30.41 ? 617 GLU A OE2   1 
ATOM   2971 N N     . HIS A 1 396 ? 60.568 50.631 13.214  1.00 20.21 ? 618 HIS A N     1 
ATOM   2972 C CA    . HIS A 1 396 ? 59.709 50.530 12.045  1.00 19.90 ? 618 HIS A CA    1 
ATOM   2973 C C     . HIS A 1 396 ? 58.244 50.310 12.416  1.00 20.37 ? 618 HIS A C     1 
ATOM   2974 O O     . HIS A 1 396 ? 57.350 50.885 11.796  1.00 19.53 ? 618 HIS A O     1 
ATOM   2975 C CB    . HIS A 1 396 ? 60.190 49.408 11.126  1.00 20.39 ? 618 HIS A CB    1 
ATOM   2976 C CG    . HIS A 1 396 ? 59.459 49.347 9.823   1.00 23.23 ? 618 HIS A CG    1 
ATOM   2977 N ND1   . HIS A 1 396 ? 59.239 50.461 9.042   1.00 24.88 ? 618 HIS A ND1   1 
ATOM   2978 C CD2   . HIS A 1 396 ? 58.911 48.305 9.154   1.00 23.84 ? 618 HIS A CD2   1 
ATOM   2979 C CE1   . HIS A 1 396 ? 58.586 50.109 7.949   1.00 25.21 ? 618 HIS A CE1   1 
ATOM   2980 N NE2   . HIS A 1 396 ? 58.375 48.806 7.992   1.00 23.98 ? 618 HIS A NE2   1 
ATOM   2981 N N     . LEU A 1 397 ? 57.991 49.489 13.431  1.00 18.88 ? 619 LEU A N     1 
ATOM   2982 C CA    . LEU A 1 397 ? 56.619 49.231 13.836  1.00 19.57 ? 619 LEU A CA    1 
ATOM   2983 C C     . LEU A 1 397 ? 55.929 50.513 14.288  1.00 19.72 ? 619 LEU A C     1 
ATOM   2984 O O     . LEU A 1 397 ? 54.771 50.750 13.945  1.00 20.96 ? 619 LEU A O     1 
ATOM   2985 C CB    . LEU A 1 397 ? 56.588 48.167 14.937  1.00 17.92 ? 619 LEU A CB    1 
ATOM   2986 C CG    . LEU A 1 397 ? 57.046 46.780 14.462  1.00 16.43 ? 619 LEU A CG    1 
ATOM   2987 C CD1   . LEU A 1 397 ? 57.028 45.809 15.630  1.00 17.67 ? 619 LEU A CD1   1 
ATOM   2988 C CD2   . LEU A 1 397 ? 56.137 46.277 13.341  1.00 17.20 ? 619 LEU A CD2   1 
ATOM   2989 N N     . TRP A 1 398 ? 56.639 51.346 15.045  1.00 20.44 ? 620 TRP A N     1 
ATOM   2990 C CA    . TRP A 1 398 ? 56.071 52.610 15.508  1.00 21.11 ? 620 TRP A CA    1 
ATOM   2991 C C     . TRP A 1 398 ? 55.719 53.472 14.299  1.00 21.45 ? 620 TRP A C     1 
ATOM   2992 O O     . TRP A 1 398 ? 54.648 54.074 14.236  1.00 21.80 ? 620 TRP A O     1 
ATOM   2993 C CB    . TRP A 1 398 ? 57.071 53.358 16.394  1.00 21.51 ? 620 TRP A CB    1 
ATOM   2994 C CG    . TRP A 1 398 ? 56.638 54.753 16.730  1.00 22.97 ? 620 TRP A CG    1 
ATOM   2995 C CD1   . TRP A 1 398 ? 57.290 55.912 16.413  1.00 23.79 ? 620 TRP A CD1   1 
ATOM   2996 C CD2   . TRP A 1 398 ? 55.462 55.138 17.453  1.00 24.10 ? 620 TRP A CD2   1 
ATOM   2997 N NE1   . TRP A 1 398 ? 56.593 56.995 16.895  1.00 23.58 ? 620 TRP A NE1   1 
ATOM   2998 C CE2   . TRP A 1 398 ? 55.467 56.549 17.538  1.00 24.22 ? 620 TRP A CE2   1 
ATOM   2999 C CE3   . TRP A 1 398 ? 54.404 54.428 18.037  1.00 24.25 ? 620 TRP A CE3   1 
ATOM   3000 C CZ2   . TRP A 1 398 ? 54.453 57.266 18.185  1.00 23.85 ? 620 TRP A CZ2   1 
ATOM   3001 C CZ3   . TRP A 1 398 ? 53.395 55.141 18.681  1.00 23.75 ? 620 TRP A CZ3   1 
ATOM   3002 C CH2   . TRP A 1 398 ? 53.429 56.547 18.749  1.00 24.64 ? 620 TRP A CH2   1 
ATOM   3003 N N     . LYS A 1 399 ? 56.634 53.523 13.341  1.00 21.48 ? 621 LYS A N     1 
ATOM   3004 C CA    . LYS A 1 399 ? 56.431 54.295 12.126  1.00 21.39 ? 621 LYS A CA    1 
ATOM   3005 C C     . LYS A 1 399 ? 55.153 53.828 11.436  1.00 21.78 ? 621 LYS A C     1 
ATOM   3006 O O     . LYS A 1 399 ? 54.314 54.635 11.043  1.00 20.93 ? 621 LYS A O     1 
ATOM   3007 C CB    . LYS A 1 399 ? 57.631 54.109 11.194  1.00 23.56 ? 621 LYS A CB    1 
ATOM   3008 C CG    . LYS A 1 399 ? 57.568 54.905 9.905   1.00 24.73 ? 621 LYS A CG    1 
ATOM   3009 C CD    . LYS A 1 399 ? 58.864 54.745 9.132   1.00 25.84 ? 621 LYS A CD    1 
ATOM   3010 C CE    . LYS A 1 399 ? 58.846 55.528 7.836   1.00 27.38 ? 621 LYS A CE    1 
ATOM   3011 N NZ    . LYS A 1 399 ? 60.155 55.411 7.132   1.00 28.05 ? 621 LYS A NZ    1 
ATOM   3012 N N     . LEU A 1 400 ? 55.009 52.516 11.299  1.00 21.63 ? 622 LEU A N     1 
ATOM   3013 C CA    . LEU A 1 400 ? 53.834 51.949 10.654  1.00 21.13 ? 622 LEU A CA    1 
ATOM   3014 C C     . LEU A 1 400 ? 52.561 52.242 11.438  1.00 19.86 ? 622 LEU A C     1 
ATOM   3015 O O     . LEU A 1 400 ? 51.534 52.584 10.857  1.00 19.79 ? 622 LEU A O     1 
ATOM   3016 C CB    . LEU A 1 400 ? 54.007 50.438 10.478  1.00 20.86 ? 622 LEU A CB    1 
ATOM   3017 C CG    . LEU A 1 400 ? 55.025 50.014 9.418   1.00 21.60 ? 622 LEU A CG    1 
ATOM   3018 C CD1   . LEU A 1 400 ? 55.153 48.503 9.395   1.00 22.77 ? 622 LEU A CD1   1 
ATOM   3019 C CD2   . LEU A 1 400 ? 54.582 50.526 8.057   1.00 22.79 ? 622 LEU A CD2   1 
ATOM   3020 N N     . ILE A 1 401 ? 52.629 52.110 12.759  1.00 19.03 ? 623 ILE A N     1 
ATOM   3021 C CA    . ILE A 1 401 ? 51.469 52.371 13.599  1.00 20.76 ? 623 ILE A CA    1 
ATOM   3022 C C     . ILE A 1 401 ? 51.049 53.836 13.497  1.00 21.97 ? 623 ILE A C     1 
ATOM   3023 O O     . ILE A 1 401 ? 49.869 54.140 13.321  1.00 22.17 ? 623 ILE A O     1 
ATOM   3024 C CB    . ILE A 1 401 ? 51.766 51.995 15.065  1.00 19.96 ? 623 ILE A CB    1 
ATOM   3025 C CG1   . ILE A 1 401 ? 51.946 50.478 15.166  1.00 19.94 ? 623 ILE A CG1   1 
ATOM   3026 C CG2   . ILE A 1 401 ? 50.644 52.467 15.968  1.00 21.20 ? 623 ILE A CG2   1 
ATOM   3027 C CD1   . ILE A 1 401 ? 52.395 49.991 16.524  1.00 21.22 ? 623 ILE A CD1   1 
ATOM   3028 N N     . GLU A 1 402 ? 52.012 54.745 13.605  1.00 23.00 ? 624 GLU A N     1 
ATOM   3029 C CA    . GLU A 1 402 ? 51.707 56.166 13.493  1.00 24.51 ? 624 GLU A CA    1 
ATOM   3030 C C     . GLU A 1 402 ? 51.118 56.453 12.118  1.00 23.71 ? 624 GLU A C     1 
ATOM   3031 O O     . GLU A 1 402 ? 50.314 57.372 11.957  1.00 23.93 ? 624 GLU A O     1 
ATOM   3032 C CB    . GLU A 1 402 ? 52.972 57.002 13.700  1.00 25.80 ? 624 GLU A CB    1 
ATOM   3033 C CG    . GLU A 1 402 ? 53.297 57.258 15.157  1.00 28.95 ? 624 GLU A CG    1 
ATOM   3034 C CD    . GLU A 1 402 ? 52.357 58.265 15.794  1.00 31.77 ? 624 GLU A CD    1 
ATOM   3035 O OE1   . GLU A 1 402 ? 52.456 59.466 15.460  1.00 32.75 ? 624 GLU A OE1   1 
ATOM   3036 O OE2   . GLU A 1 402 ? 51.514 57.859 16.622  1.00 32.74 ? 624 GLU A OE2   1 
ATOM   3037 N N     . GLY A 1 403 ? 51.519 55.649 11.135  1.00 23.12 ? 625 GLY A N     1 
ATOM   3038 C CA    . GLY A 1 403 ? 51.032 55.815 9.777   1.00 22.20 ? 625 GLY A CA    1 
ATOM   3039 C C     . GLY A 1 403 ? 49.651 55.232 9.521   1.00 22.10 ? 625 GLY A C     1 
ATOM   3040 O O     . GLY A 1 403 ? 49.158 55.272 8.393   1.00 23.54 ? 625 GLY A O     1 
ATOM   3041 N N     . GLY A 1 404 ? 49.029 54.673 10.556  1.00 21.55 ? 626 GLY A N     1 
ATOM   3042 C CA    . GLY A 1 404 ? 47.697 54.114 10.404  1.00 21.23 ? 626 GLY A CA    1 
ATOM   3043 C C     . GLY A 1 404 ? 47.616 52.617 10.159  1.00 19.82 ? 626 GLY A C     1 
ATOM   3044 O O     . GLY A 1 404 ? 46.565 52.109 9.769   1.00 19.72 ? 626 GLY A O     1 
ATOM   3045 N N     . ALA A 1 405 ? 48.712 51.902 10.390  1.00 19.62 ? 627 ALA A N     1 
ATOM   3046 C CA    . ALA A 1 405 ? 48.722 50.457 10.175  1.00 18.78 ? 627 ALA A CA    1 
ATOM   3047 C C     . ALA A 1 405 ? 47.755 49.724 11.103  1.00 18.04 ? 627 ALA A C     1 
ATOM   3048 O O     . ALA A 1 405 ? 47.439 50.196 12.194  1.00 17.86 ? 627 ALA A O     1 
ATOM   3049 C CB    . ALA A 1 405 ? 50.135 49.909 10.368  1.00 17.32 ? 627 ALA A CB    1 
ATOM   3050 N N     . HIS A 1 406 ? 47.285 48.565 10.655  1.00 17.45 ? 628 HIS A N     1 
ATOM   3051 C CA    . HIS A 1 406 ? 46.379 47.738 11.447  1.00 16.80 ? 628 HIS A CA    1 
ATOM   3052 C C     . HIS A 1 406 ? 47.197 46.613 12.069  1.00 16.40 ? 628 HIS A C     1 
ATOM   3053 O O     . HIS A 1 406 ? 48.032 46.004 11.401  1.00 16.53 ? 628 HIS A O     1 
ATOM   3054 C CB    . HIS A 1 406 ? 45.287 47.126 10.563  1.00 17.56 ? 628 HIS A CB    1 
ATOM   3055 C CG    . HIS A 1 406 ? 44.180 48.070 10.207  1.00 18.80 ? 628 HIS A CG    1 
ATOM   3056 N ND1   . HIS A 1 406 ? 44.403 49.374 9.822   1.00 20.00 ? 628 HIS A ND1   1 
ATOM   3057 C CD2   . HIS A 1 406 ? 42.841 47.880 10.131  1.00 17.96 ? 628 HIS A CD2   1 
ATOM   3058 C CE1   . HIS A 1 406 ? 43.249 49.947 9.525   1.00 21.42 ? 628 HIS A CE1   1 
ATOM   3059 N NE2   . HIS A 1 406 ? 42.286 49.061 9.703   1.00 20.70 ? 628 HIS A NE2   1 
ATOM   3060 N N     . ILE A 1 407 ? 46.959 46.343 13.347  1.00 16.08 ? 629 ILE A N     1 
ATOM   3061 C CA    . ILE A 1 407 ? 47.661 45.276 14.048  1.00 15.40 ? 629 ILE A CA    1 
ATOM   3062 C C     . ILE A 1 407 ? 46.695 44.118 14.272  1.00 15.60 ? 629 ILE A C     1 
ATOM   3063 O O     . ILE A 1 407 ? 45.531 44.331 14.617  1.00 16.23 ? 629 ILE A O     1 
ATOM   3064 C CB    . ILE A 1 407 ? 48.171 45.747 15.426  1.00 16.86 ? 629 ILE A CB    1 
ATOM   3065 C CG1   . ILE A 1 407 ? 49.256 46.807 15.244  1.00 17.15 ? 629 ILE A CG1   1 
ATOM   3066 C CG2   . ILE A 1 407 ? 48.696 44.552 16.230  1.00 17.48 ? 629 ILE A CG2   1 
ATOM   3067 C CD1   . ILE A 1 407 ? 49.670 47.478 16.537  1.00 18.12 ? 629 ILE A CD1   1 
ATOM   3068 N N     . TYR A 1 408 ? 47.179 42.899 14.069  1.00 14.12 ? 630 TYR A N     1 
ATOM   3069 C CA    . TYR A 1 408 ? 46.363 41.710 14.270  1.00 14.43 ? 630 TYR A CA    1 
ATOM   3070 C C     . TYR A 1 408 ? 47.134 40.703 15.102  1.00 14.10 ? 630 TYR A C     1 
ATOM   3071 O O     . TYR A 1 408 ? 48.306 40.449 14.839  1.00 13.51 ? 630 TYR A O     1 
ATOM   3072 C CB    . TYR A 1 408 ? 45.998 41.055 12.937  1.00 14.66 ? 630 TYR A CB    1 
ATOM   3073 C CG    . TYR A 1 408 ? 45.276 41.963 11.974  1.00 14.62 ? 630 TYR A CG    1 
ATOM   3074 C CD1   . TYR A 1 408 ? 45.985 42.820 11.134  1.00 14.92 ? 630 TYR A CD1   1 
ATOM   3075 C CD2   . TYR A 1 408 ? 43.883 41.983 11.915  1.00 14.47 ? 630 TYR A CD2   1 
ATOM   3076 C CE1   . TYR A 1 408 ? 45.328 43.675 10.259  1.00 16.78 ? 630 TYR A CE1   1 
ATOM   3077 C CE2   . TYR A 1 408 ? 43.213 42.838 11.045  1.00 15.45 ? 630 TYR A CE2   1 
ATOM   3078 C CZ    . TYR A 1 408 ? 43.942 43.682 10.222  1.00 15.89 ? 630 TYR A CZ    1 
ATOM   3079 O OH    . TYR A 1 408 ? 43.290 44.550 9.379   1.00 15.58 ? 630 TYR A OH    1 
ATOM   3080 N N     . VAL A 1 409 ? 46.475 40.133 16.106  1.00 12.94 ? 631 VAL A N     1 
ATOM   3081 C CA    . VAL A 1 409 ? 47.096 39.127 16.953  1.00 14.50 ? 631 VAL A CA    1 
ATOM   3082 C C     . VAL A 1 409 ? 46.171 37.918 16.975  1.00 14.28 ? 631 VAL A C     1 
ATOM   3083 O O     . VAL A 1 409 ? 44.973 38.050 17.224  1.00 15.30 ? 631 VAL A O     1 
ATOM   3084 C CB    . VAL A 1 409 ? 47.299 39.640 18.389  1.00 14.66 ? 631 VAL A CB    1 
ATOM   3085 C CG1   . VAL A 1 409 ? 47.933 38.551 19.238  1.00 16.82 ? 631 VAL A CG1   1 
ATOM   3086 C CG2   . VAL A 1 409 ? 48.172 40.889 18.376  1.00 15.54 ? 631 VAL A CG2   1 
ATOM   3087 N N     . CYS A 1 410 ? 46.733 36.747 16.695  1.00 14.22 ? 632 CYS A N     1 
ATOM   3088 C CA    . CYS A 1 410 ? 45.965 35.508 16.670  1.00 14.61 ? 632 CYS A CA    1 
ATOM   3089 C C     . CYS A 1 410 ? 46.727 34.359 17.309  1.00 14.90 ? 632 CYS A C     1 
ATOM   3090 O O     . CYS A 1 410 ? 47.939 34.238 17.148  1.00 14.98 ? 632 CYS A O     1 
ATOM   3091 C CB    . CYS A 1 410 ? 45.619 35.129 15.227  1.00 14.43 ? 632 CYS A CB    1 
ATOM   3092 S SG    . CYS A 1 410 ? 44.719 33.554 15.083  1.00 15.53 ? 632 CYS A SG    1 
ATOM   3093 N N     . GLY A 1 411 ? 46.005 33.508 18.028  1.00 17.44 ? 633 GLY A N     1 
ATOM   3094 C CA    . GLY A 1 411 ? 46.643 32.369 18.656  1.00 19.15 ? 633 GLY A CA    1 
ATOM   3095 C C     . GLY A 1 411 ? 46.265 32.210 20.113  1.00 21.34 ? 633 GLY A C     1 
ATOM   3096 O O     . GLY A 1 411 ? 45.107 32.388 20.492  1.00 21.88 ? 633 GLY A O     1 
ATOM   3097 N N     . ASP A 1 412 ? 47.263 31.882 20.926  1.00 23.16 ? 634 ASP A N     1 
ATOM   3098 C CA    . ASP A 1 412 ? 47.099 31.666 22.360  1.00 24.52 ? 634 ASP A CA    1 
ATOM   3099 C C     . ASP A 1 412 ? 46.654 32.899 23.149  1.00 25.27 ? 634 ASP A C     1 
ATOM   3100 O O     . ASP A 1 412 ? 47.350 33.915 23.188  1.00 24.54 ? 634 ASP A O     1 
ATOM   3101 C CB    . ASP A 1 412 ? 48.411 31.149 22.943  1.00 24.80 ? 634 ASP A CB    1 
ATOM   3102 C CG    . ASP A 1 412 ? 48.341 30.952 24.436  1.00 26.21 ? 634 ASP A CG    1 
ATOM   3103 O OD1   . ASP A 1 412 ? 49.269 31.407 25.141  1.00 26.14 ? 634 ASP A OD1   1 
ATOM   3104 O OD2   . ASP A 1 412 ? 47.358 30.340 24.901  1.00 23.67 ? 634 ASP A OD2   1 
ATOM   3105 N N     . ALA A 1 413 ? 45.506 32.788 23.807  1.00 26.14 ? 635 ALA A N     1 
ATOM   3106 C CA    . ALA A 1 413 ? 44.966 33.886 24.600  1.00 27.14 ? 635 ALA A CA    1 
ATOM   3107 C C     . ALA A 1 413 ? 45.465 33.855 26.044  1.00 28.51 ? 635 ALA A C     1 
ATOM   3108 O O     . ALA A 1 413 ? 45.328 34.834 26.774  1.00 29.75 ? 635 ALA A O     1 
ATOM   3109 C CB    . ALA A 1 413 ? 43.445 33.831 24.585  1.00 26.59 ? 635 ALA A CB    1 
ATOM   3110 N N     . ARG A 1 414 ? 46.044 32.731 26.450  1.00 29.85 ? 636 ARG A N     1 
ATOM   3111 C CA    . ARG A 1 414 ? 46.534 32.578 27.817  1.00 29.90 ? 636 ARG A CA    1 
ATOM   3112 C C     . ARG A 1 414 ? 47.690 33.505 28.176  1.00 29.73 ? 636 ARG A C     1 
ATOM   3113 O O     . ARG A 1 414 ? 47.596 34.287 29.127  1.00 31.20 ? 636 ARG A O     1 
ATOM   3114 C CB    . ARG A 1 414 ? 46.952 31.124 28.066  1.00 31.16 ? 636 ARG A CB    1 
ATOM   3115 C CG    . ARG A 1 414 ? 47.574 30.879 29.436  1.00 32.31 ? 636 ARG A CG    1 
ATOM   3116 C CD    . ARG A 1 414 ? 47.895 29.406 29.649  1.00 32.78 ? 636 ARG A CD    1 
ATOM   3117 N NE    . ARG A 1 414 ? 46.686 28.593 29.760  1.00 33.01 ? 636 ARG A NE    1 
ATOM   3118 C CZ    . ARG A 1 414 ? 45.825 28.665 30.771  1.00 32.17 ? 636 ARG A CZ    1 
ATOM   3119 N NH1   . ARG A 1 414 ? 46.036 29.513 31.769  1.00 31.30 ? 636 ARG A NH1   1 
ATOM   3120 N NH2   . ARG A 1 414 ? 44.746 27.894 30.783  1.00 31.95 ? 636 ARG A NH2   1 
ATOM   3121 N N     . ASN A 1 415 ? 48.778 33.424 27.417  1.00 27.37 ? 637 ASN A N     1 
ATOM   3122 C CA    . ASN A 1 415 ? 49.951 34.245 27.695  1.00 24.81 ? 637 ASN A CA    1 
ATOM   3123 C C     . ASN A 1 415 ? 50.427 35.070 26.509  1.00 22.28 ? 637 ASN A C     1 
ATOM   3124 O O     . ASN A 1 415 ? 50.736 36.253 26.651  1.00 22.37 ? 637 ASN A O     1 
ATOM   3125 C CB    . ASN A 1 415 ? 51.103 33.357 28.168  1.00 26.22 ? 637 ASN A CB    1 
ATOM   3126 C CG    . ASN A 1 415 ? 50.819 32.691 29.497  1.00 28.61 ? 637 ASN A CG    1 
ATOM   3127 O OD1   . ASN A 1 415 ? 50.705 33.357 30.528  1.00 29.20 ? 637 ASN A OD1   1 
ATOM   3128 N ND2   . ASN A 1 415 ? 50.705 31.368 29.482  1.00 29.45 ? 637 ASN A ND2   1 
ATOM   3129 N N     . MET A 1 416 ? 50.492 34.439 25.344  1.00 19.82 ? 638 MET A N     1 
ATOM   3130 C CA    . MET A 1 416 ? 50.962 35.101 24.133  1.00 18.31 ? 638 MET A CA    1 
ATOM   3131 C C     . MET A 1 416 ? 50.274 36.432 23.840  1.00 18.94 ? 638 MET A C     1 
ATOM   3132 O O     . MET A 1 416 ? 50.941 37.458 23.697  1.00 18.14 ? 638 MET A O     1 
ATOM   3133 C CB    . MET A 1 416 ? 50.814 34.150 22.938  1.00 18.60 ? 638 MET A CB    1 
ATOM   3134 C CG    . MET A 1 416 ? 51.438 34.639 21.629  1.00 20.09 ? 638 MET A CG    1 
ATOM   3135 S SD    . MET A 1 416 ? 50.462 35.872 20.746  1.00 18.49 ? 638 MET A SD    1 
ATOM   3136 C CE    . MET A 1 416 ? 49.089 34.856 20.193  1.00 17.29 ? 638 MET A CE    1 
ATOM   3137 N N     . ALA A 1 417 ? 48.948 36.423 23.760  1.00 17.58 ? 639 ALA A N     1 
ATOM   3138 C CA    . ALA A 1 417 ? 48.203 37.641 23.460  1.00 18.43 ? 639 ALA A CA    1 
ATOM   3139 C C     . ALA A 1 417 ? 48.525 38.779 24.424  1.00 18.05 ? 639 ALA A C     1 
ATOM   3140 O O     . ALA A 1 417 ? 48.712 39.921 24.004  1.00 18.63 ? 639 ALA A O     1 
ATOM   3141 C CB    . ALA A 1 417 ? 46.709 37.355 23.467  1.00 19.60 ? 639 ALA A CB    1 
ATOM   3142 N N     . ARG A 1 418 ? 48.589 38.465 25.715  1.00 18.69 ? 640 ARG A N     1 
ATOM   3143 C CA    . ARG A 1 418 ? 48.894 39.469 26.730  1.00 18.88 ? 640 ARG A CA    1 
ATOM   3144 C C     . ARG A 1 418 ? 50.331 39.963 26.620  1.00 17.92 ? 640 ARG A C     1 
ATOM   3145 O O     . ARG A 1 418 ? 50.588 41.162 26.733  1.00 18.07 ? 640 ARG A O     1 
ATOM   3146 C CB    . ARG A 1 418 ? 48.661 38.901 28.132  1.00 19.80 ? 640 ARG A CB    1 
ATOM   3147 C CG    . ARG A 1 418 ? 47.208 38.608 28.458  1.00 24.13 ? 640 ARG A CG    1 
