data_3QI2
# 
_entry.id   3QI2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QI2         
RCSB  RCSB063671   
WWPDB D_1000063671 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QE0 'Galpha-i1 G42R bound to KB752'                                              unspecified 
PDB 2OM2 'Galpha-i1 wildtype bound to RGS14 GoLoco'                                   unspecified 
PDB 1kjy 'Galpha-i1 wildtype bound to RGS14 GoLoco'                                   unspecified 
PDB 1Y3A 'wildtype Galpha-i1 bound to the GDP-selective phage display peptide KB-752' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QI2 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bosch, D.E.'      1 
'Willard, F.S.'    2 
'Kimple, A.J.'     3 
'Miley, M.J.'      4 
'Siderovski, D.P.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;A P-loop Mutation in Galpha Subunits Prevents Transition to the Active State: Implications for G-protein Signaling in Fungal Pathogenesis
;
'Plos Pathog.' 8   e1002553 e1002553 2012 ?      US 1553-7366 ?    ? 22383884 10.1371/journal.ppat.1002553 
1       'Structure-based protocol for identifying mutations that enhance protein-protein binding affinities.' J.Mol.Biol.    371 
1392     1404     2007 JMOBAK UK 0022-2836 0070 ? 17603074 10.1016/j.jmb.2007.05.096    
2       'Structural determinants for GoLoco-induced inhibition of nucleotide release by Galpha subunits.' Nature         416 878 
881      2002 NATUAS UK 0028-0836 0006 ? 11976690 10.1038/416878a              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bosch, D.E.'      1  
primary 'Willard, F.S.'    2  
primary 'Ramanujam, R.'    3  
primary 'Kimple, A.J.'     4  
primary 'Willard, M.D.'    5  
primary 'Naqvi, N.I.'      6  
primary 'Siderovski, D.P.' 7  
1       'Sammond, D.W.'    8  
1       'Eletr, Z.M.'      9  
1       'Purbeck, C.'      10 
1       'Kimple, R.J.'     11 
1       'Siderovski, D.P.' 12 
1       'Kuhlman, B.'      13 
2       'Kimple, R.J.'     14 
2       'Kimple, M.E.'     15 
2       'Betts, L.'        16 
2       'Sondek, J.'       17 
2       'Siderovski, D.P.' 18 
# 
_cell.entry_id           3QI2 
_cell.length_a           70.003 
_cell.length_b           131.018 
_cell.length_c           203.307 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QI2 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(i) subunit alpha-1' 37531.750 2  3.6.5.1 G42R 
'alpha-i1 subunit, residues 31-354'      ? 
2 polymer     syn 'Regulator of G-protein signaling 14'                     4093.621  2  ?       ?    
'GoLoco motif peptide, residues 497-532' ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                                443.201   2  ?       ?    ? ? 
4 non-polymer syn 'SULFATE ION'                                             96.063    2  ?       ?    ? ? 
5 non-polymer syn GLYCEROL                                                  92.094    1  ?       ?    ? ? 
6 water       nat water                                                     18.015    37 ?       ?    ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Adenylate cyclase-inhibiting G alpha protein' 
2 RGS14                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNAGAREVKLLLLGARESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQ
LFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVE
THFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL
FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKN
NLKDCGLF
;
;SNAGAREVKLLLLGARESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQ
LFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVE
THFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL
FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKN
NLKDCGLF
;
A,B ? 
2 'polypeptide(L)' no no DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  LEU n 
1 12  LEU n 
1 13  LEU n 
1 14  GLY n 
1 15  ALA n 
1 16  ARG n 
1 17  GLU n 
1 18  SER n 
1 19  GLY n 
1 20  LYS n 
1 21  SER n 
1 22  THR n 
1 23  ILE n 
1 24  VAL n 
1 25  LYS n 
1 26  GLN n 
1 27  MET n 
1 28  LYS n 
1 29  ILE n 
1 30  ILE n 
1 31  HIS n 
1 32  GLU n 
1 33  ALA n 
1 34  GLY n 
1 35  TYR n 
1 36  SER n 
1 37  GLU n 
1 38  GLU n 
1 39  GLU n 
1 40  CYS n 
1 41  LYS n 
1 42  GLN n 
1 43  TYR n 
1 44  LYS n 
1 45  ALA n 
1 46  VAL n 
1 47  VAL n 
1 48  TYR n 
1 49  SER n 
1 50  ASN n 
1 51  THR n 
1 52  ILE n 
1 53  GLN n 
1 54  SER n 
1 55  ILE n 
1 56  ILE n 
1 57  ALA n 
1 58  ILE n 
1 59  ILE n 
1 60  ARG n 
1 61  ALA n 
1 62  MET n 
1 63  GLY n 
1 64  ARG n 
1 65  LEU n 
1 66  LYS n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  GLY n 
1 71  ASP n 
1 72  SER n 
1 73  ALA n 
1 74  ARG n 
1 75  ALA n 
1 76  ASP n 
1 77  ASP n 
1 78  ALA n 
1 79  ARG n 
1 80  GLN n 
1 81  LEU n 
1 82  PHE n 
1 83  VAL n 
1 84  LEU n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  ALA n 
1 89  GLU n 
1 90  GLU n 
1 91  GLY n 
1 92  PHE n 
1 93  MET n 
1 94  THR n 
1 95  ALA n 
1 96  GLU n 
1 97  LEU n 
1 98  ALA n 
1 99  GLY n 
1 100 VAL n 
1 101 ILE n 
1 102 LYS n 
1 103 ARG n 
1 104 LEU n 
1 105 TRP n 
1 106 LYS n 
1 107 ASP n 
1 108 SER n 
1 109 GLY n 
1 110 VAL n 
1 111 GLN n 
1 112 ALA n 
1 113 CYS n 
1 114 PHE n 
1 115 ASN n 
1 116 ARG n 
1 117 SER n 
1 118 ARG n 
1 119 GLU n 
1 120 TYR n 
1 121 GLN n 
1 122 LEU n 
1 123 ASN n 
1 124 ASP n 
1 125 SER n 
1 126 ALA n 
1 127 ALA n 
1 128 TYR n 
1 129 TYR n 
1 130 LEU n 
1 131 ASN n 
1 132 ASP n 
1 133 LEU n 
1 134 ASP n 
1 135 ARG n 
1 136 ILE n 
1 137 ALA n 
1 138 GLN n 
1 139 PRO n 
1 140 ASN n 
1 141 TYR n 
1 142 ILE n 
1 143 PRO n 
1 144 THR n 
1 145 GLN n 
1 146 GLN n 
1 147 ASP n 
1 148 VAL n 
1 149 LEU n 
1 150 ARG n 
1 151 THR n 
1 152 ARG n 
1 153 VAL n 
1 154 LYS n 
1 155 THR n 
1 156 THR n 
1 157 GLY n 
1 158 ILE n 
1 159 VAL n 
1 160 GLU n 
1 161 THR n 
1 162 HIS n 
1 163 PHE n 
1 164 THR n 
1 165 PHE n 
1 166 LYS n 
1 167 ASP n 
1 168 LEU n 
1 169 HIS n 
1 170 PHE n 
1 171 LYS n 
1 172 MET n 
1 173 PHE n 
1 174 ASP n 
1 175 VAL n 
1 176 GLY n 
1 177 GLY n 
1 178 GLN n 
1 179 ARG n 
1 180 SER n 
1 181 GLU n 
1 182 ARG n 
1 183 LYS n 
1 184 LYS n 
1 185 TRP n 
1 186 ILE n 
1 187 HIS n 
1 188 CYS n 
1 189 PHE n 
1 190 GLU n 
1 191 GLY n 
1 192 VAL n 
1 193 THR n 
1 194 ALA n 
1 195 ILE n 
1 196 ILE n 
1 197 PHE n 
1 198 CYS n 
1 199 VAL n 
1 200 ALA n 
1 201 LEU n 
1 202 SER n 
1 203 ASP n 
1 204 TYR n 
1 205 ASP n 
1 206 LEU n 
1 207 VAL n 
1 208 LEU n 
1 209 ALA n 
1 210 GLU n 
1 211 ASP n 
1 212 GLU n 
1 213 GLU n 
1 214 MET n 
1 215 ASN n 
1 216 ARG n 
1 217 MET n 
1 218 HIS n 
1 219 GLU n 
1 220 SER n 
1 221 MET n 
1 222 LYS n 
1 223 LEU n 
1 224 PHE n 
1 225 ASP n 
1 226 SER n 
1 227 ILE n 
1 228 CYS n 
1 229 ASN n 
1 230 ASN n 
1 231 LYS n 
1 232 TRP n 
1 233 PHE n 
1 234 THR n 
1 235 ASP n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 ILE n 
1 240 LEU n 
1 241 PHE n 
1 242 LEU n 
1 243 ASN n 
1 244 LYS n 
1 245 LYS n 
1 246 ASP n 
1 247 LEU n 
1 248 PHE n 
1 249 GLU n 
1 250 GLU n 
1 251 LYS n 
1 252 ILE n 
1 253 LYS n 
1 254 LYS n 
1 255 SER n 
1 256 PRO n 
1 257 LEU n 
1 258 THR n 
1 259 ILE n 
1 260 CYS n 
1 261 TYR n 
1 262 PRO n 
1 263 GLU n 
1 264 TYR n 
1 265 ALA n 
1 266 GLY n 
1 267 SER n 
1 268 ASN n 
1 269 THR n 
1 270 TYR n 
1 271 GLU n 
1 272 GLU n 
1 273 ALA n 
1 274 ALA n 
1 275 ALA n 
1 276 TYR n 
1 277 ILE n 
1 278 GLN n 
1 279 CYS n 
1 280 GLN n 
1 281 PHE n 
1 282 GLU n 
1 283 ASP n 
1 284 LEU n 
1 285 ASN n 
1 286 LYS n 
1 287 ARG n 
1 288 LYS n 
1 289 ASP n 
1 290 THR n 
1 291 LYS n 
1 292 GLU n 
1 293 ILE n 
1 294 TYR n 
1 295 THR n 
1 296 HIS n 
1 297 PHE n 
1 298 THR n 
1 299 CYS n 
1 300 ALA n 
1 301 THR n 
1 302 ASP n 
1 303 THR n 
1 304 LYS n 
1 305 ASN n 
1 306 VAL n 
1 307 GLN n 
1 308 PHE n 
1 309 VAL n 
1 310 PHE n 
1 311 ASP n 
1 312 ALA n 
1 313 VAL n 
1 314 THR n 
1 315 ASP n 
1 316 VAL n 
1 317 ILE n 
1 318 ILE n 
1 319 LYS n 
1 320 ASN n 
1 321 ASN n 
1 322 LEU n 
1 323 LYS n 
1 324 ASP n 
1 325 CYS n 
1 326 GLY n 
1 327 LEU n 
1 328 PHE n 
2 1   ASP n 
2 2   ILE n 
2 3   GLU n 
2 4   GLY n 
2 5   LEU n 
2 6   VAL n 
2 7   GLU n 
2 8   LEU n 
2 9   LEU n 
2 10  ASN n 
2 11  ARG n 
2 12  VAL n 
2 13  GLN n 
2 14  SER n 
2 15  SER n 
2 16  GLY n 
2 17  ALA n 
2 18  HIS n 
2 19  ASP n 
2 20  GLN n 
2 21  ARG n 
2 22  GLY n 
2 23  LEU n 
2 24  LEU n 
2 25  ARG n 
2 26  LYS n 
2 27  GLU n 
2 28  ASP n 
2 29  LEU n 
2 30  VAL n 
2 31  LEU n 
2 32  PRO n 
2 33  GLU n 
2 34  PHE n 
2 35  LEU n 
2 36  GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GNAI1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLIC-His 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'synthetic GoLoco motif peptide identical to human RGS14 497-532' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI1_HUMAN P63096 1 
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
31  ? 
2 UNP RGS14_HUMAN O43566 2 DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ 497 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QI2 A 5 ? 328 ? P63096 31  ? 354 ? 31  354 
2 1 3QI2 B 5 ? 328 ? P63096 31  ? 354 ? 31  354 
3 2 3QI2 C 1 ? 36  ? O43566 497 ? 532 ? 496 531 
4 2 3QI2 D 1 ? 36  ? O43566 497 ? 532 ? 496 531 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QI2 SER A 1  ? UNP P63096 ?   ?  'EXPRESSION TAG'      27 1  
1 3QI2 ASN A 2  ? UNP P63096 ?   ?  'EXPRESSION TAG'      28 2  
1 3QI2 ALA A 3  ? UNP P63096 ?   ?  'EXPRESSION TAG'      29 3  
1 3QI2 GLY A 4  ? UNP P63096 ?   ?  'EXPRESSION TAG'      30 4  
1 3QI2 ARG A 16 ? UNP P63096 GLY 42 'ENGINEERED MUTATION' 42 5  
2 3QI2 SER B 1  ? UNP P63096 ?   ?  'EXPRESSION TAG'      27 6  
2 3QI2 ASN B 2  ? UNP P63096 ?   ?  'EXPRESSION TAG'      28 7  
2 3QI2 ALA B 3  ? UNP P63096 ?   ?  'EXPRESSION TAG'      29 8  
2 3QI2 GLY B 4  ? UNP P63096 ?   ?  'EXPRESSION TAG'      30 9  
2 3QI2 ARG B 16 ? UNP P63096 GLY 42 'ENGINEERED MUTATION' 42 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                               'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                               'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ?                               'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                   'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                  ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ?                               'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ?                               'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'              ?                               'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                  ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3QI2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_percent_sol   56.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
;Hanging drops were a 1:1 mixture of protein-peptide complex in buffer (10 mM Tris pH 7.5, 1 mM magnesium chloride, 5% (w/v) glycerol, 5 mM DTT) and well solution (1.7 M ammonium sulfate, 100 mM sodium acetate pH 5.0, 200 mM magnesium 
chloride, 10% (w/v) glycerol), VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-11-01 
_diffrn_detector.details                custom 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3QI2 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.705 
_reflns.d_resolution_high            2.797 
_reflns.number_obs                   18462 
_reflns.number_all                   23542 
_reflns.percent_possible_obs         78.42 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        2.0 
_reflns.B_iso_Wilson_estimate        51.89 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.797 
_reflns_shell.d_res_low              2.944 
_reflns_shell.percent_possible_all   31 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3QI2 
_refine.ls_number_reflns_obs                     18462 
_refine.ls_number_reflns_all                     23542 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.71 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.705 
_refine.ls_d_res_high                            2.797 
_refine.ls_percent_reflns_obs                    78.42 
_refine.ls_R_factor_obs                          0.2001 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1963 
_refine.ls_R_factor_R_free                       0.2726 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.16 
_refine.ls_number_reflns_R_free                  952 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -11.9978 
_refine.aniso_B[2][2]                            -8.6468 
_refine.aniso_B[3][3]                            -18.6539 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.318 
_refine.solvent_model_param_bsol                 36.758 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2om2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5605 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               5714 
_refine_hist.d_res_high                       2.797 
_refine_hist.d_res_low                        29.705 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 5770 'X-RAY DIFFRACTION' ? 
f_angle_d          0.463  ? ? 7779 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 10.271 ? ? 2124 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.032  ? ? 866  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.001  ? ? 985  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.797  2.9441  982  0.2853 31.00 0.3845 . . 60  . . . . 'X-RAY DIFFRACTION' 
. 2.9441 3.1283  1729 0.2794 55.00 0.3232 . . 88  . . . . 'X-RAY DIFFRACTION' 
. 3.1283 3.3696  2373 0.2501 75.00 0.3763 . . 128 . . . . 'X-RAY DIFFRACTION' 
. 3.3696 3.7081  2903 0.2118 92.00 0.3011 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 3.7081 4.2433  3088 0.1793 98.00 0.2381 . . 169 . . . . 'X-RAY DIFFRACTION' 
. 4.2433 5.3411  3164 0.1599 98.00 0.2533 . . 176 . . . . 'X-RAY DIFFRACTION' 
. 5.3411 29.7068 3271 0.1728 98.00 0.2179 . . 163 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QI2 
_struct.title                     'A Galpha P-loop mutation prevents transition to the activated state: G42R bound to RGS14 GoLoco' 
_struct.pdbx_descriptor           
'Guanine nucleotide-binding protein G(i) subunit alpha-1 (E.C.3.6.5.1), Regulator of G-protein signaling 14' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QI2 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;RGS14 GoLoco, Ras-like domain, all-helical domain, GoLoco motif, arginine finger, signaling protein, lipoprotein, transducer, guanine nucleotide dissociation inhibitor, GTP binding, nucleotide binding, ADP-ribosylation
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 3 ? 
I N N 4 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 19  ? HIS A 31  ? GLY A 45  HIS A 57  1 ? 13 
HELX_P HELX_P2  2  SER A 36  ? TYR A 43  ? SER A 62  TYR A 69  1 ? 8  
HELX_P HELX_P3  3  TYR A 43  ? LEU A 65  ? TYR A 69  LEU A 91  1 ? 23 
HELX_P HELX_P4  4  ALA A 73  ? ALA A 88  ? ALA A 99  ALA A 114 1 ? 16 
HELX_P HELX_P5  5  THR A 94  ? ASP A 107 ? THR A 120 ASP A 133 1 ? 14 
HELX_P HELX_P6  6  ASP A 107 ? ARG A 116 ? ASP A 133 ARG A 142 1 ? 10 
HELX_P HELX_P7  7  SER A 117 ? TYR A 120 ? SER A 143 TYR A 146 5 ? 4  
HELX_P HELX_P8  8  SER A 125 ? ASP A 132 ? SER A 151 ASP A 158 1 ? 8  
HELX_P HELX_P9  9  ASP A 132 ? GLN A 138 ? ASP A 158 GLN A 164 1 ? 7  
HELX_P HELX_P10 10 THR A 144 ? THR A 151 ? THR A 170 THR A 177 1 ? 8  
HELX_P HELX_P11 11 GLU A 181 ? GLU A 190 ? GLU A 207 GLU A 216 1 ? 10 
HELX_P HELX_P12 12 SER A 202 ? ASP A 205 ? SER A 228 ASP A 231 5 ? 4  
HELX_P HELX_P13 13 ASN A 215 ? ASN A 230 ? ASN A 241 ASN A 256 1 ? 16 
HELX_P HELX_P14 14 LYS A 231 ? THR A 234 ? LYS A 257 THR A 260 5 ? 4  
HELX_P HELX_P15 15 LYS A 244 ? ILE A 252 ? LYS A 270 ILE A 278 1 ? 9  
HELX_P HELX_P16 16 PRO A 256 ? CYS A 260 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P17 17 THR A 269 ? ASP A 283 ? THR A 295 ASP A 309 1 ? 15 
HELX_P HELX_P18 18 ASP A 302 ? ASN A 320 ? ASP A 328 ASN A 346 1 ? 19 
HELX_P HELX_P19 19 GLY B 19  ? HIS B 31  ? GLY B 45  HIS B 57  1 ? 13 
HELX_P HELX_P20 20 SER B 36  ? TYR B 43  ? SER B 62  TYR B 69  1 ? 8  
HELX_P HELX_P21 21 TYR B 43  ? LEU B 65  ? TYR B 69  LEU B 91  1 ? 23 
HELX_P HELX_P22 22 ALA B 73  ? GLY B 86  ? ALA B 99  GLY B 112 1 ? 14 
HELX_P HELX_P23 23 THR B 94  ? LYS B 106 ? THR B 120 LYS B 132 1 ? 13 
HELX_P HELX_P24 24 ASP B 107 ? ARG B 116 ? ASP B 133 ARG B 142 1 ? 10 
HELX_P HELX_P25 25 SER B 117 ? TYR B 120 ? SER B 143 TYR B 146 5 ? 4  
HELX_P HELX_P26 26 SER B 125 ? ASP B 132 ? SER B 151 ASP B 158 1 ? 8  
HELX_P HELX_P27 27 ASP B 132 ? ALA B 137 ? ASP B 158 ALA B 163 1 ? 6  
HELX_P HELX_P28 28 THR B 144 ? THR B 151 ? THR B 170 THR B 177 1 ? 8  
HELX_P HELX_P29 29 TRP B 185 ? GLU B 190 ? TRP B 211 GLU B 216 1 ? 6  
HELX_P HELX_P30 30 SER B 202 ? LEU B 206 ? SER B 228 LEU B 232 5 ? 5  
HELX_P HELX_P31 31 ASN B 215 ? ASN B 229 ? ASN B 241 ASN B 255 1 ? 15 
HELX_P HELX_P32 32 ASN B 230 ? THR B 234 ? ASN B 256 THR B 260 5 ? 5  
HELX_P HELX_P33 33 LYS B 244 ? ILE B 252 ? LYS B 270 ILE B 278 1 ? 9  
HELX_P HELX_P34 34 PRO B 256 ? CYS B 260 ? PRO B 282 CYS B 286 5 ? 5  
HELX_P HELX_P35 35 THR B 269 ? ASP B 283 ? THR B 295 ASP B 309 1 ? 15 
HELX_P HELX_P36 36 ASP B 302 ? LYS B 319 ? ASP B 328 LYS B 345 1 ? 18 
HELX_P HELX_P37 37 ASP C 1   ? GLN C 13  ? ASP C 496 GLN C 508 1 ? 13 
HELX_P HELX_P38 38 LEU D 5   ? GLN D 13  ? LEU D 500 GLN D 508 1 ? 9  
HELX_P HELX_P39 39 ARG D 25  ? LEU D 29  ? ARG D 520 LEU D 524 5 ? 5  
HELX_P HELX_P40 40 PRO D 32  ? GLN D 36  ? PRO D 527 GLN D 531 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 158 ? PHE A 165 ? ILE A 184 PHE A 191 
A 2 LEU A 168 ? VAL A 175 ? LEU A 194 VAL A 201 
A 3 ARG A 6   ? LEU A 13  ? ARG A 32  LEU A 39  
A 4 ALA A 194 ? ALA A 200 ? ALA A 220 ALA A 226 
A 5 SER A 237 ? ASN A 243 ? SER A 263 ASN A 269 
A 6 TYR A 294 ? PHE A 297 ? TYR A 320 PHE A 323 
B 1 GLU B 160 ? THR B 164 ? GLU B 186 THR B 190 
B 2 HIS B 169 ? ASP B 174 ? HIS B 195 ASP B 200 
B 3 LEU B 10  ? GLY B 14  ? LEU B 36  GLY B 40  
B 4 ALA B 194 ? ALA B 200 ? ALA B 220 ALA B 226 
B 5 SER B 237 ? ASN B 243 ? SER B 263 ASN B 269 
B 6 ILE B 293 ? PHE B 297 ? ILE B 319 PHE B 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 159 ? N VAL A 185 O ASP A 174 ? O ASP A 200 
A 2 3 O PHE A 173 ? O PHE A 199 N LEU A 10  ? N LEU A 36  
A 3 4 N LEU A 13  ? N LEU A 39  O CYS A 198 ? O CYS A 224 
A 4 5 N ILE A 195 ? N ILE A 221 O ILE A 239 ? O ILE A 265 
A 5 6 N ILE A 238 ? N ILE A 264 O TYR A 294 ? O TYR A 320 
B 1 2 N PHE B 163 ? N PHE B 189 O PHE B 170 ? O PHE B 196 
B 2 3 O PHE B 173 ? O PHE B 199 N LEU B 10  ? N LEU B 36  
B 3 4 N LEU B 11  ? N LEU B 37  O ILE B 196 ? O ILE B 222 
B 4 5 N PHE B 197 ? N PHE B 223 O PHE B 241 ? O PHE B 267 
B 5 6 N LEU B 240 ? N LEU B 266 O TYR B 294 ? O TYR B 320 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE GDP A 355' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 2'   
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 3'   
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE GDP B 356' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 ARG A 16  ? ARG A 42  . ? 1_555 ? 
2  AC1 18 GLU A 17  ? GLU A 43  . ? 1_555 ? 
3  AC1 18 SER A 18  ? SER A 44  . ? 1_555 ? 
4  AC1 18 GLY A 19  ? GLY A 45  . ? 1_555 ? 
5  AC1 18 LYS A 20  ? LYS A 46  . ? 1_555 ? 
6  AC1 18 SER A 21  ? SER A 47  . ? 1_555 ? 
7  AC1 18 THR A 22  ? THR A 48  . ? 1_555 ? 
8  AC1 18 SER A 125 ? SER A 151 . ? 1_555 ? 
9  AC1 18 ARG A 150 ? ARG A 176 . ? 1_555 ? 
10 AC1 18 ARG A 152 ? ARG A 178 . ? 1_555 ? 
11 AC1 18 ASN A 243 ? ASN A 269 . ? 1_555 ? 
12 AC1 18 LYS A 244 ? LYS A 270 . ? 1_555 ? 
13 AC1 18 ASP A 246 ? ASP A 272 . ? 1_555 ? 
14 AC1 18 LEU A 247 ? LEU A 273 . ? 1_555 ? 
15 AC1 18 CYS A 299 ? CYS A 325 . ? 1_555 ? 
16 AC1 18 ALA A 300 ? ALA A 326 . ? 1_555 ? 
17 AC1 18 THR A 301 ? THR A 327 . ? 1_555 ? 
18 AC1 18 ARG C 21  ? ARG C 516 . ? 1_555 ? 
19 AC2 2  SER A 36  ? SER A 62  . ? 1_555 ? 
20 AC2 2  GLU A 37  ? GLU A 63  . ? 1_555 ? 
21 AC3 4  LYS A 245 ? LYS A 271 . ? 1_555 ? 
22 AC3 4  GLU A 249 ? GLU A 275 . ? 3_455 ? 
23 AC3 4  GLU A 271 ? GLU A 297 . ? 3_455 ? 
24 AC3 4  PHE A 297 ? PHE A 323 . ? 1_555 ? 
25 AC4 18 GLU B 17  ? GLU B 43  . ? 1_555 ? 
26 AC4 18 SER B 18  ? SER B 44  . ? 1_555 ? 
27 AC4 18 GLY B 19  ? GLY B 45  . ? 1_555 ? 
28 AC4 18 LYS B 20  ? LYS B 46  . ? 1_555 ? 
29 AC4 18 SER B 21  ? SER B 47  . ? 1_555 ? 
30 AC4 18 THR B 22  ? THR B 48  . ? 1_555 ? 
31 AC4 18 ASP B 124 ? ASP B 150 . ? 1_555 ? 
32 AC4 18 SER B 125 ? SER B 151 . ? 1_555 ? 
33 AC4 18 ARG B 150 ? ARG B 176 . ? 1_555 ? 
34 AC4 18 ARG B 152 ? ARG B 178 . ? 1_555 ? 
35 AC4 18 ASN B 243 ? ASN B 269 . ? 1_555 ? 
36 AC4 18 LYS B 244 ? LYS B 270 . ? 1_555 ? 
37 AC4 18 ASP B 246 ? ASP B 272 . ? 1_555 ? 
38 AC4 18 LEU B 247 ? LEU B 273 . ? 1_555 ? 
39 AC4 18 CYS B 299 ? CYS B 325 . ? 1_555 ? 
40 AC4 18 ALA B 300 ? ALA B 326 . ? 1_555 ? 
41 AC4 18 THR B 301 ? THR B 327 . ? 1_555 ? 
42 AC4 18 ARG D 21  ? ARG D 516 . ? 1_555 ? 
43 AC5 4  ILE B 67  ? ILE B 93  . ? 1_555 ? 
44 AC5 4  ASP B 68  ? ASP B 94  . ? 1_555 ? 
45 AC5 4  SER B 108 ? SER B 134 . ? 1_555 ? 
46 AC5 4  GLY B 109 ? GLY B 135 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QI2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QI2 
_atom_sites.fract_transf_matrix[1][1]   0.014285 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007633 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004919 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 4   ? 1.714   18.178  39.727  1.00 88.30  ? 30  GLY A N     1 
ATOM   2    C CA    . GLY A 1 4   ? 1.363   17.009  38.943  1.00 97.58  ? 30  GLY A CA    1 
ATOM   3    C C     . GLY A 1 4   ? 0.647   15.953  39.762  1.00 105.94 ? 30  GLY A C     1 
ATOM   4    O O     . GLY A 1 4   ? -0.573  15.815  39.682  1.00 105.93 ? 30  GLY A O     1 
ATOM   5    N N     . ALA A 1 5   ? 1.412   15.205  40.552  1.00 116.24 ? 31  ALA A N     1 
ATOM   6    C CA    . ALA A 1 5   ? 0.858   14.159  41.407  1.00 122.73 ? 31  ALA A CA    1 
ATOM   7    C C     . ALA A 1 5   ? 0.087   13.113  40.605  1.00 113.59 ? 31  ALA A C     1 
ATOM   8    O O     . ALA A 1 5   ? 0.678   12.197  40.033  1.00 115.42 ? 31  ALA A O     1 
ATOM   9    C CB    . ALA A 1 5   ? -0.031  14.769  42.485  1.00 129.38 ? 31  ALA A CB    1 
ATOM   10   N N     . ARG A 1 6   ? -1.235  13.255  40.569  1.00 97.07  ? 32  ARG A N     1 
ATOM   11   C CA    . ARG A 1 6   ? -2.083  12.320  39.840  1.00 68.83  ? 32  ARG A CA    1 
ATOM   12   C C     . ARG A 1 6   ? -3.063  13.047  38.922  1.00 61.48  ? 32  ARG A C     1 
ATOM   13   O O     . ARG A 1 6   ? -3.421  14.201  39.164  1.00 49.07  ? 32  ARG A O     1 
ATOM   14   C CB    . ARG A 1 6   ? -2.845  11.412  40.811  1.00 52.52  ? 32  ARG A CB    1 
ATOM   15   C CG    . ARG A 1 6   ? -3.734  10.388  40.123  1.00 73.15  ? 32  ARG A CG    1 
ATOM   16   C CD    . ARG A 1 6   ? -4.552  9.580   41.117  1.00 88.90  ? 32  ARG A CD    1 
ATOM   17   N NE    . ARG A 1 6   ? -5.490  8.687   40.443  1.00 92.27  ? 32  ARG A NE    1 
ATOM   18   C CZ    . ARG A 1 6   ? -6.372  7.916   41.071  1.00 89.10  ? 32  ARG A CZ    1 
ATOM   19   N NH1   . ARG A 1 6   ? -6.441  7.926   42.394  1.00 88.01  ? 32  ARG A NH1   1 
ATOM   20   N NH2   . ARG A 1 6   ? -7.188  7.135   40.375  1.00 86.19  ? 32  ARG A NH2   1 
ATOM   21   N N     . GLU A 1 7   ? -3.488  12.362  37.865  1.00 64.63  ? 33  GLU A N     1 
ATOM   22   C CA    . GLU A 1 7   ? -4.464  12.905  36.930  1.00 61.62  ? 33  GLU A CA    1 
ATOM   23   C C     . GLU A 1 7   ? -5.653  11.958  36.819  1.00 59.81  ? 33  GLU A C     1 
ATOM   24   O O     . GLU A 1 7   ? -5.484  10.761  36.579  1.00 72.53  ? 33  GLU A O     1 
ATOM   25   C CB    . GLU A 1 7   ? -3.822  13.121  35.558  1.00 73.96  ? 33  GLU A CB    1 
ATOM   26   C CG    . GLU A 1 7   ? -4.764  13.668  34.498  1.00 86.63  ? 33  GLU A CG    1 
ATOM   27   C CD    . GLU A 1 7   ? -4.056  13.958  33.186  1.00 98.39  ? 33  GLU A CD    1 
ATOM   28   O OE1   . GLU A 1 7   ? -2.841  14.247  33.218  1.00 95.81  ? 33  GLU A OE1   1 
ATOM   29   O OE2   . GLU A 1 7   ? -4.713  13.899  32.125  1.00 103.82 ? 33  GLU A OE2   1 
ATOM   30   N N     . VAL A 1 8   ? -6.855  12.495  37.001  1.00 42.69  ? 34  VAL A N     1 
ATOM   31   C CA    . VAL A 1 8   ? -8.064  11.681  36.988  1.00 35.57  ? 34  VAL A CA    1 
ATOM   32   C C     . VAL A 1 8   ? -8.957  12.006  35.797  1.00 42.30  ? 34  VAL A C     1 
ATOM   33   O O     . VAL A 1 8   ? -9.314  13.162  35.575  1.00 47.60  ? 34  VAL A O     1 
ATOM   34   C CB    . VAL A 1 8   ? -8.874  11.863  38.283  1.00 35.95  ? 34  VAL A CB    1 
ATOM   35   C CG1   . VAL A 1 8   ? -10.229 11.186  38.160  1.00 46.97  ? 34  VAL A CG1   1 
ATOM   36   C CG2   . VAL A 1 8   ? -8.100  11.318  39.474  1.00 43.12  ? 34  VAL A CG2   1 
ATOM   37   N N     . LYS A 1 9   ? -9.317  10.979  35.034  1.00 36.71  ? 35  LYS A N     1 
ATOM   38   C CA    . LYS A 1 9   ? -10.191 11.160  33.882  1.00 36.20  ? 35  LYS A CA    1 
ATOM   39   C C     . LYS A 1 9   ? -11.613 10.715  34.194  1.00 42.53  ? 35  LYS A C     1 
ATOM   40   O O     . LYS A 1 9   ? -11.846 9.575   34.592  1.00 49.96  ? 35  LYS A O     1 
ATOM   41   C CB    . LYS A 1 9   ? -9.656  10.397  32.670  1.00 35.21  ? 35  LYS A CB    1 
ATOM   42   C CG    . LYS A 1 9   ? -10.527 10.526  31.430  1.00 20.05  ? 35  LYS A CG    1 
ATOM   43   C CD    . LYS A 1 9   ? -9.856  9.904   30.218  1.00 24.40  ? 35  LYS A CD    1 
ATOM   44   C CE    . LYS A 1 9   ? -10.745 9.982   28.986  1.00 25.24  ? 35  LYS A CE    1 
ATOM   45   N NZ    . LYS A 1 9   ? -10.045 9.477   27.771  1.00 27.23  ? 35  LYS A NZ    1 
ATOM   46   N N     . LEU A 1 10  ? -12.562 11.625  34.007  1.00 42.05  ? 36  LEU A N     1 
ATOM   47   C CA    . LEU A 1 10  ? -13.963 11.335  34.280  1.00 32.39  ? 36  LEU A CA    1 
ATOM   48   C C     . LEU A 1 10  ? -14.796 11.448  33.013  1.00 28.44  ? 36  LEU A C     1 
ATOM   49   O O     . LEU A 1 10  ? -14.550 12.317  32.178  1.00 36.92  ? 36  LEU A O     1 
ATOM   50   C CB    . LEU A 1 10  ? -14.498 12.291  35.343  1.00 25.45  ? 36  LEU A CB    1 
ATOM   51   C CG    . LEU A 1 10  ? -13.780 12.214  36.690  1.00 26.57  ? 36  LEU A CG    1 
ATOM   52   C CD1   . LEU A 1 10  ? -14.241 13.331  37.613  1.00 23.10  ? 36  LEU A CD1   1 
ATOM   53   C CD2   . LEU A 1 10  ? -13.997 10.848  37.328  1.00 32.61  ? 36  LEU A CD2   1 
ATOM   54   N N     . LEU A 1 11  ? -15.781 10.566  32.871  1.00 26.03  ? 37  LEU A N     1 
ATOM   55   C CA    . LEU A 1 11  ? -16.662 10.592  31.708  1.00 33.35  ? 37  LEU A CA    1 
ATOM   56   C C     . LEU A 1 11  ? -18.129 10.641  32.125  1.00 38.27  ? 37  LEU A C     1 
ATOM   57   O O     . LEU A 1 11  ? -18.587 9.823   32.923  1.00 51.55  ? 37  LEU A O     1 
ATOM   58   C CB    . LEU A 1 11  ? -16.407 9.381   30.809  1.00 26.91  ? 37  LEU A CB    1 
ATOM   59   C CG    . LEU A 1 11  ? -17.217 9.329   29.512  1.00 30.66  ? 37  LEU A CG    1 
ATOM   60   C CD1   . LEU A 1 11  ? -16.964 10.573  28.675  1.00 30.39  ? 37  LEU A CD1   1 
ATOM   61   C CD2   . LEU A 1 11  ? -16.889 8.072   28.722  1.00 27.57  ? 37  LEU A CD2   1 
ATOM   62   N N     . LEU A 1 12  ? -18.860 11.609  31.580  1.00 28.89  ? 38  LEU A N     1 
ATOM   63   C CA    . LEU A 1 12  ? -20.271 11.783  31.904  1.00 21.70  ? 38  LEU A CA    1 
ATOM   64   C C     . LEU A 1 12  ? -21.182 11.082  30.904  1.00 39.65  ? 38  LEU A C     1 
ATOM   65   O O     . LEU A 1 12  ? -21.127 11.350  29.704  1.00 49.71  ? 38  LEU A O     1 
ATOM   66   C CB    . LEU A 1 12  ? -20.628 13.269  31.966  1.00 13.32  ? 38  LEU A CB    1 
ATOM   67   C CG    . LEU A 1 12  ? -20.204 14.032  33.220  1.00 32.11  ? 38  LEU A CG    1 
ATOM   68   C CD1   . LEU A 1 12  ? -20.472 15.516  33.052  1.00 40.00  ? 38  LEU A CD1   1 
ATOM   69   C CD2   . LEU A 1 12  ? -20.928 13.491  34.445  1.00 25.83  ? 38  LEU A CD2   1 
ATOM   70   N N     . LEU A 1 13  ? -22.022 10.185  31.407  1.00 48.40  ? 39  LEU A N     1 
ATOM   71   C CA    . LEU A 1 13  ? -23.028 9.531   30.581  1.00 47.88  ? 39  LEU A CA    1 
ATOM   72   C C     . LEU A 1 13  ? -24.420 9.826   31.126  1.00 52.47  ? 39  LEU A C     1 
ATOM   73   O O     . LEU A 1 13  ? -24.566 10.324  32.242  1.00 57.10  ? 39  LEU A O     1 
ATOM   74   C CB    . LEU A 1 13  ? -22.791 8.022   30.527  1.00 43.86  ? 39  LEU A CB    1 
ATOM   75   C CG    . LEU A 1 13  ? -21.465 7.556   29.930  1.00 35.33  ? 39  LEU A CG    1 
ATOM   76   C CD1   . LEU A 1 13  ? -21.425 6.041   29.869  1.00 45.78  ? 39  LEU A CD1   1 
ATOM   77   C CD2   . LEU A 1 13  ? -21.265 8.149   28.549  1.00 43.41  ? 39  LEU A CD2   1 
ATOM   78   N N     . GLY A 1 14  ? -25.441 9.515   30.335  1.00 41.38  ? 40  GLY A N     1 
ATOM   79   C CA    . GLY A 1 14  ? -26.813 9.757   30.737  1.00 31.06  ? 40  GLY A CA    1 
ATOM   80   C C     . GLY A 1 14  ? -27.635 10.348  29.612  1.00 32.76  ? 40  GLY A C     1 
ATOM   81   O O     . GLY A 1 14  ? -27.125 11.106  28.788  1.00 26.08  ? 40  GLY A O     1 
ATOM   82   N N     . ALA A 1 15  ? -28.917 10.002  29.578  1.00 31.29  ? 41  ALA A N     1 
ATOM   83   C CA    . ALA A 1 15  ? -29.805 10.476  28.526  1.00 29.75  ? 41  ALA A CA    1 
ATOM   84   C C     . ALA A 1 15  ? -29.867 11.997  28.486  1.00 37.90  ? 41  ALA A C     1 
ATOM   85   O O     . ALA A 1 15  ? -29.474 12.673  29.436  1.00 46.50  ? 41  ALA A O     1 
ATOM   86   C CB    . ALA A 1 15  ? -31.202 9.896   28.711  1.00 27.37  ? 41  ALA A CB    1 
ATOM   87   N N     . ARG A 1 16  ? -30.362 12.525  27.373  1.00 34.61  ? 42  ARG A N     1 
ATOM   88   C CA    . ARG A 1 16  ? -30.592 13.954  27.231  1.00 24.19  ? 42  ARG A CA    1 
ATOM   89   C C     . ARG A 1 16  ? -31.409 14.472  28.411  1.00 41.33  ? 42  ARG A C     1 
ATOM   90   O O     . ARG A 1 16  ? -32.325 13.798  28.885  1.00 46.16  ? 42  ARG A O     1 
ATOM   91   C CB    . ARG A 1 16  ? -31.335 14.227  25.923  1.00 24.39  ? 42  ARG A CB    1 
ATOM   92   C CG    . ARG A 1 16  ? -32.706 13.566  25.863  1.00 65.26  ? 42  ARG A CG    1 
ATOM   93   C CD    . ARG A 1 16  ? -33.071 13.122  24.454  1.00 79.40  ? 42  ARG A CD    1 
ATOM   94   N NE    . ARG A 1 16  ? -34.315 12.356  24.439  1.00 78.92  ? 42  ARG A NE    1 
ATOM   95   C CZ    . ARG A 1 16  ? -34.408 11.075  24.785  1.00 66.23  ? 42  ARG A CZ    1 
ATOM   96   N NH1   . ARG A 1 16  ? -33.328 10.412  25.179  1.00 50.33  ? 42  ARG A NH1   1 
ATOM   97   N NH2   . ARG A 1 16  ? -35.580 10.455  24.743  1.00 56.68  ? 42  ARG A NH2   1 
ATOM   98   N N     . GLU A 1 17  ? -31.066 15.664  28.888  1.00 43.58  ? 43  GLU A N     1 
ATOM   99   C CA    . GLU A 1 17  ? -31.803 16.310  29.970  1.00 36.92  ? 43  GLU A CA    1 
ATOM   100  C C     . GLU A 1 17  ? -31.640 15.585  31.304  1.00 35.95  ? 43  GLU A C     1 
ATOM   101  O O     . GLU A 1 17  ? -32.551 15.587  32.130  1.00 41.45  ? 43  GLU A O     1 
ATOM   102  C CB    . GLU A 1 17  ? -33.288 16.416  29.614  1.00 41.19  ? 43  GLU A CB    1 
ATOM   103  C CG    . GLU A 1 17  ? -33.560 17.092  28.282  1.00 40.11  ? 43  GLU A CG    1 
ATOM   104  C CD    . GLU A 1 17  ? -33.158 18.551  28.280  1.00 53.79  ? 43  GLU A CD    1 
ATOM   105  O OE1   . GLU A 1 17  ? -32.800 19.067  27.201  1.00 58.85  ? 43  GLU A OE1   1 
ATOM   106  O OE2   . GLU A 1 17  ? -33.197 19.180  29.357  1.00 69.18  ? 43  GLU A OE2   1 
ATOM   107  N N     . SER A 1 18  ? -30.483 14.966  31.514  1.00 31.20  ? 44  SER A N     1 
ATOM   108  C CA    . SER A 1 18  ? -30.229 14.259  32.764  1.00 26.09  ? 44  SER A CA    1 
ATOM   109  C C     . SER A 1 18  ? -29.328 15.067  33.696  1.00 37.90  ? 44  SER A C     1 
ATOM   110  O O     . SER A 1 18  ? -29.130 14.695  34.852  1.00 44.76  ? 44  SER A O     1 
ATOM   111  C CB    . SER A 1 18  ? -29.636 12.870  32.503  1.00 26.41  ? 44  SER A CB    1 
ATOM   112  O OG    . SER A 1 18  ? -28.322 12.953  31.983  1.00 23.66  ? 44  SER A OG    1 
ATOM   113  N N     . GLY A 1 19  ? -28.783 16.171  33.191  1.00 36.16  ? 45  GLY A N     1 
ATOM   114  C CA    . GLY A 1 19  ? -28.001 17.077  34.014  1.00 29.16  ? 45  GLY A CA    1 
ATOM   115  C C     . GLY A 1 19  ? -26.508 17.091  33.736  1.00 40.16  ? 45  GLY A C     1 
ATOM   116  O O     . GLY A 1 19  ? -25.745 17.734  34.456  1.00 47.59  ? 45  GLY A O     1 
ATOM   117  N N     . LYS A 1 20  ? -26.086 16.391  32.689  1.00 28.06  ? 46  LYS A N     1 
ATOM   118  C CA    . LYS A 1 20  ? -24.667 16.291  32.363  1.00 26.86  ? 46  LYS A CA    1 
ATOM   119  C C     . LYS A 1 20  ? -23.997 17.656  32.215  1.00 21.91  ? 46  LYS A C     1 
ATOM   120  O O     . LYS A 1 20  ? -23.074 17.983  32.961  1.00 37.51  ? 46  LYS A O     1 
ATOM   121  C CB    . LYS A 1 20  ? -24.458 15.466  31.091  1.00 39.13  ? 46  LYS A CB    1 
ATOM   122  C CG    . LYS A 1 20  ? -24.921 14.023  31.198  1.00 32.14  ? 46  LYS A CG    1 
ATOM   123  C CD    . LYS A 1 20  ? -24.605 13.258  29.925  1.00 32.22  ? 46  LYS A CD    1 
ATOM   124  C CE    . LYS A 1 20  ? -25.223 13.932  28.708  1.00 37.42  ? 46  LYS A CE    1 
ATOM   125  N NZ    . LYS A 1 20  ? -26.712 13.958  28.765  1.00 36.02  ? 46  LYS A NZ    1 
ATOM   126  N N     . SER A 1 21  ? -24.460 18.447  31.252  1.00 28.99  ? 47  SER A N     1 
ATOM   127  C CA    . SER A 1 21  ? -23.856 19.749  30.984  1.00 36.93  ? 47  SER A CA    1 
ATOM   128  C C     . SER A 1 21  ? -23.840 20.606  32.241  1.00 46.21  ? 47  SER A C     1 
ATOM   129  O O     . SER A 1 21  ? -22.917 21.390  32.457  1.00 50.43  ? 47  SER A O     1 
ATOM   130  C CB    . SER A 1 21  ? -24.604 20.478  29.866  1.00 35.76  ? 47  SER A CB    1 
ATOM   131  O OG    . SER A 1 21  ? -25.876 20.916  30.308  1.00 64.64  ? 47  SER A OG    1 
ATOM   132  N N     . THR A 1 22  ? -24.868 20.446  33.068  1.00 40.74  ? 48  THR A N     1 
ATOM   133  C CA    . THR A 1 22  ? -24.982 21.200  34.310  1.00 28.98  ? 48  THR A CA    1 
ATOM   134  C C     . THR A 1 22  ? -23.834 20.882  35.267  1.00 28.06  ? 48  THR A C     1 
ATOM   135  O O     . THR A 1 22  ? -23.245 21.784  35.862  1.00 26.13  ? 48  THR A O     1 
ATOM   136  C CB    . THR A 1 22  ? -26.327 20.931  35.011  1.00 18.71  ? 48  THR A CB    1 
ATOM   137  O OG1   . THR A 1 22  ? -27.404 21.291  34.137  1.00 44.58  ? 48  THR A OG1   1 
ATOM   138  C CG2   . THR A 1 22  ? -26.434 21.741  36.289  1.00 22.89  ? 48  THR A CG2   1 
ATOM   139  N N     . ILE A 1 23  ? -23.519 19.597  35.410  1.00 36.41  ? 49  ILE A N     1 
ATOM   140  C CA    . ILE A 1 23  ? -22.425 19.167  36.275  1.00 31.42  ? 49  ILE A CA    1 
ATOM   141  C C     . ILE A 1 23  ? -21.115 19.828  35.864  1.00 32.85  ? 49  ILE A C     1 
ATOM   142  O O     . ILE A 1 23  ? -20.384 20.354  36.704  1.00 30.21  ? 49  ILE A O     1 
ATOM   143  C CB    . ILE A 1 23  ? -22.234 17.639  36.236  1.00 30.99  ? 49  ILE A CB    1 
ATOM   144  C CG1   . ILE A 1 23  ? -23.522 16.924  36.647  1.00 39.34  ? 49  ILE A CG1   1 
ATOM   145  C CG2   . ILE A 1 23  ? -21.082 17.225  37.138  1.00 16.51  ? 49  ILE A CG2   1 
ATOM   146  C CD1   . ILE A 1 23  ? -23.939 17.192  38.075  1.00 43.09  ? 49  ILE A CD1   1 
ATOM   147  N N     . VAL A 1 24  ? -20.823 19.792  34.567  1.00 19.00  ? 50  VAL A N     1 
ATOM   148  C CA    . VAL A 1 24  ? -19.617 20.416  34.037  1.00 37.52  ? 50  VAL A CA    1 
ATOM   149  C C     . VAL A 1 24  ? -19.583 21.900  34.381  1.00 45.63  ? 50  VAL A C     1 
ATOM   150  O O     . VAL A 1 24  ? -18.574 22.415  34.865  1.00 45.84  ? 50  VAL A O     1 
ATOM   151  C CB    . VAL A 1 24  ? -19.526 20.261  32.507  1.00 33.64  ? 50  VAL A CB    1 
ATOM   152  C CG1   . VAL A 1 24  ? -18.304 20.993  31.974  1.00 25.93  ? 50  VAL A CG1   1 
ATOM   153  C CG2   . VAL A 1 24  ? -19.479 18.793  32.124  1.00 8.28   ? 50  VAL A CG2   1 
ATOM   154  N N     . LYS A 1 25  ? -20.695 22.581  34.126  1.00 37.02  ? 51  LYS A N     1 
ATOM   155  C CA    . LYS A 1 25  ? -20.812 24.004  34.416  1.00 27.53  ? 51  LYS A CA    1 
ATOM   156  C C     . LYS A 1 25  ? -20.688 24.267  35.915  1.00 37.42  ? 51  LYS A C     1 
ATOM   157  O O     . LYS A 1 25  ? -20.308 25.360  36.332  1.00 47.95  ? 51  LYS A O     1 
ATOM   158  C CB    . LYS A 1 25  ? -22.135 24.549  33.873  1.00 36.62  ? 51  LYS A CB    1 
ATOM   159  C CG    . LYS A 1 25  ? -22.266 24.416  32.361  1.00 47.69  ? 51  LYS A CG    1 
ATOM   160  C CD    . LYS A 1 25  ? -23.720 24.388  31.911  1.00 47.15  ? 51  LYS A CD    1 
ATOM   161  C CE    . LYS A 1 25  ? -24.388 25.738  32.075  1.00 50.41  ? 51  LYS A CE    1 
ATOM   162  N NZ    . LYS A 1 25  ? -25.787 25.710  31.568  1.00 55.32  ? 51  LYS A NZ    1 
ATOM   163  N N     . GLN A 1 26  ? -21.004 23.256  36.720  1.00 29.73  ? 52  GLN A N     1 
ATOM   164  C CA    . GLN A 1 26  ? -20.845 23.353  38.167  1.00 32.67  ? 52  GLN A CA    1 
ATOM   165  C C     . GLN A 1 26  ? -19.373 23.334  38.553  1.00 37.28  ? 52  GLN A C     1 
ATOM   166  O O     . GLN A 1 26  ? -18.949 24.054  39.456  1.00 51.03  ? 52  GLN A O     1 
ATOM   167  C CB    . GLN A 1 26  ? -21.578 22.212  38.875  1.00 27.53  ? 52  GLN A CB    1 
ATOM   168  C CG    . GLN A 1 26  ? -23.066 22.438  39.061  1.00 32.74  ? 52  GLN A CG    1 
ATOM   169  C CD    . GLN A 1 26  ? -23.368 23.530  40.068  1.00 41.35  ? 52  GLN A CD    1 
ATOM   170  O OE1   . GLN A 1 26  ? -22.476 24.264  40.494  1.00 46.55  ? 52  GLN A OE1   1 
ATOM   171  N NE2   . GLN A 1 26  ? -24.632 23.641  40.456  1.00 50.73  ? 52  GLN A NE2   1 
ATOM   172  N N     . MET A 1 27  ? -18.598 22.503  37.865  1.00 23.37  ? 53  MET A N     1 
ATOM   173  C CA    . MET A 1 27  ? -17.176 22.375  38.152  1.00 28.97  ? 53  MET A CA    1 
ATOM   174  C C     . MET A 1 27  ? -16.449 23.689  37.904  1.00 48.95  ? 53  MET A C     1 
ATOM   175  O O     . MET A 1 27  ? -15.578 24.084  38.679  1.00 59.11  ? 53  MET A O     1 
ATOM   176  C CB    . MET A 1 27  ? -16.558 21.262  37.306  1.00 38.97  ? 53  MET A CB    1 
ATOM   177  C CG    . MET A 1 27  ? -17.202 19.899  37.502  1.00 51.69  ? 53  MET A CG    1 
ATOM   178  S SD    . MET A 1 27  ? -17.123 19.309  39.205  1.00 51.92  ? 53  MET A SD    1 
ATOM   179  C CE    . MET A 1 27  ? -18.669 19.928  39.867  1.00 82.02  ? 53  MET A CE    1 
ATOM   180  N N     . LYS A 1 28  ? -16.811 24.368  36.820  1.00 52.20  ? 54  LYS A N     1 
ATOM   181  C CA    . LYS A 1 28  ? -16.193 25.645  36.495  1.00 55.03  ? 54  LYS A CA    1 
ATOM   182  C C     . LYS A 1 28  ? -16.549 26.691  37.544  1.00 63.69  ? 54  LYS A C     1 
ATOM   183  O O     . LYS A 1 28  ? -15.817 27.658  37.743  1.00 79.39  ? 54  LYS A O     1 
ATOM   184  C CB    . LYS A 1 28  ? -16.609 26.117  35.100  1.00 63.12  ? 54  LYS A CB    1 
ATOM   185  C CG    . LYS A 1 28  ? -15.943 27.417  34.673  1.00 87.99  ? 54  LYS A CG    1 
ATOM   186  C CD    . LYS A 1 28  ? -15.803 27.510  33.162  1.00 103.40 ? 54  LYS A CD    1 
ATOM   187  C CE    . LYS A 1 28  ? -17.153 27.472  32.472  1.00 112.50 ? 54  LYS A CE    1 
ATOM   188  N NZ    . LYS A 1 28  ? -17.021 27.637  30.998  1.00 114.98 ? 54  LYS A NZ    1 
ATOM   189  N N     . ILE A 1 29  ? -17.673 26.483  38.220  1.00 57.08  ? 55  ILE A N     1 
ATOM   190  C CA    . ILE A 1 29  ? -18.123 27.401  39.259  1.00 51.36  ? 55  ILE A CA    1 
ATOM   191  C C     . ILE A 1 29  ? -17.499 27.066  40.609  1.00 48.22  ? 55  ILE A C     1 
ATOM   192  O O     . ILE A 1 29  ? -17.102 27.957  41.360  1.00 49.94  ? 55  ILE A O     1 
ATOM   193  C CB    . ILE A 1 29  ? -19.656 27.379  39.396  1.00 43.90  ? 55  ILE A CB    1 
ATOM   194  C CG1   . ILE A 1 29  ? -20.310 27.912  38.120  1.00 48.10  ? 55  ILE A CG1   1 
ATOM   195  C CG2   . ILE A 1 29  ? -20.098 28.190  40.603  1.00 31.67  ? 55  ILE A CG2   1 
ATOM   196  C CD1   . ILE A 1 29  ? -21.821 27.877  38.150  1.00 50.67  ? 55  ILE A CD1   1 
ATOM   197  N N     . ILE A 1 30  ? -17.413 25.774  40.909  1.00 40.51  ? 56  ILE A N     1 
ATOM   198  C CA    . ILE A 1 30  ? -16.903 25.315  42.195  1.00 40.54  ? 56  ILE A CA    1 
ATOM   199  C C     . ILE A 1 30  ? -15.379 25.253  42.229  1.00 50.57  ? 56  ILE A C     1 
ATOM   200  O O     . ILE A 1 30  ? -14.742 25.882  43.075  1.00 45.59  ? 56  ILE A O     1 
ATOM   201  C CB    . ILE A 1 30  ? -17.460 23.924  42.556  1.00 32.46  ? 56  ILE A CB    1 
ATOM   202  C CG1   . ILE A 1 30  ? -18.984 23.970  42.671  1.00 31.39  ? 56  ILE A CG1   1 
ATOM   203  C CG2   . ILE A 1 30  ? -16.842 23.421  43.851  1.00 37.54  ? 56  ILE A CG2   1 
ATOM   204  C CD1   . ILE A 1 30  ? -19.607 22.644  43.047  1.00 23.20  ? 56  ILE A CD1   1 
ATOM   205  N N     . HIS A 1 31  ? -14.799 24.494  41.305  1.00 52.42  ? 57  HIS A N     1 
ATOM   206  C CA    . HIS A 1 31  ? -13.366 24.226  41.327  1.00 49.18  ? 57  HIS A CA    1 
ATOM   207  C C     . HIS A 1 31  ? -12.564 25.082  40.353  1.00 56.87  ? 57  HIS A C     1 
ATOM   208  O O     . HIS A 1 31  ? -11.425 24.755  40.022  1.00 66.81  ? 57  HIS A O     1 
ATOM   209  C CB    . HIS A 1 31  ? -13.103 22.743  41.074  1.00 37.57  ? 57  HIS A CB    1 
ATOM   210  C CG    . HIS A 1 31  ? -13.680 21.847  42.123  1.00 46.99  ? 57  HIS A CG    1 
ATOM   211  N ND1   . HIS A 1 31  ? -14.803 21.078  41.911  1.00 55.39  ? 57  HIS A ND1   1 
ATOM   212  C CD2   . HIS A 1 31  ? -13.299 21.612  43.401  1.00 56.64  ? 57  HIS A CD2   1 
ATOM   213  C CE1   . HIS A 1 31  ? -15.084 20.399  43.009  1.00 70.62  ? 57  HIS A CE1   1 
ATOM   214  N NE2   . HIS A 1 31  ? -14.186 20.705  43.928  1.00 73.71  ? 57  HIS A NE2   1 
ATOM   215  N N     . GLU A 1 32  ? -13.162 26.179  39.901  1.00 58.50  ? 58  GLU A N     1 
ATOM   216  C CA    . GLU A 1 32  ? -12.463 27.137  39.053  1.00 47.38  ? 58  GLU A CA    1 
ATOM   217  C C     . GLU A 1 32  ? -12.797 28.562  39.487  1.00 62.69  ? 58  GLU A C     1 
ATOM   218  O O     . GLU A 1 32  ? -13.178 28.793  40.635  1.00 78.34  ? 58  GLU A O     1 
ATOM   219  C CB    . GLU A 1 32  ? -12.814 26.915  37.580  1.00 46.06  ? 58  GLU A CB    1 
ATOM   220  C CG    . GLU A 1 32  ? -12.491 25.511  37.075  1.00 63.40  ? 58  GLU A CG    1 
ATOM   221  C CD    . GLU A 1 32  ? -12.801 25.321  35.599  1.00 79.84  ? 58  GLU A CD    1 
ATOM   222  O OE1   . GLU A 1 32  ? -12.965 24.158  35.172  1.00 68.92  ? 58  GLU A OE1   1 
ATOM   223  O OE2   . GLU A 1 32  ? -12.883 26.331  34.867  1.00 88.91  ? 58  GLU A OE2   1 
ATOM   224  N N     . ALA A 1 33  ? -12.653 29.514  38.572  1.00 58.23  ? 59  ALA A N     1 
ATOM   225  C CA    . ALA A 1 33  ? -12.922 30.913  38.890  1.00 73.21  ? 59  ALA A CA    1 
ATOM   226  C C     . ALA A 1 33  ? -14.375 31.290  38.610  1.00 68.61  ? 59  ALA A C     1 
ATOM   227  O O     . ALA A 1 33  ? -14.745 32.463  38.662  1.00 69.58  ? 59  ALA A O     1 
ATOM   228  C CB    . ALA A 1 33  ? -11.977 31.825  38.119  1.00 81.27  ? 59  ALA A CB    1 
ATOM   229  N N     . GLY A 1 34  ? -15.197 30.288  38.319  1.00 60.66  ? 60  GLY A N     1 
ATOM   230  C CA    . GLY A 1 34  ? -16.584 30.524  37.970  1.00 51.83  ? 60  GLY A CA    1 
ATOM   231  C C     . GLY A 1 34  ? -16.701 31.355  36.708  1.00 55.07  ? 60  GLY A C     1 
ATOM   232  O O     . GLY A 1 34  ? -15.872 31.248  35.804  1.00 52.30  ? 60  GLY A O     1 
ATOM   233  N N     . TYR A 1 35  ? -17.736 32.184  36.644  1.00 62.84  ? 61  TYR A N     1 
ATOM   234  C CA    . TYR A 1 35  ? -17.926 33.083  35.514  1.00 62.55  ? 61  TYR A CA    1 
ATOM   235  C C     . TYR A 1 35  ? -17.724 34.530  35.947  1.00 67.39  ? 61  TYR A C     1 
ATOM   236  O O     . TYR A 1 35  ? -18.388 35.011  36.866  1.00 74.16  ? 61  TYR A O     1 
ATOM   237  C CB    . TYR A 1 35  ? -19.322 32.913  34.914  1.00 57.34  ? 61  TYR A CB    1 
ATOM   238  C CG    . TYR A 1 35  ? -19.579 31.553  34.308  1.00 45.08  ? 61  TYR A CG    1 
ATOM   239  C CD1   . TYR A 1 35  ? -20.179 30.543  35.049  1.00 43.31  ? 61  TYR A CD1   1 
ATOM   240  C CD2   . TYR A 1 35  ? -19.229 31.280  32.992  1.00 57.54  ? 61  TYR A CD2   1 
ATOM   241  C CE1   . TYR A 1 35  ? -20.420 29.297  34.498  1.00 55.68  ? 61  TYR A CE1   1 
ATOM   242  C CE2   . TYR A 1 35  ? -19.466 30.038  32.431  1.00 61.78  ? 61  TYR A CE2   1 
ATOM   243  C CZ    . TYR A 1 35  ? -20.061 29.051  33.188  1.00 61.68  ? 61  TYR A CZ    1 
ATOM   244  O OH    . TYR A 1 35  ? -20.298 27.814  32.633  1.00 54.86  ? 61  TYR A OH    1 
ATOM   245  N N     . SER A 1 36  ? -16.802 35.221  35.285  1.00 61.03  ? 62  SER A N     1 
ATOM   246  C CA    . SER A 1 36  ? -16.548 36.621  35.589  1.00 71.67  ? 62  SER A CA    1 
ATOM   247  C C     . SER A 1 36  ? -17.744 37.471  35.177  1.00 74.83  ? 62  SER A C     1 
ATOM   248  O O     . SER A 1 36  ? -18.525 37.077  34.311  1.00 54.42  ? 62  SER A O     1 
ATOM   249  C CB    . SER A 1 36  ? -15.280 37.108  34.885  1.00 73.62  ? 62  SER A CB    1 
ATOM   250  O OG    . SER A 1 36  ? -15.414 37.036  33.477  1.00 76.43  ? 62  SER A OG    1 
ATOM   251  N N     . GLU A 1 37  ? -17.884 38.632  35.810  1.00 94.10  ? 63  GLU A N     1 
ATOM   252  C CA    . GLU A 1 37  ? -18.972 39.556  35.507  1.00 87.57  ? 63  GLU A CA    1 
ATOM   253  C C     . GLU A 1 37  ? -19.145 39.721  34.003  1.00 69.22  ? 63  GLU A C     1 
ATOM   254  O O     . GLU A 1 37  ? -20.264 39.796  33.498  1.00 64.69  ? 63  GLU A O     1 
ATOM   255  C CB    . GLU A 1 37  ? -18.707 40.917  36.153  1.00 98.45  ? 63  GLU A CB    1 
ATOM   256  C CG    . GLU A 1 37  ? -19.735 41.982  35.809  1.00 105.23 ? 63  GLU A CG    1 
ATOM   257  C CD    . GLU A 1 37  ? -19.338 43.355  36.314  1.00 117.34 ? 63  GLU A CD    1 
ATOM   258  O OE1   . GLU A 1 37  ? -20.080 44.325  36.049  1.00 124.70 ? 63  GLU A OE1   1 
ATOM   259  O OE2   . GLU A 1 37  ? -18.283 43.466  36.974  1.00 119.84 ? 63  GLU A OE2   1 
ATOM   260  N N     . GLU A 1 38  ? -18.025 39.773  33.291  1.00 68.64  ? 64  GLU A N     1 
ATOM   261  C CA    . GLU A 1 38  ? -18.046 39.915  31.844  1.00 75.00  ? 64  GLU A CA    1 
ATOM   262  C C     . GLU A 1 38  ? -18.644 38.677  31.184  1.00 58.63  ? 64  GLU A C     1 
ATOM   263  O O     . GLU A 1 38  ? -19.518 38.783  30.324  1.00 48.99  ? 64  GLU A O     1 
ATOM   264  C CB    . GLU A 1 38  ? -16.633 40.168  31.314  1.00 95.14  ? 64  GLU A CB    1 
ATOM   265  C CG    . GLU A 1 38  ? -16.562 40.382  29.811  1.00 109.02 ? 64  GLU A CG    1 
ATOM   266  C CD    . GLU A 1 38  ? -17.309 41.622  29.362  1.00 118.06 ? 64  GLU A CD    1 
ATOM   267  O OE1   . GLU A 1 38  ? -17.731 42.413  30.232  1.00 116.32 ? 64  GLU A OE1   1 
ATOM   268  O OE2   . GLU A 1 38  ? -17.472 41.806  28.138  1.00 126.16 ? 64  GLU A OE2   1 
ATOM   269  N N     . GLU A 1 39  ? -18.169 37.506  31.595  1.00 53.59  ? 65  GLU A N     1 
ATOM   270  C CA    . GLU A 1 39  ? -18.650 36.245  31.042  1.00 56.42  ? 65  GLU A CA    1 
ATOM   271  C C     . GLU A 1 39  ? -20.155 36.083  31.238  1.00 59.97  ? 65  GLU A C     1 
ATOM   272  O O     . GLU A 1 39  ? -20.847 35.535  30.381  1.00 61.01  ? 65  GLU A O     1 
ATOM   273  C CB    . GLU A 1 39  ? -17.901 35.063  31.665  1.00 66.87  ? 65  GLU A CB    1 
ATOM   274  C CG    . GLU A 1 39  ? -16.426 34.998  31.287  1.00 93.83  ? 65  GLU A CG    1 
ATOM   275  C CD    . GLU A 1 39  ? -15.692 33.854  31.964  1.00 104.05 ? 65  GLU A CD    1 
ATOM   276  O OE1   . GLU A 1 39  ? -16.127 33.426  33.053  1.00 110.94 ? 65  GLU A OE1   1 
ATOM   277  O OE2   . GLU A 1 39  ? -14.675 33.386  31.409  1.00 98.55  ? 65  GLU A OE2   1 
ATOM   278  N N     . CYS A 1 40  ? -20.656 36.567  32.370  1.00 50.84  ? 66  CYS A N     1 
ATOM   279  C CA    . CYS A 1 40  ? -22.078 36.476  32.674  1.00 39.16  ? 66  CYS A CA    1 
ATOM   280  C C     . CYS A 1 40  ? -22.902 37.304  31.698  1.00 39.89  ? 66  CYS A C     1 
ATOM   281  O O     . CYS A 1 40  ? -24.025 36.940  31.357  1.00 52.74  ? 66  CYS A O     1 
ATOM   282  C CB    . CYS A 1 40  ? -22.352 36.934  34.108  1.00 46.38  ? 66  CYS A CB    1 
ATOM   283  S SG    . CYS A 1 40  ? -21.638 35.869  35.383  1.00 81.35  ? 66  CYS A SG    1 
ATOM   284  N N     . LYS A 1 41  ? -22.335 38.419  31.250  1.00 40.11  ? 67  LYS A N     1 
ATOM   285  C CA    . LYS A 1 41  ? -23.029 39.313  30.331  1.00 46.94  ? 67  LYS A CA    1 
ATOM   286  C C     . LYS A 1 41  ? -23.251 38.663  28.968  1.00 56.87  ? 67  LYS A C     1 
ATOM   287  O O     . LYS A 1 41  ? -24.158 39.046  28.229  1.00 61.65  ? 67  LYS A O     1 
ATOM   288  C CB    . LYS A 1 41  ? -22.252 40.622  30.171  1.00 45.04  ? 67  LYS A CB    1 
ATOM   289  C CG    . LYS A 1 41  ? -22.082 41.406  31.462  1.00 54.06  ? 67  LYS A CG    1 
ATOM   290  C CD    . LYS A 1 41  ? -21.362 42.725  31.219  1.00 66.18  ? 67  LYS A CD    1 
ATOM   291  C CE    . LYS A 1 41  ? -21.222 43.525  32.506  1.00 66.67  ? 67  LYS A CE    1 
ATOM   292  N NZ    . LYS A 1 41  ? -20.558 44.839  32.281  1.00 62.02  ? 67  LYS A NZ    1 
ATOM   293  N N     . GLN A 1 42  ? -22.419 37.679  28.642  1.00 58.35  ? 68  GLN A N     1 
ATOM   294  C CA    . GLN A 1 42  ? -22.508 36.985  27.361  1.00 59.39  ? 68  GLN A CA    1 
ATOM   295  C C     . GLN A 1 42  ? -23.800 36.181  27.256  1.00 67.12  ? 68  GLN A C     1 
ATOM   296  O O     . GLN A 1 42  ? -24.385 36.065  26.179  1.00 78.86  ? 68  GLN A O     1 
ATOM   297  C CB    . GLN A 1 42  ? -21.309 36.053  27.174  1.00 72.32  ? 68  GLN A CB    1 
ATOM   298  C CG    . GLN A 1 42  ? -19.952 36.730  27.305  1.00 88.50  ? 68  GLN A CG    1 
ATOM   299  C CD    . GLN A 1 42  ? -19.597 37.580  26.100  1.00 92.60  ? 68  GLN A CD    1 
ATOM   300  O OE1   . GLN A 1 42  ? -20.227 37.481  25.047  1.00 106.18 ? 68  GLN A OE1   1 
ATOM   301  N NE2   . GLN A 1 42  ? -18.578 38.418  26.248  1.00 79.88  ? 68  GLN A NE2   1 
ATOM   302  N N     . TYR A 1 43  ? -24.239 35.630  28.384  1.00 61.23  ? 69  TYR A N     1 
ATOM   303  C CA    . TYR A 1 43  ? -25.404 34.751  28.411  1.00 46.76  ? 69  TYR A CA    1 
ATOM   304  C C     . TYR A 1 43  ? -26.727 35.508  28.495  1.00 47.80  ? 69  TYR A C     1 
ATOM   305  O O     . TYR A 1 43  ? -27.796 34.903  28.441  1.00 58.62  ? 69  TYR A O     1 
ATOM   306  C CB    . TYR A 1 43  ? -25.301 33.767  29.579  1.00 49.23  ? 69  TYR A CB    1 
ATOM   307  C CG    . TYR A 1 43  ? -24.130 32.817  29.485  1.00 60.27  ? 69  TYR A CG    1 
ATOM   308  C CD1   . TYR A 1 43  ? -22.868 33.194  29.925  1.00 69.01  ? 69  TYR A CD1   1 
ATOM   309  C CD2   . TYR A 1 43  ? -24.288 31.540  28.963  1.00 67.11  ? 69  TYR A CD2   1 
ATOM   310  C CE1   . TYR A 1 43  ? -21.794 32.326  29.842  1.00 76.89  ? 69  TYR A CE1   1 
ATOM   311  C CE2   . TYR A 1 43  ? -23.221 30.666  28.877  1.00 71.46  ? 69  TYR A CE2   1 
ATOM   312  C CZ    . TYR A 1 43  ? -21.977 31.063  29.317  1.00 78.53  ? 69  TYR A CZ    1 
ATOM   313  O OH    . TYR A 1 43  ? -20.913 30.193  29.233  1.00 86.51  ? 69  TYR A OH    1 
ATOM   314  N N     . LYS A 1 44  ? -26.657 36.827  28.631  1.00 42.57  ? 70  LYS A N     1 
ATOM   315  C CA    . LYS A 1 44  ? -27.867 37.636  28.728  1.00 48.82  ? 70  LYS A CA    1 
ATOM   316  C C     . LYS A 1 44  ? -28.829 37.322  27.585  1.00 45.00  ? 70  LYS A C     1 
ATOM   317  O O     . LYS A 1 44  ? -30.044 37.286  27.776  1.00 37.84  ? 70  LYS A O     1 
ATOM   318  C CB    . LYS A 1 44  ? -27.523 39.127  28.736  1.00 68.49  ? 70  LYS A CB    1 
ATOM   319  C CG    . LYS A 1 44  ? -28.727 40.040  28.912  1.00 75.84  ? 70  LYS A CG    1 
ATOM   320  C CD    . LYS A 1 44  ? -28.304 41.495  29.045  1.00 85.73  ? 70  LYS A CD    1 
ATOM   321  C CE    . LYS A 1 44  ? -29.497 42.396  29.325  1.00 85.16  ? 70  LYS A CE    1 
ATOM   322  N NZ    . LYS A 1 44  ? -29.079 43.794  29.621  1.00 85.73  ? 70  LYS A NZ    1 
ATOM   323  N N     . ALA A 1 45  ? -28.276 37.087  26.400  1.00 48.05  ? 71  ALA A N     1 
ATOM   324  C CA    . ALA A 1 45  ? -29.082 36.793  25.221  1.00 55.22  ? 71  ALA A CA    1 
ATOM   325  C C     . ALA A 1 45  ? -29.791 35.448  25.343  1.00 62.54  ? 71  ALA A C     1 
ATOM   326  O O     . ALA A 1 45  ? -31.005 35.356  25.154  1.00 57.85  ? 71  ALA A O     1 
ATOM   327  C CB    . ALA A 1 45  ? -28.221 36.826  23.970  1.00 55.35  ? 71  ALA A CB    1 
ATOM   328  N N     . VAL A 1 46  ? -29.028 34.407  25.657  1.00 62.79  ? 72  VAL A N     1 
ATOM   329  C CA    . VAL A 1 46  ? -29.579 33.060  25.752  1.00 57.26  ? 72  VAL A CA    1 
ATOM   330  C C     . VAL A 1 46  ? -30.581 32.942  26.900  1.00 57.51  ? 72  VAL A C     1 
ATOM   331  O O     . VAL A 1 46  ? -31.523 32.152  26.833  1.00 68.47  ? 72  VAL A O     1 
ATOM   332  C CB    . VAL A 1 46  ? -28.467 31.994  25.901  1.00 57.77  ? 72  VAL A CB    1 
ATOM   333  C CG1   . VAL A 1 46  ? -27.658 32.235  27.162  1.00 73.50  ? 72  VAL A CG1   1 
ATOM   334  C CG2   . VAL A 1 46  ? -29.065 30.596  25.906  1.00 53.27  ? 72  VAL A CG2   1 
ATOM   335  N N     . VAL A 1 47  ? -30.382 33.732  27.949  1.00 44.94  ? 73  VAL A N     1 
ATOM   336  C CA    . VAL A 1 47  ? -31.308 33.724  29.074  1.00 46.88  ? 73  VAL A CA    1 
ATOM   337  C C     . VAL A 1 47  ? -32.679 34.208  28.622  1.00 42.57  ? 73  VAL A C     1 
ATOM   338  O O     . VAL A 1 47  ? -33.692 33.563  28.889  1.00 43.94  ? 73  VAL A O     1 
ATOM   339  C CB    . VAL A 1 47  ? -30.810 34.594  30.241  1.00 48.69  ? 73  VAL A CB    1 
ATOM   340  C CG1   . VAL A 1 47  ? -31.907 34.758  31.286  1.00 35.94  ? 73  VAL A CG1   1 
ATOM   341  C CG2   . VAL A 1 47  ? -29.561 33.984  30.860  1.00 43.54  ? 73  VAL A CG2   1 
ATOM   342  N N     . TYR A 1 48  ? -32.702 35.345  27.933  1.00 36.11  ? 74  TYR A N     1 
ATOM   343  C CA    . TYR A 1 48  ? -33.938 35.861  27.361  1.00 42.75  ? 74  TYR A CA    1 
ATOM   344  C C     . TYR A 1 48  ? -34.584 34.813  26.460  1.00 53.88  ? 74  TYR A C     1 
ATOM   345  O O     . TYR A 1 48  ? -35.794 34.593  26.511  1.00 69.52  ? 74  TYR A O     1 
ATOM   346  C CB    . TYR A 1 48  ? -33.677 37.139  26.561  1.00 41.63  ? 74  TYR A CB    1 
ATOM   347  C CG    . TYR A 1 48  ? -33.368 38.356  27.402  1.00 48.55  ? 74  TYR A CG    1 
ATOM   348  C CD1   . TYR A 1 48  ? -34.149 38.679  28.503  1.00 58.27  ? 74  TYR A CD1   1 
ATOM   349  C CD2   . TYR A 1 48  ? -32.311 39.199  27.079  1.00 49.38  ? 74  TYR A CD2   1 
ATOM   350  C CE1   . TYR A 1 48  ? -33.876 39.797  29.271  1.00 70.94  ? 74  TYR A CE1   1 
ATOM   351  C CE2   . TYR A 1 48  ? -32.031 40.319  27.840  1.00 60.75  ? 74  TYR A CE2   1 
ATOM   352  C CZ    . TYR A 1 48  ? -32.817 40.614  28.935  1.00 75.68  ? 74  TYR A CZ    1 
ATOM   353  O OH    . TYR A 1 48  ? -32.546 41.728  29.698  1.00 81.45  ? 74  TYR A OH    1 
ATOM   354  N N     . SER A 1 49  ? -33.765 34.168  25.636  1.00 36.27  ? 75  SER A N     1 
ATOM   355  C CA    . SER A 1 49  ? -34.250 33.150  24.713  1.00 37.97  ? 75  SER A CA    1 
ATOM   356  C C     . SER A 1 49  ? -34.964 32.017  25.438  1.00 52.54  ? 75  SER A C     1 
ATOM   357  O O     . SER A 1 49  ? -36.163 31.806  25.252  1.00 49.75  ? 75  SER A O     1 
ATOM   358  C CB    . SER A 1 49  ? -33.095 32.590  23.880  1.00 54.92  ? 75  SER A CB    1 
ATOM   359  O OG    . SER A 1 49  ? -32.526 33.597  23.062  1.00 83.77  ? 75  SER A OG    1 
ATOM   360  N N     . ASN A 1 50  ? -34.218 31.291  26.265  1.00 55.28  ? 76  ASN A N     1 
ATOM   361  C CA    . ASN A 1 50  ? -34.759 30.154  27.000  1.00 50.18  ? 76  ASN A CA    1 
ATOM   362  C C     . ASN A 1 50  ? -36.065 30.498  27.703  1.00 51.93  ? 76  ASN A C     1 
ATOM   363  O O     . ASN A 1 50  ? -36.986 29.685  27.759  1.00 51.70  ? 76  ASN A O     1 
ATOM   364  C CB    . ASN A 1 50  ? -33.737 29.642  28.016  1.00 53.70  ? 76  ASN A CB    1 
ATOM   365  C CG    . ASN A 1 50  ? -32.429 29.226  27.370  1.00 53.99  ? 76  ASN A CG    1 
ATOM   366  O OD1   . ASN A 1 50  ? -31.508 28.769  28.045  1.00 62.03  ? 76  ASN A OD1   1 
ATOM   367  N ND2   . ASN A 1 50  ? -32.343 29.381  26.055  1.00 56.35  ? 76  ASN A ND2   1 
ATOM   368  N N     . THR A 1 51  ? -36.133 31.710  28.242  1.00 49.05  ? 77  THR A N     1 
ATOM   369  C CA    . THR A 1 51  ? -37.338 32.194  28.899  1.00 39.67  ? 77  THR A CA    1 
ATOM   370  C C     . THR A 1 51  ? -38.509 32.168  27.929  1.00 44.33  ? 77  THR A C     1 
ATOM   371  O O     . THR A 1 51  ? -39.523 31.515  28.175  1.00 56.02  ? 77  THR A O     1 
ATOM   372  C CB    . THR A 1 51  ? -37.151 33.634  29.393  1.00 33.29  ? 77  THR A CB    1 
ATOM   373  O OG1   . THR A 1 51  ? -36.028 33.695  30.279  1.00 29.52  ? 77  THR A OG1   1 
ATOM   374  C CG2   . THR A 1 51  ? -38.397 34.116  30.117  1.00 33.51  ? 77  THR A CG2   1 
ATOM   375  N N     . ILE A 1 52  ? -38.354 32.885  26.822  1.00 40.30  ? 78  ILE A N     1 
ATOM   376  C CA    . ILE A 1 52  ? -39.384 32.965  25.798  1.00 39.34  ? 78  ILE A CA    1 
ATOM   377  C C     . ILE A 1 52  ? -39.681 31.596  25.196  1.00 45.71  ? 78  ILE A C     1 
ATOM   378  O O     . ILE A 1 52  ? -40.837 31.249  24.954  1.00 43.77  ? 78  ILE A O     1 
ATOM   379  C CB    . ILE A 1 52  ? -38.966 33.929  24.678  1.00 37.83  ? 78  ILE A CB    1 
ATOM   380  C CG1   . ILE A 1 52  ? -38.646 35.305  25.262  1.00 48.56  ? 78  ILE A CG1   1 
ATOM   381  C CG2   . ILE A 1 52  ? -40.057 34.032  23.630  1.00 60.54  ? 78  ILE A CG2   1 
ATOM   382  C CD1   . ILE A 1 52  ? -38.188 36.312  24.237  1.00 62.33  ? 78  ILE A CD1   1 
ATOM   383  N N     . GLN A 1 53  ? -38.630 30.819  24.958  1.00 44.35  ? 79  GLN A N     1 
ATOM   384  C CA    . GLN A 1 53  ? -38.783 29.488  24.388  1.00 50.04  ? 79  GLN A CA    1 
ATOM   385  C C     . GLN A 1 53  ? -39.622 28.597  25.296  1.00 44.59  ? 79  GLN A C     1 
ATOM   386  O O     . GLN A 1 53  ? -40.336 27.711  24.826  1.00 52.73  ? 79  GLN A O     1 
ATOM   387  C CB    . GLN A 1 53  ? -37.414 28.853  24.137  1.00 58.78  ? 79  GLN A CB    1 
ATOM   388  C CG    . GLN A 1 53  ? -36.554 29.618  23.143  1.00 57.12  ? 79  GLN A CG    1 
ATOM   389  C CD    . GLN A 1 53  ? -35.182 29.000  22.960  1.00 54.12  ? 79  GLN A CD    1 
ATOM   390  O OE1   . GLN A 1 53  ? -34.843 28.012  23.610  1.00 59.75  ? 79  GLN A OE1   1 
ATOM   391  N NE2   . GLN A 1 53  ? -34.384 29.582  22.073  1.00 51.54  ? 79  GLN A NE2   1 
ATOM   392  N N     . SER A 1 54  ? -39.537 28.841  26.598  1.00 37.93  ? 80  SER A N     1 
ATOM   393  C CA    . SER A 1 54  ? -40.282 28.053  27.572  1.00 36.63  ? 80  SER A CA    1 
ATOM   394  C C     . SER A 1 54  ? -41.764 28.401  27.552  1.00 47.91  ? 80  SER A C     1 
ATOM   395  O O     . SER A 1 54  ? -42.615 27.517  27.437  1.00 52.33  ? 80  SER A O     1 
ATOM   396  C CB    . SER A 1 54  ? -39.716 28.257  28.979  1.00 25.09  ? 80  SER A CB    1 
ATOM   397  O OG    . SER A 1 54  ? -38.394 27.755  29.074  1.00 35.59  ? 80  SER A OG    1 
ATOM   398  N N     . ILE A 1 55  ? -42.069 29.690  27.667  1.00 41.60  ? 81  ILE A N     1 
ATOM   399  C CA    . ILE A 1 55  ? -43.456 30.139  27.697  1.00 43.88  ? 81  ILE A CA    1 
ATOM   400  C C     . ILE A 1 55  ? -44.181 29.739  26.416  1.00 44.47  ? 81  ILE A C     1 
ATOM   401  O O     . ILE A 1 55  ? -45.333 29.307  26.451  1.00 38.73  ? 81  ILE A O     1 
ATOM   402  C CB    . ILE A 1 55  ? -43.566 31.662  27.924  1.00 44.47  ? 81  ILE A CB    1 
ATOM   403  C CG1   . ILE A 1 55  ? -45.035 32.090  27.972  1.00 50.59  ? 81  ILE A CG1   1 
ATOM   404  C CG2   . ILE A 1 55  ? -42.821 32.425  26.842  1.00 52.01  ? 81  ILE A CG2   1 
ATOM   405  C CD1   . ILE A 1 55  ? -45.843 31.381  29.037  1.00 54.27  ? 81  ILE A CD1   1 
ATOM   406  N N     . ILE A 1 56  ? -43.494 29.873  25.287  1.00 40.09  ? 82  ILE A N     1 
ATOM   407  C CA    . ILE A 1 56  ? -44.047 29.459  24.007  1.00 34.22  ? 82  ILE A CA    1 
ATOM   408  C C     . ILE A 1 56  ? -44.353 27.966  24.018  1.00 43.27  ? 82  ILE A C     1 
ATOM   409  O O     . ILE A 1 56  ? -45.396 27.530  23.527  1.00 52.82  ? 82  ILE A O     1 
ATOM   410  C CB    . ILE A 1 56  ? -43.085 29.775  22.851  1.00 43.55  ? 82  ILE A CB    1 
ATOM   411  C CG1   . ILE A 1 56  ? -42.975 31.288  22.655  1.00 59.78  ? 82  ILE A CG1   1 
ATOM   412  C CG2   . ILE A 1 56  ? -43.556 29.110  21.570  1.00 41.53  ? 82  ILE A CG2   1 
ATOM   413  C CD1   . ILE A 1 56  ? -42.173 31.692  21.437  1.00 56.53  ? 82  ILE A CD1   1 
ATOM   414  N N     . ALA A 1 57  ? -43.438 27.189  24.588  1.00 39.38  ? 83  ALA A N     1 
ATOM   415  C CA    . ALA A 1 57  ? -43.600 25.742  24.676  1.00 37.90  ? 83  ALA A CA    1 
ATOM   416  C C     . ALA A 1 57  ? -44.880 25.367  25.416  1.00 42.81  ? 83  ALA A C     1 
ATOM   417  O O     . ALA A 1 57  ? -45.578 24.429  25.029  1.00 37.98  ? 83  ALA A O     1 
ATOM   418  C CB    . ALA A 1 57  ? -42.391 25.116  25.353  1.00 44.68  ? 83  ALA A CB    1 
ATOM   419  N N     . ILE A 1 58  ? -45.180 26.102  26.484  1.00 32.15  ? 84  ILE A N     1 
ATOM   420  C CA    . ILE A 1 58  ? -46.393 25.860  27.257  1.00 37.16  ? 84  ILE A CA    1 
ATOM   421  C C     . ILE A 1 58  ? -47.630 26.292  26.481  1.00 49.42  ? 84  ILE A C     1 
ATOM   422  O O     . ILE A 1 58  ? -48.619 25.563  26.416  1.00 56.95  ? 84  ILE A O     1 
ATOM   423  C CB    . ILE A 1 58  ? -46.370 26.601  28.604  1.00 30.26  ? 84  ILE A CB    1 
ATOM   424  C CG1   . ILE A 1 58  ? -45.259 26.053  29.497  1.00 29.99  ? 84  ILE A CG1   1 
ATOM   425  C CG2   . ILE A 1 58  ? -47.715 26.475  29.303  1.00 24.43  ? 84  ILE A CG2   1 
ATOM   426  C CD1   . ILE A 1 58  ? -45.249 26.656  30.880  1.00 32.86  ? 84  ILE A CD1   1 
ATOM   427  N N     . ILE A 1 59  ? -47.570 27.484  25.898  1.00 46.52  ? 85  ILE A N     1 
ATOM   428  C CA    . ILE A 1 59  ? -48.690 28.004  25.127  1.00 54.19  ? 85  ILE A CA    1 
ATOM   429  C C     . ILE A 1 59  ? -49.099 27.022  24.034  1.00 58.98  ? 85  ILE A C     1 
ATOM   430  O O     . ILE A 1 59  ? -50.276 26.693  23.898  1.00 61.13  ? 85  ILE A O     1 
ATOM   431  C CB    . ILE A 1 59  ? -48.364 29.370  24.499  1.00 55.22  ? 85  ILE A CB    1 
ATOM   432  C CG1   . ILE A 1 59  ? -48.024 30.386  25.591  1.00 51.62  ? 85  ILE A CG1   1 
ATOM   433  C CG2   . ILE A 1 59  ? -49.532 29.861  23.659  1.00 42.66  ? 85  ILE A CG2   1 
ATOM   434  C CD1   . ILE A 1 59  ? -49.098 30.528  26.648  1.00 48.48  ? 85  ILE A CD1   1 
ATOM   435  N N     . ARG A 1 60  ? -48.123 26.550  23.263  1.00 56.66  ? 86  ARG A N     1 
ATOM   436  C CA    . ARG A 1 60  ? -48.395 25.580  22.208  1.00 61.91  ? 86  ARG A CA    1 
ATOM   437  C C     . ARG A 1 60  ? -49.031 24.317  22.773  1.00 59.25  ? 86  ARG A C     1 