ATOM   3148 C CD    . ARG A 1 418 ? 46.345 39.838 28.248  1.00 28.83 ? 640 ARG A CD    1 
ATOM   3149 N NE    . ARG A 1 418 ? 46.854 40.995 28.980  1.00 31.77 ? 640 ARG A NE    1 
ATOM   3150 C CZ    . ARG A 1 418 ? 46.381 42.228 28.839  1.00 32.98 ? 640 ARG A CZ    1 
ATOM   3151 N NH1   . ARG A 1 418 ? 45.387 42.460 27.993  1.00 32.44 ? 640 ARG A NH1   1 
ATOM   3152 N NH2   . ARG A 1 418 ? 46.901 43.228 29.541  1.00 32.49 ? 640 ARG A NH2   1 
ATOM   3153 N N     . ASP A 1 419 ? 51.264 39.040 26.408  1.00 16.48 ? 641 ASP A N     1 
ATOM   3154 C CA    . ASP A 1 419 ? 52.672 39.409 26.279  1.00 17.18 ? 641 ASP A CA    1 
ATOM   3155 C C     . ASP A 1 419 ? 52.885 40.316 25.078  1.00 18.16 ? 641 ASP A C     1 
ATOM   3156 O O     . ASP A 1 419 ? 53.659 41.273 25.139  1.00 18.08 ? 641 ASP A O     1 
ATOM   3157 C CB    . ASP A 1 419 ? 53.558 38.172 26.123  1.00 18.03 ? 641 ASP A CB    1 
ATOM   3158 C CG    . ASP A 1 419 ? 53.676 37.370 27.399  1.00 20.61 ? 641 ASP A CG    1 
ATOM   3159 O OD1   . ASP A 1 419 ? 53.437 37.935 28.488  1.00 20.75 ? 641 ASP A OD1   1 
ATOM   3160 O OD2   . ASP A 1 419 ? 54.027 36.175 27.311  1.00 21.10 ? 641 ASP A OD2   1 
ATOM   3161 N N     . VAL A 1 420 ? 52.209 40.000 23.981  1.00 18.38 ? 642 VAL A N     1 
ATOM   3162 C CA    . VAL A 1 420 ? 52.319 40.791 22.769  1.00 16.86 ? 642 VAL A CA    1 
ATOM   3163 C C     . VAL A 1 420 ? 51.724 42.174 22.986  1.00 17.85 ? 642 VAL A C     1 
ATOM   3164 O O     . VAL A 1 420 ? 52.296 43.175 22.558  1.00 18.84 ? 642 VAL A O     1 
ATOM   3165 C CB    . VAL A 1 420 ? 51.607 40.088 21.588  1.00 16.13 ? 642 VAL A CB    1 
ATOM   3166 C CG1   . VAL A 1 420 ? 51.417 41.056 20.420  1.00 17.11 ? 642 VAL A CG1   1 
ATOM   3167 C CG2   . VAL A 1 420 ? 52.438 38.899 21.139  1.00 16.24 ? 642 VAL A CG2   1 
ATOM   3168 N N     . GLN A 1 421 ? 50.584 42.233 23.669  1.00 18.01 ? 643 GLN A N     1 
ATOM   3169 C CA    . GLN A 1 421 ? 49.934 43.507 23.928  1.00 20.03 ? 643 GLN A CA    1 
ATOM   3170 C C     . GLN A 1 421 ? 50.831 44.394 24.786  1.00 19.97 ? 643 GLN A C     1 
ATOM   3171 O O     . GLN A 1 421 ? 50.948 45.596 24.537  1.00 19.59 ? 643 GLN A O     1 
ATOM   3172 C CB    . GLN A 1 421 ? 48.586 43.286 24.619  1.00 20.60 ? 643 GLN A CB    1 
ATOM   3173 C CG    . GLN A 1 421 ? 47.737 44.540 24.705  1.00 24.50 ? 643 GLN A CG    1 
ATOM   3174 C CD    . GLN A 1 421 ? 46.277 44.238 24.977  1.00 27.43 ? 643 GLN A CD    1 
ATOM   3175 O OE1   . GLN A 1 421 ? 45.621 43.539 24.202  1.00 29.27 ? 643 GLN A OE1   1 
ATOM   3176 N NE2   . GLN A 1 421 ? 45.758 44.767 26.077  1.00 28.72 ? 643 GLN A NE2   1 
ATOM   3177 N N     . ASN A 1 422 ? 51.470 43.801 25.790  1.00 19.36 ? 644 ASN A N     1 
ATOM   3178 C CA    . ASN A 1 422 ? 52.360 44.561 26.661  1.00 20.24 ? 644 ASN A CA    1 
ATOM   3179 C C     . ASN A 1 422 ? 53.579 45.064 25.893  1.00 20.38 ? 644 ASN A C     1 
ATOM   3180 O O     . ASN A 1 422 ? 54.110 46.135 26.189  1.00 21.06 ? 644 ASN A O     1 
ATOM   3181 C CB    . ASN A 1 422 ? 52.808 43.713 27.854  1.00 22.02 ? 644 ASN A CB    1 
ATOM   3182 C CG    . ASN A 1 422 ? 51.677 43.429 28.825  1.00 23.22 ? 644 ASN A CG    1 
ATOM   3183 O OD1   . ASN A 1 422 ? 50.762 44.238 28.986  1.00 26.18 ? 644 ASN A OD1   1 
ATOM   3184 N ND2   . ASN A 1 422 ? 51.745 42.283 29.493  1.00 24.02 ? 644 ASN A ND2   1 
ATOM   3185 N N     . THR A 1 423 ? 54.017 44.293 24.902  1.00 18.67 ? 645 THR A N     1 
ATOM   3186 C CA    . THR A 1 423 ? 55.163 44.682 24.089  1.00 18.91 ? 645 THR A CA    1 
ATOM   3187 C C     . THR A 1 423 ? 54.794 45.890 23.237  1.00 18.77 ? 645 THR A C     1 
ATOM   3188 O O     . THR A 1 423 ? 55.615 46.785 23.037  1.00 18.82 ? 645 THR A O     1 
ATOM   3189 C CB    . THR A 1 423 ? 55.625 43.525 23.184  1.00 19.12 ? 645 THR A CB    1 
ATOM   3190 O OG1   . THR A 1 423 ? 56.134 42.465 24.004  1.00 20.71 ? 645 THR A OG1   1 
ATOM   3191 C CG2   . THR A 1 423 ? 56.717 43.986 22.225  1.00 18.58 ? 645 THR A CG2   1 
ATOM   3192 N N     . PHE A 1 424 ? 53.564 45.923 22.733  1.00 18.90 ? 646 PHE A N     1 
ATOM   3193 C CA    . PHE A 1 424 ? 53.133 47.069 21.940  1.00 19.33 ? 646 PHE A CA    1 
ATOM   3194 C C     . PHE A 1 424 ? 52.981 48.291 22.848  1.00 20.60 ? 646 PHE A C     1 
ATOM   3195 O O     . PHE A 1 424 ? 53.219 49.422 22.418  1.00 20.71 ? 646 PHE A O     1 
ATOM   3196 C CB    . PHE A 1 424 ? 51.822 46.768 21.210  1.00 17.74 ? 646 PHE A CB    1 
ATOM   3197 C CG    . PHE A 1 424 ? 52.010 46.027 19.916  1.00 17.91 ? 646 PHE A CG    1 
ATOM   3198 C CD1   . PHE A 1 424 ? 51.477 44.754 19.739  1.00 17.48 ? 646 PHE A CD1   1 
ATOM   3199 C CD2   . PHE A 1 424 ? 52.720 46.608 18.869  1.00 17.08 ? 646 PHE A CD2   1 
ATOM   3200 C CE1   . PHE A 1 424 ? 51.648 44.069 18.538  1.00 17.28 ? 646 PHE A CE1   1 
ATOM   3201 C CE2   . PHE A 1 424 ? 52.896 45.931 17.663  1.00 17.99 ? 646 PHE A CE2   1 
ATOM   3202 C CZ    . PHE A 1 424 ? 52.358 44.660 17.499  1.00 17.14 ? 646 PHE A CZ    1 
ATOM   3203 N N     . TYR A 1 425 ? 52.588 48.063 24.102  1.00 20.33 ? 647 TYR A N     1 
ATOM   3204 C CA    . TYR A 1 425 ? 52.450 49.153 25.069  1.00 22.01 ? 647 TYR A CA    1 
ATOM   3205 C C     . TYR A 1 425 ? 53.817 49.809 25.202  1.00 22.86 ? 647 TYR A C     1 
ATOM   3206 O O     . TYR A 1 425 ? 53.955 51.026 25.060  1.00 24.33 ? 647 TYR A O     1 
ATOM   3207 C CB    . TYR A 1 425 ? 52.036 48.624 26.448  1.00 21.90 ? 647 TYR A CB    1 
ATOM   3208 C CG    . TYR A 1 425 ? 50.566 48.313 26.626  1.00 21.74 ? 647 TYR A CG    1 
ATOM   3209 C CD1   . TYR A 1 425 ? 50.132 47.515 27.687  1.00 23.50 ? 647 TYR A CD1   1 
ATOM   3210 C CD2   . TYR A 1 425 ? 49.606 48.815 25.748  1.00 22.12 ? 647 TYR A CD2   1 
ATOM   3211 C CE1   . TYR A 1 425 ? 48.784 47.223 27.867  1.00 23.22 ? 647 TYR A CE1   1 
ATOM   3212 C CE2   . TYR A 1 425 ? 48.253 48.528 25.921  1.00 22.30 ? 647 TYR A CE2   1 
ATOM   3213 C CZ    . TYR A 1 425 ? 47.851 47.731 26.982  1.00 23.20 ? 647 TYR A CZ    1 
ATOM   3214 O OH    . TYR A 1 425 ? 46.516 47.439 27.151  1.00 25.27 ? 647 TYR A OH    1 
ATOM   3215 N N     . ASP A 1 426 ? 54.824 48.984 25.475  1.00 23.83 ? 648 ASP A N     1 
ATOM   3216 C CA    . ASP A 1 426 ? 56.188 49.466 25.642  1.00 24.60 ? 648 ASP A CA    1 
ATOM   3217 C C     . ASP A 1 426 ? 56.707 50.187 24.407  1.00 24.35 ? 648 ASP A C     1 
ATOM   3218 O O     . ASP A 1 426 ? 57.337 51.238 24.522  1.00 25.32 ? 648 ASP A O     1 
ATOM   3219 C CB    . ASP A 1 426 ? 57.132 48.309 25.992  1.00 25.40 ? 648 ASP A CB    1 
ATOM   3220 C CG    . ASP A 1 426 ? 56.800 47.662 27.327  1.00 27.61 ? 648 ASP A CG    1 
ATOM   3221 O OD1   . ASP A 1 426 ? 56.377 48.384 28.254  1.00 28.06 ? 648 ASP A OD1   1 
ATOM   3222 O OD2   . ASP A 1 426 ? 56.976 46.433 27.456  1.00 28.18 ? 648 ASP A OD2   1 
ATOM   3223 N N     . ILE A 1 427 ? 56.455 49.620 23.230  1.00 23.19 ? 649 ILE A N     1 
ATOM   3224 C CA    . ILE A 1 427 ? 56.906 50.230 21.985  1.00 22.23 ? 649 ILE A CA    1 
ATOM   3225 C C     . ILE A 1 427 ? 56.339 51.638 21.836  1.00 23.09 ? 649 ILE A C     1 
ATOM   3226 O O     . ILE A 1 427 ? 57.076 52.580 21.552  1.00 24.89 ? 649 ILE A O     1 
ATOM   3227 C CB    . ILE A 1 427 ? 56.494 49.382 20.757  1.00 20.27 ? 649 ILE A CB    1 
ATOM   3228 C CG1   . ILE A 1 427 ? 57.293 48.075 20.738  1.00 20.02 ? 649 ILE A CG1   1 
ATOM   3229 C CG2   . ILE A 1 427 ? 56.733 50.166 19.473  1.00 20.10 ? 649 ILE A CG2   1 
ATOM   3230 C CD1   . ILE A 1 427 ? 56.954 47.149 19.576  1.00 20.84 ? 649 ILE A CD1   1 
ATOM   3231 N N     . VAL A 1 428 ? 55.032 51.779 22.039  1.00 23.69 ? 650 VAL A N     1 
ATOM   3232 C CA    . VAL A 1 428 ? 54.385 53.081 21.922  1.00 24.12 ? 650 VAL A CA    1 
ATOM   3233 C C     . VAL A 1 428 ? 54.840 54.027 23.030  1.00 24.87 ? 650 VAL A C     1 
ATOM   3234 O O     . VAL A 1 428 ? 55.001 55.227 22.806  1.00 24.80 ? 650 VAL A O     1 
ATOM   3235 C CB    . VAL A 1 428 ? 52.848 52.948 21.972  1.00 23.98 ? 650 VAL A CB    1 
ATOM   3236 C CG1   . VAL A 1 428 ? 52.199 54.316 21.840  1.00 24.37 ? 650 VAL A CG1   1 
ATOM   3237 C CG2   . VAL A 1 428 ? 52.376 52.026 20.860  1.00 23.65 ? 650 VAL A CG2   1 
ATOM   3238 N N     . ALA A 1 429 ? 55.054 53.484 24.224  1.00 25.47 ? 651 ALA A N     1 
ATOM   3239 C CA    . ALA A 1 429 ? 55.496 54.291 25.355  1.00 25.81 ? 651 ALA A CA    1 
ATOM   3240 C C     . ALA A 1 429 ? 56.884 54.869 25.088  1.00 26.35 ? 651 ALA A C     1 
ATOM   3241 O O     . ALA A 1 429 ? 57.128 56.054 25.319  1.00 27.04 ? 651 ALA A O     1 
ATOM   3242 C CB    . ALA A 1 429 ? 55.514 53.445 26.624  1.00 25.96 ? 651 ALA A CB    1 
ATOM   3243 N N     . GLU A 1 430 ? 57.787 54.031 24.592  1.00 25.82 ? 652 GLU A N     1 
ATOM   3244 C CA    . GLU A 1 430 ? 59.147 54.465 24.298  1.00 26.93 ? 652 GLU A CA    1 
ATOM   3245 C C     . GLU A 1 430 ? 59.227 55.376 23.077  1.00 26.75 ? 652 GLU A C     1 
ATOM   3246 O O     . GLU A 1 430 ? 59.586 56.549 23.190  1.00 27.59 ? 652 GLU A O     1 
ATOM   3247 C CB    . GLU A 1 430 ? 60.055 53.255 24.078  1.00 26.86 ? 652 GLU A CB    1 
ATOM   3248 C CG    . GLU A 1 430 ? 61.450 53.628 23.600  1.00 29.18 ? 652 GLU A CG    1 
ATOM   3249 C CD    . GLU A 1 430 ? 62.319 52.423 23.298  1.00 31.00 ? 652 GLU A CD    1 
ATOM   3250 O OE1   . GLU A 1 430 ? 63.464 52.622 22.837  1.00 33.66 ? 652 GLU A OE1   1 
ATOM   3251 O OE2   . GLU A 1 430 ? 61.864 51.282 23.520  1.00 31.26 ? 652 GLU A OE2   1 
ATOM   3252 N N     . LEU A 1 431 ? 58.898 54.828 21.910  1.00 26.95 ? 653 LEU A N     1 
ATOM   3253 C CA    . LEU A 1 431 ? 58.952 55.583 20.661  1.00 26.56 ? 653 LEU A CA    1 
ATOM   3254 C C     . LEU A 1 431 ? 57.960 56.739 20.602  1.00 28.12 ? 653 LEU A C     1 
ATOM   3255 O O     . LEU A 1 431 ? 58.157 57.691 19.848  1.00 28.57 ? 653 LEU A O     1 
ATOM   3256 C CB    . LEU A 1 431 ? 58.723 54.649 19.466  1.00 26.91 ? 653 LEU A CB    1 
ATOM   3257 C CG    . LEU A 1 431 ? 59.877 53.752 19.001  1.00 27.14 ? 653 LEU A CG    1 
ATOM   3258 C CD1   . LEU A 1 431 ? 61.005 54.615 18.454  1.00 27.89 ? 653 LEU A CD1   1 
ATOM   3259 C CD2   . LEU A 1 431 ? 60.370 52.888 20.151  1.00 27.21 ? 653 LEU A CD2   1 
ATOM   3260 N N     . GLY A 1 432 ? 56.898 56.656 21.396  1.00 28.01 ? 654 GLY A N     1 
ATOM   3261 C CA    . GLY A 1 432 ? 55.902 57.713 21.405  1.00 28.52 ? 654 GLY A CA    1 
ATOM   3262 C C     . GLY A 1 432 ? 56.205 58.759 22.459  1.00 29.05 ? 654 GLY A C     1 
ATOM   3263 O O     . GLY A 1 432 ? 55.507 59.767 22.570  1.00 29.24 ? 654 GLY A O     1 
ATOM   3264 N N     . ALA A 1 433 ? 57.251 58.513 23.239  1.00 29.38 ? 655 ALA A N     1 
ATOM   3265 C CA    . ALA A 1 433 ? 57.660 59.433 24.290  1.00 29.93 ? 655 ALA A CA    1 
ATOM   3266 C C     . ALA A 1 433 ? 56.485 59.818 25.182  1.00 30.54 ? 655 ALA A C     1 
ATOM   3267 O O     . ALA A 1 433 ? 56.221 61.001 25.404  1.00 30.92 ? 655 ALA A O     1 
ATOM   3268 C CB    . ALA A 1 433 ? 58.282 60.683 23.674  1.00 29.73 ? 655 ALA A CB    1 
ATOM   3269 N N     . MET A 1 434 ? 55.778 58.814 25.689  1.00 30.54 ? 656 MET A N     1 
ATOM   3270 C CA    . MET A 1 434 ? 54.639 59.055 26.563  1.00 30.22 ? 656 MET A CA    1 
ATOM   3271 C C     . MET A 1 434 ? 54.670 58.089 27.739  1.00 29.88 ? 656 MET A C     1 
ATOM   3272 O O     . MET A 1 434 ? 55.404 57.101 27.720  1.00 29.99 ? 656 MET A O     1 
ATOM   3273 C CB    . MET A 1 434 ? 53.328 58.895 25.786  1.00 30.50 ? 656 MET A CB    1 
ATOM   3274 C CG    . MET A 1 434 ? 53.117 57.521 25.173  1.00 29.42 ? 656 MET A CG    1 
ATOM   3275 S SD    . MET A 1 434 ? 51.564 57.412 24.260  1.00 29.49 ? 656 MET A SD    1 
ATOM   3276 C CE    . MET A 1 434 ? 52.074 58.008 22.662  1.00 30.45 ? 656 MET A CE    1 
ATOM   3277 N N     . GLU A 1 435 ? 53.876 58.381 28.763  1.00 29.65 ? 657 GLU A N     1 
ATOM   3278 C CA    . GLU A 1 435 ? 53.820 57.535 29.948  1.00 30.37 ? 657 GLU A CA    1 
ATOM   3279 C C     . GLU A 1 435 ? 53.078 56.236 29.650  1.00 30.10 ? 657 GLU A C     1 
ATOM   3280 O O     . GLU A 1 435 ? 52.260 56.177 28.732  1.00 30.28 ? 657 GLU A O     1 
ATOM   3281 C CB    . GLU A 1 435 ? 53.131 58.277 31.094  1.00 30.75 ? 657 GLU A CB    1 
ATOM   3282 C CG    . GLU A 1 435 ? 53.806 59.586 31.480  1.00 32.39 ? 657 GLU A CG    1 
ATOM   3283 C CD    . GLU A 1 435 ? 55.261 59.401 31.872  1.00 32.86 ? 657 GLU A CD    1 
ATOM   3284 O OE1   . GLU A 1 435 ? 55.530 58.664 32.845  1.00 33.82 ? 657 GLU A OE1   1 
ATOM   3285 O OE2   . GLU A 1 435 ? 56.137 59.992 31.206  1.00 34.00 ? 657 GLU A OE2   1 
ATOM   3286 N N     . HIS A 1 436 ? 53.371 55.199 30.432  1.00 30.98 ? 658 HIS A N     1 
ATOM   3287 C CA    . HIS A 1 436 ? 52.737 53.895 30.256  1.00 29.71 ? 658 HIS A CA    1 
ATOM   3288 C C     . HIS A 1 436 ? 51.230 54.042 30.101  1.00 29.42 ? 658 HIS A C     1 
ATOM   3289 O O     . HIS A 1 436 ? 50.645 53.549 29.137  1.00 30.32 ? 658 HIS A O     1 
ATOM   3290 C CB    . HIS A 1 436 ? 53.036 52.991 31.454  1.00 30.55 ? 658 HIS A CB    1 
ATOM   3291 C CG    . HIS A 1 436 ? 52.463 51.613 31.326  1.00 29.96 ? 658 HIS A CG    1 
ATOM   3292 N ND1   . HIS A 1 436 ? 52.922 50.700 30.401  1.00 30.10 ? 658 HIS A ND1   1 
ATOM   3293 C CD2   . HIS A 1 436 ? 51.453 51.002 31.989  1.00 30.38 ? 658 HIS A CD2   1 
ATOM   3294 C CE1   . HIS A 1 436 ? 52.219 49.586 30.499  1.00 31.31 ? 658 HIS A CE1   1 
ATOM   3295 N NE2   . HIS A 1 436 ? 51.321 49.743 31.456  1.00 30.95 ? 658 HIS A NE2   1 
ATOM   3296 N N     . ALA A 1 437 ? 50.610 54.724 31.059  1.00 27.80 ? 659 ALA A N     1 
ATOM   3297 C CA    . ALA A 1 437 ? 49.170 54.945 31.043  1.00 28.34 ? 659 ALA A CA    1 
ATOM   3298 C C     . ALA A 1 437 ? 48.709 55.539 29.716  1.00 27.47 ? 659 ALA A C     1 
ATOM   3299 O O     . ALA A 1 437 ? 47.710 55.100 29.149  1.00 28.44 ? 659 ALA A O     1 
ATOM   3300 C CB    . ALA A 1 437 ? 48.771 55.859 32.194  1.00 28.69 ? 659 ALA A CB    1 
ATOM   3301 N N     . GLN A 1 438 ? 49.436 56.539 29.227  1.00 26.88 ? 660 GLN A N     1 
ATOM   3302 C CA    . GLN A 1 438 ? 49.093 57.179 27.961  1.00 25.92 ? 660 GLN A CA    1 
ATOM   3303 C C     . GLN A 1 438 ? 49.227 56.187 26.808  1.00 25.20 ? 660 GLN A C     1 
ATOM   3304 O O     . GLN A 1 438 ? 48.513 56.282 25.807  1.00 24.81 ? 660 GLN A O     1 
ATOM   3305 C CB    . GLN A 1 438 ? 49.997 58.394 27.725  1.00 26.33 ? 660 GLN A CB    1 
ATOM   3306 C CG    . GLN A 1 438 ? 49.667 59.586 28.619  1.00 28.46 ? 660 GLN A CG    1 
ATOM   3307 C CD    . GLN A 1 438 ? 50.672 60.720 28.500  1.00 30.35 ? 660 GLN A CD    1 
ATOM   3308 O OE1   . GLN A 1 438 ? 50.407 61.842 28.934  1.00 31.98 ? 660 GLN A OE1   1 
ATOM   3309 N NE2   . GLN A 1 438 ? 51.833 60.430 27.924  1.00 29.26 ? 660 GLN A NE2   1 
ATOM   3310 N N     . ALA A 1 439 ? 50.144 55.236 26.958  1.00 25.79 ? 661 ALA A N     1 
ATOM   3311 C CA    . ALA A 1 439 ? 50.371 54.218 25.939  1.00 25.81 ? 661 ALA A CA    1 
ATOM   3312 C C     . ALA A 1 439 ? 49.228 53.211 25.962  1.00 25.92 ? 661 ALA A C     1 
ATOM   3313 O O     . ALA A 1 439 ? 48.791 52.730 24.918  1.00 26.40 ? 661 ALA A O     1 
ATOM   3314 C CB    . ALA A 1 439 ? 51.694 53.513 26.188  1.00 25.61 ? 661 ALA A CB    1 
ATOM   3315 N N     . VAL A 1 440 ? 48.753 52.887 27.160  1.00 25.74 ? 662 VAL A N     1 
ATOM   3316 C CA    . VAL A 1 440 ? 47.648 51.949 27.296  1.00 25.97 ? 662 VAL A CA    1 
ATOM   3317 C C     . VAL A 1 440 ? 46.420 52.565 26.639  1.00 27.18 ? 662 VAL A C     1 
ATOM   3318 O O     . VAL A 1 440 ? 45.624 51.870 26.007  1.00 25.64 ? 662 VAL A O     1 
ATOM   3319 C CB    . VAL A 1 440 ? 47.337 51.654 28.779  1.00 26.60 ? 662 VAL A CB    1 
ATOM   3320 C CG1   . VAL A 1 440 ? 46.123 50.744 28.885  1.00 25.78 ? 662 VAL A CG1   1 
ATOM   3321 C CG2   . VAL A 1 440 ? 48.540 51.006 29.441  1.00 26.71 ? 662 VAL A CG2   1 
ATOM   3322 N N     . ASP A 1 441 ? 46.279 53.879 26.786  1.00 25.56 ? 663 ASP A N     1 
ATOM   3323 C CA    . ASP A 1 441 ? 45.154 54.598 26.202  1.00 27.15 ? 663 ASP A CA    1 
ATOM   3324 C C     . ASP A 1 441 ? 45.299 54.633 24.683  1.00 25.37 ? 663 ASP A C     1 
ATOM   3325 O O     . ASP A 1 441 ? 44.319 54.501 23.950  1.00 25.98 ? 663 ASP A O     1 
ATOM   3326 C CB    . ASP A 1 441 ? 45.098 56.029 26.748  1.00 29.40 ? 663 ASP A CB    1 
ATOM   3327 C CG    . ASP A 1 441 ? 43.911 56.813 26.214  1.00 32.19 ? 663 ASP A CG    1 
ATOM   3328 O OD1   . ASP A 1 441 ? 42.759 56.427 26.507  1.00 33.14 ? 663 ASP A OD1   1 
ATOM   3329 O OD2   . ASP A 1 441 ? 44.129 57.814 25.496  1.00 32.72 ? 663 ASP A OD2   1 
ATOM   3330 N N     . TYR A 1 442 ? 46.532 54.812 24.221  1.00 24.72 ? 664 TYR A N     1 
ATOM   3331 C CA    . TYR A 1 442 ? 46.819 54.870 22.793  1.00 23.57 ? 664 TYR A CA    1 
ATOM   3332 C C     . TYR A 1 442 ? 46.419 53.561 22.117  1.00 22.63 ? 664 TYR A C     1 
ATOM   3333 O O     . TYR A 1 442 ? 45.727 53.564 21.096  1.00 22.52 ? 664 TYR A O     1 
ATOM   3334 C CB    . TYR A 1 442 ? 48.312 55.146 22.577  1.00 22.15 ? 664 TYR A CB    1 
ATOM   3335 C CG    . TYR A 1 442 ? 48.724 55.321 21.130  1.00 23.02 ? 664 TYR A CG    1 
ATOM   3336 C CD1   . TYR A 1 442 ? 48.799 54.230 20.263  1.00 23.20 ? 664 TYR A CD1   1 
ATOM   3337 C CD2   . TYR A 1 442 ? 49.051 56.581 20.630  1.00 22.25 ? 664 TYR A CD2   1 
ATOM   3338 C CE1   . TYR A 1 442 ? 49.191 54.389 18.935  1.00 24.49 ? 664 TYR A CE1   1 
ATOM   3339 C CE2   . TYR A 1 442 ? 49.444 56.752 19.303  1.00 23.31 ? 664 TYR A CE2   1 
ATOM   3340 C CZ    . TYR A 1 442 ? 49.512 55.652 18.463  1.00 24.48 ? 664 TYR A CZ    1 
ATOM   3341 O OH    . TYR A 1 442 ? 49.903 55.817 17.154  1.00 25.71 ? 664 TYR A OH    1 
ATOM   3342 N N     . ILE A 1 443 ? 46.849 52.445 22.694  1.00 22.42 ? 665 ILE A N     1 
ATOM   3343 C CA    . ILE A 1 443 ? 46.530 51.137 22.139  1.00 24.10 ? 665 ILE A CA    1 
ATOM   3344 C C     . ILE A 1 443 ? 45.034 50.844 22.227  1.00 23.50 ? 665 ILE A C     1 
ATOM   3345 O O     . ILE A 1 443 ? 44.444 50.315 21.285  1.00 24.51 ? 665 ILE A O     1 
ATOM   3346 C CB    . ILE A 1 443 ? 47.317 50.014 22.857  1.00 24.41 ? 665 ILE A CB    1 
ATOM   3347 C CG1   . ILE A 1 443 ? 48.805 50.114 22.506  1.00 24.94 ? 665 ILE A CG1   1 
ATOM   3348 C CG2   . ILE A 1 443 ? 46.773 48.646 22.452  1.00 25.00 ? 665 ILE A CG2   1 
ATOM   3349 C CD1   . ILE A 1 443 ? 49.101 49.999 21.020  1.00 24.72 ? 665 ILE A CD1   1 
ATOM   3350 N N     . LYS A 1 444 ? 44.417 51.191 23.350  1.00 24.59 ? 666 LYS A N     1 
ATOM   3351 C CA    . LYS A 1 444 ? 42.988 50.948 23.515  1.00 24.74 ? 666 LYS A CA    1 
ATOM   3352 C C     . LYS A 1 444 ? 42.163 51.752 22.518  1.00 24.83 ? 666 LYS A C     1 
ATOM   3353 O O     . LYS A 1 444 ? 41.081 51.326 22.114  1.00 24.86 ? 666 LYS A O     1 
ATOM   3354 C CB    . LYS A 1 444 ? 42.551 51.261 24.948  1.00 25.35 ? 666 LYS A CB    1 
ATOM   3355 C CG    . LYS A 1 444 ? 43.065 50.249 25.959  1.00 28.06 ? 666 LYS A CG    1 
ATOM   3356 C CD    . LYS A 1 444 ? 42.491 50.487 27.346  1.00 29.14 ? 666 LYS A CD    1 
ATOM   3357 C CE    . LYS A 1 444 ? 42.969 49.428 28.327  1.00 28.31 ? 666 LYS A CE    1 
ATOM   3358 N NZ    . LYS A 1 444 ? 42.402 49.630 29.691  1.00 29.41 ? 666 LYS A NZ    1 
ATOM   3359 N N     . LYS A 1 445 ? 42.666 52.916 22.119  1.00 25.03 ? 667 LYS A N     1 
ATOM   3360 C CA    . LYS A 1 445 ? 41.948 53.721 21.145  1.00 24.74 ? 667 LYS A CA    1 
ATOM   3361 C C     . LYS A 1 445 ? 42.085 53.047 19.785  1.00 24.33 ? 667 LYS A C     1 
ATOM   3362 O O     . LYS A 1 445 ? 41.194 53.146 18.944  1.00 26.39 ? 667 LYS A O     1 
ATOM   3363 C CB    . LYS A 1 445 ? 42.494 55.152 21.107  1.00 26.28 ? 667 LYS A CB    1 
ATOM   3364 C CG    . LYS A 1 445 ? 42.024 55.999 22.285  1.00 25.92 ? 667 LYS A CG    1 
ATOM   3365 C CD    . LYS A 1 445 ? 42.507 57.435 22.189  1.00 26.19 ? 667 LYS A CD    1 
ATOM   3366 C CE    . LYS A 1 445 ? 41.872 58.290 23.277  1.00 26.86 ? 667 LYS A CE    1 
ATOM   3367 N NZ    . LYS A 1 445 ? 42.387 59.688 23.266  1.00 29.35 ? 667 LYS A NZ    1 
ATOM   3368 N N     . LEU A 1 446 ? 43.201 52.353 19.577  1.00 23.76 ? 668 LEU A N     1 
ATOM   3369 C CA    . LEU A 1 446 ? 43.416 51.642 18.323  1.00 23.00 ? 668 LEU A CA    1 
ATOM   3370 C C     . LEU A 1 446 ? 42.390 50.519 18.227  1.00 22.00 ? 668 LEU A C     1 
ATOM   3371 O O     . LEU A 1 446 ? 41.836 50.263 17.160  1.00 21.93 ? 668 LEU A O     1 
ATOM   3372 C CB    . LEU A 1 446 ? 44.820 51.035 18.260  1.00 22.67 ? 668 LEU A CB    1 
ATOM   3373 C CG    . LEU A 1 446 ? 46.043 51.941 18.095  1.00 24.56 ? 668 LEU A CG    1 
ATOM   3374 C CD1   . LEU A 1 446 ? 47.288 51.070 18.020  1.00 23.91 ? 668 LEU A CD1   1 
ATOM   3375 C CD2   . LEU A 1 446 ? 45.915 52.786 16.835  1.00 24.72 ? 668 LEU A CD2   1 
ATOM   3376 N N     . MET A 1 447 ? 42.146 49.851 19.352  1.00 22.84 ? 669 MET A N     1 
ATOM   3377 C CA    . MET A 1 447 ? 41.187 48.752 19.400  1.00 23.66 ? 669 MET A CA    1 
ATOM   3378 C C     . MET A 1 447 ? 39.774 49.248 19.117  1.00 25.00 ? 669 MET A C     1 
ATOM   3379 O O     . MET A 1 447 ? 39.015 48.600 18.397  1.00 24.36 ? 669 MET A O     1 
ATOM   3380 C CB    . MET A 1 447 ? 41.226 48.068 20.770  1.00 24.67 ? 669 MET A CB    1 
ATOM   3381 C CG    . MET A 1 447 ? 42.584 47.491 21.135  1.00 24.87 ? 669 MET A CG    1 
ATOM   3382 S SD    . MET A 1 447 ? 42.595 46.626 22.719  1.00 29.36 ? 669 MET A SD    1 
ATOM   3383 C CE    . MET A 1 447 ? 42.594 44.918 22.179  1.00 28.99 ? 669 MET A CE    1 
ATOM   3384 N N     . THR A 1 448 ? 39.423 50.400 19.681  1.00 25.56 ? 670 THR A N     1 
ATOM   3385 C CA    . THR A 1 448 ? 38.096 50.967 19.474  1.00 26.81 ? 670 THR A CA    1 
ATOM   3386 C C     . THR A 1 448 ? 37.907 51.381 18.017  1.00 26.47 ? 670 THR A C     1 
ATOM   3387 O O     . THR A 1 448 ? 36.812 51.261 17.464  1.00 27.60 ? 670 THR A O     1 
ATOM   3388 C CB    . THR A 1 448 ? 37.862 52.204 20.373  1.00 27.30 ? 670 THR A CB    1 
ATOM   3389 O OG1   . THR A 1 448 ? 38.785 53.239 20.015  1.00 30.50 ? 670 THR A OG1   1 
ATOM   3390 C CG2   . THR A 1 448 ? 38.057 51.846 21.837  1.00 25.67 ? 670 THR A CG2   1 
ATOM   3391 N N     . LYS A 1 449 ? 38.980 51.858 17.393  1.00 26.72 ? 671 LYS A N     1 
ATOM   3392 C CA    . LYS A 1 449 ? 38.921 52.296 16.003  1.00 25.75 ? 671 LYS A CA    1 
ATOM   3393 C C     . LYS A 1 449 ? 39.133 51.145 15.018  1.00 25.09 ? 671 LYS A C     1 
ATOM   3394 O O     . LYS A 1 449 ? 39.216 51.360 13.811  1.00 25.95 ? 671 LYS A O     1 
ATOM   3395 C CB    . LYS A 1 449 ? 39.958 53.393 15.763  1.00 26.74 ? 671 LYS A CB    1 
ATOM   3396 C CG    . LYS A 1 449 ? 39.845 54.551 16.745  1.00 27.67 ? 671 LYS A CG    1 
ATOM   3397 C CD    . LYS A 1 449 ? 40.873 55.630 16.461  1.00 28.85 ? 671 LYS A CD    1 
ATOM   3398 C CE    . LYS A 1 449 ? 40.860 56.697 17.544  1.00 30.49 ? 671 LYS A CE    1 
ATOM   3399 N NZ    . LYS A 1 449 ? 39.526 57.345 17.677  1.00 33.11 ? 671 LYS A NZ    1 
ATOM   3400 N N     . GLY A 1 450 ? 39.218 49.925 15.542  1.00 23.30 ? 672 GLY A N     1 
ATOM   3401 C CA    . GLY A 1 450 ? 39.401 48.758 14.692  1.00 21.90 ? 672 GLY A CA    1 
ATOM   3402 C C     . GLY A 1 450 ? 40.778 48.603 14.069  1.00 20.60 ? 672 GLY A C     1 
ATOM   3403 O O     . GLY A 1 450 ? 40.920 47.954 13.031  1.00 21.13 ? 672 GLY A O     1 
ATOM   3404 N N     . ARG A 1 451 ? 41.794 49.188 14.695  1.00 20.24 ? 673 ARG A N     1 
ATOM   3405 C CA    . ARG A 1 451 ? 43.153 49.097 14.178  1.00 19.73 ? 673 ARG A CA    1 
ATOM   3406 C C     . ARG A 1 451 ? 44.039 48.136 14.969  1.00 18.57 ? 673 ARG A C     1 
ATOM   3407 O O     . ARG A 1 451 ? 45.225 47.989 14.676  1.00 19.14 ? 673 ARG A O     1 
ATOM   3408 C CB    . ARG A 1 451 ? 43.792 50.485 14.123  1.00 20.56 ? 673 ARG A CB    1 
ATOM   3409 C CG    . ARG A 1 451 ? 43.235 51.372 13.012  1.00 22.62 ? 673 ARG A CG    1 
ATOM   3410 C CD    . ARG A 1 451 ? 44.034 52.655 12.924  1.00 24.97 ? 673 ARG A CD    1 
ATOM   3411 N NE    . ARG A 1 451 ? 45.460 52.359 12.895  1.00 26.62 ? 673 ARG A NE    1 
ATOM   3412 C CZ    . ARG A 1 451 ? 46.408 53.199 13.292  1.00 26.22 ? 673 ARG A CZ    1 
ATOM   3413 N NH1   . ARG A 1 451 ? 46.086 54.403 13.750  1.00 28.12 ? 673 ARG A NH1   1 
ATOM   3414 N NH2   . ARG A 1 451 ? 47.677 52.822 13.254  1.00 25.27 ? 673 ARG A NH2   1 
ATOM   3415 N N     . TYR A 1 452 ? 43.456 47.496 15.977  1.00 19.70 ? 674 TYR A N     1 
ATOM   3416 C CA    . TYR A 1 452 ? 44.158 46.508 16.793  1.00 19.91 ? 674 TYR A CA    1 
ATOM   3417 C C     . TYR A 1 452 ? 43.108 45.432 17.033  1.00 20.74 ? 674 TYR A C     1 
ATOM   3418 O O     . TYR A 1 452 ? 42.193 45.608 17.839  1.00 22.31 ? 674 TYR A O     1 
ATOM   3419 C CB    . TYR A 1 452 ? 44.628 47.108 18.124  1.00 19.27 ? 674 TYR A CB    1 
ATOM   3420 C CG    . TYR A 1 452 ? 45.582 46.209 18.892  1.00 19.90 ? 674 TYR A CG    1 
ATOM   3421 C CD1   . TYR A 1 452 ? 46.895 46.607 19.152  1.00 20.26 ? 674 TYR A CD1   1 
ATOM   3422 C CD2   . TYR A 1 452 ? 45.176 44.953 19.345  1.00 21.91 ? 674 TYR A CD2   1 
ATOM   3423 C CE1   . TYR A 1 452 ? 47.780 45.776 19.843  1.00 20.01 ? 674 TYR A CE1   1 
ATOM   3424 C CE2   . TYR A 1 452 ? 46.049 44.116 20.033  1.00 21.27 ? 674 TYR A CE2   1 
ATOM   3425 C CZ    . TYR A 1 452 ? 47.348 44.529 20.281  1.00 19.97 ? 674 TYR A CZ    1 
ATOM   3426 O OH    . TYR A 1 452 ? 48.209 43.695 20.962  1.00 18.45 ? 674 TYR A OH    1 
ATOM   3427 N N     . SER A 1 453 ? 43.236 44.322 16.315  1.00 20.51 ? 675 SER A N     1 
ATOM   3428 C CA    . SER A 1 453 ? 42.273 43.237 16.414  1.00 19.54 ? 675 SER A CA    1 
ATOM   3429 C C     . SER A 1 453 ? 42.871 41.959 16.964  1.00 19.02 ? 675 SER A C     1 
ATOM   3430 O O     . SER A 1 453 ? 44.036 41.642 16.717  1.00 17.79 ? 675 SER A O     1 
ATOM   3431 C CB    . SER A 1 453 ? 41.669 42.968 15.038  1.00 20.19 ? 675 SER A CB    1 
ATOM   3432 O OG    . SER A 1 453 ? 41.134 44.161 14.496  1.00 18.41 ? 675 SER A OG    1 
ATOM   3433 N N     . LEU A 1 454 ? 42.055 41.221 17.707  1.00 19.36 ? 676 LEU A N     1 
ATOM   3434 C CA    . LEU A 1 454 ? 42.498 39.973 18.304  1.00 20.49 ? 676 LEU A CA    1 
ATOM   3435 C C     . LEU A 1 454 ? 41.583 38.818 17.935  1.00 20.59 ? 676 LEU A C     1 
ATOM   3436 O O     . LEU A 1 454 ? 40.367 38.980 17.811  1.00 21.80 ? 676 LEU A O     1 
ATOM   3437 C CB    . LEU A 1 454 ? 42.536 40.094 19.830  1.00 22.86 ? 676 LEU A CB    1 
ATOM   3438 C CG    . LEU A 1 454 ? 43.416 41.177 20.451  1.00 24.55 ? 676 LEU A CG    1 
ATOM   3439 C CD1   . LEU A 1 454 ? 43.248 41.162 21.963  1.00 26.58 ? 676 LEU A CD1   1 
ATOM   3440 C CD2   . LEU A 1 454 ? 44.862 40.940 20.075  1.00 26.06 ? 676 LEU A CD2   1 
ATOM   3441 N N     . ASP A 1 455 ? 42.187 37.652 17.748  1.00 18.90 ? 677 ASP A N     1 
ATOM   3442 C CA    . ASP A 1 455 ? 41.457 36.430 17.448  1.00 21.12 ? 677 ASP A CA    1 
ATOM   3443 C C     . ASP A 1 455 ? 42.229 35.384 18.234  1.00 20.00 ? 677 ASP A C     1 
ATOM   3444 O O     . ASP A 1 455 ? 43.099 34.695 17.702  1.00 19.55 ? 677 ASP A O     1 
ATOM   3445 C CB    . ASP A 1 455 ? 41.489 36.114 15.953  1.00 23.94 ? 677 ASP A CB    1 
ATOM   3446 C CG    . ASP A 1 455 ? 40.407 35.130 15.547  1.00 28.62 ? 677 ASP A CG    1 
ATOM   3447 O OD1   . ASP A 1 455 ? 40.452 33.967 15.998  1.00 29.63 ? 677 ASP A OD1   1 
ATOM   3448 O OD2   . ASP A 1 455 ? 39.503 35.528 14.781  1.00 30.92 ? 677 ASP A OD2   1 
ATOM   3449 N N     . VAL A 1 456 ? 41.917 35.289 19.520  1.00 21.18 ? 678 VAL A N     1 
ATOM   3450 C CA    . VAL A 1 456 ? 42.613 34.360 20.391  1.00 21.16 ? 678 VAL A CA    1 
ATOM   3451 C C     . VAL A 1 456 ? 41.716 33.295 20.998  1.00 21.85 ? 678 VAL A C     1 
ATOM   3452 O O     . VAL A 1 456 ? 40.508 33.487 21.153  1.00 22.59 ? 678 VAL A O     1 
ATOM   3453 C CB    . VAL A 1 456 ? 43.330 35.128 21.518  1.00 21.64 ? 678 VAL A CB    1 
ATOM   3454 C CG1   . VAL A 1 456 ? 44.402 36.030 20.924  1.00 21.79 ? 678 VAL A CG1   1 
ATOM   3455 C CG2   . VAL A 1 456 ? 42.324 35.964 22.299  1.00 22.76 ? 678 VAL A CG2   1 
ATOM   3456 N N     . TRP A 1 457 ? 42.325 32.165 21.335  1.00 22.91 ? 679 TRP A N     1 
ATOM   3457 C CA    . TRP A 1 457 ? 41.600 31.055 21.925  1.00 24.74 ? 679 TRP A CA    1 
ATOM   3458 C C     . TRP A 1 457 ? 42.504 30.290 22.887  1.00 26.46 ? 679 TRP A C     1 
ATOM   3459 O O     . TRP A 1 457 ? 43.720 30.486 22.897  1.00 26.78 ? 679 TRP A O     1 
ATOM   3460 C CB    . TRP A 1 457 ? 41.077 30.135 20.818  1.00 23.93 ? 679 TRP A CB    1 
ATOM   3461 C CG    . TRP A 1 457 ? 42.141 29.489 19.978  1.00 23.54 ? 679 TRP A CG    1 
ATOM   3462 C CD1   . TRP A 1 457 ? 42.854 28.362 20.280  1.00 24.32 ? 679 TRP A CD1   1 
ATOM   3463 C CD2   . TRP A 1 457 ? 42.595 29.916 18.685  1.00 24.08 ? 679 TRP A CD2   1 
ATOM   3464 N NE1   . TRP A 1 457 ? 43.719 28.058 19.255  1.00 25.21 ? 679 TRP A NE1   1 
ATOM   3465 C CE2   . TRP A 1 457 ? 43.583 28.996 18.264  1.00 22.80 ? 679 TRP A CE2   1 
ATOM   3466 C CE3   . TRP A 1 457 ? 42.262 30.984 17.842  1.00 24.67 ? 679 TRP A CE3   1 
ATOM   3467 C CZ2   . TRP A 1 457 ? 44.242 29.111 17.034  1.00 24.23 ? 679 TRP A CZ2   1 
ATOM   3468 C CZ3   . TRP A 1 457 ? 42.916 31.099 16.617  1.00 24.35 ? 679 TRP A CZ3   1 
ATOM   3469 C CH2   . TRP A 1 457 ? 43.895 30.166 16.225  1.00 23.39 ? 679 TRP A CH2   1 
ATOM   3470 N N     . SER A 1 458 ? 41.904 29.428 23.701  1.00 29.89 ? 680 SER A N     1 
ATOM   3471 C CA    . SER A 1 458 ? 42.655 28.643 24.671  1.00 31.80 ? 680 SER A CA    1 
ATOM   3472 C C     . SER A 1 458 ? 42.678 27.168 24.282  1.00 32.95 ? 680 SER A C     1 
ATOM   3473 O O     . SER A 1 458 ? 42.026 26.816 23.276  1.00 34.31 ? 680 SER A O     1 
ATOM   3474 C CB    . SER A 1 458 ? 42.033 28.799 26.060  1.00 32.59 ? 680 SER A CB    1 
ATOM   3475 O OG    . SER A 1 458 ? 41.967 30.163 26.439  1.00 34.29 ? 680 SER A OG    1 
ATOM   3476 O OXT   . SER A 1 458 ? 43.345 26.384 24.991  1.00 34.46 ? 680 SER A OXT   1 
HETATM 3477 P PA    . FAD B 2 .   ? 38.799 18.317 22.249  1.00 11.88 ? 752 FAD A PA    1 
HETATM 3478 O O1A   . FAD B 2 .   ? 38.266 16.922 22.155  1.00 14.30 ? 752 FAD A O1A   1 
HETATM 3479 O O2A   . FAD B 2 .   ? 37.776 19.378 22.388  1.00 13.91 ? 752 FAD A O2A   1 
HETATM 3480 O O5B   . FAD B 2 .   ? 39.712 18.356 23.439  1.00 14.20 ? 752 FAD A O5B   1 
HETATM 3481 C C5B   . FAD B 2 .   ? 40.415 19.540 23.872  1.00 17.12 ? 752 FAD A C5B   1 
HETATM 3482 C C4B   . FAD B 2 .   ? 40.644 19.553 25.377  1.00 17.70 ? 752 FAD A C4B   1 
HETATM 3483 O O4B   . FAD B 2 .   ? 41.566 18.484 25.699  1.00 19.70 ? 752 FAD A O4B   1 
HETATM 3484 C C3B   . FAD B 2 .   ? 41.353 20.796 25.921  1.00 20.05 ? 752 FAD A C3B   1 
HETATM 3485 O O3B   . FAD B 2 .   ? 40.433 21.847 26.203  1.00 21.87 ? 752 FAD A O3B   1 
HETATM 3486 C C2B   . FAD B 2 .   ? 41.891 20.295 27.251  1.00 20.92 ? 752 FAD A C2B   1 
HETATM 3487 O O2B   . FAD B 2 .   ? 40.936 20.245 28.363  1.00 24.62 ? 752 FAD A O2B   1 
HETATM 3488 C C1B   . FAD B 2 .   ? 42.352 18.877 26.849  1.00 21.44 ? 752 FAD A C1B   1 
HETATM 3489 N N9A   . FAD B 2 .   ? 43.809 18.714 26.548  1.00 20.39 ? 752 FAD A N9A   1 
HETATM 3490 C C8A   . FAD B 2 .   ? 44.597 18.952 25.426  1.00 21.46 ? 752 FAD A C8A   1 
HETATM 3491 N N7A   . FAD B 2 .   ? 45.942 18.645 25.592  1.00 21.61 ? 752 FAD A N7A   1 
HETATM 3492 C C5A   . FAD B 2 .   ? 45.991 18.190 26.889  1.00 22.76 ? 752 FAD A C5A   1 
HETATM 3493 C C6A   . FAD B 2 .   ? 47.054 17.693 27.748  1.00 23.09 ? 752 FAD A C6A   1 
HETATM 3494 N N6A   . FAD B 2 .   ? 48.356 17.589 27.327  1.00 27.08 ? 752 FAD A N6A   1 
HETATM 3495 N N1A   . FAD B 2 .   ? 46.658 17.325 29.038  1.00 25.17 ? 752 FAD A N1A   1 
HETATM 3496 C C2A   . FAD B 2 .   ? 45.409 17.377 29.577  1.00 23.46 ? 752 FAD A C2A   1 
HETATM 3497 N N3A   . FAD B 2 .   ? 44.326 17.826 28.860  1.00 22.68 ? 752 FAD A N3A   1 
HETATM 3498 C C4A   . FAD B 2 .   ? 44.680 18.224 27.506  1.00 22.69 ? 752 FAD A C4A   1 
HETATM 3499 N N1    . FAD B 2 .   ? 42.625 25.224 16.603  1.00 12.19 ? 752 FAD A N1    1 
HETATM 3500 C C2    . FAD B 2 .   ? 43.484 25.042 15.555  1.00 12.08 ? 752 FAD A C2    1 
HETATM 3501 O O2    . FAD B 2 .   ? 44.253 24.083 15.578  1.00 13.49 ? 752 FAD A O2    1 
HETATM 3502 N N3    . FAD B 2 .   ? 43.424 25.954 14.540  1.00 10.67 ? 752 FAD A N3    1 
HETATM 3503 C C4    . FAD B 2 .   ? 42.576 27.102 14.431  1.00 11.18 ? 752 FAD A C4    1 