ATOM   438  O O     . ARG A 1 60  ? -49.890 23.704  22.137  1.00 52.32  ? 86  ARG A O     1 
ATOM   439  C CB    . ARG A 1 60  ? -47.118 25.225  21.442  1.00 69.11  ? 86  ARG A CB    1 
ATOM   440  C CG    . ARG A 1 60  ? -46.638 26.313  20.498  1.00 86.91  ? 86  ARG A CG    1 
ATOM   441  C CD    . ARG A 1 60  ? -45.801 25.729  19.370  1.00 93.90  ? 86  ARG A CD    1 
ATOM   442  N NE    . ARG A 1 60  ? -45.368 26.753  18.423  1.00 105.51 ? 86  ARG A NE    1 
ATOM   443  C CZ    . ARG A 1 60  ? -44.167 27.321  18.433  1.00 114.14 ? 86  ARG A CZ    1 
ATOM   444  N NH1   . ARG A 1 60  ? -43.269 26.961  19.340  1.00 113.71 ? 86  ARG A NH1   1 
ATOM   445  N NH2   . ARG A 1 60  ? -43.859 28.244  17.533  1.00 115.94 ? 86  ARG A NH2   1 
ATOM   446  N N     . ALA A 1 61  ? -48.603 23.933  23.971  1.00 51.25  ? 87  ALA A N     1 
ATOM   447  C CA    . ALA A 1 61  ? -49.141 22.750  24.629  1.00 47.20  ? 87  ALA A CA    1 
ATOM   448  C C     . ALA A 1 61  ? -50.632 22.915  24.897  1.00 50.44  ? 87  ALA A C     1 
ATOM   449  O O     . ALA A 1 61  ? -51.399 21.957  24.803  1.00 52.34  ? 87  ALA A O     1 
ATOM   450  C CB    . ALA A 1 61  ? -48.392 22.475  25.922  1.00 46.50  ? 87  ALA A CB    1 
ATOM   451  N N     . MET A 1 62  ? -51.037 24.138  25.224  1.00 44.16  ? 88  MET A N     1 
ATOM   452  C CA    . MET A 1 62  ? -52.434 24.424  25.523  1.00 41.80  ? 88  MET A CA    1 
ATOM   453  C C     . MET A 1 62  ? -53.331 24.112  24.330  1.00 54.22  ? 88  MET A C     1 
ATOM   454  O O     . MET A 1 62  ? -54.487 23.726  24.494  1.00 69.02  ? 88  MET A O     1 
ATOM   455  C CB    . MET A 1 62  ? -52.604 25.884  25.946  1.00 41.19  ? 88  MET A CB    1 
ATOM   456  C CG    . MET A 1 62  ? -51.696 26.305  27.089  1.00 48.83  ? 88  MET A CG    1 
ATOM   457  S SD    . MET A 1 62  ? -52.070 27.954  27.709  1.00 61.80  ? 88  MET A SD    1 
ATOM   458  C CE    . MET A 1 62  ? -53.668 27.669  28.464  1.00 70.90  ? 88  MET A CE    1 
ATOM   459  N N     . GLY A 1 63  ? -52.793 24.281  23.128  1.00 55.68  ? 89  GLY A N     1 
ATOM   460  C CA    . GLY A 1 63  ? -53.539 23.987  21.921  1.00 58.45  ? 89  GLY A CA    1 
ATOM   461  C C     . GLY A 1 63  ? -53.680 22.495  21.696  1.00 60.38  ? 89  GLY A C     1 
ATOM   462  O O     . GLY A 1 63  ? -54.757 22.007  21.354  1.00 59.40  ? 89  GLY A O     1 
ATOM   463  N N     . ARG A 1 64  ? -52.585 21.768  21.897  1.00 54.00  ? 90  ARG A N     1 
ATOM   464  C CA    . ARG A 1 64  ? -52.569 20.327  21.671  1.00 47.48  ? 90  ARG A CA    1 
ATOM   465  C C     . ARG A 1 64  ? -53.291 19.558  22.775  1.00 49.69  ? 90  ARG A C     1 
ATOM   466  O O     . ARG A 1 64  ? -53.747 18.435  22.561  1.00 59.71  ? 90  ARG A O     1 
ATOM   467  C CB    . ARG A 1 64  ? -51.131 19.824  21.512  1.00 59.21  ? 90  ARG A CB    1 
ATOM   468  C CG    . ARG A 1 64  ? -50.472 20.265  20.212  1.00 78.96  ? 90  ARG A CG    1 
ATOM   469  C CD    . ARG A 1 64  ? -49.023 19.807  20.110  1.00 92.34  ? 90  ARG A CD    1 
ATOM   470  N NE    . ARG A 1 64  ? -48.130 20.583  20.968  1.00 96.97  ? 90  ARG A NE    1 
ATOM   471  C CZ    . ARG A 1 64  ? -47.453 20.080  21.996  1.00 90.42  ? 90  ARG A CZ    1 
ATOM   472  N NH1   . ARG A 1 64  ? -47.558 18.793  22.298  1.00 83.52  ? 90  ARG A NH1   1 
ATOM   473  N NH2   . ARG A 1 64  ? -46.665 20.864  22.719  1.00 85.98  ? 90  ARG A NH2   1 
ATOM   474  N N     . LEU A 1 65  ? -53.398 20.165  23.953  1.00 43.38  ? 91  LEU A N     1 
ATOM   475  C CA    . LEU A 1 65  ? -54.089 19.529  25.070  1.00 45.13  ? 91  LEU A CA    1 
ATOM   476  C C     . LEU A 1 65  ? -55.505 20.071  25.230  1.00 47.02  ? 91  LEU A C     1 
ATOM   477  O O     . LEU A 1 65  ? -56.253 19.628  26.103  1.00 46.27  ? 91  LEU A O     1 
ATOM   478  C CB    . LEU A 1 65  ? -53.305 19.708  26.373  1.00 48.93  ? 91  LEU A CB    1 
ATOM   479  C CG    . LEU A 1 65  ? -51.893 19.119  26.414  1.00 47.64  ? 91  LEU A CG    1 
ATOM   480  C CD1   . LEU A 1 65  ? -51.292 19.280  27.800  1.00 25.77  ? 91  LEU A CD1   1 
ATOM   481  C CD2   . LEU A 1 65  ? -51.903 17.656  26.000  1.00 58.50  ? 91  LEU A CD2   1 
ATOM   482  N N     . LYS A 1 66  ? -55.863 21.033  24.386  1.00 52.57  ? 92  LYS A N     1 
ATOM   483  C CA    . LYS A 1 66  ? -57.208 21.596  24.382  1.00 68.75  ? 92  LYS A CA    1 
ATOM   484  C C     . LYS A 1 66  ? -57.540 22.268  25.715  1.00 74.66  ? 92  LYS A C     1 
ATOM   485  O O     . LYS A 1 66  ? -58.620 22.065  26.270  1.00 82.71  ? 92  LYS A O     1 
ATOM   486  C CB    . LYS A 1 66  ? -58.237 20.506  24.070  1.00 83.13  ? 92  LYS A CB    1 
ATOM   487  C CG    . LYS A 1 66  ? -59.558 21.018  23.517  1.00 95.59  ? 92  LYS A CG    1 
ATOM   488  C CD    . LYS A 1 66  ? -59.422 21.450  22.065  1.00 101.88 ? 92  LYS A CD    1 
ATOM   489  C CE    . LYS A 1 66  ? -60.771 21.835  21.477  1.00 106.77 ? 92  LYS A CE    1 
ATOM   490  N NZ    . LYS A 1 66  ? -60.677 22.159  20.027  1.00 106.81 ? 92  LYS A NZ    1 
ATOM   491  N N     . ILE A 1 67  ? -56.605 23.066  26.224  1.00 68.85  ? 93  ILE A N     1 
ATOM   492  C CA    . ILE A 1 67  ? -56.805 23.785  27.480  1.00 63.74  ? 93  ILE A CA    1 
ATOM   493  C C     . ILE A 1 67  ? -57.139 25.256  27.236  1.00 70.10  ? 93  ILE A C     1 
ATOM   494  O O     . ILE A 1 67  ? -56.501 25.920  26.418  1.00 69.15  ? 93  ILE A O     1 
ATOM   495  C CB    . ILE A 1 67  ? -55.561 23.696  28.386  1.00 62.78  ? 93  ILE A CB    1 
ATOM   496  C CG1   . ILE A 1 67  ? -55.257 22.239  28.738  1.00 46.97  ? 93  ILE A CG1   1 
ATOM   497  C CG2   . ILE A 1 67  ? -55.760 24.520  29.651  1.00 65.37  ? 93  ILE A CG2   1 
ATOM   498  C CD1   . ILE A 1 67  ? -54.042 22.071  29.624  1.00 27.52  ? 93  ILE A CD1   1 
ATOM   499  N N     . ASP A 1 68  ? -58.140 25.758  27.952  1.00 72.12  ? 94  ASP A N     1 
ATOM   500  C CA    . ASP A 1 68  ? -58.569 27.146  27.805  1.00 76.95  ? 94  ASP A CA    1 
ATOM   501  C C     . ASP A 1 68  ? -57.831 28.065  28.772  1.00 72.93  ? 94  ASP A C     1 
ATOM   502  O O     . ASP A 1 68  ? -57.346 27.625  29.815  1.00 72.64  ? 94  ASP A O     1 
ATOM   503  C CB    . ASP A 1 68  ? -60.079 27.269  28.025  1.00 80.84  ? 94  ASP A CB    1 
ATOM   504  C CG    . ASP A 1 68  ? -60.887 26.578  26.943  1.00 81.28  ? 94  ASP A CG    1 
ATOM   505  O OD1   . ASP A 1 68  ? -60.289 26.136  25.939  1.00 82.63  ? 94  ASP A OD1   1 
ATOM   506  O OD2   . ASP A 1 68  ? -62.123 26.479  27.096  1.00 78.13  ? 94  ASP A OD2   1 
ATOM   507  N N     . PHE A 1 69  ? -57.748 29.344  28.416  1.00 62.81  ? 95  PHE A N     1 
ATOM   508  C CA    . PHE A 1 69  ? -57.142 30.345  29.286  1.00 58.72  ? 95  PHE A CA    1 
ATOM   509  C C     . PHE A 1 69  ? -58.072 30.670  30.450  1.00 70.85  ? 95  PHE A C     1 
ATOM   510  O O     . PHE A 1 69  ? -59.294 30.681  30.294  1.00 70.75  ? 95  PHE A O     1 
ATOM   511  C CB    . PHE A 1 69  ? -56.825 31.622  28.502  1.00 53.12  ? 95  PHE A CB    1 
ATOM   512  C CG    . PHE A 1 69  ? -55.718 31.462  27.497  1.00 67.34  ? 95  PHE A CG    1 
ATOM   513  C CD1   . PHE A 1 69  ? -54.401 31.711  27.850  1.00 73.44  ? 95  PHE A CD1   1 
ATOM   514  C CD2   . PHE A 1 69  ? -55.994 31.069  26.198  1.00 75.88  ? 95  PHE A CD2   1 
ATOM   515  C CE1   . PHE A 1 69  ? -53.379 31.568  26.928  1.00 68.13  ? 95  PHE A CE1   1 
ATOM   516  C CE2   . PHE A 1 69  ? -54.976 30.923  25.271  1.00 79.32  ? 95  PHE A CE2   1 
ATOM   517  C CZ    . PHE A 1 69  ? -53.667 31.173  25.637  1.00 69.81  ? 95  PHE A CZ    1 
ATOM   518  N N     . GLY A 1 70  ? -57.490 30.931  31.616  1.00 76.49  ? 96  GLY A N     1 
ATOM   519  C CA    . GLY A 1 70  ? -58.265 31.306  32.784  1.00 79.83  ? 96  GLY A CA    1 
ATOM   520  C C     . GLY A 1 70  ? -59.008 32.606  32.549  1.00 84.15  ? 96  GLY A C     1 
ATOM   521  O O     . GLY A 1 70  ? -60.111 32.808  33.056  1.00 78.73  ? 96  GLY A O     1 
ATOM   522  N N     . ASP A 1 71  ? -58.391 33.491  31.774  1.00 96.46  ? 97  ASP A N     1 
ATOM   523  C CA    . ASP A 1 71  ? -59.009 34.755  31.399  1.00 111.76 ? 97  ASP A CA    1 
ATOM   524  C C     . ASP A 1 71  ? -59.016 34.879  29.878  1.00 121.84 ? 97  ASP A C     1 
ATOM   525  O O     . ASP A 1 71  ? -57.970 34.777  29.237  1.00 129.62 ? 97  ASP A O     1 
ATOM   526  C CB    . ASP A 1 71  ? -58.252 35.926  32.028  1.00 122.15 ? 97  ASP A CB    1 
ATOM   527  C CG    . ASP A 1 71  ? -58.958 37.253  31.831  1.00 135.90 ? 97  ASP A CG    1 
ATOM   528  O OD1   . ASP A 1 71  ? -60.071 37.260  31.264  1.00 142.82 ? 97  ASP A OD1   1 
ATOM   529  O OD2   . ASP A 1 71  ? -58.401 38.291  32.247  1.00 138.81 ? 97  ASP A OD2   1 
ATOM   530  N N     . SER A 1 72  ? -60.197 35.095  29.306  1.00 120.07 ? 98  SER A N     1 
ATOM   531  C CA    . SER A 1 72  ? -60.349 35.155  27.854  1.00 110.25 ? 98  SER A CA    1 
ATOM   532  C C     . SER A 1 72  ? -59.552 36.299  27.231  1.00 97.67  ? 98  SER A C     1 
ATOM   533  O O     . SER A 1 72  ? -59.400 36.366  26.011  1.00 82.13  ? 98  SER A O     1 
ATOM   534  C CB    . SER A 1 72  ? -61.828 35.271  27.473  1.00 110.13 ? 98  SER A CB    1 
ATOM   535  O OG    . SER A 1 72  ? -62.416 36.428  28.042  1.00 110.21 ? 98  SER A OG    1 
ATOM   536  N N     . ALA A 1 73  ? -59.044 37.192  28.073  1.00 99.92  ? 99  ALA A N     1 
ATOM   537  C CA    . ALA A 1 73  ? -58.277 38.342  27.606  1.00 96.49  ? 99  ALA A CA    1 
ATOM   538  C C     . ALA A 1 73  ? -56.855 37.953  27.211  1.00 88.63  ? 99  ALA A C     1 
ATOM   539  O O     . ALA A 1 73  ? -56.244 38.590  26.353  1.00 70.47  ? 99  ALA A O     1 
ATOM   540  C CB    . ALA A 1 73  ? -58.254 39.429  28.671  1.00 96.37  ? 99  ALA A CB    1 
ATOM   541  N N     . ARG A 1 74  ? -56.336 36.904  27.842  1.00 101.80 ? 100 ARG A N     1 
ATOM   542  C CA    . ARG A 1 74  ? -54.970 36.452  27.598  1.00 103.99 ? 100 ARG A CA    1 
ATOM   543  C C     . ARG A 1 74  ? -54.771 35.984  26.158  1.00 100.01 ? 100 ARG A C     1 
ATOM   544  O O     . ARG A 1 74  ? -53.644 35.933  25.663  1.00 97.77  ? 100 ARG A O     1 
ATOM   545  C CB    . ARG A 1 74  ? -54.599 35.326  28.567  1.00 98.31  ? 100 ARG A CB    1 
ATOM   546  C CG    . ARG A 1 74  ? -54.756 35.677  30.043  1.00 95.96  ? 100 ARG A CG    1 
ATOM   547  C CD    . ARG A 1 74  ? -53.665 36.622  30.528  1.00 93.23  ? 100 ARG A CD    1 
ATOM   548  N NE    . ARG A 1 74  ? -53.825 37.976  30.008  1.00 97.43  ? 100 ARG A NE    1 
ATOM   549  C CZ    . ARG A 1 74  ? -54.533 38.927  30.609  1.00 104.57 ? 100 ARG A CZ    1 
ATOM   550  N NH1   . ARG A 1 74  ? -55.151 38.672  31.754  1.00 106.28 ? 100 ARG A NH1   1 
ATOM   551  N NH2   . ARG A 1 74  ? -54.624 40.134  30.065  1.00 104.37 ? 100 ARG A NH2   1 
ATOM   552  N N     . ALA A 1 75  ? -55.870 35.641  25.492  1.00 95.40  ? 101 ALA A N     1 
ATOM   553  C CA    . ALA A 1 75  ? -55.816 35.154  24.118  1.00 98.80  ? 101 ALA A CA    1 
ATOM   554  C C     . ALA A 1 75  ? -54.967 36.061  23.236  1.00 98.88  ? 101 ALA A C     1 
ATOM   555  O O     . ALA A 1 75  ? -54.104 35.591  22.494  1.00 99.77  ? 101 ALA A O     1 
ATOM   556  C CB    . ALA A 1 75  ? -57.221 35.022  23.547  1.00 105.79 ? 101 ALA A CB    1 
ATOM   557  N N     . ASP A 1 76  ? -55.215 37.364  23.323  1.00 103.49 ? 102 ASP A N     1 
ATOM   558  C CA    . ASP A 1 76  ? -54.467 38.338  22.539  1.00 106.31 ? 102 ASP A CA    1 
ATOM   559  C C     . ASP A 1 76  ? -52.997 38.345  22.943  1.00 95.89  ? 102 ASP A C     1 
ATOM   560  O O     . ASP A 1 76  ? -52.111 38.397  22.091  1.00 98.02  ? 102 ASP A O     1 
ATOM   561  C CB    . ASP A 1 76  ? -55.065 39.736  22.707  1.00 120.06 ? 102 ASP A CB    1 
ATOM   562  C CG    . ASP A 1 76  ? -54.370 40.775  21.846  1.00 131.62 ? 102 ASP A CG    1 
ATOM   563  O OD1   . ASP A 1 76  ? -53.739 40.389  20.839  1.00 134.68 ? 102 ASP A OD1   1 
ATOM   564  O OD2   . ASP A 1 76  ? -54.457 41.977  22.174  1.00 133.63 ? 102 ASP A OD2   1 
ATOM   565  N N     . ASP A 1 77  ? -52.747 38.292  24.248  1.00 80.58  ? 103 ASP A N     1 
ATOM   566  C CA    . ASP A 1 77  ? -51.383 38.297  24.766  1.00 69.89  ? 103 ASP A CA    1 
ATOM   567  C C     . ASP A 1 77  ? -50.556 37.160  24.178  1.00 71.57  ? 103 ASP A C     1 
ATOM   568  O O     . ASP A 1 77  ? -49.388 37.344  23.841  1.00 76.51  ? 103 ASP A O     1 
ATOM   569  C CB    . ASP A 1 77  ? -51.386 38.223  26.294  1.00 73.41  ? 103 ASP A CB    1 
ATOM   570  C CG    . ASP A 1 77  ? -51.900 39.496  26.936  1.00 80.03  ? 103 ASP A CG    1 
ATOM   571  O OD1   . ASP A 1 77  ? -52.130 40.479  26.200  1.00 87.55  ? 103 ASP A OD1   1 
ATOM   572  O OD2   . ASP A 1 77  ? -52.070 39.517  28.174  1.00 72.76  ? 103 ASP A OD2   1 
ATOM   573  N N     . ALA A 1 78  ? -51.166 35.985  24.057  1.00 71.85  ? 104 ALA A N     1 
ATOM   574  C CA    . ALA A 1 78  ? -50.500 34.848  23.436  1.00 74.13  ? 104 ALA A CA    1 
ATOM   575  C C     . ALA A 1 78  ? -50.054 35.216  22.025  1.00 75.23  ? 104 ALA A C     1 
ATOM   576  O O     . ALA A 1 78  ? -48.932 34.916  21.620  1.00 77.23  ? 104 ALA A O     1 
ATOM   577  C CB    . ALA A 1 78  ? -51.420 33.640  23.408  1.00 77.71  ? 104 ALA A CB    1 
ATOM   578  N N     . ARG A 1 79  ? -50.941 35.874  21.285  1.00 73.15  ? 105 ARG A N     1 
ATOM   579  C CA    . ARG A 1 79  ? -50.623 36.340  19.942  1.00 79.80  ? 105 ARG A CA    1 
ATOM   580  C C     . ARG A 1 79  ? -49.520 37.387  20.006  1.00 81.05  ? 105 ARG A C     1 
ATOM   581  O O     . ARG A 1 79  ? -48.555 37.338  19.242  1.00 77.38  ? 105 ARG A O     1 
ATOM   582  C CB    . ARG A 1 79  ? -51.864 36.932  19.273  1.00 80.26  ? 105 ARG A CB    1 
ATOM   583  C CG    . ARG A 1 79  ? -53.082 36.028  19.328  1.00 79.08  ? 105 ARG A CG    1 
ATOM   584  C CD    . ARG A 1 79  ? -54.290 36.686  18.684  1.00 69.83  ? 105 ARG A CD    1 
ATOM   585  N NE    . ARG A 1 79  ? -55.503 35.902  18.895  1.00 74.48  ? 105 ARG A NE    1 
ATOM   586  C CZ    . ARG A 1 79  ? -55.873 34.879  18.132  1.00 93.78  ? 105 ARG A CZ    1 
ATOM   587  N NH1   . ARG A 1 79  ? -55.123 34.512  17.102  1.00 98.63  ? 105 ARG A NH1   1 
ATOM   588  N NH2   . ARG A 1 79  ? -56.994 34.222  18.400  1.00 100.19 ? 105 ARG A NH2   1 
ATOM   589  N N     . GLN A 1 80  ? -49.673 38.334  20.927  1.00 77.55  ? 106 GLN A N     1 
ATOM   590  C CA    . GLN A 1 80  ? -48.674 39.374  21.135  1.00 77.32  ? 106 GLN A CA    1 
ATOM   591  C C     . GLN A 1 80  ? -47.305 38.760  21.389  1.00 76.65  ? 106 GLN A C     1 
ATOM   592  O O     . GLN A 1 80  ? -46.299 39.222  20.852  1.00 68.90  ? 106 GLN A O     1 
ATOM   593  C CB    . GLN A 1 80  ? -49.069 40.269  22.311  1.00 70.21  ? 106 GLN A CB    1 
ATOM   594  C CG    . GLN A 1 80  ? -50.284 41.138  22.050  1.00 84.57  ? 106 GLN A CG    1 
ATOM   595  C CD    . GLN A 1 80  ? -50.030 42.187  20.987  1.00 107.63 ? 106 GLN A CD    1 
ATOM   596  O OE1   . GLN A 1 80  ? -48.893 42.392  20.561  1.00 108.96 ? 106 GLN A OE1   1 
ATOM   597  N NE2   . GLN A 1 80  ? -51.089 42.862  20.556  1.00 119.27 ? 106 GLN A NE2   1 
ATOM   598  N N     . LEU A 1 81  ? -47.275 37.715  22.209  1.00 67.22  ? 107 LEU A N     1 
ATOM   599  C CA    . LEU A 1 81  ? -46.028 37.043  22.548  1.00 57.75  ? 107 LEU A CA    1 
ATOM   600  C C     . LEU A 1 81  ? -45.206 36.732  21.303  1.00 73.42  ? 107 LEU A C     1 
ATOM   601  O O     . LEU A 1 81  ? -44.054 37.149  21.191  1.00 74.87  ? 107 LEU A O     1 
ATOM   602  C CB    . LEU A 1 81  ? -46.305 35.759  23.331  1.00 33.45  ? 107 LEU A CB    1 
ATOM   603  C CG    . LEU A 1 81  ? -45.075 34.907  23.659  1.00 41.93  ? 107 LEU A CG    1 
ATOM   604  C CD1   . LEU A 1 81  ? -44.018 35.738  24.372  1.00 52.52  ? 107 LEU A CD1   1 
ATOM   605  C CD2   . LEU A 1 81  ? -45.457 33.688  24.487  1.00 38.40  ? 107 LEU A CD2   1 
ATOM   606  N N     . PHE A 1 82  ? -45.806 36.004  20.367  1.00 76.04  ? 108 PHE A N     1 
ATOM   607  C CA    . PHE A 1 82  ? -45.103 35.580  19.161  1.00 73.01  ? 108 PHE A CA    1 
ATOM   608  C C     . PHE A 1 82  ? -44.714 36.757  18.276  1.00 68.90  ? 108 PHE A C     1 
ATOM   609  O O     . PHE A 1 82  ? -43.678 36.729  17.614  1.00 68.82  ? 108 PHE A O     1 
ATOM   610  C CB    . PHE A 1 82  ? -45.947 34.576  18.376  1.00 69.54  ? 108 PHE A CB    1 
ATOM   611  C CG    . PHE A 1 82  ? -46.199 33.295  19.115  1.00 65.87  ? 108 PHE A CG    1 
ATOM   612  C CD1   . PHE A 1 82  ? -45.383 32.194  18.917  1.00 64.09  ? 108 PHE A CD1   1 
ATOM   613  C CD2   . PHE A 1 82  ? -47.245 33.194  20.016  1.00 66.12  ? 108 PHE A CD2   1 
ATOM   614  C CE1   . PHE A 1 82  ? -45.611 31.015  19.598  1.00 68.89  ? 108 PHE A CE1   1 
ATOM   615  C CE2   . PHE A 1 82  ? -47.479 32.018  20.700  1.00 73.50  ? 108 PHE A CE2   1 
ATOM   616  C CZ    . PHE A 1 82  ? -46.660 30.927  20.492  1.00 76.01  ? 108 PHE A CZ    1 
ATOM   617  N N     . VAL A 1 83  ? -45.548 37.791  18.269  1.00 65.18  ? 109 VAL A N     1 
ATOM   618  C CA    . VAL A 1 83  ? -45.262 38.992  17.494  1.00 61.61  ? 109 VAL A CA    1 
ATOM   619  C C     . VAL A 1 83  ? -44.138 39.800  18.137  1.00 58.38  ? 109 VAL A C     1 
ATOM   620  O O     . VAL A 1 83  ? -43.161 40.154  17.479  1.00 57.95  ? 109 VAL A O     1 
ATOM   621  C CB    . VAL A 1 83  ? -46.509 39.881  17.350  1.00 68.31  ? 109 VAL A CB    1 
ATOM   622  C CG1   . VAL A 1 83  ? -46.167 41.152  16.594  1.00 63.34  ? 109 VAL A CG1   1 
ATOM   623  C CG2   . VAL A 1 83  ? -47.621 39.120  16.645  1.00 77.08  ? 109 VAL A CG2   1 
ATOM   624  N N     . LEU A 1 84  ? -44.284 40.086  19.427  1.00 65.61  ? 110 LEU A N     1 
ATOM   625  C CA    . LEU A 1 84  ? -43.281 40.839  20.171  1.00 61.88  ? 110 LEU A CA    1 
ATOM   626  C C     . LEU A 1 84  ? -41.964 40.072  20.233  1.00 58.10  ? 110 LEU A C     1 
ATOM   627  O O     . LEU A 1 84  ? -40.892 40.668  20.351  1.00 49.55  ? 110 LEU A O     1 
ATOM   628  C CB    . LEU A 1 84  ? -43.779 41.140  21.586  1.00 62.52  ? 110 LEU A CB    1 
ATOM   629  C CG    . LEU A 1 84  ? -45.084 41.932  21.703  1.00 68.03  ? 110 LEU A CG    1 
ATOM   630  C CD1   . LEU A 1 84  ? -45.543 42.002  23.151  1.00 78.71  ? 110 LEU A CD1   1 
ATOM   631  C CD2   . LEU A 1 84  ? -44.927 43.327  21.117  1.00 64.91  ? 110 LEU A CD2   1 
ATOM   632  N N     . ALA A 1 85  ? -42.052 38.747  20.154  1.00 60.02  ? 111 ALA A N     1 
ATOM   633  C CA    . ALA A 1 85  ? -40.866 37.897  20.142  1.00 55.46  ? 111 ALA A CA    1 
ATOM   634  C C     . ALA A 1 85  ? -40.345 37.703  18.720  1.00 74.56  ? 111 ALA A C     1 
ATOM   635  O O     . ALA A 1 85  ? -39.165 37.425  18.514  1.00 81.26  ? 111 ALA A O     1 
ATOM   636  C CB    . ALA A 1 85  ? -41.163 36.553  20.790  1.00 33.64  ? 111 ALA A CB    1 
ATOM   637  N N     . GLY A 1 86  ? -41.231 37.847  17.741  1.00 71.25  ? 112 GLY A N     1 
ATOM   638  C CA    . GLY A 1 86  ? -40.830 37.784  16.349  1.00 67.39  ? 112 GLY A CA    1 
ATOM   639  C C     . GLY A 1 86  ? -40.193 39.096  15.943  1.00 77.62  ? 112 GLY A C     1 
ATOM   640  O O     . GLY A 1 86  ? -39.506 39.183  14.925  1.00 91.05  ? 112 GLY A O     1 
ATOM   641  N N     . ALA A 1 87  ? -40.410 40.117  16.766  1.00 79.28  ? 113 ALA A N     1 
ATOM   642  C CA    . ALA A 1 87  ? -39.979 41.473  16.439  1.00 85.50  ? 113 ALA A CA    1 
ATOM   643  C C     . ALA A 1 87  ? -38.802 41.984  17.279  1.00 96.48  ? 113 ALA A C     1 
ATOM   644  O O     . ALA A 1 87  ? -38.022 42.815  16.812  1.00 94.28  ? 113 ALA A O     1 
ATOM   645  C CB    . ALA A 1 87  ? -41.157 42.435  16.520  1.00 76.50  ? 113 ALA A CB    1 
ATOM   646  N N     . ALA A 1 88  ? -38.679 41.498  18.512  1.00 103.79 ? 114 ALA A N     1 
ATOM   647  C CA    . ALA A 1 88  ? -37.547 41.863  19.357  1.00 103.29 ? 114 ALA A CA    1 
ATOM   648  C C     . ALA A 1 88  ? -36.299 41.127  18.898  1.00 98.93  ? 114 ALA A C     1 
ATOM   649  O O     . ALA A 1 88  ? -36.303 40.466  17.858  1.00 86.51  ? 114 ALA A O     1 
ATOM   650  C CB    . ALA A 1 88  ? -37.838 41.563  20.815  1.00 99.68  ? 114 ALA A CB    1 
ATOM   651  N N     . GLU A 1 89  ? -35.235 41.231  19.685  1.00 105.74 ? 115 GLU A N     1 
ATOM   652  C CA    . GLU A 1 89  ? -33.960 40.656  19.295  1.00 110.56 ? 115 GLU A CA    1 
ATOM   653  C C     . GLU A 1 89  ? -33.128 40.229  20.501  1.00 109.69 ? 115 GLU A C     1 
ATOM   654  O O     . GLU A 1 89  ? -33.647 40.068  21.607  1.00 98.10  ? 115 GLU A O     1 
ATOM   655  C CB    . GLU A 1 89  ? -33.174 41.673  18.470  1.00 109.18 ? 115 GLU A CB    1 
ATOM   656  C CG    . GLU A 1 89  ? -32.789 42.914  19.259  1.00 109.29 ? 115 GLU A CG    1 
ATOM   657  C CD    . GLU A 1 89  ? -31.926 43.873  18.464  1.00 116.01 ? 115 GLU A CD    1 
ATOM   658  O OE1   . GLU A 1 89  ? -32.120 43.976  17.235  1.00 118.75 ? 115 GLU A OE1   1 
ATOM   659  O OE2   . GLU A 1 89  ? -31.054 44.528  19.072  1.00 119.01 ? 115 GLU A OE2   1 
ATOM   660  N N     . GLU A 1 90  ? -31.830 40.050  20.274  1.00 115.35 ? 116 GLU A N     1 
ATOM   661  C CA    . GLU A 1 90  ? -30.907 39.692  21.342  1.00 119.92 ? 116 GLU A CA    1 
ATOM   662  C C     . GLU A 1 90  ? -30.552 40.920  22.175  1.00 123.89 ? 116 GLU A C     1 
ATOM   663  O O     . GLU A 1 90  ? -30.510 42.039  21.660  1.00 122.52 ? 116 GLU A O     1 
ATOM   664  C CB    . GLU A 1 90  ? -29.637 39.066  20.763  1.00 115.20 ? 116 GLU A CB    1 
ATOM   665  C CG    . GLU A 1 90  ? -29.890 37.918  19.800  1.00 109.33 ? 116 GLU A CG    1 
ATOM   666  C CD    . GLU A 1 90  ? -28.615 37.399  19.162  1.00 102.75 ? 116 GLU A CD    1 
ATOM   667  O OE1   . GLU A 1 90  ? -27.519 37.727  19.666  1.00 96.74  ? 116 GLU A OE1   1 
ATOM   668  O OE2   . GLU A 1 90  ? -28.709 36.663  18.157  1.00 98.60  ? 116 GLU A OE2   1 
ATOM   669  N N     . GLY A 1 91  ? -30.299 40.704  23.462  1.00 120.03 ? 117 GLY A N     1 
ATOM   670  C CA    . GLY A 1 91  ? -29.952 41.784  24.367  1.00 114.91 ? 117 GLY A CA    1 
ATOM   671  C C     . GLY A 1 91  ? -30.995 42.884  24.375  1.00 111.40 ? 117 GLY A C     1 
ATOM   672  O O     . GLY A 1 91  ? -30.669 44.062  24.519  1.00 107.60 ? 117 GLY A O     1 
ATOM   673  N N     . PHE A 1 92  ? -32.256 42.495  24.221  1.00 112.03 ? 118 PHE A N     1 
ATOM   674  C CA    . PHE A 1 92  ? -33.351 43.454  24.167  1.00 106.98 ? 118 PHE A CA    1 
ATOM   675  C C     . PHE A 1 92  ? -34.599 42.872  24.818  1.00 91.30  ? 118 PHE A C     1 
ATOM   676  O O     . PHE A 1 92  ? -35.170 41.898  24.326  1.00 97.24  ? 118 PHE A O     1 
ATOM   677  C CB    . PHE A 1 92  ? -33.652 43.828  22.716  1.00 118.25 ? 118 PHE A CB    1 
ATOM   678  C CG    . PHE A 1 92  ? -34.218 45.208  22.551  1.00 121.14 ? 118 PHE A CG    1 
ATOM   679  C CD1   . PHE A 1 92  ? -35.321 45.612  23.284  1.00 122.11 ? 118 PHE A CD1   1 
ATOM   680  C CD2   . PHE A 1 92  ? -33.651 46.098  21.656  1.00 124.96 ? 118 PHE A CD2   1 
ATOM   681  C CE1   . PHE A 1 92  ? -35.842 46.882  23.133  1.00 127.40 ? 118 PHE A CE1   1 
ATOM   682  C CE2   . PHE A 1 92  ? -34.168 47.369  21.499  1.00 130.78 ? 118 PHE A CE2   1 
ATOM   683  C CZ    . PHE A 1 92  ? -35.266 47.761  22.238  1.00 130.56 ? 118 PHE A CZ    1 
ATOM   684  N N     . MET A 1 93  ? -35.024 43.475  25.923  1.00 69.78  ? 119 MET A N     1 
ATOM   685  C CA    . MET A 1 93  ? -36.186 42.985  26.652  1.00 63.84  ? 119 MET A CA    1 
ATOM   686  C C     . MET A 1 93  ? -37.169 44.110  26.957  1.00 78.03  ? 119 MET A C     1 
ATOM   687  O O     . MET A 1 93  ? -37.068 44.769  27.993  1.00 98.34  ? 119 MET A O     1 
ATOM   688  C CB    . MET A 1 93  ? -35.747 42.307  27.950  1.00 61.04  ? 119 MET A CB    1 
ATOM   689  C CG    . MET A 1 93  ? -36.870 41.610  28.690  1.00 61.57  ? 119 MET A CG    1 
ATOM   690  S SD    . MET A 1 93  ? -37.683 40.375  27.663  1.00 93.16  ? 119 MET A SD    1 
ATOM   691  C CE    . MET A 1 93  ? -38.814 39.648  28.843  1.00 40.50  ? 119 MET A CE    1 
ATOM   692  N N     . THR A 1 94  ? -38.121 44.322  26.055  1.00 65.39  ? 120 THR A N     1 
ATOM   693  C CA    . THR A 1 94  ? -39.107 45.384  26.221  1.00 61.90  ? 120 THR A CA    1 
ATOM   694  C C     . THR A 1 94  ? -39.981 45.141  27.447  1.00 65.89  ? 120 THR A C     1 
ATOM   695  O O     . THR A 1 94  ? -40.282 43.997  27.789  1.00 57.35  ? 120 THR A O     1 
ATOM   696  C CB    . THR A 1 94  ? -40.012 45.517  24.978  1.00 62.66  ? 120 THR A CB    1 
ATOM   697  O OG1   . THR A 1 94  ? -40.909 44.402  24.912  1.00 56.60  ? 120 THR A OG1   1 
ATOM   698  C CG2   . THR A 1 94  ? -39.175 45.565  23.711  1.00 69.76  ? 120 THR A CG2   1 
ATOM   699  N N     . ALA A 1 95  ? -40.382 46.222  28.106  1.00 70.53  ? 121 ALA A N     1 
ATOM   700  C CA    . ALA A 1 95  ? -41.254 46.121  29.269  1.00 61.56  ? 121 ALA A CA    1 
ATOM   701  C C     . ALA A 1 95  ? -42.605 45.544  28.868  1.00 66.18  ? 121 ALA A C     1 
ATOM   702  O O     . ALA A 1 95  ? -43.301 44.941  29.685  1.00 75.46  ? 121 ALA A O     1 
ATOM   703  C CB    . ALA A 1 95  ? -41.429 47.479  29.923  1.00 59.33  ? 121 ALA A CB    1 
ATOM   704  N N     . GLU A 1 96  ? -42.971 45.737  27.605  1.00 50.84  ? 122 GLU A N     1 
ATOM   705  C CA    . GLU A 1 96  ? -44.228 45.215  27.084  1.00 48.30  ? 122 GLU A CA    1 
ATOM   706  C C     . GLU A 1 96  ? -44.167 43.697  26.938  1.00 56.90  ? 122 GLU A C     1 
ATOM   707  O O     . GLU A 1 96  ? -45.112 42.991  27.292  1.00 58.82  ? 122 GLU A O     1 
ATOM   708  C CB    . GLU A 1 96  ? -44.561 45.859  25.737  1.00 51.56  ? 122 GLU A CB    1 
ATOM   709  C CG    . GLU A 1 96  ? -45.864 45.368  25.124  1.00 79.74  ? 122 GLU A CG    1 
ATOM   710  C CD    . GLU A 1 96  ? -46.127 45.963  23.754  1.00 107.28 ? 122 GLU A CD    1 
ATOM   711  O OE1   . GLU A 1 96  ? -45.336 46.824  23.316  1.00 120.00 ? 122 GLU A OE1   1 
ATOM   712  O OE2   . GLU A 1 96  ? -47.126 45.568  23.114  1.00 109.00 ? 122 GLU A OE2   1 
ATOM   713  N N     . LEU A 1 97  ? -43.051 43.202  26.415  1.00 56.93  ? 123 LEU A N     1 
ATOM   714  C CA    . LEU A 1 97  ? -42.865 41.768  26.224  1.00 58.18  ? 123 LEU A CA    1 
ATOM   715  C C     . LEU A 1 97  ? -42.850 41.036  27.560  1.00 51.06  ? 123 LEU A C     1 
ATOM   716  O O     . LEU A 1 97  ? -43.527 40.020  27.732  1.00 43.72  ? 123 LEU A O     1 
ATOM   717  C CB    . LEU A 1 97  ? -41.571 41.493  25.458  1.00 52.40  ? 123 LEU A CB    1 
ATOM   718  C CG    . LEU A 1 97  ? -41.221 40.024  25.222  1.00 48.69  ? 123 LEU A CG    1 
ATOM   719  C CD1   . LEU A 1 97  ? -42.371 39.299  24.537  1.00 47.57  ? 123 LEU A CD1   1 
ATOM   720  C CD2   . LEU A 1 97  ? -39.939 39.906  24.410  1.00 42.14  ? 123 LEU A CD2   1 
ATOM   721  N N     . ALA A 1 98  ? -42.071 41.556  28.503  1.00 42.79  ? 124 ALA A N     1 
ATOM   722  C CA    . ALA A 1 98  ? -42.008 40.981  29.840  1.00 49.23  ? 124 ALA A CA    1 
ATOM   723  C C     . ALA A 1 98  ? -43.390 40.978  30.476  1.00 64.74  ? 124 ALA A C     1 
ATOM   724  O O     . ALA A 1 98  ? -43.783 40.008  31.122  1.00 82.00  ? 124 ALA A O     1 
ATOM   725  C CB    . ALA A 1 98  ? -41.029 41.756  30.703  1.00 58.56  ? 124 ALA A CB    1 
ATOM   726  N N     . GLY A 1 99  ? -44.124 42.070  30.285  1.00 60.57  ? 125 GLY A N     1 
ATOM   727  C CA    . GLY A 1 99  ? -45.475 42.184  30.804  1.00 51.62  ? 125 GLY A CA    1 
ATOM   728  C C     . GLY A 1 99  ? -46.384 41.111  30.240  1.00 58.65  ? 125 GLY A C     1 
ATOM   729  O O     . GLY A 1 99  ? -47.178 40.511  30.966  1.00 65.65  ? 125 GLY A O     1 
ATOM   730  N N     . VAL A 1 100 ? -46.268 40.868  28.939  1.00 57.68  ? 126 VAL A N     1 
ATOM   731  C CA    . VAL A 1 100 ? -47.046 39.825  28.284  1.00 46.34  ? 126 VAL A CA    1 
ATOM   732  C C     . VAL A 1 100 ? -46.697 38.455  28.851  1.00 40.34  ? 126 VAL A C     1 
ATOM   733  O O     . VAL A 1 100 ? -47.575 37.713  29.292  1.00 41.91  ? 126 VAL A O     1 
ATOM   734  C CB    . VAL A 1 100 ? -46.817 39.822  26.763  1.00 48.54  ? 126 VAL A CB    1 
ATOM   735  C CG1   . VAL A 1 100 ? -47.376 38.548  26.146  1.00 53.53  ? 126 VAL A CG1   1 
ATOM   736  C CG2   . VAL A 1 100 ? -47.444 41.058  26.130  1.00 29.84  ? 126 VAL A CG2   1 
ATOM   737  N N     . ILE A 1 101 ? -45.409 38.128  28.841  1.00 34.86  ? 127 ILE A N     1 
ATOM   738  C CA    . ILE A 1 101 ? -44.933 36.865  29.391  1.00 41.32  ? 127 ILE A CA    1 
ATOM   739  C C     . ILE A 1 101 ? -45.389 36.691  30.835  1.00 50.56  ? 127 ILE A C     1 
ATOM   740  O O     . ILE A 1 101 ? -45.823 35.611  31.236  1.00 59.23  ? 127 ILE A O     1 
ATOM   741  C CB    . ILE A 1 101 ? -43.399 36.779  29.346  1.00 51.81  ? 127 ILE A CB    1 
ATOM   742  C CG1   . ILE A 1 101 ? -42.894 36.997  27.919  1.00 48.41  ? 127 ILE A CG1   1 
ATOM   743  C CG2   . ILE A 1 101 ? -42.925 35.441  29.891  1.00 63.60  ? 127 ILE A CG2   1 
ATOM   744  C CD1   . ILE A 1 101 ? -41.386 36.998  27.802  1.00 47.06  ? 127 ILE A CD1   1 
ATOM   745  N N     . LYS A 1 102 ? -45.289 37.765  31.611  1.00 48.39  ? 128 LYS A N     1 
ATOM   746  C CA    . LYS A 1 102 ? -45.652 37.737  33.023  1.00 51.06  ? 128 LYS A CA    1 
ATOM   747  C C     . LYS A 1 102 ? -47.125 37.401  33.220  1.00 53.76  ? 128 LYS A C     1 
ATOM   748  O O     . LYS A 1 102 ? -47.465 36.479  33.962  1.00 56.78  ? 128 LYS A O     1 
ATOM   749  C CB    . LYS A 1 102 ? -45.326 39.078  33.683  1.00 63.08  ? 128 LYS A CB    1 
ATOM   750  C CG    . LYS A 1 102 ? -45.555 39.106  35.184  1.00 81.93  ? 128 LYS A CG    1 
ATOM   751  C CD    . LYS A 1 102 ? -45.154 40.448  35.778  1.00 97.40  ? 128 LYS A CD    1 
ATOM   752  C CE    . LYS A 1 102 ? -45.394 40.481  37.281  1.00 105.60 ? 128 LYS A CE    1 
ATOM   753  N NZ    . LYS A 1 102 ? -45.040 41.799  37.876  1.00 109.33 ? 128 LYS A NZ    1 
ATOM   754  N N     . ARG A 1 103 ? -47.996 38.153  32.554  1.00 56.00  ? 129 ARG A N     1 
ATOM   755  C CA    . ARG A 1 103 ? -49.433 37.933  32.668  1.00 60.72  ? 129 ARG A CA    1 
ATOM   756  C C     . ARG A 1 103 ? -49.813 36.519  32.241  1.00 74.42  ? 129 ARG A C     1 
ATOM   757  O O     . ARG A 1 103 ? -50.691 35.897  32.838  1.00 85.32  ? 129 ARG A O     1 
ATOM   758  C CB    . ARG A 1 103 ? -50.210 38.969  31.850  1.00 62.48  ? 129 ARG A CB    1 
ATOM   759  C CG    . ARG A 1 103 ? -50.105 40.387  32.392  1.00 72.75  ? 129 ARG A CG    1 
ATOM   760  C CD    . ARG A 1 103 ? -51.064 41.331  31.684  1.00 72.06  ? 129 ARG A CD    1 
ATOM   761  N NE    . ARG A 1 103 ? -50.769 41.449  30.259  1.00 72.28  ? 129 ARG A NE    1 
ATOM   762  C CZ    . ARG A 1 103 ? -49.899 42.314  29.748  1.00 73.63  ? 129 ARG A CZ    1 
ATOM   763  N NH1   . ARG A 1 103 ? -49.234 43.139  30.545  1.00 66.99  ? 129 ARG A NH1   1 
ATOM   764  N NH2   . ARG A 1 103 ? -49.692 42.353  28.438  1.00 78.36  ? 129 ARG A NH2   1 
ATOM   765  N N     . LEU A 1 104 ? -49.146 36.016  31.207  1.00 66.77  ? 130 LEU A N     1 
ATOM   766  C CA    . LEU A 1 104 ? -49.374 34.652  30.747  1.00 57.70  ? 130 LEU A CA    1 
ATOM   767  C C     . LEU A 1 104 ? -48.925 33.655  31.805  1.00 61.04  ? 130 LEU A C     1 
ATOM   768  O O     . LEU A 1 104 ? -49.626 32.689  32.102  1.00 67.19  ? 130 LEU A O     1 
ATOM   769  C CB    . LEU A 1 104 ? -48.628 34.393  29.437  1.00 57.39  ? 130 LEU A CB    1 
ATOM   770  C CG    . LEU A 1 104 ? -49.203 35.051  28.182  1.00 54.28  ? 130 LEU A CG    1 
ATOM   771  C CD1   . LEU A 1 104 ? -48.234 34.927  27.017  1.00 56.86  ? 130 LEU A CD1   1 
ATOM   772  C CD2   . LEU A 1 104 ? -50.554 34.442  27.835  1.00 45.84  ? 130 LEU A CD2   1 
ATOM   773  N N     . TRP A 1 105 ? -47.752 33.903  32.376  1.00 56.96  ? 131 TRP A N     1 
ATOM   774  C CA    . TRP A 1 105 ? -47.192 33.021  33.390  1.00 59.57  ? 131 TRP A CA    1 
ATOM   775  C C     . TRP A 1 105 ? -48.064 32.984  34.640  1.00 61.52  ? 131 TRP A C     1 
ATOM   776  O O     . TRP A 1 105 ? -47.971 32.059  35.445  1.00 63.01  ? 131 TRP A O     1 
ATOM   777  C CB    . TRP A 1 105 ? -45.770 33.458  33.747  1.00 63.01  ? 131 TRP A CB    1 
ATOM   778  C CG    . TRP A 1 105 ? -45.113 32.594  34.776  1.00 63.37  ? 131 TRP A CG    1 
ATOM   779  C CD1   . TRP A 1 105 ? -44.533 33.002  35.941  1.00 64.30  ? 131 TRP A CD1   1 
ATOM   780  C CD2   . TRP A 1 105 ? -44.978 31.168  34.738  1.00 57.66  ? 131 TRP A CD2   1 
ATOM   781  N NE1   . TRP A 1 105 ? -44.037 31.919  36.627  1.00 57.97  ? 131 TRP A NE1   1 
ATOM   782  C CE2   . TRP A 1 105 ? -44.298 30.781  35.910  1.00 49.59  ? 131 TRP A CE2   1 
ATOM   783  C CE3   . TRP A 1 105 ? -45.363 30.180  33.825  1.00 51.72  ? 131 TRP A CE3   1 
ATOM   784  C CZ2   . TRP A 1 105 ? -43.995 29.452  36.193  1.00 40.77  ? 131 TRP A CZ2   1 
ATOM   785  C CZ3   . TRP A 1 105 ? -45.061 28.861  34.108  1.00 39.69  ? 131 TRP A CZ3   1 
ATOM   786  C CH2   . TRP A 1 105 ? -44.384 28.509  35.282  1.00 34.38  ? 131 TRP A CH2   1 
ATOM   787  N N     . LYS A 1 106 ? -48.913 33.994  34.793  1.00 64.52  ? 132 LYS A N     1 
ATOM   788  C CA    . LYS A 1 106 ? -49.794 34.084  35.950  1.00 77.84  ? 132 LYS A CA    1 
ATOM   789  C C     . LYS A 1 106 ? -51.133 33.398  35.686  1.00 67.37  ? 132 LYS A C     1 
ATOM   790  O O     . LYS A 1 106 ? -51.732 32.818  36.593  1.00 61.22  ? 132 LYS A O     1 
ATOM   791  C CB    . LYS A 1 106 ? -50.004 35.550  36.347  1.00 99.34  ? 132 LYS A CB    1 
ATOM   792  C CG    . LYS A 1 106 ? -50.898 35.763  37.564  1.00 121.82 ? 132 LYS A CG    1 
ATOM   793  C CD    . LYS A 1 106 ? -52.373 35.806  37.183  1.00 136.69 ? 132 LYS A CD    1 
ATOM   794  C CE    . LYS A 1 106 ? -53.259 35.986  38.406  1.00 141.34 ? 132 LYS A CE    1 
ATOM   795  N NZ    . LYS A 1 106 ? -54.706 35.997  38.050  1.00 141.59 ? 132 LYS A NZ    1 
ATOM   796  N N     . ASP A 1 107 ? -51.594 33.465  34.441  1.00 59.32  ? 133 ASP A N     1 
ATOM   797  C CA    . ASP A 1 107 ? -52.891 32.909  34.069  1.00 60.93  ? 133 ASP A CA    1 
ATOM   798  C C     . ASP A 1 107 ? -53.101 31.510  34.636  1.00 67.28  ? 133 ASP A C     1 
ATOM   799  O O     . ASP A 1 107 ? -52.216 30.659  34.558  1.00 77.07  ? 133 ASP A O     1 
ATOM   800  C CB    . ASP A 1 107 ? -53.052 32.882  32.549  1.00 75.91  ? 133 ASP A CB    1 
ATOM   801  C CG    . ASP A 1 107 ? -54.431 32.427  32.121  1.00 89.01  ? 133 ASP A CG    1 
ATOM   802  O OD1   . ASP A 1 107 ? -55.393 32.645  32.888  1.00 87.52  ? 133 ASP A OD1   1 
ATOM   803  O OD2   . ASP A 1 107 ? -54.556 31.854  31.018  1.00 99.84  ? 133 ASP A OD2   1 
ATOM   804  N N     . SER A 1 108 ? -54.279 31.283  35.207  1.00 71.99  ? 134 SER A N     1 
ATOM   805  C CA    . SER A 1 108 ? -54.605 29.998  35.814  1.00 66.80  ? 134 SER A CA    1 
ATOM   806  C C     . SER A 1 108 ? -54.622 28.881  34.776  1.00 70.07  ? 134 SER A C     1 
ATOM   807  O O     . SER A 1 108 ? -54.190 27.761  35.052  1.00 78.43  ? 134 SER A O     1 
ATOM   808  C CB    . SER A 1 108 ? -55.951 30.072  36.539  1.00 61.13  ? 134 SER A CB    1 
ATOM   809  O OG    . SER A 1 108 ? -56.988 30.464  35.657  1.00 63.27  ? 134 SER A OG    1 
ATOM   810  N N     . GLY A 1 109 ? -55.122 29.191  33.584  1.00 64.44  ? 135 GLY A N     1 
ATOM   811  C CA    . GLY A 1 109 ? -55.154 28.227  32.499  1.00 67.82  ? 135 GLY A CA    1 
ATOM   812  C C     . GLY A 1 109 ? -53.755 27.824  32.078  1.00 69.31  ? 135 GLY A C     1 
ATOM   813  O O     . GLY A 1 109 ? -53.465 26.642  31.888  1.00 68.23  ? 135 GLY A O     1 
ATOM   814  N N     . VAL A 1 110 ? -52.883 28.816  31.931  1.00 61.51  ? 136 VAL A N     1 
ATOM   815  C CA    . VAL A 1 110 ? -51.486 28.566  31.607  1.00 55.42  ? 136 VAL A CA    1 
ATOM   816  C C     . VAL A 1 110 ? -50.839 27.704  32.686  1.00 62.68  ? 136 VAL A C     1 
ATOM   817  O O     . VAL A 1 110 ? -50.107 26.761  32.385  1.00 70.89  ? 136 VAL A O     1 
ATOM   818  C CB    . VAL A 1 110 ? -50.702 29.882  31.456  1.00 47.82  ? 136 VAL A CB    1 
ATOM   819  C CG1   . VAL A 1 110 ? -49.212 29.608  31.316  1.00 34.94  ? 136 VAL A CG1   1 
ATOM   820  C CG2   . VAL A 1 110 ? -51.222 30.671  30.263  1.00 52.78  ? 136 VAL A CG2   1 
ATOM   821  N N     . GLN A 1 111 ? -51.118 28.032  33.944  1.00 57.97  ? 137 GLN A N     1 
ATOM   822  C CA    . GLN A 1 111 ? -50.612 27.253  35.068  1.00 52.99  ? 137 GLN A CA    1 
ATOM   823  C C     . GLN A 1 111 ? -51.112 25.815  35.014  1.00 56.70  ? 137 GLN A C     1 
ATOM   824  O O     . GLN A 1 111 ? -50.343 24.873  35.209  1.00 45.86  ? 137 GLN A O     1 
ATOM   825  C CB    . GLN A 1 111 ? -51.011 27.899  36.396  1.00 39.71  ? 137 GLN A CB    1 
ATOM   826  C CG    . GLN A 1 111 ? -50.169 29.103  36.766  1.00 42.15  ? 137 GLN A CG    1 
ATOM   827  C CD    . GLN A 1 111 ? -48.696 28.761  36.879  1.00 49.44  ? 137 GLN A CD    1 
ATOM   828  O OE1   . GLN A 1 111 ? -48.290 27.983  37.744  1.00 45.87  ? 137 GLN A OE1   1 
ATOM   829  N NE2   . GLN A 1 111 ? -47.886 29.342  36.002  1.00 49.61  ? 137 GLN A NE2   1 
ATOM   830  N N     . ALA A 1 112 ? -52.405 25.653  34.750  1.00 51.78  ? 138 ALA A N     1 
ATOM   831  C CA    . ALA A 1 112 ? -53.002 24.328  34.637  1.00 44.66  ? 138 ALA A CA    1 
ATOM   832  C C     . ALA A 1 112 ? -52.248 23.499  33.606  1.00 53.93  ? 138 ALA A C     1 
ATOM   833  O O     . ALA A 1 112 ? -52.040 22.300  33.788  1.00 62.14  ? 138 ALA A O     1 
ATOM   834  C CB    . ALA A 1 112 ? -54.467 24.438  34.263  1.00 48.76  ? 138 ALA A CB    1 
ATOM   835  N N     . CYS A 1 113 ? -51.840 24.148  32.520  1.00 46.64  ? 139 CYS A N     1 
ATOM   836  C CA    . CYS A 1 113 ? -51.051 23.487  31.492  1.00 36.17  ? 139 CYS A CA    1 
ATOM   837  C C     . CYS A 1 113 ? -49.655 23.194  32.020  1.00 36.78  ? 139 CYS A C     1 
ATOM   838  O O     . CYS A 1 113 ? -49.128 22.097  31.845  1.00 38.90  ? 139 CYS A O     1 
ATOM   839  C CB    . CYS A 1 113 ? -50.963 24.357  30.240  1.00 29.83  ? 139 CYS A CB    1 
ATOM   840  S SG    . CYS A 1 113 ? -50.047 23.594  28.887  1.00 49.61  ? 139 CYS A SG    1 
ATOM   841  N N     . PHE A 1 114 ? -49.062 24.188  32.670  1.00 44.65  ? 140 PHE A N     1 
ATOM   842  C CA    . PHE A 1 114 ? -47.737 24.038  33.254  1.00 38.40  ? 140 PHE A CA    1 
ATOM   843  C C     . PHE A 1 114 ? -47.689 22.851  34.208  1.00 38.94  ? 140 PHE A C     1 
ATOM   844  O O     . PHE A 1 114 ? -46.676 22.158  34.300  1.00 42.96  ? 140 PHE A O     1 
ATOM   845  C CB    . PHE A 1 114 ? -47.328 25.318  33.985  1.00 38.86  ? 140 PHE A CB    1 
ATOM   846  C CG    . PHE A 1 114 ? -46.074 25.176  34.797  1.00 44.68  ? 140 PHE A CG    1 
ATOM   847  C CD1   . PHE A 1 114 ? -44.834 25.147  34.181  1.00 39.46  ? 140 PHE A CD1   1 
ATOM   848  C CD2   . PHE A 1 114 ? -46.135 25.077  36.177  1.00 50.22  ? 140 PHE A CD2   1 
ATOM   849  C CE1   . PHE A 1 114 ? -43.679 25.016  34.926  1.00 38.84  ? 140 PHE A CE1   1 
ATOM   850  C CE2   . PHE A 1 114 ? -44.983 24.947  36.927  1.00 51.74  ? 140 PHE A CE2   1 
ATOM   851  C CZ    . PHE A 1 114 ? -43.753 24.917  36.301  1.00 48.17  ? 140 PHE A CZ    1 
ATOM   852  N N     . ASN A 1 115 ? -48.790 22.622  34.916  1.00 42.33  ? 141 ASN A N     1 
ATOM   853  C CA    . ASN A 1 115 ? -48.877 21.510  35.856  1.00 60.55  ? 141 ASN A CA    1 
ATOM   854  C C     . ASN A 1 115 ? -48.898 20.161  35.146  1.00 62.48  ? 141 ASN A C     1 
ATOM   855  O O     . ASN A 1 115 ? -48.470 19.149  35.701  1.00 64.77  ? 141 ASN A O     1 
ATOM   856  C CB    . ASN A 1 115 ? -50.110 21.654  36.751  1.00 67.24  ? 141 ASN A CB    1 
ATOM   857  C CG    . ASN A 1 115 ? -50.006 22.831  37.704  1.00 64.07  ? 141 ASN A CG    1 
ATOM   858  O OD1   . ASN A 1 115 ? -48.912 23.312  38.001  1.00 48.32  ? 141 ASN A OD1   1 
ATOM   859  N ND2   . ASN A 1 115 ? -51.149 23.296  38.194  1.00 76.71  ? 141 ASN A ND2   1 
ATOM   860  N N     . ARG A 1 116 ? -49.399 20.153  33.916  1.00 51.93  ? 142 ARG A N     1 
ATOM   861  C CA    . ARG A 1 116 ? -49.452 18.930  33.130  1.00 46.17  ? 142 ARG A CA    1 
ATOM   862  C C     . ARG A 1 116 ? -48.266 18.857  32.175  1.00 45.58  ? 142 ARG A C     1 
ATOM   863  O O     . ARG A 1 116 ? -48.361 18.272  31.097  1.00 59.92  ? 142 ARG A O     1 
ATOM   864  C CB    . ARG A 1 116 ? -50.763 18.855  32.345  1.00 46.16  ? 142 ARG A CB    1 
ATOM   865  C CG    . ARG A 1 116 ? -51.982 19.314  33.126  1.00 49.66  ? 142 ARG A CG    1 
ATOM   866  C CD    . ARG A 1 116 ? -53.163 18.384  32.903  1.00 65.11  ? 142 ARG A CD    1 
ATOM   867  N NE    . ARG A 1 116 ? -53.493 18.225  31.489  1.00 65.16  ? 142 ARG A NE    1 
ATOM   868  C CZ    . ARG A 1 116 ? -54.458 18.894  30.867  1.00 67.42  ? 142 ARG A CZ    1 
ATOM   869  N NH1   . ARG A 1 116 ? -55.194 19.772  31.534  1.00 74.79  ? 142 ARG A NH1   1 
ATOM   870  N NH2   . ARG A 1 116 ? -54.688 18.682  29.578  1.00 60.84  ? 142 ARG A NH2   1 
ATOM   871  N N     . SER A 1 117 ? -47.149 19.455  32.577  1.00 37.38  ? 143 SER A N     1 
ATOM   872  C CA    . SER A 1 117 ? -45.952 19.482  31.741  1.00 43.92  ? 143 SER A CA    1 
ATOM   873  C C     . SER A 1 117 ? -45.339 18.094  31.565  1.00 43.33  ? 143 SER A C     1 
ATOM   874  O O     . SER A 1 117 ? -44.352 17.929  30.851  1.00 46.57  ? 143 SER A O     1 
ATOM   875  C CB    . SER A 1 117 ? -44.914 20.452  32.315  1.00 49.12  ? 143 SER A CB    1 
ATOM   876  O OG    . SER A 1 117 ? -44.542 20.087  33.635  1.00 54.73  ? 143 SER A OG    1 
ATOM   877  N N     . ARG A 1 118 ? -45.928 17.098  32.221  1.00 39.51  ? 144 ARG A N     1 
ATOM   878  C CA    . ARG A 1 118 ? -45.462 15.722  32.097  1.00 36.56  ? 144 ARG A CA    1 
ATOM   879  C C     . ARG A 1 118 ? -45.967 15.096  30.804  1.00 46.18  ? 144 ARG A C     1 
ATOM   880  O O     . ARG A 1 118 ? -45.382 14.142  30.290  1.00 48.93  ? 144 ARG A O     1 
ATOM   881  C CB    . ARG A 1 118 ? -45.932 14.887  33.289  1.00 31.12  ? 144 ARG A CB    1 
ATOM   882  C CG    . ARG A 1 118 ? -47.440 14.881  33.487  1.00 29.01  ? 144 ARG A CG    1 
ATOM   883  C CD    . ARG A 1 118 ? -47.854 13.833  34.504  1.00 34.64  ? 144 ARG A CD    1 
ATOM   884  N NE    . ARG A 1 118 ? -47.566 12.479  34.038  1.00 43.96  ? 144 ARG A NE    1 
ATOM   885  C CZ    . ARG A 1 118 ? -48.461 11.685  33.460  1.00 45.17  ? 144 ARG A CZ    1 
ATOM   886  N NH1   . ARG A 1 118 ? -49.704 12.110  33.280  1.00 52.24  ? 144 ARG A NH1   1 
ATOM   887  N NH2   . ARG A 1 118 ? -48.117 10.466  33.064  1.00 25.80  ? 144 ARG A NH2   1 
ATOM   888  N N     . GLU A 1 119 ? -47.061 15.643  30.286  1.00 52.94  ? 145 GLU A N     1 
ATOM   889  C CA    . GLU A 1 119 ? -47.701 15.108  29.092  1.00 50.60  ? 145 GLU A CA    1 
ATOM   890  C C     . GLU A 1 119 ? -47.053 15.643  27.818  1.00 41.96  ? 145 GLU A C     1 
ATOM   891  O O     . GLU A 1 119 ? -47.492 15.329  26.711  1.00 49.06  ? 145 GLU A O     1 
ATOM   892  C CB    . GLU A 1 119 ? -49.199 15.424  29.106  1.00 61.69  ? 145 GLU A CB    1 
ATOM   893  C CG    . GLU A 1 119 ? -49.925 14.889  30.333  1.00 66.74  ? 145 GLU A CG    1 
ATOM   894  C CD    . GLU A 1 119 ? -51.404 15.224  30.336  1.00 68.37  ? 145 GLU A CD    1 
ATOM   895  O OE1   . GLU A 1 119 ? -51.851 15.962  29.433  1.00 67.74  ? 145 GLU A OE1   1 
ATOM   896  O OE2   . GLU A 1 119 ? -52.118 14.748  31.243  1.00 70.53  ? 145 GLU A OE2   1 
ATOM   897  N N     . TYR A 1 120 ? -46.010 16.451  27.981  1.00 33.80  ? 146 TYR A N     1 
ATOM   898  C CA    . TYR A 1 120 ? -45.250 16.962  26.844  1.00 35.70  ? 146 TYR A CA    1 
ATOM   899  C C     . TYR A 1 120 ? -43.830 17.338  27.247  1.00 35.17  ? 146 TYR A C     1 
ATOM   900  O O     . TYR A 1 120 ? -43.496 17.359  28.430  1.00 43.31  ? 146 TYR A O     1 
ATOM   901  C CB    . TYR A 1 120 ? -45.959 18.157  26.203  1.00 25.10  ? 146 TYR A CB    1 
ATOM   902  C CG    . TYR A 1 120 ? -46.207 19.313  27.143  1.00 28.48  ? 146 TYR A CG    1 
ATOM   903  C CD1   . TYR A 1 120 ? -47.319 19.328  27.974  1.00 44.22  ? 146 TYR A CD1   1 
ATOM   904  C CD2   . TYR A 1 120 ? -45.338 20.395  27.192  1.00 31.76  ? 146 TYR A CD2   1 
ATOM   905  C CE1   . TYR A 1 120 ? -47.555 20.384  28.832  1.00 47.20  ? 146 TYR A CE1   1 
ATOM   906  C CE2   . TYR A 1 120 ? -45.568 21.456  28.047  1.00 38.37  ? 146 TYR A CE2   1 
ATOM   907  C CZ    . TYR A 1 120 ? -46.678 21.444  28.865  1.00 41.54  ? 146 TYR A CZ    1 
ATOM   908  O OH    . TYR A 1 120 ? -46.915 22.496  29.720  1.00 44.13  ? 146 TYR A OH    1 
ATOM   909  N N     . GLN A 1 121 ? -42.993 17.631  26.258  1.00 48.17  ? 147 GLN A N     1 
ATOM   910  C CA    . GLN A 1 121 ? -41.601 17.969  26.526  1.00 57.54  ? 147 GLN A CA    1 
ATOM   911  C C     . GLN A 1 121 ? -41.435 19.430  26.923  1.00 48.03  ? 147 GLN A C     1 
ATOM   912  O O     . GLN A 1 121 ? -41.825 20.334  26.185  1.00 36.59  ? 147 GLN A O     1 
ATOM   913  C CB    . GLN A 1 121 ? -40.715 17.636  25.325  1.00 61.75  ? 147 GLN A CB    1 
ATOM   914  C CG    . GLN A 1 121 ? -40.528 16.146  25.095  1.00 79.88  ? 147 GLN A CG    1 
ATOM   915  C CD    . GLN A 1 121 ? -39.369 15.840  24.168  1.00 100.95 ? 147 GLN A CD    1 
ATOM   916  O OE1   . GLN A 1 121 ? -38.967 14.686  24.018  1.00 103.95 ? 147 GLN A OE1   1 
ATOM   917  N NE2   . GLN A 1 121 ? -38.819 16.876  23.545  1.00 110.42 ? 147 GLN A NE2   1 
ATOM   918  N N     . LEU A 1 122 ? -40.855 19.648  28.099  1.00 46.99  ? 148 LEU A N     1 
ATOM   919  C CA    . LEU A 1 122 ? -40.609 20.990  28.608  1.00 42.26  ? 148 LEU A CA    1 
ATOM   920  C C     . LEU A 1 122 ? -39.327 21.000  29.432  1.00 44.59  ? 148 LEU A C     1 
ATOM   921  O O     . LEU A 1 122 ? -39.092 20.096  30.235  1.00 36.46  ? 148 LEU A O     1 
ATOM   922  C CB    . LEU A 1 122 ? -41.784 21.457  29.467  1.00 38.96  ? 148 LEU A CB    1 
ATOM   923  C CG    . LEU A 1 122 ? -41.713 22.891  29.995  1.00 39.49  ? 148 LEU A CG    1 
ATOM   924  C CD1   . LEU A 1 122 ? -41.760 23.882  28.844  1.00 44.59  ? 148 LEU A CD1   1 
ATOM   925  C CD2   . LEU A 1 122 ? -42.840 23.158  30.980  1.00 39.71  ? 148 LEU A CD2   1 
ATOM   926  N N     . ASN A 1 123 ? -38.498 22.022  29.231  1.00 47.46  ? 149 ASN A N     1 
ATOM   927  C CA    . ASN A 1 123 ? -37.229 22.123  29.946  1.00 46.73  ? 149 ASN A CA    1 
ATOM   928  C C     . ASN A 1 123 ? -37.419 22.402  31.435  1.00 48.09  ? 149 ASN A C     1 
ATOM   929  O O     . ASN A 1 123 ? -38.444 22.949  31.850  1.00 37.24  ? 149 ASN A O     1 
ATOM   930  C CB    . ASN A 1 123 ? -36.328 23.185  29.310  1.00 33.79  ? 149 ASN A CB    1 
ATOM   931  C CG    . ASN A 1 123 ? -36.916 24.580  29.393  1.00 49.21  ? 149 ASN A CG    1 
ATOM   932  O OD1   . ASN A 1 123 ? -37.694 24.886  30.293  1.00 74.63  ? 149 ASN A OD1   1 
ATOM   933  N ND2   . ASN A 1 123 ? -36.539 25.436  28.452  1.00 52.24  ? 149 ASN A ND2   1 
ATOM   934  N N     . ASP A 1 124 ? -36.430 22.022  32.237  1.00 39.97  ? 150 ASP A N     1 
ATOM   935  C CA    . ASP A 1 124 ? -36.518 22.206  33.681  1.00 50.82  ? 150 ASP A CA    1 
ATOM   936  C C     . ASP A 1 124 ? -35.870 23.510  34.131  1.00 58.37  ? 150 ASP A C     1 
ATOM   937  O O     . ASP A 1 124 ? -35.443 23.644  35.278  1.00 67.14  ? 150 ASP A O     1 
ATOM   938  C CB    . ASP A 1 124 ? -35.914 21.010  34.415  1.00 48.10  ? 150 ASP A CB    1 
ATOM   939  C CG    . ASP A 1 124 ? -36.819 19.795  34.381  1.00 55.20  ? 150 ASP A CG    1 
ATOM   940  O OD1   . ASP A 1 124 ? -38.055 19.977  34.376  1.00 55.48  ? 150 ASP A OD1   1 
ATOM   941  O OD2   . ASP A 1 124 ? -36.299 18.661  34.362  1.00 63.55  ? 150 ASP A OD2   1 
ATOM   942  N N     . SER A 1 125 ? -35.805 24.468  33.214  1.00 47.35  ? 151 SER A N     1 
ATOM   943  C CA    . SER A 1 125 ? -35.329 25.806  33.531  1.00 39.52  ? 151 SER A CA    1 
ATOM   944  C C     . SER A 1 125 ? -36.457 26.806  33.324  1.00 51.00  ? 151 SER A C     1 
ATOM   945  O O     . SER A 1 125 ? -36.316 27.991  33.623  1.00 56.51  ? 151 SER A O     1 
ATOM   946  C CB    . SER A 1 125 ? -34.135 26.175  32.653  1.00 32.57  ? 151 SER A CB    1 
ATOM   947  O OG    . SER A 1 125 ? -33.058 25.279  32.861  1.00 42.45  ? 151 SER A OG    1 
ATOM   948  N N     . ALA A 1 126 ? -37.579 26.312  32.809  1.00 49.94  ? 152 ALA A N     1 
ATOM   949  C CA    . ALA A 1 126 ? -38.736 27.152  32.523  1.00 41.96  ? 152 ALA A CA    1 
ATOM   950  C C     . ALA A 1 126 ? -39.218 27.882  33.771  1.00 49.81  ? 152 ALA A C     1 
ATOM   951  O O     . ALA A 1 126 ? -39.172 29.111  33.841  1.00 58.70  ? 152 ALA A O     1 
ATOM   952  C CB    . ALA A 1 126 ? -39.859 26.319  31.929  1.00 36.10  ? 152 ALA A CB    1 
ATOM   953  N N     . ALA A 1 127 ? -39.683 27.118  34.754  1.00 41.22  ? 153 ALA A N     1 
ATOM   954  C CA    . ALA A 1 127 ? -40.176 27.695  35.997  1.00 36.44  ? 153 ALA A CA    1 
ATOM   955  C C     . ALA A 1 127 ? -39.145 28.637  36.606  1.00 44.62  ? 153 ALA A C     1 
ATOM   956  O O     . ALA A 1 127 ? -39.489 29.709  37.102  1.00 48.35  ? 153 ALA A O     1 
ATOM   957  C CB    . ALA A 1 127 ? -40.539 26.597  36.981  1.00 30.96  ? 153 ALA A CB    1 
ATOM   958  N N     . TYR A 1 128 ? -37.879 28.232  36.556  1.00 47.22  ? 154 TYR A N     1 
ATOM   959  C CA    . TYR A 1 128 ? -36.795 29.032  37.113  1.00 43.25  ? 154 TYR A CA    1 
ATOM   960  C C     . TYR A 1 128 ? -36.817 30.463  36.587  1.00 41.20  ? 154 TYR A C     1 
ATOM   961  O O     . TYR A 1 128 ? -36.948 31.415  37.355  1.00 48.60  ? 154 TYR A O     1 
ATOM   962  C CB    . TYR A 1 128 ? -35.439 28.391  36.813  1.00 28.25  ? 154 TYR A CB    1 
ATOM   963  C CG    . TYR A 1 128 ? -34.266 29.203  37.313  1.00 44.89  ? 154 TYR A CG    1 
ATOM   964  C CD1   . TYR A 1 128 ? -33.745 28.999  38.584  1.00 46.81  ? 154 TYR A CD1   1 
ATOM   965  C CD2   . TYR A 1 128 ? -33.683 30.180  36.516  1.00 54.89  ? 154 TYR A CD2   1 
ATOM   966  C CE1   . TYR A 1 128 ? -32.674 29.742  39.046  1.00 36.57  ? 154 TYR A CE1   1 
ATOM   967  C CE2   . TYR A 1 128 ? -32.612 30.927  36.970  1.00 52.44  ? 154 TYR A CE2   1 
ATOM   968  C CZ    . TYR A 1 128 ? -32.113 30.705  38.235  1.00 41.12  ? 154 TYR A CZ    1 
ATOM   969  O OH    . TYR A 1 128 ? -31.047 31.448  38.689  1.00 48.04  ? 154 TYR A OH    1 
ATOM   970  N N     . TYR A 1 129 ? -36.685 30.606  35.273  1.00 35.12  ? 155 TYR A N     1 
ATOM   971  C CA    . TYR A 1 129 ? -36.662 31.923  34.650  1.00 41.39  ? 155 TYR A CA    1 
ATOM   972  C C     . TYR A 1 129 ? -38.011 32.624  34.757  1.00 48.15  ? 155 TYR A C     1 
ATOM   973  O O     . TYR A 1 129 ? -38.088 33.778  35.177  1.00 54.71  ? 155 TYR A O     1 
ATOM   974  C CB    . TYR A 1 129 ? -36.246 31.818  33.182  1.00 44.87  ? 155 TYR A CB    1 
ATOM   975  C CG    . TYR A 1 129 ? -34.808 31.396  32.975  1.00 59.82  ? 155 TYR A CG    1 
ATOM   976  C CD1   . TYR A 1 129 ? -33.760 32.215  33.373  1.00 70.12  ? 155 TYR A CD1   1 
ATOM   977  C CD2   . TYR A 1 129 ? -34.499 30.186  32.367  1.00 58.09  ? 155 TYR A CD2   1 
ATOM   978  C CE1   . TYR A 1 129 ? -32.443 31.837  33.181  1.00 68.76  ? 155 TYR A CE1   1 
ATOM   979  C CE2   . TYR A 1 129 ? -33.185 29.800  32.169  1.00 56.32  ? 155 TYR A CE2   1 
ATOM   980  C CZ    . TYR A 1 129 ? -32.162 30.629  32.578  1.00 58.62  ? 155 TYR A CZ    1 
ATOM   981  O OH    . TYR A 1 129 ? -30.854 30.251  32.385  1.00 56.37  ? 155 TYR A OH    1 
ATOM   982  N N     . LEU A 1 130 ? -39.073 31.919  34.377  1.00 43.25  ? 156 LEU A N     1 
ATOM   983  C CA    . LEU A 1 130 ? -40.413 32.498  34.359  1.00 40.30  ? 156 LEU A CA    1 
ATOM   984  C C     . LEU A 1 130 ? -40.815 33.086  35.710  1.00 40.80  ? 156 LEU A C     1 
ATOM   985  O O     . LEU A 1 130 ? -41.619 34.016  35.776  1.00 47.62  ? 156 LEU A O     1 
ATOM   986  C CB    . LEU A 1 130 ? -41.441 31.464  33.889  1.00 39.63  ? 156 LEU A CB    1 
ATOM   987  C CG    . LEU A 1 130 ? -41.336 31.046  32.418  1.00 42.80  ? 156 LEU A CG    1 
ATOM   988  C CD1   . LEU A 1 130 ? -42.316 29.928  32.092  1.00 44.57  ? 156 LEU A CD1   1 
ATOM   989  C CD2   . LEU A 1 130 ? -41.558 32.239  31.498  1.00 36.15  ? 156 LEU A CD2   1 
ATOM   990  N N     . ASN A 1 131 ? -40.253 32.545  36.786  1.00 30.53  ? 157 ASN A N     1 
ATOM   991  C CA    . ASN A 1 131 ? -40.523 33.064  38.121  1.00 44.70  ? 157 ASN A CA    1 
ATOM   992  C C     . ASN A 1 131 ? -39.763 34.356  38.401  1.00 53.02  ? 157 ASN A C     1 
ATOM   993  O O     . ASN A 1 131 ? -40.308 35.292  38.986  1.00 57.46  ? 157 ASN A O     1 
ATOM   994  C CB    . ASN A 1 131 ? -40.191 32.018  39.186  1.00 49.56  ? 157 ASN A CB    1 
ATOM   995  C CG    . ASN A 1 131 ? -41.199 30.886  39.226  1.00 46.03  ? 157 ASN A CG    1 
ATOM   996  O OD1   . ASN A 1 131 ? -42.340 31.038  38.789  1.00 37.78  ? 157 ASN A OD1   1 
ATOM   997  N ND2   . ASN A 1 131 ? -40.782 29.742  39.759  1.00 44.11  ? 157 ASN A ND2   1 
ATOM   998  N N     . ASP A 1 132 ? -38.504 34.400  37.976  1.00 56.58  ? 158 ASP A N     1 
ATOM   999  C CA    . ASP A 1 132 ? -37.651 35.562  38.213  1.00 60.08  ? 158 ASP A CA    1 
ATOM   1000 C C     . ASP A 1 132 ? -37.736 36.570  37.070  1.00 63.97  ? 158 ASP A C     1 
ATOM   1001 O O     . ASP A 1 132 ? -36.838 37.393  36.892  1.00 64.38  ? 158 ASP A O     1 
ATOM   1002 C CB    . ASP A 1 132 ? -36.196 35.129  38.410  1.00 62.19  ? 158 ASP A CB    1 
ATOM   1003 C CG    . ASP A 1 132 ? -36.017 34.190  39.589  1.00 74.92  ? 158 ASP A CG    1 
ATOM   1004 O OD1   . ASP A 1 132 ? -36.989 33.496  39.956  1.00 82.60  ? 158 ASP A OD1   1 
ATOM   1005 O OD2   . ASP A 1 132 ? -34.899 34.142  40.146  1.00 65.10  ? 158 ASP A OD2   1 
ATOM   1006 N N     . LEU A 1 133 ? -38.820 36.506  36.303  1.00 61.50  ? 159 LEU A N     1 
ATOM   1007 C CA    . LEU A 1 133 ? -38.995 37.373  35.141  1.00 49.52  ? 159 LEU A CA    1 
ATOM   1008 C C     . LEU A 1 133 ? -38.778 38.848  35.467  1.00 52.84  ? 159 LEU A C     1 
ATOM   1009 O O     . LEU A 1 133 ? -38.110 39.563  34.720  1.00 56.40  ? 159 LEU A O     1 
ATOM   1010 C CB    . LEU A 1 133 ? -40.382 37.171  34.526  1.00 47.80  ? 159 LEU A CB    1 
ATOM   1011 C CG    . LEU A 1 133 ? -40.720 38.068  33.335  1.00 54.91  ? 159 LEU A CG    1 
ATOM   1012 C CD1   . LEU A 1 133 ? -39.643 37.970  32.266  1.00 56.51  ? 159 LEU A CD1   1 
ATOM   1013 C CD2   . LEU A 1 133 ? -42.085 37.714  32.762  1.00 54.25  ? 159 LEU A CD2   1 
ATOM   1014 N N     . ASP A 1 134 ? -39.347 39.299  36.581  1.00 58.04  ? 160 ASP A N     1 
ATOM   1015 C CA    . ASP A 1 134 ? -39.242 40.699  36.982  1.00 67.74  ? 160 ASP A CA    1 
ATOM   1016 C C     . ASP A 1 134 ? -37.790 41.151  37.094  1.00 61.74  ? 160 ASP A C     1 
ATOM   1017 O O     . ASP A 1 134 ? -37.464 42.301  36.799  1.00 60.73  ? 160 ASP A O     1 
ATOM   1018 C CB    . ASP A 1 134 ? -39.972 40.938  38.305  1.00 89.68  ? 160 ASP A CB    1 
ATOM   1019 C CG    . ASP A 1 134 ? -41.479 40.840  38.166  1.00 113.44 ? 160 ASP A CG    1 
ATOM   1020 O OD1   . ASP A 1 134 ? -42.174 40.806  39.203  1.00 113.80 ? 160 ASP A OD1   1 
ATOM   1021 O OD2   . ASP A 1 134 ? -41.969 40.798  37.017  1.00 125.23 ? 160 ASP A OD2   1 
ATOM   1022 N N     . ARG A 1 135 ? -36.922 40.239  37.521  1.00 60.29  ? 161 ARG A N     1 
ATOM   1023 C CA    . ARG A 1 135 ? -35.506 40.546  37.687  1.00 61.24  ? 161 ARG A CA    1 
ATOM   1024 C C     . ARG A 1 135 ? -34.766 40.507  36.354  1.00 60.81  ? 161 ARG A C     1 
ATOM   1025 O O     . ARG A 1 135 ? -33.885 41.327  36.096  1.00 66.46  ? 161 ARG A O     1 
ATOM   1026 C CB    . ARG A 1 135 ? -34.862 39.571  38.673  1.00 54.39  ? 161 ARG A CB    1 
ATOM   1027 C CG    . ARG A 1 135 ? -33.380 39.810  38.902  1.00 52.17  ? 161 ARG A CG    1 
ATOM   1028 C CD    . ARG A 1 135 ? -32.822 38.827  39.915  1.00 60.39  ? 161 ARG A CD    1 
ATOM   1029 N NE    . ARG A 1 135 ? -32.959 37.444  39.466  1.00 52.68  ? 161 ARG A NE    1 
ATOM   1030 C CZ    . ARG A 1 135 ? -32.031 36.788  38.778  1.00 51.03  ? 161 ARG A CZ    1 
ATOM   1031 N NH1   . ARG A 1 135 ? -30.892 37.390  38.458  1.00 45.86  ? 161 ARG A NH1   1 
ATOM   1032 N NH2   . ARG A 1 135 ? -32.241 35.531  38.411  1.00 45.20  ? 161 ARG A NH2   1 
ATOM   1033 N N     . ILE A 1 136 ? -35.130 39.546  35.512  1.00 63.44  ? 162 ILE A N     1 
ATOM   1034 C CA    . ILE A 1 136 ? -34.515 39.400  34.200  1.00 59.69  ? 162 ILE A CA    1 
ATOM   1035 C C     . ILE A 1 136 ? -34.882 40.583  33.311  1.00 54.18  ? 162 ILE A C     1 
ATOM   1036 O O     . ILE A 1 136 ? -34.059 41.076  32.536  1.00 43.86  ? 162 ILE A O     1 
ATOM   1037 C CB    . ILE A 1 136 ? -34.972 38.097  33.510  1.00 56.23  ? 162 ILE A CB    1 
ATOM   1038 C CG1   . ILE A 1 136 ? -34.886 36.915  34.479  1.00 53.08  ? 162 ILE A CG1   1 
ATOM   1039 C CG2   . ILE A 1 136 ? -34.151 37.835  32.258  1.00 65.12  ? 162 ILE A CG2   1 
ATOM   1040 C CD1   . ILE A 1 136 ? -33.510 36.707  35.075  1.00 50.27  ? 162 ILE A CD1   1 
ATOM   1041 N N     . ALA A 1 137 ? -36.125 41.036  33.438  1.00 45.76  ? 163 ALA A N     1 
ATOM   1042 C CA    . ALA A 1 137 ? -36.652 42.110  32.605  1.00 48.46  ? 163 ALA A CA    1 
ATOM   1043 C C     . ALA A 1 137 ? -35.906 43.424  32.812  1.00 64.60  ? 163 ALA A C     1 
ATOM   1044 O O     . ALA A 1 137 ? -35.841 44.258  31.908  1.00 78.81  ? 163 ALA A O     1 
ATOM   1045 C CB    . ALA A 1 137 ? -38.138 42.296  32.868  1.00 36.18  ? 163 ALA A CB    1 
ATOM   1046 N N     . GLN A 1 138 ? -35.347 43.603  34.005  1.00 56.69  ? 164 GLN A N     1 
ATOM   1047 C CA    . GLN A 1 138 ? -34.639 44.832  34.349  1.00 57.31  ? 164 GLN A CA    1 
ATOM   1048 C C     . GLN A 1 138 ? -33.594 45.210  33.302  1.00 58.98  ? 164 GLN A C     1 
ATOM   1049 O O     . GLN A 1 138 ? -32.906 44.342  32.763  1.00 56.54  ? 164 GLN A O     1 
ATOM   1050 C CB    . GLN A 1 138 ? -33.985 44.704  35.727  1.00 69.42  ? 164 GLN A CB    1 
ATOM   1051 C CG    . GLN A 1 138 ? -34.977 44.550  36.868  1.00 72.99  ? 164 GLN A CG    1 
ATOM   1052 C CD    . GLN A 1 138 ? -35.905 45.744  36.996  1.00 90.76  ? 164 GLN A CD    1 
ATOM   1053 O OE1   . GLN A 1 138 ? -37.074 45.601  37.353  1.00 99.86  ? 164 GLN A OE1   1 
ATOM   1054 N NE2   . GLN A 1 138 ? -35.387 46.930  36.699  1.00 94.10  ? 164 GLN A NE2   1 
ATOM   1055 N N     . PRO A 1 139 ? -33.481 46.515  33.008  1.00 65.06  ? 165 PRO A N     1 
ATOM   1056 C CA    . PRO A 1 139 ? -32.518 47.040  32.033  1.00 59.07  ? 165 PRO A CA    1 
ATOM   1057 C C     . PRO A 1 139 ? -31.080 46.746  32.448  1.00 67.42  ? 165 PRO A C     1 
ATOM   1058 O O     . PRO A 1 139 ? -30.287 46.258  31.642  1.00 64.85  ? 165 PRO A O     1 
ATOM   1059 C CB    . PRO A 1 139 ? -32.770 48.552  32.071  1.00 55.37  ? 165 PRO A CB    1 
ATOM   1060 C CG    . PRO A 1 139 ? -34.152 48.703  32.611  1.00 56.74  ? 165 PRO A CG    1 
ATOM   1061 C CD    . PRO A 1 139 ? -34.325 47.577  33.581  1.00 64.08  ? 165 PRO A CD    1 
ATOM   1062 N N     . ASN A 1 140 ? -30.754 47.044  33.701  1.00 76.75  ? 166 ASN A N     1 
ATOM   1063 C CA    . ASN A 1 140 ? -29.409 46.828  34.218  1.00 75.46  ? 166 ASN A CA    1 
ATOM   1064 C C     . ASN A 1 140 ? -29.154 45.369  34.585  1.00 59.79  ? 166 ASN A C     1 
ATOM   1065 O O     . ASN A 1 140 ? -28.143 45.044  35.209  1.00 48.54  ? 166 ASN A O     1 
ATOM   1066 C CB    . ASN A 1 140 ? -29.155 47.726  35.431  1.00 78.98  ? 166 ASN A CB    1 
ATOM   1067 C CG    . ASN A 1 140 ? -30.122 47.457  36.570  1.00 69.20  ? 166 ASN A CG    1 
ATOM   1068 O OD1   . ASN A 1 140 ? -30.812 46.439  36.589  1.00 62.31  ? 166 ASN A OD1   1 
ATOM   1069 N ND2   . ASN A 1 140 ? -30.172 48.373  37.531  1.00 71.24  ? 166 ASN A ND2   1 
ATOM   1070 N N     . TYR A 1 141 ? -30.074 44.495  34.191  1.00 55.06  ? 167 TYR A N     1 
ATOM   1071 C CA    . TYR A 1 141 ? -29.973 43.082  34.530  1.00 51.94  ? 167 TYR A CA    1 
ATOM   1072 C C     . TYR A 1 141 ? -28.690 42.441  34.019  1.00 58.08  ? 167 TYR A C     1 
ATOM   1073 O O     . TYR A 1 141 ? -28.336 42.576  32.848  1.00 68.39  ? 167 TYR A O     1 
ATOM   1074 C CB    . TYR A 1 141 ? -31.176 42.303  34.001  1.00 52.41  ? 167 TYR A CB    1 
ATOM   1075 C CG    . TYR A 1 141 ? -30.926 40.816  33.938  1.00 55.95  ? 167 TYR A CG    1 
ATOM   1076 C CD1   . TYR A 1 141 ? -30.718 40.079  35.097  1.00 56.67  ? 167 TYR A CD1   1 
ATOM   1077 C CD2   . TYR A 1 141 ? -30.888 40.149  32.722  1.00 46.27  ? 167 TYR A CD2   1 
ATOM   1078 C CE1   . TYR A 1 141 ? -30.482 38.720  35.047  1.00 47.12  ? 167 TYR A CE1   1 
ATOM   1079 C CE2   . TYR A 1 141 ? -30.654 38.788  32.662  1.00 47.24  ? 167 TYR A CE2   1 
ATOM   1080 C CZ    . TYR A 1 141 ? -30.452 38.079  33.828  1.00 51.12  ? 167 TYR A CZ    1 
ATOM   1081 O OH    . TYR A 1 141 ? -30.218 36.723  33.775  1.00 54.96  ? 167 TYR A OH    1 
ATOM   1082 N N     . ILE A 1 142 ? -28.001 41.741  34.914  1.00 57.79  ? 168 ILE A N     1 
ATOM   1083 C CA    . ILE A 1 142 ? -26.833 40.950  34.553  1.00 63.51  ? 168 ILE A CA    1 
ATOM   1084 C C     . ILE A 1 142 ? -26.986 39.552  35.138  1.00 65.46  ? 168 ILE A C     1 
ATOM   1085 O O     . ILE A 1 142 ? -27.134 39.396  36.350  1.00 72.29  ? 168 ILE A O     1 
ATOM   1086 C CB    . ILE A 1 142 ? -25.530 41.581  35.071  1.00 82.03  ? 168 ILE A CB    1 
ATOM   1087 C CG1   . ILE A 1 142 ? -25.323 42.963  34.449  1.00 87.44  ? 168 ILE A CG1   1 
ATOM   1088 C CG2   . ILE A 1 142 ? -24.344 40.677  34.767  1.00 87.68  ? 168 ILE A CG2   1 
ATOM   1089 C CD1   . ILE A 1 142 ? -24.040 43.639  34.881  1.00 85.37  ? 168 ILE A CD1   1 
ATOM   1090 N N     . PRO A 1 143 ? -26.952 38.529  34.273  1.00 64.26  ? 169 PRO A N     1 
ATOM   1091 C CA    . PRO A 1 143 ? -27.202 37.142  34.679  1.00 66.28  ? 169 PRO A CA    1 
ATOM   1092 C C     . PRO A 1 143 ? -26.349 36.730  35.872  1.00 72.39  ? 169 PRO A C     1 
ATOM   1093 O O     . PRO A 1 143 ? -25.121 36.777  35.792  1.00 79.37  ? 169 PRO A O     1 
ATOM   1094 C CB    . PRO A 1 143 ? -26.791 36.339  33.442  1.00 55.53  ? 169 PRO A CB    1 
ATOM   1095 C CG    . PRO A 1 143 ? -26.969 37.283  32.307  1.00 44.99  ? 169 PRO A CG    1 
ATOM   1096 C CD    . PRO A 1 143 ? -26.603 38.633  32.845  1.00 48.21  ? 169 PRO A CD    1 
ATOM   1097 N N     . THR A 1 144 ? -26.993 36.337  36.967  1.00 64.57  ? 170 THR A N     1 
ATOM   1098 C CA    . THR A 1 144 ? -26.261 35.835  38.122  1.00 59.76  ? 170 THR A CA    1 
ATOM   1099 C C     . THR A 1 144 ? -25.541 34.547  37.743  1.00 61.51  ? 170 THR A C     1 
ATOM   1100 O O     . THR A 1 144 ? -25.818 33.954  36.700  1.00 49.87  ? 170 THR A O     1 
ATOM   1101 C CB    . THR A 1 144 ? -27.182 35.580  39.332  1.00 51.48  ? 170 THR A CB    1 
ATOM   1102 O OG1   . THR A 1 144 ? -26.401 35.119  40.441  1.00 66.59  ? 170 THR A OG1   1 
ATOM   1103 C CG2   . THR A 1 144 ? -28.229 34.537  39.001  1.00 47.63  ? 170 THR A CG2   1 
ATOM   1104 N N     . GLN A 1 145 ? -24.610 34.119  38.587  1.00 69.47  ? 171 GLN A N     1 