HETATM 3504 O O4    . FAD B 2 .   ? 42.637 27.835 13.435  1.00 12.21 ? 752 FAD A O4    1 
HETATM 3505 C C4X   . FAD B 2 .   ? 41.683 27.291 15.566  1.00 11.68 ? 752 FAD A C4X   1 
HETATM 3506 N N5    . FAD B 2 .   ? 40.844 28.405 15.519  1.00 14.73 ? 752 FAD A N5    1 
HETATM 3507 C C5X   . FAD B 2 .   ? 39.996 28.569 16.612  1.00 13.34 ? 752 FAD A C5X   1 
HETATM 3508 C C6    . FAD B 2 .   ? 39.111 29.729 16.598  1.00 13.53 ? 752 FAD A C6    1 
HETATM 3509 C C7    . FAD B 2 .   ? 38.192 30.006 17.663  1.00 15.82 ? 752 FAD A C7    1 
HETATM 3510 C C7M   . FAD B 2 .   ? 37.281 31.238 17.610  1.00 16.99 ? 752 FAD A C7M   1 
HETATM 3511 C C8    . FAD B 2 .   ? 38.163 29.054 18.811  1.00 15.54 ? 752 FAD A C8    1 
HETATM 3512 C C8M   . FAD B 2 .   ? 37.232 29.230 20.016  1.00 16.52 ? 752 FAD A C8M   1 
HETATM 3513 C C9    . FAD B 2 .   ? 39.000 27.934 18.845  1.00 13.94 ? 752 FAD A C9    1 
HETATM 3514 C C9A   . FAD B 2 .   ? 39.929 27.650 17.776  1.00 13.75 ? 752 FAD A C9A   1 
HETATM 3515 N N10   . FAD B 2 .   ? 40.858 26.478 17.726  1.00 12.54 ? 752 FAD A N10   1 
HETATM 3516 C C10   . FAD B 2 .   ? 41.732 26.304 16.650  1.00 11.77 ? 752 FAD A C10   1 
HETATM 3517 C "C1'" . FAD B 2 .   ? 40.926 25.414 18.786  1.00 13.11 ? 752 FAD A "C1'" 1 
HETATM 3518 C "C2'" . FAD B 2 .   ? 39.788 24.476 18.095  1.00 12.69 ? 752 FAD A "C2'" 1 
HETATM 3519 O "O2'" . FAD B 2 .   ? 38.403 25.034 18.058  1.00 12.75 ? 752 FAD A "O2'" 1 
HETATM 3520 C "C3'" . FAD B 2 .   ? 39.659 23.156 18.990  1.00 11.87 ? 752 FAD A "C3'" 1 
HETATM 3521 O "O3'" . FAD B 2 .   ? 39.439 23.470 20.387  1.00 14.31 ? 752 FAD A "O3'" 1 
HETATM 3522 C "C4'" . FAD B 2 .   ? 40.872 22.213 18.939  1.00 12.78 ? 752 FAD A "C4'" 1 
HETATM 3523 O "O4'" . FAD B 2 .   ? 41.092 21.886 17.553  1.00 13.06 ? 752 FAD A "O4'" 1 
HETATM 3524 C "C5'" . FAD B 2 .   ? 40.715 21.001 19.691  1.00 13.05 ? 752 FAD A "C5'" 1 
HETATM 3525 O "O5'" . FAD B 2 .   ? 39.514 20.289 19.458  1.00 12.73 ? 752 FAD A "O5'" 1 
HETATM 3526 P P     . FAD B 2 .   ? 39.357 18.809 19.581  1.00 14.29 ? 752 FAD A P     1 
HETATM 3527 O O1P   . FAD B 2 .   ? 40.276 18.024 18.691  1.00 12.59 ? 752 FAD A O1P   1 
HETATM 3528 O O2P   . FAD B 2 .   ? 37.917 18.560 19.288  1.00 13.36 ? 752 FAD A O2P   1 
HETATM 3529 O O3P   . FAD B 2 .   ? 39.765 18.647 21.117  1.00 12.10 ? 752 FAD A O3P   1 
HETATM 3530 P PA    . NAP C 3 .   ? 52.551 26.097 20.102  1.00 24.32 ? 753 NAP A PA    1 
HETATM 3531 O O1A   . NAP C 3 .   ? 53.433 25.185 19.318  1.00 26.81 ? 753 NAP A O1A   1 
HETATM 3532 O O2A   . NAP C 3 .   ? 52.258 25.629 21.480  1.00 24.89 ? 753 NAP A O2A   1 
HETATM 3533 O O5B   . NAP C 3 .   ? 53.241 27.401 20.179  1.00 22.31 ? 753 NAP A O5B   1 
HETATM 3534 C C5B   . NAP C 3 .   ? 53.579 28.238 19.057  1.00 19.41 ? 753 NAP A C5B   1 
HETATM 3535 C C4B   . NAP C 3 .   ? 54.821 29.061 19.354  1.00 16.00 ? 753 NAP A C4B   1 
HETATM 3536 O O4B   . NAP C 3 .   ? 54.474 30.004 20.397  1.00 15.02 ? 753 NAP A O4B   1 
HETATM 3537 C C3B   . NAP C 3 .   ? 55.991 28.234 19.900  1.00 15.61 ? 753 NAP A C3B   1 
HETATM 3538 O O3B   . NAP C 3 .   ? 57.229 28.602 19.282  1.00 15.81 ? 753 NAP A O3B   1 
HETATM 3539 C C2B   . NAP C 3 .   ? 55.969 28.531 21.376  1.00 16.75 ? 753 NAP A C2B   1 
HETATM 3540 O O2B   . NAP C 3 .   ? 57.215 28.314 22.053  1.00 15.11 ? 753 NAP A O2B   1 
HETATM 3541 C C1B   . NAP C 3 .   ? 55.525 29.977 21.347  1.00 15.06 ? 753 NAP A C1B   1 
HETATM 3542 N N9A   . NAP C 3 .   ? 55.085 30.466 22.557  1.00 14.42 ? 753 NAP A N9A   1 
HETATM 3543 C C8A   . NAP C 3 .   ? 54.706 29.897 23.791  1.00 15.16 ? 753 NAP A C8A   1 
HETATM 3544 N N7A   . NAP C 3 .   ? 54.311 30.667 24.851  1.00 16.44 ? 753 NAP A N7A   1 
HETATM 3545 C C5A   . NAP C 3 .   ? 54.449 31.900 24.229  1.00 14.38 ? 753 NAP A C5A   1 
HETATM 3546 C C6A   . NAP C 3 .   ? 54.218 33.258 24.718  1.00 16.01 ? 753 NAP A C6A   1 
HETATM 3547 N N6A   . NAP C 3 .   ? 53.809 33.506 25.949  1.00 15.38 ? 753 NAP A N6A   1 
HETATM 3548 N N1A   . NAP C 3 .   ? 54.423 34.317 23.915  1.00 16.10 ? 753 NAP A N1A   1 
HETATM 3549 C C2A   . NAP C 3 .   ? 54.854 34.199 22.613  1.00 17.02 ? 753 NAP A C2A   1 
HETATM 3550 N N3A   . NAP C 3 .   ? 55.117 33.016 22.012  1.00 15.15 ? 753 NAP A N3A   1 
HETATM 3551 C C4A   . NAP C 3 .   ? 54.912 31.788 22.842  1.00 14.84 ? 753 NAP A C4A   1 
HETATM 3552 O O3    . NAP C 3 .   ? 51.330 26.496 19.317  1.00 28.94 ? 753 NAP A O3    1 
HETATM 3553 P PN    . NAP C 3 .   ? 50.142 25.537 18.978  1.00 31.72 ? 753 NAP A PN    1 
HETATM 3554 O O1N   . NAP C 3 .   ? 49.050 26.082 19.845  1.00 33.66 ? 753 NAP A O1N   1 
HETATM 3555 O O2N   . NAP C 3 .   ? 50.348 24.130 19.417  1.00 34.99 ? 753 NAP A O2N   1 
HETATM 3556 O O5D   . NAP C 3 .   ? 49.817 25.646 17.524  1.00 30.41 ? 753 NAP A O5D   1 
HETATM 3557 P P2B   . NAP C 3 .   ? 57.492 27.189 23.197  1.00 17.07 ? 753 NAP A P2B   1 
HETATM 3558 O O1X   . NAP C 3 .   ? 56.451 25.970 23.047  1.00 18.61 ? 753 NAP A O1X   1 
HETATM 3559 O O2X   . NAP C 3 .   ? 57.355 27.870 24.613  1.00 17.72 ? 753 NAP A O2X   1 
HETATM 3560 O O3X   . NAP C 3 .   ? 58.974 26.676 22.948  1.00 18.01 ? 753 NAP A O3X   1 
HETATM 3561 O O     . HOH D 4 .   ? 31.714 18.642 23.046  1.00 13.52 ? 1   HOH A O     1 
HETATM 3562 O O     . HOH D 4 .   ? 25.839 17.109 18.793  1.00 13.53 ? 2   HOH A O     1 
HETATM 3563 O O     . HOH D 4 .   ? 33.098 13.503 22.741  1.00 12.69 ? 3   HOH A O     1 
HETATM 3564 O O     . HOH D 4 .   ? 28.150 16.110 15.299  1.00 11.83 ? 4   HOH A O     1 
HETATM 3565 O O     . HOH D 4 .   ? 42.353 26.878 10.725  1.00 12.83 ? 5   HOH A O     1 
HETATM 3566 O O     . HOH D 4 .   ? 43.687 22.164 17.405  1.00 13.21 ? 6   HOH A O     1 
HETATM 3567 O O     . HOH D 4 .   ? 42.036 34.110 6.393   1.00 14.33 ? 7   HOH A O     1 
HETATM 3568 O O     . HOH D 4 .   ? 40.234 33.475 9.347   1.00 14.71 ? 8   HOH A O     1 
HETATM 3569 O O     . HOH D 4 .   ? 22.474 20.037 6.899   1.00 13.45 ? 9   HOH A O     1 
HETATM 3570 O O     . HOH D 4 .   ? 56.329 33.208 19.504  1.00 13.40 ? 10  HOH A O     1 
HETATM 3571 O O     . HOH D 4 .   ? 58.004 31.152 18.785  1.00 14.30 ? 11  HOH A O     1 
HETATM 3572 O O     . HOH D 4 .   ? 26.795 15.711 12.832  1.00 14.03 ? 12  HOH A O     1 
HETATM 3573 O O     . HOH D 4 .   ? 39.820 40.176 5.741   1.00 14.77 ? 13  HOH A O     1 
HETATM 3574 O O     . HOH D 4 .   ? 33.486 16.235 23.184  1.00 14.87 ? 14  HOH A O     1 
HETATM 3575 O O     . HOH D 4 .   ? 29.344 14.971 11.794  1.00 13.52 ? 15  HOH A O     1 
HETATM 3576 O O     . HOH D 4 .   ? 34.727 7.543  26.787  1.00 14.73 ? 16  HOH A O     1 
HETATM 3577 O O     . HOH D 4 .   ? 38.499 10.643 21.087  1.00 16.42 ? 17  HOH A O     1 
HETATM 3578 O O     . HOH D 4 .   ? 36.927 11.881 16.713  1.00 14.78 ? 18  HOH A O     1 
HETATM 3579 O O     . HOH D 4 .   ? 31.768 -0.806 33.613  1.00 14.51 ? 19  HOH A O     1 
HETATM 3580 O O     . HOH D 4 .   ? 35.879 10.437 20.123  1.00 17.06 ? 20  HOH A O     1 
HETATM 3581 O O     . HOH D 4 .   ? 32.560 -3.378 33.432  1.00 16.63 ? 21  HOH A O     1 
HETATM 3582 O O     . HOH D 4 .   ? 54.054 26.062 14.438  1.00 17.49 ? 22  HOH A O     1 
HETATM 3583 O O     . HOH D 4 .   ? 36.010 25.426 19.276  1.00 16.03 ? 23  HOH A O     1 
HETATM 3584 O O     . HOH D 4 .   ? 20.534 6.061  13.959  1.00 14.85 ? 24  HOH A O     1 
HETATM 3585 O O     . HOH D 4 .   ? 33.366 34.203 14.007  1.00 24.53 ? 25  HOH A O     1 
HETATM 3586 O O     . HOH D 4 .   ? 38.638 36.888 1.838   1.00 16.52 ? 26  HOH A O     1 
HETATM 3587 O O     . HOH D 4 .   ? 20.670 12.990 6.367   1.00 16.64 ? 27  HOH A O     1 
HETATM 3588 O O     . HOH D 4 .   ? 20.250 19.491 -3.338  1.00 16.79 ? 28  HOH A O     1 
HETATM 3589 O O     . HOH D 4 .   ? 36.060 19.786 24.299  1.00 17.09 ? 29  HOH A O     1 
HETATM 3590 O O     . HOH D 4 .   ? 31.916 12.049 9.599   1.00 16.46 ? 30  HOH A O     1 
HETATM 3591 O O     . HOH D 4 .   ? 21.171 19.402 9.996   1.00 16.34 ? 31  HOH A O     1 
HETATM 3592 O O     . HOH D 4 .   ? 19.737 20.724 3.481   1.00 14.92 ? 32  HOH A O     1 
HETATM 3593 O O     . HOH D 4 .   ? 39.877 10.227 23.908  1.00 16.46 ? 33  HOH A O     1 
HETATM 3594 O O     . HOH D 4 .   ? 24.123 28.974 1.629   1.00 17.29 ? 34  HOH A O     1 
HETATM 3595 O O     . HOH D 4 .   ? 37.666 28.294 -5.193  1.00 16.40 ? 35  HOH A O     1 
HETATM 3596 O O     . HOH D 4 .   ? 41.027 15.860 25.685  1.00 19.70 ? 36  HOH A O     1 
HETATM 3597 O O     . HOH D 4 .   ? 37.177 15.857 24.355  1.00 17.53 ? 37  HOH A O     1 
HETATM 3598 O O     . HOH D 4 .   ? 38.365 22.619 -1.863  1.00 15.53 ? 38  HOH A O     1 
HETATM 3599 O O     . HOH D 4 .   ? 33.224 11.496 29.075  1.00 15.40 ? 39  HOH A O     1 
HETATM 3600 O O     . HOH D 4 .   ? 29.303 15.743 32.099  1.00 19.15 ? 40  HOH A O     1 
HETATM 3601 O O     . HOH D 4 .   ? 21.087 19.347 17.540  1.00 20.19 ? 41  HOH A O     1 
HETATM 3602 O O     . HOH D 4 .   ? 37.598 22.060 21.804  1.00 17.59 ? 42  HOH A O     1 
HETATM 3603 O O     . HOH D 4 .   ? 26.958 18.681 0.441   1.00 19.50 ? 43  HOH A O     1 
HETATM 3604 O O     . HOH D 4 .   ? 45.369 28.365 2.460   1.00 17.70 ? 44  HOH A O     1 
HETATM 3605 O O     . HOH D 4 .   ? 34.827 -2.686 21.311  1.00 20.79 ? 45  HOH A O     1 
HETATM 3606 O O     . HOH D 4 .   ? 39.414 12.111 25.862  1.00 18.10 ? 46  HOH A O     1 
HETATM 3607 O O     . HOH D 4 .   ? 13.030 -4.925 14.157  1.00 20.02 ? 47  HOH A O     1 
HETATM 3608 O O     . HOH D 4 .   ? 42.064 20.786 -2.647  1.00 18.56 ? 48  HOH A O     1 
HETATM 3609 O O     . HOH D 4 .   ? 44.060 8.632  39.270  1.00 21.33 ? 49  HOH A O     1 
HETATM 3610 O O     . HOH D 4 .   ? 41.250 8.982  29.879  1.00 18.09 ? 50  HOH A O     1 
HETATM 3611 O O     . HOH D 4 .   ? 52.999 31.026 -1.766  1.00 16.15 ? 51  HOH A O     1 
HETATM 3612 O O     . HOH D 4 .   ? 29.745 13.591 9.564   1.00 16.23 ? 52  HOH A O     1 
HETATM 3613 O O     . HOH D 4 .   ? 34.637 -2.454 26.062  1.00 18.78 ? 53  HOH A O     1 
HETATM 3614 O O     . HOH D 4 .   ? 41.869 51.360 5.331   1.00 18.42 ? 54  HOH A O     1 
HETATM 3615 O O     . HOH D 4 .   ? 39.534 14.365 24.117  1.00 17.18 ? 55  HOH A O     1 
HETATM 3616 O O     . HOH D 4 .   ? 63.968 48.802 15.608  1.00 23.28 ? 56  HOH A O     1 
HETATM 3617 O O     . HOH D 4 .   ? 20.198 3.511  12.649  1.00 21.70 ? 57  HOH A O     1 
HETATM 3618 O O     . HOH D 4 .   ? 36.975 23.720 -3.994  1.00 15.23 ? 58  HOH A O     1 
HETATM 3619 O O     . HOH D 4 .   ? 24.686 19.775 26.758  1.00 21.13 ? 59  HOH A O     1 
HETATM 3620 O O     . HOH D 4 .   ? 26.958 -5.954 46.140  1.00 19.49 ? 60  HOH A O     1 
HETATM 3621 O O     . HOH D 4 .   ? 17.493 18.841 22.562  1.00 21.66 ? 61  HOH A O     1 
HETATM 3622 O O     . HOH D 4 .   ? 39.650 43.565 12.227  1.00 23.22 ? 62  HOH A O     1 
HETATM 3623 O O     . HOH D 4 .   ? 64.075 31.880 28.191  1.00 20.86 ? 63  HOH A O     1 
HETATM 3624 O O     . HOH D 4 .   ? 43.291 45.596 13.247  1.00 19.52 ? 64  HOH A O     1 
HETATM 3625 O O     . HOH D 4 .   ? 27.512 29.035 6.594   1.00 18.45 ? 65  HOH A O     1 
HETATM 3626 O O     . HOH D 4 .   ? 18.691 10.335 8.502   1.00 18.69 ? 66  HOH A O     1 
HETATM 3627 O O     . HOH D 4 .   ? 28.787 18.502 16.937  1.00 16.83 ? 67  HOH A O     1 
HETATM 3628 O O     . HOH D 4 .   ? 22.146 14.252 26.652  1.00 18.47 ? 68  HOH A O     1 
HETATM 3629 O O     . HOH D 4 .   ? 62.907 48.943 13.066  1.00 21.55 ? 69  HOH A O     1 
HETATM 3630 O O     . HOH D 4 .   ? 65.065 35.790 23.850  1.00 18.47 ? 70  HOH A O     1 
HETATM 3631 O O     . HOH D 4 .   ? 21.049 16.472 25.879  1.00 18.86 ? 71  HOH A O     1 
HETATM 3632 O O     . HOH D 4 .   ? 37.100 10.759 10.177  1.00 19.90 ? 72  HOH A O     1 
HETATM 3633 O O     . HOH D 4 .   ? 4.493  24.502 26.751  1.00 22.03 ? 73  HOH A O     1 
HETATM 3634 O O     . HOH D 4 .   ? 59.803 30.441 4.923   1.00 19.48 ? 74  HOH A O     1 
HETATM 3635 O O     . HOH D 4 .   ? 50.680 14.817 3.931   1.00 21.77 ? 75  HOH A O     1 
HETATM 3636 O O     . HOH D 4 .   ? 20.250 0.987  13.982  1.00 21.87 ? 76  HOH A O     1 
HETATM 3637 O O     . HOH D 4 .   ? 46.642 14.833 7.836   1.00 23.60 ? 77  HOH A O     1 
HETATM 3638 O O     . HOH D 4 .   ? 22.923 2.333  14.349  1.00 20.77 ? 78  HOH A O     1 
HETATM 3639 O O     . HOH D 4 .   ? 50.371 29.999 -1.721  1.00 17.91 ? 79  HOH A O     1 
HETATM 3640 O O     . HOH D 4 .   ? 35.893 -3.671 23.800  1.00 24.30 ? 80  HOH A O     1 
HETATM 3641 O O     . HOH D 4 .   ? 47.950 27.493 1.582   1.00 31.63 ? 81  HOH A O     1 
HETATM 3642 O O     . HOH D 4 .   ? 32.181 11.306 5.142   1.00 29.39 ? 82  HOH A O     1 
HETATM 3643 O O     . HOH D 4 .   ? 44.566 53.608 8.812   1.00 22.77 ? 83  HOH A O     1 
HETATM 3644 O O     . HOH D 4 .   ? 49.624 16.146 17.500  1.00 18.36 ? 84  HOH A O     1 
HETATM 3645 O O     . HOH D 4 .   ? 6.947  20.455 23.146  1.00 22.40 ? 85  HOH A O     1 
HETATM 3646 O O     . HOH D 4 .   ? 11.027 10.786 12.328  1.00 20.66 ? 86  HOH A O     1 
HETATM 3647 O O     . HOH D 4 .   ? 64.452 33.052 15.983  1.00 26.79 ? 87  HOH A O     1 
HETATM 3648 O O     . HOH D 4 .   ? 47.378 34.546 -3.654  1.00 23.27 ? 88  HOH A O     1 
HETATM 3649 O O     . HOH D 4 .   ? 55.244 25.790 17.017  1.00 21.43 ? 89  HOH A O     1 
HETATM 3650 O O     . HOH D 4 .   ? 26.086 -3.042 19.818  1.00 22.22 ? 90  HOH A O     1 
HETATM 3651 O O     . HOH D 4 .   ? 30.329 5.088  15.333  1.00 19.44 ? 91  HOH A O     1 
HETATM 3652 O O     . HOH D 4 .   ? 52.167 18.812 2.992   1.00 20.73 ? 92  HOH A O     1 
HETATM 3653 O O     . HOH D 4 .   ? 61.824 32.326 7.600   1.00 28.03 ? 93  HOH A O     1 
HETATM 3654 O O     . HOH D 4 .   ? 30.589 2.607  16.128  1.00 20.52 ? 94  HOH A O     1 
HETATM 3655 O O     . HOH D 4 .   ? 18.260 21.577 9.113   1.00 21.99 ? 95  HOH A O     1 
HETATM 3656 O O     . HOH D 4 .   ? 45.733 25.449 -1.947  1.00 27.00 ? 96  HOH A O     1 
HETATM 3657 O O     . HOH D 4 .   ? 37.354 -3.031 33.625  1.00 26.52 ? 97  HOH A O     1 
HETATM 3658 O O     . HOH D 4 .   ? 30.969 12.986 29.050  1.00 24.36 ? 98  HOH A O     1 
HETATM 3659 O O     . HOH D 4 .   ? 32.590 32.124 -0.926  1.00 22.80 ? 99  HOH A O     1 
HETATM 3660 O O     . HOH D 4 .   ? 30.778 21.052 -2.776  1.00 23.24 ? 100 HOH A O     1 
HETATM 3661 O O     . HOH D 4 .   ? 31.502 36.700 6.034   1.00 20.55 ? 101 HOH A O     1 
HETATM 3662 O O     . HOH D 4 .   ? 20.211 19.433 23.105  1.00 25.98 ? 102 HOH A O     1 
HETATM 3663 O O     . HOH D 4 .   ? 47.217 41.436 22.114  1.00 25.58 ? 103 HOH A O     1 
HETATM 3664 O O     . HOH D 4 .   ? 65.911 37.314 21.366  1.00 17.28 ? 104 HOH A O     1 
HETATM 3665 O O     . HOH D 4 .   ? 48.321 14.406 2.297   1.00 19.31 ? 105 HOH A O     1 
HETATM 3666 O O     . HOH D 4 .   ? 43.620 16.645 44.314  1.00 27.79 ? 106 HOH A O     1 
HETATM 3667 O O     . HOH D 4 .   ? 11.600 10.991 6.279   1.00 25.70 ? 107 HOH A O     1 
HETATM 3668 O O     . HOH D 4 .   ? 45.057 13.019 2.438   1.00 25.05 ? 108 HOH A O     1 
HETATM 3669 O O     . HOH D 4 .   ? 56.015 20.273 17.374  1.00 24.43 ? 109 HOH A O     1 
HETATM 3670 O O     . HOH D 4 .   ? 53.026 23.610 3.131   1.00 21.83 ? 110 HOH A O     1 
HETATM 3671 O O     . HOH D 4 .   ? 34.089 -4.637 27.654  1.00 21.37 ? 111 HOH A O     1 
HETATM 3672 O O     . HOH D 4 .   ? 25.292 5.856  12.947  1.00 30.89 ? 112 HOH A O     1 
HETATM 3673 O O     . HOH D 4 .   ? 35.064 -4.114 32.573  1.00 20.73 ? 113 HOH A O     1 
HETATM 3674 O O     . HOH D 4 .   ? 48.002 31.723 -3.260  1.00 25.19 ? 114 HOH A O     1 
HETATM 3675 O O     . HOH D 4 .   ? 40.636 15.355 -3.643  1.00 24.39 ? 115 HOH A O     1 
HETATM 3676 O O     . HOH D 4 .   ? 38.891 10.681 18.314  1.00 18.65 ? 116 HOH A O     1 
HETATM 3677 O O     . HOH D 4 .   ? 36.253 -1.128 19.679  1.00 21.58 ? 117 HOH A O     1 
HETATM 3678 O O     . HOH D 4 .   ? 31.203 -4.884 31.587  1.00 23.65 ? 118 HOH A O     1 
HETATM 3679 O O     . HOH D 4 .   ? 24.596 29.907 11.426  1.00 25.74 ? 119 HOH A O     1 
HETATM 3680 O O     . HOH D 4 .   ? 27.777 34.373 11.343  1.00 23.77 ? 120 HOH A O     1 
HETATM 3681 O O     . HOH D 4 .   ? 52.581 32.512 -3.967  1.00 23.62 ? 121 HOH A O     1 
HETATM 3682 O O     . HOH D 4 .   ? 43.731 10.404 41.992  1.00 26.62 ? 122 HOH A O     1 
HETATM 3683 O O     . HOH D 4 .   ? 33.372 16.794 44.232  1.00 18.90 ? 123 HOH A O     1 
HETATM 3684 O O     . HOH D 4 .   ? 47.236 22.189 -0.465  1.00 20.19 ? 124 HOH A O     1 
HETATM 3685 O O     . HOH D 4 .   ? 9.451  24.950 27.900  1.00 23.67 ? 125 HOH A O     1 
HETATM 3686 O O     . HOH D 4 .   ? 11.961 4.173  4.900   1.00 23.02 ? 126 HOH A O     1 
HETATM 3687 O O     . HOH D 4 .   ? 22.094 -0.680 28.507  1.00 25.33 ? 127 HOH A O     1 
HETATM 3688 O O     . HOH D 4 .   ? 45.922 13.580 32.425  1.00 24.46 ? 128 HOH A O     1 
HETATM 3689 O O     . HOH D 4 .   ? 51.430 42.877 0.503   1.00 25.50 ? 129 HOH A O     1 
HETATM 3690 O O     . HOH D 4 .   ? 28.829 28.308 -3.905  1.00 25.20 ? 130 HOH A O     1 
HETATM 3691 O O     . HOH D 4 .   ? 31.692 19.125 38.092  1.00 26.23 ? 131 HOH A O     1 
HETATM 3692 O O     . HOH D 4 .   ? 8.249  18.149 25.789  1.00 21.42 ? 132 HOH A O     1 
HETATM 3693 O O     . HOH D 4 .   ? 13.621 18.887 21.126  1.00 26.54 ? 133 HOH A O     1 
HETATM 3694 O O     . HOH D 4 .   ? 33.638 20.800 23.677  1.00 26.14 ? 134 HOH A O     1 
HETATM 3695 O O     . HOH D 4 .   ? 57.229 38.403 27.006  1.00 24.68 ? 135 HOH A O     1 
HETATM 3696 O O     . HOH D 4 .   ? 46.534 29.287 -2.650  1.00 21.81 ? 136 HOH A O     1 
HETATM 3697 O O     . HOH D 4 .   ? 37.964 10.188 14.790  1.00 27.40 ? 137 HOH A O     1 
HETATM 3698 O O     . HOH D 4 .   ? 41.412 25.341 -2.713  1.00 26.38 ? 138 HOH A O     1 
HETATM 3699 O O     . HOH D 4 .   ? 54.318 23.473 5.842   1.00 24.91 ? 139 HOH A O     1 
HETATM 3700 O O     . HOH D 4 .   ? 28.856 26.045 18.772  1.00 20.37 ? 140 HOH A O     1 
HETATM 3701 O O     . HOH D 4 .   ? 15.288 -0.505 17.415  1.00 24.41 ? 141 HOH A O     1 
HETATM 3702 O O     . HOH D 4 .   ? 42.886 8.620  31.903  1.00 24.57 ? 142 HOH A O     1 
HETATM 3703 O O     . HOH D 4 .   ? 25.445 14.519 1.766   1.00 25.81 ? 143 HOH A O     1 
HETATM 3704 O O     . HOH D 4 .   ? 30.953 24.871 20.380  1.00 24.25 ? 144 HOH A O     1 
HETATM 3705 O O     . HOH D 4 .   ? 28.779 -6.951 41.449  1.00 28.56 ? 145 HOH A O     1 
HETATM 3706 O O     . HOH D 4 .   ? 38.285 37.147 -6.763  1.00 28.93 ? 146 HOH A O     1 
HETATM 3707 O O     . HOH D 4 .   ? 26.921 32.691 3.354   1.00 23.07 ? 147 HOH A O     1 
HETATM 3708 O O     . HOH D 4 .   ? 31.465 30.966 -5.103  1.00 25.10 ? 148 HOH A O     1 
HETATM 3709 O O     . HOH D 4 .   ? 41.586 43.000 1.090   1.00 23.86 ? 149 HOH A O     1 
HETATM 3710 O O     . HOH D 4 .   ? 50.036 20.891 21.131  1.00 34.82 ? 150 HOH A O     1 
HETATM 3711 O O     . HOH D 4 .   ? 50.500 25.425 -1.381  1.00 29.57 ? 151 HOH A O     1 
HETATM 3712 O O     . HOH D 4 .   ? 40.930 45.923 11.127  1.00 29.55 ? 152 HOH A O     1 
HETATM 3713 O O     . HOH D 4 .   ? 53.611 28.584 -2.925  1.00 26.30 ? 153 HOH A O     1 
HETATM 3714 O O     . HOH D 4 .   ? 52.821 44.868 -0.539  1.00 28.15 ? 154 HOH A O     1 
HETATM 3715 O O     . HOH D 4 .   ? 33.404 -1.000 50.593  1.00 26.86 ? 155 HOH A O     1 
HETATM 3716 O O     . HOH D 4 .   ? 36.897 19.321 42.804  1.00 23.13 ? 156 HOH A O     1 
HETATM 3717 O O     . HOH D 4 .   ? 42.832 10.217 13.207  1.00 24.76 ? 157 HOH A O     1 
HETATM 3718 O O     . HOH D 4 .   ? 7.782  3.550  11.140  1.00 29.25 ? 158 HOH A O     1 
HETATM 3719 O O     . HOH D 4 .   ? 17.564 0.201  25.424  1.00 27.46 ? 159 HOH A O     1 
HETATM 3720 O O     . HOH D 4 .   ? 30.721 18.847 -0.876  1.00 22.79 ? 160 HOH A O     1 
HETATM 3721 O O     . HOH D 4 .   ? 40.316 9.035  16.815  1.00 28.42 ? 161 HOH A O     1 
HETATM 3722 O O     . HOH D 4 .   ? 11.801 12.687 14.187  1.00 24.39 ? 162 HOH A O     1 
HETATM 3723 O O     . HOH D 4 .   ? 29.420 12.994 6.824   1.00 29.16 ? 163 HOH A O     1 
HETATM 3724 O O     . HOH D 4 .   ? 39.380 46.505 8.729   1.00 29.10 ? 164 HOH A O     1 
HETATM 3725 O O     . HOH D 4 .   ? 16.585 18.627 2.932   1.00 26.52 ? 165 HOH A O     1 
HETATM 3726 O O     . HOH D 4 .   ? 52.946 50.721 3.070   1.00 25.25 ? 166 HOH A O     1 
HETATM 3727 O O     . HOH D 4 .   ? 26.858 -0.896 45.653  1.00 26.80 ? 167 HOH A O     1 
HETATM 3728 O O     . HOH D 4 .   ? 22.905 0.444  44.656  1.00 26.29 ? 168 HOH A O     1 
HETATM 3729 O O     . HOH D 4 .   ? 46.205 11.232 16.024  1.00 28.83 ? 169 HOH A O     1 
HETATM 3730 O O     . HOH D 4 .   ? 28.223 33.167 7.816   1.00 26.52 ? 170 HOH A O     1 
HETATM 3731 O O     . HOH D 4 .   ? 54.483 57.351 10.627  1.00 27.55 ? 171 HOH A O     1 
HETATM 3732 O O     . HOH D 4 .   ? 17.276 24.821 3.282   1.00 30.58 ? 172 HOH A O     1 
HETATM 3733 O O     . HOH D 4 .   ? 22.988 23.447 15.832  1.00 27.59 ? 173 HOH A O     1 
HETATM 3734 O O     . HOH D 4 .   ? 8.560  6.335  6.224   1.00 25.69 ? 174 HOH A O     1 
HETATM 3735 O O     . HOH D 4 .   ? 38.597 40.317 3.094   1.00 23.17 ? 175 HOH A O     1 
HETATM 3736 O O     . HOH D 4 .   ? 61.789 39.585 6.298   1.00 25.70 ? 176 HOH A O     1 
HETATM 3737 O O     . HOH D 4 .   ? 17.725 17.974 19.475  1.00 30.31 ? 177 HOH A O     1 
HETATM 3738 O O     . HOH D 4 .   ? 64.211 34.502 26.779  1.00 24.86 ? 178 HOH A O     1 
HETATM 3739 O O     . HOH D 4 .   ? 30.755 29.232 -2.122  1.00 28.09 ? 179 HOH A O     1 
HETATM 3740 O O     . HOH D 4 .   ? 20.105 9.347  6.326   1.00 24.15 ? 180 HOH A O     1 
HETATM 3741 O O     . HOH D 4 .   ? 55.809 18.527 15.291  1.00 27.40 ? 181 HOH A O     1 
HETATM 3742 O O     . HOH D 4 .   ? 43.633 45.009 2.535   1.00 26.80 ? 182 HOH A O     1 
HETATM 3743 O O     . HOH D 4 .   ? 52.363 12.996 11.839  1.00 26.61 ? 183 HOH A O     1 
HETATM 3744 O O     . HOH D 4 .   ? 23.220 7.424  42.269  1.00 32.07 ? 184 HOH A O     1 
HETATM 3745 O O     . HOH D 4 .   ? 35.934 6.671  13.665  1.00 25.43 ? 185 HOH A O     1 
HETATM 3746 O O     . HOH D 4 .   ? 48.762 29.919 0.700   1.00 21.47 ? 186 HOH A O     1 
HETATM 3747 O O     . HOH D 4 .   ? 46.508 9.878  37.931  1.00 25.56 ? 187 HOH A O     1 
HETATM 3748 O O     . HOH D 4 .   ? 18.711 1.208  28.116  1.00 30.44 ? 188 HOH A O     1 
HETATM 3749 O O     . HOH D 4 .   ? 7.701  15.162 25.518  1.00 28.55 ? 189 HOH A O     1 
HETATM 3750 O O     . HOH D 4 .   ? 8.235  8.397  20.594  1.00 27.20 ? 190 HOH A O     1 
HETATM 3751 O O     . HOH D 4 .   ? 62.289 29.299 4.809   1.00 26.05 ? 191 HOH A O     1 
HETATM 3752 O O     . HOH D 4 .   ? 48.062 17.223 22.092  1.00 27.39 ? 192 HOH A O     1 
HETATM 3753 O O     . HOH D 4 .   ? 53.577 23.001 0.071   1.00 29.66 ? 193 HOH A O     1 
HETATM 3754 O O     . HOH D 4 .   ? 35.812 -1.645 17.024  1.00 28.33 ? 194 HOH A O     1 
HETATM 3755 O O     . HOH D 4 .   ? 39.071 49.016 7.387   1.00 28.55 ? 195 HOH A O     1 
HETATM 3756 O O     . HOH D 4 .   ? 12.940 17.292 10.755  1.00 26.73 ? 196 HOH A O     1 
HETATM 3757 O O     . HOH D 4 .   ? 51.531 13.129 26.199  1.00 29.28 ? 197 HOH A O     1 
HETATM 3758 O O     . HOH D 4 .   ? 34.049 11.989 51.527  1.00 29.18 ? 198 HOH A O     1 
HETATM 3759 O O     . HOH D 4 .   ? 24.466 3.116  12.313  1.00 26.98 ? 199 HOH A O     1 
HETATM 3760 O O     . HOH D 4 .   ? 42.154 52.391 8.459   1.00 30.46 ? 200 HOH A O     1 
HETATM 3761 O O     . HOH D 4 .   ? 40.577 0.830  26.250  1.00 27.09 ? 201 HOH A O     1 
HETATM 3762 O O     . HOH D 4 .   ? 63.930 27.724 27.227  1.00 27.09 ? 202 HOH A O     1 
HETATM 3763 O O     . HOH D 4 .   ? 59.595 45.583 11.026  1.00 29.42 ? 203 HOH A O     1 
HETATM 3764 O O     . HOH D 4 .   ? 35.992 3.373  47.738  1.00 27.35 ? 204 HOH A O     1 
HETATM 3765 O O     . HOH D 4 .   ? 29.913 -2.501 20.675  1.00 27.23 ? 205 HOH A O     1 
HETATM 3766 O O     . HOH D 4 .   ? 34.204 19.325 42.812  1.00 25.12 ? 206 HOH A O     1 
HETATM 3767 O O     . HOH D 4 .   ? 33.160 20.150 40.313  1.00 29.67 ? 207 HOH A O     1 
HETATM 3768 O O     . HOH D 4 .   ? 22.925 11.387 6.286   1.00 27.77 ? 208 HOH A O     1 
HETATM 3769 O O     . HOH D 4 .   ? 44.163 4.158  25.606  1.00 29.49 ? 209 HOH A O     1 
HETATM 3770 O O     . HOH D 4 .   ? 36.040 6.089  48.377  1.00 25.89 ? 210 HOH A O     1 
HETATM 3771 O O     . HOH D 4 .   ? 44.387 22.672 20.078  1.00 25.76 ? 211 HOH A O     1 
HETATM 3772 O O     . HOH D 4 .   ? 27.156 12.039 7.690   1.00 29.77 ? 212 HOH A O     1 
HETATM 3773 O O     . HOH D 4 .   ? 30.503 16.552 -2.341  1.00 32.73 ? 213 HOH A O     1 
HETATM 3774 O O     . HOH D 4 .   ? 23.945 -1.072 41.550  1.00 25.67 ? 214 HOH A O     1 
HETATM 3775 O O     . HOH D 4 .   ? 31.509 16.200 30.526  1.00 23.33 ? 215 HOH A O     1 
HETATM 3776 O O     . HOH D 4 .   ? 30.199 27.120 -6.491  1.00 32.48 ? 216 HOH A O     1 
HETATM 3777 O O     . HOH D 4 .   ? 47.270 6.908  37.677  1.00 29.08 ? 217 HOH A O     1 
HETATM 3778 O O     . HOH D 4 .   ? 38.879 13.744 29.501  1.00 28.23 ? 218 HOH A O     1 
HETATM 3779 O O     . HOH D 4 .   ? 48.247 25.221 0.233   1.00 32.92 ? 219 HOH A O     1 
HETATM 3780 O O     . HOH D 4 .   ? 51.985 47.535 -4.471  1.00 27.93 ? 220 HOH A O     1 
HETATM 3781 O O     . HOH D 4 .   ? 38.786 20.335 49.064  1.00 30.57 ? 221 HOH A O     1 
HETATM 3782 O O     . HOH D 4 .   ? 30.646 1.460  13.609  1.00 27.77 ? 222 HOH A O     1 
HETATM 3783 O O     . HOH D 4 .   ? 31.045 9.587  10.315  1.00 26.58 ? 681 HOH A O     1 
HETATM 3784 O O     . HOH D 4 .   ? 26.357 30.383 9.208   1.00 28.46 ? 682 HOH A O     1 
HETATM 3785 O O     . HOH D 4 .   ? 26.132 19.294 -2.122  1.00 25.99 ? 683 HOH A O     1 
HETATM 3786 O O     . HOH D 4 .   ? 51.943 39.046 -5.322  1.00 34.33 ? 684 HOH A O     1 
HETATM 3787 O O     . HOH D 4 .   ? 37.603 1.120  41.427  1.00 27.47 ? 685 HOH A O     1 
HETATM 3788 O O     . HOH D 4 .   ? 21.621 17.478 -2.179  1.00 23.02 ? 686 HOH A O     1 
HETATM 3789 O O     . HOH D 4 .   ? 28.374 1.534  50.571  1.00 30.18 ? 687 HOH A O     1 
HETATM 3790 O O     . HOH D 4 .   ? 45.601 37.943 -9.183  1.00 32.85 ? 688 HOH A O     1 
HETATM 3791 O O     . HOH D 4 .   ? 45.330 25.690 18.359  1.00 26.32 ? 689 HOH A O     1 
HETATM 3792 O O     . HOH D 4 .   ? 61.854 33.650 0.644   1.00 32.51 ? 690 HOH A O     1 
HETATM 3793 O O     . HOH D 4 .   ? 20.988 28.055 11.906  1.00 26.04 ? 691 HOH A O     1 
HETATM 3794 O O     . HOH D 4 .   ? 45.845 53.748 3.038   1.00 31.62 ? 692 HOH A O     1 
HETATM 3795 O O     . HOH D 4 .   ? 29.410 34.683 5.878   1.00 28.51 ? 693 HOH A O     1 
HETATM 3796 O O     . HOH D 4 .   ? 26.533 16.332 31.695  1.00 24.20 ? 694 HOH A O     1 
HETATM 3797 O O     . HOH D 4 .   ? 39.578 42.225 18.765  1.00 28.02 ? 695 HOH A O     1 
HETATM 3798 O O     . HOH D 4 .   ? 11.828 5.098  30.420  1.00 26.56 ? 696 HOH A O     1 
HETATM 3799 O O     . HOH D 4 .   ? 67.219 44.848 15.031  1.00 31.28 ? 697 HOH A O     1 
HETATM 3800 O O     . HOH D 4 .   ? 59.997 41.446 24.141  1.00 33.65 ? 698 HOH A O     1 
HETATM 3801 O O     . HOH D 4 .   ? 23.863 -1.368 30.661  1.00 26.25 ? 699 HOH A O     1 
HETATM 3802 O O     . HOH D 4 .   ? 58.222 19.577 19.344  1.00 30.61 ? 700 HOH A O     1 
HETATM 3803 O O     . HOH D 4 .   ? 27.790 -3.359 22.120  1.00 26.29 ? 701 HOH A O     1 
HETATM 3804 O O     . HOH D 4 .   ? 10.151 10.381 18.595  1.00 30.12 ? 702 HOH A O     1 
HETATM 3805 O O     . HOH D 4 .   ? 35.042 20.558 -6.861  1.00 32.32 ? 703 HOH A O     1 
HETATM 3806 O O     . HOH D 4 .   ? 9.672  14.718 17.763  1.00 30.15 ? 704 HOH A O     1 
HETATM 3807 O O     . HOH D 4 .   ? 37.476 9.766  5.155   1.00 27.07 ? 705 HOH A O     1 
HETATM 3808 O O     . HOH D 4 .   ? 32.731 34.569 -0.315  1.00 26.33 ? 706 HOH A O     1 
HETATM 3809 O O     . HOH D 4 .   ? 34.897 27.041 21.182  1.00 28.40 ? 707 HOH A O     1 
HETATM 3810 O O     . HOH D 4 .   ? 50.707 27.666 -2.911  1.00 30.42 ? 708 HOH A O     1 
HETATM 3811 O O     . HOH D 4 .   ? 62.751 42.345 11.275  1.00 34.75 ? 709 HOH A O     1 
HETATM 3812 O O     . HOH D 4 .   ? 32.879 -3.252 49.153  1.00 26.99 ? 710 HOH A O     1 
HETATM 3813 O O     . HOH D 4 .   ? 49.620 31.161 19.590  1.00 30.65 ? 711 HOH A O     1 
HETATM 3814 O O     . HOH D 4 .   ? 35.508 1.101  14.812  1.00 34.39 ? 712 HOH A O     1 
HETATM 3815 O O     . HOH D 4 .   ? 9.424  11.479 10.248  1.00 30.95 ? 713 HOH A O     1 
HETATM 3816 O O     . HOH D 4 .   ? 25.009 11.026 8.673   1.00 32.43 ? 714 HOH A O     1 
HETATM 3817 O O     . HOH D 4 .   ? 33.160 8.048  13.518  1.00 28.11 ? 715 HOH A O     1 
HETATM 3818 O O     . HOH D 4 .   ? 47.627 36.025 26.763  1.00 30.17 ? 716 HOH A O     1 
HETATM 3819 O O     . HOH D 4 .   ? 38.888 56.861 20.665  1.00 31.52 ? 717 HOH A O     1 
HETATM 3820 O O     . HOH D 4 .   ? 48.983 13.256 16.740  1.00 30.94 ? 718 HOH A O     1 
HETATM 3821 O O     . HOH D 4 .   ? 51.841 30.805 21.540  1.00 25.79 ? 719 HOH A O     1 
HETATM 3822 O O     . HOH D 4 .   ? 46.744 21.752 21.324  1.00 26.68 ? 720 HOH A O     1 
HETATM 3823 O O     . HOH D 4 .   ? 42.880 21.806 22.595  1.00 29.33 ? 721 HOH A O     1 
HETATM 3824 O O     . HOH D 4 .   ? 40.629 4.690  26.232  1.00 26.87 ? 722 HOH A O     1 
HETATM 3825 O O     . HOH D 4 .   ? 57.593 30.733 28.237  1.00 31.61 ? 723 HOH A O     1 
HETATM 3826 O O     . HOH D 4 .   ? 36.807 1.568  43.967  1.00 26.64 ? 724 HOH A O     1 
HETATM 3827 O O     . HOH D 4 .   ? 36.717 -1.865 27.847  1.00 26.59 ? 725 HOH A O     1 
HETATM 3828 O O     . HOH D 4 .   ? 28.793 -2.439 32.858  1.00 27.43 ? 726 HOH A O     1 
HETATM 3829 O O     . HOH D 4 .   ? 34.368 23.649 20.906  1.00 33.61 ? 727 HOH A O     1 
HETATM 3830 O O     . HOH D 4 .   ? 28.058 29.798 16.287  1.00 32.04 ? 728 HOH A O     1 
HETATM 3831 O O     . HOH D 4 .   ? 10.072 1.225  25.016  1.00 27.76 ? 729 HOH A O     1 
HETATM 3832 O O     . HOH D 4 .   ? 18.842 17.298 27.948  1.00 31.54 ? 730 HOH A O     1 
HETATM 3833 O O     . HOH D 4 .   ? 30.962 37.549 3.487   1.00 30.27 ? 731 HOH A O     1 
HETATM 3834 O O     . HOH D 4 .   ? 43.254 6.964  22.005  1.00 35.85 ? 732 HOH A O     1 
HETATM 3835 O O     . HOH D 4 .   ? 29.519 20.657 37.501  1.00 36.07 ? 733 HOH A O     1 
HETATM 3836 O O     . HOH D 4 .   ? 18.748 11.537 35.470  1.00 34.72 ? 734 HOH A O     1 
HETATM 3837 O O     . HOH D 4 .   ? 12.624 7.073  32.231  1.00 25.06 ? 735 HOH A O     1 
HETATM 3838 O O     . HOH D 4 .   ? 46.784 13.019 40.726  1.00 30.54 ? 736 HOH A O     1 
HETATM 3839 O O     . HOH D 4 .   ? 24.332 17.169 -2.081  1.00 32.11 ? 737 HOH A O     1 
HETATM 3840 O O     . HOH D 4 .   ? 32.225 37.351 1.024   1.00 30.89 ? 738 HOH A O     1 
HETATM 3841 O O     . HOH D 4 .   ? 31.762 18.359 29.140  1.00 31.94 ? 739 HOH A O     1 
HETATM 3842 O O     . HOH D 4 .   ? 29.188 -2.332 18.103  1.00 28.28 ? 740 HOH A O     1 
HETATM 3843 O O     . HOH D 4 .   ? 26.002 21.348 20.516  1.00 29.89 ? 741 HOH A O     1 
HETATM 3844 O O     . HOH D 4 .   ? 31.166 5.749  12.928  1.00 30.01 ? 742 HOH A O     1 
HETATM 3845 O O     . HOH D 4 .   ? 32.121 -7.306 46.990  1.00 28.96 ? 743 HOH A O     1 
HETATM 3846 O O     . HOH D 4 .   ? 17.516 6.385  3.595   1.00 29.40 ? 744 HOH A O     1 
HETATM 3847 O O     . HOH D 4 .   ? 68.158 42.702 16.585  1.00 30.25 ? 745 HOH A O     1 
HETATM 3848 O O     . HOH D 4 .   ? 37.410 20.827 26.692  1.00 35.15 ? 746 HOH A O     1 
HETATM 3849 O O     . HOH D 4 .   ? 34.416 31.164 19.923  1.00 34.53 ? 747 HOH A O     1 
HETATM 3850 O O     . HOH D 4 .   ? 38.526 25.834 21.669  1.00 32.19 ? 748 HOH A O     1 
HETATM 3851 O O     . HOH D 4 .   ? 45.668 10.639 1.698   1.00 25.71 ? 749 HOH A O     1 
HETATM 3852 O O     . HOH D 4 .   ? 68.180 23.865 21.507  1.00 29.89 ? 750 HOH A O     1 
HETATM 3853 O O     . HOH D 4 .   ? 62.210 56.181 8.979   1.00 31.85 ? 751 HOH A O     1 
HETATM 3854 O O     . HOH D 4 .   ? 60.697 15.262 14.922  1.00 33.06 ? 754 HOH A O     1 
HETATM 3855 O O     . HOH D 4 .   ? 46.237 34.281 -6.293  1.00 30.13 ? 755 HOH A O     1 
HETATM 3856 O O     . HOH D 4 .   ? 68.339 35.472 21.343  1.00 32.29 ? 756 HOH A O     1 
HETATM 3857 O O     . HOH D 4 .   ? 25.035 18.526 30.460  1.00 31.68 ? 757 HOH A O     1 
HETATM 3858 O O     . HOH D 4 .   ? 41.334 7.432  7.536   1.00 32.95 ? 758 HOH A O     1 
HETATM 3859 O O     . HOH D 4 .   ? 18.637 26.287 8.475   1.00 29.30 ? 759 HOH A O     1 