ATOM   1105 C CA    . GLN A 1 145 ? -23.846 32.913  38.311  1.00 62.74  ? 171 GLN A CA    1 
ATOM   1106 C C     . GLN A 1 145 ? -24.771 31.702  38.251  1.00 62.75  ? 171 GLN A C     1 
ATOM   1107 O O     . GLN A 1 145 ? -24.496 30.733  37.544  1.00 69.02  ? 171 GLN A O     1 
ATOM   1108 C CB    . GLN A 1 145 ? -22.759 32.717  39.367  1.00 62.45  ? 171 GLN A CB    1 
ATOM   1109 C CG    . GLN A 1 145 ? -21.456 32.169  38.813  1.00 67.70  ? 171 GLN A CG    1 
ATOM   1110 C CD    . GLN A 1 145 ? -20.285 32.409  39.743  1.00 80.42  ? 171 GLN A CD    1 
ATOM   1111 O OE1   . GLN A 1 145 ? -20.456 32.879  40.868  1.00 91.62  ? 171 GLN A OE1   1 
ATOM   1112 N NE2   . GLN A 1 145 ? -19.084 32.092  39.275  1.00 86.76  ? 171 GLN A NE2   1 
ATOM   1113 N N     . GLN A 1 146 ? -25.874 31.769  38.990  1.00 50.84  ? 172 GLN A N     1 
ATOM   1114 C CA    . GLN A 1 146 ? -26.868 30.702  38.980  1.00 35.39  ? 172 GLN A CA    1 
ATOM   1115 C C     . GLN A 1 146 ? -27.668 30.721  37.682  1.00 40.49  ? 172 GLN A C     1 
ATOM   1116 O O     . GLN A 1 146 ? -28.112 29.677  37.201  1.00 45.89  ? 172 GLN A O     1 
ATOM   1117 C CB    . GLN A 1 146 ? -27.807 30.829  40.181  1.00 32.51  ? 172 GLN A CB    1 
ATOM   1118 C CG    . GLN A 1 146 ? -28.845 29.718  40.286  1.00 33.00  ? 172 GLN A CG    1 
ATOM   1119 C CD    . GLN A 1 146 ? -28.236 28.367  40.622  1.00 53.98  ? 172 GLN A CD    1 
ATOM   1120 O OE1   . GLN A 1 146 ? -28.824 27.322  40.340  1.00 61.81  ? 172 GLN A OE1   1 
ATOM   1121 N NE2   . GLN A 1 146 ? -27.052 28.382  41.227  1.00 50.55  ? 172 GLN A NE2   1 
ATOM   1122 N N     . ASP A 1 147 ? -27.853 31.913  37.120  1.00 38.88  ? 173 ASP A N     1 
ATOM   1123 C CA    . ASP A 1 147 ? -28.546 32.058  35.844  1.00 43.66  ? 173 ASP A CA    1 
ATOM   1124 C C     . ASP A 1 147 ? -27.794 31.323  34.742  1.00 40.11  ? 173 ASP A C     1 
ATOM   1125 O O     . ASP A 1 147 ? -28.367 30.497  34.032  1.00 35.54  ? 173 ASP A O     1 
ATOM   1126 C CB    . ASP A 1 147 ? -28.704 33.533  35.469  1.00 37.29  ? 173 ASP A CB    1 
ATOM   1127 C CG    . ASP A 1 147 ? -29.748 34.239  36.307  1.00 37.76  ? 173 ASP A CG    1 
ATOM   1128 O OD1   . ASP A 1 147 ? -30.447 33.558  37.088  1.00 20.49  ? 173 ASP A OD1   1 
ATOM   1129 O OD2   . ASP A 1 147 ? -29.868 35.477  36.188  1.00 47.14  ? 173 ASP A OD2   1 
ATOM   1130 N N     . VAL A 1 148 ? -26.509 31.635  34.605  1.00 39.00  ? 174 VAL A N     1 
ATOM   1131 C CA    . VAL A 1 148 ? -25.662 30.988  33.612  1.00 46.94  ? 174 VAL A CA    1 
ATOM   1132 C C     . VAL A 1 148 ? -25.757 29.473  33.745  1.00 54.17  ? 174 VAL A C     1 
ATOM   1133 O O     . VAL A 1 148 ? -25.818 28.751  32.750  1.00 62.75  ? 174 VAL A O     1 
ATOM   1134 C CB    . VAL A 1 148 ? -24.191 31.421  33.759  1.00 47.30  ? 174 VAL A CB    1 
ATOM   1135 C CG1   . VAL A 1 148 ? -23.301 30.600  32.840  1.00 48.02  ? 174 VAL A CG1   1 
ATOM   1136 C CG2   . VAL A 1 148 ? -24.041 32.909  33.471  1.00 41.05  ? 174 VAL A CG2   1 
ATOM   1137 N N     . LEU A 1 149 ? -25.777 29.003  34.986  1.00 52.58  ? 175 LEU A N     1 
ATOM   1138 C CA    . LEU A 1 149 ? -25.890 27.580  35.271  1.00 56.84  ? 175 LEU A CA    1 
ATOM   1139 C C     . LEU A 1 149 ? -27.149 26.992  34.642  1.00 61.01  ? 175 LEU A C     1 
ATOM   1140 O O     . LEU A 1 149 ? -27.176 25.825  34.252  1.00 60.83  ? 175 LEU A O     1 
ATOM   1141 C CB    . LEU A 1 149 ? -25.909 27.354  36.783  1.00 52.45  ? 175 LEU A CB    1 
ATOM   1142 C CG    . LEU A 1 149 ? -25.893 25.910  37.279  1.00 45.43  ? 175 LEU A CG    1 
ATOM   1143 C CD1   . LEU A 1 149 ? -24.632 25.202  36.810  1.00 50.19  ? 175 LEU A CD1   1 
ATOM   1144 C CD2   . LEU A 1 149 ? -26.000 25.875  38.795  1.00 44.64  ? 175 LEU A CD2   1 
ATOM   1145 N N     . ARG A 1 150 ? -28.189 27.813  34.542  1.00 61.70  ? 176 ARG A N     1 
ATOM   1146 C CA    . ARG A 1 150 ? -29.483 27.357  34.047  1.00 60.08  ? 176 ARG A CA    1 
ATOM   1147 C C     . ARG A 1 150 ? -29.642 27.504  32.535  1.00 59.31  ? 176 ARG A C     1 
ATOM   1148 O O     . ARG A 1 150 ? -30.611 27.007  31.961  1.00 52.06  ? 176 ARG A O     1 
ATOM   1149 C CB    . ARG A 1 150 ? -30.618 28.097  34.761  1.00 56.06  ? 176 ARG A CB    1 
ATOM   1150 C CG    . ARG A 1 150 ? -30.801 27.713  36.221  1.00 50.39  ? 176 ARG A CG    1 
ATOM   1151 C CD    . ARG A 1 150 ? -30.969 26.209  36.374  1.00 57.97  ? 176 ARG A CD    1 
ATOM   1152 N NE    . ARG A 1 150 ? -31.486 25.839  37.688  1.00 66.23  ? 176 ARG A NE    1 
ATOM   1153 C CZ    . ARG A 1 150 ? -32.691 25.317  37.896  1.00 56.18  ? 176 ARG A CZ    1 
ATOM   1154 N NH1   . ARG A 1 150 ? -33.505 25.094  36.872  1.00 43.55  ? 176 ARG A NH1   1 
ATOM   1155 N NH2   . ARG A 1 150 ? -33.080 25.010  39.126  1.00 50.96  ? 176 ARG A NH2   1 
ATOM   1156 N N     . THR A 1 151 ? -28.698 28.185  31.891  1.00 58.52  ? 177 THR A N     1 
ATOM   1157 C CA    . THR A 1 151 ? -28.799 28.425  30.453  1.00 50.13  ? 177 THR A CA    1 
ATOM   1158 C C     . THR A 1 151 ? -28.722 27.131  29.652  1.00 51.75  ? 177 THR A C     1 
ATOM   1159 O O     . THR A 1 151 ? -28.120 26.147  30.084  1.00 57.15  ? 177 THR A O     1 
ATOM   1160 C CB    . THR A 1 151 ? -27.718 29.396  29.940  1.00 44.13  ? 177 THR A CB    1 
ATOM   1161 O OG1   . THR A 1 151 ? -26.424 28.796  30.077  1.00 46.58  ? 177 THR A OG1   1 
ATOM   1162 C CG2   . THR A 1 151 ? -27.762 30.705  30.713  1.00 52.46  ? 177 THR A CG2   1 
ATOM   1163 N N     . ARG A 1 152 ? -29.337 27.148  28.476  1.00 53.05  ? 178 ARG A N     1 
ATOM   1164 C CA    . ARG A 1 152 ? -29.381 25.982  27.610  1.00 54.09  ? 178 ARG A CA    1 
ATOM   1165 C C     . ARG A 1 152 ? -28.934 26.370  26.208  1.00 61.15  ? 178 ARG A C     1 
ATOM   1166 O O     . ARG A 1 152 ? -29.674 27.021  25.472  1.00 69.59  ? 178 ARG A O     1 
ATOM   1167 C CB    . ARG A 1 152 ? -30.800 25.417  27.576  1.00 44.42  ? 178 ARG A CB    1 
ATOM   1168 C CG    . ARG A 1 152 ? -31.371 25.111  28.951  1.00 35.93  ? 178 ARG A CG    1 
ATOM   1169 C CD    . ARG A 1 152 ? -32.872 24.901  28.893  1.00 20.96  ? 178 ARG A CD    1 
ATOM   1170 N NE    . ARG A 1 152 ? -33.242 23.913  27.886  1.00 37.15  ? 178 ARG A NE    1 
ATOM   1171 C CZ    . ARG A 1 152 ? -33.339 22.609  28.120  1.00 40.18  ? 178 ARG A CZ    1 
ATOM   1172 N NH1   . ARG A 1 152 ? -33.096 22.132  29.332  1.00 46.50  ? 178 ARG A NH1   1 
ATOM   1173 N NH2   . ARG A 1 152 ? -33.682 21.782  27.143  1.00 39.99  ? 178 ARG A NH2   1 
ATOM   1174 N N     . VAL A 1 153 ? -27.719 25.973  25.844  1.00 54.48  ? 179 VAL A N     1 
ATOM   1175 C CA    . VAL A 1 153 ? -27.156 26.326  24.546  1.00 56.02  ? 179 VAL A CA    1 
ATOM   1176 C C     . VAL A 1 153 ? -26.915 25.091  23.684  1.00 58.83  ? 179 VAL A C     1 
ATOM   1177 O O     . VAL A 1 153 ? -26.936 23.965  24.181  1.00 68.45  ? 179 VAL A O     1 
ATOM   1178 C CB    . VAL A 1 153 ? -25.831 27.094  24.705  1.00 56.10  ? 179 VAL A CB    1 
ATOM   1179 C CG1   . VAL A 1 153 ? -26.066 28.412  25.425  1.00 56.00  ? 179 VAL A CG1   1 
ATOM   1180 C CG2   . VAL A 1 153 ? -24.819 26.245  25.458  1.00 49.51  ? 179 VAL A CG2   1 
ATOM   1181 N N     . LYS A 1 154 ? -26.686 25.306  22.392  1.00 54.96  ? 180 LYS A N     1 
ATOM   1182 C CA    . LYS A 1 154 ? -26.425 24.203  21.473  1.00 69.04  ? 180 LYS A CA    1 
ATOM   1183 C C     . LYS A 1 154 ? -25.060 23.570  21.722  1.00 74.24  ? 180 LYS A C     1 
ATOM   1184 O O     . LYS A 1 154 ? -24.023 24.204  21.521  1.00 71.26  ? 180 LYS A O     1 
ATOM   1185 C CB    . LYS A 1 154 ? -26.544 24.666  20.018  1.00 80.05  ? 180 LYS A CB    1 
ATOM   1186 C CG    . LYS A 1 154 ? -27.978 24.766  19.518  1.00 90.11  ? 180 LYS A CG    1 
ATOM   1187 C CD    . LYS A 1 154 ? -28.690 23.424  19.630  1.00 90.08  ? 180 LYS A CD    1 
ATOM   1188 C CE    . LYS A 1 154 ? -30.134 23.513  19.161  1.00 88.84  ? 180 LYS A CE    1 
ATOM   1189 N NZ    . LYS A 1 154 ? -30.852 22.220  19.343  1.00 86.95  ? 180 LYS A NZ    1 
ATOM   1190 N N     . THR A 1 155 ? -25.072 22.315  22.161  1.00 91.17  ? 181 THR A N     1 
ATOM   1191 C CA    . THR A 1 155 ? -23.845 21.589  22.464  1.00 114.92 ? 181 THR A CA    1 
ATOM   1192 C C     . THR A 1 155 ? -23.081 21.223  21.195  1.00 122.20 ? 181 THR A C     1 
ATOM   1193 O O     . THR A 1 155 ? -23.418 20.255  20.512  1.00 116.51 ? 181 THR A O     1 
ATOM   1194 C CB    . THR A 1 155 ? -24.137 20.307  23.270  1.00 121.87 ? 181 THR A CB    1 
ATOM   1195 O OG1   . THR A 1 155 ? -25.177 19.564  22.621  1.00 131.37 ? 181 THR A OG1   1 
ATOM   1196 C CG2   . THR A 1 155 ? -24.583 20.654  24.682  1.00 115.08 ? 181 THR A CG2   1 
ATOM   1197 N N     . THR A 1 156 ? -22.049 22.002  20.888  1.00 127.76 ? 182 THR A N     1 
ATOM   1198 C CA    . THR A 1 156 ? -21.247 21.778  19.691  1.00 132.98 ? 182 THR A CA    1 
ATOM   1199 C C     . THR A 1 156 ? -20.155 20.741  19.933  1.00 133.51 ? 182 THR A C     1 
ATOM   1200 O O     . THR A 1 156 ? -19.014 21.087  20.242  1.00 138.33 ? 182 THR A O     1 
ATOM   1201 C CB    . THR A 1 156 ? -20.598 23.085  19.191  1.00 130.95 ? 182 THR A CB    1 
ATOM   1202 O OG1   . THR A 1 156 ? -21.609 24.083  19.001  1.00 136.52 ? 182 THR A OG1   1 
ATOM   1203 C CG2   . THR A 1 156 ? -19.867 22.853  17.875  1.00 120.42 ? 182 THR A CG2   1 
ATOM   1204 N N     . GLY A 1 157 ? -20.512 19.469  19.795  1.00 120.89 ? 183 GLY A N     1 
ATOM   1205 C CA    . GLY A 1 157 ? -19.550 18.391  19.918  1.00 106.63 ? 183 GLY A CA    1 
ATOM   1206 C C     . GLY A 1 157 ? -19.270 17.961  21.344  1.00 89.34  ? 183 GLY A C     1 
ATOM   1207 O O     . GLY A 1 157 ? -20.163 17.947  22.192  1.00 91.07  ? 183 GLY A O     1 
ATOM   1208 N N     . ILE A 1 158 ? -18.016 17.607  21.603  1.00 72.92  ? 184 ILE A N     1 
ATOM   1209 C CA    . ILE A 1 158 ? -17.599 17.109  22.907  1.00 65.38  ? 184 ILE A CA    1 
ATOM   1210 C C     . ILE A 1 158 ? -16.955 18.210  23.738  1.00 74.72  ? 184 ILE A C     1 
ATOM   1211 O O     . ILE A 1 158 ? -16.056 18.905  23.267  1.00 88.44  ? 184 ILE A O     1 
ATOM   1212 C CB    . ILE A 1 158 ? -16.584 15.963  22.759  1.00 61.66  ? 184 ILE A CB    1 
ATOM   1213 C CG1   . ILE A 1 158 ? -17.173 14.837  21.905  1.00 67.49  ? 184 ILE A CG1   1 
ATOM   1214 C CG2   . ILE A 1 158 ? -16.154 15.451  24.125  1.00 54.70  ? 184 ILE A CG2   1 
ATOM   1215 C CD1   . ILE A 1 158 ? -16.195 13.719  21.610  1.00 63.81  ? 184 ILE A CD1   1 
ATOM   1216 N N     . VAL A 1 159 ? -17.412 18.363  24.978  1.00 62.07  ? 185 VAL A N     1 
ATOM   1217 C CA    . VAL A 1 159 ? -16.846 19.361  25.879  1.00 53.04  ? 185 VAL A CA    1 
ATOM   1218 C C     . VAL A 1 159 ? -15.893 18.735  26.893  1.00 51.72  ? 185 VAL A C     1 
ATOM   1219 O O     . VAL A 1 159 ? -16.077 17.593  27.313  1.00 50.86  ? 185 VAL A O     1 
ATOM   1220 C CB    . VAL A 1 159 ? -17.940 20.152  26.629  1.00 50.84  ? 185 VAL A CB    1 
ATOM   1221 C CG1   . VAL A 1 159 ? -18.675 21.083  25.678  1.00 39.21  ? 185 VAL A CG1   1 
ATOM   1222 C CG2   . VAL A 1 159 ? -18.905 19.205  27.321  1.00 64.30  ? 185 VAL A CG2   1 
ATOM   1223 N N     . GLU A 1 160 ? -14.874 19.497  27.278  1.00 52.35  ? 186 GLU A N     1 
ATOM   1224 C CA    . GLU A 1 160 ? -13.887 19.046  28.251  1.00 55.85  ? 186 GLU A CA    1 
ATOM   1225 C C     . GLU A 1 160 ? -13.503 20.183  29.189  1.00 55.19  ? 186 GLU A C     1 
ATOM   1226 O O     . GLU A 1 160 ? -13.198 21.288  28.741  1.00 72.95  ? 186 GLU A O     1 
ATOM   1227 C CB    . GLU A 1 160 ? -12.638 18.519  27.542  1.00 67.01  ? 186 GLU A CB    1 
ATOM   1228 C CG    . GLU A 1 160 ? -11.480 18.214  28.480  1.00 82.18  ? 186 GLU A CG    1 
ATOM   1229 C CD    . GLU A 1 160 ? -10.217 17.820  27.741  1.00 98.78  ? 186 GLU A CD    1 
ATOM   1230 O OE1   . GLU A 1 160 ? -10.188 17.944  26.498  1.00 110.14 ? 186 GLU A OE1   1 
ATOM   1231 O OE2   . GLU A 1 160 ? -9.250  17.390  28.405  1.00 97.81  ? 186 GLU A OE2   1 
ATOM   1232 N N     . THR A 1 161 ? -13.514 19.911  30.490  1.00 40.00  ? 187 THR A N     1 
ATOM   1233 C CA    . THR A 1 161 ? -13.147 20.921  31.476  1.00 45.18  ? 187 THR A CA    1 
ATOM   1234 C C     . THR A 1 161 ? -12.015 20.445  32.387  1.00 44.57  ? 187 THR A C     1 
ATOM   1235 O O     . THR A 1 161 ? -12.040 19.325  32.897  1.00 44.68  ? 187 THR A O     1 
ATOM   1236 C CB    . THR A 1 161 ? -14.360 21.363  32.322  1.00 41.97  ? 187 THR A CB    1 
ATOM   1237 O OG1   . THR A 1 161 ? -13.957 22.378  33.249  1.00 50.30  ? 187 THR A OG1   1 
ATOM   1238 C CG2   . THR A 1 161 ? -14.945 20.183  33.083  1.00 42.83  ? 187 THR A CG2   1 
ATOM   1239 N N     . HIS A 1 162 ? -11.018 21.304  32.575  1.00 46.49  ? 188 HIS A N     1 
ATOM   1240 C CA    . HIS A 1 162 ? -9.871  20.991  33.419  1.00 44.50  ? 188 HIS A CA    1 
ATOM   1241 C C     . HIS A 1 162 ? -9.985  21.746  34.735  1.00 46.96  ? 188 HIS A C     1 
ATOM   1242 O O     . HIS A 1 162 ? -10.461 22.881  34.763  1.00 55.40  ? 188 HIS A O     1 
ATOM   1243 C CB    . HIS A 1 162 ? -8.572  21.398  32.720  1.00 62.59  ? 188 HIS A CB    1 
ATOM   1244 C CG    . HIS A 1 162 ? -8.467  20.921  31.305  1.00 86.90  ? 188 HIS A CG    1 
ATOM   1245 N ND1   . HIS A 1 162 ? -7.576  19.946  30.913  1.00 95.63  ? 188 HIS A ND1   1 
ATOM   1246 C CD2   . HIS A 1 162 ? -9.140  21.287  30.189  1.00 98.70  ? 188 HIS A CD2   1 
ATOM   1247 C CE1   . HIS A 1 162 ? -7.704  19.731  29.615  1.00 102.35 ? 188 HIS A CE1   1 
ATOM   1248 N NE2   . HIS A 1 162 ? -8.648  20.531  29.153  1.00 107.60 ? 188 HIS A NE2   1 
ATOM   1249 N N     . PHE A 1 163 ? -9.548  21.117  35.822  1.00 46.00  ? 189 PHE A N     1 
ATOM   1250 C CA    . PHE A 1 163 ? -9.523  21.776  37.125  1.00 45.77  ? 189 PHE A CA    1 
ATOM   1251 C C     . PHE A 1 163 ? -8.776  20.948  38.165  1.00 42.90  ? 189 PHE A C     1 
ATOM   1252 O O     . PHE A 1 163 ? -8.651  19.732  38.030  1.00 44.69  ? 189 PHE A O     1 
ATOM   1253 C CB    . PHE A 1 163 ? -10.942 22.093  37.613  1.00 47.27  ? 189 PHE A CB    1 
ATOM   1254 C CG    . PHE A 1 163 ? -11.795 20.877  37.843  1.00 29.33  ? 189 PHE A CG    1 
ATOM   1255 C CD1   . PHE A 1 163 ? -11.762 20.210  39.058  1.00 29.31  ? 189 PHE A CD1   1 
ATOM   1256 C CD2   . PHE A 1 163 ? -12.637 20.409  36.850  1.00 28.15  ? 189 PHE A CD2   1 
ATOM   1257 C CE1   . PHE A 1 163 ? -12.547 19.094  39.274  1.00 28.16  ? 189 PHE A CE1   1 
ATOM   1258 C CE2   . PHE A 1 163 ? -13.427 19.292  37.060  1.00 42.86  ? 189 PHE A CE2   1 
ATOM   1259 C CZ    . PHE A 1 163 ? -13.382 18.635  38.275  1.00 43.81  ? 189 PHE A CZ    1 
ATOM   1260 N N     . THR A 1 164 ? -8.283  21.616  39.203  1.00 54.30  ? 190 THR A N     1 
ATOM   1261 C CA    . THR A 1 164 ? -7.547  20.940  40.266  1.00 58.58  ? 190 THR A CA    1 
ATOM   1262 C C     . THR A 1 164 ? -8.317  20.964  41.583  1.00 63.46  ? 190 THR A C     1 
ATOM   1263 O O     . THR A 1 164 ? -8.880  21.989  41.970  1.00 75.29  ? 190 THR A O     1 
ATOM   1264 C CB    . THR A 1 164 ? -6.157  21.565  40.477  1.00 69.45  ? 190 THR A CB    1 
ATOM   1265 O OG1   . THR A 1 164 ? -5.414  21.506  39.253  1.00 83.01  ? 190 THR A OG1   1 
ATOM   1266 C CG2   . THR A 1 164 ? -5.397  20.817  41.564  1.00 71.81  ? 190 THR A CG2   1 
ATOM   1267 N N     . PHE A 1 165 ? -8.335  19.826  42.267  1.00 59.74  ? 191 PHE A N     1 
ATOM   1268 C CA    . PHE A 1 165 ? -9.058  19.695  43.525  1.00 57.74  ? 191 PHE A CA    1 
ATOM   1269 C C     . PHE A 1 165 ? -8.430  18.607  44.382  1.00 56.62  ? 191 PHE A C     1 
ATOM   1270 O O     . PHE A 1 165 ? -8.327  17.456  43.960  1.00 65.44  ? 191 PHE A O     1 
ATOM   1271 C CB    . PHE A 1 165 ? -10.530 19.377  43.261  1.00 55.62  ? 191 PHE A CB    1 
ATOM   1272 C CG    . PHE A 1 165 ? -11.318 19.079  44.503  1.00 63.51  ? 191 PHE A CG    1 
ATOM   1273 C CD1   . PHE A 1 165 ? -11.459 20.033  45.496  1.00 65.24  ? 191 PHE A CD1   1 
ATOM   1274 C CD2   . PHE A 1 165 ? -11.931 17.849  44.670  1.00 61.36  ? 191 PHE A CD2   1 
ATOM   1275 C CE1   . PHE A 1 165 ? -12.188 19.763  46.637  1.00 66.91  ? 191 PHE A CE1   1 
ATOM   1276 C CE2   . PHE A 1 165 ? -12.662 17.574  45.809  1.00 68.70  ? 191 PHE A CE2   1 
ATOM   1277 C CZ    . PHE A 1 165 ? -12.791 18.532  46.793  1.00 71.60  ? 191 PHE A CZ    1 
ATOM   1278 N N     . LYS A 1 166 ? -8.012  18.977  45.588  1.00 43.59  ? 192 LYS A N     1 
ATOM   1279 C CA    . LYS A 1 166 ? -7.319  18.050  46.473  1.00 37.07  ? 192 LYS A CA    1 
ATOM   1280 C C     . LYS A 1 166 ? -6.095  17.441  45.798  1.00 35.44  ? 192 LYS A C     1 
ATOM   1281 O O     . LYS A 1 166 ? -5.936  16.221  45.771  1.00 38.44  ? 192 LYS A O     1 
ATOM   1282 C CB    . LYS A 1 166 ? -8.259  16.942  46.953  1.00 36.63  ? 192 LYS A CB    1 
ATOM   1283 C CG    . LYS A 1 166 ? -9.324  17.411  47.924  1.00 51.64  ? 192 LYS A CG    1 
ATOM   1284 C CD    . LYS A 1 166 ? -10.011 16.235  48.596  1.00 61.69  ? 192 LYS A CD    1 
ATOM   1285 C CE    . LYS A 1 166 ? -11.002 16.708  49.645  1.00 67.11  ? 192 LYS A CE    1 
ATOM   1286 N NZ    . LYS A 1 166 ? -11.589 15.573  50.405  1.00 69.90  ? 192 LYS A NZ    1 
ATOM   1287 N N     . ASP A 1 167 ? -5.240  18.298  45.250  1.00 50.82  ? 193 ASP A N     1 
ATOM   1288 C CA    . ASP A 1 167 ? -3.981  17.862  44.649  1.00 69.50  ? 193 ASP A CA    1 
ATOM   1289 C C     . ASP A 1 167 ? -4.180  16.873  43.502  1.00 63.69  ? 193 ASP A C     1 
ATOM   1290 O O     . ASP A 1 167 ? -3.279  16.100  43.176  1.00 62.74  ? 193 ASP A O     1 
ATOM   1291 C CB    . ASP A 1 167 ? -3.062  17.253  45.712  1.00 84.58  ? 193 ASP A CB    1 
ATOM   1292 C CG    . ASP A 1 167 ? -2.706  18.238  46.809  1.00 94.71  ? 193 ASP A CG    1 
ATOM   1293 O OD1   . ASP A 1 167 ? -3.010  19.439  46.654  1.00 97.46  ? 193 ASP A OD1   1 
ATOM   1294 O OD2   . ASP A 1 167 ? -2.119  17.811  47.827  1.00 100.87 ? 193 ASP A OD2   1 
ATOM   1295 N N     . LEU A 1 168 ? -5.361  16.899  42.893  1.00 56.26  ? 194 LEU A N     1 
ATOM   1296 C CA    . LEU A 1 168 ? -5.646  16.041  41.750  1.00 52.21  ? 194 LEU A CA    1 
ATOM   1297 C C     . LEU A 1 168 ? -6.006  16.871  40.526  1.00 58.60  ? 194 LEU A C     1 
ATOM   1298 O O     . LEU A 1 168 ? -6.699  17.882  40.631  1.00 64.60  ? 194 LEU A O     1 
ATOM   1299 C CB    . LEU A 1 168 ? -6.781  15.067  42.069  1.00 38.81  ? 194 LEU A CB    1 
ATOM   1300 C CG    . LEU A 1 168 ? -6.529  14.055  43.186  1.00 49.19  ? 194 LEU A CG    1 
ATOM   1301 C CD1   . LEU A 1 168 ? -7.711  13.105  43.311  1.00 54.15  ? 194 LEU A CD1   1 
ATOM   1302 C CD2   . LEU A 1 168 ? -5.243  13.285  42.934  1.00 49.62  ? 194 LEU A CD2   1 
ATOM   1303 N N     . HIS A 1 169 ? -5.530  16.439  39.363  1.00 51.35  ? 195 HIS A N     1 
ATOM   1304 C CA    . HIS A 1 169 ? -5.852  17.116  38.115  1.00 57.16  ? 195 HIS A CA    1 
ATOM   1305 C C     . HIS A 1 169 ? -6.980  16.392  37.391  1.00 57.55  ? 195 HIS A C     1 
ATOM   1306 O O     . HIS A 1 169 ? -6.773  15.334  36.796  1.00 64.05  ? 195 HIS A O     1 
ATOM   1307 C CB    . HIS A 1 169 ? -4.614  17.221  37.226  1.00 59.69  ? 195 HIS A CB    1 
ATOM   1308 C CG    . HIS A 1 169 ? -3.513  18.038  37.826  1.00 75.23  ? 195 HIS A CG    1 
ATOM   1309 N ND1   . HIS A 1 169 ? -3.330  19.371  37.528  1.00 81.34  ? 195 HIS A ND1   1 
ATOM   1310 C CD2   . HIS A 1 169 ? -2.548  17.716  38.718  1.00 91.46  ? 195 HIS A CD2   1 
ATOM   1311 C CE1   . HIS A 1 169 ? -2.293  19.833  38.206  1.00 90.52  ? 195 HIS A CE1   1 
ATOM   1312 N NE2   . HIS A 1 169 ? -1.801  18.848  38.935  1.00 94.92  ? 195 HIS A NE2   1 
ATOM   1313 N N     . PHE A 1 170 ? -8.175  16.970  37.454  1.00 51.95  ? 196 PHE A N     1 
ATOM   1314 C CA    . PHE A 1 170 ? -9.356  16.360  36.854  1.00 42.93  ? 196 PHE A CA    1 
ATOM   1315 C C     . PHE A 1 170 ? -9.580  16.803  35.412  1.00 47.52  ? 196 PHE A C     1 
ATOM   1316 O O     . PHE A 1 170 ? -9.445  17.981  35.078  1.00 47.06  ? 196 PHE A O     1 
ATOM   1317 C CB    . PHE A 1 170 ? -10.606 16.674  37.680  1.00 43.36  ? 196 PHE A CB    1 
ATOM   1318 C CG    . PHE A 1 170 ? -10.664 15.951  38.993  1.00 55.59  ? 196 PHE A CG    1 
ATOM   1319 C CD1   . PHE A 1 170 ? -10.170 16.540  40.146  1.00 59.33  ? 196 PHE A CD1   1 
ATOM   1320 C CD2   . PHE A 1 170 ? -11.216 14.683  39.076  1.00 50.15  ? 196 PHE A CD2   1 
ATOM   1321 C CE1   . PHE A 1 170 ? -10.223 15.878  41.358  1.00 51.84  ? 196 PHE A CE1   1 
ATOM   1322 C CE2   . PHE A 1 170 ? -11.272 14.015  40.284  1.00 57.38  ? 196 PHE A CE2   1 
ATOM   1323 C CZ    . PHE A 1 170 ? -10.775 14.614  41.427  1.00 57.94  ? 196 PHE A CZ    1 
ATOM   1324 N N     . LYS A 1 171 ? -9.920  15.839  34.565  1.00 46.45  ? 197 LYS A N     1 
ATOM   1325 C CA    . LYS A 1 171 ? -10.363 16.122  33.209  1.00 36.55  ? 197 LYS A CA    1 
ATOM   1326 C C     . LYS A 1 171 ? -11.734 15.491  33.017  1.00 34.09  ? 197 LYS A C     1 
ATOM   1327 O O     . LYS A 1 171 ? -11.858 14.268  32.945  1.00 31.82  ? 197 LYS A O     1 
ATOM   1328 C CB    . LYS A 1 171 ? -9.372  15.572  32.184  1.00 42.38  ? 197 LYS A CB    1 
ATOM   1329 C CG    . LYS A 1 171 ? -8.021  16.270  32.181  1.00 37.27  ? 197 LYS A CG    1 
ATOM   1330 C CD    . LYS A 1 171 ? -7.186  15.843  30.983  1.00 59.95  ? 197 LYS A CD    1 
ATOM   1331 C CE    . LYS A 1 171 ? -5.897  16.645  30.888  1.00 82.76  ? 197 LYS A CE    1 
ATOM   1332 N NZ    . LYS A 1 171 ? -5.099  16.279  29.684  1.00 87.32  ? 197 LYS A NZ    1 
ATOM   1333 N N     . MET A 1 172 ? -12.763 16.329  32.952  1.00 50.62  ? 198 MET A N     1 
ATOM   1334 C CA    . MET A 1 172 ? -14.137 15.851  32.843  1.00 42.73  ? 198 MET A CA    1 
ATOM   1335 C C     . MET A 1 172 ? -14.669 15.991  31.421  1.00 39.88  ? 198 MET A C     1 
ATOM   1336 O O     . MET A 1 172 ? -14.799 17.098  30.901  1.00 48.60  ? 198 MET A O     1 
ATOM   1337 C CB    . MET A 1 172 ? -15.040 16.600  33.825  1.00 35.24  ? 198 MET A CB    1 
ATOM   1338 C CG    . MET A 1 172 ? -16.488 16.151  33.803  1.00 35.00  ? 198 MET A CG    1 
ATOM   1339 S SD    . MET A 1 172 ? -17.486 17.004  35.037  1.00 61.93  ? 198 MET A SD    1 
ATOM   1340 C CE    . MET A 1 172 ? -16.710 16.441  36.548  1.00 18.19  ? 198 MET A CE    1 
ATOM   1341 N N     . PHE A 1 173 ? -14.974 14.858  30.799  1.00 45.10  ? 199 PHE A N     1 
ATOM   1342 C CA    . PHE A 1 173 ? -15.475 14.843  29.431  1.00 43.75  ? 199 PHE A CA    1 
ATOM   1343 C C     . PHE A 1 173 ? -16.990 14.687  29.393  1.00 40.65  ? 199 PHE A C     1 
ATOM   1344 O O     . PHE A 1 173 ? -17.578 14.010  30.238  1.00 39.84  ? 199 PHE A O     1 
ATOM   1345 C CB    . PHE A 1 173 ? -14.822 13.710  28.634  1.00 47.16  ? 199 PHE A CB    1 
ATOM   1346 C CG    . PHE A 1 173 ? -13.363 13.929  28.351  1.00 49.10  ? 199 PHE A CG    1 
ATOM   1347 C CD1   . PHE A 1 173 ? -12.938 14.289  27.084  1.00 55.50  ? 199 PHE A CD1   1 
ATOM   1348 C CD2   . PHE A 1 173 ? -12.419 13.777  29.351  1.00 47.81  ? 199 PHE A CD2   1 
ATOM   1349 C CE1   . PHE A 1 173 ? -11.597 14.490  26.819  1.00 63.91  ? 199 PHE A CE1   1 
ATOM   1350 C CE2   . PHE A 1 173 ? -11.077 13.978  29.092  1.00 53.81  ? 199 PHE A CE2   1 
ATOM   1351 C CZ    . PHE A 1 173 ? -10.666 14.335  27.824  1.00 59.08  ? 199 PHE A CZ    1 
ATOM   1352 N N     . ASP A 1 174 ? -17.614 15.319  28.406  1.00 47.16  ? 200 ASP A N     1 
ATOM   1353 C CA    . ASP A 1 174 ? -19.050 15.192  28.200  1.00 49.35  ? 200 ASP A CA    1 
ATOM   1354 C C     . ASP A 1 174 ? -19.406 15.314  26.722  1.00 51.57  ? 200 ASP A C     1 
ATOM   1355 O O     . ASP A 1 174 ? -19.223 16.368  26.114  1.00 67.85  ? 200 ASP A O     1 
ATOM   1356 C CB    . ASP A 1 174 ? -19.807 16.248  29.006  1.00 54.92  ? 200 ASP A CB    1 
ATOM   1357 C CG    . ASP A 1 174 ? -21.294 16.259  28.700  1.00 67.31  ? 200 ASP A CG    1 
ATOM   1358 O OD1   . ASP A 1 174 ? -21.848 15.181  28.393  1.00 66.56  ? 200 ASP A OD1   1 
ATOM   1359 O OD2   . ASP A 1 174 ? -21.908 17.346  28.768  1.00 66.01  ? 200 ASP A OD2   1 
ATOM   1360 N N     . VAL A 1 175 ? -19.905 14.227  26.145  1.00 20.05  ? 201 VAL A N     1 
ATOM   1361 C CA    . VAL A 1 175 ? -20.422 14.265  24.788  1.00 35.02  ? 201 VAL A CA    1 
ATOM   1362 C C     . VAL A 1 175 ? -21.911 14.560  24.868  1.00 58.41  ? 201 VAL A C     1 
ATOM   1363 O O     . VAL A 1 175 ? -22.694 13.712  25.292  1.00 76.98  ? 201 VAL A O     1 
ATOM   1364 C CB    . VAL A 1 175 ? -20.213 12.928  24.064  1.00 47.50  ? 201 VAL A CB    1 
ATOM   1365 C CG1   . VAL A 1 175 ? -20.447 13.097  22.569  1.00 51.45  ? 201 VAL A CG1   1 
ATOM   1366 C CG2   . VAL A 1 175 ? -18.815 12.397  24.331  1.00 42.44  ? 201 VAL A CG2   1 
ATOM   1367 N N     . GLY A 1 176 ? -22.299 15.768  24.475  1.00 60.63  ? 202 GLY A N     1 
ATOM   1368 C CA    . GLY A 1 176 ? -23.680 16.195  24.615  1.00 71.12  ? 202 GLY A CA    1 
ATOM   1369 C C     . GLY A 1 176 ? -24.407 16.366  23.298  1.00 80.40  ? 202 GLY A C     1 
ATOM   1370 O O     . GLY A 1 176 ? -24.034 17.207  22.481  1.00 109.09 ? 202 GLY A O     1 
ATOM   1371 N N     . GLY A 1 177 ? -25.450 15.565  23.097  1.00 55.55  ? 203 GLY A N     1 
ATOM   1372 C CA    . GLY A 1 177 ? -26.277 15.648  21.906  1.00 61.74  ? 203 GLY A CA    1 
ATOM   1373 C C     . GLY A 1 177 ? -25.567 15.222  20.636  1.00 80.73  ? 203 GLY A C     1 
ATOM   1374 O O     . GLY A 1 177 ? -26.046 14.356  19.902  1.00 87.28  ? 203 GLY A O     1 
ATOM   1375 N N     . GLN A 1 178 ? -24.419 15.840  20.380  1.00 83.29  ? 204 GLN A N     1 
ATOM   1376 C CA    . GLN A 1 178 ? -23.636 15.573  19.183  1.00 80.31  ? 204 GLN A CA    1 
ATOM   1377 C C     . GLN A 1 178 ? -23.459 14.079  18.953  1.00 69.94  ? 204 GLN A C     1 
ATOM   1378 O O     . GLN A 1 178 ? -22.768 13.403  19.715  1.00 78.22  ? 204 GLN A O     1 
ATOM   1379 C CB    . GLN A 1 178 ? -22.264 16.243  19.293  1.00 88.67  ? 204 GLN A CB    1 
ATOM   1380 C CG    . GLN A 1 178 ? -21.483 16.287  17.990  1.00 84.64  ? 204 GLN A CG    1 
ATOM   1381 C CD    . GLN A 1 178 ? -22.014 17.332  17.029  1.00 82.01  ? 204 GLN A CD    1 
ATOM   1382 O OE1   . GLN A 1 178 ? -21.736 17.287  15.831  1.00 97.60  ? 204 GLN A OE1   1 
ATOM   1383 N NE2   . GLN A 1 178 ? -22.784 18.280  17.550  1.00 68.71  ? 204 GLN A NE2   1 
ATOM   1384 N N     . ARG A 1 179 ? -24.092 13.565  17.904  1.00 60.59  ? 205 ARG A N     1 
ATOM   1385 C CA    . ARG A 1 179 ? -23.887 12.183  17.499  1.00 59.03  ? 205 ARG A CA    1 
ATOM   1386 C C     . ARG A 1 179 ? -22.439 12.008  17.062  1.00 63.86  ? 205 ARG A C     1 
ATOM   1387 O O     . ARG A 1 179 ? -22.020 12.558  16.043  1.00 77.85  ? 205 ARG A O     1 
ATOM   1388 C CB    . ARG A 1 179 ? -24.825 11.809  16.352  1.00 61.23  ? 205 ARG A CB    1 
ATOM   1389 C CG    . ARG A 1 179 ? -24.618 10.401  15.815  1.00 68.36  ? 205 ARG A CG    1 
ATOM   1390 C CD    . ARG A 1 179 ? -25.319 10.209  14.481  1.00 84.14  ? 205 ARG A CD    1 
ATOM   1391 N NE    . ARG A 1 179 ? -24.784 11.100  13.454  1.00 106.29 ? 205 ARG A NE    1 
ATOM   1392 C CZ    . ARG A 1 179 ? -25.227 11.150  12.202  1.00 111.53 ? 205 ARG A CZ    1 
ATOM   1393 N NH1   . ARG A 1 179 ? -26.219 10.359  11.814  1.00 113.57 ? 205 ARG A NH1   1 
ATOM   1394 N NH2   . ARG A 1 179 ? -24.679 11.992  11.335  1.00 103.16 ? 205 ARG A NH2   1 
ATOM   1395 N N     . SER A 1 180 ? -21.676 11.248  17.839  1.00 52.07  ? 206 SER A N     1 
ATOM   1396 C CA    . SER A 1 180 ? -20.261 11.051  17.552  1.00 51.80  ? 206 SER A CA    1 
ATOM   1397 C C     . SER A 1 180 ? -19.985 9.658   16.993  1.00 46.72  ? 206 SER A C     1 
ATOM   1398 O O     . SER A 1 180 ? -20.661 8.691   17.341  1.00 37.19  ? 206 SER A O     1 
ATOM   1399 C CB    . SER A 1 180 ? -19.424 11.299  18.809  1.00 60.48  ? 206 SER A CB    1 
ATOM   1400 O OG    . SER A 1 180 ? -19.643 12.605  19.315  1.00 59.61  ? 206 SER A OG    1 
ATOM   1401 N N     . GLU A 1 181 ? -18.984 9.568   16.123  1.00 51.32  ? 207 GLU A N     1 
ATOM   1402 C CA    . GLU A 1 181 ? -18.624 8.306   15.489  1.00 56.88  ? 207 GLU A CA    1 
ATOM   1403 C C     . GLU A 1 181 ? -17.938 7.365   16.478  1.00 50.70  ? 207 GLU A C     1 
ATOM   1404 O O     . GLU A 1 181 ? -17.347 7.807   17.463  1.00 42.40  ? 207 GLU A O     1 
ATOM   1405 C CB    . GLU A 1 181 ? -17.716 8.563   14.283  1.00 86.42  ? 207 GLU A CB    1 
ATOM   1406 C CG    . GLU A 1 181 ? -17.549 7.372   13.348  1.00 113.83 ? 207 GLU A CG    1 
ATOM   1407 C CD    . GLU A 1 181 ? -18.807 7.063   12.554  1.00 128.38 ? 207 GLU A CD    1 
ATOM   1408 O OE1   . GLU A 1 181 ? -18.778 6.118   11.738  1.00 127.20 ? 207 GLU A OE1   1 
ATOM   1409 O OE2   . GLU A 1 181 ? -19.823 7.765   12.743  1.00 136.01 ? 207 GLU A OE2   1 
ATOM   1410 N N     . ARG A 1 182 ? -18.025 6.066   16.202  1.00 57.58  ? 208 ARG A N     1 
ATOM   1411 C CA    . ARG A 1 182 ? -17.413 5.035   17.038  1.00 59.95  ? 208 ARG A CA    1 
ATOM   1412 C C     . ARG A 1 182 ? -16.001 5.415   17.479  1.00 57.71  ? 208 ARG A C     1 
ATOM   1413 O O     . ARG A 1 182 ? -15.579 5.088   18.586  1.00 60.84  ? 208 ARG A O     1 
ATOM   1414 C CB    . ARG A 1 182 ? -17.380 3.702   16.282  1.00 63.72  ? 208 ARG A CB    1 
ATOM   1415 C CG    . ARG A 1 182 ? -16.766 2.539   17.052  1.00 69.47  ? 208 ARG A CG    1 
ATOM   1416 C CD    . ARG A 1 182 ? -16.395 1.401   16.105  1.00 75.21  ? 208 ARG A CD    1 
ATOM   1417 N NE    . ARG A 1 182 ? -15.907 0.218   16.808  1.00 79.17  ? 208 ARG A NE    1 
ATOM   1418 C CZ    . ARG A 1 182 ? -16.596 -0.911  16.940  1.00 90.24  ? 208 ARG A CZ    1 
ATOM   1419 N NH1   . ARG A 1 182 ? -17.807 -1.017  16.410  1.00 88.24  ? 208 ARG A NH1   1 
ATOM   1420 N NH2   . ARG A 1 182 ? -16.074 -1.939  17.596  1.00 98.99  ? 208 ARG A NH2   1 
ATOM   1421 N N     . LYS A 1 183 ? -15.280 6.110   16.605  1.00 55.17  ? 209 LYS A N     1 
ATOM   1422 C CA    . LYS A 1 183 ? -13.899 6.498   16.873  1.00 72.59  ? 209 LYS A CA    1 
ATOM   1423 C C     . LYS A 1 183 ? -13.778 7.425   18.082  1.00 69.88  ? 209 LYS A C     1 
ATOM   1424 O O     . LYS A 1 183 ? -13.020 7.149   19.010  1.00 71.49  ? 209 LYS A O     1 
ATOM   1425 C CB    . LYS A 1 183 ? -13.286 7.161   15.637  1.00 96.45  ? 209 LYS A CB    1 
ATOM   1426 C CG    . LYS A 1 183 ? -13.318 6.289   14.389  1.00 107.86 ? 209 LYS A CG    1 
ATOM   1427 C CD    . LYS A 1 183 ? -12.761 7.021   13.176  1.00 104.42 ? 209 LYS A CD    1 
ATOM   1428 C CE    . LYS A 1 183 ? -12.776 6.130   11.941  1.00 93.40  ? 209 LYS A CE    1 
ATOM   1429 N NZ    . LYS A 1 183 ? -12.270 6.830   10.728  1.00 78.09  ? 209 LYS A NZ    1 
ATOM   1430 N N     . LYS A 1 184 ? -14.528 8.523   18.064  1.00 65.49  ? 210 LYS A N     1 
ATOM   1431 C CA    . LYS A 1 184 ? -14.470 9.508   19.140  1.00 51.85  ? 210 LYS A CA    1 
ATOM   1432 C C     . LYS A 1 184 ? -14.832 8.907   20.499  1.00 47.51  ? 210 LYS A C     1 
ATOM   1433 O O     . LYS A 1 184 ? -14.197 9.216   21.508  1.00 48.03  ? 210 LYS A O     1 
ATOM   1434 C CB    . LYS A 1 184 ? -15.377 10.702  18.830  1.00 60.08  ? 210 LYS A CB    1 
ATOM   1435 C CG    . LYS A 1 184 ? -14.928 11.535  17.635  1.00 75.45  ? 210 LYS A CG    1 
ATOM   1436 C CD    . LYS A 1 184 ? -15.864 12.713  17.391  1.00 90.84  ? 210 LYS A CD    1 
ATOM   1437 C CE    . LYS A 1 184 ? -15.417 13.541  16.193  1.00 91.17  ? 210 LYS A CE    1 
ATOM   1438 N NZ    . LYS A 1 184 ? -16.318 14.701  15.934  1.00 93.91  ? 210 LYS A NZ    1 
ATOM   1439 N N     . TRP A 1 185 ? -15.851 8.052   20.520  1.00 46.76  ? 211 TRP A N     1 
ATOM   1440 C CA    . TRP A 1 185 ? -16.299 7.418   21.758  1.00 33.84  ? 211 TRP A CA    1 
ATOM   1441 C C     . TRP A 1 185 ? -15.185 6.630   22.438  1.00 45.48  ? 211 TRP A C     1 
ATOM   1442 O O     . TRP A 1 185 ? -14.980 6.748   23.647  1.00 54.37  ? 211 TRP A O     1 
ATOM   1443 C CB    . TRP A 1 185 ? -17.496 6.500   21.499  1.00 30.38  ? 211 TRP A CB    1 
ATOM   1444 C CG    . TRP A 1 185 ? -18.794 7.228   21.330  1.00 41.80  ? 211 TRP A CG    1 
ATOM   1445 C CD1   . TRP A 1 185 ? -19.449 7.477   20.160  1.00 47.90  ? 211 TRP A CD1   1 
ATOM   1446 C CD2   . TRP A 1 185 ? -19.596 7.803   22.370  1.00 52.81  ? 211 TRP A CD2   1 
ATOM   1447 N NE1   . TRP A 1 185 ? -20.609 8.172   20.406  1.00 55.42  ? 211 TRP A NE1   1 
ATOM   1448 C CE2   . TRP A 1 185 ? -20.723 8.384   21.755  1.00 55.41  ? 211 TRP A CE2   1 
ATOM   1449 C CE3   . TRP A 1 185 ? -19.470 7.884   23.761  1.00 54.67  ? 211 TRP A CE3   1 
ATOM   1450 C CZ2   . TRP A 1 185 ? -21.718 9.037   22.482  1.00 60.14  ? 211 TRP A CZ2   1 
ATOM   1451 C CZ3   . TRP A 1 185 ? -20.459 8.533   24.481  1.00 48.81  ? 211 TRP A CZ3   1 
ATOM   1452 C CH2   . TRP A 1 185 ? -21.568 9.100   23.840  1.00 58.57  ? 211 TRP A CH2   1 
ATOM   1453 N N     . ILE A 1 186 ? -14.472 5.826   21.657  1.00 45.23  ? 212 ILE A N     1 
ATOM   1454 C CA    . ILE A 1 186 ? -13.376 5.021   22.181  1.00 43.91  ? 212 ILE A CA    1 
ATOM   1455 C C     . ILE A 1 186 ? -12.398 5.874   22.984  1.00 41.37  ? 212 ILE A C     1 
ATOM   1456 O O     . ILE A 1 186 ? -11.970 5.486   24.070  1.00 53.20  ? 212 ILE A O     1 
ATOM   1457 C CB    . ILE A 1 186 ? -12.606 4.307   21.051  1.00 47.16  ? 212 ILE A CB    1 
ATOM   1458 C CG1   . ILE A 1 186 ? -13.567 3.509   20.168  1.00 50.38  ? 212 ILE A CG1   1 
ATOM   1459 C CG2   . ILE A 1 186 ? -11.538 3.394   21.629  1.00 56.66  ? 212 ILE A CG2   1 
ATOM   1460 C CD1   . ILE A 1 186 ? -14.289 2.398   20.896  1.00 55.01  ? 212 ILE A CD1   1 
ATOM   1461 N N     . HIS A 1 187 ? -12.058 7.043   22.450  1.00 41.60  ? 213 HIS A N     1 
ATOM   1462 C CA    . HIS A 1 187 ? -11.084 7.924   23.087  1.00 43.28  ? 213 HIS A CA    1 
ATOM   1463 C C     . HIS A 1 187 ? -11.599 8.508   24.396  1.00 42.24  ? 213 HIS A C     1 
ATOM   1464 O O     . HIS A 1 187 ? -10.841 9.115   25.152  1.00 51.51  ? 213 HIS A O     1 
ATOM   1465 C CB    . HIS A 1 187 ? -10.672 9.050   22.137  1.00 54.69  ? 213 HIS A CB    1 
ATOM   1466 C CG    . HIS A 1 187 ? -10.051 8.568   20.864  1.00 60.02  ? 213 HIS A CG    1 
ATOM   1467 N ND1   . HIS A 1 187 ? -8.798  7.997   20.816  1.00 56.96  ? 213 HIS A ND1   1 
ATOM   1468 C CD2   . HIS A 1 187 ? -10.509 8.576   19.590  1.00 68.22  ? 213 HIS A CD2   1 
ATOM   1469 C CE1   . HIS A 1 187 ? -8.512  7.671   19.569  1.00 59.97  ? 213 HIS A CE1   1 
ATOM   1470 N NE2   . HIS A 1 187 ? -9.534  8.012   18.804  1.00 63.62  ? 213 HIS A NE2   1 
ATOM   1471 N N     . CYS A 1 188 ? -12.889 8.328   24.659  1.00 37.45  ? 214 CYS A N     1 
ATOM   1472 C CA    . CYS A 1 188 ? -13.483 8.792   25.907  1.00 39.65  ? 214 CYS A CA    1 
ATOM   1473 C C     . CYS A 1 188 ? -13.475 7.682   26.954  1.00 49.95  ? 214 CYS A C     1 
ATOM   1474 O O     . CYS A 1 188 ? -13.205 7.927   28.131  1.00 59.42  ? 214 CYS A O     1 
ATOM   1475 C CB    . CYS A 1 188 ? -14.908 9.292   25.672  1.00 46.14  ? 214 CYS A CB    1 
ATOM   1476 S SG    . CYS A 1 188 ? -15.023 10.692  24.533  1.00 54.99  ? 214 CYS A SG    1 
ATOM   1477 N N     . PHE A 1 189 ? -13.765 6.461   26.516  1.00 45.11  ? 215 PHE A N     1 
ATOM   1478 C CA    . PHE A 1 189 ? -13.780 5.309   27.410  1.00 49.43  ? 215 PHE A CA    1 
ATOM   1479 C C     . PHE A 1 189 ? -12.371 4.880   27.806  1.00 49.13  ? 215 PHE A C     1 
ATOM   1480 O O     . PHE A 1 189 ? -12.176 4.231   28.833  1.00 59.32  ? 215 PHE A O     1 
ATOM   1481 C CB    . PHE A 1 189 ? -14.509 4.134   26.757  1.00 56.00  ? 215 PHE A CB    1 
ATOM   1482 C CG    . PHE A 1 189 ? -15.889 4.471   26.277  1.00 56.43  ? 215 PHE A CG    1 
ATOM   1483 C CD1   . PHE A 1 189 ? -16.218 4.349   24.940  1.00 62.04  ? 215 PHE A CD1   1 
ATOM   1484 C CD2   . PHE A 1 189 ? -16.854 4.917   27.163  1.00 54.83  ? 215 PHE A CD2   1 
ATOM   1485 C CE1   . PHE A 1 189 ? -17.487 4.659   24.496  1.00 71.97  ? 215 PHE A CE1   1 
ATOM   1486 C CE2   . PHE A 1 189 ? -18.124 5.229   26.727  1.00 56.93  ? 215 PHE A CE2   1 
ATOM   1487 C CZ    . PHE A 1 189 ? -18.441 5.100   25.391  1.00 69.86  ? 215 PHE A CZ    1 
ATOM   1488 N N     . GLU A 1 190 ? -11.391 5.238   26.984  1.00 23.44  ? 216 GLU A N     1 
ATOM   1489 C CA    . GLU A 1 190 ? -10.008 4.870   27.254  1.00 28.93  ? 216 GLU A CA    1 
ATOM   1490 C C     . GLU A 1 190 ? -9.442  5.650   28.435  1.00 38.72  ? 216 GLU A C     1 
ATOM   1491 O O     . GLU A 1 190 ? -9.508  6.878   28.469  1.00 45.42  ? 216 GLU A O     1 
ATOM   1492 C CB    . GLU A 1 190 ? -9.141  5.089   26.013  1.00 40.89  ? 216 GLU A CB    1 
ATOM   1493 C CG    . GLU A 1 190 ? -9.408  4.106   24.883  1.00 53.88  ? 216 GLU A CG    1 
ATOM   1494 C CD    . GLU A 1 190 ? -8.537  4.363   23.666  1.00 63.98  ? 216 GLU A CD    1 
ATOM   1495 O OE1   . GLU A 1 190 ? -7.782  5.359   23.669  1.00 63.15  ? 216 GLU A OE1   1 
ATOM   1496 O OE2   . GLU A 1 190 ? -8.608  3.569   22.704  1.00 70.40  ? 216 GLU A OE2   1 
ATOM   1497 N N     . GLY A 1 191 ? -8.891  4.928   29.405  1.00 20.54  ? 217 GLY A N     1 
ATOM   1498 C CA    . GLY A 1 191 ? -8.225  5.544   30.538  1.00 37.82  ? 217 GLY A CA    1 
ATOM   1499 C C     . GLY A 1 191 ? -9.148  6.247   31.515  1.00 41.22  ? 217 GLY A C     1 
ATOM   1500 O O     . GLY A 1 191 ? -8.685  6.917   32.437  1.00 52.61  ? 217 GLY A O     1 
ATOM   1501 N N     . VAL A 1 192 ? -10.454 6.095   31.322  1.00 46.58  ? 218 VAL A N     1 
ATOM   1502 C CA    . VAL A 1 192 ? -11.425 6.754   32.189  1.00 35.00  ? 218 VAL A CA    1 
ATOM   1503 C C     . VAL A 1 192 ? -11.378 6.199   33.610  1.00 37.79  ? 218 VAL A C     1 
ATOM   1504 O O     . VAL A 1 192 ? -11.668 5.027   33.845  1.00 42.18  ? 218 VAL A O     1 
ATOM   1505 C CB    . VAL A 1 192 ? -12.858 6.643   31.637  1.00 25.97  ? 218 VAL A CB    1 
ATOM   1506 C CG1   . VAL A 1 192 ? -13.225 5.190   31.404  1.00 52.49  ? 218 VAL A CG1   1 
ATOM   1507 C CG2   . VAL A 1 192 ? -13.842 7.298   32.592  1.00 23.16  ? 218 VAL A CG2   1 
ATOM   1508 N N     . THR A 1 193 ? -11.001 7.056   34.553  1.00 32.63  ? 219 THR A N     1 
ATOM   1509 C CA    . THR A 1 193 ? -10.905 6.673   35.955  1.00 22.32  ? 219 THR A CA    1 
ATOM   1510 C C     . THR A 1 193 ? -12.261 6.261   36.507  1.00 37.35  ? 219 THR A C     1 
ATOM   1511 O O     . THR A 1 193 ? -12.362 5.316   37.290  1.00 43.27  ? 219 THR A O     1 
ATOM   1512 C CB    . THR A 1 193 ? -10.361 7.828   36.807  1.00 24.73  ? 219 THR A CB    1 
ATOM   1513 O OG1   . THR A 1 193 ? -9.090  8.245   36.295  1.00 36.84  ? 219 THR A OG1   1 
ATOM   1514 C CG2   . THR A 1 193 ? -10.211 7.394   38.255  1.00 28.06  ? 219 THR A CG2   1 
ATOM   1515 N N     . ALA A 1 194 ? -13.303 6.978   36.097  1.00 45.30  ? 220 ALA A N     1 
ATOM   1516 C CA    . ALA A 1 194 ? -14.660 6.680   36.540  1.00 29.78  ? 220 ALA A CA    1 
ATOM   1517 C C     . ALA A 1 194 ? -15.706 7.278   35.608  1.00 31.70  ? 220 ALA A C     1 
ATOM   1518 O O     . ALA A 1 194 ? -15.503 8.340   35.018  1.00 31.44  ? 220 ALA A O     1 
ATOM   1519 C CB    . ALA A 1 194 ? -14.877 7.174   37.960  1.00 19.28  ? 220 ALA A CB    1 
ATOM   1520 N N     . ILE A 1 195 ? -16.828 6.581   35.479  1.00 29.77  ? 221 ILE A N     1 
ATOM   1521 C CA    . ILE A 1 195 ? -17.952 7.076   34.702  1.00 28.69  ? 221 ILE A CA    1 
ATOM   1522 C C     . ILE A 1 195 ? -19.026 7.611   35.635  1.00 44.26  ? 221 ILE A C     1 
ATOM   1523 O O     . ILE A 1 195 ? -19.492 6.907   36.529  1.00 52.81  ? 221 ILE A O     1 
ATOM   1524 C CB    . ILE A 1 195 ? -18.573 5.970   33.834  1.00 30.15  ? 221 ILE A CB    1 
ATOM   1525 C CG1   . ILE A 1 195 ? -17.596 5.531   32.745  1.00 21.70  ? 221 ILE A CG1   1 
ATOM   1526 C CG2   . ILE A 1 195 ? -19.882 6.448   33.217  1.00 33.45  ? 221 ILE A CG2   1 
ATOM   1527 C CD1   . ILE A 1 195 ? -18.171 4.507   31.794  1.00 22.60  ? 221 ILE A CD1   1 
ATOM   1528 N N     . ILE A 1 196 ? -19.412 8.862   35.429  1.00 44.78  ? 222 ILE A N     1 
ATOM   1529 C CA    . ILE A 1 196 ? -20.499 9.444   36.198  1.00 30.69  ? 222 ILE A CA    1 
ATOM   1530 C C     . ILE A 1 196 ? -21.775 9.398   35.370  1.00 36.74  ? 222 ILE A C     1 
ATOM   1531 O O     . ILE A 1 196 ? -22.010 10.256  34.520  1.00 40.63  ? 222 ILE A O     1 
ATOM   1532 C CB    . ILE A 1 196 ? -20.186 10.887  36.613  1.00 25.45  ? 222 ILE A CB    1 
ATOM   1533 C CG1   . ILE A 1 196 ? -18.875 10.933  37.400  1.00 23.74  ? 222 ILE A CG1   1 
ATOM   1534 C CG2   . ILE A 1 196 ? -21.323 11.458  37.440  1.00 31.63  ? 222 ILE A CG2   1 
ATOM   1535 C CD1   . ILE A 1 196 ? -18.458 12.324  37.810  1.00 33.10  ? 222 ILE A CD1   1 
ATOM   1536 N N     . PHE A 1 197 ? -22.587 8.376   35.617  1.00 35.49  ? 223 PHE A N     1 
ATOM   1537 C CA    . PHE A 1 197 ? -23.827 8.173   34.881  1.00 37.54  ? 223 PHE A CA    1 
ATOM   1538 C C     . PHE A 1 197 ? -24.961 8.967   35.520  1.00 38.58  ? 223 PHE A C     1 
ATOM   1539 O O     . PHE A 1 197 ? -25.281 8.769   36.691  1.00 41.68  ? 223 PHE A O     1 
ATOM   1540 C CB    . PHE A 1 197 ? -24.177 6.684   34.847  1.00 22.73  ? 223 PHE A CB    1 
ATOM   1541 C CG    . PHE A 1 197 ? -25.272 6.343   33.883  1.00 24.00  ? 223 PHE A CG    1 
ATOM   1542 C CD1   . PHE A 1 197 ? -24.989 6.120   32.547  1.00 28.10  ? 223 PHE A CD1   1 
ATOM   1543 C CD2   . PHE A 1 197 ? -26.585 6.242   34.312  1.00 28.37  ? 223 PHE A CD2   1 
ATOM   1544 C CE1   . PHE A 1 197 ? -25.996 5.805   31.654  1.00 33.78  ? 223 PHE A CE1   1 
ATOM   1545 C CE2   . PHE A 1 197 ? -27.597 5.926   33.423  1.00 25.08  ? 223 PHE A CE2   1 
ATOM   1546 C CZ    . PHE A 1 197 ? -27.302 5.708   32.093  1.00 20.43  ? 223 PHE A CZ    1 
ATOM   1547 N N     . CYS A 1 198 ? -25.567 9.864   34.747  1.00 27.74  ? 224 CYS A N     1 
ATOM   1548 C CA    . CYS A 1 198 ? -26.603 10.747  35.274  1.00 23.26  ? 224 CYS A CA    1 
ATOM   1549 C C     . CYS A 1 198 ? -28.008 10.316  34.867  1.00 37.13  ? 224 CYS A C     1 
ATOM   1550 O O     . CYS A 1 198 ? -28.280 10.070  33.691  1.00 40.40  ? 224 CYS A O     1 
ATOM   1551 C CB    . CYS A 1 198 ? -26.351 12.186  34.827  1.00 19.10  ? 224 CYS A CB    1 
ATOM   1552 S SG    . CYS A 1 198 ? -24.708 12.803  35.236  1.00 46.25  ? 224 CYS A SG    1 
ATOM   1553 N N     . VAL A 1 199 ? -28.896 10.238  35.854  1.00 45.45  ? 225 VAL A N     1 
ATOM   1554 C CA    . VAL A 1 199 ? -30.280 9.838   35.629  1.00 41.47  ? 225 VAL A CA    1 
ATOM   1555 C C     . VAL A 1 199 ? -31.243 10.895  36.155  1.00 41.51  ? 225 VAL A C     1 
ATOM   1556 O O     . VAL A 1 199 ? -31.145 11.313  37.308  1.00 44.23  ? 225 VAL A O     1 
ATOM   1557 C CB    . VAL A 1 199 ? -30.601 8.505   36.331  1.00 22.91  ? 225 VAL A CB    1 
ATOM   1558 C CG1   . VAL A 1 199 ? -32.081 8.184   36.205  1.00 20.01  ? 225 VAL A CG1   1 
ATOM   1559 C CG2   . VAL A 1 199 ? -29.750 7.380   35.763  1.00 14.87  ? 225 VAL A CG2   1 
ATOM   1560 N N     . ALA A 1 200 ? -32.173 11.325  35.309  1.00 36.74  ? 226 ALA A N     1 
ATOM   1561 C CA    . ALA A 1 200 ? -33.185 12.289  35.725  1.00 37.49  ? 226 ALA A CA    1 
ATOM   1562 C C     . ALA A 1 200 ? -34.342 11.581  36.417  1.00 38.91  ? 226 ALA A C     1 
ATOM   1563 O O     . ALA A 1 200 ? -35.186 10.967  35.766  1.00 55.78  ? 226 ALA A O     1 
ATOM   1564 C CB    . ALA A 1 200 ? -33.685 13.087  34.533  1.00 53.42  ? 226 ALA A CB    1 
ATOM   1565 N N     . LEU A 1 201 ? -34.371 11.668  37.742  1.00 38.13  ? 227 LEU A N     1 
ATOM   1566 C CA    . LEU A 1 201 ? -35.399 11.005  38.536  1.00 37.47  ? 227 LEU A CA    1 
ATOM   1567 C C     . LEU A 1 201 ? -36.812 11.427  38.134  1.00 35.88  ? 227 LEU A C     1 
ATOM   1568 O O     . LEU A 1 201 ? -37.744 10.624  38.172  1.00 36.84  ? 227 LEU A O     1 
ATOM   1569 C CB    . LEU A 1 201 ? -35.171 11.274  40.025  1.00 34.33  ? 227 LEU A CB    1 
ATOM   1570 C CG    . LEU A 1 201 ? -33.975 10.570  40.667  1.00 31.62  ? 227 LEU A CG    1 
ATOM   1571 C CD1   . LEU A 1 201 ? -33.658 11.171  42.029  1.00 42.66  ? 227 LEU A CD1   1 
ATOM   1572 C CD2   . LEU A 1 201 ? -34.234 9.075   40.782  1.00 20.92  ? 227 LEU A CD2   1 
ATOM   1573 N N     . SER A 1 202 ? -36.963 12.687  37.742  1.00 24.87  ? 228 SER A N     1 
ATOM   1574 C CA    . SER A 1 202 ? -38.274 13.232  37.403  1.00 45.79  ? 228 SER A CA    1 
ATOM   1575 C C     . SER A 1 202 ? -38.833 12.678  36.091  1.00 42.59  ? 228 SER A C     1 
ATOM   1576 O O     . SER A 1 202 ? -39.969 12.972  35.720  1.00 38.20  ? 228 SER A O     1 
ATOM   1577 C CB    . SER A 1 202 ? -38.214 14.761  37.350  1.00 65.14  ? 228 SER A CB    1 
ATOM   1578 O OG    . SER A 1 202 ? -37.228 15.202  36.432  1.00 71.74  ? 228 SER A OG    1 
ATOM   1579 N N     . ASP A 1 203 ? -38.036 11.874  35.394  1.00 36.71  ? 229 ASP A N     1 
ATOM   1580 C CA    . ASP A 1 203 ? -38.452 11.303  34.116  1.00 40.18  ? 229 ASP A CA    1 
ATOM   1581 C C     . ASP A 1 203 ? -39.319 10.058  34.288  1.00 42.00  ? 229 ASP A C     1 
ATOM   1582 O O     . ASP A 1 203 ? -39.697 9.416   33.307  1.00 42.13  ? 229 ASP A O     1 
ATOM   1583 C CB    . ASP A 1 203 ? -37.231 10.960  33.256  1.00 37.19  ? 229 ASP A CB    1 
ATOM   1584 C CG    . ASP A 1 203 ? -36.566 12.188  32.664  1.00 45.01  ? 229 ASP A CG    1 
ATOM   1585 O OD1   . ASP A 1 203 ? -37.043 13.312  32.925  1.00 53.07  ? 229 ASP A OD1   1 
ATOM   1586 O OD2   . ASP A 1 203 ? -35.565 12.024  31.934  1.00 39.75  ? 229 ASP A OD2   1 
ATOM   1587 N N     . TYR A 1 204 ? -39.633 9.720   35.535  1.00 36.08  ? 230 TYR A N     1 
ATOM   1588 C CA    . TYR A 1 204 ? -40.367 8.493   35.824  1.00 39.35  ? 230 TYR A CA    1 
ATOM   1589 C C     . TYR A 1 204 ? -41.833 8.569   35.394  1.00 46.01  ? 230 TYR A C     1 
ATOM   1590 O O     . TYR A 1 204 ? -42.436 7.552   35.052  1.00 53.68  ? 230 TYR A O     1 
ATOM   1591 C CB    . TYR A 1 204 ? -40.277 8.143   37.313  1.00 22.06  ? 230 TYR A CB    1 
ATOM   1592 C CG    . TYR A 1 204 ? -41.228 8.932   38.182  1.00 20.05  ? 230 TYR A CG    1 
ATOM   1593 C CD1   . TYR A 1 204 ? -40.845 10.142  38.744  1.00 39.68  ? 230 TYR A CD1   1 
ATOM   1594 C CD2   . TYR A 1 204 ? -42.511 8.469   38.438  1.00 32.14  ? 230 TYR A CD2   1 
ATOM   1595 C CE1   . TYR A 1 204 ? -41.713 10.868  39.540  1.00 30.61  ? 230 TYR A CE1   1 
ATOM   1596 C CE2   . TYR A 1 204 ? -43.387 9.188   39.231  1.00 42.03  ? 230 TYR A CE2   1 
ATOM   1597 C CZ    . TYR A 1 204 ? -42.981 10.387  39.779  1.00 37.35  ? 230 TYR A CZ    1 
ATOM   1598 O OH    . TYR A 1 204 ? -43.846 11.108  40.568  1.00 42.60  ? 230 TYR A OH    1 
ATOM   1599 N N     . ASP A 1 205 ? -42.401 9.770   35.408  1.00 36.78  ? 231 ASP A N     1 
ATOM   1600 C CA    . ASP A 1 205 ? -43.827 9.931   35.138  1.00 37.52  ? 231 ASP A CA    1 
ATOM   1601 C C     . ASP A 1 205 ? -44.128 10.588  33.792  1.00 43.21  ? 231 ASP A C     1 
ATOM   1602 O O     . ASP A 1 205 ? -45.284 10.884  33.490  1.00 50.55  ? 231 ASP A O     1 
ATOM   1603 C CB    . ASP A 1 205 ? -44.498 10.728  36.260  1.00 45.61  ? 231 ASP A CB    1 
ATOM   1604 C CG    . ASP A 1 205 ? -44.126 12.198  36.237  1.00 52.43  ? 231 ASP A CG    1 
ATOM   1605 O OD1   . ASP A 1 205 ? -43.137 12.555  35.562  1.00 56.14  ? 231 ASP A OD1   1 
ATOM   1606 O OD2   . ASP A 1 205 ? -44.825 12.998  36.895  1.00 50.66  ? 231 ASP A OD2   1 
ATOM   1607 N N     . LEU A 1 206 ? -43.094 10.816  32.987  1.00 44.80  ? 232 LEU A N     1 
ATOM   1608 C CA    . LEU A 1 206 ? -43.274 11.471  31.693  1.00 40.14  ? 232 LEU A CA    1 
ATOM   1609 C C     . LEU A 1 206 ? -43.970 10.567  30.682  1.00 46.09  ? 232 LEU A C     1 
ATOM   1610 O O     . LEU A 1 206 ? -43.687 9.372   30.606  1.00 61.60  ? 232 LEU A O     1 
ATOM   1611 C CB    . LEU A 1 206 ? -41.931 11.937  31.123  1.00 23.71  ? 232 LEU A CB    1 
ATOM   1612 C CG    . LEU A 1 206 ? -41.212 13.070  31.857  1.00 41.39  ? 232 LEU A CG    1 
ATOM   1613 C CD1   . LEU A 1 206 ? -39.901 13.394  31.162  1.00 39.07  ? 232 LEU A CD1   1 
ATOM   1614 C CD2   . LEU A 1 206 ? -42.094 14.307  31.946  1.00 46.07  ? 232 LEU A CD2   1 
ATOM   1615 N N     . VAL A 1 207 ? -44.882 11.146  29.908  1.00 41.73  ? 233 VAL A N     1 
ATOM   1616 C CA    . VAL A 1 207 ? -45.524 10.424  28.818  1.00 37.02  ? 233 VAL A CA    1 
ATOM   1617 C C     . VAL A 1 207 ? -44.516 10.250  27.691  1.00 41.68  ? 233 VAL A C     1 
ATOM   1618 O O     . VAL A 1 207 ? -43.946 11.229  27.210  1.00 58.40  ? 233 VAL A O     1 
ATOM   1619 C CB    . VAL A 1 207 ? -46.754 11.181  28.287  1.00 26.08  ? 233 VAL A CB    1 
ATOM   1620 C CG1   . VAL A 1 207 ? -47.417 10.392  27.172  1.00 27.27  ? 233 VAL A CG1   1 
ATOM   1621 C CG2   . VAL A 1 207 ? -47.742 11.447  29.415  1.00 23.65  ? 233 VAL A CG2   1 
ATOM   1622 N N     . LEU A 1 208 ? -44.290 9.007   27.276  1.00 44.17  ? 234 LEU A N     1 
ATOM   1623 C CA    . LEU A 1 208 ? -43.263 8.721   26.277  1.00 49.09  ? 234 LEU A CA    1 
ATOM   1624 C C     . LEU A 1 208 ? -43.549 9.410   24.949  1.00 44.61  ? 234 LEU A C     1 
ATOM   1625 O O     . LEU A 1 208 ? -44.704 9.675   24.609  1.00 53.64  ? 234 LEU A O     1 
ATOM   1626 C CB    . LEU A 1 208 ? -43.109 7.215   26.055  1.00 36.86  ? 234 LEU A CB    1 
ATOM   1627 C CG    . LEU A 1 208 ? -44.054 6.552   25.051  1.00 30.08  ? 234 LEU A CG    1 
ATOM   1628 C CD1   . LEU A 1 208 ? -43.630 5.117   24.782  1.00 27.14  ? 234 LEU A CD1   1 
ATOM   1629 C CD2   . LEU A 1 208 ? -45.488 6.608   25.542  1.00 34.18  ? 234 LEU A CD2   1 
ATOM   1630 N N     . ALA A 1 209 ? -42.487 9.695   24.202  1.00 29.59  ? 235 ALA A N     1 
ATOM   1631 C CA    . ALA A 1 209 ? -42.612 10.329  22.895  1.00 38.37  ? 235 ALA A CA    1 
ATOM   1632 C C     . ALA A 1 209 ? -43.295 9.400   21.898  1.00 43.11  ? 235 ALA A C     1 
ATOM   1633 O O     . ALA A 1 209 ? -43.517 8.221   22.179  1.00 44.39  ? 235 ALA A O     1 
ATOM   1634 C CB    . ALA A 1 209 ? -41.251 10.756  22.378  1.00 34.61  ? 235 ALA A CB    1 
ATOM   1635 N N     . GLU A 1 210 ? -43.627 9.937   20.731  1.00 45.57  ? 236 GLU A N     1 
ATOM   1636 C CA    . GLU A 1 210 ? -44.320 9.157   19.716  1.00 54.05  ? 236 GLU A CA    1 
ATOM   1637 C C     . GLU A 1 210 ? -43.345 8.364   18.853  1.00 41.69  ? 236 GLU A C     1 
ATOM   1638 O O     . GLU A 1 210 ? -43.757 7.614   17.972  1.00 49.94  ? 236 GLU A O     1 
ATOM   1639 C CB    . GLU A 1 210 ? -45.195 10.062  18.846  1.00 64.18  ? 236 GLU A CB    1 
ATOM   1640 C CG    . GLU A 1 210 ? -44.453 11.222  18.208  1.00 82.44  ? 236 GLU A CG    1 
ATOM   1641 C CD    . GLU A 1 210 ? -45.358 12.085  17.350  1.00 101.34 ? 236 GLU A CD    1 
ATOM   1642 O OE1   . GLU A 1 210 ? -46.567 11.782  17.266  1.00 106.79 ? 236 GLU A OE1   1 
ATOM   1643 O OE2   . GLU A 1 210 ? -44.861 13.067  16.760  1.00 106.83 ? 236 GLU A OE2   1 
ATOM   1644 N N     . ASP A 1 211 ? -42.052 8.524   19.115  1.00 35.63  ? 237 ASP A N     1 
ATOM   1645 C CA    . ASP A 1 211 ? -41.033 7.830   18.337  1.00 50.80  ? 237 ASP A CA    1 
ATOM   1646 C C     . ASP A 1 211 ? -40.197 6.873   19.183  1.00 66.85  ? 237 ASP A C     1 
ATOM   1647 O O     . ASP A 1 211 ? -39.388 6.112   18.649  1.00 71.61  ? 237 ASP A O     1 
ATOM   1648 C CB    . ASP A 1 211 ? -40.122 8.832   17.622  1.00 62.29  ? 237 ASP A CB    1 
ATOM   1649 C CG    . ASP A 1 211 ? -39.322 9.684   18.586  1.00 75.93  ? 237 ASP A CG    1 
ATOM   1650 O OD1   . ASP A 1 211 ? -39.638 9.680   19.793  1.00 89.10  ? 237 ASP A OD1   1 
ATOM   1651 O OD2   . ASP A 1 211 ? -38.374 10.361  18.134  1.00 78.08  ? 237 ASP A OD2   1 
ATOM   1652 N N     . GLU A 1 212 ? -40.387 6.911   20.499  1.00 69.99  ? 238 GLU A N     1 
ATOM   1653 C CA    . GLU A 1 212 ? -39.657 6.013   21.390  1.00 60.32  ? 238 GLU A CA    1 
ATOM   1654 C C     . GLU A 1 212 ? -40.511 4.818   21.810  1.00 40.73  ? 238 GLU A C     1 
ATOM   1655 O O     . GLU A 1 212 ? -41.738 4.882   21.783  1.00 36.23  ? 238 GLU A O     1 
ATOM   1656 C CB    . GLU A 1 212 ? -39.101 6.763   22.608  1.00 66.26  ? 238 GLU A CB    1 
ATOM   1657 C CG    . GLU A 1 212 ? -40.141 7.461   23.468  1.00 85.60  ? 238 GLU A CG    1 
ATOM   1658 C CD    . GLU A 1 212 ? -39.526 8.121   24.692  1.00 94.06  ? 238 GLU A CD    1 
ATOM   1659 O OE1   . GLU A 1 212 ? -40.269 8.757   25.469  1.00 90.09  ? 238 GLU A OE1   1 
ATOM   1660 O OE2   . GLU A 1 212 ? -38.298 8.001   24.879  1.00 95.44  ? 238 GLU A OE2   1 
ATOM   1661 N N     . GLU A 1 213 ? -39.847 3.730   22.193  1.00 47.74  ? 239 GLU A N     1 
ATOM   1662 C CA    . GLU A 1 213 ? -40.517 2.459   22.458  1.00 37.38  ? 239 GLU A CA    1 
ATOM   1663 C C     . GLU A 1 213 ? -40.703 2.172   23.946  1.00 37.31  ? 239 GLU A C     1 
ATOM   1664 O O     . GLU A 1 213 ? -41.251 1.136   24.317  1.00 44.36  ? 239 GLU A O     1 
ATOM   1665 C CB    . GLU A 1 213 ? -39.732 1.313   21.813  1.00 39.25  ? 239 GLU A CB    1 
ATOM   1666 C CG    . GLU A 1 213 ? -38.271 1.259   22.243  1.00 69.60  ? 239 GLU A CG    1 
ATOM   1667 C CD    . GLU A 1 213 ? -37.464 0.230   21.473  1.00 92.06  ? 239 GLU A CD    1 
ATOM   1668 O OE1   . GLU A 1 213 ? -38.075 -0.616  20.788  1.00 101.90 ? 239 GLU A OE1   1 
ATOM   1669 O OE2   . GLU A 1 213 ? -36.218 0.268   21.556  1.00 93.38  ? 239 GLU A OE2   1 
ATOM   1670 N N     . MET A 1 214 ? -40.243 3.083   24.797  1.00 39.43  ? 240 MET A N     1 
ATOM   1671 C CA    . MET A 1 214 ? -40.375 2.901   26.240  1.00 43.18  ? 240 MET A CA    1 
ATOM   1672 C C     . MET A 1 214 ? -40.558 4.229   26.974  1.00 55.62  ? 240 MET A C     1 
ATOM   1673 O O     . MET A 1 214 ? -41.652 4.783   26.989  1.00 87.13  ? 240 MET A O     1 
ATOM   1674 C CB    . MET A 1 214 ? -39.186 2.113   26.796  1.00 37.10  ? 240 MET A CB    1 
ATOM   1675 C CG    . MET A 1 214 ? -37.832 2.585   26.294  1.00 52.93  ? 240 MET A CG    1 
ATOM   1676 S SD    . MET A 1 214 ? -36.488 1.479   26.771  1.00 52.90  ? 240 MET A SD    1 
ATOM   1677 C CE    . MET A 1 214 ? -36.912 0.016   25.833  1.00 61.55  ? 240 MET A CE    1 
ATOM   1678 N N     . ASN A 1 215 ? -39.490 4.723   27.591  1.00 58.36  ? 241 ASN A N     1 
ATOM   1679 C CA    . ASN A 1 215 ? -39.491 6.041   28.228  1.00 66.55  ? 241 ASN A CA    1 
ATOM   1680 C C     . ASN A 1 215 ? -38.118 6.388   28.795  1.00 59.20  ? 241 ASN A C     1 
ATOM   1681 O O     . ASN A 1 215 ? -37.344 5.494   29.142  1.00 61.45  ? 241 ASN A O     1 
ATOM   1682 C CB    . ASN A 1 215 ? -40.578 6.157   29.307  1.00 67.39  ? 241 ASN A CB    1 
ATOM   1683 C CG    . ASN A 1 215 ? -40.433 5.126   30.410  1.00 85.52  ? 241 ASN A CG    1 
ATOM   1684 O OD1   . ASN A 1 215 ? -39.338 4.639   30.682  1.00 110.45 ? 241 ASN A OD1   1 
ATOM   1685 N ND2   . ASN A 1 215 ? -41.545 4.795   31.058  1.00 75.13  ? 241 ASN A ND2   1 
ATOM   1686 N N     . ARG A 1 216 ? -37.813 7.679   28.883  1.00 46.86  ? 242 ARG A N     1 
ATOM   1687 C CA    . ARG A 1 216 ? -36.472 8.111   29.269  1.00 55.39  ? 242 ARG A CA    1 
ATOM   1688 C C     . ARG A 1 216 ? -35.897 7.324   30.445  1.00 58.16  ? 242 ARG A C     1 
ATOM   1689 O O     . ARG A 1 216 ? -34.716 6.978   30.450  1.00 65.52  ? 242 ARG A O     1 
ATOM   1690 C CB    . ARG A 1 216 ? -36.435 9.617   29.548  1.00 58.59  ? 242 ARG A CB    1 
ATOM   1691 C CG    . ARG A 1 216 ? -36.092 10.457  28.329  1.00 60.16  ? 242 ARG A CG    1 
ATOM   1692 C CD    . ARG A 1 216 ? -35.261 11.674  28.705  1.00 67.18  ? 242 ARG A CD    1 
ATOM   1693 N NE    . ARG A 1 216 ? -36.077 12.788  29.180  1.00 63.58  ? 242 ARG A NE    1 
ATOM   1694 C CZ    . ARG A 1 216 ? -36.417 13.831  28.428  1.00 50.99  ? 242 ARG A CZ    1 
ATOM   1695 N NH1   . ARG A 1 216 ? -36.008 13.899  27.170  1.00 56.45  ? 242 ARG A NH1   1 
ATOM   1696 N NH2   . ARG A 1 216 ? -37.160 14.807  28.933  1.00 36.56  ? 242 ARG A NH2   1 
ATOM   1697 N N     . MET A 1 217 ? -36.736 7.036   31.434  1.00 44.13  ? 243 MET A N     1 
ATOM   1698 C CA    . MET A 1 217 ? -36.302 6.286   32.608  1.00 28.23  ? 243 MET A CA    1 
ATOM   1699 C C     . MET A 1 217 ? -35.778 4.901   32.233  1.00 41.13  ? 243 MET A C     1 
ATOM   1700 O O     . MET A 1 217 ? -34.645 4.547   32.558  1.00 71.04  ? 243 MET A O     1 
ATOM   1701 C CB    . MET A 1 217 ? -37.441 6.157   33.620  1.00 50.30  ? 243 MET A CB    1 
ATOM   1702 C CG    . MET A 1 217 ? -37.038 5.487   34.925  1.00 64.18  ? 243 MET A CG    1 
ATOM   1703 S SD    . MET A 1 217 ? -35.717 6.369   35.781  1.00 49.60  ? 243 MET A SD    1 
ATOM   1704 C CE    . MET A 1 217 ? -36.551 7.893   36.217  1.00 78.40  ? 243 MET A CE    1 
ATOM   1705 N N     . HIS A 1 218 ? -36.609 4.123   31.547  1.00 36.87  ? 244 HIS A N     1 
ATOM   1706 C CA    . HIS A 1 218 ? -36.229 2.779   31.125  1.00 28.39  ? 244 HIS A CA    1 
ATOM   1707 C C     . HIS A 1 218 ? -35.103 2.803   30.099  1.00 43.79  ? 244 HIS A C     1 
ATOM   1708 O O     . HIS A 1 218 ? -34.217 1.950   30.127  1.00 51.22  ? 244 HIS A O     1 
ATOM   1709 C CB    . HIS A 1 218 ? -37.440 2.024   30.575  1.00 23.12  ? 244 HIS A CB    1 
ATOM   1710 C CG    . HIS A 1 218 ? -38.375 1.535   31.637  1.00 39.37  ? 244 HIS A CG    1 
ATOM   1711 N ND1   . HIS A 1 218 ? -39.289 2.357   32.261  1.00 40.75  ? 244 HIS A ND1   1 
ATOM   1712 C CD2   . HIS A 1 218 ? -38.535 0.308   32.188  1.00 38.89  ? 244 HIS A CD2   1 
ATOM   1713 C CE1   . HIS A 1 218 ? -39.972 1.657   33.149  1.00 53.36  ? 244 HIS A CE1   1 
ATOM   1714 N NE2   . HIS A 1 218 ? -39.534 0.412   33.125  1.00 50.12  ? 244 HIS A NE2   1 
ATOM   1715 N N     . GLU A 1 219 ? -35.143 3.776   29.193  1.00 41.55  ? 245 GLU A N     1 
ATOM   1716 C CA    . GLU A 1 219 ? -34.050 3.967   28.247  1.00 34.81  ? 245 GLU A CA    1 
ATOM   1717 C C     . GLU A 1 219 ? -32.750 4.116   29.018  1.00 40.75  ? 245 GLU A C     1 
ATOM   1718 O O     . GLU A 1 219 ? -31.733 3.511   28.673  1.00 29.49  ? 245 GLU A O     1 
ATOM   1719 C CB    . GLU A 1 219 ? -34.279 5.209   27.386  1.00 37.31  ? 245 GLU A CB    1 
ATOM   1720 C CG    . GLU A 1 219 ? -35.253 5.015   26.238  1.00 50.51  ? 245 GLU A CG    1 
ATOM   1721 C CD    . GLU A 1 219 ? -35.248 6.188   25.276  1.00 75.01  ? 245 GLU A CD    1 
ATOM   1722 O OE1   . GLU A 1 219 ? -36.200 6.310   24.477  1.00 94.31  ? 245 GLU A OE1   1 
ATOM   1723 O OE2   . GLU A 1 219 ? -34.291 6.989   25.322  1.00 76.59  ? 245 GLU A OE2   1 
ATOM   1724 N N     . SER A 1 220 ? -32.796 4.926   30.069  1.00 42.49  ? 246 SER A N     1 
ATOM   1725 C CA    . SER A 1 220 ? -31.638 5.143   30.922  1.00 35.15  ? 246 SER A CA    1 
ATOM   1726 C C     . SER A 1 220 ? -31.204 3.827   31.563  1.00 33.76  ? 246 SER A C     1 
ATOM   1727 O O     . SER A 1 220 ? -30.012 3.532   31.651  1.00 32.79  ? 246 SER A O     1 
ATOM   1728 C CB    . SER A 1 220 ? -31.956 6.186   31.995  1.00 22.84  ? 246 SER A CB    1 
ATOM   1729 O OG    . SER A 1 220 ? -30.769 6.705   32.572  1.00 43.32  ? 246 SER A OG    1 
ATOM   1730 N N     . MET A 1 221 ? -32.178 3.036   32.001  1.00 17.29  ? 247 MET A N     1 
ATOM   1731 C CA    . MET A 1 221 ? -31.888 1.744   32.610  1.00 28.66  ? 247 MET A CA    1 
ATOM   1732 C C     . MET A 1 221 ? -31.235 0.802   31.607  1.00 44.42  ? 247 MET A C     1 
ATOM   1733 O O     . MET A 1 221 ? -30.296 0.082   31.942  1.00 51.24  ? 247 MET A O     1 
ATOM   1734 C CB    . MET A 1 221 ? -33.161 1.108   33.166  1.00 32.88  ? 247 MET A CB    1 
ATOM   1735 C CG    . MET A 1 221 ? -33.767 1.849   34.343  1.00 19.91  ? 247 MET A CG    1 
ATOM   1736 S SD    . MET A 1 221 ? -35.188 0.976   35.025  1.00 49.35  ? 247 MET A SD    1 
ATOM   1737 C CE    . MET A 1 221 ? -34.442 -0.588  35.479  1.00 60.57  ? 247 MET A CE    1 
ATOM   1738 N N     . LYS A 1 222 ? -31.740 0.810   30.377  1.00 54.87  ? 248 LYS A N     1 
ATOM   1739 C CA    . LYS A 1 222 ? -31.196 -0.035  29.322  1.00 49.27  ? 248 LYS A CA    1 
ATOM   1740 C C     . LYS A 1 222 ? -29.768 0.385   28.989  1.00 45.30  ? 248 LYS A C     1 
ATOM   1741 O O     . LYS A 1 222 ? -28.902 -0.456  28.742  1.00 38.00  ? 248 LYS A O     1 
ATOM   1742 C CB    . LYS A 1 222 ? -32.074 0.029   28.070  1.00 45.05  ? 248 LYS A CB    1 
ATOM   1743 C CG    . LYS A 1 222 ? -31.662 -0.944  26.974  1.00 54.30  ? 248 LYS A CG    1 
ATOM   1744 C CD    . LYS A 1 222 ? -32.575 -0.843  25.761  1.00 58.99  ? 248 LYS A CD    1 
ATOM   1745 C CE    . LYS A 1 222 ? -32.161 -1.825  24.674  1.00 64.47  ? 248 LYS A CE    1 
ATOM   1746 N NZ    . LYS A 1 222 ? -32.997 -1.692  23.449  1.00 72.66  ? 248 LYS A NZ    1 
ATOM   1747 N N     . LEU A 1 223 ? -29.531 1.692   28.988  1.00 40.31  ? 249 LEU A N     1 
ATOM   1748 C CA    . LEU A 1 223 ? -28.199 2.230   28.746  1.00 33.59  ? 249 LEU A CA    1 
ATOM   1749 C C     . LEU A 1 223 ? -27.258 1.860   29.885  1.00 40.14  ? 249 LEU A C     1 
ATOM   1750 O O     . LEU A 1 223 ? -26.210 1.250   29.667  1.00 37.81  ? 249 LEU A O     1 
ATOM   1751 C CB    . LEU A 1 223 ? -28.258 3.750   28.587  1.00 25.83  ? 249 LEU A CB    1 
ATOM   1752 C CG    . LEU A 1 223 ? -26.917 4.485   28.528  1.00 32.82  ? 249 LEU A CG    1 
ATOM   1753 C CD1   . LEU A 1 223 ? -26.052 3.945   27.400  1.00 42.69  ? 249 LEU A CD1   1 
ATOM   1754 C CD2   . LEU A 1 223 ? -27.132 5.982   28.374  1.00 28.59  ? 249 LEU A CD2   1 
ATOM   1755 N N     . PHE A 1 224 ? -27.644 2.233   31.100  1.00 42.63  ? 250 PHE A N     1 
ATOM   1756 C CA    . PHE A 1 224 ? -26.851 1.939   32.287  1.00 32.77  ? 250 PHE A CA    1 
ATOM   1757 C C     . PHE A 1 224 ? -26.491 0.459   32.365  1.00 37.57  ? 250 PHE A C     1 
ATOM   1758 O O     . PHE A 1 224 ? -25.377 0.101   32.745  1.00 36.29  ? 250 PHE A O     1 
ATOM   1759 C CB    . PHE A 1 224 ? -27.605 2.358   33.549  1.00 26.92  ? 250 PHE A CB    1 
ATOM   1760 C CG    . PHE A 1 224 ? -26.860 2.072   34.817  1.00 31.92  ? 250 PHE A CG    1 
ATOM   1761 C CD1   . PHE A 1 224 ? -25.919 2.966   35.298  1.00 36.82  ? 250 PHE A CD1   1 
ATOM   1762 C CD2   . PHE A 1 224 ? -27.094 0.906   35.525  1.00 35.92  ? 250 PHE A CD2   1 
ATOM   1763 C CE1   . PHE A 1 224 ? -25.226 2.704   36.464  1.00 26.85  ? 250 PHE A CE1   1 
ATOM   1764 C CE2   . PHE A 1 224 ? -26.404 0.640   36.694  1.00 32.42  ? 250 PHE A CE2   1 
ATOM   1765 C CZ    . PHE A 1 224 ? -25.469 1.540   37.162  1.00 20.87  ? 250 PHE A CZ    1 
ATOM   1766 N N     . ASP A 1 225 ? -27.443 -0.395  32.004  1.00 39.01  ? 251 ASP A N     1 
ATOM   1767 C CA    . ASP A 1 225 ? -27.227 -1.836  32.013  1.00 34.09  ? 251 ASP A CA    1 
ATOM   1768 C C     . ASP A 1 225 ? -26.002 -2.207  31.185  1.00 40.09  ? 251 ASP A C     1 
ATOM   1769 O O     . ASP A 1 225 ? -25.033 -2.758  31.707  1.00 45.95  ? 251 ASP A O     1 
ATOM   1770 C CB    . ASP A 1 225 ? -28.465 -2.566  31.483  1.00 40.28  ? 251 ASP A CB    1 
ATOM   1771 C CG    . ASP A 1 225 ? -28.313 -4.078  31.512  1.00 58.30  ? 251 ASP A CG    1 