HETATM 3860 O O     . HOH D 4 .   ? 64.259 50.913 11.550  1.00 36.29 ? 760 HOH A O     1 
HETATM 3861 O O     . HOH D 4 .   ? 38.460 41.271 15.669  1.00 33.30 ? 761 HOH A O     1 
HETATM 3862 O O     . HOH D 4 .   ? 61.343 22.900 7.235   1.00 34.41 ? 762 HOH A O     1 
HETATM 3863 O O     . HOH D 4 .   ? 45.747 46.944 29.909  1.00 32.43 ? 763 HOH A O     1 
HETATM 3864 O O     . HOH D 4 .   ? 29.525 -4.585 35.204  1.00 34.61 ? 764 HOH A O     1 
HETATM 3865 O O     . HOH D 4 .   ? 53.506 35.080 -4.100  1.00 34.18 ? 765 HOH A O     1 
HETATM 3866 O O     . HOH D 4 .   ? 34.415 -4.431 40.564  1.00 33.50 ? 766 HOH A O     1 
HETATM 3867 O O     . HOH D 4 .   ? 54.074 40.340 29.339  1.00 32.74 ? 767 HOH A O     1 
HETATM 3868 O O     . HOH D 4 .   ? 18.222 26.665 5.856   1.00 28.12 ? 768 HOH A O     1 
HETATM 3869 O O     . HOH D 4 .   ? 18.431 22.963 25.327  1.00 30.25 ? 769 HOH A O     1 
HETATM 3870 O O     . HOH D 4 .   ? 30.542 19.068 25.534  1.00 27.49 ? 770 HOH A O     1 
HETATM 3871 O O     . HOH D 4 .   ? 9.162  -0.283 9.073   1.00 31.11 ? 771 HOH A O     1 
HETATM 3872 O O     . HOH D 4 .   ? 26.053 12.259 3.269   1.00 28.22 ? 772 HOH A O     1 
HETATM 3873 O O     . HOH D 4 .   ? 28.194 20.242 25.556  1.00 28.80 ? 773 HOH A O     1 
HETATM 3874 O O     . HOH D 4 .   ? 37.314 42.573 3.470   1.00 32.80 ? 774 HOH A O     1 
HETATM 3875 O O     . HOH D 4 .   ? 55.843 26.983 26.649  1.00 27.20 ? 775 HOH A O     1 
HETATM 3876 O O     . HOH D 4 .   ? 66.532 36.841 18.505  1.00 34.68 ? 776 HOH A O     1 
HETATM 3877 O O     . HOH D 4 .   ? 25.177 30.363 3.836   1.00 29.48 ? 777 HOH A O     1 
HETATM 3878 O O     . HOH D 4 .   ? 33.020 -5.808 38.649  1.00 33.17 ? 778 HOH A O     1 
HETATM 3879 O O     . HOH D 4 .   ? 19.595 -4.056 16.936  1.00 36.59 ? 779 HOH A O     1 
HETATM 3880 O O     . HOH D 4 .   ? 3.586  16.689 31.026  1.00 31.43 ? 780 HOH A O     1 
HETATM 3881 O O     . HOH D 4 .   ? 47.831 56.000 15.001  1.00 32.02 ? 781 HOH A O     1 
HETATM 3882 O O     . HOH D 4 .   ? 39.965 27.466 -4.975  1.00 26.68 ? 782 HOH A O     1 
HETATM 3883 O O     . HOH D 4 .   ? 18.870 22.535 28.408  1.00 33.91 ? 783 HOH A O     1 
HETATM 3884 O O     . HOH D 4 .   ? 32.237 27.032 21.350  1.00 33.23 ? 784 HOH A O     1 
HETATM 3885 O O     . HOH D 4 .   ? 41.130 -0.538 35.454  1.00 33.36 ? 785 HOH A O     1 
HETATM 3886 O O     . HOH D 4 .   ? 31.315 7.772  49.900  1.00 28.72 ? 786 HOH A O     1 
HETATM 3887 O O     . HOH D 4 .   ? 14.327 15.488 17.060  1.00 27.40 ? 787 HOH A O     1 
HETATM 3888 O O     . HOH D 4 .   ? 4.910  -3.329 13.419  1.00 35.48 ? 788 HOH A O     1 
HETATM 3889 O O     . HOH D 4 .   ? 63.104 35.654 10.473  1.00 30.76 ? 789 HOH A O     1 
HETATM 3890 O O     . HOH D 4 .   ? 26.506 15.860 -0.143  1.00 29.63 ? 790 HOH A O     1 
HETATM 3891 O O     . HOH D 4 .   ? 39.397 36.728 20.271  1.00 33.58 ? 791 HOH A O     1 
HETATM 3892 O O     . HOH D 4 .   ? 42.417 45.184 26.164  1.00 29.83 ? 792 HOH A O     1 
HETATM 3893 O O     . HOH D 4 .   ? 32.998 21.212 26.608  1.00 32.39 ? 793 HOH A O     1 
HETATM 3894 O O     . HOH D 4 .   ? 36.464 8.836  2.242   1.00 33.44 ? 794 HOH A O     1 
HETATM 3895 O O     . HOH D 4 .   ? 45.715 12.354 38.161  1.00 30.28 ? 795 HOH A O     1 
HETATM 3896 O O     . HOH D 4 .   ? 17.085 22.312 6.761   1.00 35.19 ? 796 HOH A O     1 
HETATM 3897 O O     . HOH D 4 .   ? 20.146 -1.668 23.917  1.00 32.03 ? 797 HOH A O     1 
HETATM 3898 O O     . HOH D 4 .   ? 40.572 5.926  22.306  1.00 37.36 ? 798 HOH A O     1 
HETATM 3899 O O     . HOH D 4 .   ? 62.114 60.007 24.781  1.00 34.56 ? 799 HOH A O     1 
HETATM 3900 O O     . HOH D 4 .   ? 15.145 17.405 19.339  1.00 28.68 ? 800 HOH A O     1 
HETATM 3901 O O     . HOH D 4 .   ? 38.607 6.999  48.257  1.00 29.15 ? 801 HOH A O     1 
HETATM 3902 O O     . HOH D 4 .   ? 14.144 3.474  30.720  1.00 33.41 ? 802 HOH A O     1 
HETATM 3903 O O     . HOH D 4 .   ? 44.993 49.685 -4.023  1.00 33.12 ? 803 HOH A O     1 
HETATM 3904 O O     . HOH D 4 .   ? 23.294 15.537 33.317  1.00 32.38 ? 804 HOH A O     1 
HETATM 3905 O O     . HOH D 4 .   ? 15.239 16.561 4.088   1.00 28.76 ? 805 HOH A O     1 
HETATM 3906 O O     . HOH D 4 .   ? 44.791 2.538  32.512  1.00 32.44 ? 806 HOH A O     1 
HETATM 3907 O O     . HOH D 4 .   ? 48.385 13.649 5.969   1.00 30.28 ? 807 HOH A O     1 
HETATM 3908 O O     . HOH D 4 .   ? 37.019 -0.754 44.904  1.00 34.42 ? 808 HOH A O     1 
HETATM 3909 O O     . HOH D 4 .   ? 61.047 40.389 -3.381  1.00 33.37 ? 809 HOH A O     1 
HETATM 3910 O O     . HOH D 4 .   ? 34.639 9.935  6.708   1.00 31.82 ? 810 HOH A O     1 
HETATM 3911 O O     . HOH D 4 .   ? 2.152  20.528 24.833  1.00 32.07 ? 811 HOH A O     1 
HETATM 3912 O O     . HOH D 4 .   ? 53.159 26.248 26.145  1.00 25.23 ? 812 HOH A O     1 
HETATM 3913 O O     . HOH D 4 .   ? 61.114 62.161 25.730  1.00 28.82 ? 813 HOH A O     1 
HETATM 3914 O O     . HOH D 4 .   ? 50.483 12.211 7.421   1.00 32.17 ? 814 HOH A O     1 
HETATM 3915 O O     . HOH D 4 .   ? 30.489 10.320 50.256  1.00 37.34 ? 815 HOH A O     1 
HETATM 3916 O O     . HOH D 4 .   ? 36.403 42.431 0.695   1.00 31.48 ? 816 HOH A O     1 
HETATM 3917 O O     . HOH D 4 .   ? 27.610 -4.832 38.102  1.00 30.60 ? 817 HOH A O     1 
HETATM 3918 O O     . HOH D 4 .   ? 18.536 3.677  10.330  1.00 31.78 ? 818 HOH A O     1 
HETATM 3919 O O     . HOH D 4 .   ? 39.744 44.289 2.678   1.00 31.75 ? 819 HOH A O     1 
HETATM 3920 O O     . HOH D 4 .   ? 55.583 44.744 0.196   1.00 32.10 ? 820 HOH A O     1 
HETATM 3921 O O     . HOH D 4 .   ? 28.532 -6.569 25.903  1.00 30.01 ? 821 HOH A O     1 
HETATM 3922 O O     . HOH D 4 .   ? 18.603 -5.887 21.071  1.00 34.47 ? 822 HOH A O     1 
HETATM 3923 O O     . HOH D 4 .   ? 13.291 0.570  7.082   1.00 32.00 ? 823 HOH A O     1 
HETATM 3924 O O     . HOH D 4 .   ? 66.117 31.403 17.094  1.00 28.83 ? 824 HOH A O     1 
HETATM 3925 O O     . HOH D 4 .   ? 66.604 49.639 15.383  1.00 36.12 ? 825 HOH A O     1 
HETATM 3926 O O     . HOH D 4 .   ? 53.938 26.239 23.759  1.00 22.25 ? 826 HOH A O     1 
HETATM 3927 O O     . HOH D 4 .   ? 50.503 45.544 -8.097  1.00 34.64 ? 827 HOH A O     1 
HETATM 3928 O O     . HOH D 4 .   ? 38.137 37.540 15.845  1.00 31.76 ? 828 HOH A O     1 
HETATM 3929 O O     . HOH D 4 .   ? 15.297 -3.000 18.621  1.00 34.24 ? 829 HOH A O     1 
HETATM 3930 O O     . HOH D 4 .   ? 15.498 20.708 22.039  1.00 34.83 ? 830 HOH A O     1 
HETATM 3931 O O     . HOH D 4 .   ? 15.408 4.710  34.488  1.00 31.63 ? 831 HOH A O     1 
HETATM 3932 O O     . HOH D 4 .   ? 39.819 4.090  28.555  1.00 30.20 ? 832 HOH A O     1 
HETATM 3933 O O     . HOH D 4 .   ? 47.069 27.413 -0.953  1.00 34.05 ? 833 HOH A O     1 
HETATM 3934 O O     . HOH D 4 .   ? 43.466 1.940  34.888  1.00 33.57 ? 834 HOH A O     1 
HETATM 3935 O O     . HOH D 4 .   ? 33.148 36.251 15.755  1.00 30.40 ? 835 HOH A O     1 
HETATM 3936 O O     . HOH D 4 .   ? 33.897 19.201 35.317  1.00 36.28 ? 836 HOH A O     1 
HETATM 3937 O O     . HOH D 4 .   ? 61.789 32.087 29.645  1.00 28.06 ? 837 HOH A O     1 
HETATM 3938 O O     . HOH D 4 .   ? 49.555 6.637  34.143  1.00 31.95 ? 838 HOH A O     1 
HETATM 3939 O O     . HOH D 4 .   ? 53.586 34.730 29.346  1.00 31.54 ? 839 HOH A O     1 
HETATM 3940 O O     . HOH D 4 .   ? 40.275 61.616 24.229  1.00 32.28 ? 840 HOH A O     1 
HETATM 3941 O O     . HOH D 4 .   ? 15.066 -3.803 21.173  1.00 31.80 ? 841 HOH A O     1 
HETATM 3942 O O     . HOH D 4 .   ? 59.535 63.847 24.593  1.00 35.99 ? 842 HOH A O     1 
HETATM 3943 O O     . HOH D 4 .   ? 38.046 44.949 4.455   1.00 33.40 ? 843 HOH A O     1 
HETATM 3944 O O     . HOH D 4 .   ? 22.955 16.553 29.242  1.00 28.24 ? 844 HOH A O     1 
HETATM 3945 O O     . HOH D 4 .   ? 27.690 18.822 38.079  1.00 28.54 ? 845 HOH A O     1 
HETATM 3946 O O     . HOH D 4 .   ? 61.149 57.626 25.663  1.00 30.93 ? 846 HOH A O     1 
HETATM 3947 O O     . HOH D 4 .   ? 28.054 4.805  13.204  1.00 34.15 ? 847 HOH A O     1 
HETATM 3948 O O     . HOH D 4 .   ? 34.517 -6.526 34.328  1.00 32.63 ? 848 HOH A O     1 
HETATM 3949 O O     . HOH D 4 .   ? 31.827 39.618 5.659   1.00 36.17 ? 849 HOH A O     1 
HETATM 3950 O O     . HOH D 4 .   ? 27.414 12.151 46.265  1.00 32.47 ? 850 HOH A O     1 
HETATM 3951 O O     . HOH D 4 .   ? 28.704 6.820  11.626  1.00 36.39 ? 851 HOH A O     1 
HETATM 3952 O O     . HOH D 4 .   ? 30.878 39.951 16.349  1.00 31.06 ? 852 HOH A O     1 
HETATM 3953 O O     . HOH D 4 .   ? 9.123  9.580  13.912  1.00 34.70 ? 853 HOH A O     1 
HETATM 3954 O O     . HOH D 4 .   ? 47.645 15.169 30.933  1.00 31.42 ? 854 HOH A O     1 
HETATM 3955 O O     . HOH D 4 .   ? 56.317 39.321 -7.966  1.00 33.10 ? 855 HOH A O     1 
HETATM 3956 O O     . HOH D 4 .   ? 38.411 54.697 23.257  1.00 26.63 ? 856 HOH A O     1 
HETATM 3957 O O     . HOH D 4 .   ? 25.185 17.833 33.829  1.00 34.72 ? 857 HOH A O     1 
HETATM 3958 O O     . HOH D 4 .   ? 21.594 19.893 -5.721  1.00 34.12 ? 858 HOH A O     1 
HETATM 3959 O O     . HOH D 4 .   ? 36.865 8.007  52.156  1.00 31.69 ? 859 HOH A O     1 
HETATM 3960 O O     . HOH D 4 .   ? 39.342 8.284  21.780  1.00 33.14 ? 860 HOH A O     1 
HETATM 3961 O O     . HOH D 4 .   ? 44.045 9.107  11.017  1.00 29.49 ? 861 HOH A O     1 
HETATM 3962 O O     . HOH D 4 .   ? 12.695 16.332 6.995   1.00 34.31 ? 862 HOH A O     1 
HETATM 3963 O O     . HOH D 4 .   ? 62.214 40.621 13.290  1.00 26.11 ? 863 HOH A O     1 
HETATM 3964 O O     . HOH D 4 .   ? 58.677 45.138 25.826  1.00 33.89 ? 864 HOH A O     1 
HETATM 3965 O O     . HOH D 4 .   ? 16.644 18.306 15.339  1.00 34.68 ? 865 HOH A O     1 
HETATM 3966 O O     . HOH D 4 .   ? 23.767 22.550 -2.628  1.00 33.15 ? 866 HOH A O     1 
HETATM 3967 O O     . HOH D 4 .   ? 36.079 35.401 -5.446  1.00 36.68 ? 867 HOH A O     1 
HETATM 3968 O O     . HOH D 4 .   ? 32.179 20.774 32.697  1.00 36.15 ? 868 HOH A O     1 
HETATM 3969 O O     . HOH D 4 .   ? 54.696 52.056 4.965   1.00 32.93 ? 869 HOH A O     1 
HETATM 3970 O O     . HOH D 4 .   ? 40.982 15.266 55.263  1.00 33.11 ? 870 HOH A O     1 
HETATM 3971 O O     . HOH D 4 .   ? 40.965 36.260 -9.999  1.00 35.63 ? 871 HOH A O     1 
HETATM 3972 O O     . HOH D 4 .   ? 22.440 -6.537 24.429  1.00 36.40 ? 872 HOH A O     1 
HETATM 3973 O O     . HOH D 4 .   ? 34.524 17.613 -4.432  1.00 33.80 ? 873 HOH A O     1 
HETATM 3974 O O     . HOH D 4 .   ? 34.444 6.870  51.216  1.00 32.23 ? 874 HOH A O     1 
HETATM 3975 O O     . HOH D 4 .   ? 11.503 -1.033 8.204   1.00 31.47 ? 875 HOH A O     1 
HETATM 3976 O O     . HOH D 4 .   ? 36.167 -4.070 29.972  1.00 31.47 ? 876 HOH A O     1 
HETATM 3977 O O     . HOH D 4 .   ? 42.522 8.611  15.512  1.00 28.06 ? 877 HOH A O     1 
HETATM 3978 O O     . HOH D 4 .   ? 64.601 44.464 11.844  1.00 30.94 ? 878 HOH A O     1 
HETATM 3979 O O     . HOH D 4 .   ? 53.676 30.214 27.494  1.00 35.81 ? 879 HOH A O     1 
HETATM 3980 O O     . HOH D 4 .   ? 17.282 21.602 3.982   1.00 33.30 ? 880 HOH A O     1 
HETATM 3981 O O     . HOH D 4 .   ? 53.946 19.357 23.101  1.00 33.63 ? 881 HOH A O     1 
HETATM 3982 O O     . HOH D 4 .   ? 6.663  9.381  25.038  1.00 27.75 ? 882 HOH A O     1 
HETATM 3983 O O     . HOH D 4 .   ? 36.608 14.091 -0.595  1.00 31.95 ? 883 HOH A O     1 
HETATM 3984 O O     . HOH D 4 .   ? 19.925 15.173 28.395  1.00 30.31 ? 884 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   223 ?   ?   ?   A . n 
A 1 2   GLY 2   224 ?   ?   ?   A . n 
A 1 3   SER 3   225 ?   ?   ?   A . n 
A 1 4   SER 4   226 ?   ?   ?   A . n 
A 1 5   HIS 5   227 ?   ?   ?   A . n 
A 1 6   HIS 6   228 ?   ?   ?   A . n 
A 1 7   HIS 7   229 ?   ?   ?   A . n 
A 1 8   HIS 8   230 ?   ?   ?   A . n 
A 1 9   HIS 9   231 ?   ?   ?   A . n 
A 1 10  HIS 10  232 ?   ?   ?   A . n 
A 1 11  SER 11  233 ?   ?   ?   A . n 
A 1 12  SER 12  234 ?   ?   ?   A . n 
A 1 13  GLY 13  235 ?   ?   ?   A . n 
A 1 14  LEU 14  236 ?   ?   ?   A . n 
A 1 15  VAL 15  237 ?   ?   ?   A . n 
A 1 16  PRO 16  238 ?   ?   ?   A . n 
A 1 17  ARG 17  239 ?   ?   ?   A . n 
A 1 18  GLY 18  240 ?   ?   ?   A . n 
A 1 19  SER 19  241 ?   ?   ?   A . n 
A 1 20  HIS 20  242 ?   ?   ?   A . n 
A 1 21  MET 21  243 ?   ?   ?   A . n 
A 1 22  SER 22  244 ?   ?   ?   A . n 
A 1 23  ILE 23  245 ?   ?   ?   A . n 
A 1 24  ARG 24  246 246 ARG ARG A . n 
A 1 25  GLN 25  247 247 GLN GLN A . n 
A 1 26  TYR 26  248 248 TYR TYR A . n 
A 1 27  GLU 27  249 249 GLU GLU A . n 
A 1 28  LEU 28  250 250 LEU LEU A . n 
A 1 29  VAL 29  251 251 VAL VAL A . n 
A 1 30  VAL 30  252 252 VAL VAL A . n 
A 1 31  HIS 31  253 253 HIS HIS A . n 
A 1 32  THR 32  254 254 THR THR A . n 
A 1 33  ASP 33  255 255 ASP ASP A . n 
A 1 34  ILE 34  256 256 ILE ILE A . n 
A 1 35  ASP 35  257 257 ASP ASP A . n 
A 1 36  ALA 36  258 258 ALA ALA A . n 
A 1 37  ALA 37  259 259 ALA ALA A . n 
A 1 38  LYS 38  260 260 LYS LYS A . n 
A 1 39  VAL 39  261 261 VAL VAL A . n 
A 1 40  TYR 40  262 262 TYR TYR A . n 
A 1 41  MET 41  263 263 MET MET A . n 
A 1 42  GLY 42  264 264 GLY GLY A . n 
A 1 43  GLU 43  265 265 GLU GLU A . n 
A 1 44  MET 44  266 266 MET MET A . n 
A 1 45  GLY 45  267 267 GLY GLY A . n 
A 1 46  ARG 46  268 268 ARG ARG A . n 
A 1 47  LEU 47  269 269 LEU LEU A . n 
A 1 48  LYS 48  270 270 LYS LYS A . n 
A 1 49  SER 49  271 271 SER SER A . n 
A 1 50  TYR 50  272 272 TYR TYR A . n 
A 1 51  GLU 51  273 273 GLU GLU A . n 
A 1 52  ASN 52  274 274 ASN ASN A . n 
A 1 53  GLN 53  275 275 GLN GLN A . n 
A 1 54  LYS 54  276 276 LYS LYS A . n 
A 1 55  PRO 55  277 277 PRO PRO A . n 
A 1 56  PRO 56  278 278 PRO PRO A . n 
A 1 57  PHE 57  279 279 PHE PHE A . n 
A 1 58  ASP 58  280 280 ASP ASP A . n 
A 1 59  ALA 59  281 281 ALA ALA A . n 
A 1 60  LYS 60  282 282 LYS LYS A . n 
A 1 61  ASN 61  283 283 ASN ASN A . n 
A 1 62  PRO 62  284 284 PRO PRO A . n 
A 1 63  PHE 63  285 285 PHE PHE A . n 
A 1 64  LEU 64  286 286 LEU LEU A . n 
A 1 65  ALA 65  287 287 ALA ALA A . n 
A 1 66  ALA 66  288 288 ALA ALA A . n 
A 1 67  VAL 67  289 289 VAL VAL A . n 
A 1 68  THR 68  290 290 THR THR A . n 
A 1 69  THR 69  291 291 THR THR A . n 
A 1 70  ASN 70  292 292 ASN ASN A . n 
A 1 71  ARG 71  293 293 ARG ARG A . n 
A 1 72  LYS 72  294 294 LYS LYS A . n 
A 1 73  LEU 73  295 295 LEU LEU A . n 
A 1 74  ASN 74  296 296 ASN ASN A . n 
A 1 75  GLN 75  297 297 GLN GLN A . n 
A 1 76  GLY 76  298 298 GLY GLY A . n 
A 1 77  THR 77  299 299 THR THR A . n 
A 1 78  GLU 78  300 300 GLU GLU A . n 
A 1 79  ARG 79  301 301 ARG ARG A . n 
A 1 80  HIS 80  302 302 HIS HIS A . n 
A 1 81  LEU 81  303 303 LEU LEU A . n 
A 1 82  MET 82  304 304 MET MET A . n 
A 1 83  HIS 83  305 305 HIS HIS A . n 
A 1 84  LEU 84  306 306 LEU LEU A . n 
A 1 85  GLU 85  307 307 GLU GLU A . n 
A 1 86  LEU 86  308 308 LEU LEU A . n 
A 1 87  ASP 87  309 309 ASP ASP A . n 
A 1 88  ILE 88  310 310 ILE ILE A . n 
A 1 89  SER 89  311 311 SER SER A . n 
A 1 90  ASP 90  312 312 ASP ASP A . n 
A 1 91  SER 91  313 313 SER SER A . n 
A 1 92  LYS 92  314 314 LYS LYS A . n 
A 1 93  ILE 93  315 315 ILE ILE A . n 
A 1 94  ARG 94  316 316 ARG ARG A . n 
A 1 95  TYR 95  317 317 TYR TYR A . n 
A 1 96  GLU 96  318 318 GLU GLU A . n 
A 1 97  SER 97  319 319 SER SER A . n 
A 1 98  GLY 98  320 320 GLY GLY A . n 
A 1 99  ASP 99  321 321 ASP ASP A . n 
A 1 100 HIS 100 322 322 HIS HIS A . n 
A 1 101 VAL 101 323 323 VAL VAL A . n 
A 1 102 ALA 102 324 324 ALA ALA A . n 
A 1 103 VAL 103 325 325 VAL VAL A . n 
A 1 104 TYR 104 326 326 TYR TYR A . n 
A 1 105 PRO 105 327 327 PRO PRO A . n 
A 1 106 ALA 106 328 328 ALA ALA A . n 
A 1 107 ASN 107 329 329 ASN ASN A . n 
A 1 108 ASP 108 330 330 ASP ASP A . n 
A 1 109 SER 109 331 331 SER SER A . n 
A 1 110 ALA 110 332 332 ALA ALA A . n 
A 1 111 LEU 111 333 333 LEU LEU A . n 
A 1 112 VAL 112 334 334 VAL VAL A . n 
A 1 113 ASN 113 335 335 ASN ASN A . n 
A 1 114 GLN 114 336 336 GLN GLN A . n 
A 1 115 LEU 115 337 337 LEU LEU A . n 
A 1 116 GLY 116 338 338 GLY GLY A . n 
A 1 117 LYS 117 339 339 LYS LYS A . n 
A 1 118 ILE 118 340 340 ILE ILE A . n 
A 1 119 LEU 119 341 341 LEU LEU A . n 
A 1 120 GLY 120 342 342 GLY GLY A . n 
A 1 121 ALA 121 343 343 ALA ALA A . n 
A 1 122 ASP 122 344 344 ASP ASP A . n 
A 1 123 LEU 123 345 345 LEU LEU A . n 
A 1 124 ASP 124 346 346 ASP ASP A . n 
A 1 125 VAL 125 347 347 VAL VAL A . n 
A 1 126 VAL 126 348 348 VAL VAL A . n 
A 1 127 MET 127 349 349 MET MET A . n 
A 1 128 SER 128 350 350 SER SER A . n 
A 1 129 LEU 129 351 351 LEU LEU A . n 
A 1 130 ASN 130 352 352 ASN ASN A . n 
A 1 131 ASN 131 353 353 ASN ASN A . n 
A 1 132 LEU 132 354 354 LEU LEU A . n 
A 1 133 ASP 133 355 355 ASP ASP A . n 
A 1 134 GLU 134 356 356 GLU GLU A . n 
A 1 135 GLU 135 357 357 GLU GLU A . n 
A 1 136 SER 136 358 358 SER SER A . n 
A 1 137 ASN 137 359 359 ASN ASN A . n 
A 1 138 LYS 138 360 360 LYS LYS A . n 
A 1 139 LYS 139 361 361 LYS LYS A . n 
A 1 140 HIS 140 362 362 HIS HIS A . n 
A 1 141 PRO 141 363 363 PRO PRO A . n 
A 1 142 PHE 142 364 364 PHE PHE A . n 
A 1 143 PRO 143 365 365 PRO PRO A . n 
A 1 144 CYS 144 366 366 CYS CYS A . n 
A 1 145 PRO 145 367 367 PRO PRO A . n 
A 1 146 THR 146 368 368 THR THR A . n 
A 1 147 SER 147 369 369 SER SER A . n 
A 1 148 TYR 148 370 370 TYR TYR A . n 
A 1 149 ARG 149 371 371 ARG ARG A . n 
A 1 150 THR 150 372 372 THR THR A . n 
A 1 151 ALA 151 373 373 ALA ALA A . n 
A 1 152 LEU 152 374 374 LEU LEU A . n 
A 1 153 THR 153 375 375 THR THR A . n 
A 1 154 TYR 154 376 376 TYR TYR A . n 
A 1 155 TYR 155 377 377 TYR TYR A . n 
A 1 156 LEU 156 378 378 LEU LEU A . n 
A 1 157 ASP 157 379 379 ASP ASP A . n 
A 1 158 ILE 158 380 380 ILE ILE A . n 
A 1 159 THR 159 381 381 THR THR A . n 
A 1 160 ASN 160 382 382 ASN ASN A . n 
A 1 161 PRO 161 383 383 PRO PRO A . n 
A 1 162 PRO 162 384 384 PRO PRO A . n 
A 1 163 ARG 163 385 385 ARG ARG A . n 
A 1 164 THR 164 386 386 THR THR A . n 
A 1 165 ASN 165 387 387 ASN ASN A . n 
A 1 166 VAL 166 388 388 VAL VAL A . n 
A 1 167 LEU 167 389 389 LEU LEU A . n 
A 1 168 TYR 168 390 390 TYR TYR A . n 
A 1 169 GLU 169 391 391 GLU GLU A . n 
A 1 170 LEU 170 392 392 LEU LEU A . n 
A 1 171 ALA 171 393 393 ALA ALA A . n 
A 1 172 GLN 172 394 394 GLN GLN A . n 
A 1 173 TYR 173 395 395 TYR TYR A . n 
A 1 174 ALA 174 396 396 ALA ALA A . n 
A 1 175 SER 175 397 397 SER SER A . n 
A 1 176 GLU 176 398 398 GLU GLU A . n 
A 1 177 PRO 177 399 399 PRO PRO A . n 
A 1 178 SER 178 400 400 SER SER A . n 
A 1 179 GLU 179 401 401 GLU GLU A . n 
A 1 180 GLN 180 402 402 GLN GLN A . n 
A 1 181 GLU 181 403 403 GLU GLU A . n 
A 1 182 LEU 182 404 404 LEU LEU A . n 
A 1 183 LEU 183 405 405 LEU LEU A . n 
A 1 184 ARG 184 406 406 ARG ARG A . n 
A 1 185 LYS 185 407 407 LYS LYS A . n 
A 1 186 MET 186 408 408 MET MET A . n 
A 1 187 ALA 187 409 409 ALA ALA A . n 
A 1 188 SER 188 410 410 SER SER A . n 
A 1 189 SER 189 411 411 SER SER A . n 
A 1 190 SER 190 412 412 SER SER A . n 
A 1 191 GLY 191 413 413 GLY GLY A . n 
A 1 192 GLU 192 414 414 GLU GLU A . n 
A 1 193 GLY 193 415 415 GLY GLY A . n 
A 1 194 LYS 194 416 416 LYS LYS A . n 
A 1 195 GLU 195 417 417 GLU GLU A . n 
A 1 196 LEU 196 418 418 LEU LEU A . n 
A 1 197 TYR 197 419 419 TYR TYR A . n 
A 1 198 LEU 198 420 420 LEU LEU A . n 
A 1 199 SER 199 421 421 SER SER A . n 
A 1 200 TRP 200 422 422 TRP TRP A . n 
A 1 201 VAL 201 423 423 VAL VAL A . n 
A 1 202 VAL 202 424 424 VAL VAL A . n 
A 1 203 GLU 203 425 425 GLU GLU A . n 
A 1 204 ALA 204 426 426 ALA ALA A . n 
A 1 205 ARG 205 427 427 ARG ARG A . n 
A 1 206 ARG 206 428 428 ARG ARG A . n 
A 1 207 HIS 207 429 429 HIS HIS A . n 
A 1 208 ILE 208 430 430 ILE ILE A . n 
A 1 209 LEU 209 431 431 LEU LEU A . n 
A 1 210 ALA 210 432 432 ALA ALA A . n 
A 1 211 ILE 211 433 433 ILE ILE A . n 
A 1 212 LEU 212 434 434 LEU LEU A . n 
A 1 213 GLN 213 435 435 GLN GLN A . n 
A 1 214 ASP 214 436 436 ASP ASP A . n 
A 1 215 CYS 215 437 437 CYS CYS A . n 
A 1 216 PRO 216 438 438 PRO PRO A . n 
A 1 217 SER 217 439 439 SER SER A . n 
A 1 218 LEU 218 440 440 LEU LEU A . n 
A 1 219 ARG 219 441 441 ARG ARG A . n 
A 1 220 PRO 220 442 442 PRO PRO A . n 
A 1 221 PRO 221 443 443 PRO PRO A . n 
A 1 222 ILE 222 444 444 ILE ILE A . n 
A 1 223 ASP 223 445 445 ASP ASP A . n 
A 1 224 HIS 224 446 446 HIS HIS A . n 
A 1 225 LEU 225 447 447 LEU LEU A . n 
A 1 226 CYS 226 448 448 CYS CYS A . n 
A 1 227 GLU 227 449 449 GLU GLU A . n 
A 1 228 LEU 228 450 450 LEU LEU A . n 
A 1 229 LEU 229 451 451 LEU LEU A . n 
A 1 230 PRO 230 452 452 PRO PRO A . n 
A 1 231 ARG 231 453 453 ARG ARG A . n 
A 1 232 LEU 232 454 454 LEU LEU A . n 
A 1 233 GLN 233 455 455 GLN GLN A . n 
A 1 234 ALA 234 456 456 ALA ALA A . n 
A 1 235 ARG 235 457 457 ARG ARG A . n 
A 1 236 TYR 236 458 458 TYR TYR A . n 
A 1 237 TYR 237 459 459 TYR TYR A . n 
A 1 238 SER 238 460 460 SER SER A . n 
A 1 239 ILE 239 461 461 ILE ILE A . n 
A 1 240 ALA 240 462 462 ALA ALA A . n 
A 1 241 SER 241 463 463 SER SER A . n 
A 1 242 SER 242 464 464 SER SER A . n 
A 1 243 SER 243 465 465 SER SER A . n 
A 1 244 LYS 244 466 466 LYS LYS A . n 
A 1 245 VAL 245 467 467 VAL VAL A . n 
A 1 246 HIS 246 468 468 HIS HIS A . n 
A 1 247 PRO 247 469 469 PRO PRO A . n 
A 1 248 ASN 248 470 470 ASN ASN A . n 
A 1 249 SER 249 471 471 SER SER A . n 
A 1 250 VAL 250 472 472 VAL VAL A . n 
A 1 251 HIS 251 473 473 HIS HIS A . n 
A 1 252 ILE 252 474 474 ILE ILE A . n 
A 1 253 CYS 253 475 475 CYS CYS A . n 
A 1 254 ALA 254 476 476 ALA ALA A . n 
A 1 255 VAL 255 477 477 VAL VAL A . n 
A 1 256 VAL 256 478 478 VAL VAL A . n 
A 1 257 VAL 257 479 479 VAL VAL A . n 
A 1 258 GLU 258 480 480 GLU GLU A . n 
A 1 259 TYR 259 481 481 TYR TYR A . n 
A 1 260 GLU 260 482 482 GLU GLU A . n 
A 1 261 THR 261 483 483 THR THR A . n 
A 1 262 LYS 262 484 484 LYS LYS A . n 
A 1 263 ALA 263 485 485 ALA ALA A . n 
A 1 264 GLY 264 486 486 GLY GLY A . n 
A 1 265 ARG 265 487 487 ARG ARG A . n 
A 1 266 ILE 266 488 488 ILE ILE A . n 
A 1 267 ASN 267 489 489 ASN ASN A . n 
A 1 268 LYS 268 490 490 LYS LYS A . n 
A 1 269 GLY 269 491 491 GLY GLY A . n 
A 1 270 VAL 270 492 492 VAL VAL A . n 
A 1 271 ALA 271 493 493 ALA ALA A . n 
A 1 272 THR 272 494 494 THR THR A . n 
A 1 273 ASN 273 495 495 ASN ASN A . n 
A 1 274 TRP 274 496 496 TRP TRP A . n 
A 1 275 LEU 275 497 497 LEU LEU A . n 
A 1 276 ARG 276 498 498 ARG ARG A . n 
A 1 277 ALA 277 499 499 ALA ALA A . n 
A 1 278 LYS 278 500 500 LYS LYS A . n 
A 1 279 GLU 279 501 501 GLU GLU A . n 
A 1 280 PRO 280 502 502 PRO PRO A . n 
A 1 281 VAL 281 503 503 VAL VAL A . n 
A 1 282 GLY 282 504 504 GLY GLY A . n 
A 1 283 GLU 283 505 505 GLU GLU A . n 
A 1 284 ASN 284 506 506 ASN ASN A . n 
A 1 285 GLY 285 507 507 GLY GLY A . n 
A 1 286 GLY 286 508 508 GLY GLY A . n 
A 1 287 ARG 287 509 509 ARG ALA A . n 
A 1 288 ALA 288 510 510 ALA ALA A . n 
A 1 289 LEU 289 511 511 LEU LEU A . n 
A 1 290 VAL 290 512 512 VAL VAL A . n 
A 1 291 PRO 291 513 513 PRO PRO A . n 
A 1 292 MET 292 514 514 MET MET A . n 
A 1 293 PHE 293 515 515 PHE PHE A . n 
A 1 294 VAL 294 516 516 VAL VAL A . n 
A 1 295 ARG 295 517 517 ARG ARG A . n 
A 1 296 LYS 296 518 518 LYS LYS A . n 
A 1 297 SER 297 519 519 SER SER A . n 
A 1 298 GLN 298 520 520 GLN GLN A . n 
A 1 299 PHE 299 521 521 PHE PHE A . n 
A 1 300 ARG 300 522 522 ARG ARG A . n 
A 1 301 LEU 301 523 523 LEU LEU A . n 
A 1 302 PRO 302 524 524 PRO PRO A . n 
A 1 303 PHE 303 525 525 PHE PHE A . n 
A 1 304 LYS 304 526 526 LYS LYS A . n 
A 1 305 ALA 305 527 527 ALA ALA A . n 
A 1 306 THR 306 528 528 THR THR A . n 
A 1 307 THR 307 529 529 THR THR A . n 
A 1 308 PRO 308 530 530 PRO PRO A . n 
A 1 309 VAL 309 531 531 VAL VAL A . n 
A 1 310 ILE 310 532 532 ILE ILE A . n 
A 1 311 MET 311 533 533 MET MET A . n 
A 1 312 VAL 312 534 534 VAL VAL A . n 
A 1 313 GLY 313 535 535 GLY GLY A . n 
A 1 314 PRO 314 536 536 PRO PRO A . n 
A 1 315 GLY 315 537 537 GLY GLY A . n 
A 1 316 THR 316 538 538 THR THR A . n 
A 1 317 GLY 317 539 539 GLY GLY A . n 
A 1 318 VAL 318 540 540 VAL VAL A . n 
A 1 319 ALA 319 541 541 ALA ALA A . n 
A 1 320 PRO 320 542 542 PRO PRO A . n 
A 1 321 PHE 321 543 543 PHE PHE A . n 
A 1 322 ILE 322 544 544 ILE ILE A . n 
A 1 323 GLY 323 545 545 GLY GLY A . n 
A 1 324 PHE 324 546 546 PHE PHE A . n 
A 1 325 ILE 325 547 547 ILE ILE A . n 
A 1 326 GLN 326 548 548 GLN GLN A . n 
A 1 327 GLU 327 549 549 GLU GLU A . n 
A 1 328 ARG 328 550 550 ARG ARG A . n 
A 1 329 ALA 329 551 551 ALA ALA A . n 
A 1 330 TRP 330 552 552 TRP TRP A . n 
A 1 331 LEU 331 553 553 LEU LEU A . n 
A 1 332 ARG 332 554 554 ARG ARG A . n 
A 1 333 GLN 333 555 555 GLN GLN A . n 
A 1 334 GLN 334 556 556 GLN GLN A . n 
A 1 335 GLY 335 557 557 GLY GLY A . n 
A 1 336 LYS 336 558 558 LYS LYS A . n 
A 1 337 GLU 337 559 559 GLU GLU A . n 
A 1 338 VAL 338 560 560 VAL VAL A . n 
A 1 339 GLY 339 561 561 GLY GLY A . n 
A 1 340 GLU 340 562 562 GLU GLU A . n 
A 1 341 THR 341 563 563 THR THR A . n 
A 1 342 LEU 342 564 564 LEU LEU A . n 
A 1 343 LEU 343 565 565 LEU LEU A . n 
A 1 344 TYR 344 566 566 TYR TYR A . n 
A 1 345 TYR 345 567 567 TYR TYR A . n 
A 1 346 GLY 346 568 568 GLY GLY A . n 
A 1 347 CYS 347 569 569 CYS CYS A . n 
A 1 348 ARG 348 570 570 ARG ARG A . n 
A 1 349 ARG 349 571 571 ARG ARG A . n 
A 1 350 SER 350 572 572 SER SER A . n 
A 1 351 ASP 351 573 573 ASP ASP A . n 
A 1 352 GLU 352 574 574 GLU GLU A . n 
A 1 353 ASP 353 575 575 ASP ASP A . n 
A 1 354 TYR 354 576 576 TYR TYR A . n 
A 1 355 LEU 355 577 577 LEU LEU A . n 
A 1 356 TYR 356 578 578 TYR TYR A . n 
A 1 357 ARG 357 579 579 ARG ARG A . n 
A 1 358 GLU 358 580 580 GLU GLU A . n 
A 1 359 GLU 359 581 581 GLU GLU A . n 
A 1 360 LEU 360 582 582 LEU LEU A . n 
A 1 361 ALA 361 583 583 ALA ALA A . n 
A 1 362 GLN 362 584 584 GLN GLN A . n 
A 1 363 PHE 363 585 585 PHE PHE A . n 
A 1 364 HIS 364 586 586 HIS HIS A . n 
A 1 365 ARG 365 587 587 ARG ARG A . n 
A 1 366 ASP 366 588 588 ASP ASP A . n 
A 1 367 GLY 367 589 589 GLY GLY A . n 
A 1 368 ALA 368 590 590 ALA ALA A . n 
A 1 369 LEU 369 591 591 LEU LEU A . n 
A 1 370 THR 370 592 592 THR THR A . n 
A 1 371 GLN 371 593 593 GLN GLN A . n 
A 1 372 LEU 372 594 594 LEU LEU A . n 
A 1 373 ASN 373 595 595 ASN ASN A . n 
A 1 374 VAL 374 596 596 VAL VAL A . n 
A 1 375 ALA 375 597 597 ALA ALA A . n 
A 1 376 PHE 376 598 598 PHE PHE A . n 
A 1 377 SER 377 599 599 SER SER A . n 
A 1 378 ARG 378 600 600 ARG ARG A . n 
A 1 379 GLU 379 601 601 GLU GLU A . n 
A 1 380 GLN 380 602 602 GLN GLN A . n 
A 1 381 SER 381 603 603 SER SER A . n 
A 1 382 HIS 382 604 604 HIS HIS A . n 
A 1 383 LYS 383 605 605 LYS LYS A . n 
A 1 384 VAL 384 606 606 VAL VAL A . n 
A 1 385 TYR 385 607 607 TYR TYR A . n 
A 1 386 VAL 386 608 608 VAL VAL A . n 
A 1 387 GLN 387 609 609 GLN GLN A . n 
A 1 388 HIS 388 610 610 HIS HIS A . n 
A 1 389 LEU 389 611 611 LEU LEU A . n 
A 1 390 LEU 390 612 612 LEU LEU A . n 
A 1 391 LYS 391 613 613 LYS LYS A . n 
A 1 392 GLN 392 614 614 GLN GLN A . n 
A 1 393 ASP 393 615 615 ASP ASP A . n 
A 1 394 ARG 394 616 616 ARG ARG A . n 
A 1 395 GLU 395 617 617 GLU GLU A . n 
A 1 396 HIS 396 618 618 HIS HIS A . n 
A 1 397 LEU 397 619 619 LEU LEU A . n 
A 1 398 TRP 398 620 620 TRP TRP A . n 
A 1 399 LYS 399 621 621 LYS LYS A . n 
A 1 400 LEU 400 622 622 LEU LEU A . n 
A 1 401 ILE 401 623 623 ILE ILE A . n 
A 1 402 GLU 402 624 624 GLU GLU A . n 
A 1 403 GLY 403 625 625 GLY GLY A . n 
A 1 404 GLY 404 626 626 GLY GLY A . n 
A 1 405 ALA 405 627 627 ALA ALA A . n 
A 1 406 HIS 406 628 628 HIS HIS A . n 
A 1 407 ILE 407 629 629 ILE ILE A . n 
A 1 408 TYR 408 630 630 TYR TYR A . n 
A 1 409 VAL 409 631 631 VAL VAL A . n 
A 1 410 CYS 410 632 632 CYS CYS A . n 
A 1 411 GLY 411 633 633 GLY GLY A . n 
A 1 412 ASP 412 634 634 ASP ASP A . n 
A 1 413 ALA 413 635 635 ALA ALA A . n 
A 1 414 ARG 414 636 636 ARG ARG A . n 
A 1 415 ASN 415 637 637 ASN ASN A . n 
A 1 416 MET 416 638 638 MET MET A . n 
A 1 417 ALA 417 639 639 ALA ALA A . n 
A 1 418 ARG 418 640 640 ARG ARG A . n 
A 1 419 ASP 419 641 641 ASP ASP A . n 
A 1 420 VAL 420 642 642 VAL VAL A . n 
A 1 421 GLN 421 643 643 GLN GLN A . n 
A 1 422 ASN 422 644 644 ASN ASN A . n 
A 1 423 THR 423 645 645 THR THR A . n 
A 1 424 PHE 424 646 646 PHE PHE A . n 
A 1 425 TYR 425 647 647 TYR TYR A . n 
A 1 426 ASP 426 648 648 ASP ASP A . n 
A 1 427 ILE 427 649 649 ILE ILE A . n 
A 1 428 VAL 428 650 650 VAL VAL A . n 
A 1 429 ALA 429 651 651 ALA ALA A . n 
A 1 430 GLU 430 652 652 GLU GLU A . n 
A 1 431 LEU 431 653 653 LEU LEU A . n 
A 1 432 GLY 432 654 654 GLY GLY A . n 
A 1 433 ALA 433 655 655 ALA ALA A . n 
A 1 434 MET 434 656 656 MET MET A . n 
A 1 435 GLU 435 657 657 GLU GLU A . n 
A 1 436 HIS 436 658 658 HIS HIS A . n 
A 1 437 ALA 437 659 659 ALA ALA A . n 
A 1 438 GLN 438 660 660 GLN GLN A . n 
A 1 439 ALA 439 661 661 ALA ALA A . n 
A 1 440 VAL 440 662 662 VAL VAL A . n 
A 1 441 ASP 441 663 663 ASP ASP A . n 
A 1 442 TYR 442 664 664 TYR TYR A . n 
A 1 443 ILE 443 665 665 ILE ILE A . n 
A 1 444 LYS 444 666 666 LYS LYS A . n 
A 1 445 LYS 445 667 667 LYS LYS A . n 
A 1 446 LEU 446 668 668 LEU LEU A . n 
A 1 447 MET 447 669 669 MET MET A . n 
A 1 448 THR 448 670 670 THR THR A . n 
A 1 449 LYS 449 671 671 LYS LYS A . n 
A 1 450 GLY 450 672 672 GLY GLY A . n 
A 1 451 ARG 451 673 673 ARG ARG A . n 
A 1 452 TYR 452 674 674 TYR TYR A . n 
A 1 453 SER 453 675 675 SER SER A . n 
A 1 454 LEU 454 676 676 LEU LEU A . n 
A 1 455 ASP 455 677 677 ASP ASP A . n 
A 1 456 VAL 456 678 678 VAL VAL A . n 
A 1 457 TRP 457 679 679 TRP TRP A . n 
A 1 458 SER 458 680 680 SER SER A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-08-17 
2 'Structure model' 1 1 2011-08-24 
3 'Structure model' 1 2 2011-08-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
MOLREP   phasing           .   ? 2 
CNS      refinement        1.2 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
_pdbx_entry_details.entry_id             3QFS 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'A503V IS A NATURAL VARIANT' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLY 504 ? ? O A GLY 507 ? ? 2.07 
2 1 O A VAL 503 ? ? O A GLY 508 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 255 ? ? -141.62 59.22   
2 1 VAL A 423 ? ? -100.59 -60.41  
3 1 VAL A 503 ? ? -111.59 -96.14  
4 1 GLU A 505 ? ? -46.65  -179.79 
5 1 ASN A 506 ? ? 53.05   14.25   
6 1 GLU A 574 ? ? -123.60 -60.41  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 509 ? CG  ? A ARG 287 CG  
2  1 Y 1 A ARG 509 ? CD  ? A ARG 287 CD  
3  1 Y 1 A ARG 509 ? NE  ? A ARG 287 NE  
4  1 Y 1 A ARG 509 ? CZ  ? A ARG 287 CZ  
5  1 Y 1 A ARG 509 ? NH1 ? A ARG 287 NH1 
6  1 Y 1 A ARG 509 ? NH2 ? A ARG 287 NH2 
7  1 N 1 A NAP 753 ? C5D ? C NAP 1   C5D 
8  1 N 1 A NAP 753 ? C4D ? C NAP 1   C4D 
9  1 N 1 A NAP 753 ? O4D ? C NAP 1   O4D 
10 1 N 1 A NAP 753 ? C3D ? C NAP 1   C3D 
11 1 N 1 A NAP 753 ? O3D ? C NAP 1   O3D 
12 1 N 1 A NAP 753 ? C2D ? C NAP 1   C2D 
13 1 N 1 A NAP 753 ? O2D ? C NAP 1   O2D 
14 1 N 1 A NAP 753 ? C1D ? C NAP 1   C1D 
15 1 N 1 A NAP 753 ? N1N ? C NAP 1   N1N 
16 1 N 1 A NAP 753 ? C2N ? C NAP 1   C2N 
17 1 N 1 A NAP 753 ? C3N ? C NAP 1   C3N 
18 1 N 1 A NAP 753 ? C7N ? C NAP 1   C7N 
19 1 N 1 A NAP 753 ? O7N ? C NAP 1   O7N 
20 1 N 1 A NAP 753 ? N7N ? C NAP 1   N7N 
21 1 N 1 A NAP 753 ? C4N ? C NAP 1   C4N 
22 1 N 1 A NAP 753 ? C5N ? C NAP 1   C5N 
23 1 N 1 A NAP 753 ? C6N ? C NAP 1   C6N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 223 ? A MET 1  
2  1 Y 1 A GLY 224 ? A GLY 2  
3  1 Y 1 A SER 225 ? A SER 3  
4  1 Y 1 A SER 226 ? A SER 4  
5  1 Y 1 A HIS 227 ? A HIS 5  
6  1 Y 1 A HIS 228 ? A HIS 6  
7  1 Y 1 A HIS 229 ? A HIS 7  
8  1 Y 1 A HIS 230 ? A HIS 8  
9  1 Y 1 A HIS 231 ? A HIS 9  
10 1 Y 1 A HIS 232 ? A HIS 10 
11 1 Y 1 A SER 233 ? A SER 11 
12 1 Y 1 A SER 234 ? A SER 12 
13 1 Y 1 A GLY 235 ? A GLY 13 
14 1 Y 1 A LEU 236 ? A LEU 14 
15 1 Y 1 A VAL 237 ? A VAL 15 
16 1 Y 1 A PRO 238 ? A PRO 16 
17 1 Y 1 A ARG 239 ? A ARG 17 
18 1 Y 1 A GLY 240 ? A GLY 18 
19 1 Y 1 A SER 241 ? A SER 19 
20 1 Y 1 A HIS 242 ? A HIS 20 
21 1 Y 1 A MET 243 ? A MET 21 
22 1 Y 1 A SER 244 ? A SER 22 
23 1 Y 1 A ILE 245 ? A ILE 23 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FLAVIN-ADENINE DINUCLEOTIDE'                      FAD 
3 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 
4 water                                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FAD 1   752 752 FAD FAD A . 