ATOM   1772 O OD1   . ASP A 1 225 ? -27.280 -4.569  32.015  1.00 75.07  ? 251 ASP A OD1   1 
ATOM   1773 O OD2   . ASP A 1 225 ? -29.229 -4.779  31.032  1.00 50.73  ? 251 ASP A OD2   1 
ATOM   1774 N N     . SER A 1 226 ? -26.053 -1.896  29.893  1.00 38.56  ? 252 SER A N     1 
ATOM   1775 C CA    . SER A 1 226 ? -24.973 -2.237  28.973  1.00 39.62  ? 252 SER A CA    1 
ATOM   1776 C C     . SER A 1 226 ? -23.639 -1.656  29.425  1.00 37.82  ? 252 SER A C     1 
ATOM   1777 O O     . SER A 1 226 ? -22.589 -2.264  29.226  1.00 47.23  ? 252 SER A O     1 
ATOM   1778 C CB    . SER A 1 226 ? -25.303 -1.751  27.561  1.00 51.79  ? 252 SER A CB    1 
ATOM   1779 O OG    . SER A 1 226 ? -26.544 -2.272  27.122  1.00 59.93  ? 252 SER A OG    1 
ATOM   1780 N N     . ILE A 1 227 ? -23.689 -0.476  30.033  1.00 31.67  ? 253 ILE A N     1 
ATOM   1781 C CA    . ILE A 1 227 ? -22.485 0.194   30.513  1.00 42.97  ? 253 ILE A CA    1 
ATOM   1782 C C     . ILE A 1 227 ? -21.732 -0.635  31.552  1.00 45.56  ? 253 ILE A C     1 
ATOM   1783 O O     . ILE A 1 227 ? -20.629 -1.115  31.291  1.00 51.10  ? 253 ILE A O     1 
ATOM   1784 C CB    . ILE A 1 227 ? -22.810 1.577   31.114  1.00 47.09  ? 253 ILE A CB    1 
ATOM   1785 C CG1   . ILE A 1 227 ? -23.410 2.495   30.048  1.00 48.92  ? 253 ILE A CG1   1 
ATOM   1786 C CG2   . ILE A 1 227 ? -21.562 2.206   31.710  1.00 28.32  ? 253 ILE A CG2   1 
ATOM   1787 C CD1   . ILE A 1 227 ? -22.480 2.763   28.889  1.00 42.16  ? 253 ILE A CD1   1 
ATOM   1788 N N     . CYS A 1 228 ? -22.331 -0.803  32.727  1.00 38.27  ? 254 CYS A N     1 
ATOM   1789 C CA    . CYS A 1 228 ? -21.655 -1.472  33.834  1.00 54.32  ? 254 CYS A CA    1 
ATOM   1790 C C     . CYS A 1 228 ? -21.629 -2.990  33.678  1.00 55.85  ? 254 CYS A C     1 
ATOM   1791 O O     . CYS A 1 228 ? -21.099 -3.699  34.534  1.00 67.61  ? 254 CYS A O     1 
ATOM   1792 C CB    . CYS A 1 228 ? -22.295 -1.092  35.172  1.00 62.68  ? 254 CYS A CB    1 
ATOM   1793 S SG    . CYS A 1 228 ? -23.860 -1.918  35.520  1.00 35.13  ? 254 CYS A SG    1 
ATOM   1794 N N     . ASN A 1 229 ? -22.204 -3.487  32.589  1.00 45.61  ? 255 ASN A N     1 
ATOM   1795 C CA    . ASN A 1 229 ? -22.168 -4.917  32.306  1.00 46.62  ? 255 ASN A CA    1 
ATOM   1796 C C     . ASN A 1 229 ? -21.240 -5.246  31.140  1.00 40.53  ? 255 ASN A C     1 
ATOM   1797 O O     . ASN A 1 229 ? -20.999 -6.414  30.836  1.00 44.68  ? 255 ASN A O     1 
ATOM   1798 C CB    . ASN A 1 229 ? -23.575 -5.465  32.052  1.00 58.65  ? 255 ASN A CB    1 
ATOM   1799 C CG    . ASN A 1 229 ? -24.417 -5.517  33.314  1.00 55.73  ? 255 ASN A CG    1 
ATOM   1800 O OD1   . ASN A 1 229 ? -24.077 -4.906  34.326  1.00 59.20  ? 255 ASN A OD1   1 
ATOM   1801 N ND2   . ASN A 1 229 ? -25.521 -6.250  33.259  1.00 60.85  ? 255 ASN A ND2   1 
ATOM   1802 N N     . ASN A 1 230 ? -20.718 -4.209  30.493  1.00 36.99  ? 256 ASN A N     1 
ATOM   1803 C CA    . ASN A 1 230 ? -19.767 -4.399  29.406  1.00 44.68  ? 256 ASN A CA    1 
ATOM   1804 C C     . ASN A 1 230 ? -18.381 -4.737  29.942  1.00 39.40  ? 256 ASN A C     1 
ATOM   1805 O O     . ASN A 1 230 ? -17.774 -3.942  30.662  1.00 37.56  ? 256 ASN A O     1 
ATOM   1806 C CB    . ASN A 1 230 ? -19.703 -3.161  28.511  1.00 52.26  ? 256 ASN A CB    1 
ATOM   1807 C CG    . ASN A 1 230 ? -19.013 -3.434  27.190  1.00 62.94  ? 256 ASN A CG    1 
ATOM   1808 O OD1   . ASN A 1 230 ? -18.815 -4.587  26.809  1.00 61.72  ? 256 ASN A OD1   1 
ATOM   1809 N ND2   . ASN A 1 230 ? -18.648 -2.374  26.481  1.00 81.61  ? 256 ASN A ND2   1 
ATOM   1810 N N     . LYS A 1 231 ? -17.892 -5.921  29.582  1.00 39.36  ? 257 LYS A N     1 
ATOM   1811 C CA    . LYS A 1 231 ? -16.620 -6.437  30.084  1.00 38.72  ? 257 LYS A CA    1 
ATOM   1812 C C     . LYS A 1 231 ? -15.459 -5.471  29.855  1.00 39.70  ? 257 LYS A C     1 
ATOM   1813 O O     . LYS A 1 231 ? -14.449 -5.523  30.557  1.00 35.29  ? 257 LYS A O     1 
ATOM   1814 C CB    . LYS A 1 231 ? -16.309 -7.795  29.443  1.00 30.80  ? 257 LYS A CB    1 
ATOM   1815 C CG    . LYS A 1 231 ? -15.084 -8.500  30.010  1.00 46.66  ? 257 LYS A CG    1 
ATOM   1816 C CD    . LYS A 1 231 ? -14.801 -9.810  29.278  1.00 67.13  ? 257 LYS A CD    1 
ATOM   1817 C CE    . LYS A 1 231 ? -13.513 -10.461 29.775  1.00 87.89  ? 257 LYS A CE    1 
ATOM   1818 N NZ    . LYS A 1 231 ? -13.130 -11.683 29.002  1.00 96.04  ? 257 LYS A NZ    1 
ATOM   1819 N N     . TRP A 1 232 ? -15.609 -4.586  28.876  1.00 35.49  ? 258 TRP A N     1 
ATOM   1820 C CA    . TRP A 1 232 ? -14.543 -3.656  28.524  1.00 41.02  ? 258 TRP A CA    1 
ATOM   1821 C C     . TRP A 1 232 ? -14.409 -2.527  29.546  1.00 40.80  ? 258 TRP A C     1 
ATOM   1822 O O     . TRP A 1 232 ? -13.443 -1.765  29.520  1.00 36.76  ? 258 TRP A O     1 
ATOM   1823 C CB    . TRP A 1 232 ? -14.772 -3.093  27.118  1.00 47.33  ? 258 TRP A CB    1 
ATOM   1824 C CG    . TRP A 1 232 ? -13.524 -2.579  26.459  1.00 47.91  ? 258 TRP A CG    1 
ATOM   1825 C CD1   . TRP A 1 232 ? -12.325 -3.224  26.362  1.00 49.64  ? 258 TRP A CD1   1 
ATOM   1826 C CD2   . TRP A 1 232 ? -13.358 -1.322  25.789  1.00 45.47  ? 258 TRP A CD2   1 
ATOM   1827 N NE1   . TRP A 1 232 ? -11.421 -2.443  25.683  1.00 54.07  ? 258 TRP A NE1   1 
ATOM   1828 C CE2   . TRP A 1 232 ? -12.030 -1.272  25.320  1.00 51.72  ? 258 TRP A CE2   1 
ATOM   1829 C CE3   . TRP A 1 232 ? -14.202 -0.235  25.545  1.00 52.09  ? 258 TRP A CE3   1 
ATOM   1830 C CZ2   . TRP A 1 232 ? -11.527 -0.176  24.620  1.00 52.72  ? 258 TRP A CZ2   1 
ATOM   1831 C CZ3   . TRP A 1 232 ? -13.700 0.853   24.850  1.00 52.22  ? 258 TRP A CZ3   1 
ATOM   1832 C CH2   . TRP A 1 232 ? -12.375 0.873   24.396  1.00 49.73  ? 258 TRP A CH2   1 
ATOM   1833 N N     . PHE A 1 233 ? -15.377 -2.426  30.452  1.00 48.08  ? 259 PHE A N     1 
ATOM   1834 C CA    . PHE A 1 233 ? -15.356 -1.377  31.467  1.00 48.06  ? 259 PHE A CA    1 
ATOM   1835 C C     . PHE A 1 233 ? -15.018 -1.912  32.854  1.00 40.70  ? 259 PHE A C     1 
ATOM   1836 O O     . PHE A 1 233 ? -15.119 -1.191  33.845  1.00 47.80  ? 259 PHE A O     1 
ATOM   1837 C CB    . PHE A 1 233 ? -16.696 -0.642  31.509  1.00 49.07  ? 259 PHE A CB    1 
ATOM   1838 C CG    . PHE A 1 233 ? -16.996 0.136   30.265  1.00 51.53  ? 259 PHE A CG    1 
ATOM   1839 C CD1   . PHE A 1 233 ? -16.219 1.226   29.912  1.00 51.86  ? 259 PHE A CD1   1 
ATOM   1840 C CD2   . PHE A 1 233 ? -18.058 -0.216  29.452  1.00 55.37  ? 259 PHE A CD2   1 
ATOM   1841 C CE1   . PHE A 1 233 ? -16.491 1.947   28.768  1.00 50.73  ? 259 PHE A CE1   1 
ATOM   1842 C CE2   . PHE A 1 233 ? -18.337 0.502   28.307  1.00 58.20  ? 259 PHE A CE2   1 
ATOM   1843 C CZ    . PHE A 1 233 ? -17.552 1.586   27.964  1.00 56.53  ? 259 PHE A CZ    1 
ATOM   1844 N N     . THR A 1 234 ? -14.616 -3.177  32.913  1.00 32.80  ? 260 THR A N     1 
ATOM   1845 C CA    . THR A 1 234 ? -14.301 -3.835  34.178  1.00 46.73  ? 260 THR A CA    1 
ATOM   1846 C C     . THR A 1 234 ? -13.544 -2.939  35.159  1.00 57.64  ? 260 THR A C     1 
ATOM   1847 O O     . THR A 1 234 ? -13.981 -2.743  36.293  1.00 70.55  ? 260 THR A O     1 
ATOM   1848 C CB    . THR A 1 234 ? -13.499 -5.130  33.948  1.00 40.69  ? 260 THR A CB    1 
ATOM   1849 O OG1   . THR A 1 234 ? -14.338 -6.103  33.313  1.00 38.84  ? 260 THR A OG1   1 
ATOM   1850 C CG2   . THR A 1 234 ? -12.993 -5.690  35.272  1.00 30.87  ? 260 THR A CG2   1 
ATOM   1851 N N     . ASP A 1 235 ? -12.414 -2.395  34.720  1.00 45.45  ? 261 ASP A N     1 
ATOM   1852 C CA    . ASP A 1 235 ? -11.561 -1.604  35.603  1.00 60.08  ? 261 ASP A CA    1 
ATOM   1853 C C     . ASP A 1 235 ? -12.076 -0.182  35.815  1.00 60.83  ? 261 ASP A C     1 
ATOM   1854 O O     . ASP A 1 235 ? -11.592 0.536   36.691  1.00 67.05  ? 261 ASP A O     1 
ATOM   1855 C CB    . ASP A 1 235 ? -10.125 -1.574  35.077  1.00 82.43  ? 261 ASP A CB    1 
ATOM   1856 C CG    . ASP A 1 235 ? -9.455  -2.931  35.143  1.00 101.12 ? 261 ASP A CG    1 
ATOM   1857 O OD1   . ASP A 1 235 ? -10.017 -3.842  35.788  1.00 102.31 ? 261 ASP A OD1   1 
ATOM   1858 O OD2   . ASP A 1 235 ? -8.365  -3.087  34.553  1.00 111.09 ? 261 ASP A OD2   1 
ATOM   1859 N N     . THR A 1 236 ? -13.058 0.220   35.015  1.00 53.74  ? 262 THR A N     1 
ATOM   1860 C CA    . THR A 1 236 ? -13.624 1.560   35.118  1.00 40.01  ? 262 THR A CA    1 
ATOM   1861 C C     . THR A 1 236 ? -14.671 1.645   36.225  1.00 55.70  ? 262 THR A C     1 
ATOM   1862 O O     . THR A 1 236 ? -15.647 0.895   36.229  1.00 61.73  ? 262 THR A O     1 
ATOM   1863 C CB    . THR A 1 236 ? -14.250 2.008   33.788  1.00 36.89  ? 262 THR A CB    1 
ATOM   1864 O OG1   . THR A 1 236 ? -13.228 2.109   32.788  1.00 55.41  ? 262 THR A OG1   1 
ATOM   1865 C CG2   . THR A 1 236 ? -14.930 3.357   33.950  1.00 37.49  ? 262 THR A CG2   1 
ATOM   1866 N N     . SER A 1 237 ? -14.461 2.564   37.163  1.00 52.30  ? 263 SER A N     1 
ATOM   1867 C CA    . SER A 1 237 ? -15.365 2.723   38.295  1.00 56.08  ? 263 SER A CA    1 
ATOM   1868 C C     . SER A 1 237 ? -16.665 3.402   37.882  1.00 51.19  ? 263 SER A C     1 
ATOM   1869 O O     . SER A 1 237 ? -16.650 4.433   37.210  1.00 49.29  ? 263 SER A O     1 
ATOM   1870 C CB    . SER A 1 237 ? -14.687 3.516   39.414  1.00 67.50  ? 263 SER A CB    1 
ATOM   1871 O OG    . SER A 1 237 ? -13.538 2.838   39.891  1.00 77.87  ? 263 SER A OG    1 
ATOM   1872 N N     . ILE A 1 238 ? -17.788 2.819   38.292  1.00 50.52  ? 264 ILE A N     1 
ATOM   1873 C CA    . ILE A 1 238 ? -19.103 3.352   37.946  1.00 41.16  ? 264 ILE A CA    1 
ATOM   1874 C C     . ILE A 1 238 ? -19.693 4.185   39.076  1.00 42.62  ? 264 ILE A C     1 
ATOM   1875 O O     . ILE A 1 238 ? -19.775 3.732   40.218  1.00 51.39  ? 264 ILE A O     1 
ATOM   1876 C CB    . ILE A 1 238 ? -20.100 2.229   37.603  1.00 34.78  ? 264 ILE A CB    1 
ATOM   1877 C CG1   . ILE A 1 238 ? -19.590 1.397   36.424  1.00 43.97  ? 264 ILE A CG1   1 
ATOM   1878 C CG2   . ILE A 1 238 ? -21.467 2.817   37.295  1.00 19.54  ? 264 ILE A CG2   1 
ATOM   1879 C CD1   . ILE A 1 238 ? -19.423 2.186   35.144  1.00 52.30  ? 264 ILE A CD1   1 
ATOM   1880 N N     . ILE A 1 239 ? -20.110 5.402   38.746  1.00 42.99  ? 265 ILE A N     1 
ATOM   1881 C CA    . ILE A 1 239 ? -20.722 6.299   39.718  1.00 38.61  ? 265 ILE A CA    1 
ATOM   1882 C C     . ILE A 1 239 ? -22.108 6.733   39.257  1.00 41.87  ? 265 ILE A C     1 
ATOM   1883 O O     . ILE A 1 239 ? -22.259 7.334   38.194  1.00 58.67  ? 265 ILE A O     1 
ATOM   1884 C CB    . ILE A 1 239 ? -19.859 7.548   39.951  1.00 30.84  ? 265 ILE A CB    1 
ATOM   1885 C CG1   . ILE A 1 239 ? -18.480 7.146   40.477  1.00 28.16  ? 265 ILE A CG1   1 
ATOM   1886 C CG2   . ILE A 1 239 ? -20.552 8.497   40.916  1.00 17.84  ? 265 ILE A CG2   1 
ATOM   1887 C CD1   . ILE A 1 239 ? -17.509 8.295   40.595  1.00 30.23  ? 265 ILE A CD1   1 
ATOM   1888 N N     . LEU A 1 240 ? -23.116 6.427   40.066  1.00 33.01  ? 266 LEU A N     1 
ATOM   1889 C CA    . LEU A 1 240 ? -24.497 6.742   39.725  1.00 28.20  ? 266 LEU A CA    1 
ATOM   1890 C C     . LEU A 1 240 ? -24.937 8.068   40.339  1.00 28.94  ? 266 LEU A C     1 
ATOM   1891 O O     . LEU A 1 240 ? -24.806 8.281   41.543  1.00 40.63  ? 266 LEU A O     1 
ATOM   1892 C CB    . LEU A 1 240 ? -25.425 5.617   40.185  1.00 31.15  ? 266 LEU A CB    1 
ATOM   1893 C CG    . LEU A 1 240 ? -26.882 5.705   39.733  1.00 29.30  ? 266 LEU A CG    1 
ATOM   1894 C CD1   . LEU A 1 240 ? -26.960 5.708   38.216  1.00 31.16  ? 266 LEU A CD1   1 
ATOM   1895 C CD2   . LEU A 1 240 ? -27.690 4.554   40.312  1.00 26.95  ? 266 LEU A CD2   1 
ATOM   1896 N N     . PHE A 1 241 ? -25.457 8.957   39.499  1.00 30.83  ? 267 PHE A N     1 
ATOM   1897 C CA    . PHE A 1 241 ? -25.958 10.249  39.953  1.00 24.10  ? 267 PHE A CA    1 
ATOM   1898 C C     . PHE A 1 241 ? -27.456 10.360  39.723  1.00 36.14  ? 267 PHE A C     1 
ATOM   1899 O O     . PHE A 1 241 ? -27.896 10.907  38.712  1.00 38.06  ? 267 PHE A O     1 
ATOM   1900 C CB    . PHE A 1 241 ? -25.250 11.389  39.221  1.00 17.48  ? 267 PHE A CB    1 
ATOM   1901 C CG    . PHE A 1 241 ? -23.984 11.844  39.883  1.00 31.60  ? 267 PHE A CG    1 
ATOM   1902 C CD1   . PHE A 1 241 ? -23.305 11.013  40.758  1.00 43.34  ? 267 PHE A CD1   1 
ATOM   1903 C CD2   . PHE A 1 241 ? -23.468 13.104  39.622  1.00 30.73  ? 267 PHE A CD2   1 
ATOM   1904 C CE1   . PHE A 1 241 ? -22.136 11.433  41.366  1.00 43.32  ? 267 PHE A CE1   1 
ATOM   1905 C CE2   . PHE A 1 241 ? -22.299 13.529  40.225  1.00 27.37  ? 267 PHE A CE2   1 
ATOM   1906 C CZ    . PHE A 1 241 ? -21.633 12.693  41.099  1.00 32.67  ? 267 PHE A CZ    1 
ATOM   1907 N N     . LEU A 1 242 ? -28.241 9.835   40.656  1.00 42.10  ? 268 LEU A N     1 
ATOM   1908 C CA    . LEU A 1 242 ? -29.684 9.999   40.593  1.00 37.36  ? 268 LEU A CA    1 
ATOM   1909 C C     . LEU A 1 242 ? -30.013 11.475  40.781  1.00 33.01  ? 268 LEU A C     1 
ATOM   1910 O O     . LEU A 1 242 ? -30.113 11.967  41.904  1.00 27.11  ? 268 LEU A O     1 
ATOM   1911 C CB    . LEU A 1 242 ? -30.370 9.132   41.646  1.00 24.91  ? 268 LEU A CB    1 
ATOM   1912 C CG    . LEU A 1 242 ? -30.036 7.646   41.496  1.00 27.89  ? 268 LEU A CG    1 
ATOM   1913 C CD1   . LEU A 1 242 ? -30.755 6.811   42.541  1.00 39.23  ? 268 LEU A CD1   1 
ATOM   1914 C CD2   . LEU A 1 242 ? -30.377 7.165   40.091  1.00 18.29  ? 268 LEU A CD2   1 
ATOM   1915 N N     . ASN A 1 243 ? -30.168 12.174  39.661  1.00 28.81  ? 269 ASN A N     1 
ATOM   1916 C CA    . ASN A 1 243 ? -30.286 13.626  39.658  1.00 32.33  ? 269 ASN A CA    1 
ATOM   1917 C C     . ASN A 1 243 ? -31.732 14.113  39.672  1.00 33.60  ? 269 ASN A C     1 
ATOM   1918 O O     . ASN A 1 243 ? -32.667 13.320  39.548  1.00 31.19  ? 269 ASN A O     1 
ATOM   1919 C CB    . ASN A 1 243 ? -29.552 14.200  38.445  1.00 32.30  ? 269 ASN A CB    1 
ATOM   1920 C CG    . ASN A 1 243 ? -29.306 15.688  38.562  1.00 44.02  ? 269 ASN A CG    1 
ATOM   1921 O OD1   . ASN A 1 243 ? -29.018 16.197  39.644  1.00 51.85  ? 269 ASN A OD1   1 
ATOM   1922 N ND2   . ASN A 1 243 ? -29.413 16.395  37.443  1.00 44.30  ? 269 ASN A ND2   1 
ATOM   1923 N N     . LYS A 1 244 ? -31.901 15.425  39.821  1.00 27.96  ? 270 LYS A N     1 
ATOM   1924 C CA    . LYS A 1 244 ? -33.222 16.045  39.876  1.00 28.75  ? 270 LYS A CA    1 
ATOM   1925 C C     . LYS A 1 244 ? -34.046 15.521  41.048  1.00 33.89  ? 270 LYS A C     1 
ATOM   1926 O O     . LYS A 1 244 ? -35.269 15.415  40.959  1.00 43.22  ? 270 LYS A O     1 
ATOM   1927 C CB    . LYS A 1 244 ? -33.978 15.836  38.561  1.00 30.34  ? 270 LYS A CB    1 
ATOM   1928 C CG    . LYS A 1 244 ? -33.383 16.574  37.371  1.00 29.45  ? 270 LYS A CG    1 
ATOM   1929 C CD    . LYS A 1 244 ? -34.217 16.344  36.120  1.00 25.52  ? 270 LYS A CD    1 
ATOM   1930 C CE    . LYS A 1 244 ? -33.691 17.135  34.937  1.00 26.45  ? 270 LYS A CE    1 
ATOM   1931 N NZ    . LYS A 1 244 ? -34.476 16.849  33.703  1.00 33.10  ? 270 LYS A NZ    1 
ATOM   1932 N N     . LYS A 1 245 ? -33.369 15.198  42.145  1.00 26.07  ? 271 LYS A N     1 
ATOM   1933 C CA    . LYS A 1 245 ? -34.042 14.699  43.338  1.00 32.78  ? 271 LYS A CA    1 
ATOM   1934 C C     . LYS A 1 245 ? -35.111 15.677  43.822  1.00 36.69  ? 271 LYS A C     1 
ATOM   1935 O O     . LYS A 1 245 ? -36.145 15.269  44.351  1.00 50.61  ? 271 LYS A O     1 
ATOM   1936 C CB    . LYS A 1 245 ? -33.029 14.430  44.457  1.00 28.82  ? 271 LYS A CB    1 
ATOM   1937 C CG    . LYS A 1 245 ? -32.231 15.654  44.880  1.00 34.86  ? 271 LYS A CG    1 
ATOM   1938 C CD    . LYS A 1 245 ? -31.456 15.407  46.164  1.00 37.33  ? 271 LYS A CD    1 
ATOM   1939 C CE    . LYS A 1 245 ? -30.743 16.670  46.624  1.00 54.07  ? 271 LYS A CE    1 
ATOM   1940 N NZ    . LYS A 1 245 ? -30.136 16.516  47.975  1.00 55.08  ? 271 LYS A NZ    1 
ATOM   1941 N N     . ASP A 1 246 ? -34.859 16.969  43.637  1.00 17.95  ? 272 ASP A N     1 
ATOM   1942 C CA    . ASP A 1 246 ? -35.785 17.997  44.094  1.00 23.28  ? 272 ASP A CA    1 
ATOM   1943 C C     . ASP A 1 246 ? -37.092 17.958  43.304  1.00 48.02  ? 272 ASP A C     1 
ATOM   1944 O O     . ASP A 1 246 ? -38.180 18.021  43.881  1.00 46.74  ? 272 ASP A O     1 
ATOM   1945 C CB    . ASP A 1 246 ? -35.145 19.389  44.012  1.00 25.98  ? 272 ASP A CB    1 
ATOM   1946 C CG    . ASP A 1 246 ? -34.772 19.784  42.592  1.00 38.65  ? 272 ASP A CG    1 
ATOM   1947 O OD1   . ASP A 1 246 ? -34.090 18.993  41.908  1.00 43.63  ? 272 ASP A OD1   1 
ATOM   1948 O OD2   . ASP A 1 246 ? -35.155 20.895  42.165  1.00 31.40  ? 272 ASP A OD2   1 
ATOM   1949 N N     . LEU A 1 247 ? -36.979 17.849  41.984  1.00 39.54  ? 273 LEU A N     1 
ATOM   1950 C CA    . LEU A 1 247 ? -38.150 17.768  41.121  1.00 29.22  ? 273 LEU A CA    1 
ATOM   1951 C C     . LEU A 1 247 ? -38.889 16.455  41.344  1.00 33.53  ? 273 LEU A C     1 
ATOM   1952 O O     . LEU A 1 247 ? -40.119 16.410  41.324  1.00 40.61  ? 273 LEU A O     1 
ATOM   1953 C CB    . LEU A 1 247 ? -37.746 17.901  39.652  1.00 26.85  ? 273 LEU A CB    1 
ATOM   1954 C CG    . LEU A 1 247 ? -37.092 19.229  39.269  1.00 35.44  ? 273 LEU A CG    1 
ATOM   1955 C CD1   . LEU A 1 247 ? -36.860 19.291  37.772  1.00 38.39  ? 273 LEU A CD1   1 
ATOM   1956 C CD2   . LEU A 1 247 ? -37.952 20.395  39.725  1.00 47.60  ? 273 LEU A CD2   1 
ATOM   1957 N N     . PHE A 1 248 ? -38.128 15.388  41.555  1.00 34.73  ? 274 PHE A N     1 
ATOM   1958 C CA    . PHE A 1 248 ? -38.703 14.080  41.830  1.00 39.48  ? 274 PHE A CA    1 
ATOM   1959 C C     . PHE A 1 248 ? -39.585 14.143  43.072  1.00 42.13  ? 274 PHE A C     1 
ATOM   1960 O O     . PHE A 1 248 ? -40.692 13.604  43.090  1.00 42.13  ? 274 PHE A O     1 
ATOM   1961 C CB    . PHE A 1 248 ? -37.591 13.046  42.014  1.00 38.57  ? 274 PHE A CB    1 
ATOM   1962 C CG    . PHE A 1 248 ? -38.086 11.663  42.325  1.00 36.12  ? 274 PHE A CG    1 
ATOM   1963 C CD1   . PHE A 1 248 ? -38.725 10.907  41.356  1.00 30.37  ? 274 PHE A CD1   1 
ATOM   1964 C CD2   . PHE A 1 248 ? -37.895 11.111  43.581  1.00 30.03  ? 274 PHE A CD2   1 
ATOM   1965 C CE1   . PHE A 1 248 ? -39.176 9.629   41.637  1.00 32.05  ? 274 PHE A CE1   1 
ATOM   1966 C CE2   . PHE A 1 248 ? -38.341 9.833   43.868  1.00 39.26  ? 274 PHE A CE2   1 
ATOM   1967 C CZ    . PHE A 1 248 ? -38.983 9.092   42.895  1.00 43.41  ? 274 PHE A CZ    1 
ATOM   1968 N N     . GLU A 1 249 ? -39.090 14.820  44.104  1.00 39.65  ? 275 GLU A N     1 
ATOM   1969 C CA    . GLU A 1 249 ? -39.821 14.949  45.359  1.00 39.31  ? 275 GLU A CA    1 
ATOM   1970 C C     . GLU A 1 249 ? -41.172 15.629  45.157  1.00 40.97  ? 275 GLU A C     1 
ATOM   1971 O O     . GLU A 1 249 ? -42.174 15.222  45.741  1.00 48.66  ? 275 GLU A O     1 
ATOM   1972 C CB    . GLU A 1 249 ? -38.990 15.719  46.389  1.00 43.69  ? 275 GLU A CB    1 
ATOM   1973 C CG    . GLU A 1 249 ? -39.639 15.813  47.761  1.00 66.01  ? 275 GLU A CG    1 
ATOM   1974 C CD    . GLU A 1 249 ? -38.745 16.479  48.791  1.00 70.90  ? 275 GLU A CD    1 
ATOM   1975 O OE1   . GLU A 1 249 ? -37.604 16.851  48.441  1.00 63.26  ? 275 GLU A OE1   1 
ATOM   1976 O OE2   . GLU A 1 249 ? -39.186 16.628  49.951  1.00 75.41  ? 275 GLU A OE2   1 
ATOM   1977 N N     . GLU A 1 250 ? -41.194 16.663  44.323  1.00 49.68  ? 276 GLU A N     1 
ATOM   1978 C CA    . GLU A 1 250 ? -42.419 17.412  44.065  1.00 47.15  ? 276 GLU A CA    1 
ATOM   1979 C C     . GLU A 1 250 ? -43.375 16.624  43.179  1.00 46.45  ? 276 GLU A C     1 
ATOM   1980 O O     . GLU A 1 250 ? -44.591 16.812  43.242  1.00 57.26  ? 276 GLU A O     1 
ATOM   1981 C CB    . GLU A 1 250 ? -42.093 18.758  43.421  1.00 70.59  ? 276 GLU A CB    1 
ATOM   1982 C CG    . GLU A 1 250 ? -41.103 19.594  44.214  1.00 111.02 ? 276 GLU A CG    1 
ATOM   1983 C CD    . GLU A 1 250 ? -40.636 20.819  43.454  1.00 136.61 ? 276 GLU A CD    1 
ATOM   1984 O OE1   . GLU A 1 250 ? -41.226 21.124  42.396  1.00 139.74 ? 276 GLU A OE1   1 
ATOM   1985 O OE2   . GLU A 1 250 ? -39.678 21.477  43.915  1.00 143.46 ? 276 GLU A OE2   1 
ATOM   1986 N N     . LYS A 1 251 ? -42.822 15.742  42.352  1.00 38.90  ? 277 LYS A N     1 
ATOM   1987 C CA    . LYS A 1 251 ? -43.637 14.916  41.467  1.00 34.50  ? 277 LYS A CA    1 
ATOM   1988 C C     . LYS A 1 251 ? -44.246 13.733  42.210  1.00 42.35  ? 277 LYS A C     1 
ATOM   1989 O O     . LYS A 1 251 ? -45.409 13.390  41.998  1.00 42.55  ? 277 LYS A O     1 
ATOM   1990 C CB    . LYS A 1 251 ? -42.817 14.411  40.276  1.00 28.32  ? 277 LYS A CB    1 
ATOM   1991 C CG    . LYS A 1 251 ? -42.551 15.454  39.203  1.00 22.09  ? 277 LYS A CG    1 
ATOM   1992 C CD    . LYS A 1 251 ? -42.091 14.796  37.906  1.00 33.20  ? 277 LYS A CD    1 
ATOM   1993 C CE    . LYS A 1 251 ? -42.034 15.799  36.763  1.00 47.02  ? 277 LYS A CE    1 
ATOM   1994 N NZ    . LYS A 1 251 ? -41.849 15.139  35.440  1.00 41.88  ? 277 LYS A NZ    1 
ATOM   1995 N N     . ILE A 1 252 ? -43.456 13.115  43.082  1.00 37.05  ? 278 ILE A N     1 
ATOM   1996 C CA    . ILE A 1 252 ? -43.895 11.925  43.802  1.00 31.97  ? 278 ILE A CA    1 
ATOM   1997 C C     . ILE A 1 252 ? -45.142 12.199  44.644  1.00 45.15  ? 278 ILE A C     1 
ATOM   1998 O O     . ILE A 1 252 ? -45.801 11.270  45.111  1.00 47.41  ? 278 ILE A O     1 
ATOM   1999 C CB    . ILE A 1 252 ? -42.778 11.368  44.707  1.00 35.06  ? 278 ILE A CB    1 
ATOM   2000 C CG1   . ILE A 1 252 ? -43.012 9.886   44.996  1.00 43.26  ? 278 ILE A CG1   1 
ATOM   2001 C CG2   . ILE A 1 252 ? -42.680 12.168  45.996  1.00 52.68  ? 278 ILE A CG2   1 
ATOM   2002 C CD1   . ILE A 1 252 ? -42.967 9.014   43.763  1.00 43.36  ? 278 ILE A CD1   1 
ATOM   2003 N N     . LYS A 1 253 ? -45.465 13.476  44.827  1.00 48.52  ? 279 LYS A N     1 
ATOM   2004 C CA    . LYS A 1 253 ? -46.623 13.867  45.623  1.00 46.53  ? 279 LYS A CA    1 
ATOM   2005 C C     . LYS A 1 253 ? -47.939 13.599  44.902  1.00 56.10  ? 279 LYS A C     1 
ATOM   2006 O O     . LYS A 1 253 ? -48.915 13.170  45.518  1.00 70.95  ? 279 LYS A O     1 
ATOM   2007 C CB    . LYS A 1 253 ? -46.536 15.343  46.016  1.00 41.72  ? 279 LYS A CB    1 
ATOM   2008 C CG    . LYS A 1 253 ? -45.466 15.651  47.048  1.00 39.22  ? 279 LYS A CG    1 
ATOM   2009 C CD    . LYS A 1 253 ? -45.510 17.112  47.464  1.00 43.45  ? 279 LYS A CD    1 
ATOM   2010 C CE    . LYS A 1 253 ? -44.445 17.423  48.504  1.00 42.17  ? 279 LYS A CE    1 
ATOM   2011 N NZ    . LYS A 1 253 ? -44.494 18.845  48.941  1.00 52.03  ? 279 LYS A NZ    1 
ATOM   2012 N N     . LYS A 1 254 ? -47.967 13.856  43.599  1.00 59.90  ? 280 LYS A N     1 
ATOM   2013 C CA    . LYS A 1 254 ? -49.194 13.689  42.826  1.00 62.41  ? 280 LYS A CA    1 
ATOM   2014 C C     . LYS A 1 254 ? -49.096 12.564  41.796  1.00 51.69  ? 280 LYS A C     1 
ATOM   2015 O O     . LYS A 1 254 ? -50.109 11.986  41.403  1.00 56.83  ? 280 LYS A O     1 
ATOM   2016 C CB    . LYS A 1 254 ? -49.592 15.006  42.155  1.00 69.76  ? 280 LYS A CB    1 
ATOM   2017 C CG    . LYS A 1 254 ? -49.889 16.122  43.146  1.00 92.72  ? 280 LYS A CG    1 
ATOM   2018 C CD    . LYS A 1 254 ? -50.586 17.300  42.485  1.00 108.72 ? 280 LYS A CD    1 
ATOM   2019 C CE    . LYS A 1 254 ? -50.987 18.344  43.518  1.00 115.45 ? 280 LYS A CE    1 
ATOM   2020 N NZ    . LYS A 1 254 ? -51.747 19.474  42.916  1.00 115.29 ? 280 LYS A NZ    1 
ATOM   2021 N N     . SER A 1 255 ? -47.876 12.257  41.369  1.00 43.63  ? 281 SER A N     1 
ATOM   2022 C CA    . SER A 1 255 ? -47.646 11.179  40.414  1.00 49.10  ? 281 SER A CA    1 
ATOM   2023 C C     . SER A 1 255 ? -47.041 9.963   41.106  1.00 56.18  ? 281 SER A C     1 
ATOM   2024 O O     . SER A 1 255 ? -45.891 10.001  41.538  1.00 61.26  ? 281 SER A O     1 
ATOM   2025 C CB    . SER A 1 255 ? -46.721 11.645  39.287  1.00 45.27  ? 281 SER A CB    1 
ATOM   2026 O OG    . SER A 1 255 ? -47.261 12.764  38.609  1.00 52.62  ? 281 SER A OG    1 
ATOM   2027 N N     . PRO A 1 256 ? -47.820 8.877   41.216  1.00 48.53  ? 282 PRO A N     1 
ATOM   2028 C CA    . PRO A 1 256 ? -47.339 7.639   41.839  1.00 48.68  ? 282 PRO A CA    1 
ATOM   2029 C C     . PRO A 1 256 ? -46.215 6.993   41.033  1.00 46.33  ? 282 PRO A C     1 
ATOM   2030 O O     . PRO A 1 256 ? -46.150 7.164   39.817  1.00 45.71  ? 282 PRO A O     1 
ATOM   2031 C CB    . PRO A 1 256 ? -48.580 6.741   41.841  1.00 44.94  ? 282 PRO A CB    1 
ATOM   2032 C CG    . PRO A 1 256 ? -49.459 7.294   40.776  1.00 46.56  ? 282 PRO A CG    1 
ATOM   2033 C CD    . PRO A 1 256 ? -49.222 8.770   40.782  1.00 45.83  ? 282 PRO A CD    1 
ATOM   2034 N N     . LEU A 1 257 ? -45.340 6.260   41.715  1.00 42.10  ? 283 LEU A N     1 
ATOM   2035 C CA    . LEU A 1 257 ? -44.213 5.602   41.064  1.00 35.88  ? 283 LEU A CA    1 
ATOM   2036 C C     . LEU A 1 257 ? -44.688 4.429   40.215  1.00 51.83  ? 283 LEU A C     1 
ATOM   2037 O O     . LEU A 1 257 ? -43.952 3.919   39.368  1.00 54.26  ? 283 LEU A O     1 
ATOM   2038 C CB    . LEU A 1 257 ? -43.202 5.124   42.110  1.00 34.21  ? 283 LEU A CB    1 
ATOM   2039 C CG    . LEU A 1 257 ? -41.936 4.420   41.612  1.00 38.17  ? 283 LEU A CG    1 
ATOM   2040 C CD1   . LEU A 1 257 ? -41.184 5.286   40.612  1.00 36.82  ? 283 LEU A CD1   1 
ATOM   2041 C CD2   . LEU A 1 257 ? -41.039 4.045   42.782  1.00 34.94  ? 283 LEU A CD2   1 
ATOM   2042 N N     . THR A 1 258 ? -45.928 4.009   40.447  1.00 55.47  ? 284 THR A N     1 
ATOM   2043 C CA    . THR A 1 258 ? -46.514 2.889   39.721  1.00 41.39  ? 284 THR A CA    1 
ATOM   2044 C C     . THR A 1 258 ? -46.586 3.166   38.220  1.00 42.14  ? 284 THR A C     1 
ATOM   2045 O O     . THR A 1 258 ? -46.575 2.241   37.406  1.00 44.20  ? 284 THR A O     1 
ATOM   2046 C CB    . THR A 1 258 ? -47.917 2.558   40.257  1.00 27.80  ? 284 THR A CB    1 
ATOM   2047 O OG1   . THR A 1 258 ? -47.832 2.269   41.657  1.00 39.48  ? 284 THR A OG1   1 
ATOM   2048 C CG2   . THR A 1 258 ? -48.500 1.355   39.534  1.00 47.95  ? 284 THR A CG2   1 
ATOM   2049 N N     . ILE A 1 259 ? -46.650 4.444   37.857  1.00 41.17  ? 285 ILE A N     1 
ATOM   2050 C CA    . ILE A 1 259 ? -46.716 4.833   36.454  1.00 47.33  ? 285 ILE A CA    1 
ATOM   2051 C C     . ILE A 1 259 ? -45.457 4.397   35.713  1.00 47.96  ? 285 ILE A C     1 
ATOM   2052 O O     . ILE A 1 259 ? -45.496 4.106   34.517  1.00 69.87  ? 285 ILE A O     1 
ATOM   2053 C CB    . ILE A 1 259 ? -46.905 6.354   36.292  1.00 57.28  ? 285 ILE A CB    1 
ATOM   2054 C CG1   . ILE A 1 259 ? -48.148 6.822   37.049  1.00 76.42  ? 285 ILE A CG1   1 
ATOM   2055 C CG2   . ILE A 1 259 ? -47.017 6.726   34.823  1.00 54.81  ? 285 ILE A CG2   1 
ATOM   2056 C CD1   . ILE A 1 259 ? -48.420 8.304   36.915  1.00 75.68  ? 285 ILE A CD1   1 
ATOM   2057 N N     . CYS A 1 260 ? -44.342 4.348   36.432  1.00 32.82  ? 286 CYS A N     1 
ATOM   2058 C CA    . CYS A 1 260 ? -43.077 3.934   35.839  1.00 36.11  ? 286 CYS A CA    1 
ATOM   2059 C C     . CYS A 1 260 ? -42.780 2.471   36.151  1.00 49.77  ? 286 CYS A C     1 
ATOM   2060 O O     . CYS A 1 260 ? -42.424 1.697   35.263  1.00 54.72  ? 286 CYS A O     1 
ATOM   2061 C CB    . CYS A 1 260 ? -41.935 4.820   36.334  1.00 22.53  ? 286 CYS A CB    1 
ATOM   2062 S SG    . CYS A 1 260 ? -40.353 4.484   35.542  1.00 46.26  ? 286 CYS A SG    1 
ATOM   2063 N N     . TYR A 1 261 ? -42.927 2.100   37.419  1.00 48.24  ? 287 TYR A N     1 
ATOM   2064 C CA    . TYR A 1 261 ? -42.713 0.722   37.843  1.00 49.57  ? 287 TYR A CA    1 
ATOM   2065 C C     . TYR A 1 261 ? -44.002 0.136   38.407  1.00 53.71  ? 287 TYR A C     1 
ATOM   2066 O O     . TYR A 1 261 ? -44.281 0.273   39.598  1.00 43.29  ? 287 TYR A O     1 
ATOM   2067 C CB    . TYR A 1 261 ? -41.600 0.647   38.888  1.00 46.17  ? 287 TYR A CB    1 
ATOM   2068 C CG    . TYR A 1 261 ? -40.272 1.197   38.418  1.00 44.01  ? 287 TYR A CG    1 
ATOM   2069 C CD1   . TYR A 1 261 ? -39.308 0.363   37.868  1.00 49.55  ? 287 TYR A CD1   1 
ATOM   2070 C CD2   . TYR A 1 261 ? -39.981 2.551   38.530  1.00 40.58  ? 287 TYR A CD2   1 
ATOM   2071 C CE1   . TYR A 1 261 ? -38.089 0.863   37.442  1.00 55.12  ? 287 TYR A CE1   1 
ATOM   2072 C CE2   . TYR A 1 261 ? -38.767 3.058   38.107  1.00 44.01  ? 287 TYR A CE2   1 
ATOM   2073 C CZ    . TYR A 1 261 ? -37.825 2.211   37.564  1.00 51.97  ? 287 TYR A CZ    1 
ATOM   2074 O OH    . TYR A 1 261 ? -36.615 2.716   37.141  1.00 42.62  ? 287 TYR A OH    1 
ATOM   2075 N N     . PRO A 1 262 ? -44.792 -0.518  37.544  1.00 56.43  ? 288 PRO A N     1 
ATOM   2076 C CA    . PRO A 1 262 ? -46.100 -1.087  37.891  1.00 56.47  ? 288 PRO A CA    1 
ATOM   2077 C C     . PRO A 1 262 ? -46.038 -2.066  39.061  1.00 60.16  ? 288 PRO A C     1 
ATOM   2078 O O     . PRO A 1 262 ? -46.961 -2.104  39.875  1.00 66.81  ? 288 PRO A O     1 
ATOM   2079 C CB    . PRO A 1 262 ? -46.508 -1.826  36.613  1.00 50.77  ? 288 PRO A CB    1 
ATOM   2080 C CG    . PRO A 1 262 ? -45.779 -1.123  35.525  1.00 52.64  ? 288 PRO A CG    1 
ATOM   2081 C CD    . PRO A 1 262 ? -44.466 -0.714  36.121  1.00 44.60  ? 288 PRO A CD    1 
ATOM   2082 N N     . GLU A 1 263 ? -44.963 -2.843  39.140  1.00 57.78  ? 289 GLU A N     1 
ATOM   2083 C CA    . GLU A 1 263 ? -44.830 -3.864  40.175  1.00 56.82  ? 289 GLU A CA    1 
ATOM   2084 C C     . GLU A 1 263 ? -44.386 -3.282  41.518  1.00 62.23  ? 289 GLU A C     1 
ATOM   2085 O O     . GLU A 1 263 ? -43.945 -4.013  42.405  1.00 62.44  ? 289 GLU A O     1 
ATOM   2086 C CB    . GLU A 1 263 ? -43.858 -4.963  39.726  1.00 67.93  ? 289 GLU A CB    1 
ATOM   2087 C CG    . GLU A 1 263 ? -42.400 -4.522  39.628  1.00 92.95  ? 289 GLU A CG    1 
ATOM   2088 C CD    . GLU A 1 263 ? -42.127 -3.624  38.434  1.00 100.89 ? 289 GLU A CD    1 
ATOM   2089 O OE1   . GLU A 1 263 ? -42.979 -3.565  37.521  1.00 108.00 ? 289 GLU A OE1   1 
ATOM   2090 O OE2   . GLU A 1 263 ? -41.056 -2.980  38.405  1.00 87.50  ? 289 GLU A OE2   1 
ATOM   2091 N N     . TYR A 1 264 ? -44.510 -1.965  41.662  1.00 65.57  ? 290 TYR A N     1 
ATOM   2092 C CA    . TYR A 1 264 ? -44.122 -1.282  42.895  1.00 57.94  ? 290 TYR A CA    1 
ATOM   2093 C C     . TYR A 1 264 ? -45.275 -1.234  43.896  1.00 70.38  ? 290 TYR A C     1 
ATOM   2094 O O     . TYR A 1 264 ? -46.341 -0.686  43.609  1.00 63.91  ? 290 TYR A O     1 
ATOM   2095 C CB    . TYR A 1 264 ? -43.625 0.133   42.587  1.00 40.70  ? 290 TYR A CB    1 
ATOM   2096 C CG    . TYR A 1 264 ? -43.290 0.959   43.809  1.00 39.65  ? 290 TYR A CG    1 
ATOM   2097 C CD1   . TYR A 1 264 ? -42.114 0.744   44.516  1.00 49.31  ? 290 TYR A CD1   1 
ATOM   2098 C CD2   . TYR A 1 264 ? -44.141 1.964   44.247  1.00 46.96  ? 290 TYR A CD2   1 
ATOM   2099 C CE1   . TYR A 1 264 ? -41.801 1.500   45.631  1.00 43.30  ? 290 TYR A CE1   1 
ATOM   2100 C CE2   . TYR A 1 264 ? -43.835 2.726   45.360  1.00 48.69  ? 290 TYR A CE2   1 
ATOM   2101 C CZ    . TYR A 1 264 ? -42.664 2.490   46.048  1.00 45.07  ? 290 TYR A CZ    1 
ATOM   2102 O OH    . TYR A 1 264 ? -42.355 3.245   47.158  1.00 43.37  ? 290 TYR A OH    1 
ATOM   2103 N N     . ALA A 1 265 ? -45.052 -1.809  45.073  1.00 73.88  ? 291 ALA A N     1 
ATOM   2104 C CA    . ALA A 1 265 ? -46.085 -1.875  46.102  1.00 74.74  ? 291 ALA A CA    1 
ATOM   2105 C C     . ALA A 1 265 ? -45.719 -1.053  47.336  1.00 68.75  ? 291 ALA A C     1 
ATOM   2106 O O     . ALA A 1 265 ? -46.211 -1.313  48.434  1.00 69.19  ? 291 ALA A O     1 
ATOM   2107 C CB    . ALA A 1 265 ? -46.360 -3.321  46.485  1.00 74.80  ? 291 ALA A CB    1 
ATOM   2108 N N     . GLY A 1 266 ? -44.851 -0.064  47.150  1.00 56.52  ? 292 GLY A N     1 
ATOM   2109 C CA    . GLY A 1 266 ? -44.465 0.816   48.237  1.00 51.28  ? 292 GLY A CA    1 
ATOM   2110 C C     . GLY A 1 266 ? -45.313 2.071   48.254  1.00 45.99  ? 292 GLY A C     1 
ATOM   2111 O O     . GLY A 1 266 ? -46.112 2.299   47.346  1.00 59.52  ? 292 GLY A O     1 
ATOM   2112 N N     . SER A 1 267 ? -45.144 2.888   49.288  1.00 35.16  ? 293 SER A N     1 
ATOM   2113 C CA    . SER A 1 267 ? -45.904 4.127   49.409  1.00 51.70  ? 293 SER A CA    1 
ATOM   2114 C C     . SER A 1 267 ? -45.323 5.215   48.511  1.00 55.30  ? 293 SER A C     1 
ATOM   2115 O O     . SER A 1 267 ? -44.144 5.177   48.158  1.00 57.00  ? 293 SER A O     1 
ATOM   2116 C CB    . SER A 1 267 ? -45.945 4.598   50.865  1.00 63.17  ? 293 SER A CB    1 
ATOM   2117 O OG    . SER A 1 267 ? -44.638 4.750   51.393  1.00 74.18  ? 293 SER A OG    1 
ATOM   2118 N N     . ASN A 1 268 ? -46.159 6.179   48.139  1.00 57.04  ? 294 ASN A N     1 
ATOM   2119 C CA    . ASN A 1 268 ? -45.724 7.284   47.293  1.00 56.19  ? 294 ASN A CA    1 
ATOM   2120 C C     . ASN A 1 268 ? -44.971 8.353   48.078  1.00 53.93  ? 294 ASN A C     1 
ATOM   2121 O O     . ASN A 1 268 ? -45.415 9.499   48.172  1.00 46.63  ? 294 ASN A O     1 
ATOM   2122 C CB    . ASN A 1 268 ? -46.916 7.906   46.563  1.00 67.34  ? 294 ASN A CB    1 
ATOM   2123 C CG    . ASN A 1 268 ? -47.486 6.996   45.494  1.00 69.68  ? 294 ASN A CG    1 
ATOM   2124 O OD1   . ASN A 1 268 ? -46.820 6.068   45.032  1.00 53.91  ? 294 ASN A OD1   1 
ATOM   2125 N ND2   . ASN A 1 268 ? -48.723 7.260   45.090  1.00 79.39  ? 294 ASN A ND2   1 
ATOM   2126 N N     . THR A 1 269 ? -43.834 7.967   48.646  1.00 49.50  ? 295 THR A N     1 
ATOM   2127 C CA    . THR A 1 269 ? -42.987 8.895   49.382  1.00 44.64  ? 295 THR A CA    1 
ATOM   2128 C C     . THR A 1 269 ? -41.648 9.047   48.678  1.00 51.98  ? 295 THR A C     1 
ATOM   2129 O O     . THR A 1 269 ? -41.142 8.098   48.082  1.00 67.52  ? 295 THR A O     1 
ATOM   2130 C CB    . THR A 1 269 ? -42.735 8.414   50.823  1.00 50.82  ? 295 THR A CB    1 
ATOM   2131 O OG1   . THR A 1 269 ? -42.151 7.105   50.796  1.00 48.53  ? 295 THR A OG1   1 
ATOM   2132 C CG2   . THR A 1 269 ? -44.036 8.366   51.606  1.00 67.42  ? 295 THR A CG2   1 
ATOM   2133 N N     . TYR A 1 270 ? -41.078 10.244  48.747  1.00 48.55  ? 296 TYR A N     1 
ATOM   2134 C CA    . TYR A 1 270 ? -39.777 10.495  48.144  1.00 34.58  ? 296 TYR A CA    1 
ATOM   2135 C C     . TYR A 1 270 ? -38.744 9.491   48.640  1.00 40.68  ? 296 TYR A C     1 
ATOM   2136 O O     . TYR A 1 270 ? -37.962 8.953   47.858  1.00 58.29  ? 296 TYR A O     1 
ATOM   2137 C CB    . TYR A 1 270 ? -39.306 11.918  48.450  1.00 34.64  ? 296 TYR A CB    1 
ATOM   2138 C CG    . TYR A 1 270 ? -37.857 12.167  48.100  1.00 39.04  ? 296 TYR A CG    1 
ATOM   2139 C CD1   . TYR A 1 270 ? -37.480 12.465  46.797  1.00 54.06  ? 296 TYR A CD1   1 
ATOM   2140 C CD2   . TYR A 1 270 ? -36.866 12.102  49.071  1.00 36.74  ? 296 TYR A CD2   1 
ATOM   2141 C CE1   . TYR A 1 270 ? -36.156 12.690  46.471  1.00 59.09  ? 296 TYR A CE1   1 
ATOM   2142 C CE2   . TYR A 1 270 ? -35.539 12.326  48.754  1.00 49.94  ? 296 TYR A CE2   1 
ATOM   2143 C CZ    . TYR A 1 270 ? -35.190 12.619  47.452  1.00 56.99  ? 296 TYR A CZ    1 
ATOM   2144 O OH    . TYR A 1 270 ? -33.872 12.843  47.129  1.00 58.79  ? 296 TYR A OH    1 
ATOM   2145 N N     . GLU A 1 271 ? -38.755 9.236   49.945  1.00 37.37  ? 297 GLU A N     1 
ATOM   2146 C CA    . GLU A 1 271 ? -37.759 8.370   50.568  1.00 35.06  ? 297 GLU A CA    1 
ATOM   2147 C C     . GLU A 1 271 ? -37.845 6.919   50.092  1.00 46.25  ? 297 GLU A C     1 
ATOM   2148 O O     . GLU A 1 271 ? -36.834 6.319   49.722  1.00 50.09  ? 297 GLU A O     1 
ATOM   2149 C CB    . GLU A 1 271 ? -37.865 8.438   52.095  1.00 24.54  ? 297 GLU A CB    1 
ATOM   2150 C CG    . GLU A 1 271 ? -37.477 9.788   52.698  1.00 25.22  ? 297 GLU A CG    1 
ATOM   2151 C CD    . GLU A 1 271 ? -38.544 10.855  52.512  1.00 45.02  ? 297 GLU A CD    1 
ATOM   2152 O OE1   . GLU A 1 271 ? -39.708 10.498  52.232  1.00 56.52  ? 297 GLU A OE1   1 
ATOM   2153 O OE2   . GLU A 1 271 ? -38.219 12.054  52.655  1.00 40.65  ? 297 GLU A OE2   1 
ATOM   2154 N N     . GLU A 1 272 ? -39.051 6.359   50.099  1.00 45.65  ? 298 GLU A N     1 
ATOM   2155 C CA    . GLU A 1 272 ? -39.237 4.955   49.746  1.00 59.95  ? 298 GLU A CA    1 
ATOM   2156 C C     . GLU A 1 272 ? -39.193 4.725   48.237  1.00 55.36  ? 298 GLU A C     1 
ATOM   2157 O O     . GLU A 1 272 ? -38.775 3.663   47.775  1.00 53.53  ? 298 GLU A O     1 
ATOM   2158 C CB    . GLU A 1 272 ? -40.548 4.422   50.331  1.00 67.32  ? 298 GLU A CB    1 
ATOM   2159 C CG    . GLU A 1 272 ? -40.751 2.928   50.138  1.00 76.94  ? 298 GLU A CG    1 
ATOM   2160 C CD    . GLU A 1 272 ? -41.961 2.406   50.885  1.00 91.88  ? 298 GLU A CD    1 
ATOM   2161 O OE1   . GLU A 1 272 ? -42.398 1.272   50.593  1.00 99.26  ? 298 GLU A OE1   1 
ATOM   2162 O OE2   . GLU A 1 272 ? -42.477 3.129   51.764  1.00 90.62  ? 298 GLU A OE2   1 
ATOM   2163 N N     . ALA A 1 273 ? -39.623 5.725   47.474  1.00 40.72  ? 299 ALA A N     1 
ATOM   2164 C CA    . ALA A 1 273 ? -39.618 5.627   46.019  1.00 43.70  ? 299 ALA A CA    1 
ATOM   2165 C C     . ALA A 1 273 ? -38.204 5.756   45.459  1.00 48.29  ? 299 ALA A C     1 
ATOM   2166 O O     . ALA A 1 273 ? -37.791 4.973   44.602  1.00 45.56  ? 299 ALA A O     1 
ATOM   2167 C CB    . ALA A 1 273 ? -40.531 6.680   45.410  1.00 31.37  ? 299 ALA A CB    1 
ATOM   2168 N N     . ALA A 1 274 ? -37.467 6.750   45.947  1.00 46.20  ? 300 ALA A N     1 
ATOM   2169 C CA    . ALA A 1 274 ? -36.099 6.978   45.499  1.00 37.37  ? 300 ALA A CA    1 
ATOM   2170 C C     . ALA A 1 274 ? -35.228 5.766   45.798  1.00 46.76  ? 300 ALA A C     1 
ATOM   2171 O O     . ALA A 1 274 ? -34.414 5.354   44.970  1.00 59.89  ? 300 ALA A O     1 
ATOM   2172 C CB    . ALA A 1 274 ? -35.523 8.220   46.158  1.00 24.12  ? 300 ALA A CB    1 
ATOM   2173 N N     . ALA A 1 275 ? -35.405 5.197   46.986  1.00 39.42  ? 301 ALA A N     1 
ATOM   2174 C CA    . ALA A 1 275 ? -34.675 3.998   47.371  1.00 35.28  ? 301 ALA A CA    1 
ATOM   2175 C C     . ALA A 1 275 ? -35.002 2.854   46.418  1.00 45.13  ? 301 ALA A C     1 
ATOM   2176 O O     . ALA A 1 275 ? -34.142 2.034   46.098  1.00 54.40  ? 301 ALA A O     1 
ATOM   2177 C CB    . ALA A 1 275 ? -35.009 3.612   48.801  1.00 31.84  ? 301 ALA A CB    1 
ATOM   2178 N N     . TYR A 1 276 ? -36.251 2.811   45.963  1.00 45.43  ? 302 TYR A N     1 
ATOM   2179 C CA    . TYR A 1 276 ? -36.694 1.785   45.027  1.00 38.86  ? 302 TYR A CA    1 
ATOM   2180 C C     . TYR A 1 276 ? -36.016 1.948   43.672  1.00 38.33  ? 302 TYR A C     1 
ATOM   2181 O O     . TYR A 1 276 ? -35.448 0.996   43.133  1.00 36.49  ? 302 TYR A O     1 
ATOM   2182 C CB    . TYR A 1 276 ? -38.213 1.836   44.867  1.00 37.42  ? 302 TYR A CB    1 
ATOM   2183 C CG    . TYR A 1 276 ? -38.781 0.769   43.959  1.00 45.61  ? 302 TYR A CG    1 
ATOM   2184 C CD1   . TYR A 1 276 ? -38.965 -0.530  44.413  1.00 46.64  ? 302 TYR A CD1   1 
ATOM   2185 C CD2   . TYR A 1 276 ? -39.145 1.063   42.651  1.00 60.94  ? 302 TYR A CD2   1 
ATOM   2186 C CE1   . TYR A 1 276 ? -39.489 -1.509  43.589  1.00 61.98  ? 302 TYR A CE1   1 
ATOM   2187 C CE2   . TYR A 1 276 ? -39.671 0.092   41.818  1.00 67.42  ? 302 TYR A CE2   1 
ATOM   2188 C CZ    . TYR A 1 276 ? -39.841 -1.194  42.292  1.00 76.45  ? 302 TYR A CZ    1 
ATOM   2189 O OH    . TYR A 1 276 ? -40.363 -2.167  41.469  1.00 82.17  ? 302 TYR A OH    1 
ATOM   2190 N N     . ILE A 1 277 ? -36.077 3.159   43.126  1.00 30.40  ? 303 ILE A N     1 
ATOM   2191 C CA    . ILE A 1 277 ? -35.449 3.452   41.843  1.00 33.59  ? 303 ILE A CA    1 
ATOM   2192 C C     . ILE A 1 277 ? -33.979 3.054   41.856  1.00 45.49  ? 303 ILE A C     1 
ATOM   2193 O O     . ILE A 1 277 ? -33.495 2.402   40.931  1.00 65.09  ? 303 ILE A O     1 
ATOM   2194 C CB    . ILE A 1 277 ? -35.567 4.941   41.475  1.00 25.30  ? 303 ILE A CB    1 
ATOM   2195 C CG1   . ILE A 1 277 ? -37.030 5.313   41.230  1.00 19.74  ? 303 ILE A CG1   1 
ATOM   2196 C CG2   . ILE A 1 277 ? -34.735 5.250   40.242  1.00 17.09  ? 303 ILE A CG2   1 
ATOM   2197 C CD1   . ILE A 1 277 ? -37.228 6.754   40.811  1.00 12.84  ? 303 ILE A CD1   1 
ATOM   2198 N N     . GLN A 1 278 ? -33.274 3.450   42.910  1.00 34.59  ? 304 GLN A N     1 
ATOM   2199 C CA    . GLN A 1 278 ? -31.875 3.080   43.072  1.00 44.43  ? 304 GLN A CA    1 
ATOM   2200 C C     . GLN A 1 278 ? -31.685 1.575   42.907  1.00 52.99  ? 304 GLN A C     1 
ATOM   2201 O O     . GLN A 1 278 ? -30.776 1.127   42.210  1.00 62.09  ? 304 GLN A O     1 
ATOM   2202 C CB    . GLN A 1 278 ? -31.356 3.524   44.442  1.00 48.61  ? 304 GLN A CB    1 
ATOM   2203 C CG    . GLN A 1 278 ? -29.965 3.003   44.773  1.00 52.06  ? 304 GLN A CG    1 
ATOM   2204 C CD    . GLN A 1 278 ? -29.508 3.390   46.167  1.00 48.54  ? 304 GLN A CD    1 
ATOM   2205 O OE1   . GLN A 1 278 ? -30.078 4.282   46.795  1.00 51.77  ? 304 GLN A OE1   1 
ATOM   2206 N NE2   . GLN A 1 278 ? -28.471 2.720   46.656  1.00 46.89  ? 304 GLN A NE2   1 
ATOM   2207 N N     . CYS A 1 279 ? -32.551 0.799   43.551  1.00 51.30  ? 305 CYS A N     1 
ATOM   2208 C CA    . CYS A 1 279 ? -32.454 -0.654  43.500  1.00 52.15  ? 305 CYS A CA    1 
ATOM   2209 C C     . CYS A 1 279 ? -32.678 -1.184  42.091  1.00 50.68  ? 305 CYS A C     1 
ATOM   2210 O O     . CYS A 1 279 ? -32.025 -2.136  41.669  1.00 53.84  ? 305 CYS A O     1 
ATOM   2211 C CB    . CYS A 1 279 ? -33.442 -1.298  44.474  1.00 59.72  ? 305 CYS A CB    1 
ATOM   2212 S SG    . CYS A 1 279 ? -33.040 -1.027  46.215  1.00 87.27  ? 305 CYS A SG    1 
ATOM   2213 N N     . GLN A 1 280 ? -33.603 -0.564  41.365  1.00 47.05  ? 306 GLN A N     1 
ATOM   2214 C CA    . GLN A 1 280 ? -33.883 -0.967  39.992  1.00 45.76  ? 306 GLN A CA    1 
ATOM   2215 C C     . GLN A 1 280 ? -32.637 -0.845  39.125  1.00 50.06  ? 306 GLN A C     1 
ATOM   2216 O O     . GLN A 1 280 ? -32.386 -1.686  38.263  1.00 52.49  ? 306 GLN A O     1 
ATOM   2217 C CB    . GLN A 1 280 ? -35.021 -0.132  39.407  1.00 46.35  ? 306 GLN A CB    1 
ATOM   2218 C CG    . GLN A 1 280 ? -36.304 -0.231  40.201  1.00 46.24  ? 306 GLN A CG    1 
ATOM   2219 C CD    . GLN A 1 280 ? -36.662 -1.665  40.522  1.00 59.22  ? 306 GLN A CD    1 
ATOM   2220 O OE1   . GLN A 1 280 ? -36.713 -2.517  39.634  1.00 64.91  ? 306 GLN A OE1   1 
ATOM   2221 N NE2   . GLN A 1 280 ? -36.908 -1.942  41.797  1.00 64.61  ? 306 GLN A NE2   1 
ATOM   2222 N N     . PHE A 1 281 ? -31.860 0.208   39.362  1.00 46.30  ? 307 PHE A N     1 
ATOM   2223 C CA    . PHE A 1 281 ? -30.614 0.423   38.635  1.00 41.65  ? 307 PHE A CA    1 
ATOM   2224 C C     . PHE A 1 281 ? -29.509 -0.507  39.127  1.00 47.42  ? 307 PHE A C     1 
ATOM   2225 O O     . PHE A 1 281 ? -28.878 -1.205  38.335  1.00 47.85  ? 307 PHE A O     1 
ATOM   2226 C CB    . PHE A 1 281 ? -30.166 1.882   38.754  1.00 25.98  ? 307 PHE A CB    1 
ATOM   2227 C CG    . PHE A 1 281 ? -30.927 2.823   37.865  1.00 32.83  ? 307 PHE A CG    1 
ATOM   2228 C CD1   . PHE A 1 281 ? -32.164 3.314   38.249  1.00 42.11  ? 307 PHE A CD1   1 
ATOM   2229 C CD2   . PHE A 1 281 ? -30.405 3.216   36.643  1.00 41.51  ? 307 PHE A CD2   1 
ATOM   2230 C CE1   . PHE A 1 281 ? -32.865 4.180   37.429  1.00 51.89  ? 307 PHE A CE1   1 
ATOM   2231 C CE2   . PHE A 1 281 ? -31.100 4.081   35.819  1.00 39.03  ? 307 PHE A CE2   1 
ATOM   2232 C CZ    . PHE A 1 281 ? -32.332 4.564   36.213  1.00 48.27  ? 307 PHE A CZ    1 
ATOM   2233 N N     . GLU A 1 282 ? -29.283 -0.515  40.437  1.00 39.21  ? 308 GLU A N     1 
ATOM   2234 C CA    . GLU A 1 282 ? -28.230 -1.334  41.026  1.00 32.03  ? 308 GLU A CA    1 
ATOM   2235 C C     . GLU A 1 282 ? -28.429 -2.828  40.769  1.00 34.58  ? 308 GLU A C     1 
ATOM   2236 O O     . GLU A 1 282 ? -27.461 -3.586  40.709  1.00 42.80  ? 308 GLU A O     1 
ATOM   2237 C CB    . GLU A 1 282 ? -28.112 -1.065  42.529  1.00 39.12  ? 308 GLU A CB    1 
ATOM   2238 C CG    . GLU A 1 282 ? -27.549 0.307   42.870  1.00 49.03  ? 308 GLU A CG    1 
ATOM   2239 C CD    . GLU A 1 282 ? -27.331 0.496   44.361  1.00 66.29  ? 308 GLU A CD    1 
ATOM   2240 O OE1   . GLU A 1 282 ? -28.013 -0.185  45.156  1.00 76.01  ? 308 GLU A OE1   1 
ATOM   2241 O OE2   . GLU A 1 282 ? -26.478 1.329   44.737  1.00 65.82  ? 308 GLU A OE2   1 
ATOM   2242 N N     . ASP A 1 283 ? -29.680 -3.248  40.616  1.00 42.24  ? 309 ASP A N     1 
ATOM   2243 C CA    . ASP A 1 283 ? -29.981 -4.654  40.363  1.00 49.57  ? 309 ASP A CA    1 
ATOM   2244 C C     . ASP A 1 283 ? -29.681 -5.046  38.920  1.00 46.00  ? 309 ASP A C     1 
ATOM   2245 O O     . ASP A 1 283 ? -29.709 -6.227  38.571  1.00 44.17  ? 309 ASP A O     1 
ATOM   2246 C CB    . ASP A 1 283 ? -31.437 -4.973  40.710  1.00 55.80  ? 309 ASP A CB    1 
ATOM   2247 C CG    . ASP A 1 283 ? -31.691 -4.977  42.204  1.00 68.17  ? 309 ASP A CG    1 
ATOM   2248 O OD1   . ASP A 1 283 ? -30.730 -4.757  42.971  1.00 69.20  ? 309 ASP A OD1   1 
ATOM   2249 O OD2   . ASP A 1 283 ? -32.850 -5.202  42.612  1.00 69.47  ? 309 ASP A OD2   1 
ATOM   2250 N N     . LEU A 1 284 ? -29.395 -4.051  38.085  1.00 38.79  ? 310 LEU A N     1 
ATOM   2251 C CA    . LEU A 1 284 ? -29.028 -4.301  36.696  1.00 47.52  ? 310 LEU A CA    1 
ATOM   2252 C C     . LEU A 1 284 ? -27.569 -4.738  36.606  1.00 57.59  ? 310 LEU A C     1 
ATOM   2253 O O     . LEU A 1 284 ? -27.118 -5.231  35.571  1.00 73.62  ? 310 LEU A O     1 
ATOM   2254 C CB    . LEU A 1 284 ? -29.255 -3.054  35.841  1.00 41.34  ? 310 LEU A CB    1 
ATOM   2255 C CG    . LEU A 1 284 ? -30.705 -2.594  35.703  1.00 49.20  ? 310 LEU A CG    1 
ATOM   2256 C CD1   . LEU A 1 284 ? -30.793 -1.327  34.863  1.00 53.01  ? 310 LEU A CD1   1 
ATOM   2257 C CD2   . LEU A 1 284 ? -31.561 -3.702  35.107  1.00 42.31  ? 310 LEU A CD2   1 
ATOM   2258 N N     . ASN A 1 285 ? -26.838 -4.551  37.700  1.00 42.01  ? 311 ASN A N     1 
ATOM   2259 C CA    . ASN A 1 285 ? -25.446 -4.964  37.777  1.00 36.33  ? 311 ASN A CA    1 
ATOM   2260 C C     . ASN A 1 285 ? -25.328 -6.457  38.054  1.00 47.71  ? 311 ASN A C     1 
ATOM   2261 O O     . ASN A 1 285 ? -25.533 -6.903  39.184  1.00 55.75  ? 311 ASN A O     1 
ATOM   2262 C CB    . ASN A 1 285 ? -24.718 -4.171  38.860  1.00 44.60  ? 311 ASN A CB    1 
ATOM   2263 C CG    . ASN A 1 285 ? -23.269 -4.590  39.013  1.00 61.81  ? 311 ASN A CG    1 
ATOM   2264 O OD1   . ASN A 1 285 ? -22.678 -5.173  38.102  1.00 75.21  ? 311 ASN A OD1   1 
ATOM   2265 N ND2   . ASN A 1 285 ? -22.687 -4.290  40.168  1.00 46.75  ? 311 ASN A ND2   1 
ATOM   2266 N N     . LYS A 1 286 ? -24.996 -7.225  37.021  1.00 54.99  ? 312 LYS A N     1 
ATOM   2267 C CA    . LYS A 1 286 ? -24.884 -8.670  37.160  1.00 67.82  ? 312 LYS A CA    1 
ATOM   2268 C C     . LYS A 1 286 ? -23.531 -9.073  37.734  1.00 73.66  ? 312 LYS A C     1 
ATOM   2269 O O     . LYS A 1 286 ? -22.944 -10.077 37.331  1.00 66.01  ? 312 LYS A O     1 
ATOM   2270 C CB    . LYS A 1 286 ? -25.138 -9.358  35.819  1.00 76.25  ? 312 LYS A CB    1 
ATOM   2271 C CG    . LYS A 1 286 ? -26.553 -9.159  35.297  1.00 85.41  ? 312 LYS A CG    1 
ATOM   2272 C CD    . LYS A 1 286 ? -26.796 -9.941  34.019  1.00 84.52  ? 312 LYS A CD    1 
ATOM   2273 C CE    . LYS A 1 286 ? -25.815 -9.539  32.933  1.00 81.16  ? 312 LYS A CE    1 
ATOM   2274 N NZ    . LYS A 1 286 ? -26.048 -10.299 31.675  1.00 76.28  ? 312 LYS A NZ    1 
ATOM   2275 N N     . ARG A 1 287 ? -23.047 -8.280  38.685  1.00 86.80  ? 313 ARG A N     1 
ATOM   2276 C CA    . ARG A 1 287 ? -21.758 -8.523  39.321  1.00 92.08  ? 313 ARG A CA    1 
ATOM   2277 C C     . ARG A 1 287 ? -21.768 -8.051  40.772  1.00 102.16 ? 313 ARG A C     1 
ATOM   2278 O O     . ARG A 1 287 ? -21.151 -7.040  41.108  1.00 97.94  ? 313 ARG A O     1 
ATOM   2279 C CB    . ARG A 1 287 ? -20.645 -7.807  38.555  1.00 88.23  ? 313 ARG A CB    1 
ATOM   2280 C CG    . ARG A 1 287 ? -20.496 -8.247  37.110  1.00 88.88  ? 313 ARG A CG    1 
ATOM   2281 C CD    . ARG A 1 287 ? -19.466 -7.401  36.388  1.00 103.07 ? 313 ARG A CD    1 
ATOM   2282 N NE    . ARG A 1 287 ? -19.375 -7.741  34.972  1.00 119.15 ? 313 ARG A NE    1 
ATOM   2283 C CZ    . ARG A 1 287 ? -18.598 -7.107  34.101  1.00 124.88 ? 313 ARG A CZ    1 
ATOM   2284 N NH1   . ARG A 1 287 ? -17.841 -6.094  34.502  1.00 119.31 ? 313 ARG A NH1   1 
ATOM   2285 N NH2   . ARG A 1 287 ? -18.577 -7.484  32.829  1.00 128.81 ? 313 ARG A NH2   1 
ATOM   2286 N N     . LYS A 1 288 ? -22.471 -8.787  41.628  1.00 118.87 ? 314 LYS A N     1 
ATOM   2287 C CA    . LYS A 1 288 ? -22.549 -8.450  43.046  1.00 136.53 ? 314 LYS A CA    1 
ATOM   2288 C C     . LYS A 1 288 ? -21.164 -8.385  43.686  1.00 149.39 ? 314 LYS A C     1 
ATOM   2289 O O     . LYS A 1 288 ? -20.909 -7.548  44.552  1.00 150.05 ? 314 LYS A O     1 
ATOM   2290 C CB    . LYS A 1 288 ? -23.415 -9.468  43.792  1.00 140.19 ? 314 LYS A CB    1 
ATOM   2291 C CG    . LYS A 1 288 ? -24.879 -9.475  43.381  1.00 134.64 ? 314 LYS A CG    1 
ATOM   2292 C CD    . LYS A 1 288 ? -25.645 -10.578 44.097  1.00 123.53 ? 314 LYS A CD    1 
ATOM   2293 C CE    . LYS A 1 288 ? -25.508 -10.460 45.607  1.00 112.97 ? 314 LYS A CE    1 
ATOM   2294 N NZ    . LYS A 1 288 ? -26.220 -11.558 46.318  1.00 105.61 ? 314 LYS A NZ    1 
ATOM   2295 N N     . ASP A 1 289 ? -20.275 -9.272  43.252  1.00 157.30 ? 315 ASP A N     1 
ATOM   2296 C CA    . ASP A 1 289 ? -18.942 -9.380  43.837  1.00 155.58 ? 315 ASP A CA    1 
ATOM   2297 C C     . ASP A 1 289 ? -17.952 -8.409  43.199  1.00 143.47 ? 315 ASP A C     1 
ATOM   2298 O O     . ASP A 1 289 ? -17.304 -7.623  43.892  1.00 136.14 ? 315 ASP A O     1 
ATOM   2299 C CB    . ASP A 1 289 ? -18.421 -10.814 43.706  1.00 162.78 ? 315 ASP A CB    1 
ATOM   2300 C CG    . ASP A 1 289 ? -19.374 -11.838 44.294  1.00 167.87 ? 315 ASP A CG    1 
ATOM   2301 O OD1   . ASP A 1 289 ? -20.322 -11.436 45.001  1.00 169.43 ? 315 ASP A OD1   1 
ATOM   2302 O OD2   . ASP A 1 289 ? -19.173 -13.046 44.048  1.00 169.78 ? 315 ASP A OD2   1 
ATOM   2303 N N     . THR A 1 290 ? -17.838 -8.472  41.876  1.00 138.73 ? 316 THR A N     1 
ATOM   2304 C CA    . THR A 1 290 ? -16.890 -7.640  41.142  1.00 134.66 ? 316 THR A CA    1 
ATOM   2305 C C     . THR A 1 290 ? -17.208 -6.154  41.275  1.00 129.53 ? 316 THR A C     1 
ATOM   2306 O O     . THR A 1 290 ? -16.585 -5.442  42.065  1.00 128.24 ? 316 THR A O     1 
ATOM   2307 C CB    . THR A 1 290 ? -16.863 -8.010  39.645  1.00 133.13 ? 316 THR A CB    1 
ATOM   2308 O OG1   . THR A 1 290 ? -16.579 -9.407  39.499  1.00 132.41 ? 316 THR A OG1   1 
ATOM   2309 C CG2   . THR A 1 290 ? -15.803 -7.200  38.911  1.00 129.87 ? 316 THR A CG2   1 
ATOM   2310 N N     . LYS A 1 291 ? -18.182 -5.694  40.496  1.00 121.45 ? 317 LYS A N     1 
ATOM   2311 C CA    . LYS A 1 291 ? -18.549 -4.282  40.464  1.00 110.86 ? 317 LYS A CA    1 
ATOM   2312 C C     . LYS A 1 291 ? -19.031 -3.761  41.815  1.00 102.18 ? 317 LYS A C     1 
ATOM   2313 O O     . LYS A 1 291 ? -19.514 -4.520  42.655  1.00 104.97 ? 317 LYS A O     1 
ATOM   2314 C CB    . LYS A 1 291 ? -19.619 -4.033  39.397  1.00 110.45 ? 317 LYS A CB    1 
ATOM   2315 C CG    . LYS A 1 291 ? -19.093 -4.047  37.971  1.00 104.22 ? 317 LYS A CG    1 
ATOM   2316 C CD    . LYS A 1 291 ? -18.134 -2.892  37.735  1.00 96.80  ? 317 LYS A CD    1 
ATOM   2317 C CE    . LYS A 1 291 ? -17.641 -2.861  36.300  1.00 81.72  ? 317 LYS A CE    1 
ATOM   2318 N NZ    . LYS A 1 291 ? -16.739 -1.702  36.064  1.00 68.08  ? 317 LYS A NZ    1 
ATOM   2319 N N     . GLU A 1 292 ? -18.892 -2.454  42.010  1.00 94.43  ? 318 GLU A N     1 
ATOM   2320 C CA    . GLU A 1 292 ? -19.347 -1.796  43.226  1.00 86.12  ? 318 GLU A CA    1 
ATOM   2321 C C     . GLU A 1 292 ? -19.804 -0.385  42.872  1.00 76.98  ? 318 GLU A C     1 
ATOM   2322 O O     . GLU A 1 292 ? -18.990 0.531   42.763  1.00 92.03  ? 318 GLU A O     1 
ATOM   2323 C CB    . GLU A 1 292 ? -18.221 -1.753  44.262  1.00 97.45  ? 318 GLU A CB    1 
ATOM   2324 C CG    . GLU A 1 292 ? -18.689 -1.848  45.708  1.00 112.81 ? 318 GLU A CG    1 
ATOM   2325 C CD    . GLU A 1 292 ? -19.469 -0.628  46.159  1.00 124.66 ? 318 GLU A CD    1 
ATOM   2326 O OE1   . GLU A 1 292 ? -19.205 0.476   45.640  1.00 137.40 ? 318 GLU A OE1   1 
ATOM   2327 O OE2   . GLU A 1 292 ? -20.342 -0.772  47.041  1.00 119.59 ? 318 GLU A OE2   1 
ATOM   2328 N N     . ILE A 1 293 ? -21.109 -0.218  42.686  1.00 54.67  ? 319 ILE A N     1 
ATOM   2329 C CA    . ILE A 1 293 ? -21.665 1.049   42.221  1.00 46.70  ? 319 ILE A CA    1 
ATOM   2330 C C     . ILE A 1 293 ? -21.781 2.098   43.327  1.00 49.72  ? 319 ILE A C     1 
ATOM   2331 O O     . ILE A 1 293 ? -22.279 1.816   44.418  1.00 60.03  ? 319 ILE A O     1 
ATOM   2332 C CB    . ILE A 1 293 ? -23.047 0.844   41.578  1.00 49.98  ? 319 ILE A CB    1 
ATOM   2333 C CG1   . ILE A 1 293 ? -22.962 -0.207  40.469  1.00 50.11  ? 319 ILE A CG1   1 
ATOM   2334 C CG2   . ILE A 1 293 ? -23.588 2.162   41.042  1.00 46.12  ? 319 ILE A CG2   1 
ATOM   2335 C CD1   . ILE A 1 293 ? -24.289 -0.509  39.814  1.00 50.60  ? 319 ILE A CD1   1 
ATOM   2336 N N     . TYR A 1 294 ? -21.321 3.310   43.030  1.00 36.18  ? 320 TYR A N     1 
ATOM   2337 C CA    . TYR A 1 294 ? -21.378 4.414   43.982  1.00 35.49  ? 320 TYR A CA    1 
ATOM   2338 C C     . TYR A 1 294 ? -22.528 5.356   43.635  1.00 48.75  ? 320 TYR A C     1 
ATOM   2339 O O     . TYR A 1 294 ? -22.398 6.214   42.762  1.00 71.13  ? 320 TYR A O     1 
ATOM   2340 C CB    . TYR A 1 294 ? -20.055 5.186   43.987  1.00 43.81  ? 320 TYR A CB    1 
ATOM   2341 C CG    . TYR A 1 294 ? -18.824 4.314   44.140  1.00 51.13  ? 320 TYR A CG    1 
ATOM   2342 C CD1   . TYR A 1 294 ? -18.405 3.883   45.391  1.00 58.54  ? 320 TYR A CD1   1 
ATOM   2343 C CD2   . TYR A 1 294 ? -18.078 3.931   43.033  1.00 60.03  ? 320 TYR A CD2   1 
ATOM   2344 C CE1   . TYR A 1 294 ? -17.280 3.088   45.535  1.00 70.31  ? 320 TYR A CE1   1 
ATOM   2345 C CE2   . TYR A 1 294 ? -16.952 3.137   43.166  1.00 60.27  ? 320 TYR A CE2   1 
ATOM   2346 C CZ    . TYR A 1 294 ? -16.557 2.719   44.419  1.00 64.77  ? 320 TYR A CZ    1 
ATOM   2347 O OH    . TYR A 1 294 ? -15.437 1.929   44.558  1.00 57.03  ? 320 TYR A OH    1 
ATOM   2348 N N     . THR A 1 295 ? -23.651 5.196   44.326  1.00 43.00  ? 321 THR A N     1 
ATOM   2349 C CA    . THR A 1 295 ? -24.854 5.971   44.037  1.00 31.94  ? 321 THR A CA    1 
ATOM   2350 C C     . THR A 1 295 ? -24.922 7.275   44.834  1.00 35.00  ? 321 THR A C     1 
ATOM   2351 O O     . THR A 1 295 ? -24.454 7.345   45.972  1.00 34.44  ? 321 THR A O     1 
ATOM   2352 C CB    . THR A 1 295 ? -26.121 5.144   44.321  1.00 35.08  ? 321 THR A CB    1 
ATOM   2353 O OG1   . THR A 1 295 ? -26.038 3.890   43.633  1.00 41.32  ? 321 THR A OG1   1 
ATOM   2354 C CG2   . THR A 1 295 ? -27.367 5.891   43.867  1.00 37.54  ? 321 THR A CG2   1 
ATOM   2355 N N     . HIS A 1 296 ? -25.513 8.302   44.228  1.00 26.77  ? 322 HIS A N     1 
ATOM   2356 C CA    . HIS A 1 296 ? -25.678 9.601   44.875  1.00 24.25  ? 322 HIS A CA    1 
ATOM   2357 C C     . HIS A 1 296 ? -26.976 10.268  44.432  1.00 32.44  ? 322 HIS A C     1 
ATOM   2358 O O     . HIS A 1 296 ? -27.281 10.319  43.241  1.00 46.31  ? 322 HIS A O     1 
ATOM   2359 C CB    . HIS A 1 296 ? -24.498 10.519  44.551  1.00 31.18  ? 322 HIS A CB    1 
ATOM   2360 C CG    . HIS A 1 296 ? -23.179 10.008  45.039  1.00 51.74  ? 322 HIS A CG    1 
ATOM   2361 N ND1   . HIS A 1 296 ? -22.653 10.356  46.265  1.00 54.92  ? 322 HIS A ND1   1 
ATOM   2362 C CD2   . HIS A 1 296 ? -22.276 9.178   44.465  1.00 55.29  ? 322 HIS A CD2   1 
ATOM   2363 C CE1   . HIS A 1 296 ? -21.484 9.761   46.425  1.00 47.20  ? 322 HIS A CE1   1 
ATOM   2364 N NE2   . HIS A 1 296 ? -21.232 9.041   45.347  1.00 56.65  ? 322 HIS A NE2   1 
ATOM   2365 N N     . PHE A 1 297 ? -27.738 10.779  45.392  1.00 32.99  ? 323 PHE A N     1 
ATOM   2366 C CA    . PHE A 1 297 ? -28.968 11.499  45.081  1.00 40.64  ? 323 PHE A CA    1 
ATOM   2367 C C     . PHE A 1 297 ? -28.691 12.994  45.027  1.00 42.63  ? 323 PHE A C     1 
ATOM   2368 O O     . PHE A 1 297 ? -28.620 13.663  46.059  1.00 62.22  ? 323 PHE A O     1 
ATOM   2369 C CB    . PHE A 1 297 ? -30.051 11.189  46.112  1.00 35.99  ? 323 PHE A CB    1 
ATOM   2370 C CG    . PHE A 1 297 ? -30.499 9.756   46.103  1.00 30.60  ? 323 PHE A CG    1 
ATOM   2371 C CD1   . PHE A 1 297 ? -29.766 8.783   46.762  1.00 35.20  ? 323 PHE A CD1   1 
ATOM   2372 C CD2   . PHE A 1 297 ? -31.653 9.380   45.434  1.00 29.61  ? 323 PHE A CD2   1 
ATOM   2373 C CE1   . PHE A 1 297 ? -30.175 7.462   46.755  1.00 39.37  ? 323 PHE A CE1   1 
ATOM   2374 C CE2   . PHE A 1 297 ? -32.068 8.061   45.424  1.00 25.01  ? 323 PHE A CE2   1 
ATOM   2375 C CZ    . PHE A 1 297 ? -31.328 7.101   46.085  1.00 33.43  ? 323 PHE A CZ    1 
ATOM   2376 N N     . THR A 1 298 ? -28.541 13.513  43.814  1.00 27.26  ? 324 THR A N     1 
ATOM   2377 C CA    . THR A 1 298 ? -28.064 14.877  43.626  1.00 37.72  ? 324 THR A CA    1 
ATOM   2378 C C     . THR A 1 298 ? -29.096 15.831  43.034  1.00 38.61  ? 324 THR A C     1 
ATOM   2379 O O     . THR A 1 298 ? -30.102 15.414  42.457  1.00 34.59  ? 324 THR A O     1 
ATOM   2380 C CB    . THR A 1 298 ? -26.826 14.900  42.714  1.00 32.82  ? 324 THR A CB    1 
ATOM   2381 O OG1   . THR A 1 298 ? -27.181 14.413  41.413  1.00 29.97  ? 324 THR A OG1   1 
ATOM   2382 C CG2   . THR A 1 298 ? -25.723 14.029  43.296  1.00 28.79  ? 324 THR A CG2   1 
ATOM   2383 N N     . CYS A 1 299 ? -28.826 17.122  43.196  1.00 31.17  ? 325 CYS A N     1 
ATOM   2384 C CA    . CYS A 1 299 ? -29.559 18.174  42.508  1.00 31.29  ? 325 CYS A CA    1 
ATOM   2385 C C     . CYS A 1 299 ? -28.541 19.020  41.749  1.00 38.92  ? 325 CYS A C     1 
ATOM   2386 O O     . CYS A 1 299 ? -27.932 19.928  42.312  1.00 40.22  ? 325 CYS A O     1 
ATOM   2387 C CB    . CYS A 1 299 ? -30.336 19.035  43.501  1.00 19.80  ? 325 CYS A CB    1 
ATOM   2388 S SG    . CYS A 1 299 ? -31.249 20.404  42.749  1.00 41.62  ? 325 CYS A SG    1 
ATOM   2389 N N     . ALA A 1 300 ? -28.360 18.705  40.469  1.00 28.73  ? 326 ALA A N     1 
ATOM   2390 C CA    . ALA A 1 300 ? -27.286 19.282  39.663  1.00 27.12  ? 326 ALA A CA    1 
ATOM   2391 C C     . ALA A 1 300 ? -27.253 20.810  39.665  1.00 36.66  ? 326 ALA A C     1 
ATOM   2392 O O     . ALA A 1 300 ? -26.212 21.414  39.405  1.00 44.49  ? 326 ALA A O     1 
ATOM   2393 C CB    . ALA A 1 300 ? -27.355 18.755  38.239  1.00 30.58  ? 326 ALA A CB    1 
ATOM   2394 N N     . THR A 1 301 ? -28.388 21.433  39.955  1.00 30.33  ? 327 THR A N     1 
ATOM   2395 C CA    . THR A 1 301 ? -28.468 22.887  39.951  1.00 32.89  ? 327 THR A CA    1 
ATOM   2396 C C     . THR A 1 301 ? -28.104 23.468  41.314  1.00 48.25  ? 327 THR A C     1 
ATOM   2397 O O     . THR A 1 301 ? -27.774 24.648  41.430  1.00 59.50  ? 327 THR A O     1 
ATOM   2398 C CB    . THR A 1 301 ? -29.866 23.370  39.527  1.00 32.82  ? 327 THR A CB    1 
ATOM   2399 O OG1   . THR A 1 301 ? -30.860 22.742  40.348  1.00 37.33  ? 327 THR A OG1   1 
ATOM   2400 C CG2   . THR A 1 301 ? -30.124 23.011  38.073  1.00 28.69  ? 327 THR A CG2   1 
ATOM   2401 N N     . ASP A 1 302 ? -28.163 22.629  42.342  1.00 45.29  ? 328 ASP A N     1 
ATOM   2402 C CA    . ASP A 1 302 ? -27.795 23.039  43.690  1.00 41.35  ? 328 ASP A CA    1 
ATOM   2403 C C     . ASP A 1 302 ? -26.284 22.946  43.862  1.00 37.16  ? 328 ASP A C     1 
ATOM   2404 O O     . ASP A 1 302 ? -25.737 21.857  44.042  1.00 40.55  ? 328 ASP A O     1 
ATOM   2405 C CB    . ASP A 1 302 ? -28.502 22.163  44.727  1.00 41.66  ? 328 ASP A CB    1 
ATOM   2406 C CG    . ASP A 1 302 ? -28.272 22.636  46.150  1.00 40.68  ? 328 ASP A CG    1 
ATOM   2407 O OD1   . ASP A 1 302 ? -27.691 23.726  46.333  1.00 45.27  ? 328 ASP A OD1   1 
ATOM   2408 O OD2   . ASP A 1 302 ? -28.677 21.916  47.087  1.00 48.50  ? 328 ASP A OD2   1 
ATOM   2409 N N     . THR A 1 303 ? -25.613 24.091  43.799  1.00 30.70  ? 329 THR A N     1 
ATOM   2410 C CA    . THR A 1 303 ? -24.159 24.125  43.906  1.00 35.92  ? 329 THR A CA    1 
ATOM   2411 C C     . THR A 1 303 ? -23.679 23.488  45.203  1.00 41.17  ? 329 THR A C     1 
ATOM   2412 O O     . THR A 1 303 ? -22.882 22.551  45.185  1.00 43.52  ? 329 THR A O     1 
ATOM   2413 C CB    . THR A 1 303 ? -23.617 25.560  43.822  1.00 27.35  ? 329 THR A CB    1 
ATOM   2414 O OG1   . THR A 1 303 ? -23.837 26.079  42.504  1.00 29.18  ? 329 THR A OG1   1 
ATOM   2415 C CG2   . THR A 1 303 ? -22.125 25.579  44.127  1.00 20.47  ? 329 THR A CG2   1 
ATOM   2416 N N     . LYS A 1 304 ? -24.169 24.005  46.324  1.00 44.58  ? 330 LYS A N     1 
ATOM   2417 C CA    . LYS A 1 304 ? -23.816 23.473  47.633  1.00 44.37  ? 330 LYS A CA    1 
ATOM   2418 C C     . LYS A 1 304 ? -23.840 21.949  47.614  1.00 26.02  ? 330 LYS A C     1 
ATOM   2419 O O     . LYS A 1 304 ? -22.877 21.297  48.017  1.00 39.50  ? 330 LYS A O     1 
ATOM   2420 C CB    . LYS A 1 304 ? -24.771 24.007  48.703  1.00 62.70  ? 330 LYS A CB    1 
ATOM   2421 C CG    . LYS A 1 304 ? -24.473 23.509  50.108  1.00 84.27  ? 330 LYS A CG    1 
ATOM   2422 C CD    . LYS A 1 304 ? -25.532 23.971  51.098  1.00 92.26  ? 330 LYS A CD    1 
ATOM   2423 C CE    . LYS A 1 304 ? -25.264 23.420  52.491  1.00 89.63  ? 330 LYS A CE    1 
ATOM   2424 N NZ    . LYS A 1 304 ? -26.330 23.799  53.460  1.00 81.86  ? 330 LYS A NZ    1 
ATOM   2425 N N     . ASN A 1 305 ? -24.944 21.386  47.135  1.00 22.83  ? 331 ASN A N     1 
ATOM   2426 C CA    . ASN A 1 305 ? -25.077 19.940  47.019  1.00 28.49  ? 331 ASN A CA    1 
ATOM   2427 C C     . ASN A 1 305 ? -23.953 19.345  46.182  1.00 30.07  ? 331 ASN A C     1 
ATOM   2428 O O     . ASN A 1 305 ? -23.128 18.585  46.689  1.00 21.70  ? 331 ASN A O     1 
ATOM   2429 C CB    . ASN A 1 305 ? -26.431 19.572  46.409  1.00 42.59  ? 331 ASN A CB    1 
ATOM   2430 C CG    . ASN A 1 305 ? -26.637 18.071  46.305  1.00 51.14  ? 331 ASN A CG    1 
ATOM   2431 O OD1   . ASN A 1 305 ? -27.073 17.565  45.272  1.00 63.40  ? 331 ASN A OD1   1 
ATOM   2432 N ND2   . ASN A 1 305 ? -26.321 17.353  47.376  1.00 45.32  ? 331 ASN A ND2   1 
ATOM   2433 N N     . VAL A 1 306 ? -23.926 19.702  44.901  1.00 36.03  ? 332 VAL A N     1 
ATOM   2434 C CA    . VAL A 1 306 ? -22.917 19.195  43.977  1.00 37.55  ? 332 VAL A CA    1 
ATOM   2435 C C     . VAL A 1 306 ? -21.516 19.238  44.579  1.00 38.33  ? 332 VAL A C     1 
ATOM   2436 O O     . VAL A 1 306 ? -20.767 18.265  44.496  1.00 38.80  ? 332 VAL A O     1 
ATOM   2437 C CB    . VAL A 1 306 ? -22.920 19.973  42.647  1.00 31.89  ? 332 VAL A CB    1 
ATOM   2438 C CG1   . VAL A 1 306 ? -21.712 19.592  41.805  1.00 17.91  ? 332 VAL A CG1   1 
ATOM   2439 C CG2   . VAL A 1 306 ? -24.212 19.717  41.883  1.00 17.55  ? 332 VAL A CG2   1 
ATOM   2440 N N     . GLN A 1 307 ? -21.170 20.368  45.187  1.00 36.52  ? 333 GLN A N     1 
ATOM   2441 C CA    . GLN A 1 307 ? -19.865 20.522  45.818  1.00 30.78  ? 333 GLN A CA    1 
ATOM   2442 C C     . GLN A 1 307 ? -19.599 19.388  46.800  1.00 33.91  ? 333 GLN A C     1 
ATOM   2443 O O     . GLN A 1 307 ? -18.570 18.718  46.727  1.00 45.19  ? 333 GLN A O     1 
ATOM   2444 C CB    . GLN A 1 307 ? -19.769 21.866  46.539  1.00 19.72  ? 333 GLN A CB    1 
ATOM   2445 C CG    . GLN A 1 307 ? -18.430 22.103  47.212  1.00 34.49  ? 333 GLN A CG    1 
ATOM   2446 C CD    . GLN A 1 307 ? -18.345 23.455  47.887  1.00 47.82  ? 333 GLN A CD    1 
ATOM   2447 O OE1   . GLN A 1 307 ? -17.265 23.896  48.282  1.00 67.09  ? 333 GLN A OE1   1 
ATOM   2448 N NE2   . GLN A 1 307 ? -19.484 24.124  48.022  1.00 46.00  ? 333 GLN A NE2   1 
ATOM   2449 N N     . PHE A 1 308 ? -20.538 19.179  47.717  1.00 38.54  ? 334 PHE A N     1 
ATOM   2450 C CA    . PHE A 1 308 ? -20.423 18.115  48.705  1.00 36.48  ? 334 PHE A CA    1 
ATOM   2451 C C     . PHE A 1 308 ? -20.344 16.746  48.040  1.00 33.38  ? 334 PHE A C     1 
ATOM   2452 O O     . PHE A 1 308 ? -19.470 15.940  48.360  1.00 36.04  ? 334 PHE A O     1 
ATOM   2453 C CB    . PHE A 1 308 ? -21.605 18.157  49.674  1.00 40.51  ? 334 PHE A CB    1 
ATOM   2454 C CG    . PHE A 1 308 ? -21.624 17.019  50.654  1.00 44.12  ? 334 PHE A CG    1 
ATOM   2455 C CD1   . PHE A 1 308 ? -20.879 17.079  51.820  1.00 42.71  ? 334 PHE A CD1   1 
ATOM   2456 C CD2   . PHE A 1 308 ? -22.387 15.888  50.410  1.00 27.47  ? 334 PHE A CD2   1 
ATOM   2457 C CE1   . PHE A 1 308 ? -20.894 16.035  52.722  1.00 37.40  ? 334 PHE A CE1   1 
ATOM   2458 C CE2   . PHE A 1 308 ? -22.406 14.841  51.308  1.00 19.89  ? 334 PHE A CE2   1 
ATOM   2459 C CZ    . PHE A 1 308 ? -21.659 14.914  52.467  1.00 35.06  ? 334 PHE A CZ    1 
ATOM   2460 N N     . VAL A 1 309 ? -21.262 16.486  47.117  1.00 33.02  ? 335 VAL A N     1 
ATOM   2461 C CA    . VAL A 1 309 ? -21.285 15.210  46.417  1.00 33.91  ? 335 VAL A CA    1 
ATOM   2462 C C     . VAL A 1 309 ? -19.939 14.930  45.764  1.00 34.57  ? 335 VAL A C     1 
ATOM   2463 O O     . VAL A 1 309 ? -19.351 13.869  45.966  1.00 37.68  ? 335 VAL A O     1 
ATOM   2464 C CB    . VAL A 1 309 ? -22.380 15.171  45.337  1.00 25.61  ? 335 VAL A CB    1 
ATOM   2465 C CG1   . VAL A 1 309 ? -22.367 13.825  44.628  1.00 25.12  ? 335 VAL A CG1   1 
ATOM   2466 C CG2   . VAL A 1 309 ? -23.743 15.441  45.953  1.00 12.25  ? 335 VAL A CG2   1 
ATOM   2467 N N     . PHE A 1 310 ? -19.450 15.891  44.988  1.00 42.30  ? 336 PHE A N     1 
ATOM   2468 C CA    . PHE A 1 310 ? -18.200 15.713  44.261  1.00 47.78  ? 336 PHE A CA    1 
ATOM   2469 C C     . PHE A 1 310 ? -17.032 15.477  45.211  1.00 55.76  ? 336 PHE A C     1 
ATOM   2470 O O     . PHE A 1 310 ? -16.159 14.653  44.941  1.00 54.27  ? 336 PHE A O     1 
ATOM   2471 C CB    . PHE A 1 310 ? -17.915 16.916  43.366  1.00 25.02  ? 336 PHE A CB    1 
ATOM   2472 C CG    . PHE A 1 310 ? -16.819 16.676  42.375  1.00 25.86  ? 336 PHE A CG    1 
ATOM   2473 C CD1   . PHE A 1 310 ? -17.101 16.131  41.135  1.00 30.64  ? 336 PHE A CD1   1 
ATOM   2474 C CD2   . PHE A 1 310 ? -15.506 16.983  42.686  1.00 39.75  ? 336 PHE A CD2   1 
ATOM   2475 C CE1   . PHE A 1 310 ? -16.093 15.904  40.218  1.00 46.96  ? 336 PHE A CE1   1 
ATOM   2476 C CE2   . PHE A 1 310 ? -14.493 16.758  41.774  1.00 41.63  ? 336 PHE A CE2   1 
ATOM   2477 C CZ    . PHE A 1 310 ? -14.787 16.218  40.538  1.00 47.06  ? 336 PHE A CZ    1 
ATOM   2478 N N     . ASP A 1 311 ? -17.020 16.210  46.318  1.00 53.68  ? 337 ASP A N     1 
ATOM   2479 C CA    . ASP A 1 311 ? -16.010 16.017  47.349  1.00 49.78  ? 337 ASP A CA    1 
ATOM   2480 C C     . ASP A 1 311 ? -16.010 14.561  47.802  1.00 46.73  ? 337 ASP A C     1 
ATOM   2481 O O     . ASP A 1 311 ? -14.956 13.935  47.918  1.00 48.09  ? 337 ASP A O     1 
ATOM   2482 C CB    . ASP A 1 311 ? -16.280 16.939  48.538  1.00 58.12  ? 337 ASP A CB    1 
ATOM   2483 C CG    . ASP A 1 311 ? -15.255 16.783  49.643  1.00 70.07  ? 337 ASP A CG    1 
ATOM   2484 O OD1   . ASP A 1 311 ? -14.166 16.236  49.372  1.00 87.15  ? 337 ASP A OD1   1 
ATOM   2485 O OD2   . ASP A 1 311 ? -15.537 17.210  50.782  1.00 61.49  ? 337 ASP A OD2   1 
ATOM   2486 N N     . ALA A 1 312 ? -17.202 14.027  48.050  1.00 41.34  ? 338 ALA A N     1 
ATOM   2487 C CA    . ALA A 1 312 ? -17.356 12.634  48.452  1.00 34.58  ? 338 ALA A CA    1 
ATOM   2488 C C     . ALA A 1 312 ? -16.809 11.703  47.379  1.00 46.14  ? 338 ALA A C     1 
ATOM   2489 O O     . ALA A 1 312 ? -16.079 10.756  47.676  1.00 54.37  ? 338 ALA A O     1 
ATOM   2490 C CB    . ALA A 1 312 ? -18.814 12.321  48.728  1.00 26.02  ? 338 ALA A CB    1 
ATOM   2491 N N     . VAL A 1 313 ? -17.173 11.978  46.131  1.00 44.56  ? 339 VAL A N     1 
ATOM   2492 C CA    . VAL A 1 313 ? -16.691 11.198  45.000  1.00 41.28  ? 339 VAL A CA    1 
ATOM   2493 C C     . VAL A 1 313 ? -15.168 11.196  44.956  1.00 39.11  ? 339 VAL A C     1 
ATOM   2494 O O     . VAL A 1 313 ? -14.544 10.153  44.766  1.00 47.30  ? 339 VAL A O     1 
ATOM   2495 C CB    . VAL A 1 313 ? -17.225 11.750  43.669  1.00 39.85  ? 339 VAL A CB    1 
ATOM   2496 C CG1   . VAL A 1 313 ? -16.566 11.037  42.501  1.00 33.27  ? 339 VAL A CG1   1 
ATOM   2497 C CG2   . VAL A 1 313 ? -18.739 11.611  43.606  1.00 42.01  ? 339 VAL A CG2   1 
ATOM   2498 N N     . THR A 1 314 ? -14.580 12.375  45.133  1.00 26.70  ? 340 THR A N     1 
ATOM   2499 C CA    . THR A 1 314 ? -13.130 12.526  45.135  1.00 28.03  ? 340 THR A CA    1 
ATOM   2500 C C     . THR A 1 314 ? -12.475 11.543  46.097  1.00 43.04  ? 340 THR A C     1 
ATOM   2501 O O     . THR A 1 314 ? -11.663 10.713  45.692  1.00 55.21  ? 340 THR A O     1 
ATOM   2502 C CB    . THR A 1 314 ? -12.717 13.956  45.526  1.00 38.61  ? 340 THR A CB    1 
ATOM   2503 O OG1   . THR A 1 314 ? -13.252 14.886  44.576  1.00 49.11  ? 340 THR A OG1   1 
ATOM   2504 C CG2   . THR A 1 314 ? -11.202 14.085  45.562  1.00 25.99  ? 340 THR A CG2   1 
ATOM   2505 N N     . ASP A 1 315 ? -12.835 11.643  47.372  1.00 43.42  ? 341 ASP A N     1 
ATOM   2506 C CA    . ASP A 1 315 ? -12.294 10.754  48.393  1.00 55.79  ? 341 ASP A CA    1 
ATOM   2507 C C     . ASP A 1 315 ? -12.323 9.301   47.934  1.00 57.19  ? 341 ASP A C     1 
ATOM   2508 O O     . ASP A 1 315 ? -11.314 8.600   48.002  1.00 68.34  ? 341 ASP A O     1 
ATOM   2509 C CB    . ASP A 1 315 ? -13.066 10.907  49.705  1.00 63.22  ? 341 ASP A CB    1 
ATOM   2510 C CG    . ASP A 1 315 ? -12.819 12.245  50.371  1.00 82.36  ? 341 ASP A CG    1 
ATOM   2511 O OD1   . ASP A 1 315 ? -11.870 12.946  49.962  1.00 99.00  ? 341 ASP A OD1   1 
ATOM   2512 O OD2   . ASP A 1 315 ? -13.570 12.594  51.306  1.00 80.12  ? 341 ASP A OD2   1 
ATOM   2513 N N     . VAL A 1 316 ? -13.483 8.856   47.464  1.00 42.41  ? 342 VAL A N     1 
ATOM   2514 C CA    . VAL A 1 316 ? -13.647 7.482   47.004  1.00 50.10  ? 342 VAL A CA    1 
ATOM   2515 C C     . VAL A 1 316 ? -12.588 7.103   45.971  1.00 59.77  ? 342 VAL A C     1 
ATOM   2516 O O     . VAL A 1 316 ? -12.097 5.973   45.958  1.00 66.23  ? 342 VAL A O     1 
ATOM   2517 C CB    . VAL A 1 316 ? -15.048 7.253   46.409  1.00 49.08  ? 342 VAL A CB    1 
ATOM   2518 C CG1   . VAL A 1 316 ? -15.136 5.875   45.767  1.00 43.96  ? 342 VAL A CG1   1 
ATOM   2519 C CG2   . VAL A 1 316 ? -16.111 7.423   47.484  1.00 41.02  ? 342 VAL A CG2   1 
ATOM   2520 N N     . ILE A 1 317 ? -12.237 8.054   45.112  1.00 55.68  ? 343 ILE A N     1 
ATOM   2521 C CA    . ILE A 1 317 ? -11.249 7.812   44.068  1.00 57.82  ? 343 ILE A CA    1 
ATOM   2522 C C     . ILE A 1 317 ? -9.841  7.728   44.646  1.00 58.93  ? 343 ILE A C     1 
ATOM   2523 O O     . ILE A 1 317 ? -9.033  6.900   44.223  1.00 75.10  ? 343 ILE A O     1 
ATOM   2524 C CB    . ILE A 1 317 ? -11.294 8.905   42.988  1.00 53.41  ? 343 ILE A CB    1 
ATOM   2525 C CG1   . ILE A 1 317 ? -12.689 8.974   42.365  1.00 47.90  ? 343 ILE A CG1   1 
ATOM   2526 C CG2   . ILE A 1 317 ? -10.247 8.639   41.919  1.00 68.49  ? 343 ILE A CG2   1 
ATOM   2527 C CD1   . ILE A 1 317 ? -12.822 10.019  41.284  1.00 53.44  ? 343 ILE A CD1   1 
ATOM   2528 N N     . ILE A 1 318 ? -9.553  8.589   45.616  1.00 43.72  ? 344 ILE A N     1 
ATOM   2529 C CA    . ILE A 1 318 ? -8.253  8.595   46.274  1.00 45.90  ? 344 ILE A CA    1 
ATOM   2530 C C     . ILE A 1 318 ? -8.053  7.323   47.097  1.00 59.84  ? 344 ILE A C     1 
ATOM   2531 O O     . ILE A 1 318 ? -6.958  6.760   47.134  1.00 69.91  ? 344 ILE A O     1 
ATOM   2532 C CB    . ILE A 1 318 ? -8.093  9.829   47.183  1.00 48.18  ? 344 ILE A CB    1 
ATOM   2533 C CG1   . ILE A 1 318 ? -8.289  11.114  46.374  1.00 53.11  ? 344 ILE A CG1   1 
ATOM   2534 C CG2   . ILE A 1 318 ? -6.731  9.824   47.856  1.00 48.92  ? 344 ILE A CG2   1 
ATOM   2535 C CD1   . ILE A 1 318 ? -8.060  12.381  47.171  1.00 51.03  ? 344 ILE A CD1   1 
ATOM   2536 N N     . LYS A 1 319 ? -9.122  6.874   47.747  1.00 61.98  ? 345 LYS A N     1 
ATOM   2537 C CA    . LYS A 1 319 ? -9.088  5.661   48.559  1.00 66.50  ? 345 LYS A CA    1 
ATOM   2538 C C     . LYS A 1 319 ? -8.699  4.432   47.745  1.00 67.55  ? 345 LYS A C     1 
ATOM   2539 O O     . LYS A 1 319 ? -7.973  3.563   48.225  1.00 70.63  ? 345 LYS A O     1 
ATOM   2540 C CB    . LYS A 1 319 ? -10.451 5.426   49.216  1.00 79.17  ? 345 LYS A CB    1 
ATOM   2541 C CG    . LYS A 1 319 ? -10.653 4.009   49.736  1.00 91.19  ? 345 LYS A CG    1 
ATOM   2542 C CD    . LYS A 1 319 ? -12.109 3.756   50.096  1.00 105.74 ? 345 LYS A CD    1 
ATOM   2543 C CE    . LYS A 1 319 ? -12.348 2.295   50.443  1.00 116.51 ? 345 LYS A CE    1 
ATOM   2544 N NZ    . LYS A 1 319 ? -13.785 2.019   50.720  1.00 121.26 ? 345 LYS A NZ    1 
ATOM   2545 N N     . ASN A 1 320 ? -9.189  4.364   46.512  1.00 63.32  ? 346 ASN A N     1 
ATOM   2546 C CA    . ASN A 1 320 ? -8.969  3.197   45.666  1.00 52.19  ? 346 ASN A CA    1 
ATOM   2547 C C     . ASN A 1 320 ? -7.536  3.084   45.152  1.00 63.27  ? 346 ASN A C     1 
ATOM   2548 O O     . ASN A 1 320 ? -7.303  2.612   44.040  1.00 82.81  ? 346 ASN A O     1 
ATOM   2549 C CB    . ASN A 1 320 ? -9.963  3.186   44.503  1.00 50.34  ? 346 ASN A CB    1 
ATOM   2550 C CG    . ASN A 1 320 ? -11.404 3.130   44.973  1.00 53.92  ? 346 ASN A CG    1 
ATOM   2551 O OD1   . ASN A 1 320 ? -11.676 3.086   46.172  1.00 50.92  ? 346 ASN A OD1   1 
ATOM   2552 N ND2   . ASN A 1 320 ? -12.336 3.130   44.027  1.00 57.67  ? 346 ASN A ND2   1 
ATOM   2553 N N     . ASN A 1 321 ? -6.584  3.518   45.971  1.00 65.57  ? 347 ASN A N     1 
ATOM   2554 C CA    . ASN A 1 321 ? -5.166  3.378   45.659  1.00 72.98  ? 347 ASN A CA    1 
ATOM   2555 C C     . ASN A 1 321 ? -4.399  2.660   46.769  1.00 65.38  ? 347 ASN A C     1 
ATOM   2556 O O     . ASN A 1 321 ? -4.482  3.032   47.942  1.00 43.28  ? 347 ASN A O     1 
ATOM   2557 C CB    . ASN A 1 321 ? -4.534  4.743   45.379  1.00 80.83  ? 347 ASN A CB    1 
ATOM   2558 C CG    . ASN A 1 321 ? -4.893  5.285   44.008  1.00 83.63  ? 347 ASN A CG    1 
ATOM   2559 O OD1   . ASN A 1 321 ? -4.464  6.374   43.629  1.00 95.03  ? 347 ASN A OD1   1 
ATOM   2560 N ND2   . ASN A 1 321 ? -5.677  4.525   43.256  1.00 71.00  ? 347 ASN A ND2   1 
ATOM   2561 N N     . VAL B 1 8   ? -19.252 33.913  0.798   1.00 95.57  ? 34  VAL B N     1 
ATOM   2562 C CA    . VAL B 1 8   ? -18.427 35.056  1.172   1.00 101.70 ? 34  VAL B CA    1 
ATOM   2563 C C     . VAL B 1 8   ? -18.578 35.374  2.657   1.00 105.38 ? 34  VAL B C     1 
ATOM   2564 O O     . VAL B 1 8   ? -19.652 35.194  3.233   1.00 113.03 ? 34  VAL B O     1 
ATOM   2565 C CB    . VAL B 1 8   ? -18.781 36.305  0.337   1.00 104.71 ? 34  VAL B CB    1 
ATOM   2566 C CG1   . VAL B 1 8   ? -20.220 36.721  0.588   1.00 103.07 ? 34  VAL B CG1   1 
ATOM   2567 C CG2   . VAL B 1 8   ? -17.827 37.448  0.654   1.00 106.49 ? 34  VAL B CG2   1 
ATOM   2568 N N     . LYS B 1 9   ? -17.498 35.844  3.272   1.00 100.05 ? 35  LYS B N     1 
ATOM   2569 C CA    . LYS B 1 9   ? -17.494 36.133  4.701   1.00 95.86  ? 35  LYS B CA    1 
ATOM   2570 C C     . LYS B 1 9   ? -16.848 37.481  5.007   1.00 88.75  ? 35  LYS B C     1 
ATOM   2571 O O     . LYS B 1 9   ? -15.629 37.632  4.921   1.00 85.03  ? 35  LYS B O     1 
ATOM   2572 C CB    . LYS B 1 9   ? -16.767 35.022  5.461   1.00 106.40 ? 35  LYS B CB    1 
ATOM   2573 C CG    . LYS B 1 9   ? -16.687 35.238  6.961   1.00 106.81 ? 35  LYS B CG    1 
ATOM   2574 C CD    . LYS B 1 9   ? -15.955 34.088  7.632   1.00 109.85 ? 35  LYS B CD    1 
ATOM   2575 C CE    . LYS B 1 9   ? -15.914 34.260  9.140   1.00 112.65 ? 35  LYS B CE    1 
ATOM   2576 N NZ    . LYS B 1 9   ? -15.210 33.124  9.796   1.00 115.50 ? 35  LYS B NZ    1 
ATOM   2577 N N     . LEU B 1 10  ? -17.674 38.458  5.367   1.00 87.67  ? 36  LEU B N     1 
ATOM   2578 C CA    . LEU B 1 10  ? -17.186 39.790  5.702   1.00 83.95  ? 36  LEU B CA    1 
ATOM   2579 C C     . LEU B 1 10  ? -17.033 39.953  7.209   1.00 79.11  ? 36  LEU B C     1 
ATOM   2580 O O     . LEU B 1 10  ? -17.941 39.629  7.974   1.00 72.37  ? 36  LEU B O     1 
ATOM   2581 C CB    . LEU B 1 10  ? -18.126 40.863  5.150   1.00 84.21  ? 36  LEU B CB    1 
ATOM   2582 C CG    . LEU B 1 10  ? -18.294 40.893  3.630   1.00 92.37  ? 36  LEU B CG    1 
ATOM   2583 C CD1   . LEU B 1 10  ? -19.307 41.952  3.224   1.00 103.51 ? 36  LEU B CD1   1 
ATOM   2584 C CD2   . LEU B 1 10  ? -16.957 41.134  2.947   1.00 85.36  ? 36  LEU B CD2   1 
ATOM   2585 N N     . LEU B 1 11  ? -15.879 40.459  7.628   1.00 78.03  ? 37  LEU B N     1 
ATOM   2586 C CA    . LEU B 1 11  ? -15.598 40.647  9.045   1.00 76.35  ? 37  LEU B CA    1 
ATOM   2587 C C     . LEU B 1 11  ? -15.456 42.127  9.383   1.00 71.79  ? 37  LEU B C     1 
ATOM   2588 O O     . LEU B 1 11  ? -14.636 42.831  8.794   1.00 74.36  ? 37  LEU B O     1 
ATOM   2589 C CB    . LEU B 1 11  ? -14.329 39.893  9.439   1.00 74.90  ? 37  LEU B CB    1 
ATOM   2590 C CG    . LEU B 1 11  ? -13.959 39.930  10.920  1.00 71.10  ? 37  LEU B CG    1 
ATOM   2591 C CD1   . LEU B 1 11  ? -15.116 39.424  11.769  1.00 57.88  ? 37  LEU B CD1   1 
ATOM   2592 C CD2   . LEU B 1 11  ? -12.701 39.115  11.173  1.00 75.60  ? 37  LEU B CD2   1 
ATOM   2593 N N     . LEU B 1 12  ? -16.258 42.594  10.335  1.00 65.22  ? 38  LEU B N     1 
ATOM   2594 C CA    . LEU B 1 12  ? -16.232 43.995  10.738  1.00 66.11  ? 38  LEU B CA    1 
ATOM   2595 C C     . LEU B 1 12  ? -15.264 44.254  11.888  1.00 77.97  ? 38  LEU B C     1 
ATOM   2596 O O     . LEU B 1 12  ? -15.371 43.648  12.955  1.00 84.05  ? 38  LEU B O     1 
ATOM   2597 C CB    . LEU B 1 12  ? -17.633 44.472  11.123  1.00 58.85  ? 38  LEU B CB    1 
ATOM   2598 C CG    . LEU B 1 12  ? -18.623 44.685  9.979   1.00 49.52  ? 38  LEU B CG    1 
ATOM   2599 C CD1   . LEU B 1 12  ? -19.963 45.159  10.517  1.00 34.61  ? 38  LEU B CD1   1 
ATOM   2600 C CD2   . LEU B 1 12  ? -18.063 45.682  8.984   1.00 53.06  ? 38  LEU B CD2   1 
ATOM   2601 N N     . LEU B 1 13  ? -14.320 45.160  11.660  1.00 74.10  ? 39  LEU B N     1 
ATOM   2602 C CA    . LEU B 1 13  ? -13.384 45.575  12.697  1.00 60.81  ? 39  LEU B CA    1 
ATOM   2603 C C     . LEU B 1 13  ? -13.403 47.092  12.838  1.00 61.81  ? 39  LEU B C     1 
ATOM   2604 O O     . LEU B 1 13  ? -14.029 47.788  12.039  1.00 56.19  ? 39  LEU B O     1 
ATOM   2605 C CB    . LEU B 1 13  ? -11.969 45.090  12.377  1.00 50.65  ? 39  LEU B CB    1 
ATOM   2606 C CG    . LEU B 1 13  ? -11.780 43.575  12.285  1.00 56.57  ? 39  LEU B CG    1 
ATOM   2607 C CD1   . LEU B 1 13  ? -10.315 43.228  12.061  1.00 55.83  ? 39  LEU B CD1   1 
ATOM   2608 C CD2   . LEU B 1 13  ? -12.307 42.897  13.539  1.00 58.20  ? 39  LEU B CD2   1 
ATOM   2609 N N     . GLY B 1 14  ? -12.718 47.599  13.856  1.00 70.36  ? 40  GLY B N     1 
ATOM   2610 C CA    . GLY B 1 14  ? -12.676 49.028  14.106  1.00 74.02  ? 40  GLY B CA    1 
ATOM   2611 C C     . GLY B 1 14  ? -12.976 49.368  15.552  1.00 65.11  ? 40  GLY B C     1 
ATOM   2612 O O     . GLY B 1 14  ? -13.577 48.573  16.274  1.00 49.42  ? 40  GLY B O     1 
ATOM   2613 N N     . ALA B 1 15  ? -12.558 50.555  15.977  1.00 34.55  ? 41  ALA B N     1 
ATOM   2614 C CA    . ALA B 1 15  ? -12.760 50.988  17.354  1.00 45.84  ? 41  ALA B CA    1 
ATOM   2615 C C     . ALA B 1 15  ? -14.241 51.098  17.698  1.00 47.94  ? 41  ALA B C     1 
ATOM   2616 O O     . ALA B 1 15  ? -15.100 51.036  16.819  1.00 53.12  ? 41  ALA B O     1 
ATOM   2617 C CB    . ALA B 1 15  ? -12.060 52.316  17.597  1.00 48.96  ? 41  ALA B CB    1 
ATOM   2618 N N     . ARG B 1 16  ? -14.533 51.259  18.984  1.00 45.75  ? 42  ARG B N     1 
ATOM   2619 C CA    . ARG B 1 16  ? -15.905 51.424  19.441  1.00 52.32  ? 42  ARG B CA    1 
ATOM   2620 C C     . ARG B 1 16  ? -16.484 52.729  18.906  1.00 67.57  ? 42  ARG B C     1 
ATOM   2621 O O     . ARG B 1 16  ? -15.799 53.753  18.881  1.00 74.18  ? 42  ARG B O     1 
ATOM   2622 C CB    . ARG B 1 16  ? -15.964 51.401  20.970  1.00 56.38  ? 42  ARG B CB    1 
ATOM   2623 C CG    . ARG B 1 16  ? -17.366 51.538  21.543  1.00 89.57  ? 42  ARG B CG    1 
ATOM   2624 C CD    . ARG B 1 16  ? -17.382 51.266  23.041  1.00 115.45 ? 42  ARG B CD    1 
ATOM   2625 N NE    . ARG B 1 16  ? -16.534 52.196  23.783  1.00 134.39 ? 42  ARG B NE    1 
ATOM   2626 C CZ    . ARG B 1 16  ? -16.975 53.307  24.365  1.00 142.26 ? 42  ARG B CZ    1 
ATOM   2627 N NH1   . ARG B 1 16  ? -18.259 53.631  24.293  1.00 146.87 ? 42  ARG B NH1   1 
ATOM   2628 N NH2   . ARG B 1 16  ? -16.132 54.094  25.021  1.00 140.09 ? 42  ARG B NH2   1 
ATOM   2629 N N     . GLU B 1 17  ? -17.740 52.684  18.471  1.00 38.67  ? 43  GLU B N     1 
ATOM   2630 C CA    . GLU B 1 17  ? -18.424 53.865  17.953  1.00 44.75  ? 43  GLU B CA    1 
ATOM   2631 C C     . GLU B 1 17  ? -17.855 54.304  16.607  1.00 50.72  ? 43  GLU B C     1 
ATOM   2632 O O     . GLU B 1 17  ? -17.860 55.492  16.283  1.00 48.75  ? 43  GLU B O     1 
ATOM   2633 C CB    . GLU B 1 17  ? -18.327 55.020  18.952  1.00 45.01  ? 43  GLU B CB    1 
ATOM   2634 C CG    . GLU B 1 17  ? -18.839 54.690  20.339  1.00 42.90  ? 43  GLU B CG    1 
ATOM   2635 C CD    . GLU B 1 17  ? -20.349 54.688  20.414  1.00 51.55  ? 43  GLU B CD    1 
ATOM   2636 O OE1   . GLU B 1 17  ? -20.903 53.864  21.171  1.00 63.52  ? 43  GLU B OE1   1 
ATOM   2637 O OE2   . GLU B 1 17  ? -20.981 55.510  19.716  1.00 49.40  ? 43  GLU B OE2   1 
ATOM   2638 N N     . SER B 1 18  ? -17.367 53.345  15.826  1.00 54.36  ? 44  SER B N     1 
ATOM   2639 C CA    . SER B 1 18  ? -16.762 53.653  14.533  1.00 46.36  ? 44  SER B CA    1 
ATOM   2640 C C     . SER B 1 18  ? -17.753 53.502  13.381  1.00 41.87  ? 44  SER B C     1 
ATOM   2641 O O     . SER B 1 18  ? -17.565 54.083  12.312  1.00 48.33  ? 44  SER B O     1 
ATOM   2642 C CB    . SER B 1 18  ? -15.531 52.778  14.290  1.00 48.97  ? 44  SER B CB    1 
ATOM   2643 O OG    . SER B 1 18  ? -15.874 51.403  14.283  1.00 56.54  ? 44  SER B OG    1 
ATOM   2644 N N     . GLY B 1 19  ? -18.805 52.719  13.601  1.00 31.06  ? 45  GLY B N     1 
ATOM   2645 C CA    . GLY B 1 19  ? -19.829 52.518  12.591  1.00 19.44  ? 45  GLY B CA    1 
ATOM   2646 C C     . GLY B 1 19  ? -20.149 51.057  12.331  1.00 40.64  ? 45  GLY B C     1 
ATOM   2647 O O     . GLY B 1 19  ? -20.992 50.740  11.492  1.00 45.70  ? 45  GLY B O     1 
ATOM   2648 N N     . LYS B 1 20  ? -19.478 50.166  13.055  1.00 46.50  ? 46  LYS B N     1 
ATOM   2649 C CA    . LYS B 1 20  ? -19.625 48.730  12.837  1.00 43.47  ? 46  LYS B CA    1 
ATOM   2650 C C     . LYS B 1 20  ? -21.083 48.279  12.825  1.00 57.28  ? 46  LYS B C     1 
ATOM   2651 O O     . LYS B 1 20  ? -21.606 47.881  11.785  1.00 62.65  ? 46  LYS B O     1 
ATOM   2652 C CB    . LYS B 1 20  ? -18.841 47.939  13.887  1.00 45.34  ? 46  LYS B CB    1 
ATOM   2653 C CG    . LYS B 1 20  ? -17.333 48.101  13.788  1.00 42.82  ? 46  LYS B CG    1 
ATOM   2654 C CD    . LYS B 1 20  ? -16.620 47.241  14.818  1.00 41.94  ? 46  LYS B CD    1 
ATOM   2655 C CE    . LYS B 1 20  ? -17.114 47.545  16.223  1.00 49.39  ? 46  LYS B CE    1 
ATOM   2656 N NZ    . LYS B 1 20  ? -16.953 48.984  16.569  1.00 43.56  ? 46  LYS B NZ    1 
ATOM   2657 N N     . SER B 1 21  ? -21.734 48.341  13.983  1.00 63.55  ? 47  SER B N     1 
ATOM   2658 C CA    . SER B 1 21  ? -23.107 47.864  14.108  1.00 57.84  ? 47  SER B CA    1 
ATOM   2659 C C     . SER B 1 21  ? -24.071 48.649  13.221  1.00 48.45  ? 47  SER B C     1 
ATOM   2660 O O     . SER B 1 21  ? -25.053 48.099  12.724  1.00 43.10  ? 47  SER B O     1 
ATOM   2661 C CB    . SER B 1 21  ? -23.568 47.895  15.569  1.00 57.34  ? 47  SER B CB    1 
ATOM   2662 O OG    . SER B 1 21  ? -23.482 49.199  16.110  1.00 63.99  ? 47  SER B OG    1 
ATOM   2663 N N     . THR B 1 22  ? -23.786 49.932  13.021  1.00 50.56  ? 48  THR B N     1 
ATOM   2664 C CA    . THR B 1 22  ? -24.611 50.767  12.153  1.00 55.68  ? 48  THR B CA    1 
ATOM   2665 C C     . THR B 1 22  ? -24.608 50.231  10.722  1.00 54.06  ? 48  THR B C     1 
ATOM   2666 O O     . THR B 1 22  ? -25.595 50.363  9.998   1.00 37.10  ? 48  THR B O     1 
ATOM   2667 C CB    . THR B 1 22  ? -24.135 52.233  12.151  1.00 59.16  ? 48  THR B CB    1 
ATOM   2668 O OG1   . THR B 1 22  ? -24.112 52.734  13.493  1.00 72.27  ? 48  THR B OG1   1 
ATOM   2669 C CG2   . THR B 1 22  ? -25.065 53.096  11.310  1.00 49.71  ? 48  THR B CG2   1 
ATOM   2670 N N     . ILE B 1 23  ? -23.492 49.626  10.323  1.00 54.52  ? 49  ILE B N     1 
ATOM   2671 C CA    . ILE B 1 23  ? -23.373 49.020  9.000   1.00 43.36  ? 49  ILE B CA    1 
ATOM   2672 C C     . ILE B 1 23  ? -24.254 47.781  8.881   1.00 50.58  ? 49  ILE B C     1 
ATOM   2673 O O     . ILE B 1 23  ? -25.018 47.641  7.926   1.00 59.22  ? 49  ILE B O     1 
ATOM   2674 C CB    . ILE B 1 23  ? -21.919 48.622  8.689   1.00 40.75  ? 49  ILE B CB    1 
ATOM   2675 C CG1   . ILE B 1 23  ? -21.041 49.867  8.559   1.00 47.15  ? 49  ILE B CG1   1 
ATOM   2676 C CG2   . ILE B 1 23  ? -21.856 47.798  7.414   1.00 36.91  ? 49  ILE B CG2   1 
ATOM   2677 C CD1   . ILE B 1 23  ? -21.461 50.793  7.441   1.00 49.61  ? 49  ILE B CD1   1 
ATOM   2678 N N     . VAL B 1 24  ? -24.137 46.884  9.855   1.00 51.66  ? 50  VAL B N     1 
ATOM   2679 C CA    . VAL B 1 24  ? -24.938 45.666  9.877   1.00 51.74  ? 50  VAL B CA    1 
ATOM   2680 C C     . VAL B 1 24  ? -26.417 45.991  9.712   1.00 58.31  ? 50  VAL B C     1 
ATOM   2681 O O     . VAL B 1 24  ? -27.135 45.316  8.974   1.00 70.79  ? 50  VAL B O     1 
ATOM   2682 C CB    . VAL B 1 24  ? -24.741 44.886  11.191  1.00 44.23  ? 50  VAL B CB    1 
ATOM   2683 C CG1   . VAL B 1 24  ? -25.681 43.693  11.247  1.00 40.42  ? 50  VAL B CG1   1 
ATOM   2684 C CG2   . VAL B 1 24  ? -23.295 44.439  11.330  1.00 49.09  ? 50  VAL B CG2   1 
ATOM   2685 N N     . LYS B 1 25  ? -26.862 47.035  10.403  1.00 51.03  ? 51  LYS B N     1 
ATOM   2686 C CA    . LYS B 1 25  ? -28.255 47.461  10.346  1.00 56.65  ? 51  LYS B CA    1 
ATOM   2687 C C     . LYS B 1 25  ? -28.624 47.928  8.941   1.00 59.63  ? 51  LYS B C     1 
ATOM   2688 O O     . LYS B 1 25  ? -29.719 47.652  8.452   1.00 60.90  ? 51  LYS B O     1 
ATOM   2689 C CB    . LYS B 1 25  ? -28.511 48.568  11.371  1.00 57.58  ? 51  LYS B CB    1 
ATOM   2690 C CG    . LYS B 1 25  ? -28.182 48.155  12.802  1.00 71.03  ? 51  LYS B CG    1 
ATOM   2691 C CD    . LYS B 1 25  ? -28.077 49.351  13.739  1.00 69.34  ? 51  LYS B CD    1 
ATOM   2692 C CE    . LYS B 1 25  ? -29.430 49.991  13.995  1.00 67.71  ? 51  LYS B CE    1 
ATOM   2693 N NZ    . LYS B 1 25  ? -29.330 51.099  14.983  1.00 63.72  ? 51  LYS B NZ    1 
ATOM   2694 N N     . GLN B 1 26  ? -27.700 48.632  8.294   1.00 52.22  ? 52  GLN B N     1 
ATOM   2695 C CA    . GLN B 1 26  ? -27.910 49.092  6.927   1.00 43.63  ? 52  GLN B CA    1 
ATOM   2696 C C     . GLN B 1 26  ? -28.121 47.916  5.982   1.00 57.76  ? 52  GLN B C     1 
ATOM   2697 O O     . GLN B 1 26  ? -28.944 47.982  5.071   1.00 60.47  ? 52  GLN B O     1 
ATOM   2698 C CB    . GLN B 1 26  ? -26.726 49.937  6.454   1.00 36.06  ? 52  GLN B CB    1 
ATOM   2699 C CG    . GLN B 1 26  ? -26.679 51.337  7.040   1.00 37.57  ? 52  GLN B CG    1 
ATOM   2700 C CD    . GLN B 1 26  ? -27.793 52.225  6.519   1.00 44.99  ? 52  GLN B CD    1 
ATOM   2701 O OE1   . GLN B 1 26  ? -28.824 51.741  6.051   1.00 42.46  ? 52  GLN B OE1   1 
ATOM   2702 N NE2   . GLN B 1 26  ? -27.591 53.535  6.600   1.00 48.93  ? 52  GLN B NE2   1 
ATOM   2703 N N     . MET B 1 27  ? -27.372 46.842  6.205   1.00 62.76  ? 53  MET B N     1 
ATOM   2704 C CA    . MET B 1 27  ? -27.483 45.648  5.377   1.00 64.32  ? 53  MET B CA    1 
ATOM   2705 C C     . MET B 1 27  ? -28.903 45.094  5.407   1.00 63.08  ? 53  MET B C     1 
ATOM   2706 O O     . MET B 1 27  ? -29.508 44.853  4.362   1.00 64.54  ? 53  MET B O     1 
ATOM   2707 C CB    . MET B 1 27  ? -26.494 44.580  5.845   1.00 69.87  ? 53  MET B CB    1 
ATOM   2708 C CG    . MET B 1 27  ? -25.035 45.019  5.835   1.00 64.10  ? 53  MET B CG    1 
ATOM   2709 S SD    . MET B 1 27  ? -24.344 45.228  4.181   1.00 75.49  ? 53  MET B SD    1 
ATOM   2710 C CE    . MET B 1 27  ? -24.887 46.884  3.764   1.00 42.07  ? 53  MET B CE    1 
ATOM   2711 N N     . LYS B 1 28  ? -29.432 44.899  6.610   1.00 64.20  ? 54  LYS B N     1 
ATOM   2712 C CA    . LYS B 1 28  ? -30.781 44.375  6.773   1.00 70.19  ? 54  LYS B CA    1 
ATOM   2713 C C     . LYS B 1 28  ? -31.814 45.302  6.139   1.00 77.23  ? 54  LYS B C     1 
ATOM   2714 O O     . LYS B 1 28  ? -32.868 44.856  5.690   1.00 97.05  ? 54  LYS B O     1 
ATOM   2715 C CB    . LYS B 1 28  ? -31.095 44.142  8.254   1.00 78.56  ? 54  LYS B CB    1 
ATOM   2716 C CG    . LYS B 1 28  ? -32.488 43.590  8.515   1.00 98.04  ? 54  LYS B CG    1 
ATOM   2717 C CD    . LYS B 1 28  ? -32.582 42.936  9.886   1.00 110.60 ? 54  LYS B CD    1 
ATOM   2718 C CE    . LYS B 1 28  ? -32.137 43.883  10.987  1.00 116.45 ? 54  LYS B CE    1 
ATOM   2719 N NZ    . LYS B 1 28  ? -32.257 43.264  12.338  1.00 117.65 ? 54  LYS B NZ    1 
ATOM   2720 N N     . ILE B 1 29  ? -31.505 46.594  6.099   1.00 64.46  ? 55  ILE B N     1 
ATOM   2721 C CA    . ILE B 1 29  ? -32.383 47.565  5.457   1.00 64.03  ? 55  ILE B CA    1 
ATOM   2722 C C     . ILE B 1 29  ? -32.284 47.476  3.939   1.00 67.87  ? 55  ILE B C     1 
ATOM   2723 O O     . ILE B 1 29  ? -33.294 47.382  3.242   1.00 82.54  ? 55  ILE B O     1 
ATOM   2724 C CB    . ILE B 1 29  ? -32.039 49.006  5.875   1.00 59.50  ? 55  ILE B CB    1 
ATOM   2725 C CG1   . ILE B 1 29  ? -32.331 49.219  7.360   1.00 61.57  ? 55  ILE B CG1   1 
ATOM   2726 C CG2   . ILE B 1 29  ? -32.818 50.005  5.034   1.00 55.46  ? 55  ILE B CG2   1 
ATOM   2727 C CD1   . ILE B 1 29  ? -32.073 50.633  7.831   1.00 55.34  ? 55  ILE B CD1   1 
ATOM   2728 N N     . ILE B 1 30  ? -31.053 47.504  3.439   1.00 57.46  ? 56  ILE B N     1 
ATOM   2729 C CA    . ILE B 1 30  ? -30.797 47.547  2.005   1.00 54.27  ? 56  ILE B CA    1 
ATOM   2730 C C     . ILE B 1 30  ? -31.100 46.228  1.304   1.00 68.39  ? 56  ILE B C     1 
ATOM   2731 O O     . ILE B 1 30  ? -31.922 46.176  0.388   1.00 81.78  ? 56  ILE B O     1 
ATOM   2732 C CB    . ILE B 1 30  ? -29.335 47.936  1.714   1.00 48.28  ? 56  ILE B CB    1 
ATOM   2733 C CG1   . ILE B 1 30  ? -29.045 49.343  2.241   1.00 54.08  ? 56  ILE B CG1   1 
ATOM   2734 C CG2   . ILE B 1 30  ? -29.046 47.848  0.222   1.00 39.85  ? 56  ILE B CG2   1 
ATOM   2735 C CD1   . ILE B 1 30  ? -27.605 49.777  2.080   1.00 48.00  ? 56  ILE B CD1   1 
ATOM   2736 N N     . HIS B 1 31  ? -30.435 45.164  1.739   1.00 62.37  ? 57  HIS B N     1 
ATOM   2737 C CA    . HIS B 1 31  ? -30.516 43.884  1.047   1.00 66.83  ? 57  HIS B CA    1 
ATOM   2738 C C     . HIS B 1 31  ? -31.499 42.911  1.691   1.00 66.49  ? 57  HIS B C     1 
ATOM   2739 O O     . HIS B 1 31  ? -31.438 41.705  1.451   1.00 72.49  ? 57  HIS B O     1 
ATOM   2740 C CB    . HIS B 1 31  ? -29.126 43.255  0.946   1.00 74.88  ? 57  HIS B CB    1 
ATOM   2741 C CG    . HIS B 1 31  ? -28.107 44.154  0.320   1.00 77.83  ? 57  HIS B CG    1 
ATOM   2742 N ND1   . HIS B 1 31  ? -27.306 44.999  1.058   1.00 83.07  ? 57  HIS B ND1   1 
ATOM   2743 C CD2   . HIS B 1 31  ? -27.766 44.349  -0.975  1.00 83.33  ? 57  HIS B CD2   1 
ATOM   2744 C CE1   . HIS B 1 31  ? -26.511 45.670  0.246   1.00 87.80  ? 57  HIS B CE1   1 
ATOM   2745 N NE2   . HIS B 1 31  ? -26.769 45.295  -0.994  1.00 88.44  ? 57  HIS B NE2   1 
ATOM   2746 N N     . GLU B 1 32  ? -32.405 43.441  2.505   1.00 58.06  ? 58  GLU B N     1 
ATOM   2747 C CA    . GLU B 1 32  ? -33.456 42.630  3.109   1.00 66.53  ? 58  GLU B CA    1 
ATOM   2748 C C     . GLU B 1 32  ? -34.757 43.419  3.181   1.00 83.77  ? 58  GLU B C     1 
ATOM   2749 O O     . GLU B 1 32  ? -34.888 44.475  2.560   1.00 86.46  ? 58  GLU B O     1 
ATOM   2750 C CB    . GLU B 1 32  ? -33.048 42.154  4.504   1.00 63.63  ? 58  GLU B CB    1 
ATOM   2751 C CG    . GLU B 1 32  ? -31.761 41.346  4.540   1.00 71.26  ? 58  GLU B CG    1 
ATOM   2752 C CD    . GLU B 1 32  ? -31.424 40.849  5.931   1.00 84.69  ? 58  GLU B CD    1 
ATOM   2753 O OE1   . GLU B 1 32  ? -30.238 40.553  6.188   1.00 87.51  ? 58  GLU B OE1   1 
ATOM   2754 O OE2   . GLU B 1 32  ? -32.344 40.757  6.770   1.00 95.38  ? 58  GLU B OE2   1 
ATOM   2755 N N     . ALA B 1 33  ? -35.716 42.903  3.942   1.00 89.84  ? 59  ALA B N     1 
ATOM   2756 C CA    . ALA B 1 33  ? -37.013 43.554  4.085   1.00 98.41  ? 59  ALA B CA    1 
ATOM   2757 C C     . ALA B 1 33  ? -36.924 44.756  5.018   1.00 98.20  ? 59  ALA B C     1 
ATOM   2758 O O     . ALA B 1 33  ? -37.913 45.453  5.247   1.00 100.31 ? 59  ALA B O     1 
ATOM   2759 C CB    . ALA B 1 33  ? -38.052 42.563  4.590   1.00 102.85 ? 59  ALA B CB    1 
ATOM   2760 N N     . GLY B 1 34  ? -35.731 44.995  5.553   1.00 94.31  ? 60  GLY B N     1 
ATOM   2761 C CA    . GLY B 1 34  ? -35.514 46.094  6.474   1.00 94.23  ? 60  GLY B CA    1 
ATOM   2762 C C     . GLY B 1 34  ? -36.204 45.868  7.804   1.00 91.81  ? 60  GLY B C     1 
ATOM   2763 O O     . GLY B 1 34  ? -36.110 44.788  8.389   1.00 86.34  ? 60  GLY B O     1 
ATOM   2764 N N     . TYR B 1 35  ? -36.897 46.895  8.284   1.00 90.89  ? 61  TYR B N     1 
ATOM   2765 C CA    . TYR B 1 35  ? -37.645 46.801  9.531   1.00 89.87  ? 61  TYR B CA    1 
ATOM   2766 C C     . TYR B 1 35  ? -39.128 47.054  9.289   1.00 97.38  ? 61  TYR B C     1 
ATOM   2767 O O     . TYR B 1 35  ? -39.504 48.046  8.664   1.00 103.81 ? 61  TYR B O     1 
ATOM   2768 C CB    . TYR B 1 35  ? -37.109 47.798  10.562  1.00 84.30  ? 61  TYR B CB    1 
ATOM   2769 C CG    . TYR B 1 35  ? -35.700 47.512  11.033  1.00 80.62  ? 61  TYR B CG    1 
ATOM   2770 C CD1   . TYR B 1 35  ? -34.629 48.275  10.587  1.00 75.97  ? 61  TYR B CD1   1 
ATOM   2771 C CD2   . TYR B 1 35  ? -35.442 46.483  11.928  1.00 81.75  ? 61  TYR B CD2   1 
ATOM   2772 C CE1   . TYR B 1 35  ? -33.340 48.019  11.017  1.00 73.61  ? 61  TYR B CE1   1 
ATOM   2773 C CE2   . TYR B 1 35  ? -34.158 46.220  12.365  1.00 83.78  ? 61  TYR B CE2   1 
ATOM   2774 C CZ    . TYR B 1 35  ? -33.110 46.990  11.906  1.00 81.12  ? 61  TYR B CZ    1 
ATOM   2775 O OH    . TYR B 1 35  ? -31.829 46.731  12.339  1.00 80.64  ? 61  TYR B OH    1 
ATOM   2776 N N     . SER B 1 36  ? -39.967 46.152  9.786   1.00 95.81  ? 62  SER B N     1 
ATOM   2777 C CA    . SER B 1 36  ? -41.410 46.300  9.651   1.00 95.10  ? 62  SER B CA    1 
ATOM   2778 C C     . SER B 1 36  ? -41.950 47.291  10.676  1.00 87.17  ? 62  SER B C     1 
ATOM   2779 O O     . SER B 1 36  ? -41.238 47.697  11.594  1.00 82.23  ? 62  SER B O     1 
ATOM   2780 C CB    . SER B 1 36  ? -42.105 44.946  9.809   1.00 96.19  ? 62  SER B CB    1 
ATOM   2781 O OG    . SER B 1 36  ? -41.812 44.368  11.070  1.00 94.72  ? 62  SER B OG    1 
ATOM   2782 N N     . GLU B 1 37  ? -43.210 47.679  10.512  1.00 88.15  ? 63  GLU B N     1 
ATOM   2783 C CA    . GLU B 1 37  ? -43.841 48.627  11.422  1.00 86.90  ? 63  GLU B CA    1 
ATOM   2784 C C     . GLU B 1 37  ? -43.869 48.095  12.849  1.00 76.95  ? 63  GLU B C     1 
ATOM   2785 O O     . GLU B 1 37  ? -43.748 48.857  13.808  1.00 78.43  ? 63  GLU B O     1 
ATOM   2786 C CB    . GLU B 1 37  ? -45.260 48.958  10.955  1.00 106.34 ? 63  GLU B CB    1 
ATOM   2787 C CG    . GLU B 1 37  ? -45.315 49.710  9.637   1.00 128.52 ? 63  GLU B CG    1 
ATOM   2788 C CD    . GLU B 1 37  ? -44.666 51.078  9.722   1.00 143.70 ? 63  GLU B CD    1 
ATOM   2789 O OE1   . GLU B 1 37  ? -44.524 51.602  10.847  1.00 146.20 ? 63  GLU B OE1   1 
ATOM   2790 O OE2   . GLU B 1 37  ? -44.302 51.632  8.663   1.00 150.30 ? 63  GLU B OE2   1 
ATOM   2791 N N     . GLU B 1 38  ? -44.027 46.783  12.984  1.00 74.15  ? 64  GLU B N     1 
ATOM   2792 C CA    . GLU B 1 38  ? -44.078 46.157  14.299  1.00 72.44  ? 64  GLU B CA    1 
ATOM   2793 C C     . GLU B 1 38  ? -42.709 46.177  14.970  1.00 66.33  ? 64  GLU B C     1 
ATOM   2794 O O     . GLU B 1 38  ? -42.596 46.457  16.164  1.00 63.53  ? 64  GLU B O     1 
ATOM   2795 C CB    . GLU B 1 38  ? -44.595 44.722  14.193  1.00 79.58  ? 64  GLU B CB    1 
ATOM   2796 C CG    . GLU B 1 38  ? -44.803 44.048  15.537  1.00 91.34  ? 64  GLU B CG    1 
ATOM   2797 C CD    . GLU B 1 38  ? -45.826 44.766  16.396  1.00 103.29 ? 64  GLU B CD    1 
ATOM   2798 O OE1   . GLU B 1 38  ? -46.631 45.546  15.843  1.00 101.21 ? 64  GLU B OE1   1 
ATOM   2799 O OE2   . GLU B 1 38  ? -45.828 44.547  17.626  1.00 111.52 ? 64  GLU B OE2   1 
ATOM   2800 N N     . GLU B 1 39  ? -41.671 45.877  14.196  1.00 64.88  ? 65  GLU B N     1 
ATOM   2801 C CA    . GLU B 1 39  ? -40.306 45.914  14.706  1.00 63.43  ? 65  GLU B CA    1 
ATOM   2802 C C     . GLU B 1 39  ? -39.940 47.323  15.158  1.00 67.49  ? 65  GLU B C     1 
ATOM   2803 O O     . GLU B 1 39  ? -39.345 47.510  16.219  1.00 68.98  ? 65  GLU B O     1 
ATOM   2804 C CB    . GLU B 1 39  ? -39.319 45.419  13.648  1.00 59.77  ? 65  GLU B CB    1 
ATOM   2805 C CG    . GLU B 1 39  ? -39.420 43.930  13.360  1.00 75.74  ? 65  GLU B CG    1 
ATOM   2806 C CD    . GLU B 1 39  ? -38.451 43.476  12.286  1.00 88.64  ? 65  GLU B CD    1 
ATOM   2807 O OE1   . GLU B 1 39  ? -38.640 43.861  11.113  1.00 93.38  ? 65  GLU B OE1   1 
ATOM   2808 O OE2   . GLU B 1 39  ? -37.504 42.730  12.615  1.00 89.54  ? 65  GLU B OE2   1 
ATOM   2809 N N     . CYS B 1 40  ? -40.301 48.313  14.348  1.00 70.20  ? 66  CYS B N     1 
ATOM   2810 C CA    . CYS B 1 40  ? -40.051 49.706  14.695  1.00 70.31  ? 66  CYS B CA    1 
ATOM   2811 C C     . CYS B 1 40  ? -40.630 50.033  16.068  1.00 70.33  ? 66  CYS B C     1 
ATOM   2812 O O     . CYS B 1 40  ? -39.966 50.655  16.898  1.00 78.50  ? 66  CYS B O     1 
ATOM   2813 C CB    . CYS B 1 40  ? -40.633 50.643  13.633  1.00 69.78  ? 66  CYS B CB    1 
ATOM   2814 S SG    . CYS B 1 40  ? -39.789 50.579  12.033  1.00 68.02  ? 66  CYS B SG    1 
ATOM   2815 N N     . LYS B 1 41  ? -41.866 49.605  16.305  1.00 55.58  ? 67  LYS B N     1 
ATOM   2816 C CA    . LYS B 1 41  ? -42.525 49.840  17.584  1.00 54.01  ? 67  LYS B CA    1 
ATOM   2817 C C     . LYS B 1 41  ? -41.682 49.318  18.743  1.00 59.16  ? 67  LYS B C     1 
ATOM   2818 O O     . LYS B 1 41  ? -41.701 49.881  19.838  1.00 54.00  ? 67  LYS B O     1 
ATOM   2819 C CB    . LYS B 1 41  ? -43.906 49.184  17.609  1.00 67.27  ? 67  LYS B CB    1 
ATOM   2820 C CG    . LYS B 1 41  ? -44.885 49.743  16.591  1.00 75.88  ? 67  LYS B CG    1 
ATOM   2821 C CD    . LYS B 1 41  ? -46.238 49.057  16.703  1.00 85.80  ? 67  LYS B CD    1 
ATOM   2822 C CE    . LYS B 1 41  ? -47.223 49.600  15.681  1.00 91.94  ? 67  LYS B CE    1 
ATOM   2823 N NZ    . LYS B 1 41  ? -48.555 48.944  15.793  1.00 94.54  ? 67  LYS B NZ    1 
ATOM   2824 N N     . GLN B 1 42  ? -40.942 48.242  18.494  1.00 66.11  ? 68  GLN B N     1 
ATOM   2825 C CA    . GLN B 1 42  ? -40.109 47.628  19.523  1.00 62.90  ? 68  GLN B CA    1 
ATOM   2826 C C     . GLN B 1 42  ? -39.008 48.573  19.989  1.00 51.95  ? 68  GLN B C     1 
ATOM   2827 O O     . GLN B 1 42  ? -38.629 48.569  21.159  1.00 57.49  ? 68  GLN B O     1 
ATOM   2828 C CB    . GLN B 1 42  ? -39.491 46.327  19.008  1.00 70.04  ? 68  GLN B CB    1 
ATOM   2829 C CG    . GLN B 1 42  ? -40.504 45.326  18.479  1.00 81.03  ? 68  GLN B CG    1 
ATOM   2830 C CD    . GLN B 1 42  ? -41.482 44.867  19.542  1.00 92.08  ? 68  GLN B CD    1 
ATOM   2831 O OE1   . GLN B 1 42  ? -41.210 44.968  20.739  1.00 88.63  ? 68  GLN B OE1   1 
ATOM   2832 N NE2   . GLN B 1 42  ? -42.628 44.355  19.109  1.00 99.98  ? 68  GLN B NE2   1 
ATOM   2833 N N     . TYR B 1 43  ? -38.499 49.383  19.067  1.00 52.64  ? 69  TYR B N     1 
ATOM   2834 C CA    . TYR B 1 43  ? -37.401 50.295  19.370  1.00 52.22  ? 69  TYR B CA    1 
ATOM   2835 C C     . TYR B 1 43  ? -37.876 51.622  19.958  1.00 44.02  ? 69  TYR B C     1 
ATOM   2836 O O     . TYR B 1 43  ? -37.094 52.559  20.102  1.00 40.43  ? 69  TYR B O     1 
ATOM   2837 C CB    . TYR B 1 43  ? -36.557 50.548  18.118  1.00 49.62  ? 69  TYR B CB    1 
ATOM   2838 C CG    . TYR B 1 43  ? -35.828 49.325  17.613  1.00 44.03  ? 69  TYR B CG    1 
ATOM   2839 C CD1   . TYR B 1 43  ? -36.447 48.431  16.751  1.00 43.96  ? 69  TYR B CD1   1 
ATOM   2840 C CD2   . TYR B 1 43  ? -34.518 49.065  17.999  1.00 40.91  ? 69  TYR B CD2   1 
ATOM   2841 C CE1   . TYR B 1 43  ? -35.783 47.309  16.287  1.00 54.17  ? 69  TYR B CE1   1 
ATOM   2842 C CE2   . TYR B 1 43  ? -33.846 47.947  17.541  1.00 47.36  ? 69  TYR B CE2   1 
ATOM   2843 C CZ    . TYR B 1 43  ? -34.483 47.072  16.685  1.00 58.98  ? 69  TYR B CZ    1 
ATOM   2844 O OH    . TYR B 1 43  ? -33.818 45.958  16.226  1.00 65.42  ? 69  TYR B OH    1 
ATOM   2845 N N     . LYS B 1 44  ? -39.157 51.703  20.299  1.00 42.49  ? 70  LYS B N     1 
ATOM   2846 C CA    . LYS B 1 44  ? -39.708 52.930  20.859  1.00 37.62  ? 70  LYS B CA    1 
ATOM   2847 C C     . LYS B 1 44  ? -39.044 53.268  22.192  1.00 42.39  ? 70  LYS B C     1 
ATOM   2848 O O     . LYS B 1 44  ? -38.655 54.411  22.429  1.00 59.53  ? 70  LYS B O     1 
ATOM   2849 C CB    . LYS B 1 44  ? -41.225 52.814  21.033  1.00 34.06  ? 70  LYS B CB    1 
ATOM   2850 C CG    . LYS B 1 44  ? -41.908 54.117  21.426  1.00 36.90  ? 70  LYS B CG    1 
ATOM   2851 C CD    . LYS B 1 44  ? -43.406 53.924  21.612  1.00 60.17  ? 70  LYS B CD    1 
ATOM   2852 C CE    . LYS B 1 44  ? -44.089 55.224  22.006  1.00 74.68  ? 70  LYS B CE    1 
ATOM   2853 N NZ    . LYS B 1 44  ? -45.536 55.027  22.297  1.00 88.33  ? 70  LYS B NZ    1 
ATOM   2854 N N     . ALA B 1 45  ? -38.910 52.264  23.054  1.00 30.78  ? 71  ALA B N     1 
ATOM   2855 C CA    . ALA B 1 45  ? -38.326 52.460  24.377  1.00 38.60  ? 71  ALA B CA    1 
ATOM   2856 C C     . ALA B 1 45  ? -36.844 52.822  24.305  1.00 46.91  ? 71  ALA B C     1 
ATOM   2857 O O     . ALA B 1 45  ? -36.367 53.671  25.058  1.00 50.49  ? 71  ALA B O     1 
ATOM   2858 C CB    . ALA B 1 45  ? -38.528 51.222  25.234  1.00 38.90  ? 71  ALA B CB    1 
ATOM   2859 N N     . VAL B 1 46  ? -36.120 52.173  23.399  1.00 42.95  ? 72  VAL B N     1 
ATOM   2860 C CA    . VAL B 1 46  ? -34.686 52.408  23.263  1.00 42.06  ? 72  VAL B CA    1 
ATOM   2861 C C     . VAL B 1 46  ? -34.395 53.786  22.661  1.00 42.93  ? 72  VAL B C     1 
ATOM   2862 O O     . VAL B 1 46  ? -33.305 54.332  22.840  1.00 33.36  ? 72  VAL B O     1 
ATOM   2863 C CB    . VAL B 1 46  ? -34.003 51.301  22.431  1.00 33.39  ? 72  VAL B CB    1 
ATOM   2864 C CG1   . VAL B 1 46  ? -34.512 51.316  21.005  1.00 58.65  ? 72  VAL B CG1   1 
ATOM   2865 C CG2   . VAL B 1 46  ? -32.492 51.466  22.460  1.00 35.68  ? 72  VAL B CG2   1 
ATOM   2866 N N     . VAL B 1 47  ? -35.374 54.344  21.954  1.00 44.28  ? 73  VAL B N     1 
ATOM   2867 C CA    . VAL B 1 47  ? -35.259 55.702  21.432  1.00 29.51  ? 73  VAL B CA    1 
ATOM   2868 C C     . VAL B 1 47  ? -35.401 56.711  22.566  1.00 30.15  ? 73  VAL B C     1 
ATOM   2869 O O     . VAL B 1 47  ? -34.591 57.628  22.700  1.00 31.15  ? 73  VAL B O     1 
ATOM   2870 C CB    . VAL B 1 47  ? -36.324 55.999  20.360  1.00 29.61  ? 73  VAL B CB    1 
ATOM   2871 C CG1   . VAL B 1 47  ? -36.410 57.494  20.099  1.00 28.00  ? 73  VAL B CG1   1 
ATOM   2872 C CG2   . VAL B 1 47  ? -36.013 55.245  19.079  1.00 28.21  ? 73  VAL B CG2   1 
ATOM   2873 N N     . TYR B 1 48  ? -36.437 56.535  23.380  1.00 29.01  ? 74  TYR B N     1 
ATOM   2874 C CA    . TYR B 1 48  ? -36.627 57.373  24.556  1.00 39.61  ? 74  TYR B CA    1 
ATOM   2875 C C     . TYR B 1 48  ? -35.419 57.266  25.480  1.00 41.62  ? 74  TYR B C     1 
ATOM   2876 O O     . TYR B 1 48  ? -34.923 58.271  25.988  1.00 50.00  ? 74  TYR B O     1 
ATOM   2877 C CB    . TYR B 1 48  ? -37.897 56.974  25.310  1.00 55.16  ? 74  TYR B CB    1 
ATOM   2878 C CG    . TYR B 1 48  ? -39.180 57.284  24.571  1.00 58.35  ? 74  TYR B CG    1 
ATOM   2879 C CD1   . TYR B 1 48  ? -39.284 58.406  23.759  1.00 42.94  ? 74  TYR B CD1   1 
ATOM   2880 C CD2   . TYR B 1 48  ? -40.294 56.466  24.702  1.00 59.91  ? 74  TYR B CD2   1 
ATOM   2881 C CE1   . TYR B 1 48  ? -40.456 58.696  23.088  1.00 44.17  ? 74  TYR B CE1   1 
ATOM   2882 C CE2   . TYR B 1 48  ? -41.472 56.749  24.036  1.00 60.67  ? 74  TYR B CE2   1 
ATOM   2883 C CZ    . TYR B 1 48  ? -41.547 57.865  23.230  1.00 52.95  ? 74  TYR B CZ    1 
ATOM   2884 O OH    . TYR B 1 48  ? -42.717 58.152  22.564  1.00 47.53  ? 74  TYR B OH    1 
ATOM   2885 N N     . SER B 1 49  ? -34.949 56.040  25.688  1.00 30.25  ? 75  SER B N     1 
ATOM   2886 C CA    . SER B 1 49  ? -33.789 55.798  26.537  1.00 35.16  ? 75  SER B CA    1 
ATOM   2887 C C     . SER B 1 49  ? -32.567 56.554  26.028  1.00 41.52  ? 75  SER B C     1 
ATOM   2888 O O     . SER B 1 49  ? -31.956 57.328  26.765  1.00 47.91  ? 75  SER B O     1 
ATOM   2889 C CB    . SER B 1 49  ? -33.487 54.301  26.622  1.00 45.59  ? 75  SER B CB    1 
ATOM   2890 O OG    . SER B 1 49  ? -34.521 53.609  27.301  1.00 47.96  ? 75  SER B OG    1 
ATOM   2891 N N     . ASN B 1 50  ? -32.218 56.327  24.766  1.00 38.25  ? 76  ASN B N     1 
ATOM   2892 C CA    . ASN B 1 50  ? -31.069 56.991  24.157  1.00 44.91  ? 76  ASN B CA    1 
ATOM   2893 C C     . ASN B 1 50  ? -31.138 58.510  24.274  1.00 44.39  ? 76  ASN B C     1 
ATOM   2894 O O     . ASN B 1 50  ? -30.156 59.159  24.630  1.00 57.28  ? 76  ASN B O     1 
ATOM   2895 C CB    . ASN B 1 50  ? -30.926 56.584  22.689  1.00 34.37  ? 76  ASN B CB    1 
ATOM   2896 C CG    . ASN B 1 50  ? -30.498 55.139  22.524  1.00 35.92  ? 76  ASN B CG    1 
ATOM   2897 O OD1   . ASN B 1 50  ? -30.620 54.564  21.444  1.00 38.69  ? 76  ASN B OD1   1 
ATOM   2898 N ND2   . ASN B 1 50  ? -29.995 54.544  23.599  1.00 39.91  ? 76  ASN B ND2   1 
ATOM   2899 N N     . THR B 1 51  ? -32.304 59.071  23.972  1.00 27.12  ? 77  THR B N     1 
ATOM   2900 C CA    . THR B 1 51  ? -32.499 60.511  24.064  1.00 30.63  ? 77  THR B CA    1 
ATOM   2901 C C     . THR B 1 51  ? -32.090 61.030  25.435  1.00 38.36  ? 77  THR B C     1 
ATOM   2902 O O     . THR B 1 51  ? -31.255 61.928  25.549  1.00 40.86  ? 77  THR B O     1 
ATOM   2903 C CB    . THR B 1 51  ? -33.965 60.891  23.816  1.00 28.66  ? 77  THR B CB    1 
ATOM   2904 O OG1   . THR B 1 51  ? -34.369 60.428  22.523  1.00 19.11  ? 77  THR B OG1   1 
ATOM   2905 C CG2   . THR B 1 51  ? -34.139 62.400  23.892  1.00 38.65  ? 77  THR B CG2   1 
ATOM   2906 N N     . ILE B 1 52  ? -32.686 60.455  26.474  1.00 28.39  ? 78  ILE B N     1 
ATOM   2907 C CA    . ILE B 1 52  ? -32.400 60.852  27.846  1.00 30.30  ? 78  ILE B CA    1 
ATOM   2908 C C     . ILE B 1 52  ? -30.921 60.687  28.174  1.00 46.58  ? 78  ILE B C     1 
ATOM   2909 O O     . ILE B 1 52  ? -30.276 61.614  28.662  1.00 47.42  ? 78  ILE B O     1 
ATOM   2910 C CB    . ILE B 1 52  ? -33.220 60.024  28.843  1.00 29.92  ? 78  ILE B CB    1 
ATOM   2911 C CG1   . ILE B 1 52  ? -34.710 60.106  28.503  1.00 38.46  ? 78  ILE B CG1   1 
ATOM   2912 C CG2   . ILE B 1 52  ? -32.961 60.498  30.259  1.00 27.13  ? 78  ILE B CG2   1 
ATOM   2913 C CD1   . ILE B 1 52  ? -35.585 59.224  29.371  1.00 38.30  ? 78  ILE B CD1   1 
ATOM   2914 N N     . GLN B 1 53  ? -30.392 59.499  27.907  1.00 50.32  ? 79  GLN B N     1 
ATOM   2915 C CA    . GLN B 1 53  ? -28.982 59.220  28.144  1.00 39.28  ? 79  GLN B CA    1 
ATOM   2916 C C     . GLN B 1 53  ? -28.109 60.308  27.530  1.00 37.21  ? 79  GLN B C     1 
ATOM   2917 O O     . GLN B 1 53  ? -27.100 60.709  28.108  1.00 45.41  ? 79  GLN B O     1 
ATOM   2918 C CB    . GLN B 1 53  ? -28.606 57.854  27.568  1.00 40.32  ? 79  GLN B CB    1 
ATOM   2919 C CG    . GLN B 1 53  ? -29.323 56.685  28.228  1.00 59.90  ? 79  GLN B CG    1 
ATOM   2920 C CD    . GLN B 1 53  ? -29.119 55.377  27.485  1.00 71.59  ? 79  GLN B CD    1 
ATOM   2921 O OE1   . GLN B 1 53  ? -28.765 55.368  26.306  1.00 70.95  ? 79  GLN B OE1   1 
ATOM   2922 N NE2   . GLN B 1 53  ? -29.346 54.264  28.173  1.00 72.53  ? 79  GLN B NE2   1 
ATOM   2923 N N     . SER B 1 54  ? -28.513 60.787  26.357  1.00 29.59  ? 80  SER B N     1 
ATOM   2924 C CA    . SER B 1 54  ? -27.760 61.810  25.644  1.00 18.45  ? 80  SER B CA    1 
ATOM   2925 C C     . SER B 1 54  ? -27.764 63.133  26.398  1.00 36.71  ? 80  SER B C     1 
ATOM   2926 O O     . SER B 1 54  ? -26.707 63.676  26.720  1.00 50.37  ? 80  SER B O     1 
ATOM   2927 C CB    . SER B 1 54  ? -28.330 62.007  24.241  1.00 22.91  ? 80  SER B CB    1 
ATOM   2928 O OG    . SER B 1 54  ? -28.297 60.797  23.505  1.00 35.18  ? 80  SER B OG    1 
ATOM   2929 N N     . ILE B 1 55  ? -28.956 63.651  26.675  1.00 39.39  ? 81  ILE B N     1 
ATOM   2930 C CA    . ILE B 1 55  ? -29.082 64.922  27.378  1.00 39.22  ? 81  ILE B CA    1 
ATOM   2931 C C     . ILE B 1 55  ? -28.475 64.830  28.772  1.00 38.21  ? 81  ILE B C     1 
ATOM   2932 O O     . ILE B 1 55  ? -27.928 65.804  29.286  1.00 39.65  ? 81  ILE B O     1 
ATOM   2933 C CB    . ILE B 1 55  ? -30.554 65.383  27.475  1.00 33.58  ? 81  ILE B CB    1 
ATOM   2934 C CG1   . ILE B 1 55  ? -30.648 66.718  28.218  1.00 20.21  ? 81  ILE B CG1   1 
ATOM   2935 C CG2   . ILE B 1 55  ? -31.405 64.329  28.162  1.00 32.39  ? 81  ILE B CG2   1 
ATOM   2936 C CD1   . ILE B 1 55  ? -29.949 67.861  27.513  1.00 18.53  ? 81  ILE B CD1   1 
ATOM   2937 N N     . ILE B 1 56  ? -28.568 63.650  29.376  1.00 35.35  ? 82  ILE B N     1 
ATOM   2938 C CA    . ILE B 1 56  ? -27.991 63.425  30.695  1.00 29.51  ? 82  ILE B CA    1 
ATOM   2939 C C     . ILE B 1 56  ? -26.472 63.527  30.651  1.00 28.22  ? 82  ILE B C     1 
ATOM   2940 O O     . ILE B 1 56  ? -25.868 64.245  31.445  1.00 20.20  ? 82  ILE B O     1 
ATOM   2941 C CB    . ILE B 1 56  ? -28.392 62.056  31.264  1.00 27.97  ? 82  ILE B CB    1 
ATOM   2942 C CG1   . ILE B 1 56  ? -29.832 62.100  31.779  1.00 35.63  ? 82  ILE B CG1   1 
ATOM   2943 C CG2   . ILE B 1 56  ? -27.443 61.648  32.379  1.00 15.77  ? 82  ILE B CG2   1 
ATOM   2944 C CD1   . ILE B 1 56  ? -30.264 60.841  32.498  1.00 38.92  ? 82  ILE B CD1   1 
ATOM   2945 N N     . ALA B 1 57  ? -25.862 62.806  29.716  1.00 41.60  ? 83  ALA B N     1 
ATOM   2946 C CA    . ALA B 1 57  ? -24.416 62.847  29.538  1.00 34.02  ? 83  ALA B CA    1 
ATOM   2947 C C     . ALA B 1 57  ? -23.943 64.285  29.360  1.00 28.74  ? 83  ALA B C     1 
ATOM   2948 O O     . ALA B 1 57  ? -22.869 64.660  29.833  1.00 33.75  ? 83  ALA B O     1 
ATOM   2949 C CB    . ALA B 1 57  ? -24.006 62.001  28.347  1.00 26.65  ? 83  ALA B CB    1 
ATOM   2950 N N     . ILE B 1 58  ? -24.756 65.084  28.678  1.00 33.40  ? 84  ILE B N     1 
ATOM   2951 C CA    . ILE B 1 58  ? -24.445 66.489  28.448  1.00 34.20  ? 84  ILE B CA    1 
ATOM   2952 C C     . ILE B 1 58  ? -24.541 67.291  29.738  1.00 30.15  ? 84  ILE B C     1 
ATOM   2953 O O     . ILE B 1 58  ? -23.695 68.141  30.014  1.00 42.08  ? 84  ILE B O     1 
ATOM   2954 C CB    . ILE B 1 58  ? -25.387 67.110  27.403  1.00 33.17  ? 84  ILE B CB    1 
ATOM   2955 C CG1   . ILE B 1 58  ? -25.257 66.375  26.069  1.00 25.79  ? 84  ILE B CG1   1 
ATOM   2956 C CG2   . ILE B 1 58  ? -25.092 68.594  27.235  1.00 18.91  ? 84  ILE B CG2   1 
ATOM   2957 C CD1   . ILE B 1 58  ? -26.114 66.955  24.972  1.00 39.00  ? 84  ILE B CD1   1 
ATOM   2958 N N     . ILE B 1 59  ? -25.579 67.020  30.522  1.00 31.81  ? 85  ILE B N     1 
ATOM   2959 C CA    . ILE B 1 59  ? -25.768 67.697  31.799  1.00 39.59  ? 85  ILE B CA    1 
ATOM   2960 C C     . ILE B 1 59  ? -24.612 67.401  32.745  1.00 42.38  ? 85  ILE B C     1 
ATOM   2961 O O     . ILE B 1 59  ? -24.075 68.305  33.384  1.00 50.02  ? 85  ILE B O     1 
ATOM   2962 C CB    . ILE B 1 59  ? -27.088 67.282  32.472  1.00 42.59  ? 85  ILE B CB    1 
ATOM   2963 C CG1   . ILE B 1 59  ? -28.279 67.720  31.618  1.00 34.36  ? 85  ILE B CG1   1 
ATOM   2964 C CG2   . ILE B 1 59  ? -27.184 67.877  33.868  1.00 38.49  ? 85  ILE B CG2   1 
ATOM   2965 C CD1   . ILE B 1 59  ? -28.311 69.204  31.339  1.00 36.35  ? 85  ILE B CD1   1 
ATOM   2966 N N     . ARG B 1 60  ? -24.232 66.131  32.830  1.00 44.08  ? 86  ARG B N     1 
ATOM   2967 C CA    . ARG B 1 60  ? -23.106 65.729  33.662  1.00 44.28  ? 86  ARG B CA    1 
ATOM   2968 C C     . ARG B 1 60  ? -21.849 66.486  33.261  1.00 46.31  ? 86  ARG B C     1 
ATOM   2969 O O     . ARG B 1 60  ? -21.133 67.018  34.111  1.00 40.40  ? 86  ARG B O     1 
ATOM   2970 C CB    . ARG B 1 60  ? -22.867 64.220  33.566  1.00 42.21  ? 86  ARG B CB    1 
ATOM   2971 C CG    . ARG B 1 60  ? -23.975 63.385  34.180  1.00 59.83  ? 86  ARG B CG    1 
ATOM   2972 C CD    . ARG B 1 60  ? -23.417 62.199  34.950  1.00 70.76  ? 86  ARG B CD    1 
ATOM   2973 N NE    . ARG B 1 60  ? -24.447 61.550  35.756  1.00 71.46  ? 86  ARG B NE    1 
ATOM   2974 C CZ    . ARG B 1 60  ? -25.218 60.560  35.322  1.00 63.41  ? 86  ARG B CZ    1 
ATOM   2975 N NH1   . ARG B 1 60  ? -25.074 60.097  34.086  1.00 58.31  ? 86  ARG B NH1   1 
ATOM   2976 N NH2   . ARG B 1 60  ? -26.133 60.031  36.123  1.00 45.39  ? 86  ARG B NH2   1 
ATOM   2977 N N     . ALA B 1 61  ? -21.589 66.533  31.958  1.00 45.01  ? 87  ALA B N     1 
ATOM   2978 C CA    . ALA B 1 61  ? -20.423 67.233  31.437  1.00 36.97  ? 87  ALA B CA    1 
ATOM   2979 C C     . ALA B 1 61  ? -20.390 68.680  31.919  1.00 34.46  ? 87  ALA B C     1 
ATOM   2980 O O     . ALA B 1 61  ? -19.325 69.222  32.204  1.00 31.96  ? 87  ALA B O     1 
ATOM   2981 C CB    . ALA B 1 61  ? -20.403 67.172  29.920  1.00 36.22  ? 87  ALA B CB    1 
ATOM   2982 N N     . MET B 1 62  ? -21.564 69.298  32.014  1.00 40.48  ? 88  MET B N     1 
ATOM   2983 C CA    . MET B 1 62  ? -21.665 70.682  32.462  1.00 40.23  ? 88  MET B CA    1 
ATOM   2984 C C     . MET B 1 62  ? -21.166 70.838  33.893  1.00 46.61  ? 88  MET B C     1 
ATOM   2985 O O     . MET B 1 62  ? -20.671 71.898  34.275  1.00 49.05  ? 88  MET B O     1 
ATOM   2986 C CB    . MET B 1 62  ? -23.107 71.177  32.359  1.00 32.22  ? 88  MET B CB    1 
ATOM   2987 C CG    . MET B 1 62  ? -23.685 71.108  30.959  1.00 34.05  ? 88  MET B CG    1 
ATOM   2988 S SD    . MET B 1 62  ? -25.366 71.746  30.888  1.00 79.96  ? 88  MET B SD    1 
ATOM   2989 C CE    . MET B 1 62  ? -25.100 73.432  31.428  1.00 11.28  ? 88  MET B CE    1 
ATOM   2990 N N     . GLY B 1 63  ? -21.302 69.778  34.680  1.00 57.39  ? 89  GLY B N     1 
ATOM   2991 C CA    . GLY B 1 63  ? -20.839 69.789  36.055  1.00 54.92  ? 89  GLY B CA    1 
ATOM   2992 C C     . GLY B 1 63  ? -19.358 69.486  36.150  1.00 56.92  ? 89  GLY B C     1 
ATOM   2993 O O     . GLY B 1 63  ? -18.666 69.990  37.034  1.00 77.38  ? 89  GLY B O     1 
ATOM   2994 N N     . ARG B 1 64  ? -18.871 68.659  35.231  1.00 46.70  ? 90  ARG B N     1 
ATOM   2995 C CA    . ARG B 1 64  ? -17.465 68.277  35.207  1.00 44.09  ? 90  ARG B CA    1 
ATOM   2996 C C     . ARG B 1 64  ? -16.601 69.326  34.510  1.00 50.84  ? 90  ARG B C     1 
ATOM   2997 O O     . ARG B 1 64  ? -15.386 69.366  34.705  1.00 74.49  ? 90  ARG B O     1 
ATOM   2998 C CB    . ARG B 1 64  ? -17.291 66.911  34.535  1.00 57.30  ? 90  ARG B CB    1 
ATOM   2999 C CG    . ARG B 1 64  ? -17.846 65.750  35.350  1.00 72.79  ? 90  ARG B CG    1 
ATOM   3000 C CD    . ARG B 1 64  ? -17.691 64.412  34.634  1.00 82.52  ? 90  ARG B CD    1 
ATOM   3001 N NE    . ARG B 1 64  ? -18.742 64.180  33.644  1.00 82.61  ? 90  ARG B NE    1 
ATOM   3002 C CZ    . ARG B 1 64  ? -18.566 64.260  32.328  1.00 71.55  ? 90  ARG B CZ    1 
ATOM   3003 N NH1   . ARG B 1 64  ? -17.373 64.562  31.833  1.00 76.59  ? 90  ARG B NH1   1 
ATOM   3004 N NH2   . ARG B 1 64  ? -19.583 64.031  31.506  1.00 49.62  ? 90  ARG B NH2   1 
ATOM   3005 N N     . LEU B 1 65  ? -17.231 70.175  33.705  1.00 39.82  ? 91  LEU B N     1 
ATOM   3006 C CA    . LEU B 1 65  ? -16.507 71.189  32.943  1.00 45.51  ? 91  LEU B CA    1 
ATOM   3007 C C     . LEU B 1 65  ? -16.733 72.596  33.488  1.00 46.17  ? 91  LEU B C     1 
ATOM   3008 O O     . LEU B 1 65  ? -16.216 73.569  32.937  1.00 50.35  ? 91  LEU B O     1 
ATOM   3009 C CB    . LEU B 1 65  ? -16.905 71.138  31.465  1.00 51.98  ? 91  LEU B CB    1 
ATOM   3010 C CG    . LEU B 1 65  ? -16.609 69.834  30.722  1.00 49.67  ? 91  LEU B CG    1 
ATOM   3011 C CD1   . LEU B 1 65  ? -17.150 69.895  29.299  1.00 37.59  ? 91  LEU B CD1   1 
ATOM   3012 C CD2   . LEU B 1 65  ? -15.114 69.539  30.726  1.00 47.03  ? 91  LEU B CD2   1 
ATOM   3013 N N     . LYS B 1 66  ? -17.504 72.693  34.567  1.00 38.64  ? 92  LYS B N     1 
ATOM   3014 C CA    . LYS B 1 66  ? -17.813 73.978  35.191  1.00 39.15  ? 92  LYS B CA    1 
ATOM   3015 C C     . LYS B 1 66  ? -18.536 74.905  34.214  1.00 38.94  ? 92  LYS B C     1 
ATOM   3016 O O     . LYS B 1 66  ? -18.217 76.090  34.112  1.00 51.59  ? 92  LYS B O     1 
ATOM   3017 C CB    . LYS B 1 66  ? -16.535 74.641  35.715  1.00 59.97  ? 92  LYS B CB    1 
ATOM   3018 C CG    . LYS B 1 66  ? -16.763 75.828  36.644  1.00 74.50  ? 92  LYS B CG    1 
ATOM   3019 C CD    . LYS B 1 66  ? -17.320 75.389  37.989  1.00 83.71  ? 92  LYS B CD    1 
ATOM   3020 C CE    . LYS B 1 66  ? -17.430 76.565  38.950  1.00 79.63  ? 92  LYS B CE    1 
ATOM   3021 N NZ    . LYS B 1 66  ? -17.914 76.149  40.298  1.00 64.04  ? 92  LYS B NZ    1 
ATOM   3022 N N     . ILE B 1 67  ? -19.509 74.356  33.493  1.00 31.73  ? 93  ILE B N     1 
ATOM   3023 C CA    . ILE B 1 67  ? -20.306 75.136  32.553  1.00 33.71  ? 93  ILE B CA    1 
ATOM   3024 C C     . ILE B 1 67  ? -21.687 75.424  33.134  1.00 41.29  ? 93  ILE B C     1 
ATOM   3025 O O     . ILE B 1 67  ? -22.424 74.503  33.490  1.00 39.49  ? 93  ILE B O     1 
ATOM   3026 C CB    . ILE B 1 67  ? -20.462 74.409  31.201  1.00 33.82  ? 93  ILE B CB    1 
ATOM   3027 C CG1   . ILE B 1 67  ? -19.090 74.090  30.604  1.00 39.63  ? 93  ILE B CG1   1 
ATOM   3028 C CG2   . ILE B 1 67  ? -21.282 75.247  30.235  1.00 26.61  ? 93  ILE B CG2   1 
ATOM   3029 C CD1   . ILE B 1 67  ? -19.151 73.364  29.280  1.00 23.57  ? 93  ILE B CD1   1 
ATOM   3030 N N     . ASP B 1 68  ? -22.031 76.705  33.228  1.00 34.60  ? 94  ASP B N     1 
ATOM   3031 C CA    . ASP B 1 68  ? -23.305 77.118  33.810  1.00 27.02  ? 94  ASP B CA    1 
ATOM   3032 C C     . ASP B 1 68  ? -24.438 77.105  32.787  1.00 44.61  ? 94  ASP B C     1 
ATOM   3033 O O     . ASP B 1 68  ? -24.203 77.052  31.579  1.00 40.72  ? 94  ASP B O     1 
ATOM   3034 C CB    . ASP B 1 68  ? -23.186 78.515  34.426  1.00 29.47  ? 94  ASP B CB    1 
ATOM   3035 C CG    . ASP B 1 68  ? -22.208 78.564  35.583  1.00 59.62  ? 94  ASP B CG    1 
ATOM   3036 O OD1   . ASP B 1 68  ? -21.603 77.517  35.901  1.00 74.23  ? 94  ASP B OD1   1 
ATOM   3037 O OD2   . ASP B 1 68  ? -22.046 79.651  36.176  1.00 67.13  ? 94  ASP B OD2   1 
ATOM   3038 N N     . PHE B 1 69  ? -25.670 77.156  33.285  1.00 47.14  ? 95  PHE B N     1 
ATOM   3039 C CA    . PHE B 1 69  ? -26.844 77.235  32.426  1.00 38.72  ? 95  PHE B CA    1 
ATOM   3040 C C     . PHE B 1 69  ? -27.050 78.664  31.944  1.00 37.85  ? 95  PHE B C     1 
ATOM   3041 O O     . PHE B 1 69  ? -26.778 79.617  32.674  1.00 49.40  ? 95  PHE B O     1 
ATOM   3042 C CB    . PHE B 1 69  ? -28.095 76.772  33.177  1.00 50.07  ? 95  PHE B CB    1 
ATOM   3043 C CG    . PHE B 1 69  ? -28.094 75.312  33.521  1.00 47.51  ? 95  PHE B CG    1 
ATOM   3044 C CD1   . PHE B 1 69  ? -28.376 74.359  32.556  1.00 56.70  ? 95  PHE B CD1   1 
ATOM   3045 C CD2   . PHE B 1 69  ? -27.826 74.892  34.812  1.00 41.25  ? 95  PHE B CD2   1 
ATOM   3046 C CE1   . PHE B 1 69  ? -28.380 73.013  32.870  1.00 58.99  ? 95  PHE B CE1   1 
ATOM   3047 C CE2   . PHE B 1 69  ? -27.829 73.548  35.134  1.00 48.88  ? 95  PHE B CE2   1 
ATOM   3048 C CZ    . PHE B 1 69  ? -28.106 72.607  34.161  1.00 50.28  ? 95  PHE B CZ    1 
ATOM   3049 N N     . GLY B 1 70  ? -27.535 78.808  30.714  1.00 36.10  ? 96  GLY B N     1 
ATOM   3050 C CA    . GLY B 1 70  ? -27.875 80.115  30.187  1.00 50.00  ? 96  GLY B CA    1 
ATOM   3051 C C     . GLY B 1 70  ? -28.887 80.777  31.098  1.00 65.92  ? 96  GLY B C     1 
ATOM   3052 O O     . GLY B 1 70  ? -28.708 81.916  31.532  1.00 66.39  ? 96  GLY B O     1 
ATOM   3053 N N     . ASP B 1 71  ? -29.958 80.047  31.391  1.00 73.04  ? 97  ASP B N     1 
ATOM   3054 C CA    . ASP B 1 71  ? -30.949 80.490  32.359  1.00 72.39  ? 97  ASP B CA    1 
ATOM   3055 C C     . ASP B 1 71  ? -30.779 79.689  33.644  1.00 54.07  ? 97  ASP B C     1 
ATOM   3056 O O     . ASP B 1 71  ? -30.824 78.460  33.627  1.00 48.70  ? 97  ASP B O     1 
ATOM   3057 C CB    . ASP B 1 71  ? -32.362 80.313  31.803  1.00 86.63  ? 97  ASP B CB    1 
ATOM   3058 C CG    . ASP B 1 71  ? -33.432 80.835  32.746  1.00 103.10 ? 97  ASP B CG    1 
ATOM   3059 O OD1   . ASP B 1 71  ? -33.077 81.368  33.820  1.00 101.83 ? 97  ASP B OD1   1 
ATOM   3060 O OD2   . ASP B 1 71  ? -34.630 80.713  32.413  1.00 113.68 ? 97  ASP B OD2   1 
ATOM   3061 N N     . SER B 1 72  ? -30.575 80.391  34.753  1.00 51.01  ? 98  SER B N     1 
ATOM   3062 C CA    . SER B 1 72  ? -30.367 79.746  36.044  1.00 43.82  ? 98  SER B CA    1 
ATOM   3063 C C     . SER B 1 72  ? -31.539 78.846  36.432  1.00 50.37  ? 98  SER B C     1 
ATOM   3064 O O     . SER B 1 72  ? -31.388 77.926  37.236  1.00 54.67  ? 98  SER B O     1 
ATOM   3065 C CB    . SER B 1 72  ? -30.126 80.799  37.128  1.00 56.04  ? 98  SER B CB    1 
ATOM   3066 O OG    . SER B 1 72  ? -31.137 81.793  37.107  1.00 71.56  ? 98  SER B OG    1 
ATOM   3067 N N     . ALA B 1 73  ? -32.705 79.115  35.854  1.00 52.86  ? 99  ALA B N     1 
ATOM   3068 C CA    . ALA B 1 73  ? -33.903 78.339  36.152  1.00 44.11  ? 99  ALA B CA    1 
ATOM   3069 C C     . ALA B 1 73  ? -33.813 76.916  35.603  1.00 38.96  ? 99  ALA B C     1 
ATOM   3070 O O     . ALA B 1 73  ? -34.526 76.021  36.058  1.00 30.43  ? 99  ALA B O     1 
ATOM   3071 C CB    . ALA B 1 73  ? -35.135 79.043  35.606  1.00 46.35  ? 99  ALA B CB    1 
ATOM   3072 N N     . ARG B 1 74  ? -32.935 76.714  34.625  1.00 47.49  ? 100 ARG B N     1 
ATOM   3073 C CA    . ARG B 1 74  ? -32.770 75.407  33.996  1.00 43.22  ? 100 ARG B CA    1 
ATOM   3074 C C     . ARG B 1 74  ? -32.162 74.399  34.967  1.00 44.57  ? 100 ARG B C     1 
ATOM   3075 O O     . ARG B 1 74  ? -32.226 73.189  34.744  1.00 42.97  ? 100 ARG B O     1 
ATOM   3076 C CB    . ARG B 1 74  ? -31.905 75.517  32.738  1.00 23.94  ? 100 ARG B CB    1 
ATOM   3077 C CG    . ARG B 1 74  ? -32.412 76.516  31.703  1.00 35.40  ? 100 ARG B CG    1 
ATOM   3078 C CD    . ARG B 1 74  ? -33.608 75.983  30.928  1.00 43.44  ? 100 ARG B CD    1 
ATOM   3079 N NE    . ARG B 1 74  ? -34.777 75.777  31.779  1.00 45.41  ? 100 ARG B NE    1 
ATOM   3080 C CZ    . ARG B 1 74  ? -35.698 76.704  32.019  1.00 49.48  ? 100 ARG B CZ    1 
ATOM   3081 N NH1   . ARG B 1 74  ? -35.590 77.908  31.472  1.00 36.84  ? 100 ARG B NH1   1 
ATOM   3082 N NH2   . ARG B 1 74  ? -36.729 76.427  32.806  1.00 68.95  ? 100 ARG B NH2   1 
ATOM   3083 N N     . ALA B 1 75  ? -31.569 74.904  36.043  1.00 36.03  ? 101 ALA B N     1 
ATOM   3084 C CA    . ALA B 1 75  ? -31.008 74.045  37.076  1.00 40.08  ? 101 ALA B CA    1 
ATOM   3085 C C     . ALA B 1 75  ? -32.098 73.156  37.663  1.00 54.20  ? 101 ALA B C     1 
ATOM   3086 O O     . ALA B 1 75  ? -31.873 71.977  37.937  1.00 53.37  ? 101 ALA B O     1 
ATOM   3087 C CB    . ALA B 1 75  ? -30.356 74.880  38.163  1.00 36.22  ? 101 ALA B CB    1 
ATOM   3088 N N     . ASP B 1 76  ? -33.282 73.731  37.851  1.00 58.55  ? 102 ASP B N     1 
ATOM   3089 C CA    . ASP B 1 76  ? -34.427 72.984  38.352  1.00 57.35  ? 102 ASP B CA    1 
ATOM   3090 C C     . ASP B 1 76  ? -34.818 71.871  37.386  1.00 56.24  ? 102 ASP B C     1 
ATOM   3091 O O     . ASP B 1 76  ? -35.036 70.729  37.792  1.00 55.12  ? 102 ASP B O     1 
ATOM   3092 C CB    . ASP B 1 76  ? -35.618 73.915  38.572  1.00 62.90  ? 102 ASP B CB    1 
ATOM   3093 C CG    . ASP B 1 76  ? -36.873 73.167  38.968  1.00 79.55  ? 102 ASP B CG    1 
ATOM   3094 O OD1   . ASP B 1 76  ? -36.788 72.299  39.863  1.00 79.75  ? 102 ASP B OD1   1 
ATOM   3095 O OD2   . ASP B 1 76  ? -37.943 73.444  38.385  1.00 90.94  ? 102 ASP B OD2   1 
ATOM   3096 N N     . ASP B 1 77  ? -34.910 72.213  36.105  1.00 44.63  ? 103 ASP B N     1 
ATOM   3097 C CA    . ASP B 1 77  ? -35.267 71.238  35.081  1.00 36.28  ? 103 ASP B CA    1 
ATOM   3098 C C     . ASP B 1 77  ? -34.277 70.078  35.059  1.00 37.99  ? 103 ASP B C     1 
ATOM   3099 O O     . ASP B 1 77  ? -34.650 68.937  34.789  1.00 43.09  ? 103 ASP B O     1 
ATOM   3100 C CB    . ASP B 1 77  ? -35.338 71.901  33.703  1.00 25.99  ? 103 ASP B CB    1 
ATOM   3101 C CG    . ASP B 1 77  ? -36.509 72.856  33.573  1.00 52.08  ? 103 ASP B CG    1 
ATOM   3102 O OD1   . ASP B 1 77  ? -37.235 73.054  34.571  1.00 69.40  ? 103 ASP B OD1   1 
ATOM   3103 O OD2   . ASP B 1 77  ? -36.706 73.409  32.471  1.00 57.04  ? 103 ASP B OD2   1 
ATOM   3104 N N     . ALA B 1 78  ? -33.014 70.379  35.349  1.00 36.79  ? 104 ALA B N     1 
ATOM   3105 C CA    . ALA B 1 78  ? -31.969 69.361  35.370  1.00 26.54  ? 104 ALA B CA    1 