C 3 NAP 1   753 753 NAP NAP A . 
D 4 HOH 1   1   1   HOH WAT A . 
D 4 HOH 2   2   2   HOH WAT A . 
D 4 HOH 3   3   3   HOH WAT A . 
D 4 HOH 4   4   4   HOH WAT A . 
D 4 HOH 5   5   5   HOH WAT A . 
D 4 HOH 6   6   6   HOH WAT A . 
D 4 HOH 7   7   7   HOH WAT A . 
D 4 HOH 8   8   8   HOH WAT A . 
D 4 HOH 9   9   9   HOH WAT A . 
D 4 HOH 10  10  10  HOH WAT A . 
D 4 HOH 11  11  11  HOH WAT A . 
D 4 HOH 12  12  12  HOH WAT A . 
D 4 HOH 13  13  13  HOH WAT A . 
D 4 HOH 14  14  14  HOH WAT A . 
D 4 HOH 15  15  15  HOH WAT A . 
D 4 HOH 16  16  16  HOH WAT A . 
D 4 HOH 17  17  17  HOH WAT A . 
D 4 HOH 18  18  18  HOH WAT A . 
D 4 HOH 19  19  19  HOH WAT A . 
D 4 HOH 20  20  20  HOH WAT A . 
D 4 HOH 21  21  21  HOH WAT A . 
D 4 HOH 22  22  22  HOH WAT A . 
D 4 HOH 23  23  23  HOH WAT A . 
D 4 HOH 24  24  24  HOH WAT A . 
D 4 HOH 25  25  25  HOH WAT A . 
D 4 HOH 26  26  26  HOH WAT A . 
D 4 HOH 27  27  27  HOH WAT A . 
D 4 HOH 28  28  28  HOH WAT A . 
D 4 HOH 29  29  29  HOH WAT A . 
D 4 HOH 30  30  30  HOH WAT A . 
D 4 HOH 31  31  31  HOH WAT A . 
D 4 HOH 32  32  32  HOH WAT A . 
D 4 HOH 33  33  33  HOH WAT A . 
D 4 HOH 34  34  34  HOH WAT A . 
D 4 HOH 35  35  35  HOH WAT A . 
D 4 HOH 36  36  36  HOH WAT A . 
D 4 HOH 37  37  37  HOH WAT A . 
D 4 HOH 38  38  38  HOH WAT A . 
D 4 HOH 39  39  39  HOH WAT A . 
D 4 HOH 40  40  40  HOH WAT A . 
D 4 HOH 41  41  41  HOH WAT A . 
D 4 HOH 42  42  42  HOH WAT A . 
D 4 HOH 43  43  43  HOH WAT A . 
D 4 HOH 44  44  44  HOH WAT A . 
D 4 HOH 45  45  45  HOH WAT A . 
D 4 HOH 46  46  46  HOH WAT A . 
D 4 HOH 47  47  47  HOH WAT A . 
D 4 HOH 48  48  48  HOH WAT A . 
D 4 HOH 49  49  49  HOH WAT A . 
D 4 HOH 50  50  50  HOH WAT A . 
D 4 HOH 51  51  51  HOH WAT A . 
D 4 HOH 52  52  52  HOH WAT A . 
D 4 HOH 53  53  53  HOH WAT A . 
D 4 HOH 54  54  54  HOH WAT A . 
D 4 HOH 55  55  55  HOH WAT A . 
D 4 HOH 56  56  56  HOH WAT A . 
D 4 HOH 57  57  57  HOH WAT A . 
D 4 HOH 58  58  58  HOH WAT A . 
D 4 HOH 59  59  59  HOH WAT A . 
D 4 HOH 60  60  60  HOH WAT A . 
D 4 HOH 61  61  61  HOH WAT A . 
D 4 HOH 62  62  62  HOH WAT A . 
D 4 HOH 63  63  63  HOH WAT A . 
D 4 HOH 64  64  64  HOH WAT A . 
D 4 HOH 65  65  65  HOH WAT A . 
D 4 HOH 66  66  66  HOH WAT A . 
D 4 HOH 67  67  67  HOH WAT A . 
D 4 HOH 68  68  68  HOH WAT A . 
D 4 HOH 69  69  69  HOH WAT A . 
D 4 HOH 70  70  70  HOH WAT A . 
D 4 HOH 71  71  71  HOH WAT A . 
D 4 HOH 72  72  72  HOH WAT A . 
D 4 HOH 73  73  73  HOH WAT A . 
D 4 HOH 74  74  74  HOH WAT A . 
D 4 HOH 75  75  75  HOH WAT A . 
D 4 HOH 76  76  76  HOH WAT A . 
D 4 HOH 77  77  77  HOH WAT A . 
D 4 HOH 78  78  78  HOH WAT A . 
D 4 HOH 79  79  79  HOH WAT A . 
D 4 HOH 80  80  80  HOH WAT A . 
D 4 HOH 81  81  81  HOH WAT A . 
D 4 HOH 82  82  82  HOH WAT A . 
D 4 HOH 83  83  83  HOH WAT A . 
D 4 HOH 84  84  84  HOH WAT A . 
D 4 HOH 85  85  85  HOH WAT A . 
D 4 HOH 86  86  86  HOH WAT A . 
D 4 HOH 87  87  87  HOH WAT A . 
D 4 HOH 88  88  88  HOH WAT A . 
D 4 HOH 89  89  89  HOH WAT A . 
D 4 HOH 90  90  90  HOH WAT A . 
D 4 HOH 91  91  91  HOH WAT A . 
D 4 HOH 92  92  92  HOH WAT A . 
D 4 HOH 93  93  93  HOH WAT A . 
D 4 HOH 94  94  94  HOH WAT A . 
D 4 HOH 95  95  95  HOH WAT A . 
D 4 HOH 96  96  96  HOH WAT A . 
D 4 HOH 97  97  97  HOH WAT A . 
D 4 HOH 98  98  98  HOH WAT A . 
D 4 HOH 99  99  99  HOH WAT A . 
D 4 HOH 100 100 100 HOH WAT A . 
D 4 HOH 101 101 101 HOH WAT A . 
D 4 HOH 102 102 102 HOH WAT A . 
D 4 HOH 103 103 103 HOH WAT A . 
D 4 HOH 104 104 104 HOH WAT A . 
D 4 HOH 105 105 105 HOH WAT A . 
D 4 HOH 106 106 106 HOH WAT A . 
D 4 HOH 107 107 107 HOH WAT A . 
D 4 HOH 108 108 108 HOH WAT A . 
D 4 HOH 109 109 109 HOH WAT A . 
D 4 HOH 110 110 110 HOH WAT A . 
D 4 HOH 111 111 111 HOH WAT A . 
D 4 HOH 112 112 112 HOH WAT A . 
D 4 HOH 113 113 113 HOH WAT A . 
D 4 HOH 114 114 114 HOH WAT A . 
D 4 HOH 115 115 115 HOH WAT A . 
D 4 HOH 116 116 116 HOH WAT A . 
D 4 HOH 117 117 117 HOH WAT A . 
D 4 HOH 118 118 118 HOH WAT A . 
D 4 HOH 119 119 119 HOH WAT A . 
D 4 HOH 120 120 120 HOH WAT A . 
D 4 HOH 121 121 121 HOH WAT A . 
D 4 HOH 122 122 122 HOH WAT A . 
D 4 HOH 123 123 123 HOH WAT A . 
D 4 HOH 124 124 124 HOH WAT A . 
D 4 HOH 125 125 125 HOH WAT A . 
D 4 HOH 126 126 126 HOH WAT A . 
D 4 HOH 127 127 127 HOH WAT A . 
D 4 HOH 128 128 128 HOH WAT A . 
D 4 HOH 129 129 129 HOH WAT A . 
D 4 HOH 130 130 130 HOH WAT A . 
D 4 HOH 131 131 131 HOH WAT A . 
D 4 HOH 132 132 132 HOH WAT A . 
D 4 HOH 133 133 133 HOH WAT A . 
D 4 HOH 134 134 134 HOH WAT A . 
D 4 HOH 135 135 135 HOH WAT A . 
D 4 HOH 136 136 136 HOH WAT A . 
D 4 HOH 137 137 137 HOH WAT A . 
D 4 HOH 138 138 138 HOH WAT A . 
D 4 HOH 139 139 139 HOH WAT A . 
D 4 HOH 140 140 140 HOH WAT A . 
D 4 HOH 141 141 141 HOH WAT A . 
D 4 HOH 142 142 142 HOH WAT A . 
D 4 HOH 143 143 143 HOH WAT A . 
D 4 HOH 144 144 144 HOH WAT A . 
D 4 HOH 145 145 145 HOH WAT A . 
D 4 HOH 146 146 146 HOH WAT A . 
D 4 HOH 147 147 147 HOH WAT A . 
D 4 HOH 148 148 148 HOH WAT A . 
D 4 HOH 149 149 149 HOH WAT A . 
D 4 HOH 150 150 150 HOH WAT A . 
D 4 HOH 151 151 151 HOH WAT A . 
D 4 HOH 152 152 152 HOH WAT A . 
D 4 HOH 153 153 153 HOH WAT A . 
D 4 HOH 154 154 154 HOH WAT A . 
D 4 HOH 155 155 155 HOH WAT A . 
D 4 HOH 156 156 156 HOH WAT A . 
D 4 HOH 157 157 157 HOH WAT A . 
D 4 HOH 158 158 158 HOH WAT A . 
D 4 HOH 159 159 159 HOH WAT A . 
D 4 HOH 160 160 160 HOH WAT A . 
D 4 HOH 161 161 161 HOH WAT A . 
D 4 HOH 162 162 162 HOH WAT A . 
D 4 HOH 163 163 163 HOH WAT A . 
D 4 HOH 164 164 164 HOH WAT A . 
D 4 HOH 165 165 165 HOH WAT A . 
D 4 HOH 166 166 166 HOH WAT A . 
D 4 HOH 167 167 167 HOH WAT A . 
D 4 HOH 168 168 168 HOH WAT A . 
D 4 HOH 169 169 169 HOH WAT A . 
D 4 HOH 170 170 170 HOH WAT A . 
D 4 HOH 171 171 171 HOH WAT A . 
D 4 HOH 172 172 172 HOH WAT A . 
D 4 HOH 173 173 173 HOH WAT A . 
D 4 HOH 174 174 174 HOH WAT A . 
D 4 HOH 175 175 175 HOH WAT A . 
D 4 HOH 176 176 176 HOH WAT A . 
D 4 HOH 177 177 177 HOH WAT A . 
D 4 HOH 178 178 178 HOH WAT A . 
D 4 HOH 179 179 179 HOH WAT A . 
D 4 HOH 180 180 180 HOH WAT A . 
D 4 HOH 181 181 181 HOH WAT A . 
D 4 HOH 182 182 182 HOH WAT A . 
D 4 HOH 183 183 183 HOH WAT A . 
D 4 HOH 184 184 184 HOH WAT A . 
D 4 HOH 185 185 185 HOH WAT A . 
D 4 HOH 186 186 186 HOH WAT A . 
D 4 HOH 187 187 187 HOH WAT A . 
D 4 HOH 188 188 188 HOH WAT A . 
D 4 HOH 189 189 189 HOH WAT A . 
D 4 HOH 190 190 190 HOH WAT A . 
D 4 HOH 191 191 191 HOH WAT A . 
D 4 HOH 192 192 192 HOH WAT A . 
D 4 HOH 193 193 193 HOH WAT A . 
D 4 HOH 194 194 194 HOH WAT A . 
D 4 HOH 195 195 195 HOH WAT A . 
D 4 HOH 196 196 196 HOH WAT A . 
D 4 HOH 197 197 197 HOH WAT A . 
D 4 HOH 198 198 198 HOH WAT A . 
D 4 HOH 199 199 199 HOH WAT A . 
D 4 HOH 200 200 200 HOH WAT A . 
D 4 HOH 201 201 201 HOH WAT A . 
D 4 HOH 202 202 202 HOH WAT A . 
D 4 HOH 203 203 203 HOH WAT A . 
D 4 HOH 204 204 204 HOH WAT A . 
D 4 HOH 205 205 205 HOH WAT A . 
D 4 HOH 206 206 206 HOH WAT A . 
D 4 HOH 207 207 207 HOH WAT A . 
D 4 HOH 208 208 208 HOH WAT A . 
D 4 HOH 209 209 209 HOH WAT A . 
D 4 HOH 210 210 210 HOH WAT A . 
D 4 HOH 211 211 211 HOH WAT A . 
D 4 HOH 212 212 212 HOH WAT A . 
D 4 HOH 213 213 213 HOH WAT A . 
D 4 HOH 214 214 214 HOH WAT A . 
D 4 HOH 215 215 215 HOH WAT A . 
D 4 HOH 216 216 216 HOH WAT A . 
D 4 HOH 217 217 217 HOH WAT A . 
D 4 HOH 218 218 218 HOH WAT A . 
D 4 HOH 219 219 219 HOH WAT A . 
D 4 HOH 220 220 220 HOH WAT A . 
D 4 HOH 221 221 221 HOH WAT A . 
D 4 HOH 222 222 222 HOH WAT A . 
D 4 HOH 223 681 223 HOH WAT A . 
D 4 HOH 224 682 224 HOH WAT A . 
D 4 HOH 225 683 225 HOH WAT A . 
D 4 HOH 226 684 226 HOH WAT A . 
D 4 HOH 227 685 227 HOH WAT A . 
D 4 HOH 228 686 228 HOH WAT A . 
D 4 HOH 229 687 229 HOH WAT A . 
D 4 HOH 230 688 230 HOH WAT A . 
D 4 HOH 231 689 231 HOH WAT A . 
D 4 HOH 232 690 232 HOH WAT A . 
D 4 HOH 233 691 233 HOH WAT A . 
D 4 HOH 234 692 234 HOH WAT A . 
D 4 HOH 235 693 235 HOH WAT A . 
D 4 HOH 236 694 236 HOH WAT A . 
D 4 HOH 237 695 237 HOH WAT A . 
D 4 HOH 238 696 238 HOH WAT A . 
D 4 HOH 239 697 239 HOH WAT A . 
D 4 HOH 240 698 240 HOH WAT A . 
D 4 HOH 241 699 241 HOH WAT A . 
D 4 HOH 242 700 242 HOH WAT A . 
D 4 HOH 243 701 243 HOH WAT A . 
D 4 HOH 244 702 244 HOH WAT A . 
D 4 HOH 245 703 245 HOH WAT A . 
D 4 HOH 246 704 246 HOH WAT A . 
D 4 HOH 247 705 247 HOH WAT A . 
D 4 HOH 248 706 248 HOH WAT A . 
D 4 HOH 249 707 249 HOH WAT A . 
D 4 HOH 250 708 250 HOH WAT A . 
D 4 HOH 251 709 251 HOH WAT A . 
D 4 HOH 252 710 252 HOH WAT A . 
D 4 HOH 253 711 253 HOH WAT A . 
D 4 HOH 254 712 254 HOH WAT A . 
D 4 HOH 255 713 255 HOH WAT A . 
D 4 HOH 256 714 256 HOH WAT A . 
D 4 HOH 257 715 257 HOH WAT A . 
D 4 HOH 258 716 258 HOH WAT A . 
D 4 HOH 259 717 259 HOH WAT A . 
D 4 HOH 260 718 260 HOH WAT A . 
D 4 HOH 261 719 261 HOH WAT A . 
D 4 HOH 262 720 262 HOH WAT A . 
D 4 HOH 263 721 263 HOH WAT A . 
D 4 HOH 264 722 264 HOH WAT A . 
D 4 HOH 265 723 265 HOH WAT A . 
D 4 HOH 266 724 266 HOH WAT A . 
D 4 HOH 267 725 267 HOH WAT A . 
D 4 HOH 268 726 268 HOH WAT A . 
D 4 HOH 269 727 269 HOH WAT A . 
D 4 HOH 270 728 270 HOH WAT A . 
D 4 HOH 271 729 271 HOH WAT A . 
D 4 HOH 272 730 272 HOH WAT A . 
D 4 HOH 273 731 273 HOH WAT A . 
D 4 HOH 274 732 274 HOH WAT A . 
D 4 HOH 275 733 275 HOH WAT A . 
D 4 HOH 276 734 276 HOH WAT A . 
D 4 HOH 277 735 277 HOH WAT A . 
D 4 HOH 278 736 278 HOH WAT A . 
D 4 HOH 279 737 279 HOH WAT A . 
D 4 HOH 280 738 280 HOH WAT A . 
D 4 HOH 281 739 281 HOH WAT A . 
D 4 HOH 282 740 282 HOH WAT A . 
D 4 HOH 283 741 283 HOH WAT A . 
D 4 HOH 284 742 284 HOH WAT A . 
D 4 HOH 285 743 285 HOH WAT A . 
D 4 HOH 286 744 286 HOH WAT A . 
D 4 HOH 287 745 287 HOH WAT A . 
D 4 HOH 288 746 288 HOH WAT A . 
D 4 HOH 289 747 289 HOH WAT A . 
D 4 HOH 290 748 290 HOH WAT A . 
D 4 HOH 291 749 291 HOH WAT A . 
D 4 HOH 292 750 292 HOH WAT A . 
D 4 HOH 293 751 293 HOH WAT A . 
D 4 HOH 294 754 294 HOH WAT A . 
D 4 HOH 295 755 295 HOH WAT A . 
D 4 HOH 296 756 296 HOH WAT A . 
D 4 HOH 297 757 297 HOH WAT A . 
D 4 HOH 298 758 298 HOH WAT A . 
D 4 HOH 299 759 299 HOH WAT A . 
D 4 HOH 300 760 300 HOH WAT A . 
D 4 HOH 301 761 301 HOH WAT A . 
D 4 HOH 302 762 302 HOH WAT A . 
D 4 HOH 303 763 303 HOH WAT A . 
D 4 HOH 304 764 304 HOH WAT A . 
D 4 HOH 305 765 305 HOH WAT A . 
D 4 HOH 306 766 306 HOH WAT A . 
D 4 HOH 307 767 307 HOH WAT A . 
D 4 HOH 308 768 308 HOH WAT A . 
D 4 HOH 309 769 309 HOH WAT A . 
D 4 HOH 310 770 310 HOH WAT A . 
D 4 HOH 311 771 311 HOH WAT A . 
D 4 HOH 312 772 312 HOH WAT A . 
D 4 HOH 313 773 313 HOH WAT A . 
D 4 HOH 314 774 314 HOH WAT A . 
D 4 HOH 315 775 315 HOH WAT A . 
D 4 HOH 316 776 316 HOH WAT A . 
D 4 HOH 317 777 317 HOH WAT A . 
D 4 HOH 318 778 318 HOH WAT A . 
D 4 HOH 319 779 319 HOH WAT A . 
D 4 HOH 320 780 320 HOH WAT A . 
D 4 HOH 321 781 321 HOH WAT A . 
D 4 HOH 322 782 322 HOH WAT A . 
D 4 HOH 323 783 323 HOH WAT A . 
D 4 HOH 324 784 324 HOH WAT A . 
D 4 HOH 325 785 325 HOH WAT A . 
D 4 HOH 326 786 326 HOH WAT A . 
D 4 HOH 327 787 327 HOH WAT A . 
D 4 HOH 328 788 328 HOH WAT A . 
D 4 HOH 329 789 329 HOH WAT A . 
D 4 HOH 330 790 330 HOH WAT A . 
D 4 HOH 331 791 331 HOH WAT A . 
D 4 HOH 332 792 332 HOH WAT A . 
D 4 HOH 333 793 333 HOH WAT A . 
D 4 HOH 334 794 334 HOH WAT A . 
D 4 HOH 335 795 335 HOH WAT A . 
D 4 HOH 336 796 336 HOH WAT A . 
D 4 HOH 337 797 337 HOH WAT A . 
D 4 HOH 338 798 338 HOH WAT A . 
D 4 HOH 339 799 339 HOH WAT A . 
D 4 HOH 340 800 340 HOH WAT A . 
D 4 HOH 341 801 341 HOH WAT A . 
D 4 HOH 342 802 342 HOH WAT A . 
D 4 HOH 343 803 343 HOH WAT A . 
D 4 HOH 344 804 344 HOH WAT A . 
D 4 HOH 345 805 345 HOH WAT A . 
D 4 HOH 346 806 346 HOH WAT A . 
D 4 HOH 347 807 347 HOH WAT A . 
D 4 HOH 348 808 348 HOH WAT A . 
D 4 HOH 349 809 349 HOH WAT A . 
D 4 HOH 350 810 350 HOH WAT A . 
D 4 HOH 351 811 351 HOH WAT A . 
D 4 HOH 352 812 352 HOH WAT A . 
D 4 HOH 353 813 353 HOH WAT A . 
D 4 HOH 354 814 354 HOH WAT A . 
D 4 HOH 355 815 355 HOH WAT A . 
D 4 HOH 356 816 356 HOH WAT A . 
D 4 HOH 357 817 357 HOH WAT A . 
D 4 HOH 358 818 358 HOH WAT A . 
D 4 HOH 359 819 359 HOH WAT A . 
D 4 HOH 360 820 360 HOH WAT A . 
D 4 HOH 361 821 361 HOH WAT A . 
D 4 HOH 362 822 362 HOH WAT A . 
D 4 HOH 363 823 363 HOH WAT A . 
D 4 HOH 364 824 364 HOH WAT A . 
D 4 HOH 365 825 365 HOH WAT A . 
D 4 HOH 366 826 366 HOH WAT A . 
D 4 HOH 367 827 367 HOH WAT A . 
D 4 HOH 368 828 368 HOH WAT A . 
D 4 HOH 369 829 369 HOH WAT A . 
D 4 HOH 370 830 370 HOH WAT A . 
D 4 HOH 371 831 371 HOH WAT A . 
D 4 HOH 372 832 372 HOH WAT A . 
D 4 HOH 373 833 373 HOH WAT A . 
D 4 HOH 374 834 374 HOH WAT A . 
D 4 HOH 375 835 375 HOH WAT A . 
D 4 HOH 376 836 376 HOH WAT A . 
D 4 HOH 377 837 377 HOH WAT A . 
D 4 HOH 378 838 378 HOH WAT A . 
D 4 HOH 379 839 379 HOH WAT A . 
D 4 HOH 380 840 380 HOH WAT A . 
D 4 HOH 381 841 381 HOH WAT A . 
D 4 HOH 382 842 382 HOH WAT A . 
D 4 HOH 383 843 383 HOH WAT A . 
D 4 HOH 384 844 384 HOH WAT A . 
D 4 HOH 385 845 385 HOH WAT A . 
D 4 HOH 386 846 386 HOH WAT A . 
D 4 HOH 387 847 387 HOH WAT A . 
D 4 HOH 388 848 388 HOH WAT A . 
D 4 HOH 389 849 389 HOH WAT A . 
D 4 HOH 390 850 390 HOH WAT A . 
D 4 HOH 391 851 391 HOH WAT A . 
D 4 HOH 392 852 392 HOH WAT A . 
D 4 HOH 393 853 393 HOH WAT A . 
D 4 HOH 394 854 394 HOH WAT A . 
D 4 HOH 395 855 395 HOH WAT A . 
D 4 HOH 396 856 396 HOH WAT A . 
D 4 HOH 397 857 397 HOH WAT A . 
D 4 HOH 398 858 398 HOH WAT A . 
D 4 HOH 399 859 399 HOH WAT A . 
D 4 HOH 400 860 400 HOH WAT A . 
D 4 HOH 401 861 401 HOH WAT A . 
D 4 HOH 402 862 402 HOH WAT A . 
D 4 HOH 403 863 403 HOH WAT A . 
D 4 HOH 404 864 404 HOH WAT A . 
D 4 HOH 405 865 405 HOH WAT A . 
D 4 HOH 406 866 406 HOH WAT A . 
D 4 HOH 407 867 407 HOH WAT A . 
D 4 HOH 408 868 408 HOH WAT A . 
D 4 HOH 409 869 409 HOH WAT A . 
D 4 HOH 410 870 410 HOH WAT A . 
D 4 HOH 411 871 411 HOH WAT A . 
D 4 HOH 412 872 412 HOH WAT A . 
D 4 HOH 413 873 413 HOH WAT A . 
D 4 HOH 414 874 414 HOH WAT A . 
D 4 HOH 415 875 415 HOH WAT A . 
D 4 HOH 416 876 416 HOH WAT A . 
D 4 HOH 417 877 417 HOH WAT A . 
D 4 HOH 418 878 418 HOH WAT A . 
D 4 HOH 419 879 419 HOH WAT A . 
D 4 HOH 420 880 420 HOH WAT A . 
D 4 HOH 421 881 421 HOH WAT A . 
D 4 HOH 422 882 422 HOH WAT A . 
D 4 HOH 423 883 423 HOH WAT A . 
D 4 HOH 424 884 424 HOH WAT A . 
#