ATOM   3106 C C     . ALA B 1 78  ? -32.245 68.310  36.442  1.00 37.86  ? 104 ALA B C     1 
ATOM   3107 O O     . ALA B 1 78  ? -32.164 67.108  36.182  1.00 22.94  ? 104 ALA B O     1 
ATOM   3108 C CB    . ALA B 1 78  ? -30.613 70.001  35.590  1.00 22.33  ? 104 ALA B CB    1 
ATOM   3109 N N     . ARG B 1 79  ? -32.568 68.768  37.648  1.00 34.29  ? 105 ARG B N     1 
ATOM   3110 C CA    . ARG B 1 79  ? -32.927 67.861  38.728  1.00 32.87  ? 105 ARG B CA    1 
ATOM   3111 C C     . ARG B 1 79  ? -34.169 67.079  38.323  1.00 36.41  ? 105 ARG B C     1 
ATOM   3112 O O     . ARG B 1 79  ? -34.217 65.855  38.452  1.00 42.23  ? 105 ARG B O     1 
ATOM   3113 C CB    . ARG B 1 79  ? -33.194 68.636  40.018  1.00 46.81  ? 105 ARG B CB    1 
ATOM   3114 C CG    . ARG B 1 79  ? -32.164 69.713  40.326  1.00 63.50  ? 105 ARG B CG    1 
ATOM   3115 C CD    . ARG B 1 79  ? -32.499 70.450  41.615  1.00 64.33  ? 105 ARG B CD    1 
ATOM   3116 N NE    . ARG B 1 79  ? -31.843 71.753  41.688  1.00 74.17  ? 105 ARG B NE    1 
ATOM   3117 C CZ    . ARG B 1 79  ? -30.610 71.947  42.144  1.00 86.26  ? 105 ARG B CZ    1 
ATOM   3118 N NH1   . ARG B 1 79  ? -29.889 70.920  42.572  1.00 86.39  ? 105 ARG B NH1   1 
ATOM   3119 N NH2   . ARG B 1 79  ? -30.096 73.169  42.171  1.00 91.37  ? 105 ARG B NH2   1 
ATOM   3120 N N     . GLN B 1 80  ? -35.168 67.800  37.822  1.00 31.94  ? 106 GLN B N     1 
ATOM   3121 C CA    . GLN B 1 80  ? -36.427 67.200  37.398  1.00 47.70  ? 106 GLN B CA    1 
ATOM   3122 C C     . GLN B 1 80  ? -36.208 66.075  36.395  1.00 42.57  ? 106 GLN B C     1 
ATOM   3123 O O     . GLN B 1 80  ? -36.929 65.079  36.398  1.00 37.98  ? 106 GLN B O     1 
ATOM   3124 C CB    . GLN B 1 80  ? -37.343 68.265  36.792  1.00 69.88  ? 106 GLN B CB    1 
ATOM   3125 C CG    . GLN B 1 80  ? -37.851 69.283  37.796  1.00 81.46  ? 106 GLN B CG    1 
ATOM   3126 C CD    . GLN B 1 80  ? -38.751 68.659  38.842  1.00 88.61  ? 106 GLN B CD    1 
ATOM   3127 O OE1   . GLN B 1 80  ? -39.465 67.693  38.566  1.00 78.99  ? 106 GLN B OE1   1 
ATOM   3128 N NE2   . GLN B 1 80  ? -38.725 69.209  40.051  1.00 96.42  ? 106 GLN B NE2   1 
ATOM   3129 N N     . LEU B 1 81  ? -35.208 66.244  35.536  1.00 48.98  ? 107 LEU B N     1 
ATOM   3130 C CA    . LEU B 1 81  ? -34.898 65.252  34.515  1.00 49.25  ? 107 LEU B CA    1 
ATOM   3131 C C     . LEU B 1 81  ? -34.700 63.869  35.126  1.00 49.72  ? 107 LEU B C     1 
ATOM   3132 O O     . LEU B 1 81  ? -35.372 62.910  34.748  1.00 55.89  ? 107 LEU B O     1 
ATOM   3133 C CB    . LEU B 1 81  ? -33.648 65.664  33.734  1.00 45.00  ? 107 LEU B CB    1 
ATOM   3134 C CG    . LEU B 1 81  ? -33.168 64.690  32.657  1.00 39.11  ? 107 LEU B CG    1 
ATOM   3135 C CD1   . LEU B 1 81  ? -34.262 64.434  31.632  1.00 43.22  ? 107 LEU B CD1   1 
ATOM   3136 C CD2   . LEU B 1 81  ? -31.910 65.213  31.984  1.00 37.45  ? 107 LEU B CD2   1 
ATOM   3137 N N     . PHE B 1 82  ? -33.777 63.776  36.076  1.00 43.11  ? 108 PHE B N     1 
ATOM   3138 C CA    . PHE B 1 82  ? -33.468 62.505  36.718  1.00 37.85  ? 108 PHE B CA    1 
ATOM   3139 C C     . PHE B 1 82  ? -34.657 61.982  37.514  1.00 34.71  ? 108 PHE B C     1 
ATOM   3140 O O     . PHE B 1 82  ? -34.858 60.773  37.628  1.00 35.07  ? 108 PHE B O     1 
ATOM   3141 C CB    . PHE B 1 82  ? -32.238 62.651  37.614  1.00 39.31  ? 108 PHE B CB    1 
ATOM   3142 C CG    . PHE B 1 82  ? -31.007 63.086  36.874  1.00 40.80  ? 108 PHE B CG    1 
ATOM   3143 C CD1   . PHE B 1 82  ? -30.125 62.151  36.358  1.00 43.65  ? 108 PHE B CD1   1 
ATOM   3144 C CD2   . PHE B 1 82  ? -30.742 64.429  36.675  1.00 30.54  ? 108 PHE B CD2   1 
ATOM   3145 C CE1   . PHE B 1 82  ? -28.996 62.548  35.668  1.00 32.85  ? 108 PHE B CE1   1 
ATOM   3146 C CE2   . PHE B 1 82  ? -29.614 64.832  35.987  1.00 37.87  ? 108 PHE B CE2   1 
ATOM   3147 C CZ    . PHE B 1 82  ? -28.740 63.890  35.482  1.00 26.72  ? 108 PHE B CZ    1 
ATOM   3148 N N     . VAL B 1 83  ? -35.444 62.903  38.058  1.00 40.22  ? 109 VAL B N     1 
ATOM   3149 C CA    . VAL B 1 83  ? -36.639 62.544  38.808  1.00 55.96  ? 109 VAL B CA    1 
ATOM   3150 C C     . VAL B 1 83  ? -37.634 61.818  37.914  1.00 58.38  ? 109 VAL B C     1 
ATOM   3151 O O     . VAL B 1 83  ? -38.029 60.685  38.192  1.00 62.34  ? 109 VAL B O     1 
ATOM   3152 C CB    . VAL B 1 83  ? -37.331 63.790  39.390  1.00 62.71  ? 109 VAL B CB    1 
ATOM   3153 C CG1   . VAL B 1 83  ? -38.643 63.406  40.052  1.00 58.53  ? 109 VAL B CG1   1 
ATOM   3154 C CG2   . VAL B 1 83  ? -36.415 64.503  40.372  1.00 73.98  ? 109 VAL B CG2   1 
ATOM   3155 N N     . LEU B 1 84  ? -38.031 62.483  36.836  1.00 47.86  ? 110 LEU B N     1 
ATOM   3156 C CA    . LEU B 1 84  ? -39.061 61.969  35.944  1.00 42.57  ? 110 LEU B CA    1 
ATOM   3157 C C     . LEU B 1 84  ? -38.585 60.750  35.164  1.00 48.40  ? 110 LEU B C     1 
ATOM   3158 O O     . LEU B 1 84  ? -39.334 59.792  34.979  1.00 62.36  ? 110 LEU B O     1 
ATOM   3159 C CB    . LEU B 1 84  ? -39.518 63.067  34.984  1.00 44.82  ? 110 LEU B CB    1 
ATOM   3160 C CG    . LEU B 1 84  ? -39.925 64.379  35.659  1.00 52.80  ? 110 LEU B CG    1 
ATOM   3161 C CD1   . LEU B 1 84  ? -40.256 65.440  34.621  1.00 71.00  ? 110 LEU B CD1   1 
ATOM   3162 C CD2   . LEU B 1 84  ? -41.097 64.161  36.606  1.00 36.54  ? 110 LEU B CD2   1 
ATOM   3163 N N     . ALA B 1 85  ? -37.339 60.790  34.706  1.00 49.17  ? 111 ALA B N     1 
ATOM   3164 C CA    . ALA B 1 85  ? -36.770 59.675  33.959  1.00 56.20  ? 111 ALA B CA    1 
ATOM   3165 C C     . ALA B 1 85  ? -36.764 58.412  34.810  1.00 62.41  ? 111 ALA B C     1 
ATOM   3166 O O     . ALA B 1 85  ? -37.041 57.317  34.317  1.00 52.12  ? 111 ALA B O     1 
ATOM   3167 C CB    . ALA B 1 85  ? -35.363 60.010  33.496  1.00 56.68  ? 111 ALA B CB    1 
ATOM   3168 N N     . GLY B 1 86  ? -36.449 58.576  36.091  1.00 66.76  ? 112 GLY B N     1 
ATOM   3169 C CA    . GLY B 1 86  ? -36.411 57.463  37.020  1.00 59.92  ? 112 GLY B CA    1 
ATOM   3170 C C     . GLY B 1 86  ? -37.795 56.977  37.395  1.00 61.32  ? 112 GLY B C     1 
ATOM   3171 O O     . GLY B 1 86  ? -37.949 55.924  38.012  1.00 71.07  ? 112 GLY B O     1 
ATOM   3172 N N     . ALA B 1 87  ? -38.808 57.750  37.020  1.00 64.28  ? 113 ALA B N     1 
ATOM   3173 C CA    . ALA B 1 87  ? -40.190 57.395  37.318  1.00 71.45  ? 113 ALA B CA    1 
ATOM   3174 C C     . ALA B 1 87  ? -41.043 57.405  36.055  1.00 70.54  ? 113 ALA B C     1 
ATOM   3175 O O     . ALA B 1 87  ? -42.200 57.823  36.081  1.00 71.99  ? 113 ALA B O     1 
ATOM   3176 C CB    . ALA B 1 87  ? -40.768 58.344  38.357  1.00 74.34  ? 113 ALA B CB    1 
ATOM   3177 N N     . ALA B 1 88  ? -40.466 56.943  34.951  1.00 74.55  ? 114 ALA B N     1 
ATOM   3178 C CA    . ALA B 1 88  ? -41.170 56.921  33.675  1.00 79.64  ? 114 ALA B CA    1 
ATOM   3179 C C     . ALA B 1 88  ? -41.204 55.520  33.080  1.00 79.20  ? 114 ALA B C     1 
ATOM   3180 O O     . ALA B 1 88  ? -40.212 54.792  33.126  1.00 75.14  ? 114 ALA B O     1 
ATOM   3181 C CB    . ALA B 1 88  ? -40.528 57.898  32.699  1.00 82.62  ? 114 ALA B CB    1 
ATOM   3182 N N     . GLU B 1 89  ? -42.352 55.150  32.524  1.00 86.40  ? 115 GLU B N     1 
ATOM   3183 C CA    . GLU B 1 89  ? -42.513 53.848  31.888  1.00 101.60 ? 115 GLU B CA    1 
ATOM   3184 C C     . GLU B 1 89  ? -41.812 53.831  30.535  1.00 108.22 ? 115 GLU B C     1 
ATOM   3185 O O     . GLU B 1 89  ? -42.213 54.540  29.611  1.00 118.78 ? 115 GLU B O     1 
ATOM   3186 C CB    . GLU B 1 89  ? -43.994 53.519  31.701  1.00 106.95 ? 115 GLU B CB    1 
ATOM   3187 C CG    . GLU B 1 89  ? -44.794 53.480  32.989  1.00 111.28 ? 115 GLU B CG    1 
ATOM   3188 C CD    . GLU B 1 89  ? -46.245 53.123  32.747  1.00 109.01 ? 115 GLU B CD    1 
ATOM   3189 O OE1   . GLU B 1 89  ? -46.628 52.948  31.567  1.00 105.39 ? 115 GLU B OE1   1 
ATOM   3190 O OE2   . GLU B 1 89  ? -47.001 53.017  33.734  1.00 103.76 ? 115 GLU B OE2   1 
ATOM   3191 N N     . GLU B 1 90  ? -40.766 53.019  30.421  1.00 97.86  ? 116 GLU B N     1 
ATOM   3192 C CA    . GLU B 1 90  ? -40.023 52.920  29.172  1.00 91.79  ? 116 GLU B CA    1 
ATOM   3193 C C     . GLU B 1 90  ? -40.966 52.579  28.024  1.00 82.32  ? 116 GLU B C     1 
ATOM   3194 O O     . GLU B 1 90  ? -41.827 51.707  28.151  1.00 74.09  ? 116 GLU B O     1 
ATOM   3195 C CB    . GLU B 1 90  ? -38.909 51.877  29.278  1.00 95.24  ? 116 GLU B CB    1 
ATOM   3196 C CG    . GLU B 1 90  ? -39.400 50.454  29.469  1.00 100.98 ? 116 GLU B CG    1 
ATOM   3197 C CD    . GLU B 1 90  ? -38.274 49.445  29.397  1.00 104.98 ? 116 GLU B CD    1 
ATOM   3198 O OE1   . GLU B 1 90  ? -38.559 48.238  29.256  1.00 104.42 ? 116 GLU B OE1   1 
ATOM   3199 O OE2   . GLU B 1 90  ? -37.100 49.864  29.476  1.00 107.67 ? 116 GLU B OE2   1 
ATOM   3200 N N     . GLY B 1 91  ? -40.803 53.276  26.906  1.00 77.61  ? 117 GLY B N     1 
ATOM   3201 C CA    . GLY B 1 91  ? -41.684 53.100  25.769  1.00 68.83  ? 117 GLY B CA    1 
ATOM   3202 C C     . GLY B 1 91  ? -42.770 54.155  25.757  1.00 62.30  ? 117 GLY B C     1 
ATOM   3203 O O     . GLY B 1 91  ? -43.660 54.137  24.906  1.00 62.81  ? 117 GLY B O     1 
ATOM   3204 N N     . PHE B 1 92  ? -42.697 55.078  26.711  1.00 59.09  ? 118 PHE B N     1 
ATOM   3205 C CA    . PHE B 1 92  ? -43.660 56.169  26.796  1.00 63.36  ? 118 PHE B CA    1 
ATOM   3206 C C     . PHE B 1 92  ? -43.063 57.393  27.480  1.00 57.21  ? 118 PHE B C     1 
ATOM   3207 O O     . PHE B 1 92  ? -42.525 57.298  28.584  1.00 51.01  ? 118 PHE B O     1 
ATOM   3208 C CB    . PHE B 1 92  ? -44.919 55.722  27.541  1.00 53.79  ? 118 PHE B CB    1 
ATOM   3209 C CG    . PHE B 1 92  ? -45.996 56.767  27.584  1.00 53.85  ? 118 PHE B CG    1 
ATOM   3210 C CD1   . PHE B 1 92  ? -47.029 56.755  26.662  1.00 72.81  ? 118 PHE B CD1   1 
ATOM   3211 C CD2   . PHE B 1 92  ? -45.972 57.768  28.542  1.00 44.90  ? 118 PHE B CD2   1 
ATOM   3212 C CE1   . PHE B 1 92  ? -48.021 57.717  26.698  1.00 73.08  ? 118 PHE B CE1   1 
ATOM   3213 C CE2   . PHE B 1 92  ? -46.960 58.733  28.582  1.00 50.05  ? 118 PHE B CE2   1 
ATOM   3214 C CZ    . PHE B 1 92  ? -47.986 58.708  27.659  1.00 62.60  ? 118 PHE B CZ    1 
ATOM   3215 N N     . MET B 1 93  ? -43.168 58.544  26.822  1.00 48.88  ? 119 MET B N     1 
ATOM   3216 C CA    . MET B 1 93  ? -42.685 59.795  27.391  1.00 38.29  ? 119 MET B CA    1 
ATOM   3217 C C     . MET B 1 93  ? -43.837 60.726  27.734  1.00 40.68  ? 119 MET B C     1 
ATOM   3218 O O     . MET B 1 93  ? -44.695 60.999  26.895  1.00 40.41  ? 119 MET B O     1 
ATOM   3219 C CB    . MET B 1 93  ? -41.726 60.498  26.432  1.00 38.91  ? 119 MET B CB    1 
ATOM   3220 C CG    . MET B 1 93  ? -41.209 61.824  26.962  1.00 40.51  ? 119 MET B CG    1 
ATOM   3221 S SD    . MET B 1 93  ? -39.983 62.574  25.883  1.00 78.88  ? 119 MET B SD    1 
ATOM   3222 C CE    . MET B 1 93  ? -38.755 61.271  25.808  1.00 15.03  ? 119 MET B CE    1 
ATOM   3223 N N     . THR B 1 94  ? -43.847 61.213  28.971  1.00 45.63  ? 120 THR B N     1 
ATOM   3224 C CA    . THR B 1 94  ? -44.884 62.130  29.423  1.00 41.71  ? 120 THR B CA    1 
ATOM   3225 C C     . THR B 1 94  ? -44.665 63.527  28.848  1.00 41.22  ? 120 THR B C     1 
ATOM   3226 O O     . THR B 1 94  ? -43.568 63.858  28.393  1.00 30.29  ? 120 THR B O     1 
ATOM   3227 C CB    . THR B 1 94  ? -44.938 62.208  30.962  1.00 40.80  ? 120 THR B CB    1 
ATOM   3228 O OG1   . THR B 1 94  ? -46.031 63.044  31.366  1.00 71.19  ? 120 THR B OG1   1 
ATOM   3229 C CG2   . THR B 1 94  ? -43.642 62.775  31.514  1.00 31.38  ? 120 THR B CG2   1 
ATOM   3230 N N     . ALA B 1 95  ? -45.716 64.340  28.868  1.00 41.20  ? 121 ALA B N     1 
ATOM   3231 C CA    . ALA B 1 95  ? -45.658 65.690  28.319  1.00 37.77  ? 121 ALA B CA    1 
ATOM   3232 C C     . ALA B 1 95  ? -44.669 66.570  29.073  1.00 47.78  ? 121 ALA B C     1 
ATOM   3233 O O     . ALA B 1 95  ? -43.893 67.306  28.463  1.00 57.53  ? 121 ALA B O     1 
ATOM   3234 C CB    . ALA B 1 95  ? -47.041 66.324  28.321  1.00 36.96  ? 121 ALA B CB    1 
ATOM   3235 N N     . GLU B 1 96  ? -44.699 66.497  30.399  1.00 51.70  ? 122 GLU B N     1 
ATOM   3236 C CA    . GLU B 1 96  ? -43.821 67.330  31.209  1.00 60.61  ? 122 GLU B CA    1 
ATOM   3237 C C     . GLU B 1 96  ? -42.352 67.001  30.962  1.00 49.55  ? 122 GLU B C     1 
ATOM   3238 O O     . GLU B 1 96  ? -41.512 67.898  30.906  1.00 47.31  ? 122 GLU B O     1 
ATOM   3239 C CB    . GLU B 1 96  ? -44.158 67.208  32.696  1.00 75.82  ? 122 GLU B CB    1 
ATOM   3240 C CG    . GLU B 1 96  ? -43.358 68.154  33.578  1.00 95.51  ? 122 GLU B CG    1 
ATOM   3241 C CD    . GLU B 1 96  ? -43.911 68.255  34.984  1.00 126.93 ? 122 GLU B CD    1 
ATOM   3242 O OE1   . GLU B 1 96  ? -44.999 67.697  35.237  1.00 141.17 ? 122 GLU B OE1   1 
ATOM   3243 O OE2   . GLU B 1 96  ? -43.260 68.897  35.836  1.00 135.08 ? 122 GLU B OE2   1 
ATOM   3244 N N     . LEU B 1 97  ? -42.046 65.717  30.808  1.00 40.87  ? 123 LEU B N     1 
ATOM   3245 C CA    . LEU B 1 97  ? -40.673 65.300  30.545  1.00 40.64  ? 123 LEU B CA    1 
ATOM   3246 C C     . LEU B 1 97  ? -40.186 65.855  29.211  1.00 40.32  ? 123 LEU B C     1 
ATOM   3247 O O     . LEU B 1 97  ? -39.053 66.318  29.093  1.00 29.40  ? 123 LEU B O     1 
ATOM   3248 C CB    . LEU B 1 97  ? -40.557 63.777  30.550  1.00 34.09  ? 123 LEU B CB    1 
ATOM   3249 C CG    . LEU B 1 97  ? -39.145 63.250  30.302  1.00 38.81  ? 123 LEU B CG    1 
ATOM   3250 C CD1   . LEU B 1 97  ? -38.166 63.895  31.270  1.00 8.65   ? 123 LEU B CD1   1 
ATOM   3251 C CD2   . LEU B 1 97  ? -39.108 61.736  30.419  1.00 51.71  ? 123 LEU B CD2   1 
ATOM   3252 N N     . ALA B 1 98  ? -41.054 65.801  28.208  1.00 38.31  ? 124 ALA B N     1 
ATOM   3253 C CA    . ALA B 1 98  ? -40.742 66.359  26.901  1.00 24.25  ? 124 ALA B CA    1 
ATOM   3254 C C     . ALA B 1 98  ? -40.390 67.835  27.034  1.00 33.19  ? 124 ALA B C     1 
ATOM   3255 O O     . ALA B 1 98  ? -39.373 68.291  26.513  1.00 36.46  ? 124 ALA B O     1 
ATOM   3256 C CB    . ALA B 1 98  ? -41.915 66.176  25.956  1.00 14.86  ? 124 ALA B CB    1 
ATOM   3257 N N     . GLY B 1 99  ? -41.238 68.578  27.738  1.00 34.04  ? 125 GLY B N     1 
ATOM   3258 C CA    . GLY B 1 99  ? -41.006 69.993  27.962  1.00 39.30  ? 125 GLY B CA    1 
ATOM   3259 C C     . GLY B 1 99  ? -39.721 70.238  28.726  1.00 43.08  ? 125 GLY B C     1 
ATOM   3260 O O     . GLY B 1 99  ? -38.999 71.198  28.459  1.00 43.02  ? 125 GLY B O     1 
ATOM   3261 N N     . VAL B 1 100 ? -39.436 69.364  29.686  1.00 38.40  ? 126 VAL B N     1 
ATOM   3262 C CA    . VAL B 1 100 ? -38.209 69.459  30.463  1.00 38.48  ? 126 VAL B CA    1 
ATOM   3263 C C     . VAL B 1 100 ? -36.995 69.318  29.558  1.00 39.83  ? 126 VAL B C     1 
ATOM   3264 O O     . VAL B 1 100 ? -36.175 70.230  29.456  1.00 56.99  ? 126 VAL B O     1 
ATOM   3265 C CB    . VAL B 1 100 ? -38.143 68.377  31.556  1.00 46.93  ? 126 VAL B CB    1 
ATOM   3266 C CG1   . VAL B 1 100 ? -36.730 68.274  32.118  1.00 46.13  ? 126 VAL B CG1   1 
ATOM   3267 C CG2   . VAL B 1 100 ? -39.146 68.675  32.659  1.00 42.76  ? 126 VAL B CG2   1 
ATOM   3268 N N     . ILE B 1 101 ? -36.889 68.169  28.900  1.00 37.22  ? 127 ILE B N     1 
ATOM   3269 C CA    . ILE B 1 101 ? -35.773 67.898  28.005  1.00 41.35  ? 127 ILE B CA    1 
ATOM   3270 C C     . ILE B 1 101 ? -35.615 69.008  26.972  1.00 37.85  ? 127 ILE B C     1 
ATOM   3271 O O     . ILE B 1 101 ? -34.506 69.467  26.704  1.00 43.37  ? 127 ILE B O     1 
ATOM   3272 C CB    . ILE B 1 101 ? -35.945 66.548  27.285  1.00 41.44  ? 127 ILE B CB    1 
ATOM   3273 C CG1   . ILE B 1 101 ? -35.938 65.403  28.301  1.00 34.21  ? 127 ILE B CG1   1 
ATOM   3274 C CG2   . ILE B 1 101 ? -34.848 66.353  26.251  1.00 45.52  ? 127 ILE B CG2   1 
ATOM   3275 C CD1   . ILE B 1 101 ? -36.088 64.029  27.681  1.00 20.89  ? 127 ILE B CD1   1 
ATOM   3276 N N     . LYS B 1 102 ? -36.734 69.442  26.403  1.00 38.21  ? 128 LYS B N     1 
ATOM   3277 C CA    . LYS B 1 102 ? -36.722 70.477  25.378  1.00 37.54  ? 128 LYS B CA    1 
ATOM   3278 C C     . LYS B 1 102 ? -36.138 71.787  25.897  1.00 39.50  ? 128 LYS B C     1 
ATOM   3279 O O     . LYS B 1 102 ? -35.287 72.395  25.247  1.00 52.67  ? 128 LYS B O     1 
ATOM   3280 C CB    . LYS B 1 102 ? -38.134 70.705  24.834  1.00 46.76  ? 128 LYS B CB    1 
ATOM   3281 C CG    . LYS B 1 102 ? -38.206 71.685  23.677  1.00 60.45  ? 128 LYS B CG    1 
ATOM   3282 C CD    . LYS B 1 102 ? -39.614 71.756  23.104  1.00 70.88  ? 128 LYS B CD    1 
ATOM   3283 C CE    . LYS B 1 102 ? -39.666 72.653  21.878  1.00 74.69  ? 128 LYS B CE    1 
ATOM   3284 N NZ    . LYS B 1 102 ? -41.021 72.684  21.266  1.00 71.12  ? 128 LYS B NZ    1 
ATOM   3285 N N     . ARG B 1 103 ? -36.595 72.218  27.069  1.00 31.43  ? 129 ARG B N     1 
ATOM   3286 C CA    . ARG B 1 103 ? -36.135 73.475  27.650  1.00 29.03  ? 129 ARG B CA    1 
ATOM   3287 C C     . ARG B 1 103 ? -34.641 73.454  27.962  1.00 37.35  ? 129 ARG B C     1 
ATOM   3288 O O     . ARG B 1 103 ? -33.986 74.497  27.977  1.00 39.92  ? 129 ARG B O     1 
ATOM   3289 C CB    . ARG B 1 103 ? -36.935 73.818  28.909  1.00 21.25  ? 129 ARG B CB    1 
ATOM   3290 C CG    . ARG B 1 103 ? -38.341 74.313  28.634  1.00 35.26  ? 129 ARG B CG    1 
ATOM   3291 C CD    . ARG B 1 103 ? -38.923 75.011  29.852  1.00 42.88  ? 129 ARG B CD    1 
ATOM   3292 N NE    . ARG B 1 103 ? -39.132 74.096  30.969  1.00 38.95  ? 129 ARG B NE    1 
ATOM   3293 C CZ    . ARG B 1 103 ? -40.284 73.484  31.223  1.00 53.88  ? 129 ARG B CZ    1 
ATOM   3294 N NH1   . ARG B 1 103 ? -41.332 73.691  30.437  1.00 67.74  ? 129 ARG B NH1   1 
ATOM   3295 N NH2   . ARG B 1 103 ? -40.390 72.668  32.261  1.00 50.72  ? 129 ARG B NH2   1 
ATOM   3296 N N     . LEU B 1 104 ? -34.108 72.264  28.214  1.00 35.72  ? 130 LEU B N     1 
ATOM   3297 C CA    . LEU B 1 104 ? -32.685 72.107  28.483  1.00 37.92  ? 130 LEU B CA    1 
ATOM   3298 C C     . LEU B 1 104 ? -31.882 72.134  27.188  1.00 43.30  ? 130 LEU B C     1 
ATOM   3299 O O     . LEU B 1 104 ? -30.831 72.768  27.110  1.00 38.16  ? 130 LEU B O     1 
ATOM   3300 C CB    . LEU B 1 104 ? -32.424 70.801  29.232  1.00 39.54  ? 130 LEU B CB    1 
ATOM   3301 C CG    . LEU B 1 104 ? -32.961 70.731  30.661  1.00 50.90  ? 130 LEU B CG    1 
ATOM   3302 C CD1   . LEU B 1 104 ? -32.792 69.330  31.231  1.00 50.29  ? 130 LEU B CD1   1 
ATOM   3303 C CD2   . LEU B 1 104 ? -32.268 71.764  31.538  1.00 57.82  ? 130 LEU B CD2   1 
ATOM   3304 N N     . TRP B 1 105 ? -32.387 71.442  26.173  1.00 39.14  ? 131 TRP B N     1 
ATOM   3305 C CA    . TRP B 1 105 ? -31.726 71.394  24.876  1.00 39.82  ? 131 TRP B CA    1 
ATOM   3306 C C     . TRP B 1 105 ? -31.702 72.770  24.216  1.00 50.22  ? 131 TRP B C     1 
ATOM   3307 O O     . TRP B 1 105 ? -30.812 73.069  23.422  1.00 60.22  ? 131 TRP B O     1 
ATOM   3308 C CB    . TRP B 1 105 ? -32.416 70.376  23.966  1.00 43.24  ? 131 TRP B CB    1 
ATOM   3309 C CG    . TRP B 1 105 ? -31.831 70.294  22.589  1.00 43.10  ? 131 TRP B CG    1 
ATOM   3310 C CD1   . TRP B 1 105 ? -32.432 70.661  21.423  1.00 39.85  ? 131 TRP B CD1   1 
ATOM   3311 C CD2   . TRP B 1 105 ? -30.526 69.817  22.236  1.00 50.29  ? 131 TRP B CD2   1 
ATOM   3312 N NE1   . TRP B 1 105 ? -31.586 70.439  20.363  1.00 46.71  ? 131 TRP B NE1   1 
ATOM   3313 C CE2   . TRP B 1 105 ? -30.409 69.922  20.836  1.00 54.45  ? 131 TRP B CE2   1 
ATOM   3314 C CE3   . TRP B 1 105 ? -29.446 69.313  22.968  1.00 43.88  ? 131 TRP B CE3   1 
ATOM   3315 C CZ2   . TRP B 1 105 ? -29.255 69.542  20.152  1.00 49.15  ? 131 TRP B CZ2   1 
ATOM   3316 C CZ3   . TRP B 1 105 ? -28.302 68.934  22.286  1.00 41.18  ? 131 TRP B CZ3   1 
ATOM   3317 C CH2   . TRP B 1 105 ? -28.215 69.051  20.893  1.00 36.14  ? 131 TRP B CH2   1 
ATOM   3318 N N     . LYS B 1 106 ? -32.681 73.605  24.551  1.00 41.59  ? 132 LYS B N     1 
ATOM   3319 C CA    . LYS B 1 106 ? -32.759 74.951  23.994  1.00 21.82  ? 132 LYS B CA    1 
ATOM   3320 C C     . LYS B 1 106 ? -31.995 75.958  24.843  1.00 31.61  ? 132 LYS B C     1 
ATOM   3321 O O     . LYS B 1 106 ? -32.013 77.157  24.564  1.00 56.91  ? 132 LYS B O     1 
ATOM   3322 C CB    . LYS B 1 106 ? -34.217 75.395  23.844  1.00 23.38  ? 132 LYS B CB    1 
ATOM   3323 C CG    . LYS B 1 106 ? -34.987 74.653  22.767  1.00 47.08  ? 132 LYS B CG    1 
ATOM   3324 C CD    . LYS B 1 106 ? -36.326 75.318  22.492  1.00 72.36  ? 132 LYS B CD    1 
ATOM   3325 C CE    . LYS B 1 106 ? -36.979 74.736  21.248  1.00 96.01  ? 132 LYS B CE    1 
ATOM   3326 N NZ    . LYS B 1 106 ? -38.232 75.455  20.881  1.00 102.96 ? 132 LYS B NZ    1 
ATOM   3327 N N     . ASP B 1 107 ? -31.324 75.469  25.880  1.00 31.77  ? 133 ASP B N     1 
ATOM   3328 C CA    . ASP B 1 107 ? -30.575 76.341  26.777  1.00 35.22  ? 133 ASP B CA    1 
ATOM   3329 C C     . ASP B 1 107 ? -29.174 76.623  26.245  1.00 40.93  ? 133 ASP B C     1 
ATOM   3330 O O     . ASP B 1 107 ? -28.432 75.701  25.903  1.00 46.62  ? 133 ASP B O     1 
ATOM   3331 C CB    . ASP B 1 107 ? -30.491 75.732  28.176  1.00 25.36  ? 133 ASP B CB    1 
ATOM   3332 C CG    . ASP B 1 107 ? -29.712 76.601  29.139  1.00 39.92  ? 133 ASP B CG    1 
ATOM   3333 O OD1   . ASP B 1 107 ? -30.194 77.705  29.468  1.00 44.01  ? 133 ASP B OD1   1 
ATOM   3334 O OD2   . ASP B 1 107 ? -28.615 76.181  29.563  1.00 51.54  ? 133 ASP B OD2   1 
ATOM   3335 N N     . SER B 1 108 ? -28.820 77.902  26.180  1.00 39.81  ? 134 SER B N     1 
ATOM   3336 C CA    . SER B 1 108 ? -27.520 78.316  25.663  1.00 44.64  ? 134 SER B CA    1 
ATOM   3337 C C     . SER B 1 108 ? -26.380 77.633  26.406  1.00 48.84  ? 134 SER B C     1 
ATOM   3338 O O     . SER B 1 108 ? -25.365 77.274  25.809  1.00 44.55  ? 134 SER B O     1 
ATOM   3339 C CB    . SER B 1 108 ? -27.371 79.835  25.749  1.00 43.82  ? 134 SER B CB    1 
ATOM   3340 O OG    . SER B 1 108 ? -27.640 80.295  27.062  1.00 55.62  ? 134 SER B OG    1 
ATOM   3341 N N     . GLY B 1 109 ? -26.553 77.456  27.712  1.00 49.72  ? 135 GLY B N     1 
ATOM   3342 C CA    . GLY B 1 109 ? -25.553 76.792  28.525  1.00 45.74  ? 135 GLY B CA    1 
ATOM   3343 C C     . GLY B 1 109 ? -25.356 75.356  28.092  1.00 41.22  ? 135 GLY B C     1 
ATOM   3344 O O     . GLY B 1 109 ? -24.232 74.916  27.850  1.00 43.03  ? 135 GLY B O     1 
ATOM   3345 N N     . VAL B 1 110 ? -26.459 74.624  27.990  1.00 36.99  ? 136 VAL B N     1 
ATOM   3346 C CA    . VAL B 1 110 ? -26.418 73.231  27.568  1.00 48.16  ? 136 VAL B CA    1 
ATOM   3347 C C     . VAL B 1 110 ? -25.823 73.108  26.168  1.00 46.19  ? 136 VAL B C     1 
ATOM   3348 O O     . VAL B 1 110 ? -25.071 72.176  25.880  1.00 45.54  ? 136 VAL B O     1 
ATOM   3349 C CB    . VAL B 1 110 ? -27.823 72.595  27.599  1.00 38.74  ? 136 VAL B CB    1 
ATOM   3350 C CG1   . VAL B 1 110 ? -27.777 71.158  27.099  1.00 23.90  ? 136 VAL B CG1   1 
ATOM   3351 C CG2   . VAL B 1 110 ? -28.396 72.657  29.007  1.00 41.49  ? 136 VAL B CG2   1 
ATOM   3352 N N     . GLN B 1 111 ? -26.161 74.058  25.303  1.00 38.84  ? 137 GLN B N     1 
ATOM   3353 C CA    . GLN B 1 111 ? -25.645 74.065  23.940  1.00 33.44  ? 137 GLN B CA    1 
ATOM   3354 C C     . GLN B 1 111 ? -24.155 74.381  23.914  1.00 43.92  ? 137 GLN B C     1 
ATOM   3355 O O     . GLN B 1 111 ? -23.402 73.799  23.133  1.00 40.95  ? 137 GLN B O     1 
ATOM   3356 C CB    . GLN B 1 111 ? -26.421 75.062  23.079  1.00 32.45  ? 137 GLN B CB    1 
ATOM   3357 C CG    . GLN B 1 111 ? -27.805 74.577  22.688  1.00 37.81  ? 137 GLN B CG    1 
ATOM   3358 C CD    . GLN B 1 111 ? -27.756 73.352  21.794  1.00 44.48  ? 137 GLN B CD    1 
ATOM   3359 O OE1   . GLN B 1 111 ? -26.857 73.211  20.964  1.00 46.17  ? 137 GLN B OE1   1 
ATOM   3360 N NE2   . GLN B 1 111 ? -28.725 72.461  21.957  1.00 51.65  ? 137 GLN B NE2   1 
ATOM   3361 N N     . ALA B 1 112 ? -23.734 75.305  24.771  1.00 47.02  ? 138 ALA B N     1 
ATOM   3362 C CA    . ALA B 1 112 ? -22.321 75.634  24.900  1.00 36.85  ? 138 ALA B CA    1 
ATOM   3363 C C     . ALA B 1 112 ? -21.533 74.372  25.219  1.00 36.40  ? 138 ALA B C     1 
ATOM   3364 O O     . ALA B 1 112 ? -20.499 74.100  24.609  1.00 43.27  ? 138 ALA B O     1 
ATOM   3365 C CB    . ALA B 1 112 ? -22.114 76.677  25.982  1.00 28.51  ? 138 ALA B CB    1 
ATOM   3366 N N     . CYS B 1 113 ? -22.039 73.602  26.178  1.00 32.80  ? 139 CYS B N     1 
ATOM   3367 C CA    . CYS B 1 113 ? -21.414 72.348  26.578  1.00 33.73  ? 139 CYS B CA    1 
ATOM   3368 C C     . CYS B 1 113 ? -21.475 71.322  25.453  1.00 41.50  ? 139 CYS B C     1 
ATOM   3369 O O     . CYS B 1 113 ? -20.532 70.558  25.245  1.00 60.61  ? 139 CYS B O     1 
ATOM   3370 C CB    . CYS B 1 113 ? -22.096 71.792  27.829  1.00 38.71  ? 139 CYS B CB    1 
ATOM   3371 S SG    . CYS B 1 113 ? -21.403 70.236  28.431  1.00 46.89  ? 139 CYS B SG    1 
ATOM   3372 N N     . PHE B 1 114 ? -22.591 71.308  24.733  1.00 28.50  ? 140 PHE B N     1 
ATOM   3373 C CA    . PHE B 1 114 ? -22.766 70.401  23.605  1.00 37.38  ? 140 PHE B CA    1 
ATOM   3374 C C     . PHE B 1 114 ? -21.689 70.628  22.549  1.00 40.71  ? 140 PHE B C     1 
ATOM   3375 O O     . PHE B 1 114 ? -21.204 69.683  21.926  1.00 39.58  ? 140 PHE B O     1 
ATOM   3376 C CB    . PHE B 1 114 ? -24.156 70.579  22.991  1.00 40.26  ? 140 PHE B CB    1 
ATOM   3377 C CG    . PHE B 1 114 ? -24.335 69.873  21.678  1.00 46.88  ? 140 PHE B CG    1 
ATOM   3378 C CD1   . PHE B 1 114 ? -24.337 68.488  21.613  1.00 53.70  ? 140 PHE B CD1   1 
ATOM   3379 C CD2   . PHE B 1 114 ? -24.513 70.593  20.508  1.00 42.09  ? 140 PHE B CD2   1 
ATOM   3380 C CE1   . PHE B 1 114 ? -24.504 67.835  20.406  1.00 50.54  ? 140 PHE B CE1   1 
ATOM   3381 C CE2   . PHE B 1 114 ? -24.682 69.947  19.298  1.00 35.21  ? 140 PHE B CE2   1 
ATOM   3382 C CZ    . PHE B 1 114 ? -24.678 68.566  19.247  1.00 43.90  ? 140 PHE B CZ    1 
ATOM   3383 N N     . ASN B 1 115 ? -21.315 71.887  22.357  1.00 34.52  ? 141 ASN B N     1 
ATOM   3384 C CA    . ASN B 1 115 ? -20.285 72.239  21.391  1.00 33.45  ? 141 ASN B CA    1 
ATOM   3385 C C     . ASN B 1 115 ? -18.907 71.781  21.853  1.00 47.91  ? 141 ASN B C     1 
ATOM   3386 O O     . ASN B 1 115 ? -18.008 71.563  21.040  1.00 68.35  ? 141 ASN B O     1 
ATOM   3387 C CB    . ASN B 1 115 ? -20.287 73.746  21.140  1.00 39.42  ? 141 ASN B CB    1 
ATOM   3388 C CG    . ASN B 1 115 ? -21.633 74.253  20.649  1.00 49.37  ? 141 ASN B CG    1 
ATOM   3389 O OD1   . ASN B 1 115 ? -22.311 73.591  19.860  1.00 20.42  ? 141 ASN B OD1   1 
ATOM   3390 N ND2   . ASN B 1 115 ? -22.023 75.436  21.113  1.00 59.82  ? 141 ASN B ND2   1 
ATOM   3391 N N     . ARG B 1 116 ? -18.752 71.634  23.164  1.00 38.59  ? 142 ARG B N     1 
ATOM   3392 C CA    . ARG B 1 116 ? -17.495 71.179  23.744  1.00 28.59  ? 142 ARG B CA    1 
ATOM   3393 C C     . ARG B 1 116 ? -17.486 69.659  23.870  1.00 33.98  ? 142 ARG B C     1 
ATOM   3394 O O     . ARG B 1 116 ? -16.713 69.098  24.645  1.00 44.28  ? 142 ARG B O     1 
ATOM   3395 C CB    . ARG B 1 116 ? -17.287 71.807  25.124  1.00 21.06  ? 142 ARG B CB    1 
ATOM   3396 C CG    . ARG B 1 116 ? -17.438 73.319  25.158  1.00 28.69  ? 142 ARG B CG    1 
ATOM   3397 C CD    . ARG B 1 116 ? -16.107 74.013  25.398  1.00 42.83  ? 142 ARG B CD    1 
ATOM   3398 N NE    . ARG B 1 116 ? -15.500 73.633  26.672  1.00 49.17  ? 142 ARG B NE    1 
ATOM   3399 C CZ    . ARG B 1 116 ? -15.730 74.252  27.826  1.00 48.42  ? 142 ARG B CZ    1 
ATOM   3400 N NH1   . ARG B 1 116 ? -16.562 75.283  27.874  1.00 49.22  ? 142 ARG B NH1   1 
ATOM   3401 N NH2   . ARG B 1 116 ? -15.129 73.837  28.933  1.00 46.11  ? 142 ARG B NH2   1 
ATOM   3402 N N     . SER B 1 117 ? -18.349 68.998  23.107  1.00 30.39  ? 143 SER B N     1 
ATOM   3403 C CA    . SER B 1 117 ? -18.491 67.547  23.189  1.00 35.10  ? 143 SER B CA    1 
ATOM   3404 C C     . SER B 1 117 ? -17.199 66.798  22.857  1.00 42.04  ? 143 SER B C     1 
ATOM   3405 O O     . SER B 1 117 ? -17.129 65.578  23.002  1.00 40.04  ? 143 SER B O     1 
ATOM   3406 C CB    . SER B 1 117 ? -19.631 67.067  22.288  1.00 37.96  ? 143 SER B CB    1 
ATOM   3407 O OG    . SER B 1 117 ? -19.440 67.501  20.953  1.00 59.86  ? 143 SER B OG    1 
ATOM   3408 N N     . ARG B 1 118 ? -16.182 67.526  22.407  1.00 43.00  ? 144 ARG B N     1 
ATOM   3409 C CA    . ARG B 1 118 ? -14.877 66.925  22.148  1.00 30.79  ? 144 ARG B CA    1 
ATOM   3410 C C     . ARG B 1 118 ? -14.134 66.680  23.458  1.00 34.49  ? 144 ARG B C     1 
ATOM   3411 O O     . ARG B 1 118 ? -13.132 65.966  23.493  1.00 32.45  ? 144 ARG B O     1 
ATOM   3412 C CB    . ARG B 1 118 ? -14.039 67.815  21.224  1.00 9.59   ? 144 ARG B CB    1 
ATOM   3413 C CG    . ARG B 1 118 ? -13.826 69.232  21.742  1.00 30.11  ? 144 ARG B CG    1 
ATOM   3414 C CD    . ARG B 1 118 ? -12.979 70.058  20.784  1.00 27.86  ? 144 ARG B CD    1 
ATOM   3415 N NE    . ARG B 1 118 ? -11.587 69.616  20.751  1.00 38.44  ? 144 ARG B NE    1 
ATOM   3416 C CZ    . ARG B 1 118 ? -10.567 70.307  21.254  1.00 43.52  ? 144 ARG B CZ    1 
ATOM   3417 N NH1   . ARG B 1 118 ? -10.776 71.487  21.826  1.00 39.88  ? 144 ARG B NH1   1 
ATOM   3418 N NH2   . ARG B 1 118 ? -9.334  69.821  21.179  1.00 23.16  ? 144 ARG B NH2   1 
ATOM   3419 N N     . GLU B 1 119 ? -14.640 67.273  24.534  1.00 29.68  ? 145 GLU B N     1 
ATOM   3420 C CA    . GLU B 1 119 ? -13.983 67.207  25.835  1.00 32.64  ? 145 GLU B CA    1 
ATOM   3421 C C     . GLU B 1 119 ? -14.637 66.186  26.766  1.00 37.01  ? 145 GLU B C     1 
ATOM   3422 O O     . GLU B 1 119 ? -14.322 66.121  27.954  1.00 48.33  ? 145 GLU B O     1 
ATOM   3423 C CB    . GLU B 1 119 ? -13.965 68.594  26.479  1.00 35.20  ? 145 GLU B CB    1 
ATOM   3424 C CG    . GLU B 1 119 ? -13.380 69.662  25.570  1.00 36.05  ? 145 GLU B CG    1 
ATOM   3425 C CD    . GLU B 1 119 ? -13.541 71.061  26.125  1.00 50.91  ? 145 GLU B CD    1 
ATOM   3426 O OE1   . GLU B 1 119 ? -13.598 71.212  27.366  1.00 39.12  ? 145 GLU B OE1   1 
ATOM   3427 O OE2   . GLU B 1 119 ? -13.603 72.011  25.313  1.00 53.32  ? 145 GLU B OE2   1 
ATOM   3428 N N     . TYR B 1 120 ? -15.549 65.393  26.214  1.00 35.04  ? 146 TYR B N     1 
ATOM   3429 C CA    . TYR B 1 120 ? -16.151 64.272  26.930  1.00 30.69  ? 146 TYR B CA    1 
ATOM   3430 C C     . TYR B 1 120 ? -16.759 63.297  25.927  1.00 48.47  ? 146 TYR B C     1 
ATOM   3431 O O     . TYR B 1 120 ? -16.832 63.593  24.735  1.00 60.07  ? 146 TYR B O     1 
ATOM   3432 C CB    . TYR B 1 120 ? -17.203 64.753  27.938  1.00 31.17  ? 146 TYR B CB    1 
ATOM   3433 C CG    . TYR B 1 120 ? -18.315 65.591  27.343  1.00 37.59  ? 146 TYR B CG    1 
ATOM   3434 C CD1   . TYR B 1 120 ? -18.181 66.967  27.213  1.00 48.26  ? 146 TYR B CD1   1 
ATOM   3435 C CD2   . TYR B 1 120 ? -19.503 65.007  26.921  1.00 34.77  ? 146 TYR B CD2   1 
ATOM   3436 C CE1   . TYR B 1 120 ? -19.195 67.738  26.671  1.00 46.18  ? 146 TYR B CE1   1 
ATOM   3437 C CE2   . TYR B 1 120 ? -20.524 65.770  26.378  1.00 30.84  ? 146 TYR B CE2   1 
ATOM   3438 C CZ    . TYR B 1 120 ? -20.364 67.134  26.256  1.00 33.73  ? 146 TYR B CZ    1 
ATOM   3439 O OH    . TYR B 1 120 ? -21.374 67.896  25.717  1.00 28.74  ? 146 TYR B OH    1 
ATOM   3440 N N     . GLN B 1 121 ? -17.184 62.132  26.404  1.00 50.98  ? 147 GLN B N     1 
ATOM   3441 C CA    . GLN B 1 121 ? -17.771 61.127  25.524  1.00 53.40  ? 147 GLN B CA    1 
ATOM   3442 C C     . GLN B 1 121 ? -19.262 61.373  25.298  1.00 41.72  ? 147 GLN B C     1 
ATOM   3443 O O     . GLN B 1 121 ? -20.045 61.390  26.246  1.00 41.40  ? 147 GLN B O     1 
ATOM   3444 C CB    . GLN B 1 121 ? -17.539 59.720  26.080  1.00 59.64  ? 147 GLN B CB    1 
ATOM   3445 C CG    . GLN B 1 121 ? -16.078 59.302  26.106  1.00 67.34  ? 147 GLN B CG    1 
ATOM   3446 C CD    . GLN B 1 121 ? -15.892 57.855  26.521  1.00 81.83  ? 147 GLN B CD    1 
ATOM   3447 O OE1   . GLN B 1 121 ? -14.856 57.248  26.249  1.00 85.87  ? 147 GLN B OE1   1 
ATOM   3448 N NE2   . GLN B 1 121 ? -16.899 57.294  27.179  1.00 90.14  ? 147 GLN B NE2   1 
ATOM   3449 N N     . LEU B 1 122 ? -19.644 61.566  24.039  1.00 36.45  ? 148 LEU B N     1 
ATOM   3450 C CA    . LEU B 1 122 ? -21.040 61.811  23.686  1.00 43.56  ? 148 LEU B CA    1 
ATOM   3451 C C     . LEU B 1 122 ? -21.425 61.092  22.393  1.00 46.44  ? 148 LEU B C     1 
ATOM   3452 O O     . LEU B 1 122 ? -20.814 61.311  21.345  1.00 45.83  ? 148 LEU B O     1 
ATOM   3453 C CB    . LEU B 1 122 ? -21.302 63.313  23.552  1.00 30.97  ? 148 LEU B CB    1 
ATOM   3454 C CG    . LEU B 1 122 ? -22.736 63.719  23.203  1.00 44.70  ? 148 LEU B CG    1 
ATOM   3455 C CD1   . LEU B 1 122 ? -23.718 63.176  24.232  1.00 53.60  ? 148 LEU B CD1   1 
ATOM   3456 C CD2   . LEU B 1 122 ? -22.859 65.231  23.090  1.00 45.88  ? 148 LEU B CD2   1 
ATOM   3457 N N     . ASN B 1 123 ? -22.441 60.236  22.469  1.00 38.41  ? 149 ASN B N     1 
ATOM   3458 C CA    . ASN B 1 123 ? -22.892 59.490  21.299  1.00 34.56  ? 149 ASN B CA    1 
ATOM   3459 C C     . ASN B 1 123 ? -23.365 60.424  20.192  1.00 35.96  ? 149 ASN B C     1 
ATOM   3460 O O     . ASN B 1 123 ? -23.964 61.466  20.460  1.00 32.81  ? 149 ASN B O     1 
ATOM   3461 C CB    . ASN B 1 123 ? -23.996 58.497  21.669  1.00 29.42  ? 149 ASN B CB    1 
ATOM   3462 C CG    . ASN B 1 123 ? -25.342 59.165  21.872  1.00 43.38  ? 149 ASN B CG    1 
ATOM   3463 O OD1   . ASN B 1 123 ? -26.210 59.116  20.999  1.00 37.92  ? 149 ASN B OD1   1 
ATOM   3464 N ND2   . ASN B 1 123 ? -25.524 59.793  23.028  1.00 44.81  ? 149 ASN B ND2   1 
ATOM   3465 N N     . ASP B 1 124 ? -23.097 60.044  18.949  1.00 43.80  ? 150 ASP B N     1 
ATOM   3466 C CA    . ASP B 1 124 ? -23.388 60.910  17.811  1.00 49.40  ? 150 ASP B CA    1 
ATOM   3467 C C     . ASP B 1 124 ? -24.846 60.834  17.357  1.00 49.52  ? 150 ASP B C     1 
ATOM   3468 O O     . ASP B 1 124 ? -25.199 61.346  16.294  1.00 46.19  ? 150 ASP B O     1 
ATOM   3469 C CB    . ASP B 1 124 ? -22.441 60.601  16.651  1.00 56.20  ? 150 ASP B CB    1 
ATOM   3470 C CG    . ASP B 1 124 ? -20.983 60.781  17.030  1.00 66.54  ? 150 ASP B CG    1 
ATOM   3471 O OD1   . ASP B 1 124 ? -20.713 61.157  18.191  1.00 78.01  ? 150 ASP B OD1   1 
ATOM   3472 O OD2   . ASP B 1 124 ? -20.108 60.549  16.171  1.00 66.56  ? 150 ASP B OD2   1 
ATOM   3473 N N     . SER B 1 125 ? -25.687 60.197  18.169  1.00 50.76  ? 151 SER B N     1 
ATOM   3474 C CA    . SER B 1 125 ? -27.125 60.164  17.918  1.00 32.87  ? 151 SER B CA    1 
ATOM   3475 C C     . SER B 1 125 ? -27.845 61.165  18.810  1.00 45.20  ? 151 SER B C     1 
ATOM   3476 O O     . SER B 1 125 ? -29.058 61.339  18.710  1.00 63.50  ? 151 SER B O     1 
ATOM   3477 C CB    . SER B 1 125 ? -27.689 58.766  18.167  1.00 21.52  ? 151 SER B CB    1 
ATOM   3478 O OG    . SER B 1 125 ? -27.151 57.830  17.254  1.00 41.23  ? 151 SER B OG    1 
ATOM   3479 N N     . ALA B 1 126 ? -27.084 61.816  19.685  1.00 42.54  ? 152 ALA B N     1 
ATOM   3480 C CA    . ALA B 1 126 ? -27.636 62.769  20.641  1.00 26.83  ? 152 ALA B CA    1 
ATOM   3481 C C     . ALA B 1 126 ? -28.451 63.860  19.955  1.00 35.70  ? 152 ALA B C     1 
ATOM   3482 O O     . ALA B 1 126 ? -29.649 64.003  20.206  1.00 40.21  ? 152 ALA B O     1 
ATOM   3483 C CB    . ALA B 1 126 ? -26.524 63.383  21.474  1.00 27.27  ? 152 ALA B CB    1 
ATOM   3484 N N     . ALA B 1 127 ? -27.793 64.626  19.090  1.00 41.54  ? 153 ALA B N     1 
ATOM   3485 C CA    . ALA B 1 127 ? -28.441 65.734  18.394  1.00 39.96  ? 153 ALA B CA    1 
ATOM   3486 C C     . ALA B 1 127 ? -29.600 65.264  17.518  1.00 46.84  ? 153 ALA B C     1 
ATOM   3487 O O     . ALA B 1 127 ? -30.606 65.961  17.386  1.00 44.91  ? 153 ALA B O     1 
ATOM   3488 C CB    . ALA B 1 127 ? -27.423 66.507  17.564  1.00 34.83  ? 153 ALA B CB    1 
ATOM   3489 N N     . TYR B 1 128 ? -29.453 64.080  16.928  1.00 50.80  ? 154 TYR B N     1 
ATOM   3490 C CA    . TYR B 1 128 ? -30.479 63.519  16.053  1.00 41.27  ? 154 TYR B CA    1 
ATOM   3491 C C     . TYR B 1 128 ? -31.850 63.491  16.722  1.00 43.40  ? 154 TYR B C     1 
ATOM   3492 O O     . TYR B 1 128 ? -32.823 64.023  16.189  1.00 48.05  ? 154 TYR B O     1 
ATOM   3493 C CB    . TYR B 1 128 ? -30.089 62.110  15.603  1.00 41.21  ? 154 TYR B CB    1 
ATOM   3494 C CG    . TYR B 1 128 ? -31.112 61.450  14.704  1.00 55.93  ? 154 TYR B CG    1 
ATOM   3495 C CD1   . TYR B 1 128 ? -31.132 61.705  13.340  1.00 64.76  ? 154 TYR B CD1   1 
ATOM   3496 C CD2   . TYR B 1 128 ? -32.056 60.571  15.219  1.00 59.41  ? 154 TYR B CD2   1 
ATOM   3497 C CE1   . TYR B 1 128 ? -32.066 61.106  12.514  1.00 64.99  ? 154 TYR B CE1   1 
ATOM   3498 C CE2   . TYR B 1 128 ? -32.992 59.966  14.401  1.00 52.50  ? 154 TYR B CE2   1 
ATOM   3499 C CZ    . TYR B 1 128 ? -32.993 60.237  13.050  1.00 59.47  ? 154 TYR B CZ    1 
ATOM   3500 O OH    . TYR B 1 128 ? -33.922 59.637  12.230  1.00 60.52  ? 154 TYR B OH    1 
ATOM   3501 N N     . TYR B 1 129 ? -31.921 62.866  17.892  1.00 44.68  ? 155 TYR B N     1 
ATOM   3502 C CA    . TYR B 1 129 ? -33.172 62.775  18.632  1.00 37.96  ? 155 TYR B CA    1 
ATOM   3503 C C     . TYR B 1 129 ? -33.546 64.113  19.257  1.00 49.06  ? 155 TYR B C     1 
ATOM   3504 O O     . TYR B 1 129 ? -34.677 64.578  19.119  1.00 64.99  ? 155 TYR B O     1 
ATOM   3505 C CB    . TYR B 1 129 ? -33.078 61.705  19.720  1.00 35.82  ? 155 TYR B CB    1 
ATOM   3506 C CG    . TYR B 1 129 ? -32.890 60.303  19.190  1.00 39.39  ? 155 TYR B CG    1 
ATOM   3507 C CD1   . TYR B 1 129 ? -33.899 59.670  18.476  1.00 39.90  ? 155 TYR B CD1   1 
ATOM   3508 C CD2   . TYR B 1 129 ? -31.708 59.607  19.412  1.00 36.38  ? 155 TYR B CD2   1 
ATOM   3509 C CE1   . TYR B 1 129 ? -33.734 58.387  17.990  1.00 36.58  ? 155 TYR B CE1   1 
ATOM   3510 C CE2   . TYR B 1 129 ? -31.535 58.322  18.930  1.00 31.29  ? 155 TYR B CE2   1 
ATOM   3511 C CZ    . TYR B 1 129 ? -32.552 57.719  18.220  1.00 26.14  ? 155 TYR B CZ    1 
ATOM   3512 O OH    . TYR B 1 129 ? -32.389 56.441  17.738  1.00 23.90  ? 155 TYR B OH    1 
ATOM   3513 N N     . LEU B 1 130 ? -32.588 64.726  19.942  1.00 46.84  ? 156 LEU B N     1 
ATOM   3514 C CA    . LEU B 1 130 ? -32.839 65.960  20.680  1.00 52.63  ? 156 LEU B CA    1 
ATOM   3515 C C     . LEU B 1 130 ? -33.404 67.080  19.808  1.00 46.76  ? 156 LEU B C     1 
ATOM   3516 O O     . LEU B 1 130 ? -34.022 68.017  20.314  1.00 54.89  ? 156 LEU B O     1 
ATOM   3517 C CB    . LEU B 1 130 ? -31.569 66.418  21.399  1.00 40.45  ? 156 LEU B CB    1 
ATOM   3518 C CG    . LEU B 1 130 ? -31.102 65.445  22.483  1.00 27.90  ? 156 LEU B CG    1 
ATOM   3519 C CD1   . LEU B 1 130 ? -29.738 65.838  23.031  1.00 24.64  ? 156 LEU B CD1   1 
ATOM   3520 C CD2   . LEU B 1 130 ? -32.136 65.359  23.596  1.00 18.95  ? 156 LEU B CD2   1 
ATOM   3521 N N     . ASN B 1 131 ? -33.194 66.980  18.501  1.00 37.53  ? 157 ASN B N     1 
ATOM   3522 C CA    . ASN B 1 131 ? -33.749 67.956  17.569  1.00 54.67  ? 157 ASN B CA    1 
ATOM   3523 C C     . ASN B 1 131 ? -35.198 67.648  17.197  1.00 57.82  ? 157 ASN B C     1 
ATOM   3524 O O     . ASN B 1 131 ? -36.061 68.524  17.253  1.00 68.88  ? 157 ASN B O     1 
ATOM   3525 C CB    . ASN B 1 131 ? -32.882 68.063  16.313  1.00 62.70  ? 157 ASN B CB    1 
ATOM   3526 C CG    . ASN B 1 131 ? -31.596 68.830  16.557  1.00 50.07  ? 157 ASN B CG    1 
ATOM   3527 O OD1   . ASN B 1 131 ? -31.525 69.677  17.448  1.00 38.07  ? 157 ASN B OD1   1 
ATOM   3528 N ND2   . ASN B 1 131 ? -30.573 68.540  15.760  1.00 42.42  ? 157 ASN B ND2   1 
ATOM   3529 N N     . ASP B 1 132 ? -35.460 66.401  16.819  1.00 51.34  ? 158 ASP B N     1 
ATOM   3530 C CA    . ASP B 1 132 ? -36.812 65.979  16.469  1.00 62.89  ? 158 ASP B CA    1 
ATOM   3531 C C     . ASP B 1 132 ? -37.586 65.615  17.731  1.00 57.45  ? 158 ASP B C     1 
ATOM   3532 O O     . ASP B 1 132 ? -38.266 64.593  17.783  1.00 54.35  ? 158 ASP B O     1 
ATOM   3533 C CB    . ASP B 1 132 ? -36.769 64.783  15.516  1.00 74.90  ? 158 ASP B CB    1 
ATOM   3534 C CG    . ASP B 1 132 ? -35.963 65.063  14.261  1.00 91.30  ? 158 ASP B CG    1 
ATOM   3535 O OD1   . ASP B 1 132 ? -35.355 66.151  14.170  1.00 102.78 ? 158 ASP B OD1   1 
ATOM   3536 O OD2   . ASP B 1 132 ? -35.936 64.194  13.365  1.00 93.26  ? 158 ASP B OD2   1 
ATOM   3537 N N     . LEU B 1 133 ? -37.483 66.468  18.743  1.00 62.90  ? 159 LEU B N     1 
ATOM   3538 C CA    . LEU B 1 133 ? -38.026 66.170  20.064  1.00 68.57  ? 159 LEU B CA    1 
ATOM   3539 C C     . LEU B 1 133 ? -39.555 66.192  20.106  1.00 72.10  ? 159 LEU B C     1 
ATOM   3540 O O     . LEU B 1 133 ? -40.176 65.322  20.718  1.00 63.48  ? 159 LEU B O     1 
ATOM   3541 C CB    . LEU B 1 133 ? -37.443 67.135  21.100  1.00 58.68  ? 159 LEU B CB    1 
ATOM   3542 C CG    . LEU B 1 133 ? -37.505 66.694  22.562  1.00 54.53  ? 159 LEU B CG    1 
ATOM   3543 C CD1   . LEU B 1 133 ? -37.009 65.267  22.715  1.00 56.41  ? 159 LEU B CD1   1 
ATOM   3544 C CD2   . LEU B 1 133 ? -36.693 67.638  23.426  1.00 60.12  ? 159 LEU B CD2   1 
ATOM   3545 N N     . ASP B 1 134 ? -40.158 67.184  19.458  1.00 75.95  ? 160 ASP B N     1 
ATOM   3546 C CA    . ASP B 1 134 ? -41.614 67.293  19.421  1.00 62.69  ? 160 ASP B CA    1 
ATOM   3547 C C     . ASP B 1 134 ? -42.238 66.106  18.699  1.00 54.30  ? 160 ASP B C     1 
ATOM   3548 O O     . ASP B 1 134 ? -43.359 65.700  19.005  1.00 47.28  ? 160 ASP B O     1 
ATOM   3549 C CB    . ASP B 1 134 ? -42.044 68.597  18.748  1.00 60.98  ? 160 ASP B CB    1 
ATOM   3550 C CG    . ASP B 1 134 ? -41.707 69.818  19.575  1.00 71.52  ? 160 ASP B CG    1 
ATOM   3551 O OD1   . ASP B 1 134 ? -41.692 70.932  19.010  1.00 77.13  ? 160 ASP B OD1   1 
ATOM   3552 O OD2   . ASP B 1 134 ? -41.454 69.664  20.788  1.00 74.55  ? 160 ASP B OD2   1 
ATOM   3553 N N     . ARG B 1 135 ? -41.507 65.554  17.737  1.00 56.63  ? 161 ARG B N     1 
ATOM   3554 C CA    . ARG B 1 135 ? -41.985 64.405  16.978  1.00 53.13  ? 161 ARG B CA    1 
ATOM   3555 C C     . ARG B 1 135 ? -41.924 63.120  17.802  1.00 52.74  ? 161 ARG B C     1 
ATOM   3556 O O     . ARG B 1 135 ? -42.827 62.286  17.737  1.00 35.30  ? 161 ARG B O     1 
ATOM   3557 C CB    . ARG B 1 135 ? -41.176 64.240  15.687  1.00 48.51  ? 161 ARG B CB    1 
ATOM   3558 C CG    . ARG B 1 135 ? -41.525 62.986  14.895  1.00 41.79  ? 161 ARG B CG    1 
ATOM   3559 C CD    . ARG B 1 135 ? -40.858 62.974  13.528  1.00 39.01  ? 161 ARG B CD    1 
ATOM   3560 N NE    . ARG B 1 135 ? -39.401 62.912  13.615  1.00 49.55  ? 161 ARG B NE    1 
ATOM   3561 C CZ    . ARG B 1 135 ? -38.705 61.782  13.692  1.00 50.21  ? 161 ARG B CZ    1 
ATOM   3562 N NH1   . ARG B 1 135 ? -39.331 60.613  13.700  1.00 38.18  ? 161 ARG B NH1   1 
ATOM   3563 N NH2   . ARG B 1 135 ? -37.381 61.820  13.764  1.00 56.17  ? 161 ARG B NH2   1 
ATOM   3564 N N     . ILE B 1 136 ? -40.858 62.973  18.581  1.00 62.40  ? 162 ILE B N     1 
ATOM   3565 C CA    . ILE B 1 136 ? -40.622 61.751  19.342  1.00 62.88  ? 162 ILE B CA    1 
ATOM   3566 C C     . ILE B 1 136 ? -41.517 61.635  20.573  1.00 40.09  ? 162 ILE B C     1 
ATOM   3567 O O     . ILE B 1 136 ? -42.001 60.550  20.900  1.00 37.15  ? 162 ILE B O     1 
ATOM   3568 C CB    . ILE B 1 136 ? -39.147 61.651  19.793  1.00 77.86  ? 162 ILE B CB    1 
ATOM   3569 C CG1   . ILE B 1 136 ? -38.211 61.712  18.586  1.00 79.95  ? 162 ILE B CG1   1 
ATOM   3570 C CG2   . ILE B 1 136 ? -38.911 60.373  20.581  1.00 86.90  ? 162 ILE B CG2   1 
ATOM   3571 C CD1   . ILE B 1 136 ? -38.424 60.595  17.592  1.00 80.17  ? 162 ILE B CD1   1 
ATOM   3572 N N     . ALA B 1 137 ? -41.741 62.757  21.248  1.00 32.42  ? 163 ALA B N     1 
ATOM   3573 C CA    . ALA B 1 137 ? -42.375 62.747  22.563  1.00 42.11  ? 163 ALA B CA    1 
ATOM   3574 C C     . ALA B 1 137 ? -43.903 62.746  22.531  1.00 54.87  ? 163 ALA B C     1 
ATOM   3575 O O     . ALA B 1 137 ? -44.544 63.475  23.287  1.00 68.76  ? 163 ALA B O     1 
ATOM   3576 C CB    . ALA B 1 137 ? -41.866 63.914  23.394  1.00 50.72  ? 163 ALA B CB    1 
ATOM   3577 N N     . GLN B 1 138 ? -44.484 61.920  21.669  1.00 54.12  ? 164 GLN B N     1 
ATOM   3578 C CA    . GLN B 1 138 ? -45.935 61.778  21.630  1.00 63.47  ? 164 GLN B CA    1 
ATOM   3579 C C     . GLN B 1 138 ? -46.348 60.318  21.775  1.00 72.84  ? 164 GLN B C     1 
ATOM   3580 O O     . GLN B 1 138 ? -45.650 59.422  21.303  1.00 81.24  ? 164 GLN B O     1 
ATOM   3581 C CB    . GLN B 1 138 ? -46.504 62.372  20.341  1.00 68.47  ? 164 GLN B CB    1 
ATOM   3582 C CG    . GLN B 1 138 ? -46.323 63.875  20.224  1.00 77.57  ? 164 GLN B CG    1 
ATOM   3583 C CD    . GLN B 1 138 ? -47.018 64.453  19.008  1.00 95.14  ? 164 GLN B CD    1 
ATOM   3584 O OE1   . GLN B 1 138 ? -47.683 63.736  18.260  1.00 107.79 ? 164 GLN B OE1   1 
ATOM   3585 N NE2   . GLN B 1 138 ? -46.870 65.757  18.805  1.00 96.70  ? 164 GLN B NE2   1 
ATOM   3586 N N     . PRO B 1 139 ? -47.487 60.075  22.441  1.00 69.00  ? 165 PRO B N     1 
ATOM   3587 C CA    . PRO B 1 139 ? -47.995 58.715  22.653  1.00 75.82  ? 165 PRO B CA    1 
ATOM   3588 C C     . PRO B 1 139 ? -48.222 57.987  21.333  1.00 82.13  ? 165 PRO B C     1 
ATOM   3589 O O     . PRO B 1 139 ? -47.753 56.861  21.167  1.00 85.71  ? 165 PRO B O     1 
ATOM   3590 C CB    . PRO B 1 139 ? -49.327 58.942  23.380  1.00 89.33  ? 165 PRO B CB    1 
ATOM   3591 C CG    . PRO B 1 139 ? -49.677 60.374  23.130  1.00 87.35  ? 165 PRO B CG    1 
ATOM   3592 C CD    . PRO B 1 139 ? -48.374 61.095  23.022  1.00 70.37  ? 165 PRO B CD    1 
ATOM   3593 N N     . ASN B 1 140 ? -48.936 58.623  20.409  1.00 92.91  ? 166 ASN B N     1 
ATOM   3594 C CA    . ASN B 1 140 ? -49.131 58.054  19.081  1.00 93.84  ? 166 ASN B CA    1 
ATOM   3595 C C     . ASN B 1 140 ? -47.928 58.317  18.177  1.00 79.25  ? 166 ASN B C     1 
ATOM   3596 O O     . ASN B 1 140 ? -48.025 59.042  17.187  1.00 69.69  ? 166 ASN B O     1 
ATOM   3597 C CB    . ASN B 1 140 ? -50.434 58.559  18.442  1.00 107.41 ? 166 ASN B CB    1 
ATOM   3598 C CG    . ASN B 1 140 ? -50.597 60.067  18.542  1.00 107.97 ? 166 ASN B CG    1 
ATOM   3599 O OD1   . ASN B 1 140 ? -49.626 60.800  18.727  1.00 116.58 ? 166 ASN B OD1   1 
ATOM   3600 N ND2   . ASN B 1 140 ? -51.837 60.537  18.414  1.00 85.03  ? 166 ASN B ND2   1 
ATOM   3601 N N     . TYR B 1 141 ? -46.795 57.719  18.538  1.00 77.76  ? 167 TYR B N     1 
ATOM   3602 C CA    . TYR B 1 141 ? -45.547 57.885  17.797  1.00 66.96  ? 167 TYR B CA    1 
ATOM   3603 C C     . TYR B 1 141 ? -44.935 56.549  17.395  1.00 60.58  ? 167 TYR B C     1 
ATOM   3604 O O     . TYR B 1 141 ? -44.803 55.641  18.216  1.00 57.37  ? 167 TYR B O     1 
ATOM   3605 C CB    . TYR B 1 141 ? -44.535 58.692  18.619  1.00 57.68  ? 167 TYR B CB    1 
ATOM   3606 C CG    . TYR B 1 141 ? -43.083 58.390  18.293  1.00 63.92  ? 167 TYR B CG    1 
ATOM   3607 C CD1   . TYR B 1 141 ? -42.494 58.873  17.130  1.00 68.50  ? 167 TYR B CD1   1 
ATOM   3608 C CD2   . TYR B 1 141 ? -42.300 57.627  19.154  1.00 67.75  ? 167 TYR B CD2   1 
ATOM   3609 C CE1   . TYR B 1 141 ? -41.168 58.598  16.830  1.00 59.72  ? 167 TYR B CE1   1 
ATOM   3610 C CE2   . TYR B 1 141 ? -40.973 57.349  18.863  1.00 58.05  ? 167 TYR B CE2   1 
ATOM   3611 C CZ    . TYR B 1 141 ? -40.413 57.837  17.699  1.00 57.28  ? 167 TYR B CZ    1 
ATOM   3612 O OH    . TYR B 1 141 ? -39.096 57.563  17.404  1.00 46.01  ? 167 TYR B OH    1 
ATOM   3613 N N     . ILE B 1 142 ? -44.563 56.440  16.124  1.00 58.64  ? 168 ILE B N     1 
ATOM   3614 C CA    . ILE B 1 142 ? -43.840 55.277  15.627  1.00 49.76  ? 168 ILE B CA    1 
ATOM   3615 C C     . ILE B 1 142 ? -42.521 55.725  15.006  1.00 48.12  ? 168 ILE B C     1 
ATOM   3616 O O     . ILE B 1 142 ? -42.510 56.552  14.093  1.00 47.71  ? 168 ILE B O     1 
ATOM   3617 C CB    . ILE B 1 142 ? -44.653 54.507  14.574  1.00 50.06  ? 168 ILE B CB    1 
ATOM   3618 C CG1   . ILE B 1 142 ? -46.028 54.133  15.128  1.00 57.53  ? 168 ILE B CG1   1 
ATOM   3619 C CG2   . ILE B 1 142 ? -43.897 53.267  14.125  1.00 45.72  ? 168 ILE B CG2   1 
ATOM   3620 C CD1   . ILE B 1 142 ? -46.887 53.360  14.152  1.00 57.04  ? 168 ILE B CD1   1 
ATOM   3621 N N     . PRO B 1 143 ? -41.402 55.182  15.504  1.00 56.37  ? 169 PRO B N     1 
ATOM   3622 C CA    . PRO B 1 143 ? -40.078 55.576  15.013  1.00 59.67  ? 169 PRO B CA    1 
ATOM   3623 C C     . PRO B 1 143 ? -39.868 55.176  13.556  1.00 59.32  ? 169 PRO B C     1 
ATOM   3624 O O     . PRO B 1 143 ? -40.200 54.056  13.167  1.00 54.81  ? 169 PRO B O     1 
ATOM   3625 C CB    . PRO B 1 143 ? -39.121 54.802  15.923  1.00 55.20  ? 169 PRO B CB    1 
ATOM   3626 C CG    . PRO B 1 143 ? -39.915 53.645  16.418  1.00 54.14  ? 169 PRO B CG    1 
ATOM   3627 C CD    . PRO B 1 143 ? -41.323 54.143  16.544  1.00 61.37  ? 169 PRO B CD    1 
ATOM   3628 N N     . THR B 1 144 ? -39.326 56.095  12.762  1.00 51.81  ? 170 THR B N     1 
ATOM   3629 C CA    . THR B 1 144 ? -39.045 55.825  11.359  1.00 46.38  ? 170 THR B CA    1 
ATOM   3630 C C     . THR B 1 144 ? -37.959 54.768  11.232  1.00 55.30  ? 170 THR B C     1 
ATOM   3631 O O     . THR B 1 144 ? -37.286 54.436  12.208  1.00 63.32  ? 170 THR B O     1 
ATOM   3632 C CB    . THR B 1 144 ? -38.591 57.095  10.618  1.00 53.76  ? 170 THR B CB    1 
ATOM   3633 O OG1   . THR B 1 144 ? -37.358 57.565  11.178  1.00 50.89  ? 170 THR B OG1   1 
ATOM   3634 C CG2   . THR B 1 144 ? -39.644 58.184  10.735  1.00 67.15  ? 170 THR B CG2   1 
ATOM   3635 N N     . GLN B 1 145 ? -37.789 54.242  10.025  1.00 64.69  ? 171 GLN B N     1 
ATOM   3636 C CA    . GLN B 1 145 ? -36.756 53.249  9.774   1.00 68.85  ? 171 GLN B CA    1 
ATOM   3637 C C     . GLN B 1 145 ? -35.387 53.878  10.017  1.00 62.57  ? 171 GLN B C     1 
ATOM   3638 O O     . GLN B 1 145 ? -34.420 53.187  10.336  1.00 53.15  ? 171 GLN B O     1 
ATOM   3639 C CB    . GLN B 1 145 ? -36.865 52.715  8.345   1.00 72.82  ? 171 GLN B CB    1 
ATOM   3640 C CG    . GLN B 1 145 ? -36.160 51.388  8.115   1.00 75.01  ? 171 GLN B CG    1 
ATOM   3641 C CD    . GLN B 1 145 ? -36.440 50.813  6.738   1.00 91.87  ? 171 GLN B CD    1 
ATOM   3642 O OE1   . GLN B 1 145 ? -37.091 51.447  5.908   1.00 95.81  ? 171 GLN B OE1   1 
ATOM   3643 N NE2   . GLN B 1 145 ? -35.946 49.606  6.489   1.00 101.42 ? 171 GLN B NE2   1 
ATOM   3644 N N     . GLN B 1 146 ? -35.321 55.198  9.873   1.00 55.28  ? 172 GLN B N     1 
ATOM   3645 C CA    . GLN B 1 146 ? -34.096 55.939  10.139  1.00 38.80  ? 172 GLN B CA    1 
ATOM   3646 C C     . GLN B 1 146 ? -33.868 56.054  11.639  1.00 38.96  ? 172 GLN B C     1 
ATOM   3647 O O     . GLN B 1 146 ? -32.738 55.945  12.114  1.00 42.47  ? 172 GLN B O     1 
ATOM   3648 C CB    . GLN B 1 146 ? -34.167 57.333  9.516   1.00 44.84  ? 172 GLN B CB    1 
ATOM   3649 C CG    . GLN B 1 146 ? -32.885 58.141  9.654   1.00 59.26  ? 172 GLN B CG    1 
ATOM   3650 C CD    . GLN B 1 146 ? -31.749 57.595  8.807   1.00 63.84  ? 172 GLN B CD    1 
ATOM   3651 O OE1   . GLN B 1 146 ? -30.588 57.952  9.005   1.00 64.22  ? 172 GLN B OE1   1 
ATOM   3652 N NE2   . GLN B 1 146 ? -32.080 56.727  7.856   1.00 56.71  ? 172 GLN B NE2   1 
ATOM   3653 N N     . ASP B 1 147 ? -34.950 56.282  12.377  1.00 37.67  ? 173 ASP B N     1 
ATOM   3654 C CA    . ASP B 1 147 ? -34.887 56.349  13.832  1.00 34.85  ? 173 ASP B CA    1 
ATOM   3655 C C     . ASP B 1 147 ? -34.297 55.065  14.396  1.00 41.65  ? 173 ASP B C     1 
ATOM   3656 O O     . ASP B 1 147 ? -33.393 55.098  15.231  1.00 38.10  ? 173 ASP B O     1 
ATOM   3657 C CB    . ASP B 1 147 ? -36.279 56.580  14.422  1.00 38.32  ? 173 ASP B CB    1 
ATOM   3658 C CG    . ASP B 1 147 ? -36.793 57.982  14.171  1.00 44.10  ? 173 ASP B CG    1 
ATOM   3659 O OD1   . ASP B 1 147 ? -36.068 58.776  13.536  1.00 54.39  ? 173 ASP B OD1   1 
ATOM   3660 O OD2   . ASP B 1 147 ? -37.921 58.290  14.612  1.00 29.19  ? 173 ASP B OD2   1 
ATOM   3661 N N     . VAL B 1 148 ? -34.818 53.935  13.932  1.00 46.52  ? 174 VAL B N     1 
ATOM   3662 C CA    . VAL B 1 148 ? -34.332 52.631  14.363  1.00 50.71  ? 174 VAL B CA    1 
ATOM   3663 C C     . VAL B 1 148 ? -32.856 52.478  14.018  1.00 54.74  ? 174 VAL B C     1 
ATOM   3664 O O     . VAL B 1 148 ? -32.119 51.755  14.686  1.00 57.21  ? 174 VAL B O     1 
ATOM   3665 C CB    . VAL B 1 148 ? -35.134 51.494  13.703  1.00 42.83  ? 174 VAL B CB    1 
ATOM   3666 C CG1   . VAL B 1 148 ? -34.678 50.144  14.229  1.00 36.70  ? 174 VAL B CG1   1 
ATOM   3667 C CG2   . VAL B 1 148 ? -36.619 51.687  13.951  1.00 46.26  ? 174 VAL B CG2   1 
ATOM   3668 N N     . LEU B 1 149 ? -32.428 53.176  12.972  1.00 59.31  ? 175 LEU B N     1 
ATOM   3669 C CA    . LEU B 1 149 ? -31.046 53.111  12.521  1.00 64.30  ? 175 LEU B CA    1 
ATOM   3670 C C     . LEU B 1 149 ? -30.120 53.891  13.453  1.00 49.37  ? 175 LEU B C     1 
ATOM   3671 O O     . LEU B 1 149 ? -28.936 53.575  13.578  1.00 37.56  ? 175 LEU B O     1 
ATOM   3672 C CB    . LEU B 1 149 ? -30.938 53.650  11.093  1.00 68.98  ? 175 LEU B CB    1 
ATOM   3673 C CG    . LEU B 1 149 ? -29.606 53.458  10.368  1.00 64.50  ? 175 LEU B CG    1 
ATOM   3674 C CD1   . LEU B 1 149 ? -29.230 51.985  10.327  1.00 59.86  ? 175 LEU B CD1   1 
ATOM   3675 C CD2   . LEU B 1 149 ? -29.681 54.039  8.964   1.00 59.90  ? 175 LEU B CD2   1 
ATOM   3676 N N     . ARG B 1 150 ? -30.667 54.907  14.111  1.00 39.89  ? 176 ARG B N     1 
ATOM   3677 C CA    . ARG B 1 150 ? -29.874 55.767  14.983  1.00 35.44  ? 176 ARG B CA    1 
ATOM   3678 C C     . ARG B 1 150 ? -29.824 55.277  16.428  1.00 39.72  ? 176 ARG B C     1 
ATOM   3679 O O     . ARG B 1 150 ? -29.053 55.793  17.237  1.00 35.50  ? 176 ARG B O     1 
ATOM   3680 C CB    . ARG B 1 150 ? -30.390 57.207  14.932  1.00 36.41  ? 176 ARG B CB    1 
ATOM   3681 C CG    . ARG B 1 150 ? -29.911 57.989  13.724  1.00 32.40  ? 176 ARG B CG    1 
ATOM   3682 C CD    . ARG B 1 150 ? -28.395 57.945  13.626  1.00 45.70  ? 176 ARG B CD    1 
ATOM   3683 N NE    . ARG B 1 150 ? -27.878 58.858  12.611  1.00 57.73  ? 176 ARG B NE    1 
ATOM   3684 C CZ    . ARG B 1 150 ? -27.448 60.089  12.865  1.00 59.91  ? 176 ARG B CZ    1 
ATOM   3685 N NH1   . ARG B 1 150 ? -27.472 60.557  14.105  1.00 61.20  ? 176 ARG B NH1   1 
ATOM   3686 N NH2   . ARG B 1 150 ? -26.993 60.851  11.881  1.00 66.89  ? 176 ARG B NH2   1 
ATOM   3687 N N     . THR B 1 151 ? -30.647 54.284  16.752  1.00 42.21  ? 177 THR B N     1 
ATOM   3688 C CA    . THR B 1 151 ? -30.662 53.729  18.102  1.00 35.90  ? 177 THR B CA    1 
ATOM   3689 C C     . THR B 1 151 ? -29.342 53.032  18.408  1.00 51.27  ? 177 THR B C     1 
ATOM   3690 O O     . THR B 1 151 ? -28.599 52.658  17.500  1.00 64.98  ? 177 THR B O     1 
ATOM   3691 C CB    . THR B 1 151 ? -31.818 52.733  18.304  1.00 36.16  ? 177 THR B CB    1 
ATOM   3692 O OG1   . THR B 1 151 ? -31.632 51.598  17.447  1.00 48.95  ? 177 THR B OG1   1 
ATOM   3693 C CG2   . THR B 1 151 ? -33.153 53.393  17.994  1.00 32.50  ? 177 THR B CG2   1 
ATOM   3694 N N     . ARG B 1 152 ? -29.055 52.858  19.693  1.00 50.07  ? 178 ARG B N     1 
ATOM   3695 C CA    . ARG B 1 152 ? -27.798 52.256  20.116  1.00 47.10  ? 178 ARG B CA    1 
ATOM   3696 C C     . ARG B 1 152 ? -27.995 51.289  21.278  1.00 43.00  ? 178 ARG B C     1 
ATOM   3697 O O     . ARG B 1 152 ? -28.472 51.671  22.346  1.00 43.21  ? 178 ARG B O     1 
ATOM   3698 C CB    . ARG B 1 152 ? -26.786 53.345  20.477  1.00 49.30  ? 178 ARG B CB    1 
ATOM   3699 C CG    . ARG B 1 152 ? -27.425 54.621  20.997  1.00 58.40  ? 178 ARG B CG    1 
ATOM   3700 C CD    . ARG B 1 152 ? -26.489 55.814  20.875  1.00 56.56  ? 178 ARG B CD    1 
ATOM   3701 N NE    . ARG B 1 152 ? -25.313 55.684  21.729  1.00 54.80  ? 178 ARG B NE    1 
ATOM   3702 C CZ    . ARG B 1 152 ? -24.124 55.271  21.304  1.00 56.96  ? 178 ARG B CZ    1 
ATOM   3703 N NH1   . ARG B 1 152 ? -23.947 54.952  20.030  1.00 64.99  ? 178 ARG B NH1   1 
ATOM   3704 N NH2   . ARG B 1 152 ? -23.112 55.183  22.154  1.00 52.76  ? 178 ARG B NH2   1 
ATOM   3705 N N     . VAL B 1 153 ? -27.627 50.031  21.051  1.00 53.55  ? 179 VAL B N     1 
ATOM   3706 C CA    . VAL B 1 153 ? -27.762 48.985  22.059  1.00 64.53  ? 179 VAL B CA    1 
ATOM   3707 C C     . VAL B 1 153 ? -26.410 48.339  22.353  1.00 76.13  ? 179 VAL B C     1 
ATOM   3708 O O     . VAL B 1 153 ? -25.452 48.509  21.598  1.00 66.27  ? 179 VAL B O     1 
ATOM   3709 C CB    . VAL B 1 153 ? -28.754 47.891  21.608  1.00 50.00  ? 179 VAL B CB    1 
ATOM   3710 C CG1   . VAL B 1 153 ? -30.175 48.437  21.564  1.00 26.72  ? 179 VAL B CG1   1 
ATOM   3711 C CG2   . VAL B 1 153 ? -28.348 47.331  20.252  1.00 42.81  ? 179 VAL B CG2   1 
ATOM   3712 N N     . LYS B 1 154 ? -26.338 47.596  23.454  1.00 87.73  ? 180 LYS B N     1 
ATOM   3713 C CA    . LYS B 1 154 ? -25.109 46.905  23.828  1.00 97.42  ? 180 LYS B CA    1 
ATOM   3714 C C     . LYS B 1 154 ? -24.965 45.601  23.043  1.00 95.43  ? 180 LYS B C     1 
ATOM   3715 O O     . LYS B 1 154 ? -25.899 45.167  22.370  1.00 91.88  ? 180 LYS B O     1 
ATOM   3716 C CB    . LYS B 1 154 ? -25.076 46.639  25.336  1.00 108.32 ? 180 LYS B CB    1 
ATOM   3717 C CG    . LYS B 1 154 ? -25.250 47.892  26.187  1.00 114.33 ? 180 LYS B CG    1 
ATOM   3718 C CD    . LYS B 1 154 ? -25.125 47.598  27.679  1.00 114.93 ? 180 LYS B CD    1 
ATOM   3719 C CE    . LYS B 1 154 ? -23.687 47.285  28.073  1.00 111.61 ? 180 LYS B CE    1 
ATOM   3720 N NZ    . LYS B 1 154 ? -23.537 47.089  29.545  1.00 98.50  ? 180 LYS B NZ    1 
ATOM   3721 N N     . THR B 1 155 ? -23.791 44.983  23.130  1.00 97.28  ? 181 THR B N     1 
ATOM   3722 C CA    . THR B 1 155 ? -23.512 43.766  22.374  1.00 102.38 ? 181 THR B CA    1 
ATOM   3723 C C     . THR B 1 155 ? -23.432 42.535  23.273  1.00 110.64 ? 181 THR B C     1 
ATOM   3724 O O     . THR B 1 155 ? -22.881 42.592  24.373  1.00 109.61 ? 181 THR B O     1 
ATOM   3725 C CB    . THR B 1 155 ? -22.200 43.892  21.575  1.00 100.21 ? 181 THR B CB    1 
ATOM   3726 O OG1   . THR B 1 155 ? -22.295 44.998  20.669  1.00 96.51  ? 181 THR B OG1   1 
ATOM   3727 C CG2   . THR B 1 155 ? -21.930 42.620  20.788  1.00 106.28 ? 181 THR B CG2   1 
ATOM   3728 N N     . THR B 1 156 ? -23.986 41.423  22.797  1.00 118.13 ? 182 THR B N     1 
ATOM   3729 C CA    . THR B 1 156 ? -23.960 40.172  23.547  1.00 126.39 ? 182 THR B CA    1 
ATOM   3730 C C     . THR B 1 156 ? -23.083 39.127  22.863  1.00 114.66 ? 182 THR B C     1 
ATOM   3731 O O     . THR B 1 156 ? -23.468 37.964  22.739  1.00 117.54 ? 182 THR B O     1 
ATOM   3732 C CB    . THR B 1 156 ? -25.376 39.594  23.735  1.00 137.17 ? 182 THR B CB    1 
ATOM   3733 O OG1   . THR B 1 156 ? -25.986 39.389  22.455  1.00 142.11 ? 182 THR B OG1   1 
ATOM   3734 C CG2   . THR B 1 156 ? -26.236 40.543  24.558  1.00 132.00 ? 182 THR B CG2   1 
ATOM   3735 N N     . GLY B 1 157 ? -21.903 39.548  22.420  1.00 122.95 ? 183 GLY B N     1 
ATOM   3736 C CA    . GLY B 1 157 ? -20.959 38.645  21.789  1.00 117.72 ? 183 GLY B CA    1 
ATOM   3737 C C     . GLY B 1 157 ? -21.227 38.427  20.313  1.00 117.19 ? 183 GLY B C     1 
ATOM   3738 O O     . GLY B 1 157 ? -21.044 39.331  19.497  1.00 108.54 ? 183 GLY B O     1 
ATOM   3739 N N     . ILE B 1 158 ? -21.661 37.218  19.973  1.00 126.56 ? 184 ILE B N     1 
ATOM   3740 C CA    . ILE B 1 158 ? -21.934 36.853  18.587  1.00 125.92 ? 184 ILE B CA    1 
ATOM   3741 C C     . ILE B 1 158 ? -22.917 37.827  17.944  1.00 119.78 ? 184 ILE B C     1 
ATOM   3742 O O     . ILE B 1 158 ? -24.015 38.044  18.458  1.00 121.93 ? 184 ILE B O     1 
ATOM   3743 C CB    . ILE B 1 158 ? -22.509 35.426  18.488  1.00 125.87 ? 184 ILE B CB    1 
ATOM   3744 C CG1   . ILE B 1 158 ? -21.692 34.456  19.345  1.00 114.10 ? 184 ILE B CG1   1 
ATOM   3745 C CG2   . ILE B 1 158 ? -22.558 34.968  17.036  1.00 123.17 ? 184 ILE B CG2   1 
ATOM   3746 C CD1   . ILE B 1 158 ? -22.261 33.054  19.396  1.00 103.64 ? 184 ILE B CD1   1 
ATOM   3747 N N     . VAL B 1 159 ? -22.515 38.413  16.821  1.00 104.74 ? 185 VAL B N     1 
ATOM   3748 C CA    . VAL B 1 159 ? -23.374 39.330  16.079  1.00 104.45 ? 185 VAL B CA    1 
ATOM   3749 C C     . VAL B 1 159 ? -23.168 39.167  14.578  1.00 113.10 ? 185 VAL B C     1 
ATOM   3750 O O     . VAL B 1 159 ? -22.050 39.300  14.083  1.00 119.41 ? 185 VAL B O     1 
ATOM   3751 C CB    . VAL B 1 159 ? -23.104 40.797  16.457  1.00 96.29  ? 185 VAL B CB    1 
ATOM   3752 C CG1   . VAL B 1 159 ? -23.891 41.732  15.547  1.00 79.70  ? 185 VAL B CG1   1 
ATOM   3753 C CG2   . VAL B 1 159 ? -23.450 41.046  17.917  1.00 106.93 ? 185 VAL B CG2   1 
ATOM   3754 N N     . GLU B 1 160 ? -24.248 38.883  13.856  1.00 111.54 ? 186 GLU B N     1 
ATOM   3755 C CA    . GLU B 1 160 ? -24.156 38.684  12.414  1.00 108.41 ? 186 GLU B CA    1 
ATOM   3756 C C     . GLU B 1 160 ? -25.516 38.709  11.722  1.00 101.03 ? 186 GLU B C     1 
ATOM   3757 O O     . GLU B 1 160 ? -26.556 38.532  12.360  1.00 92.99  ? 186 GLU B O     1 
ATOM   3758 C CB    . GLU B 1 160 ? -23.421 37.376  12.102  1.00 117.58 ? 186 GLU B CB    1 
ATOM   3759 C CG    . GLU B 1 160 ? -24.059 36.134  12.704  1.00 131.57 ? 186 GLU B CG    1 
ATOM   3760 C CD    . GLU B 1 160 ? -25.197 35.595  11.861  1.00 141.82 ? 186 GLU B CD    1 
ATOM   3761 O OE1   . GLU B 1 160 ? -25.971 34.756  12.370  1.00 146.61 ? 186 GLU B OE1   1 
ATOM   3762 O OE2   . GLU B 1 160 ? -25.317 36.010  10.689  1.00 143.56 ? 186 GLU B OE2   1 
ATOM   3763 N N     . THR B 1 161 ? -25.494 38.932  10.411  1.00 99.52  ? 187 THR B N     1 
ATOM   3764 C CA    . THR B 1 161 ? -26.708 38.944  9.601   1.00 99.92  ? 187 THR B CA    1 
ATOM   3765 C C     . THR B 1 161 ? -26.458 38.263  8.256   1.00 96.58  ? 187 THR B C     1 
ATOM   3766 O O     . THR B 1 161 ? -25.347 38.303  7.727   1.00 90.42  ? 187 THR B O     1 
ATOM   3767 C CB    . THR B 1 161 ? -27.223 40.381  9.368   1.00 92.54  ? 187 THR B CB    1 
ATOM   3768 O OG1   . THR B 1 161 ? -28.432 40.343  8.600   1.00 88.95  ? 187 THR B OG1   1 
ATOM   3769 C CG2   . THR B 1 161 ? -26.184 41.211  8.629   1.00 87.92  ? 187 THR B CG2   1 
ATOM   3770 N N     . HIS B 1 162 ? -27.493 37.633  7.711   1.00 99.54  ? 188 HIS B N     1 
ATOM   3771 C CA    . HIS B 1 162 ? -27.373 36.922  6.443   1.00 101.89 ? 188 HIS B CA    1 
ATOM   3772 C C     . HIS B 1 162 ? -28.227 37.571  5.360   1.00 102.83 ? 188 HIS B C     1 
ATOM   3773 O O     . HIS B 1 162 ? -29.404 37.861  5.578   1.00 108.15 ? 188 HIS B O     1 
ATOM   3774 C CB    . HIS B 1 162 ? -27.775 35.455  6.611   1.00 109.18 ? 188 HIS B CB    1 
ATOM   3775 C CG    . HIS B 1 162 ? -26.968 34.721  7.636   1.00 123.72 ? 188 HIS B CG    1 
ATOM   3776 N ND1   . HIS B 1 162 ? -25.720 34.202  7.369   1.00 129.56 ? 188 HIS B ND1   1 
ATOM   3777 C CD2   . HIS B 1 162 ? -27.234 34.414  8.928   1.00 131.04 ? 188 HIS B CD2   1 
ATOM   3778 C CE1   . HIS B 1 162 ? -25.250 33.609  8.452   1.00 133.55 ? 188 HIS B CE1   1 
ATOM   3779 N NE2   . HIS B 1 162 ? -26.150 33.723  9.412   1.00 134.44 ? 188 HIS B NE2   1 
ATOM   3780 N N     . PHE B 1 163 ? -27.632 37.792  4.193   1.00 95.13  ? 189 PHE B N     1 
ATOM   3781 C CA    . PHE B 1 163 ? -28.343 38.414  3.082   1.00 99.90  ? 189 PHE B CA    1 
ATOM   3782 C C     . PHE B 1 163 ? -27.714 38.062  1.739   1.00 104.42 ? 189 PHE B C     1 
ATOM   3783 O O     . PHE B 1 163 ? -26.507 37.845  1.644   1.00 104.96 ? 189 PHE B O     1 
ATOM   3784 C CB    . PHE B 1 163 ? -28.377 39.933  3.254   1.00 103.60 ? 189 PHE B CB    1 
ATOM   3785 C CG    . PHE B 1 163 ? -27.031 40.587  3.127   1.00 107.35 ? 189 PHE B CG    1 
ATOM   3786 C CD1   . PHE B 1 163 ? -26.610 41.107  1.914   1.00 104.18 ? 189 PHE B CD1   1 
ATOM   3787 C CD2   . PHE B 1 163 ? -26.186 40.681  4.221   1.00 113.23 ? 189 PHE B CD2   1 
ATOM   3788 C CE1   . PHE B 1 163 ? -25.372 41.711  1.794   1.00 102.94 ? 189 PHE B CE1   1 
ATOM   3789 C CE2   . PHE B 1 163 ? -24.946 41.283  4.107   1.00 111.55 ? 189 PHE B CE2   1 
ATOM   3790 C CZ    . PHE B 1 163 ? -24.539 41.799  2.892   1.00 107.05 ? 189 PHE B CZ    1 
ATOM   3791 N N     . THR B 1 164 ? -28.543 38.015  0.702   1.00 108.14 ? 190 THR B N     1 
ATOM   3792 C CA    . THR B 1 164 ? -28.071 37.725  -0.645  1.00 107.86 ? 190 THR B CA    1 
ATOM   3793 C C     . THR B 1 164 ? -28.048 38.997  -1.487  1.00 102.80 ? 190 THR B C     1 
ATOM   3794 O O     . THR B 1 164 ? -28.967 39.814  -1.420  1.00 100.36 ? 190 THR B O     1 
ATOM   3795 C CB    . THR B 1 164 ? -28.957 36.671  -1.338  1.00 113.01 ? 190 THR B CB    1 
ATOM   3796 O OG1   . THR B 1 164 ? -28.994 35.477  -0.547  1.00 113.94 ? 190 THR B OG1   1 
ATOM   3797 C CG2   . THR B 1 164 ? -28.416 36.342  -2.721  1.00 112.69 ? 190 THR B CG2   1 
ATOM   3798 N N     . PHE B 1 165 ? -26.991 39.163  -2.274  1.00 96.86  ? 191 PHE B N     1 
ATOM   3799 C CA    . PHE B 1 165 ? -26.865 40.323  -3.148  1.00 96.07  ? 191 PHE B CA    1 
ATOM   3800 C C     . PHE B 1 165 ? -26.012 39.992  -4.366  1.00 100.63 ? 191 PHE B C     1 
ATOM   3801 O O     . PHE B 1 165 ? -24.860 39.577  -4.234  1.00 103.77 ? 191 PHE B O     1 
ATOM   3802 C CB    . PHE B 1 165 ? -26.272 41.508  -2.384  1.00 90.35  ? 191 PHE B CB    1 
ATOM   3803 C CG    . PHE B 1 165 ? -26.161 42.764  -3.202  1.00 88.45  ? 191 PHE B CG    1 
ATOM   3804 C CD1   . PHE B 1 165 ? -27.267 43.280  -3.857  1.00 88.91  ? 191 PHE B CD1   1 
ATOM   3805 C CD2   . PHE B 1 165 ? -24.954 43.437  -3.301  1.00 85.79  ? 191 PHE B CD2   1 
ATOM   3806 C CE1   . PHE B 1 165 ? -27.170 44.438  -4.605  1.00 90.71  ? 191 PHE B CE1   1 
ATOM   3807 C CE2   . PHE B 1 165 ? -24.851 44.596  -4.047  1.00 88.78  ? 191 PHE B CE2   1 
ATOM   3808 C CZ    . PHE B 1 165 ? -25.961 45.098  -4.699  1.00 92.62  ? 191 PHE B CZ    1 
ATOM   3809 N N     . LYS B 1 166 ? -26.587 40.175  -5.550  1.00 97.39  ? 192 LYS B N     1 
ATOM   3810 C CA    . LYS B 1 166 ? -25.905 39.842  -6.795  1.00 98.48  ? 192 LYS B CA    1 
ATOM   3811 C C     . LYS B 1 166 ? -25.482 38.375  -6.813  1.00 107.79 ? 192 LYS B C     1 
ATOM   3812 O O     . LYS B 1 166 ? -24.331 38.054  -7.106  1.00 103.45 ? 192 LYS B O     1 
ATOM   3813 C CB    . LYS B 1 166 ? -24.693 40.752  -7.012  1.00 93.67  ? 192 LYS B CB    1 
ATOM   3814 C CG    . LYS B 1 166 ? -25.049 42.206  -7.286  1.00 93.18  ? 192 LYS B CG    1 
ATOM   3815 C CD    . LYS B 1 166 ? -23.813 43.026  -7.629  1.00 94.77  ? 192 LYS B CD    1 
ATOM   3816 C CE    . LYS B 1 166 ? -24.186 44.446  -8.033  1.00 99.90  ? 192 LYS B CE    1 
ATOM   3817 N NZ    . LYS B 1 166 ? -22.994 45.253  -8.417  1.00 96.56  ? 192 LYS B NZ    1 
ATOM   3818 N N     . ASP B 1 167 ? -26.425 37.493  -6.493  1.00 121.92 ? 193 ASP B N     1 
ATOM   3819 C CA    . ASP B 1 167 ? -26.179 36.052  -6.493  1.00 134.44 ? 193 ASP B CA    1 
ATOM   3820 C C     . ASP B 1 167 ? -25.042 35.649  -5.556  1.00 129.39 ? 193 ASP B C     1 
ATOM   3821 O O     . ASP B 1 167 ? -24.339 34.668  -5.806  1.00 119.57 ? 193 ASP B O     1 
ATOM   3822 C CB    . ASP B 1 167 ? -25.897 35.551  -7.913  1.00 143.74 ? 193 ASP B CB    1 
ATOM   3823 C CG    . ASP B 1 167 ? -27.102 35.674  -8.825  1.00 148.87 ? 193 ASP B CG    1 
ATOM   3824 O OD1   . ASP B 1 167 ? -28.144 36.195  -8.372  1.00 151.03 ? 193 ASP B OD1   1 
ATOM   3825 O OD2   . ASP B 1 167 ? -27.009 35.247  -9.995  1.00 147.95 ? 193 ASP B OD2   1 
ATOM   3826 N N     . LEU B 1 168 ? -24.870 36.404  -4.476  1.00 129.98 ? 194 LEU B N     1 
ATOM   3827 C CA    . LEU B 1 168 ? -23.829 36.113  -3.495  1.00 121.01 ? 194 LEU B CA    1 
ATOM   3828 C C     . LEU B 1 168 ? -24.403 36.022  -2.084  1.00 113.76 ? 194 LEU B C     1 
ATOM   3829 O O     . LEU B 1 168 ? -25.099 36.929  -1.628  1.00 116.38 ? 194 LEU B O     1 
ATOM   3830 C CB    . LEU B 1 168 ? -22.728 37.174  -3.549  1.00 118.53 ? 194 LEU B CB    1 
ATOM   3831 C CG    . LEU B 1 168 ? -21.922 37.236  -4.847  1.00 120.62 ? 194 LEU B CG    1 
ATOM   3832 C CD1   . LEU B 1 168 ? -20.970 38.423  -4.840  1.00 120.72 ? 194 LEU B CD1   1 
ATOM   3833 C CD2   . LEU B 1 168 ? -21.163 35.936  -5.068  1.00 118.29 ? 194 LEU B CD2   1 
ATOM   3834 N N     . HIS B 1 169 ? -24.106 34.922  -1.399  1.00 107.29 ? 195 HIS B N     1 
ATOM   3835 C CA    . HIS B 1 169 ? -24.597 34.708  -0.042  1.00 112.28 ? 195 HIS B CA    1 
ATOM   3836 C C     . HIS B 1 169 ? -23.639 35.292  0.994   1.00 111.21 ? 195 HIS B C     1 
ATOM   3837 O O     . HIS B 1 169 ? -22.617 34.688  1.320   1.00 108.40 ? 195 HIS B O     1 
ATOM   3838 C CB    . HIS B 1 169 ? -24.822 33.217  0.223   1.00 115.55 ? 195 HIS B CB    1 
ATOM   3839 C CG    . HIS B 1 169 ? -25.849 32.593  -0.670  1.00 119.47 ? 195 HIS B CG    1 
ATOM   3840 N ND1   . HIS B 1 169 ? -27.200 32.642  -0.398  1.00 117.84 ? 195 HIS B ND1   1 
ATOM   3841 C CD2   . HIS B 1 169 ? -25.724 31.905  -1.829  1.00 116.84 ? 195 HIS B CD2   1 
ATOM   3842 C CE1   . HIS B 1 169 ? -27.862 32.012  -1.352  1.00 112.12 ? 195 HIS B CE1   1 
ATOM   3843 N NE2   . HIS B 1 169 ? -26.990 31.555  -2.233  1.00 112.23 ? 195 HIS B NE2   1 
ATOM   3844 N N     . PHE B 1 170 ? -23.981 36.469  1.508   1.00 106.23 ? 196 PHE B N     1 
ATOM   3845 C CA    . PHE B 1 170 ? -23.139 37.165  2.474   1.00 99.34  ? 196 PHE B CA    1 
ATOM   3846 C C     . PHE B 1 170 ? -23.415 36.731  3.910   1.00 106.64 ? 196 PHE B C     1 
ATOM   3847 O O     . PHE B 1 170 ? -24.561 36.487  4.289   1.00 103.59 ? 196 PHE B O     1 
ATOM   3848 C CB    . PHE B 1 170 ? -23.327 38.679  2.357   1.00 93.76  ? 196 PHE B CB    1 
ATOM   3849 C CG    . PHE B 1 170 ? -22.725 39.276  1.117   1.00 87.81  ? 196 PHE B CG    1 
ATOM   3850 C CD1   . PHE B 1 170 ? -23.447 39.329  -0.063  1.00 88.71  ? 196 PHE B CD1   1 
ATOM   3851 C CD2   . PHE B 1 170 ? -21.441 39.797  1.136   1.00 82.89  ? 196 PHE B CD2   1 
ATOM   3852 C CE1   . PHE B 1 170 ? -22.896 39.883  -1.204  1.00 94.60  ? 196 PHE B CE1   1 
ATOM   3853 C CE2   . PHE B 1 170 ? -20.885 40.351  0.000   1.00 83.67  ? 196 PHE B CE2   1 
ATOM   3854 C CZ    . PHE B 1 170 ? -21.613 40.395  -1.171  1.00 93.59  ? 196 PHE B CZ    1 
ATOM   3855 N N     . LYS B 1 171 ? -22.352 36.642  4.703   1.00 117.40 ? 197 LYS B N     1 
ATOM   3856 C CA    . LYS B 1 171 ? -22.466 36.385  6.133   1.00 122.70 ? 197 LYS B CA    1 
ATOM   3857 C C     . LYS B 1 171 ? -21.592 37.373  6.899   1.00 112.37 ? 197 LYS B C     1 
ATOM   3858 O O     . LYS B 1 171 ? -20.433 37.088  7.199   1.00 118.24 ? 197 LYS B O     1 
ATOM   3859 C CB    . LYS B 1 171 ? -22.060 34.948  6.466   1.00 133.95 ? 197 LYS B CB    1 
ATOM   3860 C CG    . LYS B 1 171 ? -22.972 33.887  5.868   1.00 142.70 ? 197 LYS B CG    1 
ATOM   3861 C CD    . LYS B 1 171 ? -22.608 32.497  6.368   1.00 142.84 ? 197 LYS B CD    1 
ATOM   3862 C CE    . LYS B 1 171 ? -23.559 31.443  5.822   1.00 137.00 ? 197 LYS B CE    1 
ATOM   3863 N NZ    . LYS B 1 171 ? -23.226 30.079  6.319   1.00 131.54 ? 197 LYS B NZ    1 
ATOM   3864 N N     . MET B 1 172 ? -22.154 38.537  7.206   1.00 100.11 ? 198 MET B N     1 
ATOM   3865 C CA    . MET B 1 172 ? -21.407 39.610  7.855   1.00 97.56  ? 198 MET B CA    1 
ATOM   3866 C C     . MET B 1 172 ? -21.336 39.426  9.367   1.00 91.84  ? 198 MET B C     1 
ATOM   3867 O O     . MET B 1 172 ? -22.362 39.381  10.043  1.00 98.23  ? 198 MET B O     1 
ATOM   3868 C CB    . MET B 1 172 ? -22.030 40.966  7.518   1.00 101.73 ? 198 MET B CB    1 
ATOM   3869 C CG    . MET B 1 172 ? -21.371 42.149  8.205   1.00 102.47 ? 198 MET B CG    1 
ATOM   3870 S SD    . MET B 1 172 ? -22.052 43.724  7.654   1.00 103.83 ? 198 MET B SD    1 
ATOM   3871 C CE    . MET B 1 172 ? -21.586 43.706  5.925   1.00 50.61  ? 198 MET B CE    1 
ATOM   3872 N N     . PHE B 1 173 ? -20.118 39.327  9.892   1.00 82.85  ? 199 PHE B N     1 
ATOM   3873 C CA    . PHE B 1 173 ? -19.913 39.126  11.323  1.00 85.46  ? 199 PHE B CA    1 
ATOM   3874 C C     . PHE B 1 173 ? -19.280 40.347  11.987  1.00 89.25  ? 199 PHE B C     1 
ATOM   3875 O O     . PHE B 1 173 ? -18.202 40.792  11.593  1.00 92.61  ? 199 PHE B O     1 
ATOM   3876 C CB    . PHE B 1 173 ? -19.051 37.884  11.572  1.00 84.38  ? 199 PHE B CB    1 
ATOM   3877 C CG    . PHE B 1 173 ? -19.713 36.594  11.170  1.00 91.04  ? 199 PHE B CG    1 
ATOM   3878 C CD1   . PHE B 1 173 ? -20.444 35.858  12.089  1.00 99.65  ? 199 PHE B CD1   1 
ATOM   3879 C CD2   . PHE B 1 173 ? -19.602 36.116  9.876   1.00 87.35  ? 199 PHE B CD2   1 
ATOM   3880 C CE1   . PHE B 1 173 ? -21.055 34.672  11.722  1.00 97.16  ? 199 PHE B CE1   1 
ATOM   3881 C CE2   . PHE B 1 173 ? -20.211 34.931  9.503   1.00 89.99  ? 199 PHE B CE2   1 
ATOM   3882 C CZ    . PHE B 1 173 ? -20.938 34.208  10.428  1.00 90.29  ? 199 PHE B CZ    1 
ATOM   3883 N N     . ASP B 1 174 ? -19.960 40.883  12.996  1.00 89.85  ? 200 ASP B N     1 
ATOM   3884 C CA    . ASP B 1 174 ? -19.459 42.031  13.744  1.00 92.40  ? 200 ASP B CA    1 
ATOM   3885 C C     . ASP B 1 174 ? -19.063 41.633  15.162  1.00 97.43  ? 200 ASP B C     1 
ATOM   3886 O O     . ASP B 1 174 ? -19.846 41.016  15.886  1.00 93.25  ? 200 ASP B O     1 
ATOM   3887 C CB    . ASP B 1 174 ? -20.509 43.142  13.792  1.00 95.32  ? 200 ASP B CB    1 
ATOM   3888 C CG    . ASP B 1 174 ? -20.080 44.311  14.658  1.00 100.75 ? 200 ASP B CG    1 
ATOM   3889 O OD1   . ASP B 1 174 ? -18.859 44.510  14.830  1.00 104.53 ? 200 ASP B OD1   1 
ATOM   3890 O OD2   . ASP B 1 174 ? -20.964 45.034  15.164  1.00 100.92 ? 200 ASP B OD2   1 
ATOM   3891 N N     . VAL B 1 175 ? -17.845 41.995  15.554  1.00 100.51 ? 201 VAL B N     1 
ATOM   3892 C CA    . VAL B 1 175 ? -17.329 41.659  16.875  1.00 106.56 ? 201 VAL B CA    1 
ATOM   3893 C C     . VAL B 1 175 ? -18.254 42.152  17.983  1.00 108.98 ? 201 VAL B C     1 
ATOM   3894 O O     . VAL B 1 175 ? -18.910 41.358  18.655  1.00 113.85 ? 201 VAL B O     1 
ATOM   3895 C CB    . VAL B 1 175 ? -15.929 42.255  17.098  1.00 117.12 ? 201 VAL B CB    1 
ATOM   3896 C CG1   . VAL B 1 175 ? -15.430 41.919  18.495  1.00 123.84 ? 201 VAL B CG1   1 
ATOM   3897 C CG2   . VAL B 1 175 ? -14.962 41.748  16.040  1.00 116.42 ? 201 VAL B CG2   1 
ATOM   3898 N N     . GLY B 1 176 ? -18.297 43.467  18.169  1.00 112.98 ? 202 GLY B N     1 
ATOM   3899 C CA    . GLY B 1 176 ? -19.139 44.064  19.188  1.00 119.83 ? 202 GLY B CA    1 
ATOM   3900 C C     . GLY B 1 176 ? -18.348 44.846  20.217  1.00 128.06 ? 202 GLY B C     1 
ATOM   3901 O O     . GLY B 1 176 ? -17.117 44.820  20.220  1.00 123.01 ? 202 GLY B O     1 
ATOM   3902 N N     . GLY B 1 177 ? -19.060 45.544  21.096  1.00 139.41 ? 203 GLY B N     1 
ATOM   3903 C CA    . GLY B 1 177 ? -18.430 46.347  22.127  1.00 144.17 ? 203 GLY B CA    1 
ATOM   3904 C C     . GLY B 1 177 ? -17.756 45.508  23.195  1.00 148.87 ? 203 GLY B C     1 
ATOM   3905 O O     . GLY B 1 177 ? -16.895 45.993  23.928  1.00 155.03 ? 203 GLY B O     1 
ATOM   3906 N N     . GLN B 1 178 ? -18.150 44.243  23.284  1.00 147.05 ? 204 GLN B N     1 
ATOM   3907 C CA    . GLN B 1 178 ? -17.566 43.330  24.260  1.00 149.26 ? 204 GLN B CA    1 
ATOM   3908 C C     . GLN B 1 178 ? -16.372 42.581  23.677  1.00 150.16 ? 204 GLN B C     1 
ATOM   3909 O O     . GLN B 1 178 ? -16.282 42.382  22.466  1.00 153.71 ? 204 GLN B O     1 
ATOM   3910 C CB    . GLN B 1 178 ? -18.621 42.344  24.770  1.00 148.43 ? 204 GLN B CB    1 
ATOM   3911 C CG    . GLN B 1 178 ? -19.458 41.698  23.674  1.00 141.16 ? 204 GLN B CG    1 
ATOM   3912 C CD    . GLN B 1 178 ? -18.649 40.777  22.783  1.00 132.57 ? 204 GLN B CD    1 
ATOM   3913 O OE1   . GLN B 1 178 ? -17.864 39.960  23.264  1.00 131.80 ? 204 GLN B OE1   1 
ATOM   3914 N NE2   . GLN B 1 178 ? -18.840 40.902  21.475  1.00 128.15 ? 204 GLN B NE2   1 
ATOM   3915 N N     . ARG B 1 179 ? -15.453 42.173  24.546  1.00 142.74 ? 205 ARG B N     1 
ATOM   3916 C CA    . ARG B 1 179 ? -14.280 41.421  24.117  1.00 132.33 ? 205 ARG B CA    1 
ATOM   3917 C C     . ARG B 1 179 ? -14.554 39.922  24.164  1.00 120.05 ? 205 ARG B C     1 
ATOM   3918 O O     . ARG B 1 179 ? -15.044 39.401  25.166  1.00 114.27 ? 205 ARG B O     1 
ATOM   3919 C CB    . ARG B 1 179 ? -13.072 41.765  24.989  1.00 134.11 ? 205 ARG B CB    1 
ATOM   3920 C CG    . ARG B 1 179 ? -13.276 41.486  26.467  1.00 135.03 ? 205 ARG B CG    1 
ATOM   3921 C CD    . ARG B 1 179 ? -12.003 41.725  27.258  1.00 136.55 ? 205 ARG B CD    1 
ATOM   3922 N NE    . ARG B 1 179 ? -12.185 41.436  28.676  1.00 138.15 ? 205 ARG B NE    1 
ATOM   3923 C CZ    . ARG B 1 179 ? -12.595 42.328  29.572  1.00 140.52 ? 205 ARG B CZ    1 
ATOM   3924 N NH1   . ARG B 1 179 ? -12.865 43.571  29.196  1.00 139.97 ? 205 ARG B NH1   1 
ATOM   3925 N NH2   . ARG B 1 179 ? -12.735 41.979  30.843  1.00 142.27 ? 205 ARG B NH2   1 
ATOM   3926 N N     . SER B 1 180 ? -14.239 39.232  23.074  1.00 118.80 ? 206 SER B N     1 
ATOM   3927 C CA    . SER B 1 180 ? -14.456 37.794  22.995  1.00 128.21 ? 206 SER B CA    1 
ATOM   3928 C C     . SER B 1 180 ? -13.361 37.040  23.741  1.00 130.68 ? 206 SER B C     1 
ATOM   3929 O O     . SER B 1 180 ? -12.372 37.633  24.172  1.00 116.25 ? 206 SER B O     1 
ATOM   3930 C CB    . SER B 1 180 ? -14.512 37.341  21.534  1.00 134.18 ? 206 SER B CB    1 
ATOM   3931 O OG    . SER B 1 180 ? -14.806 35.958  21.436  1.00 137.94 ? 206 SER B OG    1 
ATOM   3932 N N     . GLU B 1 181 ? -13.545 35.732  23.892  1.00 144.73 ? 207 GLU B N     1 
ATOM   3933 C CA    . GLU B 1 181 ? -12.563 34.896  24.573  1.00 150.92 ? 207 GLU B CA    1 
ATOM   3934 C C     . GLU B 1 181 ? -11.236 34.870  23.822  1.00 156.62 ? 207 GLU B C     1 
ATOM   3935 O O     . GLU B 1 181 ? -11.141 35.344  22.691  1.00 151.45 ? 207 GLU B O     1 
ATOM   3936 C CB    . GLU B 1 181 ? -13.096 33.473  24.760  1.00 145.64 ? 207 GLU B CB    1 
ATOM   3937 C CG    . GLU B 1 181 ? -14.252 33.368  25.741  1.00 140.28 ? 207 GLU B CG    1 
ATOM   3938 C CD    . GLU B 1 181 ? -14.650 31.932  26.019  1.00 137.70 ? 207 GLU B CD    1 
ATOM   3939 O OE1   . GLU B 1 181 ? -14.147 31.029  25.318  1.00 135.92 ? 207 GLU B OE1   1 
ATOM   3940 O OE2   . GLU B 1 181 ? -15.467 31.707  26.937  1.00 135.27 ? 207 GLU B OE2   1 
ATOM   3941 N N     . ARG B 1 182 ? -10.216 34.307  24.459  1.00 164.48 ? 208 ARG B N     1 
ATOM   3942 C CA    . ARG B 1 182 ? -8.870  34.291  23.897  1.00 165.32 ? 208 ARG B CA    1 
ATOM   3943 C C     . ARG B 1 182 ? -8.773  33.439  22.632  1.00 157.62 ? 208 ARG B C     1 
ATOM   3944 O O     . ARG B 1 182 ? -7.946  33.705  21.760  1.00 147.50 ? 208 ARG B O     1 
ATOM   3945 C CB    . ARG B 1 182 ? -7.867  33.797  24.943  1.00 171.99 ? 208 ARG B CB    1 
ATOM   3946 C CG    . ARG B 1 182 ? -7.918  34.563  26.257  1.00 173.75 ? 208 ARG B CG    1 
ATOM   3947 C CD    . ARG B 1 182 ? -6.906  34.025  27.258  1.00 175.71 ? 208 ARG B CD    1 
ATOM   3948 N NE    . ARG B 1 182 ? -5.533  34.200  26.796  1.00 173.68 ? 208 ARG B NE    1 
ATOM   3949 C CZ    . ARG B 1 182 ? -4.796  35.280  27.036  1.00 169.13 ? 208 ARG B CZ    1 
ATOM   3950 N NH1   . ARG B 1 182 ? -5.301  36.288  27.735  1.00 160.16 ? 208 ARG B NH1   1 
ATOM   3951 N NH2   . ARG B 1 182 ? -3.555  35.353  26.576  1.00 171.44 ? 208 ARG B NH2   1 
ATOM   3952 N N     . LYS B 1 183 ? -9.621  32.420  22.534  1.00 156.96 ? 209 LYS B N     1 
ATOM   3953 C CA    . LYS B 1 183 ? -9.555  31.486  21.414  1.00 147.96 ? 209 LYS B CA    1 
ATOM   3954 C C     . LYS B 1 183 ? -10.829 31.483  20.572  1.00 140.41 ? 209 LYS B C     1 
ATOM   3955 O O     . LYS B 1 183 ? -10.948 30.712  19.620  1.00 132.98 ? 209 LYS B O     1 
ATOM   3956 C CB    . LYS B 1 183 ? -9.250  30.072  21.918  1.00 146.66 ? 209 LYS B CB    1 
ATOM   3957 C CG    . LYS B 1 183 ? -7.955  29.967  22.712  1.00 144.59 ? 209 LYS B CG    1 
ATOM   3958 C CD    . LYS B 1 183 ? -7.718  28.551  23.212  1.00 143.52 ? 209 LYS B CD    1 
ATOM   3959 C CE    . LYS B 1 183 ? -6.437  28.464  24.029  1.00 145.63 ? 209 LYS B CE    1 
ATOM   3960 N NZ    . LYS B 1 183 ? -6.193  27.087  24.544  1.00 146.22 ? 209 LYS B NZ    1 
ATOM   3961 N N     . LYS B 1 184 ? -11.778 32.345  20.923  1.00 140.29 ? 210 LYS B N     1 
ATOM   3962 C CA    . LYS B 1 184 ? -13.033 32.435  20.181  1.00 132.57 ? 210 LYS B CA    1 
ATOM   3963 C C     . LYS B 1 184 ? -12.906 33.324  18.950  1.00 117.17 ? 210 LYS B C     1 
ATOM   3964 O O     . LYS B 1 184 ? -13.697 33.216  18.014  1.00 114.31 ? 210 LYS B O     1 
ATOM   3965 C CB    . LYS B 1 184 ? -14.164 32.942  21.079  1.00 131.94 ? 210 LYS B CB    1 
ATOM   3966 C CG    . LYS B 1 184 ? -14.783 31.876  21.964  1.00 134.15 ? 210 LYS B CG    1 
ATOM   3967 C CD    . LYS B 1 184 ? -16.008 32.413  22.683  1.00 136.64 ? 210 LYS B CD    1 
ATOM   3968 C CE    . LYS B 1 184 ? -16.729 31.315  23.445  1.00 142.72 ? 210 LYS B CE    1 
ATOM   3969 N NZ    . LYS B 1 184 ? -17.933 31.834  24.149  1.00 146.40 ? 210 LYS B NZ    1 
ATOM   3970 N N     . TRP B 1 185 ? -11.910 34.204  18.957  1.00 105.49 ? 211 TRP B N     1 
ATOM   3971 C CA    . TRP B 1 185 ? -11.678 35.103  17.834  1.00 101.41 ? 211 TRP B CA    1 
ATOM   3972 C C     . TRP B 1 185 ? -11.398 34.331  16.548  1.00 107.25 ? 211 TRP B C     1 
ATOM   3973 O O     . TRP B 1 185 ? -11.811 34.741  15.464  1.00 97.79  ? 211 TRP B O     1 
ATOM   3974 C CB    . TRP B 1 185 ? -10.514 36.049  18.136  1.00 97.00  ? 211 TRP B CB    1 
ATOM   3975 C CG    . TRP B 1 185 ? -10.842 37.118  19.132  1.00 104.14 ? 211 TRP B CG    1 
ATOM   3976 C CD1   . TRP B 1 185 ? -10.735 37.034  20.489  1.00 118.08 ? 211 TRP B CD1   1 
ATOM   3977 C CD2   . TRP B 1 185 ? -11.326 38.437  18.849  1.00 101.39 ? 211 TRP B CD2   1 
ATOM   3978 N NE1   . TRP B 1 185 ? -11.125 38.217  21.070  1.00 116.36 ? 211 TRP B NE1   1 
ATOM   3979 C CE2   . TRP B 1 185 ? -11.492 39.095  20.084  1.00 106.48 ? 211 TRP B CE2   1 
ATOM   3980 C CE3   . TRP B 1 185 ? -11.636 39.124  17.671  1.00 90.37  ? 211 TRP B CE3   1 
ATOM   3981 C CZ2   . TRP B 1 185 ? -11.954 40.406  20.175  1.00 99.14  ? 211 TRP B CZ2   1 
ATOM   3982 C CZ3   . TRP B 1 185 ? -12.095 40.426  17.764  1.00 83.87  ? 211 TRP B CZ3   1 
ATOM   3983 C CH2   . TRP B 1 185 ? -12.249 41.053  19.006  1.00 88.45  ? 211 TRP B CH2   1 
ATOM   3984 N N     . ILE B 1 186 ? -10.698 33.210  16.678  1.00 114.22 ? 212 ILE B N     1 
ATOM   3985 C CA    . ILE B 1 186 ? -10.292 32.416  15.523  1.00 108.53 ? 212 ILE B CA    1 
ATOM   3986 C C     . ILE B 1 186 ? -11.458 32.087  14.594  1.00 97.58  ? 212 ILE B C     1 
ATOM   3987 O O     . ILE B 1 186 ? -11.319 32.146  13.373  1.00 93.43  ? 212 ILE B O     1 
ATOM   3988 C CB    . ILE B 1 186 ? -9.613  31.106  15.957  1.00 120.39 ? 212 ILE B CB    1 
ATOM   3989 C CG1   . ILE B 1 186 ? -8.514  31.394  16.981  1.00 117.48 ? 212 ILE B CG1   1 
ATOM   3990 C CG2   . ILE B 1 186 ? -9.050  30.374  14.748  1.00 127.82 ? 212 ILE B CG2   1 
ATOM   3991 C CD1   . ILE B 1 186 ? -7.439  32.326  16.472  1.00 110.33 ? 212 ILE B CD1   1 
ATOM   3992 N N     . HIS B 1 187 ? -12.602 31.740  15.177  1.00 101.00 ? 213 HIS B N     1 
ATOM   3993 C CA    . HIS B 1 187 ? -13.781 31.371  14.398  1.00 105.80 ? 213 HIS B CA    1 
ATOM   3994 C C     . HIS B 1 187 ? -14.030 32.331  13.241  1.00 107.49 ? 213 HIS B C     1 
ATOM   3995 O O     . HIS B 1 187 ? -14.270 31.905  12.112  1.00 114.26 ? 213 HIS B O     1 
ATOM   3996 C CB    . HIS B 1 187 ? -15.024 31.304  15.290  1.00 115.08 ? 213 HIS B CB    1 
ATOM   3997 C CG    . HIS B 1 187 ? -15.026 30.148  16.241  1.00 134.63 ? 213 HIS B CG    1 
ATOM   3998 N ND1   . HIS B 1 187 ? -15.367 28.869  15.856  1.00 141.94 ? 213 HIS B ND1   1 
ATOM   3999 C CD2   . HIS B 1 187 ? -14.736 30.079  17.562  1.00 145.45 ? 213 HIS B CD2   1 
ATOM   4000 C CE1   . HIS B 1 187 ? -15.283 28.061  16.898  1.00 148.78 ? 213 HIS B CE1   1 
ATOM   4001 N NE2   . HIS B 1 187 ? -14.903 28.770  17.945  1.00 152.85 ? 213 HIS B NE2   1 
ATOM   4002 N N     . CYS B 1 188 ? -13.968 33.628  13.526  1.00 104.84 ? 214 CYS B N     1 
ATOM   4003 C CA    . CYS B 1 188 ? -14.254 34.645  12.521  1.00 103.35 ? 214 CYS B CA    1 
ATOM   4004 C C     . CYS B 1 188 ? -13.079 34.856  11.572  1.00 108.27 ? 214 CYS B C     1 
ATOM   4005 O O     . CYS B 1 188 ? -13.265 35.238  10.417  1.00 113.97 ? 214 CYS B O     1 
ATOM   4006 C CB    . CYS B 1 188 ? -14.634 35.968  13.188  1.00 96.28  ? 214 CYS B CB    1 
ATOM   4007 S SG    . CYS B 1 188 ? -13.269 36.792  14.035  1.00 174.83 ? 214 CYS B SG    1 
ATOM   4008 N N     . PHE B 1 189 ? -11.869 34.610  12.062  1.00 104.36 ? 215 PHE B N     1 
ATOM   4009 C CA    . PHE B 1 189 ? -10.671 34.798  11.252  1.00 105.00 ? 215 PHE B CA    1 
ATOM   4010 C C     . PHE B 1 189 ? -10.488 33.672  10.241  1.00 111.10 ? 215 PHE B C     1 
ATOM   4011 O O     . PHE B 1 189 ? -9.790  33.831  9.240   1.00 112.55 ? 215 PHE B O     1 
ATOM   4012 C CB    . PHE B 1 189 ? -9.431  34.918  12.138  1.00 102.14 ? 215 PHE B CB    1 
ATOM   4013 C CG    . PHE B 1 189 ? -9.441  36.123  13.030  1.00 90.44  ? 215 PHE B CG    1 
ATOM   4014 C CD1   . PHE B 1 189 ? -9.421  35.984  14.406  1.00 89.09  ? 215 PHE B CD1   1 
ATOM   4015 C CD2   . PHE B 1 189 ? -9.480  37.397  12.491  1.00 84.70  ? 215 PHE B CD2   1 
ATOM   4016 C CE1   . PHE B 1 189 ? -9.432  37.093  15.228  1.00 90.85  ? 215 PHE B CE1   1 
ATOM   4017 C CE2   . PHE B 1 189 ? -9.491  38.510  13.307  1.00 86.45  ? 215 PHE B CE2   1 
ATOM   4018 C CZ    . PHE B 1 189 ? -9.468  38.358  14.678  1.00 87.58  ? 215 PHE B CZ    1 
ATOM   4019 N N     . GLU B 1 190 ? -11.118 32.534  10.508  1.00 116.44 ? 216 GLU B N     1 
ATOM   4020 C CA    . GLU B 1 190 ? -11.006 31.380  9.627   1.00 125.18 ? 216 GLU B CA    1 
ATOM   4021 C C     . GLU B 1 190 ? -11.835 31.557  8.359   1.00 127.19 ? 216 GLU B C     1 
ATOM   4022 O O     . GLU B 1 190 ? -13.063 31.627  8.412   1.00 128.32 ? 216 GLU B O     1 
ATOM   4023 C CB    . GLU B 1 190 ? -11.424 30.102  10.358  1.00 135.70 ? 216 GLU B CB    1 
ATOM   4024 C CG    . GLU B 1 190 ? -10.502 29.711  11.502  1.00 145.70 ? 216 GLU B CG    1 
ATOM   4025 C CD    . GLU B 1 190 ? -10.950 28.446  12.208  1.00 150.95 ? 216 GLU B CD    1 
ATOM   4026 O OE1   . GLU B 1 190 ? -12.083 27.987  11.950  1.00 153.06 ? 216 GLU B OE1   1 
ATOM   4027 O OE2   . GLU B 1 190 ? -10.170 27.910  13.023  1.00 150.59 ? 216 GLU B OE2   1 
ATOM   4028 N N     . GLY B 1 191 ? -11.151 31.636  7.221   1.00 126.85 ? 217 GLY B N     1 
ATOM   4029 C CA    . GLY B 1 191 ? -11.811 31.694  5.930   1.00 123.04 ? 217 GLY B CA    1 
ATOM   4030 C C     . GLY B 1 191 ? -12.435 33.034  5.596   1.00 111.88 ? 217 GLY B C     1 
ATOM   4031 O O     . GLY B 1 191 ? -13.108 33.171  4.573   1.00 111.97 ? 217 GLY B O     1 
ATOM   4032 N N     . VAL B 1 192 ? -12.216 34.026  6.453   1.00 104.24 ? 218 VAL B N     1 
ATOM   4033 C CA    . VAL B 1 192 ? -12.759 35.359  6.220   1.00 100.13 ? 218 VAL B CA    1 
ATOM   4034 C C     . VAL B 1 192 ? -12.326 35.889  4.856   1.00 93.44  ? 218 VAL B C     1 
ATOM   4035 O O     . VAL B 1 192 ? -11.134 35.964  4.556   1.00 99.22  ? 218 VAL B O     1 
ATOM   4036 C CB    . VAL B 1 192 ? -12.347 36.352  7.327   1.00 95.99  ? 218 VAL B CB    1 
ATOM   4037 C CG1   . VAL B 1 192 ? -10.840 36.326  7.539   1.00 97.20  ? 218 VAL B CG1   1 
ATOM   4038 C CG2   . VAL B 1 192 ? -12.826 37.757  6.988   1.00 86.78  ? 218 VAL B CG2   1 
ATOM   4039 N N     . THR B 1 193 ? -13.303 36.245  4.030   1.00 81.59  ? 219 THR B N     1 
ATOM   4040 C CA    . THR B 1 193 ? -13.029 36.720  2.680   1.00 81.56  ? 219 THR B CA    1 
ATOM   4041 C C     . THR B 1 193 ? -12.431 38.122  2.695   1.00 83.68  ? 219 THR B C     1 
ATOM   4042 O O     . THR B 1 193 ? -11.321 38.340  2.209   1.00 83.54  ? 219 THR B O     1 
ATOM   4043 C CB    . THR B 1 193 ? -14.303 36.724  1.817   1.00 81.70  ? 219 THR B CB    1 
ATOM   4044 O OG1   . THR B 1 193 ? -14.841 35.398  1.752   1.00 85.78  ? 219 THR B OG1   1 
ATOM   4045 C CG2   . THR B 1 193 ? -13.992 37.212  0.411   1.00 76.03  ? 219 THR B CG2   1 
ATOM   4046 N N     . ALA B 1 194 ? -13.174 39.069  3.256   1.00 84.59  ? 220 ALA B N     1 
ATOM   4047 C CA    . ALA B 1 194 ? -12.714 40.449  3.337   1.00 86.00  ? 220 ALA B CA    1 
ATOM   4048 C C     . ALA B 1 194 ? -12.959 41.027  4.724   1.00 89.36  ? 220 ALA B C     1 
ATOM   4049 O O     . ALA B 1 194 ? -13.841 40.571  5.452   1.00 96.12  ? 220 ALA B O     1 
ATOM   4050 C CB    . ALA B 1 194 ? -13.398 41.300  2.279   1.00 76.14  ? 220 ALA B CB    1 
ATOM   4051 N N     . ILE B 1 195 ? -12.169 42.032  5.085   1.00 79.49  ? 221 ILE B N     1 
ATOM   4052 C CA    . ILE B 1 195 ? -12.335 42.711  6.361   1.00 72.42  ? 221 ILE B CA    1 
ATOM   4053 C C     . ILE B 1 195 ? -12.700 44.171  6.139   1.00 67.03  ? 221 ILE B C     1 
ATOM   4054 O O     . ILE B 1 195 ? -12.127 44.840  5.281   1.00 65.27  ? 221 ILE B O     1 
ATOM   4055 C CB    . ILE B 1 195 ? -11.060 42.631  7.217   1.00 79.25  ? 221 ILE B CB    1 
ATOM   4056 C CG1   . ILE B 1 195 ? -10.683 41.172  7.475   1.00 85.73  ? 221 ILE B CG1   1 
ATOM   4057 C CG2   . ILE B 1 195 ? -11.254 43.369  8.532   1.00 74.26  ? 221 ILE B CG2   1 
ATOM   4058 C CD1   . ILE B 1 195 ? -9.447  41.006  8.327   1.00 86.19  ? 221 ILE B CD1   1 
ATOM   4059 N N     . ILE B 1 196 ? -13.664 44.655  6.914   1.00 68.96  ? 222 ILE B N     1 
ATOM   4060 C CA    . ILE B 1 196 ? -14.109 46.038  6.815   1.00 56.13  ? 222 ILE B CA    1 
ATOM   4061 C C     . ILE B 1 196 ? -13.756 46.798  8.089   1.00 52.40  ? 222 ILE B C     1 
ATOM   4062 O O     . ILE B 1 196 ? -14.505 46.776  9.065   1.00 54.64  ? 222 ILE B O     1 
ATOM   4063 C CB    . ILE B 1 196 ? -15.626 46.120  6.575   1.00 54.00  ? 222 ILE B CB    1 
ATOM   4064 C CG1   . ILE B 1 196 ? -16.015 45.294  5.346   1.00 57.41  ? 222 ILE B CG1   1 
ATOM   4065 C CG2   . ILE B 1 196 ? -16.065 47.565  6.413   1.00 50.19  ? 222 ILE B CG2   1 
ATOM   4066 C CD1   . ILE B 1 196 ? -17.503 45.271  5.071   1.00 50.50  ? 222 ILE B CD1   1 
ATOM   4067 N N     . PHE B 1 197 ? -12.607 47.464  8.072   1.00 54.92  ? 223 PHE B N     1 
ATOM   4068 C CA    . PHE B 1 197 ? -12.139 48.215  9.229   1.00 59.96  ? 223 PHE B CA    1 
ATOM   4069 C C     . PHE B 1 197 ? -12.741 49.617  9.238   1.00 55.71  ? 223 PHE B C     1 
ATOM   4070 O O     . PHE B 1 197 ? -12.523 50.402  8.315   1.00 50.71  ? 223 PHE B O     1 
ATOM   4071 C CB    . PHE B 1 197 ? -10.611 48.288  9.235   1.00 54.62  ? 223 PHE B CB    1 
ATOM   4072 C CG    . PHE B 1 197 ? -10.031 48.742  10.542  1.00 47.11  ? 223 PHE B CG    1 
ATOM   4073 C CD1   . PHE B 1 197 ? -9.863  47.849  11.587  1.00 53.32  ? 223 PHE B CD1   1 
ATOM   4074 C CD2   . PHE B 1 197 ? -9.648  50.059  10.725  1.00 48.44  ? 223 PHE B CD2   1 
ATOM   4075 C CE1   . PHE B 1 197 ? -9.329  48.261  12.792  1.00 55.30  ? 223 PHE B CE1   1 
ATOM   4076 C CE2   . PHE B 1 197 ? -9.111  50.478  11.929  1.00 54.91  ? 223 PHE B CE2   1 
ATOM   4077 C CZ    . PHE B 1 197 ? -8.952  49.578  12.963  1.00 51.56  ? 223 PHE B CZ    1 
ATOM   4078 N N     . CYS B 1 198 ? -13.497 49.926  10.286  1.00 52.11  ? 224 CYS B N     1 
ATOM   4079 C CA    . CYS B 1 198 ? -14.202 51.199  10.374  1.00 51.45  ? 224 CYS B CA    1 
ATOM   4080 C C     . CYS B 1 198 ? -13.463 52.203  11.254  1.00 56.06  ? 224 CYS B C     1 
ATOM   4081 O O     . CYS B 1 198 ? -13.031 51.875  12.361  1.00 61.15  ? 224 CYS B O     1 
ATOM   4082 C CB    . CYS B 1 198 ? -15.619 50.980  10.906  1.00 49.94  ? 224 CYS B CB    1 
ATOM   4083 S SG    . CYS B 1 198 ? -16.569 49.747  9.989   1.00 60.59  ? 224 CYS B SG    1 
ATOM   4084 N N     . VAL B 1 199 ? -13.328 53.428  10.755  1.00 44.46  ? 225 VAL B N     1 
ATOM   4085 C CA    . VAL B 1 199 ? -12.631 54.482  11.484  1.00 52.26  ? 225 VAL B CA    1 
ATOM   4086 C C     . VAL B 1 199 ? -13.437 55.776  11.521  1.00 51.27  ? 225 VAL B C     1 
ATOM   4087 O O     . VAL B 1 199 ? -13.628 56.429  10.496  1.00 51.27  ? 225 VAL B O     1 
ATOM   4088 C CB    . VAL B 1 199 ? -11.250 54.778  10.866  1.00 53.84  ? 225 VAL B CB    1 
ATOM   4089 C CG1   . VAL B 1 199 ? -10.612 55.981  11.546  1.00 53.14  ? 225 VAL B CG1   1 
ATOM   4090 C CG2   . VAL B 1 199 ? -10.348 53.559  10.967  1.00 57.65  ? 225 VAL B CG2   1 
ATOM   4091 N N     . ALA B 1 200 ? -13.904 56.144  12.709  1.00 48.43  ? 226 ALA B N     1 
ATOM   4092 C CA    . ALA B 1 200 ? -14.639 57.390  12.882  1.00 37.93  ? 226 ALA B CA    1 
ATOM   4093 C C     . ALA B 1 200 ? -13.713 58.582  12.673  1.00 33.56  ? 226 ALA B C     1 
ATOM   4094 O O     . ALA B 1 200 ? -12.879 58.886  13.524  1.00 37.60  ? 226 ALA B O     1 
ATOM   4095 C CB    . ALA B 1 200 ? -15.272 57.444  14.263  1.00 43.33  ? 226 ALA B CB    1 
ATOM   4096 N N     . LEU B 1 201 ? -13.858 59.251  11.534  1.00 41.50  ? 227 LEU B N     1 
ATOM   4097 C CA    . LEU B 1 201 ? -13.033 60.413  11.225  1.00 44.60  ? 227 LEU B CA    1 
ATOM   4098 C C     . LEU B 1 201 ? -13.183 61.494  12.289  1.00 39.88  ? 227 LEU B C     1 
ATOM   4099 O O     . LEU B 1 201 ? -12.210 62.146  12.668  1.00 39.14  ? 227 LEU B O     1 
ATOM   4100 C CB    . LEU B 1 201 ? -13.397 60.982  9.851   1.00 44.87  ? 227 LEU B CB    1 
ATOM   4101 C CG    . LEU B 1 201 ? -13.112 60.096  8.636   1.00 49.13  ? 227 LEU B CG    1 
ATOM   4102 C CD1   . LEU B 1 201 ? -13.598 60.765  7.361   1.00 52.97  ? 227 LEU B CD1   1 
ATOM   4103 C CD2   . LEU B 1 201 ? -11.631 59.773  8.541   1.00 46.05  ? 227 LEU B CD2   1 
ATOM   4104 N N     . SER B 1 202 ? -14.408 61.668  12.773  1.00 46.18  ? 228 SER B N     1 
ATOM   4105 C CA    . SER B 1 202 ? -14.724 62.724  13.730  1.00 58.72  ? 228 SER B CA    1 
ATOM   4106 C C     . SER B 1 202 ? -14.003 62.579  15.074  1.00 56.61  ? 228 SER B C     1 
ATOM   4107 O O     . SER B 1 202 ? -14.038 63.490  15.901  1.00 68.21  ? 228 SER B O     1 
ATOM   4108 C CB    . SER B 1 202 ? -16.238 62.803  13.950  1.00 55.68  ? 228 SER B CB    1 
ATOM   4109 O OG    . SER B 1 202 ? -16.765 61.543  14.331  1.00 48.43  ? 228 SER B OG    1 
ATOM   4110 N N     . ASP B 1 203 ? -13.353 61.440  15.289  1.00 37.77  ? 229 ASP B N     1 
ATOM   4111 C CA    . ASP B 1 203 ? -12.644 61.193  16.543  1.00 34.69  ? 229 ASP B CA    1 
ATOM   4112 C C     . ASP B 1 203 ? -11.266 61.850  16.555  1.00 37.62  ? 229 ASP B C     1 
ATOM   4113 O O     . ASP B 1 203 ? -10.487 61.665  17.492  1.00 42.83  ? 229 ASP B O     1 
ATOM   4114 C CB    . ASP B 1 203 ? -12.513 59.689  16.807  1.00 37.71  ? 229 ASP B CB    1 
ATOM   4115 C CG    . ASP B 1 203 ? -13.827 59.049  17.222  1.00 59.80  ? 229 ASP B CG    1 
ATOM   4116 O OD1   . ASP B 1 203 ? -14.838 59.775  17.335  1.00 76.61  ? 229 ASP B OD1   1 
ATOM   4117 O OD2   . ASP B 1 203 ? -13.847 57.818  17.440  1.00 51.68  ? 229 ASP B OD2   1 
ATOM   4118 N N     . TYR B 1 204 ? -10.970 62.621  15.515  1.00 37.68  ? 230 TYR B N     1 
ATOM   4119 C CA    . TYR B 1 204 ? -9.662  63.251  15.386  1.00 44.71  ? 230 TYR B CA    1 
ATOM   4120 C C     . TYR B 1 204 ? -9.476  64.370  16.407  1.00 43.71  ? 230 TYR B C     1 
ATOM   4121 O O     . TYR B 1 204 ? -8.353  64.669  16.811  1.00 41.93  ? 230 TYR B O     1 
ATOM   4122 C CB    . TYR B 1 204 ? -9.467  63.802  13.971  1.00 43.32  ? 230 TYR B CB    1 
ATOM   4123 C CG    . TYR B 1 204 ? -10.152 65.130  13.737  1.00 36.32  ? 230 TYR B CG    1 
ATOM   4124 C CD1   . TYR B 1 204 ? -11.492 65.189  13.383  1.00 38.93  ? 230 TYR B CD1   1 
ATOM   4125 C CD2   . TYR B 1 204 ? -9.457  66.325  13.873  1.00 31.66  ? 230 TYR B CD2   1 
ATOM   4126 C CE1   . TYR B 1 204 ? -12.123 66.401  13.172  1.00 47.64  ? 230 TYR B CE1   1 
ATOM   4127 C CE2   . TYR B 1 204 ? -10.078 67.542  13.663  1.00 30.03  ? 230 TYR B CE2   1 
ATOM   4128 C CZ    . TYR B 1 204 ? -11.411 67.574  13.313  1.00 41.99  ? 230 TYR B CZ    1 
ATOM   4129 O OH    . TYR B 1 204 ? -12.037 68.781  13.103  1.00 34.77  ? 230 TYR B OH    1 
ATOM   4130 N N     . ASP B 1 205 ? -10.583 64.981  16.821  1.00 45.11  ? 231 ASP B N     1 
ATOM   4131 C CA    . ASP B 1 205 ? -10.532 66.155  17.689  1.00 40.27  ? 231 ASP B CA    1 
ATOM   4132 C C     . ASP B 1 205 ? -10.773 65.831  19.160  1.00 35.10  ? 231 ASP B C     1 
ATOM   4133 O O     . ASP B 1 205 ? -10.733 66.722  20.008  1.00 44.04  ? 231 ASP B O     1 
ATOM   4134 C CB    . ASP B 1 205 ? -11.539 67.212  17.225  1.00 53.81  ? 231 ASP B CB    1 
ATOM   4135 C CG    . ASP B 1 205 ? -12.978 66.820  17.517  1.00 67.81  ? 231 ASP B CG    1 
ATOM   4136 O OD1   . ASP B 1 205 ? -13.229 65.633  17.819  1.00 73.28  ? 231 ASP B OD1   1 
ATOM   4137 O OD2   . ASP B 1 205 ? -13.860 67.702  17.444  1.00 58.99  ? 231 ASP B OD2   1 
ATOM   4138 N N     . LEU B 1 206 ? -11.030 64.562  19.459  1.00 45.98  ? 232 LEU B N     1 
ATOM   4139 C CA    . LEU B 1 206 ? -11.297 64.148  20.834  1.00 35.44  ? 232 LEU B CA    1 
ATOM   4140 C C     . LEU B 1 206 ? -10.137 64.505  21.754  1.00 42.26  ? 232 LEU B C     1 
ATOM   4141 O O     . LEU B 1 206 ? -8.974  64.291  21.412  1.00 51.33  ? 232 LEU B O     1 
ATOM   4142 C CB    . LEU B 1 206 ? -11.576 62.645  20.910  1.00 22.42  ? 232 LEU B CB    1 
ATOM   4143 C CG    . LEU B 1 206 ? -12.793 62.117  20.150  1.00 43.85  ? 232 LEU B CG    1 
ATOM   4144 C CD1   . LEU B 1 206 ? -12.920 60.612  20.334  1.00 50.98  ? 232 LEU B CD1   1 
ATOM   4145 C CD2   . LEU B 1 206 ? -14.060 62.826  20.603  1.00 46.02  ? 232 LEU B CD2   1 
ATOM   4146 N N     . VAL B 1 207 ? -10.462 65.051  22.922  1.00 43.58  ? 233 VAL B N     1 
ATOM   4147 C CA    . VAL B 1 207 ? -9.452  65.376  23.921  1.00 37.38  ? 233 VAL B CA    1 
ATOM   4148 C C     . VAL B 1 207 ? -8.872  64.106  24.533  1.00 53.57  ? 233 VAL B C     1 
ATOM   4149 O O     . VAL B 1 207 ? -9.605  63.167  24.846  1.00 57.38  ? 233 VAL B O     1 
ATOM   4150 C CB    . VAL B 1 207 ? -10.027 66.258  25.037  1.00 23.15  ? 233 VAL B CB    1 
ATOM   4151 C CG1   . VAL B 1 207 ? -8.994  66.467  26.135  1.00 20.11  ? 233 VAL B CG1   1 
ATOM   4152 C CG2   . VAL B 1 207 ? -10.489 67.591  24.470  1.00 27.16  ? 233 VAL B CG2   1 
ATOM   4153 N N     . LEU B 1 208 ? -7.554  64.081  24.696  1.00 67.13  ? 234 LEU B N     1 
ATOM   4154 C CA    . LEU B 1 208 ? -6.871  62.914  25.238  1.00 67.25  ? 234 LEU B CA    1 
ATOM   4155 C C     . LEU B 1 208 ? -7.413  62.567  26.621  1.00 84.15  ? 234 LEU B C     1 
ATOM   4156 O O     . LEU B 1 208 ? -7.530  63.435  27.487  1.00 93.07  ? 234 LEU B O     1 
ATOM   4157 C CB    . LEU B 1 208 ? -5.363  63.160  25.302  1.00 54.90  ? 234 LEU B CB    1 
ATOM   4158 C CG    . LEU B 1 208 ? -4.495  61.925  25.546  1.00 55.87  ? 234 LEU B CG    1 
ATOM   4159 C CD1   . LEU B 1 208 ? -4.754  60.876  24.478  1.00 50.58  ? 234 LEU B CD1   1 
ATOM   4160 C CD2   . LEU B 1 208 ? -3.025  62.302  25.583  1.00 57.33  ? 234 LEU B CD2   1 
ATOM   4161 N N     . ALA B 1 209 ? -7.746  61.296  26.820  1.00 86.54  ? 235 ALA B N     1 
ATOM   4162 C CA    . ALA B 1 209 ? -8.317  60.846  28.084  1.00 92.09  ? 235 ALA B CA    1 
ATOM   4163 C C     . ALA B 1 209 ? -7.302  60.902  29.220  1.00 91.88  ? 235 ALA B C     1 
ATOM   4164 O O     . ALA B 1 209 ? -6.148  61.282  29.023  1.00 85.38  ? 235 ALA B O     1 
ATOM   4165 C CB    . ALA B 1 209 ? -8.886  59.441  27.946  1.00 101.57 ? 235 ALA B CB    1 
ATOM   4166 N N     . GLU B 1 210 ? -7.746  60.511  30.410  1.00 100.70 ? 236 GLU B N     1 
ATOM   4167 C CA    . GLU B 1 210 ? -6.927  60.604  31.611  1.00 112.27 ? 236 GLU B CA    1 
ATOM   4168 C C     . GLU B 1 210 ? -5.619  59.822  31.504  1.00 107.61 ? 236 GLU B C     1 
ATOM   4169 O O     . GLU B 1 210 ? -4.535  60.403  31.547  1.00 101.24 ? 236 GLU B O     1 
ATOM   4170 C CB    . GLU B 1 210 ? -7.722  60.135  32.832  1.00 128.09 ? 236 GLU B CB    1 
ATOM   4171 C CG    . GLU B 1 210 ? -9.000  60.923  33.080  1.00 136.37 ? 236 GLU B CG    1 
ATOM   4172 C CD    . GLU B 1 210 ? -9.766  60.427  34.292  1.00 147.10 ? 236 GLU B CD    1 
ATOM   4173 O OE1   . GLU B 1 210 ? -10.820 61.016  34.611  1.00 152.11 ? 236 GLU B OE1   1 
ATOM   4174 O OE2   . GLU B 1 210 ? -9.314  59.449  34.925  1.00 146.02 ? 236 GLU B OE2   1 
ATOM   4175 N N     . ASP B 1 211 ? -5.726  58.505  31.361  1.00 119.20 ? 237 ASP B N     1 
ATOM   4176 C CA    . ASP B 1 211 ? -4.552  57.637  31.405  1.00 127.65 ? 237 ASP B CA    1 
ATOM   4177 C C     . ASP B 1 211 ? -3.947  57.325  30.035  1.00 117.54 ? 237 ASP B C     1 
ATOM   4178 O O     . ASP B 1 211 ? -2.727  57.224  29.903  1.00 110.19 ? 237 ASP B O     1 
ATOM   4179 C CB    . ASP B 1 211 ? -4.873  56.336  32.151  1.00 147.01 ? 237 ASP B CB    1 
ATOM   4180 C CG    . ASP B 1 211 ? -6.020  55.565  31.521  1.00 165.46 ? 237 ASP B CG    1 
ATOM   4181 O OD1   . ASP B 1 211 ? -6.720  56.128  30.653  1.00 170.83 ? 237 ASP B OD1   1 
ATOM   4182 O OD2   . ASP B 1 211 ? -6.225  54.393  31.901  1.00 172.31 ? 237 ASP B OD2   1 
ATOM   4183 N N     . GLU B 1 212 ? -4.796  57.171  29.023  1.00 112.91 ? 238 GLU B N     1 
ATOM   4184 C CA    . GLU B 1 212 ? -4.330  56.764  27.699  1.00 110.52 ? 238 GLU B CA    1 
ATOM   4185 C C     . GLU B 1 212 ? -3.225  57.677  27.171  1.00 103.83 ? 238 GLU B C     1 
ATOM   4186 O O     . GLU B 1 212 ? -3.267  58.894  27.356  1.00 91.11  ? 238 GLU B O     1 
ATOM   4187 C CB    . GLU B 1 212 ? -5.493  56.685  26.707  1.00 114.55 ? 238 GLU B CB    1 
ATOM   4188 C CG    . GLU B 1 212 ? -6.167  58.012  26.413  1.00 124.11 ? 238 GLU B CG    1 
ATOM   4189 C CD    . GLU B 1 212 ? -7.337  57.868  25.457  1.00 131.07 ? 238 GLU B CD    1 
ATOM   4190 O OE1   . GLU B 1 212 ? -7.860  58.903  24.992  1.00 131.86 ? 238 GLU B OE1   1 
ATOM   4191 O OE2   . GLU B 1 212 ? -7.733  56.718  25.170  1.00 131.97 ? 238 GLU B OE2   1 
ATOM   4192 N N     . GLU B 1 213 ? -2.238  57.075  26.514  1.00 107.13 ? 239 GLU B N     1 
ATOM   4193 C CA    . GLU B 1 213 ? -1.069  57.803  26.029  1.00 104.52 ? 239 GLU B CA    1 
ATOM   4194 C C     . GLU B 1 213 ? -1.301  58.458  24.667  1.00 101.90 ? 239 GLU B C     1 
ATOM   4195 O O     . GLU B 1 213 ? -1.247  59.682  24.546  1.00 116.16 ? 239 GLU B O     1 
ATOM   4196 C CB    . GLU B 1 213 ? 0.151   56.879  25.978  1.00 106.27 ? 239 GLU B CB    1 
ATOM   4197 C CG    . GLU B 1 213 ? -0.100  55.553  25.279  1.00 114.24 ? 239 GLU B CG    1 
ATOM   4198 C CD    . GLU B 1 213 ? 1.116   54.648  25.288  1.00 124.22 ? 239 GLU B CD    1 
ATOM   4199 O OE1   . GLU B 1 213 ? 2.128   55.017  25.920  1.00 130.97 ? 239 GLU B OE1   1 
ATOM   4200 O OE2   . GLU B 1 213 ? 1.059   53.568  24.663  1.00 122.90 ? 239 GLU B OE2   1 
ATOM   4201 N N     . MET B 1 214 ? -1.553  57.645  23.645  1.00 79.24  ? 240 MET B N     1 
ATOM   4202 C CA    . MET B 1 214 ? -1.811  58.163  22.305  1.00 62.59  ? 240 MET B CA    1 
ATOM   4203 C C     . MET B 1 214 ? -3.288  58.494  22.125  1.00 62.82  ? 240 MET B C     1 
ATOM   4204 O O     . MET B 1 214 ? -4.144  57.935  22.810  1.00 64.81  ? 240 MET B O     1 
ATOM   4205 C CB    . MET B 1 214 ? -1.355  57.165  21.237  1.00 52.07  ? 240 MET B CB    1 
ATOM   4206 C CG    . MET B 1 214 ? -2.004  55.795  21.341  1.00 39.76  ? 240 MET B CG    1 
ATOM   4207 S SD    . MET B 1 214 ? -1.498  54.684  20.013  1.00 86.08  ? 240 MET B SD    1 
ATOM   4208 C CE    . MET B 1 214 ? 0.282   54.694  20.217  1.00 57.21  ? 240 MET B CE    1 
ATOM   4209 N N     . ASN B 1 215 ? -3.583  59.405  21.201  1.00 67.52  ? 241 ASN B N     1 
ATOM   4210 C CA    . ASN B 1 215 ? -4.959  59.837  20.973  1.00 74.17  ? 241 ASN B CA    1 
ATOM   4211 C C     . ASN B 1 215 ? -5.819  58.753  20.327  1.00 73.99  ? 241 ASN B C     1 
ATOM   4212 O O     . ASN B 1 215 ? -5.302  57.763  19.810  1.00 75.30  ? 241 ASN B O     1 
ATOM   4213 C CB    . ASN B 1 215 ? -5.002  61.131  20.151  1.00 73.23  ? 241 ASN B CB    1 
ATOM   4214 C CG    . ASN B 1 215 ? -4.445  60.957  18.751  1.00 70.29  ? 241 ASN B CG    1 
ATOM   4215 O OD1   . ASN B 1 215 ? -4.279  59.836  18.270  1.00 76.37  ? 241 ASN B OD1   1 
ATOM   4216 N ND2   . ASN B 1 215 ? -4.158  62.071  18.087  1.00 54.74  ? 241 ASN B ND2   1 
ATOM   4217 N N     . ARG B 1 216 ? -7.133  58.952  20.363  1.00 67.48  ? 242 ARG B N     1 
ATOM   4218 C CA    . ARG B 1 216 ? -8.081  57.965  19.855  1.00 68.59  ? 242 ARG B CA    1 
ATOM   4219 C C     . ARG B 1 216 ? -7.759  57.499  18.438  1.00 61.16  ? 242 ARG B C     1 
ATOM   4220 O O     . ARG B 1 216 ? -7.812  56.305  18.144  1.00 61.70  ? 242 ARG B O     1 
ATOM   4221 C CB    . ARG B 1 216 ? -9.509  58.513  19.912  1.00 79.44  ? 242 ARG B CB    1 
ATOM   4222 C CG    . ARG B 1 216 ? -10.117 58.522  21.305  1.00 94.05  ? 242 ARG B CG    1 
ATOM   4223 C CD    . ARG B 1 216 ? -10.219 57.113  21.871  1.00 106.91 ? 242 ARG B CD    1 
ATOM   4224 N NE    . ARG B 1 216 ? -10.952 56.217  20.980  1.00 119.98 ? 242 ARG B NE    1 
ATOM   4225 C CZ    . ARG B 1 216 ? -12.278 56.142  20.923  1.00 126.42 ? 242 ARG B CZ    1 
ATOM   4226 N NH1   . ARG B 1 216 ? -13.022 56.915  21.703  1.00 127.30 ? 242 ARG B NH1   1 
ATOM   4227 N NH2   . ARG B 1 216 ? -12.863 55.298  20.083  1.00 123.09 ? 242 ARG B NH2   1 
ATOM   4228 N N     . MET B 1 217 ? -7.425  58.444  17.565  1.00 58.53  ? 243 MET B N     1 
ATOM   4229 C CA    . MET B 1 217 ? -7.173  58.125  16.163  1.00 65.33  ? 243 MET B CA    1 
ATOM   4230 C C     . MET B 1 217 ? -5.992  57.172  15.999  1.00 59.15  ? 243 MET B C     1 
ATOM   4231 O O     . MET B 1 217 ? -6.072  56.192  15.259  1.00 51.28  ? 243 MET B O     1 
ATOM   4232 C CB    . MET B 1 217 ? -6.942  59.402  15.354  1.00 56.39  ? 243 MET B CB    1 
ATOM   4233 C CG    . MET B 1 217 ? -6.818  59.175  13.855  1.00 61.12  ? 243 MET B CG    1 
ATOM   4234 S SD    . MET B 1 217 ? -8.360  58.642  13.084  1.00 63.69  ? 243 MET B SD    1 
ATOM   4235 C CE    . MET B 1 217 ? -9.382  60.092  13.329  1.00 66.02  ? 243 MET B CE    1 
ATOM   4236 N N     . HIS B 1 218 ? -4.897  57.462  16.692  1.00 60.13  ? 244 HIS B N     1 
ATOM   4237 C CA    . HIS B 1 218 ? -3.709  56.621  16.608  1.00 64.39  ? 244 HIS B CA    1 
ATOM   4238 C C     . HIS B 1 218 ? -3.955  55.230  17.187  1.00 60.78  ? 244 HIS B C     1 
ATOM   4239 O O     . HIS B 1 218 ? -3.344  54.253  16.754  1.00 70.88  ? 244 HIS B O     1 
ATOM   4240 C CB    . HIS B 1 218 ? -2.514  57.296  17.286  1.00 68.95  ? 244 HIS B CB    1 
ATOM   4241 C CG    . HIS B 1 218 ? -1.907  58.400  16.476  1.00 67.35  ? 244 HIS B CG    1 
ATOM   4242 N ND1   . HIS B 1 218 ? -2.404  59.686  16.478  1.00 55.03  ? 244 HIS B ND1   1 
ATOM   4243 C CD2   . HIS B 1 218 ? -0.846  58.408  15.635  1.00 60.73  ? 244 HIS B CD2   1 
ATOM   4244 C CE1   . HIS B 1 218 ? -1.674  60.439  15.675  1.00 49.92  ? 244 HIS B CE1   1 
ATOM   4245 N NE2   . HIS B 1 218 ? -0.722  59.689  15.151  1.00 57.14  ? 244 HIS B NE2   1 
ATOM   4246 N N     . GLU B 1 219 ? -4.851  55.143  18.165  1.00 50.83  ? 245 GLU B N     1 
ATOM   4247 C CA    . GLU B 1 219 ? -5.254  53.850  18.702  1.00 51.36  ? 245 GLU B CA    1 
ATOM   4248 C C     . GLU B 1 219 ? -5.849  53.010  17.580  1.00 59.11  ? 245 GLU B C     1 
ATOM   4249 O O     . GLU B 1 219 ? -5.618  51.803  17.499  1.00 60.29  ? 245 GLU B O     1 
ATOM   4250 C CB    . GLU B 1 219 ? -6.283  54.019  19.821  1.00 62.03  ? 245 GLU B CB    1 
ATOM   4251 C CG    . GLU B 1 219 ? -5.737  54.645  21.094  1.00 78.36  ? 245 GLU B CG    1 
ATOM   4252 C CD    . GLU B 1 219 ? -6.773  54.702  22.202  1.00 89.95  ? 245 GLU B CD    1 
ATOM   4253 O OE1   . GLU B 1 219 ? -6.415  55.077  23.338  1.00 91.54  ? 245 GLU B OE1   1 
ATOM   4254 O OE2   . GLU B 1 219 ? -7.948  54.368  21.937  1.00 96.58  ? 245 GLU B OE2   1 
ATOM   4255 N N     . SER B 1 220 ? -6.616  53.666  16.715  1.00 60.20  ? 246 SER B N     1 
ATOM   4256 C CA    . SER B 1 220 ? -7.241  53.002  15.580  1.00 57.48  ? 246 SER B CA    1 
ATOM   4257 C C     . SER B 1 220 ? -6.208  52.687  14.505  1.00 61.44  ? 246 SER B C     1 
ATOM   4258 O O     . SER B 1 220 ? -6.303  51.671  13.817  1.00 66.69  ? 246 SER B O     1 
ATOM   4259 C CB    . SER B 1 220 ? -8.358  53.873  15.001  1.00 52.29  ? 246 SER B CB    1 
ATOM   4260 O OG    . SER B 1 220 ? -9.003  53.229  13.916  1.00 50.32  ? 246 SER B OG    1 
ATOM   4261 N N     . MET B 1 221 ? -5.220  53.565  14.364  1.00 56.82  ? 247 MET B N     1 
ATOM   4262 C CA    . MET B 1 221 ? -4.157  53.364  13.387  1.00 52.53  ? 247 MET B CA    1 
ATOM   4263 C C     . MET B 1 221 ? -3.300  52.155  13.743  1.00 52.06  ? 247 MET B C     1 
ATOM   4264 O O     . MET B 1 221 ? -3.004  51.322  12.888  1.00 43.73  ? 247 MET B O     1 
ATOM   4265 C CB    . MET B 1 221 ? -3.280  54.613  13.278  1.00 48.43  ? 247 MET B CB    1 
ATOM   4266 C CG    . MET B 1 221 ? -3.995  55.832  12.728  1.00 33.37  ? 247 MET B CG    1 
ATOM   4267 S SD    . MET B 1 221 ? -2.900  57.255  12.573  1.00 77.69  ? 247 MET B SD    1 
ATOM   4268 C CE    . MET B 1 221 ? -1.688  56.632  11.410  1.00 48.27  ? 247 MET B CE    1 
ATOM   4269 N N     . LYS B 1 222 ? -2.902  52.062  15.009  1.00 45.62  ? 248 LYS B N     1 
ATOM   4270 C CA    . LYS B 1 222 ? -2.076  50.949  15.458  1.00 58.47  ? 248 LYS B CA    1 
ATOM   4271 C C     . LYS B 1 222 ? -2.787  49.613  15.259  1.00 64.38  ? 248 LYS B C     1 
ATOM   4272 O O     . LYS B 1 222 ? -2.166  48.625  14.868  1.00 67.11  ? 248 LYS B O     1 
ATOM   4273 C CB    . LYS B 1 222 ? -1.673  51.118  16.925  1.00 68.35  ? 248 LYS B CB    1 
ATOM   4274 C CG    . LYS B 1 222 ? -0.741  50.024  17.427  1.00 74.51  ? 248 LYS B CG    1 
ATOM   4275 C CD    . LYS B 1 222 ? -0.372  50.220  18.887  1.00 84.89  ? 248 LYS B CD    1 
ATOM   4276 C CE    . LYS B 1 222 ? 0.550   49.110  19.370  1.00 93.33  ? 248 LYS B CE    1 
ATOM   4277 N NZ    . LYS B 1 222 ? 0.909   49.262  20.808  1.00 93.76  ? 248 LYS B NZ    1 
ATOM   4278 N N     . LEU B 1 223 ? -4.088  49.587  15.529  1.00 63.79  ? 249 LEU B N     1 
ATOM   4279 C CA    . LEU B 1 223 ? -4.876  48.374  15.342  1.00 64.51  ? 249 LEU B CA    1 
ATOM   4280 C C     . LEU B 1 223 ? -4.924  47.978  13.871  1.00 64.95  ? 249 LEU B C     1 
ATOM   4281 O O     . LEU B 1 223 ? -4.709  46.818  13.521  1.00 70.58  ? 249 LEU B O     1 
ATOM   4282 C CB    . LEU B 1 223 ? -6.295  48.559  15.879  1.00 60.95  ? 249 LEU B CB    1 
ATOM   4283 C CG    . LEU B 1 223 ? -7.236  47.388  15.590  1.00 64.69  ? 249 LEU B CG    1 
ATOM   4284 C CD1   . LEU B 1 223 ? -6.639  46.090  16.111  1.00 72.88  ? 249 LEU B CD1   1 
ATOM   4285 C CD2   . LEU B 1 223 ? -8.612  47.630  16.189  1.00 62.69  ? 249 LEU B CD2   1 
ATOM   4286 N N     . PHE B 1 224 ? -5.215  48.951  13.014  1.00 57.97  ? 250 PHE B N     1 
ATOM   4287 C CA    . PHE B 1 224 ? -5.234  48.729  11.576  1.00 56.08  ? 250 PHE B CA    1 
ATOM   4288 C C     . PHE B 1 224 ? -3.870  48.237  11.115  1.00 63.30  ? 250 PHE B C     1 
ATOM   4289 O O     . PHE B 1 224 ? -3.766  47.321  10.301  1.00 71.68  ? 250 PHE B O     1 
ATOM   4290 C CB    . PHE B 1 224 ? -5.603  50.021  10.849  1.00 56.30  ? 250 PHE B CB    1 
ATOM   4291 C CG    . PHE B 1 224 ? -5.592  49.903  9.354   1.00 69.33  ? 250 PHE B CG    1 
ATOM   4292 C CD1   . PHE B 1 224 ? -6.696  49.410  8.676   1.00 86.52  ? 250 PHE B CD1   1 
ATOM   4293 C CD2   . PHE B 1 224 ? -4.483  50.293  8.623   1.00 74.33  ? 250 PHE B CD2   1 
ATOM   4294 C CE1   . PHE B 1 224 ? -6.691  49.302  7.298   1.00 89.19  ? 250 PHE B CE1   1 
ATOM   4295 C CE2   . PHE B 1 224 ? -4.471  50.188  7.245   1.00 89.09  ? 250 PHE B CE2   1 
ATOM   4296 C CZ    . PHE B 1 224 ? -5.577  49.692  6.581   1.00 92.42  ? 250 PHE B CZ    1 
ATOM   4297 N N     . ASP B 1 225 ? -2.825  48.858  11.651  1.00 68.37  ? 251 ASP B N     1 
ATOM   4298 C CA    . ASP B 1 225 ? -1.453  48.474  11.350  1.00 71.05  ? 251 ASP B CA    1 
ATOM   4299 C C     . ASP B 1 225 ? -1.238  47.000  11.674  1.00 62.13  ? 251 ASP B C     1 
ATOM   4300 O O     . ASP B 1 225 ? -0.477  46.310  10.999  1.00 70.45  ? 251 ASP B O     1 
ATOM   4301 C CB    . ASP B 1 225 ? -0.480  49.340  12.154  1.00 88.42  ? 251 ASP B CB    1 
ATOM   4302 C CG    . ASP B 1 225 ? 0.969   49.103  11.774  1.00 100.22 ? 251 ASP B CG    1 
ATOM   4303 O OD1   . ASP B 1 225 ? 1.219   48.382  10.787  1.00 110.90 ? 251 ASP B OD1   1 
ATOM   4304 O OD2   . ASP B 1 225 ? 1.860   49.643  12.464  1.00 97.70  ? 251 ASP B OD2   1 
ATOM   4305 N N     . SER B 1 226 ? -1.922  46.523  12.708  1.00 63.34  ? 252 SER B N     1 
ATOM   4306 C CA    . SER B 1 226 ? -1.796  45.136  13.138  1.00 75.12  ? 252 SER B CA    1 
ATOM   4307 C C     . SER B 1 226 ? -2.557  44.195  12.213  1.00 89.12  ? 252 SER B C     1 
ATOM   4308 O O     . SER B 1 226 ? -2.264  43.002  12.150  1.00 102.96 ? 252 SER B O     1 
ATOM   4309 C CB    . SER B 1 226 ? -2.302  44.972  14.572  1.00 81.93  ? 252 SER B CB    1 
ATOM   4310 O OG    . SER B 1 226 ? -1.541  45.754  15.474  1.00 98.56  ? 252 SER B OG    1 
ATOM   4311 N N     . ILE B 1 227 ? -3.533  44.738  11.494  1.00 87.31  ? 253 ILE B N     1 
ATOM   4312 C CA    . ILE B 1 227 ? -4.375  43.927  10.624  1.00 87.55  ? 253 ILE B CA    1 
ATOM   4313 C C     . ILE B 1 227 ? -3.749  43.710  9.248   1.00 97.63  ? 253 ILE B C     1 
ATOM   4314 O O     . ILE B 1 227 ? -3.465  42.577  8.860   1.00 103.76 ? 253 ILE B O     1 
ATOM   4315 C CB    . ILE B 1 227 ? -5.774  44.547  10.450  1.00 79.76  ? 253 ILE B CB    1 
ATOM   4316 C CG1   . ILE B 1 227 ? -6.424  44.793  11.812  1.00 65.22  ? 253 ILE B CG1   1 
ATOM   4317 C CG2   . ILE B 1 227 ? -6.652  43.646  9.595   1.00 83.09  ? 253 ILE B CG2   1 
ATOM   4318 C CD1   . ILE B 1 227 ? -6.627  43.534  12.624  1.00 61.82  ? 253 ILE B CD1   1 
ATOM   4319 N N     . CYS B 1 228 ? -3.534  44.798  8.516   1.00 101.59 ? 254 CYS B N     1 
ATOM   4320 C CA    . CYS B 1 228 ? -3.048  44.710  7.141   1.00 106.47 ? 254 CYS B CA    1 
ATOM   4321 C C     . CYS B 1 228 ? -1.597  44.239  7.050   1.00 123.51 ? 254 CYS B C     1 
ATOM   4322 O O     . CYS B 1 228 ? -1.149  43.797  5.992   1.00 134.85 ? 254 CYS B O     1 
ATOM   4323 C CB    . CYS B 1 228 ? -3.213  46.052  6.421   1.00 92.34  ? 254 CYS B CB    1 
ATOM   4324 S SG    . CYS B 1 228 ? -2.164  47.379  7.052   1.00 110.91 ? 254 CYS B SG    1 
ATOM   4325 N N     . ASN B 1 229 ? -0.867  44.334  8.156   1.00 119.89 ? 255 ASN B N     1 
ATOM   4326 C CA    . ASN B 1 229 ? 0.533   43.920  8.172   1.00 113.63 ? 255 ASN B CA    1 
ATOM   4327 C C     . ASN B 1 229 ? 0.742   42.529  8.762   1.00 115.86 ? 255 ASN B C     1 
ATOM   4328 O O     . ASN B 1 229 ? 1.860   42.014  8.778   1.00 115.30 ? 255 ASN B O     1 
ATOM   4329 C CB    . ASN B 1 229 ? 1.395   44.947  8.910   1.00 106.85 ? 255 ASN B CB    1 
ATOM   4330 C CG    . ASN B 1 229 ? 1.532   46.248  8.146   1.00 96.74  ? 255 ASN B CG    1 
ATOM   4331 O OD1   . ASN B 1 229 ? 0.890   46.447  7.114   1.00 87.99  ? 255 ASN B OD1   1 
ATOM   4332 N ND2   . ASN B 1 229 ? 2.374   47.143  8.648   1.00 100.27 ? 255 ASN B ND2   1 
ATOM   4333 N N     . ASN B 1 230 ? -0.338  41.924  9.245   1.00 115.46 ? 256 ASN B N     1 
ATOM   4334 C CA    . ASN B 1 230 ? -0.271  40.568  9.773   1.00 113.71 ? 256 ASN B CA    1 
ATOM   4335 C C     . ASN B 1 230 ? -0.304  39.540  8.648   1.00 119.17 ? 256 ASN B C     1 
ATOM   4336 O O     . ASN B 1 230 ? -1.146  39.612  7.752   1.00 104.23 ? 256 ASN B O     1 
ATOM   4337 C CB    . ASN B 1 230 ? -1.412  40.313  10.758  1.00 102.32 ? 256 ASN B CB    1 
ATOM   4338 C CG    . ASN B 1 230 ? -1.289  38.972  11.457  1.00 94.24  ? 256 ASN B CG    1 
ATOM   4339 O OD1   . ASN B 1 230 ? -2.259  38.463  12.018  1.00 83.41  ? 256 ASN B OD1   1 
ATOM   4340 N ND2   . ASN B 1 230 ? -0.094  38.392  11.426  1.00 99.85  ? 256 ASN B ND2   1 
ATOM   4341 N N     . LYS B 1 231 ? 0.619   38.587  8.700   1.00 135.87 ? 257 LYS B N     1 
ATOM   4342 C CA    . LYS B 1 231 ? 0.730   37.564  7.667   1.00 146.25 ? 257 LYS B CA    1 
ATOM   4343 C C     . LYS B 1 231 ? -0.511  36.677  7.604   1.00 141.66 ? 257 LYS B C     1 
ATOM   4344 O O     . LYS B 1 231 ? -0.768  36.030  6.589   1.00 144.94 ? 257 LYS B O     1 
ATOM   4345 C CB    . LYS B 1 231 ? 1.979   36.704  7.892   1.00 159.46 ? 257 LYS B CB    1 
ATOM   4346 C CG    . LYS B 1 231 ? 3.302   37.424  7.648   1.00 167.77 ? 257 LYS B CG    1 
ATOM   4347 C CD    . LYS B 1 231 ? 3.607   38.444  8.736   1.00 168.00 ? 257 LYS B CD    1 
ATOM   4348 C CE    . LYS B 1 231 ? 4.935   39.139  8.483   1.00 165.28 ? 257 LYS B CE    1 
ATOM   4349 N NZ    . LYS B 1 231 ? 5.251   40.138  9.541   1.00 162.24 ? 257 LYS B NZ    1 
ATOM   4350 N N     . TRP B 1 232 ? -1.280  36.656  8.688   1.00 131.64 ? 258 TRP B N     1 
ATOM   4351 C CA    . TRP B 1 232 ? -2.461  35.801  8.774   1.00 130.39 ? 258 TRP B CA    1 
ATOM   4352 C C     . TRP B 1 232 ? -3.633  36.345  7.955   1.00 122.42 ? 258 TRP B C     1 
ATOM   4353 O O     . TRP B 1 232 ? -4.725  35.776  7.962   1.00 118.85 ? 258 TRP B O     1 
ATOM   4354 C CB    . TRP B 1 232 ? -2.868  35.599  10.238  1.00 140.32 ? 258 TRP B CB    1 
ATOM   4355 C CG    . TRP B 1 232 ? -4.026  34.662  10.431  1.00 149.95 ? 258 TRP B CG    1 
ATOM   4356 C CD1   . TRP B 1 232 ? -5.304  34.997  10.773  1.00 147.15 ? 258 TRP B CD1   1 
ATOM   4357 C CD2   . TRP B 1 232 ? -4.011  33.234  10.290  1.00 160.59 ? 258 TRP B CD2   1 
ATOM   4358 N NE1   . TRP B 1 232 ? -6.085  33.869  10.855  1.00 149.25 ? 258 TRP B NE1   1 
ATOM   4359 C CE2   . TRP B 1 232 ? -5.316  32.775  10.563  1.00 157.78 ? 258 TRP B CE2   1 
ATOM   4360 C CE3   . TRP B 1 232 ? -3.022  32.302  9.960   1.00 163.79 ? 258 TRP B CE3   1 
ATOM   4361 C CZ2   . TRP B 1 232 ? -5.656  31.424  10.516  1.00 158.90 ? 258 TRP B CZ2   1 
ATOM   4362 C CZ3   . TRP B 1 232 ? -3.363  30.961  9.914   1.00 160.95 ? 258 TRP B CZ3   1 
ATOM   4363 C CH2   . TRP B 1 232 ? -4.668  30.535  10.191  1.00 159.19 ? 258 TRP B CH2   1 
ATOM   4364 N N     . PHE B 1 233 ? -3.401  37.444  7.243   1.00 118.64 ? 259 PHE B N     1 
ATOM   4365 C CA    . PHE B 1 233 ? -4.437  38.044  6.407   1.00 113.28 ? 259 PHE B CA    1 
ATOM   4366 C C     . PHE B 1 233 ? -3.900  38.431  5.034   1.00 107.17 ? 259 PHE B C     1 
ATOM   4367 O O     . PHE B 1 233 ? -4.319  39.433  4.454   1.00 102.87 ? 259 PHE B O     1 
ATOM   4368 C CB    . PHE B 1 233 ? -5.037  39.274  7.091   1.00 109.68 ? 259 PHE B CB    1 
ATOM   4369 C CG    . PHE B 1 233 ? -5.716  38.972  8.394   1.00 107.41 ? 259 PHE B CG    1 
ATOM   4370 C CD1   . PHE B 1 233 ? -7.042  38.573  8.424   1.00 106.30 ? 259 PHE B CD1   1 
ATOM   4371 C CD2   . PHE B 1 233 ? -5.030  39.090  9.591   1.00 111.90 ? 259 PHE B CD2   1 
ATOM   4372 C CE1   . PHE B 1 233 ? -7.670  38.296  9.622   1.00 105.27 ? 259 PHE B CE1   1 
ATOM   4373 C CE2   . PHE B 1 233 ? -5.653  38.814  10.792  1.00 114.95 ? 259 PHE B CE2   1 
ATOM   4374 C CZ    . PHE B 1 233 ? -6.974  38.417  10.807  1.00 109.67 ? 259 PHE B CZ    1 
ATOM   4375 N N     . THR B 1 234 ? -2.974  37.631  4.517   1.00 105.04 ? 260 THR B N     1 
ATOM   4376 C CA    . THR B 1 234 ? -2.359  37.910  3.226   1.00 106.64 ? 260 THR B CA    1 
ATOM   4377 C C     . THR B 1 234 ? -3.356  37.755  2.081   1.00 107.17 ? 260 THR B C     1 
ATOM   4378 O O     . THR B 1 234 ? -3.384  38.569  1.156   1.00 101.95 ? 260 THR B O     1 
ATOM   4379 C CB    . THR B 1 234 ? -1.145  36.997  2.971   1.00 107.34 ? 260 THR B CB    1 
ATOM   4380 O OG1   . THR B 1 234 ? -0.177  37.184  4.011   1.00 100.31 ? 260 THR B OG1   1 
ATOM   4381 C CG2   . THR B 1 234 ? -0.507  37.320  1.628   1.00 112.19 ? 260 THR B CG2   1 
ATOM   4382 N N     . ASP B 1 235 ? -4.174  36.710  2.148   1.00 110.90 ? 261 ASP B N     1 
ATOM   4383 C CA    . ASP B 1 235 ? -5.158  36.444  1.104   1.00 117.07 ? 261 ASP B CA    1 
ATOM   4384 C C     . ASP B 1 235 ? -6.504  37.092  1.415   1.00 109.01 ? 261 ASP B C     1 
ATOM   4385 O O     . ASP B 1 235 ? -7.501  36.828  0.743   1.00 99.26  ? 261 ASP B O     1 
ATOM   4386 C CB    . ASP B 1 235 ? -5.331  34.937  0.895   1.00 128.35 ? 261 ASP B CB    1 
ATOM   4387 C CG    . ASP B 1 235 ? -4.093  34.282  0.310   1.00 130.02 ? 261 ASP B CG    1 
ATOM   4388 O OD1   . ASP B 1 235 ? -3.090  34.991  0.085   1.00 128.73 ? 261 ASP B OD1   1 
ATOM   4389 O OD2   . ASP B 1 235 ? -4.124  33.056  0.072   1.00 129.35 ? 261 ASP B OD2   1 
ATOM   4390 N N     . THR B 1 236 ? -6.526  37.943  2.435   1.00 107.82 ? 262 THR B N     1 
ATOM   4391 C CA    . THR B 1 236 ? -7.748  38.639  2.821   1.00 99.97  ? 262 THR B CA    1 
ATOM   4392 C C     . THR B 1 236 ? -7.779  40.052  2.249   1.00 94.29  ? 262 THR B C     1 
ATOM   4393 O O     . THR B 1 236 ? -6.773  40.763  2.269   1.00 92.36  ? 262 THR B O     1 
ATOM   4394 C CB    . THR B 1 236 ? -7.900  38.706  4.350   1.00 98.18  ? 262 THR B CB    1 
ATOM   4395 O OG1   . THR B 1 236 ? -7.850  37.382  4.896   1.00 103.69 ? 262 THR B OG1   1 
ATOM   4396 C CG2   . THR B 1 236 ? -9.224  39.356  4.725   1.00 94.11  ? 262 THR B CG2   1 
ATOM   4397 N N     . SER B 1 237 ? -8.937  40.453  1.737   1.00 91.30  ? 263 SER B N     1 
ATOM   4398 C CA    . SER B 1 237 ? -9.095  41.776  1.146   1.00 96.44  ? 263 SER B CA    1 
ATOM   4399 C C     . SER B 1 237 ? -9.386  42.827  2.211   1.00 101.62 ? 263 SER B C     1 
ATOM   4400 O O     . SER B 1 237 ? -10.477 42.866  2.779   1.00 103.76 ? 263 SER B O     1 
ATOM   4401 C CB    . SER B 1 237 ? -10.210 41.764  0.099   1.00 105.41 ? 263 SER B CB    1 
ATOM   4402 O OG    . SER B 1 237 ? -9.921  40.843  -0.939  1.00 115.23 ? 263 SER B OG    1 
ATOM   4403 N N     . ILE B 1 238 ? -8.401  43.679  2.477   1.00 92.21  ? 264 ILE B N     1 
ATOM   4404 C CA    . ILE B 1 238 ? -8.551  44.727  3.477   1.00 84.15  ? 264 ILE B CA    1 
ATOM   4405 C C     . ILE B 1 238 ? -9.320  45.918  2.920   1.00 72.81  ? 264 ILE B C     1 
ATOM   4406 O O     . ILE B 1 238 ? -8.870  46.585  1.988   1.00 61.79  ? 264 ILE B O     1 
ATOM   4407 C CB    . ILE B 1 238 ? -7.189  45.205  4.010   1.00 91.73  ? 264 ILE B CB    1 
ATOM   4408 C CG1   . ILE B 1 238 ? -6.486  44.072  4.760   1.00 90.02  ? 264 ILE B CG1   1 
ATOM   4409 C CG2   . ILE B 1 238 ? -7.368  46.410  4.919   1.00 97.67  ? 264 ILE B CG2   1 
ATOM   4410 C CD1   . ILE B 1 238 ? -7.285  43.526  5.925   1.00 83.37  ? 264 ILE B CD1   1 
ATOM   4411 N N     . ILE B 1 239 ? -10.485 46.176  3.501   1.00 70.47  ? 265 ILE B N     1 
ATOM   4412 C CA    . ILE B 1 239 ? -11.322 47.289  3.078   1.00 68.77  ? 265 ILE B CA    1 
ATOM   4413 C C     . ILE B 1 239 ? -11.427 48.335  4.181   1.00 70.95  ? 265 ILE B C     1 
ATOM   4414 O O     . ILE B 1 239 ? -11.935 48.060  5.268   1.00 80.43  ? 265 ILE B O     1 
ATOM   4415 C CB    . ILE B 1 239 ? -12.727 46.812  2.687   1.00 63.19  ? 265 ILE B CB    1 
ATOM   4416 C CG1   . ILE B 1 239 ? -12.636 45.800  1.543   1.00 62.94  ? 265 ILE B CG1   1 
ATOM   4417 C CG2   . ILE B 1 239 ? -13.601 47.995  2.302   1.00 48.33  ? 265 ILE B CG2   1 
ATOM   4418 C CD1   . ILE B 1 239 ? -13.962 45.190  1.160   1.00 64.38  ? 265 ILE B CD1   1 
ATOM   4419 N N     . LEU B 1 240 ? -10.939 49.536  3.891   1.00 66.52  ? 266 LEU B N     1 
ATOM   4420 C CA    . LEU B 1 240 ? -10.917 50.618  4.867   1.00 49.64  ? 266 LEU B CA    1 
ATOM   4421 C C     . LEU B 1 240 ? -12.177 51.473  4.778   1.00 49.82  ? 266 LEU B C     1 
ATOM   4422 O O     . LEU B 1 240 ? -12.580 51.895  3.694   1.00 53.19  ? 266 LEU B O     1 
ATOM   4423 C CB    . LEU B 1 240 ? -9.673  51.484  4.661   1.00 39.35  ? 266 LEU B CB    1 
ATOM   4424 C CG    . LEU B 1 240 ? -9.416  52.584  5.689   1.00 41.98  ? 266 LEU B CG    1 
ATOM   4425 C CD1   . LEU B 1 240 ? -9.391  52.003  7.095   1.00 40.06  ? 266 LEU B CD1   1 
ATOM   4426 C CD2   . LEU B 1 240 ? -8.116  53.308  5.375   1.00 38.14  ? 266 LEU B CD2   1 
ATOM   4427 N N     . PHE B 1 241 ? -12.795 51.723  5.927   1.00 47.40  ? 267 PHE B N     1 
ATOM   4428 C CA    . PHE B 1 241 ? -14.019 52.512  5.992   1.00 54.52  ? 267 PHE B CA    1 
ATOM   4429 C C     . PHE B 1 241 ? -13.846 53.757  6.853   1.00 54.56  ? 267 PHE B C     1 
ATOM   4430 O O     . PHE B 1 241 ? -14.131 53.739  8.050   1.00 58.82  ? 267 PHE B O     1 
ATOM   4431 C CB    . PHE B 1 241 ? -15.167 51.664  6.541   1.00 67.19  ? 267 PHE B CB    1 
ATOM   4432 C CG    . PHE B 1 241 ? -16.048 51.074  5.479   1.00 71.44  ? 267 PHE B CG    1 
ATOM   4433 C CD1   . PHE B 1 241 ? -15.506 50.332  4.442   1.00 80.08  ? 267 PHE B CD1   1 
ATOM   4434 C CD2   . PHE B 1 241 ? -17.420 51.249  5.526   1.00 55.92  ? 267 PHE B CD2   1 
ATOM   4435 C CE1   . PHE B 1 241 ? -16.316 49.786  3.467   1.00 74.55  ? 267 PHE B CE1   1 
ATOM   4436 C CE2   . PHE B 1 241 ? -18.235 50.703  4.555   1.00 61.80  ? 267 PHE B CE2   1 
ATOM   4437 C CZ    . PHE B 1 241 ? -17.683 49.971  3.524   1.00 64.72  ? 267 PHE B CZ    1 
ATOM   4438 N N     . LEU B 1 242 ? -13.378 54.839  6.240   1.00 50.60  ? 268 LEU B N     1 
ATOM   4439 C CA    . LEU B 1 242 ? -13.249 56.108  6.942   1.00 46.52  ? 268 LEU B CA    1 
ATOM   4440 C C     . LEU B 1 242 ? -14.634 56.729  7.108   1.00 46.53  ? 268 LEU B C     1 
ATOM   4441 O O     . LEU B 1 242 ? -15.133 57.408  6.211   1.00 55.24  ? 268 LEU B O     1 
ATOM   4442 C CB    . LEU B 1 242 ? -12.308 57.046  6.182   1.00 46.15  ? 268 LEU B CB    1 
ATOM   4443 C CG    . LEU B 1 242 ? -10.934 56.449  5.857   1.00 38.34  ? 268 LEU B CG    1 
ATOM   4444 C CD1   . LEU B 1 242 ? -10.043 57.456  5.141   1.00 26.10  ? 268 LEU B CD1   1 
ATOM   4445 C CD2   . LEU B 1 242 ? -10.255 55.934  7.119   1.00 26.50  ? 268 LEU B CD2   1 
ATOM   4446 N N     . ASN B 1 243 ? -15.247 56.487  8.263   1.00 42.44  ? 269 ASN B N     1 
ATOM   4447 C CA    . ASN B 1 243 ? -16.650 56.823  8.485   1.00 49.70  ? 269 ASN B CA    1 
ATOM   4448 C C     . ASN B 1 243 ? -16.882 58.175  9.163   1.00 63.71  ? 269 ASN B C     1 
ATOM   4449 O O     . ASN B 1 243 ? -15.936 58.858  9.557   1.00 64.22  ? 269 ASN B O     1 
ATOM   4450 C CB    . ASN B 1 243 ? -17.328 55.714  9.293   1.00 43.44  ? 269 ASN B CB    1 
ATOM   4451 C CG    . ASN B 1 243 ? -18.837 55.753  9.183   1.00 54.11  ? 269 ASN B CG    1 
ATOM   4452 O OD1   . ASN B 1 243 ? -19.386 55.975  8.104   1.00 64.09  ? 269 ASN B OD1   1 
ATOM   4453 N ND2   . ASN B 1 243 ? -19.519 55.534  10.301  1.00 47.17  ? 269 ASN B ND2   1 
ATOM   4454 N N     . LYS B 1 244 ? -18.154 58.546  9.294   1.00 64.91  ? 270 LYS B N     1 
ATOM   4455 C CA    . LYS B 1 244 ? -18.551 59.805  9.920   1.00 51.28  ? 270 LYS B CA    1 
ATOM   4456 C C     . LYS B 1 244 ? -17.957 61.013  9.203   1.00 39.04  ? 270 LYS B C     1 
ATOM   4457 O O     . LYS B 1 244 ? -17.556 61.989  9.836   1.00 33.54  ? 270 LYS B O     1 
ATOM   4458 C CB    . LYS B 1 244 ? -18.174 59.820  11.405  1.00 64.75  ? 270 LYS B CB    1 
ATOM   4459 C CG    . LYS B 1 244 ? -18.926 58.792  12.240  1.00 66.05  ? 270 LYS B CG    1 
ATOM   4460 C CD    . LYS B 1 244 ? -18.597 58.914  13.721  1.00 56.74  ? 270 LYS B CD    1 
ATOM   4461 C CE    . LYS B 1 244 ? -19.371 57.890  14.541  1.00 57.43  ? 270 LYS B CE    1 
ATOM   4462 N NZ    . LYS B 1 244 ? -19.081 57.990  15.999  1.00 59.18  ? 270 LYS B NZ    1 
ATOM   4463 N N     . LYS B 1 245 ? -17.914 60.941  7.876   1.00 40.27  ? 271 LYS B N     1 
ATOM   4464 C CA    . LYS B 1 245 ? -17.347 62.015  7.069   1.00 45.89  ? 271 LYS B CA    1 
ATOM   4465 C C     . LYS B 1 245 ? -18.184 63.289  7.138   1.00 47.10  ? 271 LYS B C     1 
ATOM   4466 O O     . LYS B 1 245 ? -17.650 64.394  7.061   1.00 56.78  ? 271 LYS B O     1 
ATOM   4467 C CB    . LYS B 1 245 ? -17.176 61.566  5.614   1.00 48.66  ? 271 LYS B CB    1 
ATOM   4468 C CG    . LYS B 1 245 ? -18.463 61.132  4.929   1.00 48.80  ? 271 LYS B CG    1 
ATOM   4469 C CD    . LYS B 1 245 ? -18.208 60.785  3.470   1.00 50.52  ? 271 LYS B CD    1 
ATOM   4470 C CE    . LYS B 1 245 ? -19.496 60.431  2.744   1.00 63.07  ? 271 LYS B CE    1 
ATOM   4471 N NZ    . LYS B 1 245 ? -19.257 60.148  1.299   1.00 63.41  ? 271 LYS B NZ    1 
ATOM   4472 N N     . ASP B 1 246 ? -19.496 63.131  7.281   1.00 43.89  ? 272 ASP B N     1 
ATOM   4473 C CA    . ASP B 1 246 ? -20.390 64.279  7.397   1.00 54.66  ? 272 ASP B CA    1 
ATOM   4474 C C     . ASP B 1 246 ? -20.061 65.090  8.645   1.00 61.73  ? 272 ASP B C     1 
ATOM   4475 O O     . ASP B 1 246 ? -20.012 66.320  8.605   1.00 63.92  ? 272 ASP B O     1 
ATOM   4476 C CB    . ASP B 1 246 ? -21.853 63.830  7.422   1.00 55.30  ? 272 ASP B CB    1 
ATOM   4477 C CG    . ASP B 1 246 ? -22.158 62.889  8.573   1.00 52.89  ? 272 ASP B CG    1 
ATOM   4478 O OD1   . ASP B 1 246 ? -21.261 62.112  8.965   1.00 50.38  ? 272 ASP B OD1   1 
ATOM   4479 O OD2   . ASP B 1 246 ? -23.299 62.922  9.081   1.00 52.37  ? 272 ASP B OD2   1 
ATOM   4480 N N     . LEU B 1 247 ? -19.834 64.391  9.752   1.00 52.78  ? 273 LEU B N     1 
ATOM   4481 C CA    . LEU B 1 247 ? -19.453 65.036  11.000  1.00 39.22  ? 273 LEU B CA    1 
ATOM   4482 C C     . LEU B 1 247 ? -18.079 65.676  10.859  1.00 44.37  ? 273 LEU B C     1 
ATOM   4483 O O     . LEU B 1 247 ? -17.875 66.826  11.246  1.00 57.97  ? 273 LEU B O     1 
ATOM   4484 C CB    . LEU B 1 247 ? -19.447 64.022  12.144  1.00 32.76  ? 273 LEU B CB    1 
ATOM   4485 C CG    . LEU B 1 247 ? -20.804 63.417  12.505  1.00 33.71  ? 273 LEU B CG    1 
ATOM   4486 C CD1   . LEU B 1 247 ? -20.644 62.265  13.485  1.00 19.60  ? 273 LEU B CD1   1 
ATOM   4487 C CD2   . LEU B 1 247 ? -21.737 64.481  13.066  1.00 33.01  ? 273 LEU B CD2   1 
ATOM   4488 N N     . PHE B 1 248 ? -17.141 64.921  10.300  1.00 34.80  ? 274 PHE B N     1 
ATOM   4489 C CA    . PHE B 1 248 ? -15.794 65.422  10.068  1.00 45.32  ? 274 PHE B CA    1 
ATOM   4490 C C     . PHE B 1 248 ? -15.849 66.714  9.260   1.00 46.43  ? 274 PHE B C     1 
ATOM   4491 O O     . PHE B 1 248 ? -15.189 67.698  9.594   1.00 36.57  ? 274 PHE B O     1 
ATOM   4492 C CB    . PHE B 1 248 ? -14.961 64.371  9.331   1.00 59.90  ? 274 PHE B CB    1 
ATOM   4493 C CG    . PHE B 1 248 ? -13.525 64.764  9.131   1.00 69.13  ? 274 PHE B CG    1 
ATOM   4494 C CD1   . PHE B 1 248 ? -12.563 64.430  10.070  1.00 74.06  ? 274 PHE B CD1   1 
ATOM   4495 C CD2   . PHE B 1 248 ? -13.135 65.463  8.001   1.00 72.78  ? 274 PHE B CD2   1 
ATOM   4496 C CE1   . PHE B 1 248 ? -11.241 64.790  9.887   1.00 77.03  ? 274 PHE B CE1   1 
ATOM   4497 C CE2   . PHE B 1 248 ? -11.816 65.825  7.813   1.00 72.84  ? 274 PHE B CE2   1 
ATOM   4498 C CZ    . PHE B 1 248 ? -10.868 65.488  8.757   1.00 75.42  ? 274 PHE B CZ    1 
ATOM   4499 N N     . GLU B 1 249 ? -16.652 66.700  8.202   1.00 53.65  ? 275 GLU B N     1 
ATOM   4500 C CA    . GLU B 1 249 ? -16.796 67.850  7.318   1.00 45.75  ? 275 GLU B CA    1 
ATOM   4501 C C     . GLU B 1 249 ? -17.232 69.092  8.087   1.00 43.68  ? 275 GLU B C     1 
ATOM   4502 O O     . GLU B 1 249 ? -16.927 70.217  7.694   1.00 44.40  ? 275 GLU B O     1 
ATOM   4503 C CB    . GLU B 1 249 ? -17.799 67.535  6.205   1.00 44.72  ? 275 GLU B CB    1 
ATOM   4504 C CG    . GLU B 1 249 ? -17.895 68.595  5.121   1.00 53.95  ? 275 GLU B CG    1 
ATOM   4505 C CD    . GLU B 1 249 ? -18.690 68.123  3.918   1.00 76.42  ? 275 GLU B CD    1 
ATOM   4506 O OE1   . GLU B 1 249 ? -19.142 66.958  3.922   1.00 76.62  ? 275 GLU B OE1   1 
ATOM   4507 O OE2   . GLU B 1 249 ? -18.859 68.916  2.968   1.00 87.23  ? 275 GLU B OE2   1 
ATOM   4508 N N     . GLU B 1 250 ? -17.942 68.882  9.190   1.00 45.82  ? 276 GLU B N     1 
ATOM   4509 C CA    . GLU B 1 250 ? -18.419 69.991  10.005  1.00 43.86  ? 276 GLU B CA    1 
ATOM   4510 C C     . GLU B 1 250 ? -17.390 70.407  11.047  1.00 38.39  ? 276 GLU B C     1 
ATOM   4511 O O     . GLU B 1 250 ? -17.162 71.596  11.255  1.00 47.20  ? 276 GLU B O     1 
ATOM   4512 C CB    . GLU B 1 250 ? -19.739 69.629  10.681  1.00 42.01  ? 276 GLU B CB    1 
ATOM   4513 C CG    . GLU B 1 250 ? -20.840 69.263  9.694   1.00 72.07  ? 276 GLU B CG    1 
ATOM   4514 C CD    . GLU B 1 250 ? -22.113 68.803  10.378  1.00 100.81 ? 276 GLU B CD    1 
ATOM   4515 O OE1   . GLU B 1 250 ? -22.114 68.700  11.623  1.00 98.12  ? 276 GLU B OE1   1 
ATOM   4516 O OE2   . GLU B 1 250 ? -23.114 68.542  9.675   1.00 117.42 ? 276 GLU B OE2   1 
ATOM   4517 N N     . LYS B 1 251 ? -16.769 69.424  11.696  1.00 35.68  ? 277 LYS B N     1 
ATOM   4518 C CA    . LYS B 1 251 ? -15.787 69.694  12.744  1.00 43.17  ? 277 LYS B CA    1 
ATOM   4519 C C     . LYS B 1 251 ? -14.542 70.405  12.218  1.00 55.64  ? 277 LYS B C     1 
ATOM   4520 O O     . LYS B 1 251 ? -14.036 71.334  12.850  1.00 58.40  ? 277 LYS B O     1 
ATOM   4521 C CB    . LYS B 1 251 ? -15.376 68.399  13.453  1.00 38.08  ? 277 LYS B CB    1 
ATOM   4522 C CG    . LYS B 1 251 ? -16.447 67.794  14.347  1.00 50.32  ? 277 LYS B CG    1 
ATOM   4523 C CD    . LYS B 1 251 ? -15.885 66.642  15.171  1.00 57.24  ? 277 LYS B CD    1 
ATOM   4524 C CE    . LYS B 1 251 ? -16.910 66.110  16.162  1.00 64.11  ? 277 LYS B CE    1 
ATOM   4525 N NZ    . LYS B 1 251 ? -16.320 65.100  17.086  1.00 66.17  ? 277 LYS B NZ    1 
ATOM   4526 N N     . ILE B 1 252 ? -14.054 69.965  11.061  1.00 49.78  ? 278 ILE B N     1 
ATOM   4527 C CA    . ILE B 1 252 ? -12.795 70.462  10.510  1.00 49.40  ? 278 ILE B CA    1 
ATOM   4528 C C     . ILE B 1 252 ? -12.787 71.978  10.326  1.00 55.12  ? 278 ILE B C     1 
ATOM   4529 O O     . ILE B 1 252 ? -11.729 72.594  10.197  1.00 53.87  ? 278 ILE B O     1 
ATOM   4530 C CB    . ILE B 1 252 ? -12.460 69.782  9.165   1.00 41.49  ? 278 ILE B CB    1 
ATOM   4531 C CG1   . ILE B 1 252 ? -11.015 70.078  8.758   1.00 39.90  ? 278 ILE B CG1   1 
ATOM   4532 C CG2   . ILE B 1 252 ? -13.433 70.228  8.085   1.00 39.57  ? 278 ILE B CG2   1 
ATOM   4533 C CD1   . ILE B 1 252 ? -9.987  69.623  9.772   1.00 12.36  ? 278 ILE B CD1   1 
ATOM   4534 N N     . LYS B 1 253 ? -13.972 72.575  10.318  1.00 53.02  ? 279 LYS B N     1 
ATOM   4535 C CA    . LYS B 1 253 ? -14.097 74.017  10.163  1.00 57.60  ? 279 LYS B CA    1 
ATOM   4536 C C     . LYS B 1 253 ? -13.479 74.752  11.350  1.00 62.77  ? 279 LYS B C     1 
ATOM   4537 O O     . LYS B 1 253 ? -12.695 75.685  11.175  1.00 54.99  ? 279 LYS B O     1 
ATOM   4538 C CB    . LYS B 1 253 ? -15.569 74.399  10.001  1.00 75.93  ? 279 LYS B CB    1 
ATOM   4539 C CG    . LYS B 1 253 ? -16.252 73.692  8.839   1.00 89.05  ? 279 LYS B CG    1 
ATOM   4540 C CD    . LYS B 1 253 ? -17.759 73.888  8.863   1.00 90.72  ? 279 LYS B CD    1 
ATOM   4541 C CE    . LYS B 1 253 ? -18.425 73.128  7.726   1.00 90.89  ? 279 LYS B CE    1 
ATOM   4542 N NZ    . LYS B 1 253 ? -19.910 73.167  7.815   1.00 91.62  ? 279 LYS B NZ    1 
ATOM   4543 N N     . LYS B 1 254 ? -13.826 74.319  12.558  1.00 67.65  ? 280 LYS B N     1 
ATOM   4544 C CA    . LYS B 1 254 ? -13.343 74.975  13.769  1.00 65.21  ? 280 LYS B CA    1 
ATOM   4545 C C     . LYS B 1 254 ? -12.166 74.244  14.406  1.00 67.60  ? 280 LYS B C     1 
ATOM   4546 O O     . LYS B 1 254 ? -11.245 74.874  14.927  1.00 78.36  ? 280 LYS B O     1 
ATOM   4547 C CB    . LYS B 1 254 ? -14.477 75.128  14.784  1.00 76.99  ? 280 LYS B CB    1 
ATOM   4548 C CG    . LYS B 1 254 ? -15.599 76.041  14.325  1.00 91.51  ? 280 LYS B CG    1 
ATOM   4549 C CD    . LYS B 1 254 ? -16.608 76.274  15.436  1.00 99.05  ? 280 LYS B CD    1 
ATOM   4550 C CE    . LYS B 1 254 ? -17.697 77.237  14.999  1.00 107.80 ? 280 LYS B CE    1 
ATOM   4551 N NZ    . LYS B 1 254 ? -18.665 77.509  16.097  1.00 113.73 ? 280 LYS B NZ    1 
ATOM   4552 N N     . SER B 1 255 ? -12.199 72.916  14.369  1.00 53.94  ? 281 SER B N     1 
ATOM   4553 C CA    . SER B 1 255 ? -11.140 72.111  14.970  1.00 51.53  ? 281 SER B CA    1 
ATOM   4554 C C     . SER B 1 255 ? -10.101 71.679  13.937  1.00 51.74  ? 281 SER B C     1 
ATOM   4555 O O     . SER B 1 255 ? -10.366 70.806  13.112  1.00 69.07  ? 281 SER B O     1 
ATOM   4556 C CB    . SER B 1 255 ? -11.729 70.882  15.666  1.00 44.43  ? 281 SER B CB    1 
ATOM   4557 O OG    . SER B 1 255 ? -12.631 71.257  16.690  1.00 44.65  ? 281 SER B OG    1 
ATOM   4558 N N     . PRO B 1 256 ? -8.908  72.288  13.986  1.00 28.21  ? 282 PRO B N     1 
ATOM   4559 C CA    . PRO B 1 256 ? -7.836  71.952  13.045  1.00 44.95  ? 282 PRO B CA    1 
ATOM   4560 C C     . PRO B 1 256 ? -7.378  70.510  13.214  1.00 52.19  ? 282 PRO B C     1 
ATOM   4561 O O     . PRO B 1 256 ? -7.433  69.970  14.319  1.00 52.17  ? 282 PRO B O     1 
ATOM   4562 C CB    . PRO B 1 256 ? -6.709  72.911  13.442  1.00 43.36  ? 282 PRO B CB    1 
ATOM   4563 C CG    . PRO B 1 256 ? -6.985  73.254  14.861  1.00 39.12  ? 282 PRO B CG    1 
ATOM   4564 C CD    . PRO B 1 256 ? -8.481  73.294  14.971  1.00 35.62  ? 282 PRO B CD    1 
ATOM   4565 N N     . LEU B 1 257 ? -6.929  69.899  12.123  1.00 49.73  ? 283 LEU B N     1 
ATOM   4566 C CA    . LEU B 1 257 ? -6.435  68.529  12.161  1.00 43.21  ? 283 LEU B CA    1 
ATOM   4567 C C     . LEU B 1 257 ? -5.176  68.445  13.017  1.00 43.38  ? 283 LEU B C     1 
ATOM   4568 O O     . LEU B 1 257 ? -4.746  67.359  13.404  1.00 40.84  ? 283 LEU B O     1 
ATOM   4569 C CB    . LEU B 1 257 ? -6.149  68.028  10.744  1.00 43.40  ? 283 LEU B CB    1 
ATOM   4570 C CG    . LEU B 1 257 ? -5.794  66.549  10.583  1.00 46.16  ? 283 LEU B CG    1 
ATOM   4571 C CD1   . LEU B 1 257 ? -6.907  65.667  11.126  1.00 46.91  ? 283 LEU B CD1   1 
ATOM   4572 C CD2   . LEU B 1 257 ? -5.518  66.227  9.125   1.00 55.33  ? 283 LEU B CD2   1 
ATOM   4573 N N     . THR B 1 258 ? -4.593  69.604  13.306  1.00 50.54  ? 284 THR B N     1 
ATOM   4574 C CA    . THR B 1 258 ? -3.398  69.693  14.138  1.00 46.77  ? 284 THR B CA    1 
ATOM   4575 C C     . THR B 1 258 ? -3.630  69.049  15.501  1.00 62.91  ? 284 THR B C     1 
ATOM   4576 O O     . THR B 1 258 ? -2.702  68.531  16.124  1.00 64.03  ? 284 THR B O     1 
ATOM   4577 C CB    . THR B 1 258 ? -2.965  71.156  14.327  1.00 37.23  ? 284 THR B CB    1 
ATOM   4578 O OG1   . THR B 1 258 ? -2.502  71.678  13.076  1.00 40.47  ? 284 THR B OG1   1 
ATOM   4579 C CG2   . THR B 1 258 ? -1.849  71.258  15.355  1.00 61.94  ? 284 THR B CG2   1 
ATOM   4580 N N     . ILE B 1 259 ? -4.878  69.086  15.957  1.00 58.41  ? 285 ILE B N     1 
ATOM   4581 C CA    . ILE B 1 259 ? -5.259  68.446  17.209  1.00 42.91  ? 285 ILE B CA    1 
ATOM   4582 C C     . ILE B 1 259 ? -4.810  66.989  17.238  1.00 45.06  ? 285 ILE B C     1 
ATOM   4583 O O     . ILE B 1 259 ? -4.242  66.521  18.225  1.00 47.66  ? 285 ILE B O     1 
ATOM   4584 C CB    . ILE B 1 259 ? -6.782  68.500  17.418  1.00 35.34  ? 285 ILE B CB    1 
ATOM   4585 C CG1   . ILE B 1 259 ? -7.239  69.943  17.636  1.00 36.66  ? 285 ILE B CG1   1 
ATOM   4586 C CG2   . ILE B 1 259 ? -7.191  67.631  18.594  1.00 35.68  ? 285 ILE B CG2   1 
ATOM   4587 C CD1   . ILE B 1 259 ? -8.722  70.076  17.885  1.00 42.55  ? 285 ILE B CD1   1 
ATOM   4588 N N     . CYS B 1 260 ? -5.065  66.279  16.145  1.00 52.62  ? 286 CYS B N     1 
ATOM   4589 C CA    . CYS B 1 260 ? -4.742  64.861  16.051  1.00 35.90  ? 286 CYS B CA    1 
ATOM   4590 C C     . CYS B 1 260 ? -3.324  64.651  15.528  1.00 34.26  ? 286 CYS B C     1 
ATOM   4591 O O     . CYS B 1 260 ? -2.508  63.983  16.163  1.00 41.45  ? 286 CYS B O     1 
ATOM   4592 C CB    . CYS B 1 260 ? -5.748  64.155  15.143  1.00 21.09  ? 286 CYS B CB    1 
ATOM   4593 S SG    . CYS B 1 260 ? -5.653  62.361  15.186  1.00 48.41  ? 286 CYS B SG    1 
ATOM   4594 N N     . TYR B 1 261 ? -3.042  65.220  14.361  1.00 36.28  ? 287 TYR B N     1 
ATOM   4595 C CA    . TYR B 1 261 ? -1.708  65.161  13.780  1.00 39.92  ? 287 TYR B CA    1 
ATOM   4596 C C     . TYR B 1 261 ? -1.034  66.518  13.906  1.00 54.41  ? 287 TYR B C     1 
ATOM   4597 O O     . TYR B 1 261 ? -1.317  67.431  13.131  1.00 64.75  ? 287 TYR B O     1 
ATOM   4598 C CB    . TYR B 1 261 ? -1.777  64.751  12.309  1.00 39.08  ? 287 TYR B CB    1 
ATOM   4599 C CG    . TYR B 1 261 ? -2.411  63.401  12.076  1.00 47.48  ? 287 TYR B CG    1 
ATOM   4600 C CD1   . TYR B 1 261 ? -1.657  62.236  12.144  1.00 50.30  ? 287 TYR B CD1   1 
ATOM   4601 C CD2   . TYR B 1 261 ? -3.764  63.290  11.784  1.00 49.73  ? 287 TYR B CD2   1 
ATOM   4602 C CE1   . TYR B 1 261 ? -2.233  60.999  11.930  1.00 50.93  ? 287 TYR B CE1   1 
ATOM   4603 C CE2   . TYR B 1 261 ? -4.349  62.058  11.567  1.00 52.98  ? 287 TYR B CE2   1 
ATOM   4604 C CZ    . TYR B 1 261 ? -3.579  60.916  11.642  1.00 58.77  ? 287 TYR B CZ    1 
ATOM   4605 O OH    . TYR B 1 261 ? -4.160  59.689  11.428  1.00 65.53  ? 287 TYR B OH    1 
ATOM   4606 N N     . PRO B 1 262 ? -0.142  66.656  14.894  1.00 61.72  ? 288 PRO B N     1 
ATOM   4607 C CA    . PRO B 1 262 ? 0.563   67.915  15.155  1.00 69.25  ? 288 PRO B CA    1 
ATOM   4608 C C     . PRO B 1 262 ? 1.461   68.325  13.991  1.00 69.93  ? 288 PRO B C     1 
ATOM   4609 O O     . PRO B 1 262 ? 1.747   69.510  13.826  1.00 61.12  ? 288 PRO B O     1 
ATOM   4610 C CB    . PRO B 1 262 ? 1.413   67.591  16.388  1.00 72.31  ? 288 PRO B CB    1 
ATOM   4611 C CG    . PRO B 1 262 ? 0.746   66.410  17.018  1.00 67.88  ? 288 PRO B CG    1 
ATOM   4612 C CD    . PRO B 1 262 ? 0.197   65.617  15.880  1.00 60.63  ? 288 PRO B CD    1 
ATOM   4613 N N     . GLU B 1 263 ? 1.892   67.352  13.194  1.00 80.56  ? 289 GLU B N     1 
ATOM   4614 C CA    . GLU B 1 263 ? 2.814   67.610  12.092  1.00 84.62  ? 289 GLU B CA    1 
ATOM   4615 C C     . GLU B 1 263 ? 2.087   67.882  10.778  1.00 77.60  ? 289 GLU B C     1 
ATOM   4616 O O     . GLU B 1 263 ? 2.663   67.733  9.700   1.00 69.82  ? 289 GLU B O     1 
ATOM   4617 C CB    . GLU B 1 263 ? 3.784   66.437  11.915  1.00 92.43  ? 289 GLU B CB    1 
ATOM   4618 C CG    . GLU B 1 263 ? 3.142   65.161  11.385  1.00 100.49 ? 289 GLU B CG    1 
ATOM   4619 C CD    . GLU B 1 263 ? 2.252   64.474  12.407  1.00 107.08 ? 289 GLU B CD    1 
ATOM   4620 O OE1   . GLU B 1 263 ? 2.383   64.771  13.613  1.00 110.04 ? 289 GLU B OE1   1 
ATOM   4621 O OE2   . GLU B 1 263 ? 1.426   63.629  12.002  1.00 107.76 ? 289 GLU B OE2   1 
ATOM   4622 N N     . TYR B 1 264 ? 0.823   68.280  10.872  1.00 79.67  ? 290 TYR B N     1 
ATOM   4623 C CA    . TYR B 1 264 ? 0.027   68.582  9.688   1.00 64.81  ? 290 TYR B CA    1 
ATOM   4624 C C     . TYR B 1 264 ? 0.100   70.064  9.337   1.00 64.78  ? 290 TYR B C     1 
ATOM   4625 O O     . TYR B 1 264 ? -0.286  70.920  10.134  1.00 65.78  ? 290 TYR B O     1 
ATOM   4626 C CB    . TYR B 1 264 ? -1.428  68.162  9.893   1.00 53.73  ? 290 TYR B CB    1 
ATOM   4627 C CG    . TYR B 1 264 ? -2.344  68.559  8.757   1.00 62.87  ? 290 TYR B CG    1 
ATOM   4628 C CD1   . TYR B 1 264 ? -2.409  67.802  7.595   1.00 67.38  ? 290 TYR B CD1   1 
ATOM   4629 C CD2   . TYR B 1 264 ? -3.146  69.689  8.848   1.00 64.65  ? 290 TYR B CD2   1 
ATOM   4630 C CE1   . TYR B 1 264 ? -3.244  68.160  6.553   1.00 64.19  ? 290 TYR B CE1   1 
ATOM   4631 C CE2   . TYR B 1 264 ? -3.985  70.056  7.813   1.00 66.21  ? 290 TYR B CE2   1 
ATOM   4632 C CZ    . TYR B 1 264 ? -4.031  69.287  6.667   1.00 67.75  ? 290 TYR B CZ    1 
ATOM   4633 O OH    . TYR B 1 264 ? -4.864  69.647  5.633   1.00 65.27  ? 290 TYR B OH    1 
ATOM   4634 N N     . ALA B 1 265 ? 0.594   70.358  8.138   1.00 63.84  ? 291 ALA B N     1 
ATOM   4635 C CA    . ALA B 1 265 ? 0.754   71.737  7.690   1.00 71.00  ? 291 ALA B CA    1 
ATOM   4636 C C     . ALA B 1 265 ? -0.145  72.063  6.500   1.00 68.19  ? 291 ALA B C     1 
ATOM   4637 O O     . ALA B 1 265 ? 0.178   72.932  5.689   1.00 70.52  ? 291 ALA B O     1 
ATOM   4638 C CB    . ALA B 1 265 ? 2.209   72.016  7.349   1.00 76.37  ? 291 ALA B CB    1 
ATOM   4639 N N     . GLY B 1 266 ? -1.270  71.363  6.398   1.00 58.38  ? 292 GLY B N     1 
ATOM   4640 C CA    . GLY B 1 266 ? -2.221  71.607  5.329   1.00 62.90  ? 292 GLY B CA    1 
ATOM   4641 C C     . GLY B 1 266 ? -3.315  72.570  5.750   1.00 67.80  ? 292 GLY B C     1 
ATOM   4642 O O     . GLY B 1 266 ? -3.375  72.986  6.906   1.00 56.83  ? 292 GLY B O     1 
ATOM   4643 N N     . SER B 1 267 ? -4.182  72.926  4.808   1.00 72.20  ? 293 SER B N     1 
ATOM   4644 C CA    . SER B 1 267 ? -5.277  73.847  5.090   1.00 65.71  ? 293 SER B CA    1 
ATOM   4645 C C     . SER B 1 267 ? -6.396  73.138  5.839   1.00 57.70  ? 293 SER B C     1 
ATOM   4646 O O     . SER B 1 267 ? -6.453  71.909  5.870   1.00 49.63  ? 293 SER B O     1 
ATOM   4647 C CB    . SER B 1 267 ? -5.825  74.446  3.794   1.00 68.21  ? 293 SER B CB    1 
ATOM   4648 O OG    . SER B 1 267 ? -6.547  73.479  3.053   1.00 62.20  ? 293 SER B OG    1 
ATOM   4649 N N     . ASN B 1 268 ? -7.287  73.919  6.439   1.00 61.37  ? 294 ASN B N     1 
ATOM   4650 C CA    . ASN B 1 268 ? -8.412  73.357  7.175   1.00 65.52  ? 294 ASN B CA    1 
ATOM   4651 C C     . ASN B 1 268 ? -9.666  73.211  6.319   1.00 66.52  ? 294 ASN B C     1 
ATOM   4652 O O     . ASN B 1 268 ? -10.701 73.812  6.606   1.00 72.98  ? 294 ASN B O     1 
ATOM   4653 C CB    . ASN B 1 268 ? -8.708  74.182  8.428   1.00 74.79  ? 294 ASN B CB    1 
ATOM   4654 C CG    . ASN B 1 268 ? -7.667  73.983  9.514   1.00 83.62  ? 294 ASN B CG    1 
ATOM   4655 O OD1   . ASN B 1 268 ? -6.807  73.106  9.413   1.00 66.68  ? 294 ASN B OD1   1 
ATOM   4656 N ND2   . ASN B 1 268 ? -7.744  74.794  10.562  1.00 97.49  ? 294 ASN B ND2   1 
ATOM   4657 N N     . THR B 1 269 ? -9.559  72.411  5.264   1.00 60.27  ? 295 THR B N     1 
ATOM   4658 C CA    . THR B 1 269 ? -10.708 72.069  4.435   1.00 59.32  ? 295 THR B CA    1 
ATOM   4659 C C     . THR B 1 269 ? -10.937 70.564  4.495   1.00 47.75  ? 295 THR B C     1 
ATOM   4660 O O     . THR B 1 269 ? -9.993  69.792  4.660   1.00 43.08  ? 295 THR B O     1 
ATOM   4661 C CB    . THR B 1 269 ? -10.506 72.489  2.965   1.00 69.83  ? 295 THR B CB    1 
ATOM   4662 O OG1   . THR B 1 269 ? -9.510  71.659  2.355   1.00 59.73  ? 295 THR B OG1   1 
ATOM   4663 C CG2   . THR B 1 269 ? -10.077 73.947  2.879   1.00 82.64  ? 295 THR B CG2   1 
ATOM   4664 N N     . TYR B 1 270 ? -12.192 70.149  4.365   1.00 41.72  ? 296 TYR B N     1 
ATOM   4665 C CA    . TYR B 1 270 ? -12.529 68.731  4.411   1.00 44.77  ? 296 TYR B CA    1 
ATOM   4666 C C     . TYR B 1 270 ? -11.657 67.910  3.464   1.00 57.27  ? 296 TYR B C     1 
ATOM   4667 O O     . TYR B 1 270 ? -11.175 66.836  3.823   1.00 65.59  ? 296 TYR B O     1 
ATOM   4668 C CB    . TYR B 1 270 ? -14.006 68.515  4.077   1.00 39.83  ? 296 TYR B CB    1 
ATOM   4669 C CG    . TYR B 1 270 ? -14.340 67.081  3.739   1.00 42.72  ? 296 TYR B CG    1 
ATOM   4670 C CD1   . TYR B 1 270 ? -14.549 66.140  4.739   1.00 50.35  ? 296 TYR B CD1   1 
ATOM   4671 C CD2   . TYR B 1 270 ? -14.439 66.665  2.418   1.00 35.14  ? 296 TYR B CD2   1 
ATOM   4672 C CE1   . TYR B 1 270 ? -14.849 64.826  4.433   1.00 46.37  ? 296 TYR B CE1   1 
ATOM   4673 C CE2   . TYR B 1 270 ? -14.738 65.353  2.104   1.00 43.94  ? 296 TYR B CE2   1 
ATOM   4674 C CZ    . TYR B 1 270 ? -14.942 64.439  3.114   1.00 47.04  ? 296 TYR B CZ    1 
ATOM   4675 O OH    . TYR B 1 270 ? -15.241 63.132  2.804   1.00 49.62  ? 296 TYR B OH    1 
ATOM   4676 N N     . GLU B 1 271 ? -11.455 68.425  2.257   1.00 54.60  ? 297 GLU B N     1 
ATOM   4677 C CA    . GLU B 1 271 ? -10.713 67.706  1.228   1.00 57.91  ? 297 GLU B CA    1 
ATOM   4678 C C     . GLU B 1 271 ? -9.265  67.427  1.629   1.00 58.05  ? 297 GLU B C     1 
ATOM   4679 O O     . GLU B 1 271 ? -8.859  66.271  1.759   1.00 45.63  ? 297 GLU B O     1 
ATOM   4680 C CB    . GLU B 1 271 ? -10.758 68.469  -0.101  1.00 50.11  ? 297 GLU B CB    1 
ATOM   4681 C CG    . GLU B 1 271 ? -12.085 68.367  -0.845  1.00 47.50  ? 297 GLU B CG    1 
ATOM   4682 C CD    . GLU B 1 271 ? -13.228 69.067  -0.129  1.00 64.03  ? 297 GLU B CD    1 
ATOM   4683 O OE1   . GLU B 1 271 ? -12.960 69.942  0.721   1.00 83.34  ? 297 GLU B OE1   1 
ATOM   4684 O OE2   . GLU B 1 271 ? -14.398 68.746  -0.424  1.00 58.98  ? 297 GLU B OE2   1 
ATOM   4685 N N     . GLU B 1 272 ? -8.491  68.489  1.824   1.00 53.58  ? 298 GLU B N     1 
ATOM   4686 C CA    . GLU B 1 272 ? -7.070  68.352  2.121   1.00 55.38  ? 298 GLU B CA    1 
ATOM   4687 C C     . GLU B 1 272 ? -6.824  67.594  3.424   1.00 59.30  ? 298 GLU B C     1 
ATOM   4688 O O     . GLU B 1 272 ? -5.871  66.821  3.530   1.00 63.76  ? 298 GLU B O     1 
ATOM   4689 C CB    . GLU B 1 272 ? -6.391  69.723  2.161   1.00 67.29  ? 298 GLU B CB    1 
ATOM   4690 C CG    . GLU B 1 272 ? -4.880  69.663  2.330   1.00 84.83  ? 298 GLU B CG    1 
ATOM   4691 C CD    . GLU B 1 272 ? -4.205  70.995  2.056   1.00 96.99  ? 298 GLU B CD    1 
ATOM   4692 O OE1   . GLU B 1 272 ? -3.021  71.149  2.421   1.00 95.44  ? 298 GLU B OE1   1 
ATOM   4693 O OE2   . GLU B 1 272 ? -4.857  71.888  1.474   1.00 103.61 ? 298 GLU B OE2   1 
ATOM   4694 N N     . ALA B 1 273 ? -7.689  67.812  4.408   1.00 57.37  ? 299 ALA B N     1 
ATOM   4695 C CA    . ALA B 1 273 ? -7.552  67.160  5.706   1.00 48.96  ? 299 ALA B CA    1 
ATOM   4696 C C     . ALA B 1 273 ? -7.851  65.664  5.626   1.00 47.66  ? 299 ALA B C     1 
ATOM   4697 O O     . ALA B 1 273 ? -7.010  64.835  5.978   1.00 46.87  ? 299 ALA B O     1 
ATOM   4698 C CB    . ALA B 1 273 ? -8.453  67.828  6.732   1.00 53.98  ? 299 ALA B CB    1 
ATOM   4699 N N     . ALA B 1 274 ? -9.052  65.326  5.164   1.00 37.22  ? 300 ALA B N     1 
ATOM   4700 C CA    . ALA B 1 274 ? -9.462  63.932  5.031   1.00 28.97  ? 300 ALA B CA    1 
ATOM   4701 C C     . ALA B 1 274 ? -8.413  63.125  4.279   1.00 35.86  ? 300 ALA B C     1 
ATOM   4702 O O     . ALA B 1 274 ? -8.054  62.019  4.684   1.00 42.94  ? 300 ALA B O     1 
ATOM   4703 C CB    . ALA B 1 274 ? -10.807 63.837  4.326   1.00 22.53  ? 300 ALA B CB    1 
ATOM   4704 N N     . ALA B 1 275 ? -7.926  63.687  3.179   1.00 28.66  ? 301 ALA B N     1 
ATOM   4705 C CA    . ALA B 1 275 ? -6.916  63.023  2.367   1.00 43.52  ? 301 ALA B CA    1 
ATOM   4706 C C     . ALA B 1 275 ? -5.693  62.662  3.204   1.00 51.52  ? 301 ALA B C     1 
ATOM   4707 O O     . ALA B 1 275 ? -5.178  61.546  3.120   1.00 43.09  ? 301 ALA B O     1 
ATOM   4708 C CB    . ALA B 1 275 ? -6.519  63.902  1.192   1.00 31.59  ? 301 ALA B CB    1 
ATOM   4709 N N     . TYR B 1 276 ? -5.235  63.612  4.013   1.00 53.49  ? 302 TYR B N     1 
ATOM   4710 C CA    . TYR B 1 276 ? -4.073  63.391  4.864   1.00 55.56  ? 302 TYR B CA    1 
ATOM   4711 C C     . TYR B 1 276 ? -4.273  62.157  5.734   1.00 61.64  ? 302 TYR B C     1 
ATOM   4712 O O     . TYR B 1 276 ? -3.378  61.321  5.858   1.00 72.37  ? 302 TYR B O     1 
ATOM   4713 C CB    . TYR B 1 276 ? -3.805  64.613  5.742   1.00 46.87  ? 302 TYR B CB    1 
ATOM   4714 C CG    . TYR B 1 276 ? -2.543  64.499  6.566   1.00 53.44  ? 302 TYR B CG    1 
ATOM   4715 C CD1   . TYR B 1 276 ? -1.319  64.907  6.054   1.00 62.66  ? 302 TYR B CD1   1 
ATOM   4716 C CD2   . TYR B 1 276 ? -2.574  63.982  7.854   1.00 45.59  ? 302 TYR B CD2   1 
ATOM   4717 C CE1   . TYR B 1 276 ? -0.161  64.804  6.802   1.00 58.43  ? 302 TYR B CE1   1 
ATOM   4718 C CE2   . TYR B 1 276 ? -1.422  63.875  8.609   1.00 55.17  ? 302 TYR B CE2   1 
ATOM   4719 C CZ    . TYR B 1 276 ? -0.218  64.288  8.078   1.00 65.43  ? 302 TYR B CZ    1 
ATOM   4720 O OH    . TYR B 1 276 ? 0.934   64.185  8.824   1.00 73.92  ? 302 TYR B OH    1 
ATOM   4721 N N     . ILE B 1 277 ? -5.455  62.050  6.331   1.00 45.61  ? 303 ILE B N     1 
ATOM   4722 C CA    . ILE B 1 277 ? -5.788  60.904  7.167   1.00 43.41  ? 303 ILE B CA    1 
ATOM   4723 C C     . ILE B 1 277 ? -5.717  59.603  6.378   1.00 44.53  ? 303 ILE B C     1 
ATOM   4724 O O     . ILE B 1 277 ? -5.103  58.632  6.820   1.00 49.36  ? 303 ILE B O     1 
ATOM   4725 C CB    . ILE B 1 277 ? -7.193  61.042  7.769   1.00 49.56  ? 303 ILE B CB    1 
ATOM   4726 C CG1   . ILE B 1 277 ? -7.268  62.282  8.662   1.00 53.54  ? 303 ILE B CG1   1 
ATOM   4727 C CG2   . ILE B 1 277 ? -7.559  59.789  8.549   1.00 55.01  ? 303 ILE B CG2   1 
ATOM   4728 C CD1   . ILE B 1 277 ? -8.625  62.496  9.296   1.00 48.79  ? 303 ILE B CD1   1 
ATOM   4729 N N     . GLN B 1 278 ? -6.353  59.590  5.211   1.00 43.98  ? 304 GLN B N     1 
ATOM   4730 C CA    . GLN B 1 278 ? -6.364  58.409  4.356   1.00 55.05  ? 304 GLN B CA    1 
ATOM   4731 C C     . GLN B 1 278 ? -4.955  57.872  4.145   1.00 63.64  ? 304 GLN B C     1 
ATOM   4732 O O     . GLN B 1 278 ? -4.712  56.672  4.273   1.00 67.96  ? 304 GLN B O     1 
ATOM   4733 C CB    . GLN B 1 278 ? -7.001  58.728  3.004   1.00 60.91  ? 304 GLN B CB    1 
ATOM   4734 C CG    . GLN B 1 278 ? -6.982  57.562  2.028   1.00 58.43  ? 304 GLN B CG    1 
ATOM   4735 C CD    . GLN B 1 278 ? -7.497  57.940  0.654   1.00 64.78  ? 304 GLN B CD    1 
ATOM   4736 O OE1   . GLN B 1 278 ? -7.757  59.110  0.376   1.00 78.98  ? 304 GLN B OE1   1 
ATOM   4737 N NE2   . GLN B 1 278 ? -7.646  56.948  -0.215  1.00 69.30  ? 304 GLN B NE2   1 
ATOM   4738 N N     . CYS B 1 279 ? -4.030  58.769  3.818   1.00 67.47  ? 305 CYS B N     1 
ATOM   4739 C CA    . CYS B 1 279 ? -2.640  58.389  3.605   1.00 68.75  ? 305 CYS B CA    1 
ATOM   4740 C C     . CYS B 1 279 ? -2.043  57.792  4.872   1.00 63.67  ? 305 CYS B C     1 
ATOM   4741 O O     . CYS B 1 279 ? -1.366  56.768  4.825   1.00 62.61  ? 305 CYS B O     1 
ATOM   4742 C CB    . CYS B 1 279 ? -1.816  59.594  3.149   1.00 72.85  ? 305 CYS B CB    1 
ATOM   4743 S SG    . CYS B 1 279 ? -2.335  60.287  1.562   1.00 115.39 ? 305 CYS B SG    1 
ATOM   4744 N N     . GLN B 1 280 ? -2.306  58.435  6.005   1.00 63.73  ? 306 GLN B N     1 
ATOM   4745 C CA    . GLN B 1 280 ? -1.793  57.970  7.288   1.00 61.22  ? 306 GLN B CA    1 
ATOM   4746 C C     . GLN B 1 280 ? -2.047  56.481  7.494   1.00 62.81  ? 306 GLN B C     1 
ATOM   4747 O O     . GLN B 1 280 ? -1.184  55.759  7.991   1.00 72.90  ? 306 GLN B O     1 
ATOM   4748 C CB    . GLN B 1 280 ? -2.414  58.768  8.433   1.00 55.20  ? 306 GLN B CB    1 
ATOM   4749 C CG    . GLN B 1 280 ? -2.115  60.250  8.367   1.00 63.73  ? 306 GLN B CG    1 
ATOM   4750 C CD    . GLN B 1 280 ? -0.633  60.532  8.250   1.00 59.60  ? 306 GLN B CD    1 
ATOM   4751 O OE1   . GLN B 1 280 ? 0.147   60.203  9.144   1.00 56.70  ? 306 GLN B OE1   1 
ATOM   4752 N NE2   . GLN B 1 280 ? -0.233  61.146  7.142   1.00 52.43  ? 306 GLN B NE2   1 
ATOM   4753 N N     . PHE B 1 281 ? -3.235  56.028  7.109   1.00 48.36  ? 307 PHE B N     1 
ATOM   4754 C CA    . PHE B 1 281 ? -3.601  54.627  7.270   1.00 53.30  ? 307 PHE B CA    1 
ATOM   4755 C C     . PHE B 1 281 ? -2.997  53.750  6.180   1.00 61.77  ? 307 PHE B C     1 
ATOM   4756 O O     . PHE B 1 281 ? -2.395  52.717  6.471   1.00 79.61  ? 307 PHE B O     1 
ATOM   4757 C CB    . PHE B 1 281 ? -5.121  54.467  7.295   1.00 61.52  ? 307 PHE B CB    1 
ATOM   4758 C CG    . PHE B 1 281 ? -5.756  54.910  8.583   1.00 60.70  ? 307 PHE B CG    1 
ATOM   4759 C CD1   . PHE B 1 281 ? -6.088  56.238  8.787   1.00 69.11  ? 307 PHE B CD1   1 
ATOM   4760 C CD2   . PHE B 1 281 ? -6.021  53.994  9.589   1.00 51.00  ? 307 PHE B CD2   1 
ATOM   4761 C CE1   . PHE B 1 281 ? -6.672  56.645  9.972   1.00 74.45  ? 307 PHE B CE1   1 
ATOM   4762 C CE2   . PHE B 1 281 ? -6.605  54.394  10.774  1.00 52.79  ? 307 PHE B CE2   1 
ATOM   4763 C CZ    . PHE B 1 281 ? -6.931  55.722  10.967  1.00 67.39  ? 307 PHE B CZ    1 
ATOM   4764 N N     . GLU B 1 282 ? -3.159  54.163  4.927   1.00 55.01  ? 308 GLU B N     1 
ATOM   4765 C CA    . GLU B 1 282 ? -2.645  53.391  3.800   1.00 67.11  ? 308 GLU B CA    1 
ATOM   4766 C C     . GLU B 1 282 ? -1.133  53.206  3.885   1.00 72.27  ? 308 GLU B C     1 
ATOM   4767 O O     . GLU B 1 282 ? -0.598  52.188  3.447   1.00 67.10  ? 308 GLU B O     1 
ATOM   4768 C CB    . GLU B 1 282 ? -3.022  54.051  2.471   1.00 74.30  ? 308 GLU B CB    1 
ATOM   4769 C CG    . GLU B 1 282 ? -4.514  54.046  2.176   1.00 81.57  ? 308 GLU B CG    1 
ATOM   4770 C CD    . GLU B 1 282 ? -4.833  54.503  0.765   1.00 79.34  ? 308 GLU B CD    1 
ATOM   4771 O OE1   . GLU B 1 282 ? -3.892  54.848  0.020   1.00 79.57  ? 308 GLU B OE1   1 
ATOM   4772 O OE2   . GLU B 1 282 ? -6.027  54.515  0.399   1.00 77.76  ? 308 GLU B OE2   1 
ATOM   4773 N N     . ASP B 1 283 ? -0.450  54.194  4.453   1.00 82.27  ? 309 ASP B N     1 
ATOM   4774 C CA    . ASP B 1 283 ? 1.002   54.149  4.580   1.00 85.17  ? 309 ASP B CA    1 
ATOM   4775 C C     . ASP B 1 283 ? 1.447   53.140  5.634   1.00 80.06  ? 309 ASP B C     1 
ATOM   4776 O O     . ASP B 1 283 ? 2.584   52.671  5.613   1.00 88.34  ? 309 ASP B O     1 
ATOM   4777 C CB    . ASP B 1 283 ? 1.555   55.538  4.908   1.00 92.11  ? 309 ASP B CB    1 
ATOM   4778 C CG    . ASP B 1 283 ? 1.296   56.546  3.804   1.00 101.41 ? 309 ASP B CG    1 
ATOM   4779 O OD1   . ASP B 1 283 ? 0.760   56.150  2.747   1.00 91.79  ? 309 ASP B OD1   1 
ATOM   4780 O OD2   . ASP B 1 283 ? 1.629   57.735  3.994   1.00 109.95 ? 309 ASP B OD2   1 
ATOM   4781 N N     . LEU B 1 284 ? 0.547   52.810  6.555   1.00 71.79  ? 310 LEU B N     1 
ATOM   4782 C CA    . LEU B 1 284 ? 0.849   51.835  7.595   1.00 70.05  ? 310 LEU B CA    1 
ATOM   4783 C C     . LEU B 1 284 ? 1.153   50.477  6.978   1.00 73.86  ? 310 LEU B C     1 
ATOM   4784 O O     . LEU B 1 284 ? 1.967   49.715  7.499   1.00 84.53  ? 310 LEU B O     1 
ATOM   4785 C CB    . LEU B 1 284 ? -0.314  51.713  8.580   1.00 71.11  ? 310 LEU B CB    1 
ATOM   4786 C CG    . LEU B 1 284 ? -0.726  52.997  9.298   1.00 76.16  ? 310 LEU B CG    1 
ATOM   4787 C CD1   . LEU B 1 284 ? -1.881  52.727  10.248  1.00 82.38  ? 310 LEU B CD1   1 
ATOM   4788 C CD2   . LEU B 1 284 ? 0.457   53.600  10.041  1.00 75.11  ? 310 LEU B CD2   1 
ATOM   4789 N N     . ASN B 1 285 ? 0.491   50.181  5.864   1.00 70.28  ? 311 ASN B N     1 
ATOM   4790 C CA    . ASN B 1 285 ? 0.730   48.943  5.133   1.00 86.48  ? 311 ASN B CA    1 
ATOM   4791 C C     . ASN B 1 285 ? 2.136   48.918  4.542   1.00 93.84  ? 311 ASN B C     1 
ATOM   4792 O O     . ASN B 1 285 ? 2.430   49.635  3.586   1.00 93.64  ? 311 ASN B O     1 
ATOM   4793 C CB    . ASN B 1 285 ? -0.316  48.767  4.029   1.00 87.70  ? 311 ASN B CB    1 
ATOM   4794 C CG    . ASN B 1 285 ? -0.169  47.452  3.286   1.00 81.52  ? 311 ASN B CG    1 
ATOM   4795 O OD1   . ASN B 1 285 ? 0.694   46.636  3.607   1.00 87.45  ? 311 ASN B OD1   1 
ATOM   4796 N ND2   . ASN B 1 285 ? -1.017  47.241  2.285   1.00 72.60  ? 311 ASN B ND2   1 
ATOM   4797 N N     . LYS B 1 286 ? 3.002   48.091  5.118   1.00 97.56  ? 312 LYS B N     1 
ATOM   4798 C CA    . LYS B 1 286 ? 4.394   48.022  4.688   1.00 106.06 ? 312 LYS B CA    1 
ATOM   4799 C C     . LYS B 1 286 ? 4.528   47.360  3.320   1.00 116.73 ? 312 LYS B C     1 
ATOM   4800 O O     . LYS B 1 286 ? 5.016   47.972  2.370   1.00 120.94 ? 312 LYS B O     1 
ATOM   4801 C CB    . LYS B 1 286 ? 5.242   47.283  5.726   1.00 111.96 ? 312 LYS B CB    1 
ATOM   4802 C CG    . LYS B 1 286 ? 5.075   47.804  7.148   1.00 114.61 ? 312 LYS B CG    1 
ATOM   4803 C CD    . LYS B 1 286 ? 5.301   49.307  7.227   1.00 112.79 ? 312 LYS B CD    1 
ATOM   4804 C CE    . LYS B 1 286 ? 5.030   49.832  8.630   1.00 106.43 ? 312 LYS B CE    1 
ATOM   4805 N NZ    . LYS B 1 286 ? 5.192   51.309  8.717   1.00 99.48  ? 312 LYS B NZ    1 
ATOM   4806 N N     . ARG B 1 287 ? 4.095   46.107  3.224   1.00 123.57 ? 313 ARG B N     1 
ATOM   4807 C CA    . ARG B 1 287 ? 4.125   45.383  1.958   1.00 129.10 ? 313 ARG B CA    1 
ATOM   4808 C C     . ARG B 1 287 ? 2.877   45.684  1.135   1.00 120.13 ? 313 ARG B C     1 
ATOM   4809 O O     . ARG B 1 287 ? 1.909   44.925  1.161   1.00 115.40 ? 313 ARG B O     1 
ATOM   4810 C CB    . ARG B 1 287 ? 4.250   43.878  2.201   1.00 144.47 ? 313 ARG B CB    1 
ATOM   4811 C CG    . ARG B 1 287 ? 5.563   43.461  2.844   1.00 158.80 ? 313 ARG B CG    1 
ATOM   4812 C CD    . ARG B 1 287 ? 5.590   41.969  3.133   1.00 169.90 ? 313 ARG B CD    1 
ATOM   4813 N NE    . ARG B 1 287 ? 4.547   41.578  4.078   1.00 177.40 ? 313 ARG B NE    1 
ATOM   4814 C CZ    . ARG B 1 287 ? 4.373   40.340  4.529   1.00 179.87 ? 313 ARG B CZ    1 
ATOM   4815 N NH1   . ARG B 1 287 ? 5.174   39.365  4.122   1.00 178.92 ? 313 ARG B NH1   1 
ATOM   4816 N NH2   . ARG B 1 287 ? 3.397   40.077  5.387   1.00 181.03 ? 313 ARG B NH2   1 
ATOM   4817 N N     . LYS B 1 288 ? 2.909   46.795  0.405   1.00 121.84 ? 314 LYS B N     1 
ATOM   4818 C CA    . LYS B 1 288 ? 1.761   47.234  -0.380  1.00 130.36 ? 314 LYS B CA    1 
ATOM   4819 C C     . LYS B 1 288 ? 1.451   46.286  -1.533  1.00 135.50 ? 314 LYS B C     1 
ATOM   4820 O O     . LYS B 1 288 ? 0.288   46.046  -1.856  1.00 138.74 ? 314 LYS B O     1 
ATOM   4821 C CB    . LYS B 1 288 ? 1.989   48.648  -0.920  1.00 132.85 ? 314 LYS B CB    1 
ATOM   4822 C CG    . LYS B 1 288 ? 0.858   49.157  -1.800  1.00 139.02 ? 314 LYS B CG    1 
ATOM   4823 C CD    . LYS B 1 288 ? 1.148   50.549  -2.338  1.00 135.29 ? 314 LYS B CD    1 
ATOM   4824 C CE    . LYS B 1 288 ? 0.008   51.048  -3.213  1.00 126.03 ? 314 LYS B CE    1 
ATOM   4825 N NZ    . LYS B 1 288 ? -1.281  51.112  -2.467  1.00 115.27 ? 314 LYS B NZ    1 
ATOM   4826 N N     . ASP B 1 289 ? 2.499   45.751  -2.152  1.00 130.32 ? 315 ASP B N     1 
ATOM   4827 C CA    . ASP B 1 289 ? 2.340   44.890  -3.319  1.00 121.54 ? 315 ASP B CA    1 
ATOM   4828 C C     . ASP B 1 289 ? 2.077   43.440  -2.922  1.00 109.48 ? 315 ASP B C     1 
ATOM   4829 O O     . ASP B 1 289 ? 2.739   42.525  -3.409  1.00 84.64  ? 315 ASP B O     1 
ATOM   4830 C CB    . ASP B 1 289 ? 3.578   44.972  -4.214  1.00 121.62 ? 315 ASP B CB    1 
ATOM   4831 C CG    . ASP B 1 289 ? 3.883   46.389  -4.661  1.00 119.75 ? 315 ASP B CG    1 
ATOM   4832 O OD1   . ASP B 1 289 ? 4.671   46.554  -5.616  1.00 121.31 ? 315 ASP B OD1   1 
ATOM   4833 O OD2   . ASP B 1 289 ? 3.336   47.339  -4.061  1.00 112.70 ? 315 ASP B OD2   1 
ATOM   4834 N N     . THR B 1 290 ? 1.105   43.239  -2.038  1.00 125.39 ? 316 THR B N     1 
ATOM   4835 C CA    . THR B 1 290 ? 0.759   41.902  -1.569  1.00 130.48 ? 316 THR B CA    1 
ATOM   4836 C C     . THR B 1 290 ? -0.704  41.828  -1.146  1.00 130.81 ? 316 THR B C     1 
ATOM   4837 O O     . THR B 1 290 ? -1.497  42.716  -1.459  1.00 132.82 ? 316 THR B O     1 
ATOM   4838 C CB    . THR B 1 290 ? 1.650   41.469  -0.386  1.00 129.28 ? 316 THR B CB    1 
ATOM   4839 O OG1   . THR B 1 290 ? 3.024   41.466  -0.792  1.00 124.81 ? 316 THR B OG1   1 
ATOM   4840 C CG2   . THR B 1 290 ? 1.263   40.077  0.091   1.00 124.11 ? 316 THR B CG2   1 
ATOM   4841 N N     . GLU B 1 292 ? -2.358  45.882  -1.069  1.00 48.73  ? 318 GLU B N     1 
ATOM   4842 C CA    . GLU B 1 292 ? -3.494  46.561  -1.686  1.00 75.57  ? 318 GLU B CA    1 
ATOM   4843 C C     . GLU B 1 292 ? -4.629  46.810  -0.692  1.00 85.88  ? 318 GLU B C     1 
ATOM   4844 O O     . GLU B 1 292 ? -5.220  45.869  -0.161  1.00 77.33  ? 318 GLU B O     1 
ATOM   4845 C CB    . GLU B 1 292 ? -4.011  45.761  -2.883  1.00 89.39  ? 318 GLU B CB    1 
ATOM   4846 C CG    . GLU B 1 292 ? -5.293  46.308  -3.497  1.00 113.00 ? 318 GLU B CG    1 
ATOM   4847 C CD    . GLU B 1 292 ? -5.119  47.690  -4.105  1.00 132.74 ? 318 GLU B CD    1 
ATOM   4848 O OE1   . GLU B 1 292 ? -5.487  47.869  -5.285  1.00 140.29 ? 318 GLU B OE1   1 
ATOM   4849 O OE2   . GLU B 1 292 ? -4.616  48.596  -3.408  1.00 138.24 ? 318 GLU B OE2   1 
ATOM   4850 N N     . ILE B 1 293 ? -4.931  48.083  -0.454  1.00 90.84  ? 319 ILE B N     1 
ATOM   4851 C CA    . ILE B 1 293 ? -5.975  48.466  0.492   1.00 81.78  ? 319 ILE B CA    1 
ATOM   4852 C C     . ILE B 1 293 ? -7.066  49.302  -0.172  1.00 77.40  ? 319 ILE B C     1 
ATOM   4853 O O     . ILE B 1 293 ? -6.791  50.348  -0.761  1.00 77.97  ? 319 ILE B O     1 
ATOM   4854 C CB    . ILE B 1 293 ? -5.396  49.252  1.682   1.00 73.66  ? 319 ILE B CB    1 
ATOM   4855 C CG1   . ILE B 1 293 ? -4.364  48.406  2.428   1.00 70.71  ? 319 ILE B CG1   1 
ATOM   4856 C CG2   . ILE B 1 293 ? -6.507  49.691  2.622   1.00 72.33  ? 319 ILE B CG2   1 
ATOM   4857 C CD1   . ILE B 1 293 ? -3.755  49.102  3.624   1.00 68.42  ? 319 ILE B CD1   1 
ATOM   4858 N N     . TYR B 1 294 ? -8.306  48.835  -0.066  1.00 72.29  ? 320 TYR B N     1 
ATOM   4859 C CA    . TYR B 1 294 ? -9.442  49.519  -0.674  1.00 67.50  ? 320 TYR B CA    1 
ATOM   4860 C C     . TYR B 1 294 ? -10.114 50.438  0.337   1.00 60.62  ? 320 TYR B C     1 
ATOM   4861 O O     . TYR B 1 294 ? -10.736 49.975  1.290   1.00 54.52  ? 320 TYR B O     1 
ATOM   4862 C CB    . TYR B 1 294 ? -10.447 48.499  -1.209  1.00 65.58  ? 320 TYR B CB    1 
ATOM   4863 C CG    . TYR B 1 294 ? -9.806  47.377  -1.996  1.00 73.49  ? 320 TYR B CG    1 
ATOM   4864 C CD1   . TYR B 1 294 ? -9.554  47.511  -3.355  1.00 79.70  ? 320 TYR B CD1   1 
ATOM   4865 C CD2   . TYR B 1 294 ? -9.449  46.186  -1.377  1.00 67.76  ? 320 TYR B CD2   1 
ATOM   4866 C CE1   . TYR B 1 294 ? -8.965  46.489  -4.076  1.00 81.62  ? 320 TYR B CE1   1 
ATOM   4867 C CE2   . TYR B 1 294 ? -8.861  45.159  -2.089  1.00 63.03  ? 320 TYR B CE2   1 
ATOM   4868 C CZ    . TYR B 1 294 ? -8.621  45.315  -3.437  1.00 80.03  ? 320 TYR B CZ    1 
ATOM   4869 O OH    . TYR B 1 294 ? -8.035  44.293  -4.148  1.00 90.28  ? 320 TYR B OH    1 
ATOM   4870 N N     . THR B 1 295 ? -9.990  51.743  0.119   1.00 61.89  ? 321 THR B N     1 
ATOM   4871 C CA    . THR B 1 295 ? -10.498 52.730  1.066   1.00 49.60  ? 321 THR B CA    1 
ATOM   4872 C C     . THR B 1 295 ? -11.765 53.417  0.567   1.00 49.56  ? 321 THR B C     1 
ATOM   4873 O O     . THR B 1 295 ? -11.919 53.668  -0.629  1.00 45.68  ? 321 THR B O     1 
ATOM   4874 C CB    . THR B 1 295 ? -9.434  53.800  1.371   1.00 59.15  ? 321 THR B CB    1 
ATOM   4875 O OG1   . THR B 1 295 ? -8.241  53.167  1.850   1.00 67.10  ? 321 THR B OG1   1 
ATOM   4876 C CG2   . THR B 1 295 ? -9.943  54.781  2.417   1.00 56.35  ? 321 THR B CG2   1 
ATOM   4877 N N     . HIS B 1 296 ? -12.668 53.717  1.497   1.00 54.35  ? 322 HIS B N     1 
ATOM   4878 C CA    . HIS B 1 296 ? -13.914 54.408  1.181   1.00 42.53  ? 322 HIS B CA    1 
ATOM   4879 C C     . HIS B 1 296 ? -14.250 55.440  2.248   1.00 50.45  ? 322 HIS B C     1 
ATOM   4880 O O     . HIS B 1 296 ? -14.122 55.173  3.443   1.00 59.35  ? 322 HIS B O     1 
ATOM   4881 C CB    . HIS B 1 296 ? -15.068 53.411  1.064   1.00 37.15  ? 322 HIS B CB    1 
ATOM   4882 C CG    . HIS B 1 296 ? -14.953 52.483  -0.105  1.00 54.23  ? 322 HIS B CG    1 
ATOM   4883 N ND1   . HIS B 1 296 ? -15.501 52.768  -1.337  1.00 59.74  ? 322 HIS B ND1   1 
ATOM   4884 C CD2   . HIS B 1 296 ? -14.359 51.272  -0.228  1.00 64.67  ? 322 HIS B CD2   1 
ATOM   4885 C CE1   . HIS B 1 296 ? -15.245 51.774  -2.170  1.00 67.10  ? 322 HIS B CE1   1 
ATOM   4886 N NE2   . HIS B 1 296 ? -14.554 50.855  -1.522  1.00 62.09  ? 322 HIS B NE2   1 
ATOM   4887 N N     . PHE B 1 297 ? -14.674 56.622  1.813   1.00 58.15  ? 323 PHE B N     1 
ATOM   4888 C CA    . PHE B 1 297 ? -15.188 57.635  2.727   1.00 60.90  ? 323 PHE B CA    1 
ATOM   4889 C C     . PHE B 1 297 ? -16.702 57.505  2.785   1.00 58.44  ? 323 PHE B C     1 
ATOM   4890 O O     . PHE B 1 297 ? -17.391 57.782  1.803   1.00 78.38  ? 323 PHE B O     1 
ATOM   4891 C CB    . PHE B 1 297 ? -14.796 59.038  2.263   1.00 54.36  ? 323 PHE B CB    1 
ATOM   4892 C CG    . PHE B 1 297 ? -13.339 59.354  2.441   1.00 39.04  ? 323 PHE B CG    1 
ATOM   4893 C CD1   . PHE B 1 297 ? -12.404 58.928  1.513   1.00 37.44  ? 323 PHE B CD1   1 
ATOM   4894 C CD2   . PHE B 1 297 ? -12.904 60.086  3.533   1.00 38.80  ? 323 PHE B CD2   1 
ATOM   4895 C CE1   . PHE B 1 297 ? -11.063 59.221  1.672   1.00 40.91  ? 323 PHE B CE1   1 
ATOM   4896 C CE2   . PHE B 1 297 ? -11.565 60.384  3.699   1.00 45.68  ? 323 PHE B CE2   1 
ATOM   4897 C CZ    . PHE B 1 297 ? -10.643 59.950  2.767   1.00 53.54  ? 323 PHE B CZ    1 
ATOM   4898 N N     . THR B 1 298 ? -17.221 57.081  3.932   1.00 42.23  ? 324 THR B N     1 
ATOM   4899 C CA    . THR B 1 298 ? -18.637 56.750  4.037   1.00 40.74  ? 324 THR B CA    1 
ATOM   4900 C C     . THR B 1 298 ? -19.359 57.500  5.148   1.00 44.49  ? 324 THR B C     1 
ATOM   4901 O O     . THR B 1 298 ? -18.737 58.068  6.045   1.00 45.13  ? 324 THR B O     1 
ATOM   4902 C CB    . THR B 1 298 ? -18.841 55.240  4.280   1.00 49.20  ? 324 THR B CB    1 
ATOM   4903 O OG1   . THR B 1 298 ? -18.457 54.912  5.621   1.00 52.45  ? 324 THR B OG1   1 
ATOM   4904 C CG2   . THR B 1 298 ? -18.013 54.425  3.301   1.00 65.19  ? 324 THR B CG2   1 
ATOM   4905 N N     . CYS B 1 299 ? -20.685 57.492  5.065   1.00 41.78  ? 325 CYS B N     1 
ATOM   4906 C CA    . CYS B 1 299 ? -21.538 57.979  6.136   1.00 31.10  ? 325 CYS B CA    1 
ATOM   4907 C C     . CYS B 1 299 ? -22.504 56.857  6.502   1.00 46.26  ? 325 CYS B C     1 
ATOM   4908 O O     . CYS B 1 299 ? -23.603 56.767  5.954   1.00 45.92  ? 325 CYS B O     1 
ATOM   4909 C CB    . CYS B 1 299 ? -22.305 59.223  5.693   1.00 21.79  ? 325 CYS B CB    1 
ATOM   4910 S SG    . CYS B 1 299 ? -23.281 59.998  7.003   1.00 49.22  ? 325 CYS B SG    1 
ATOM   4911 N N     . ALA B 1 300 ? -22.076 56.003  7.427   1.00 49.15  ? 326 ALA B N     1 
ATOM   4912 C CA    . ALA B 1 300 ? -22.786 54.767  7.754   1.00 46.06  ? 326 ALA B CA    1 
ATOM   4913 C C     . ALA B 1 300 ? -24.278 54.942  8.032   1.00 52.50  ? 326 ALA B C     1 
ATOM   4914 O O     . ALA B 1 300 ? -25.048 53.990  7.913   1.00 62.75  ? 326 ALA B O     1 
ATOM   4915 C CB    . ALA B 1 300 ? -22.110 54.066  8.926   1.00 43.61  ? 326 ALA B CB    1 
ATOM   4916 N N     . THR B 1 301 ? -24.683 56.152  8.403   1.00 44.14  ? 327 THR B N     1 
ATOM   4917 C CA    . THR B 1 301 ? -26.082 56.410  8.729   1.00 44.20  ? 327 THR B CA    1 
ATOM   4918 C C     . THR B 1 301 ? -26.886 56.860  7.512   1.00 46.25  ? 327 THR B C     1 
ATOM   4919 O O     . THR B 1 301 ? -28.108 56.991  7.578   1.00 44.37  ? 327 THR B O     1 
ATOM   4920 C CB    . THR B 1 301 ? -26.218 57.456  9.848   1.00 35.17  ? 327 THR B CB    1 
ATOM   4921 O OG1   . THR B 1 301 ? -25.541 58.659  9.464   1.00 40.53  ? 327 THR B OG1   1 
ATOM   4922 C CG2   . THR B 1 301 ? -25.615 56.929  11.139  1.00 38.83  ? 327 THR B CG2   1 
ATOM   4923 N N     . ASP B 1 302 ? -26.193 57.096  6.403   1.00 50.43  ? 328 ASP B N     1 
ATOM   4924 C CA    . ASP B 1 302 ? -26.852 57.493  5.165   1.00 59.73  ? 328 ASP B CA    1 
ATOM   4925 C C     . ASP B 1 302 ? -27.123 56.272  4.295   1.00 71.66  ? 328 ASP B C     1 
ATOM   4926 O O     . ASP B 1 302 ? -26.237 55.791  3.588   1.00 75.02  ? 328 ASP B O     1 
ATOM   4927 C CB    . ASP B 1 302 ? -25.999 58.507  4.402   1.00 67.99  ? 328 ASP B CB    1 
ATOM   4928 C CG    . ASP B 1 302 ? -26.701 59.050  3.174   1.00 84.55  ? 328 ASP B CG    1 
ATOM   4929 O OD1   . ASP B 1 302 ? -27.930 58.859  3.055   1.00 90.31  ? 328 ASP B OD1   1 
ATOM   4930 O OD2   . ASP B 1 302 ? -26.023 59.671  2.328   1.00 92.47  ? 328 ASP B OD2   1 
ATOM   4931 N N     . THR B 1 303 ? -28.355 55.777  4.357   1.00 70.00  ? 329 THR B N     1 
ATOM   4932 C CA    . THR B 1 303 ? -28.750 54.577  3.627   1.00 64.06  ? 329 THR B CA    1 
ATOM   4933 C C     . THR B 1 303 ? -28.375 54.652  2.150   1.00 71.89  ? 329 THR B C     1 
ATOM   4934 O O     . THR B 1 303 ? -27.895 53.676  1.569   1.00 65.63  ? 329 THR B O     1 
ATOM   4935 C CB    . THR B 1 303 ? -30.265 54.334  3.746   1.00 56.49  ? 329 THR B CB    1 
ATOM   4936 O OG1   . THR B 1 303 ? -30.644 54.333  5.128   1.00 63.91  ? 329 THR B OG1   1 
ATOM   4937 C CG2   . THR B 1 303 ? -30.643 53.003  3.115   1.00 42.42  ? 329 THR B CG2   1 
ATOM   4938 N N     . LYS B 1 304 ? -28.598 55.816  1.549   1.00 77.86  ? 330 LYS B N     1 
ATOM   4939 C CA    . LYS B 1 304 ? -28.310 56.023  0.135   1.00 68.05  ? 330 LYS B CA    1 
ATOM   4940 C C     . LYS B 1 304 ? -26.832 55.784  -0.163  1.00 59.22  ? 330 LYS B C     1 
ATOM   4941 O O     . LYS B 1 304 ? -26.489 55.039  -1.079  1.00 53.43  ? 330 LYS B O     1 
ATOM   4942 C CB    . LYS B 1 304 ? -28.717 57.439  -0.282  1.00 79.13  ? 330 LYS B CB    1 
ATOM   4943 C CG    . LYS B 1 304 ? -28.725 57.685  -1.785  1.00 88.32  ? 330 LYS B CG    1 
ATOM   4944 C CD    . LYS B 1 304 ? -29.329 59.048  -2.112  1.00 94.67  ? 330 LYS B CD    1 
ATOM   4945 C CE    . LYS B 1 304 ? -29.424 59.277  -3.615  1.00 91.58  ? 330 LYS B CE    1 
ATOM   4946 N NZ    . LYS B 1 304 ? -30.090 60.570  -3.947  1.00 74.09  ? 330 LYS B NZ    1 
ATOM   4947 N N     . ASN B 1 305 ? -25.964 56.414  0.622   1.00 70.33  ? 331 ASN B N     1 
ATOM   4948 C CA    . ASN B 1 305 ? -24.522 56.300  0.427   1.00 73.89  ? 331 ASN B CA    1 
ATOM   4949 C C     . ASN B 1 305 ? -23.989 54.899  0.709   1.00 70.98  ? 331 ASN B C     1 
ATOM   4950 O O     . ASN B 1 305 ? -23.191 54.363  -0.060  1.00 64.79  ? 331 ASN B O     1 
ATOM   4951 C CB    . ASN B 1 305 ? -23.782 57.321  1.293   1.00 76.12  ? 331 ASN B CB    1 
ATOM   4952 C CG    . ASN B 1 305 ? -22.278 57.262  1.107   1.00 71.06  ? 331 ASN B CG    1 
ATOM   4953 O OD1   . ASN B 1 305 ? -21.516 57.525  2.036   1.00 54.78  ? 331 ASN B OD1   1 
ATOM   4954 N ND2   . ASN B 1 305 ? -21.844 56.910  -0.099  1.00 75.54  ? 331 ASN B ND2   1 
ATOM   4955 N N     . VAL B 1 306 ? -24.426 54.315  1.821   1.00 65.46  ? 332 VAL B N     1 
ATOM   4956 C CA    . VAL B 1 306 ? -23.997 52.972  2.199   1.00 62.24  ? 332 VAL B CA    1 
ATOM   4957 C C     . VAL B 1 306 ? -24.304 51.970  1.091   1.00 64.69  ? 332 VAL B C     1 
ATOM   4958 O O     . VAL B 1 306 ? -23.493 51.093  0.791   1.00 54.21  ? 332 VAL B O     1 
ATOM   4959 C CB    . VAL B 1 306 ? -24.670 52.508  3.505   1.00 61.22  ? 332 VAL B CB    1 
ATOM   4960 C CG1   . VAL B 1 306 ? -24.320 51.059  3.798   1.00 59.56  ? 332 VAL B CG1   1 
ATOM   4961 C CG2   . VAL B 1 306 ? -24.257 53.406  4.660   1.00 64.08  ? 332 VAL B CG2   1 
ATOM   4962 N N     . GLN B 1 307 ? -25.477 52.110  0.482   1.00 71.84  ? 333 GLN B N     1 
ATOM   4963 C CA    . GLN B 1 307 ? -25.884 51.230  -0.606  1.00 69.77  ? 333 GLN B CA    1 
ATOM   4964 C C     . GLN B 1 307 ? -24.921 51.327  -1.782  1.00 60.09  ? 333 GLN B C     1 
ATOM   4965 O O     . GLN B 1 307 ? -24.568 50.318  -2.391  1.00 72.89  ? 333 GLN B O     1 
ATOM   4966 C CB    . GLN B 1 307 ? -27.306 51.562  -1.061  1.00 75.52  ? 333 GLN B CB    1 
ATOM   4967 C CG    . GLN B 1 307 ? -27.825 50.660  -2.170  1.00 79.33  ? 333 GLN B CG    1 
ATOM   4968 C CD    . GLN B 1 307 ? -29.262 50.964  -2.543  1.00 77.99  ? 333 GLN B CD    1 
ATOM   4969 O OE1   . GLN B 1 307 ? -29.880 50.238  -3.322  1.00 90.42  ? 333 GLN B OE1   1 
ATOM   4970 N NE2   . GLN B 1 307 ? -29.803 52.040  -1.984  1.00 65.71  ? 333 GLN B NE2   1 
ATOM   4971 N N     . PHE B 1 308 ? -24.498 52.548  -2.095  1.00 43.02  ? 334 PHE B N     1 
ATOM   4972 C CA    . PHE B 1 308 ? -23.587 52.781  -3.210  1.00 55.12  ? 334 PHE B CA    1 
ATOM   4973 C C     . PHE B 1 308 ? -22.171 52.308  -2.895  1.00 59.90  ? 334 PHE B C     1 
ATOM   4974 O O     . PHE B 1 308 ? -21.498 51.729  -3.746  1.00 64.88  ? 334 PHE B O     1 
ATOM   4975 C CB    . PHE B 1 308 ? -23.572 54.263  -3.589  1.00 82.49  ? 334 PHE B CB    1 
ATOM   4976 C CG    . PHE B 1 308 ? -22.647 54.588  -4.727  1.00 110.20 ? 334 PHE B CG    1 
ATOM   4977 C CD1   . PHE B 1 308 ? -23.059 54.421  -6.040  1.00 126.13 ? 334 PHE B CD1   1 
ATOM   4978 C CD2   . PHE B 1 308 ? -21.367 55.059  -4.485  1.00 113.12 ? 334 PHE B CD2   1 
ATOM   4979 C CE1   . PHE B 1 308 ? -22.211 54.718  -7.090  1.00 131.87 ? 334 PHE B CE1   1 
ATOM   4980 C CE2   . PHE B 1 308 ? -20.515 55.358  -5.531  1.00 124.51 ? 334 PHE B CE2   1 
ATOM   4981 C CZ    . PHE B 1 308 ? -20.937 55.186  -6.835  1.00 131.46 ? 334 PHE B CZ    1 
ATOM   4982 N N     . VAL B 1 309 ? -21.722 52.561  -1.670  1.00 63.61  ? 335 VAL B N     1 
ATOM   4983 C CA    . VAL B 1 309 ? -20.381 52.164  -1.260  1.00 66.98  ? 335 VAL B CA    1 
ATOM   4984 C C     . VAL B 1 309 ? -20.239 50.646  -1.222  1.00 66.53  ? 335 VAL B C     1 
ATOM   4985 O O     . VAL B 1 309 ? -19.283 50.093  -1.763  1.00 68.78  ? 335 VAL B O     1 
ATOM   4986 C CB    . VAL B 1 309 ? -20.008 52.745  0.116   1.00 64.50  ? 335 VAL B CB    1 
ATOM   4987 C CG1   . VAL B 1 309 ? -18.670 52.190  0.577   1.00 51.75  ? 335 VAL B CG1   1 
ATOM   4988 C CG2   . VAL B 1 309 ? -19.971 54.266  0.059   1.00 58.98  ? 335 VAL B CG2   1 
ATOM   4989 N N     . PHE B 1 310 ? -21.193 49.976  -0.585  1.00 68.48  ? 336 PHE B N     1 
ATOM   4990 C CA    . PHE B 1 310 ? -21.171 48.521  -0.498  1.00 72.40  ? 336 PHE B CA    1 
ATOM   4991 C C     . PHE B 1 310 ? -21.320 47.893  -1.880  1.00 79.73  ? 336 PHE B C     1 
ATOM   4992 O O     . PHE B 1 310 ? -20.788 46.814  -2.142  1.00 83.91  ? 336 PHE B O     1 
ATOM   4993 C CB    . PHE B 1 310 ? -22.275 48.018  0.433   1.00 79.23  ? 336 PHE B CB    1 
ATOM   4994 C CG    . PHE B 1 310 ? -22.241 46.534  0.666   1.00 92.51  ? 336 PHE B CG    1 
ATOM   4995 C CD1   . PHE B 1 310 ? -21.460 45.996  1.675   1.00 93.16  ? 336 PHE B CD1   1 
ATOM   4996 C CD2   . PHE B 1 310 ? -22.990 45.677  -0.123  1.00 97.26  ? 336 PHE B CD2   1 
ATOM   4997 C CE1   . PHE B 1 310 ? -21.426 44.631  1.894   1.00 91.88  ? 336 PHE B CE1   1 
ATOM   4998 C CE2   . PHE B 1 310 ? -22.960 44.312  0.090   1.00 100.19 ? 336 PHE B CE2   1 
ATOM   4999 C CZ    . PHE B 1 310 ? -22.177 43.788  1.100   1.00 96.71  ? 336 PHE B CZ    1 
ATOM   5000 N N     . ASP B 1 311 ? -22.050 48.572  -2.759  1.00 77.25  ? 337 ASP B N     1 
ATOM   5001 C CA    . ASP B 1 311 ? -22.206 48.120  -4.136  1.00 86.90  ? 337 ASP B CA    1 
ATOM   5002 C C     . ASP B 1 311 ? -20.845 48.106  -4.823  1.00 83.81  ? 337 ASP B C     1 
ATOM   5003 O O     . ASP B 1 311 ? -20.487 47.143  -5.501  1.00 71.95  ? 337 ASP B O     1 
ATOM   5004 C CB    . ASP B 1 311 ? -23.176 49.032  -4.891  1.00 97.38  ? 337 ASP B CB    1 
ATOM   5005 C CG    . ASP B 1 311 ? -23.560 48.483  -6.255  1.00 101.60 ? 337 ASP B CG    1 
ATOM   5006 O OD1   . ASP B 1 311 ? -22.783 47.690  -6.827  1.00 94.45  ? 337 ASP B OD1   1 
ATOM   5007 O OD2   . ASP B 1 311 ? -24.644 48.852  -6.756  1.00 102.04 ? 337 ASP B OD2   1 
ATOM   5008 N N     . ALA B 1 312 ? -20.088 49.183  -4.635  1.00 85.12  ? 338 ALA B N     1 
ATOM   5009 C CA    . ALA B 1 312 ? -18.742 49.282  -5.183  1.00 77.71  ? 338 ALA B CA    1 
ATOM   5010 C C     . ALA B 1 312 ? -17.815 48.276  -4.508  1.00 71.66  ? 338 ALA B C     1 
ATOM   5011 O O     . ALA B 1 312 ? -16.878 47.770  -5.124  1.00 69.35  ? 338 ALA B O     1 
ATOM   5012 C CB    . ALA B 1 312 ? -18.207 50.695  -5.018  1.00 75.69  ? 338 ALA B CB    1 
ATOM   5013 N N     . VAL B 1 313 ? -18.085 47.993  -3.238  1.00 78.75  ? 339 VAL B N     1 
ATOM   5014 C CA    . VAL B 1 313 ? -17.305 47.018  -2.484  1.00 80.88  ? 339 VAL B CA    1 
ATOM   5015 C C     . VAL B 1 313 ? -17.493 45.618  -3.052  1.00 71.63  ? 339 VAL B C     1 
ATOM   5016 O O     . VAL B 1 313 ? -16.528 44.878  -3.238  1.00 67.00  ? 339 VAL B O     1 
ATOM   5017 C CB    . VAL B 1 313 ? -17.701 47.008  -0.995  1.00 89.37  ? 339 VAL B CB    1 
ATOM   5018 C CG1   . VAL B 1 313 ? -17.095 45.803  -0.291  1.00 81.75  ? 339 VAL B CG1   1 
ATOM   5019 C CG2   . VAL B 1 313 ? -17.273 48.303  -0.321  1.00 95.93  ? 339 VAL B CG2   1 
ATOM   5020 N N     . THR B 1 314 ? -18.745 45.262  -3.321  1.00 70.85  ? 340 THR B N     1 
ATOM   5021 C CA    . THR B 1 314 ? -19.071 43.958  -3.883  1.00 73.06  ? 340 THR B CA    1 
ATOM   5022 C C     . THR B 1 314 ? -18.305 43.715  -5.179  1.00 75.40  ? 340 THR B C     1 
ATOM   5023 O O     . THR B 1 314 ? -17.708 42.655  -5.366  1.00 73.11  ? 340 THR B O     1 
ATOM   5024 C CB    . THR B 1 314 ? -20.580 43.826  -4.156  1.00 86.17  ? 340 THR B CB    1 
ATOM   5025 O OG1   . THR B 1 314 ? -21.302 43.937  -2.924  1.00 81.70  ? 340 THR B OG1   1 
ATOM   5026 C CG2   . THR B 1 314 ? -20.889 42.483  -4.800  1.00 100.07 ? 340 THR B CG2   1 
ATOM   5027 N N     . ASP B 1 315 ? -18.325 44.704  -6.067  1.00 74.56  ? 341 ASP B N     1 
ATOM   5028 C CA    . ASP B 1 315 ? -17.614 44.610  -7.338  1.00 69.91  ? 341 ASP B CA    1 
ATOM   5029 C C     . ASP B 1 315 ? -16.131 44.335  -7.121  1.00 60.02  ? 341 ASP B C     1 
ATOM   5030 O O     . ASP B 1 315 ? -15.497 43.642  -7.914  1.00 65.33  ? 341 ASP B O     1 
ATOM   5031 C CB    . ASP B 1 315 ? -17.798 45.890  -8.159  1.00 85.36  ? 341 ASP B CB    1 
ATOM   5032 C CG    . ASP B 1 315 ? -19.207 46.038  -8.706  1.00 109.41 ? 341 ASP B CG    1 
ATOM   5033 O OD1   . ASP B 1 315 ? -20.019 45.104  -8.530  1.00 118.77 ? 341 ASP B OD1   1 
ATOM   5034 O OD2   . ASP B 1 315 ? -19.502 47.087  -9.316  1.00 113.40 ? 341 ASP B OD2   1 
ATOM   5035 N N     . VAL B 1 316 ? -15.585 44.882  -6.039  1.00 70.73  ? 342 VAL B N     1 
ATOM   5036 C CA    . VAL B 1 316 ? -14.180 44.680  -5.705  1.00 80.54  ? 342 VAL B CA    1 
ATOM   5037 C C     . VAL B 1 316 ? -13.906 43.231  -5.318  1.00 90.51  ? 342 VAL B C     1 
ATOM   5038 O O     . VAL B 1 316 ? -12.911 42.642  -5.741  1.00 101.49 ? 342 VAL B O     1 
ATOM   5039 C CB    . VAL B 1 316 ? -13.730 45.607  -4.560  1.00 70.16  ? 342 VAL B CB    1 
ATOM   5040 C CG1   . VAL B 1 316 ? -12.333 45.234  -4.092  1.00 63.71  ? 342 VAL B CG1   1 
ATOM   5041 C CG2   . VAL B 1 316 ? -13.780 47.060  -5.004  1.00 69.60  ? 342 VAL B CG2   1 
ATOM   5042 N N     . ILE B 1 317 ? -14.794 42.659  -4.513  1.00 84.61  ? 343 ILE B N     1 
ATOM   5043 C CA    . ILE B 1 317 ? -14.647 41.275  -4.087  1.00 91.38  ? 343 ILE B CA    1 
ATOM   5044 C C     . ILE B 1 317 ? -14.762 40.327  -5.278  1.00 98.96  ? 343 ILE B C     1 
ATOM   5045 O O     . ILE B 1 317 ? -14.036 39.338  -5.366  1.00 93.74  ? 343 ILE B O     1 
ATOM   5046 C CB    . ILE B 1 317 ? -15.697 40.895  -3.027  1.00 91.47  ? 343 ILE B CB    1 
ATOM   5047 C CG1   . ILE B 1 317 ? -15.696 41.915  -1.887  1.00 93.20  ? 343 ILE B CG1   1 
ATOM   5048 C CG2   . ILE B 1 317 ? -15.434 39.494  -2.496  1.00 91.28  ? 343 ILE B CG2   1 
ATOM   5049 C CD1   . ILE B 1 317 ? -16.742 41.648  -0.826  1.00 92.24  ? 343 ILE B CD1   1 
ATOM   5050 N N     . ILE B 1 318 ? -15.670 40.645  -6.195  1.00 106.08 ? 344 ILE B N     1 
ATOM   5051 C CA    . ILE B 1 318 ? -15.911 39.814  -7.371  1.00 105.54 ? 344 ILE B CA    1 
ATOM   5052 C C     . ILE B 1 318 ? -14.633 39.515  -8.152  1.00 104.91 ? 344 ILE B C     1 
ATOM   5053 O O     . ILE B 1 318 ? -14.338 38.359  -8.455  1.00 109.20 ? 344 ILE B O     1 
ATOM   5054 C CB    . ILE B 1 318 ? -16.938 40.464  -8.320  1.00 106.53 ? 344 ILE B CB    1 
ATOM   5055 C CG1   . ILE B 1 318 ? -18.314 40.529  -7.653  1.00 98.40  ? 344 ILE B CG1   1 
ATOM   5056 C CG2   . ILE B 1 318 ? -17.017 39.694  -9.629  1.00 112.34 ? 344 ILE B CG2   1 
ATOM   5057 C CD1   . ILE B 1 318 ? -19.390 41.141  -8.525  1.00 92.31  ? 344 ILE B CD1   1 
ATOM   5058 N N     . LYS B 1 319 ? -13.877 40.562  -8.470  1.00 101.56 ? 345 LYS B N     1 
ATOM   5059 C CA    . LYS B 1 319 ? -12.657 40.417  -9.256  1.00 109.89 ? 345 LYS B CA    1 
ATOM   5060 C C     . LYS B 1 319 ? -11.536 39.753  -8.455  1.00 118.84 ? 345 LYS B C     1 
ATOM   5061 O O     . LYS B 1 319 ? -10.360 39.888  -8.794  1.00 127.59 ? 345 LYS B O     1 
ATOM   5062 C CB    . LYS B 1 319 ? -12.195 41.782  -9.778  1.00 113.06 ? 345 LYS B CB    1 
ATOM   5063 C CG    . LYS B 1 319 ? -11.881 42.786  -8.682  1.00 117.53 ? 345 LYS B CG    1 
ATOM   5064 C CD    . LYS B 1 319 ? -11.392 44.108  -9.253  1.00 116.78 ? 345 LYS B CD    1 
ATOM   5065 C CE    . LYS B 1 319 ? -11.062 45.095  -8.143  1.00 106.33 ? 345 LYS B CE    1 
ATOM   5066 N NZ    . LYS B 1 319 ? -10.565 46.397  -8.670  1.00 94.73  ? 345 LYS B NZ    1 
ATOM   5067 N N     . ASN B 1 320 ? -11.906 39.039  -7.395  1.00 117.37 ? 346 ASN B N     1 
ATOM   5068 C CA    . ASN B 1 320 ? -10.934 38.351  -6.547  1.00 115.81 ? 346 ASN B CA    1 
ATOM   5069 C C     . ASN B 1 320 ? -11.388 36.946  -6.155  1.00 113.49 ? 346 ASN B C     1 
ATOM   5070 O O     . ASN B 1 320 ? -11.047 36.449  -5.080  1.00 102.60 ? 346 ASN B O     1 
ATOM   5071 C CB    . ASN B 1 320 ? -10.631 39.170  -5.287  1.00 110.77 ? 346 ASN B CB    1 
ATOM   5072 C CG    . ASN B 1 320 ? -9.972  40.504  -5.595  1.00 101.45 ? 346 ASN B CG    1 
ATOM   5073 O OD1   . ASN B 1 320 ? -9.136  40.608  -6.493  1.00 89.35  ? 346 ASN B OD1   1 
ATOM   5074 N ND2   . ASN B 1 320 ? -10.342 41.532  -4.840  1.00 104.24 ? 346 ASN B ND2   1 
ATOM   5075 N N     . ASN B 1 321 ? -12.155 36.309  -7.032  1.00 120.36 ? 347 ASN B N     1 
ATOM   5076 C CA    . ASN B 1 321 ? -12.622 34.951  -6.789  1.00 123.69 ? 347 ASN B CA    1 
ATOM   5077 C C     . ASN B 1 321 ? -11.855 33.918  -7.618  1.00 121.83 ? 347 ASN B C     1 
ATOM   5078 O O     . ASN B 1 321 ? -12.123 32.720  -7.539  1.00 122.39 ? 347 ASN B O     1 
ATOM   5079 C CB    . ASN B 1 321 ? -14.121 34.858  -7.069  1.00 120.97 ? 347 ASN B CB    1 
ATOM   5080 C CG    . ASN B 1 321 ? -14.745 33.606  -6.495  1.00 119.82 ? 347 ASN B CG    1 
ATOM   5081 O OD1   . ASN B 1 321 ? -15.815 33.182  -6.927  1.00 115.76 ? 347 ASN B OD1   1 
ATOM   5082 N ND2   . ASN B 1 321 ? -14.079 33.005  -5.515  1.00 122.03 ? 347 ASN B ND2   1 
ATOM   5083 N N     . LEU B 1 322 ? -10.896 34.390  -8.408  1.00 116.84 ? 348 LEU B N     1 
ATOM   5084 C CA    . LEU B 1 322 ? -10.105 33.507  -9.259  1.00 120.69 ? 348 LEU B CA    1 
ATOM   5085 C C     . LEU B 1 322 ? -11.003 32.689  -10.184 1.00 113.27 ? 348 LEU B C     1 
ATOM   5086 O O     . LEU B 1 322 ? -10.819 32.685  -11.403 1.00 104.54 ? 348 LEU B O     1 
ATOM   5087 C CB    . LEU B 1 322 ? -9.241  32.574  -8.410  1.00 125.76 ? 348 LEU B CB    1 
ATOM   5088 C CG    . LEU B 1 322 ? -8.339  33.261  -7.387  1.00 121.09 ? 348 LEU B CG    1 
ATOM   5089 C CD1   . LEU B 1 322 ? -7.598  32.236  -6.544  1.00 119.36 ? 348 LEU B CD1   1 
ATOM   5090 C CD2   . LEU B 1 322 ? -7.365  34.199  -8.083  1.00 116.49 ? 348 LEU B CD2   1 
ATOM   5091 N N     . ASP C 2 1   ? -21.289 -6.539  21.312  1.00 58.51  ? 496 ASP C N     1 
ATOM   5092 C CA    . ASP C 2 1   ? -20.572 -5.662  20.394  1.00 72.99  ? 496 ASP C CA    1 
ATOM   5093 C C     . ASP C 2 1   ? -20.470 -4.241  20.943  1.00 75.73  ? 496 ASP C C     1 
ATOM   5094 O O     . ASP C 2 1   ? -21.271 -3.828  21.781  1.00 58.48  ? 496 ASP C O     1 
ATOM   5095 C CB    . ASP C 2 1   ? -21.249 -5.650  19.020  1.00 84.33  ? 496 ASP C CB    1 
ATOM   5096 C CG    . ASP C 2 1   ? -22.674 -5.124  19.072  1.00 105.38 ? 496 ASP C CG    1 
ATOM   5097 O OD1   . ASP C 2 1   ? -23.191 -4.893  20.185  1.00 119.51 ? 496 ASP C OD1   1 
ATOM   5098 O OD2   . ASP C 2 1   ? -23.279 -4.942  17.994  1.00 105.66 ? 496 ASP C OD2   1 
ATOM   5099 N N     . ILE C 2 2   ? -19.476 -3.500  20.467  1.00 84.22  ? 497 ILE C N     1 
ATOM   5100 C CA    . ILE C 2 2   ? -19.303 -2.111  20.870  1.00 69.84  ? 497 ILE C CA    1 
ATOM   5101 C C     . ILE C 2 2   ? -20.146 -1.199  19.990  1.00 54.44  ? 497 ILE C C     1 
ATOM   5102 O O     . ILE C 2 2   ? -20.627 -0.158  20.438  1.00 49.59  ? 497 ILE C O     1 
ATOM   5103 C CB    . ILE C 2 2   ? -17.830 -1.676  20.792  1.00 73.99  ? 497 ILE C CB    1 
ATOM   5104 C CG1   . ILE C 2 2   ? -16.972 -2.530  21.725  1.00 82.28  ? 497 ILE C CG1   1 
ATOM   5105 C CG2   . ILE C 2 2   ? -17.687 -0.206  21.150  1.00 66.55  ? 497 ILE C CG2   1 
ATOM   5106 C CD1   . ILE C 2 2   ? -15.529 -2.093  21.778  1.00 90.24  ? 497 ILE C CD1   1 
ATOM   5107 N N     . GLU C 2 3   ? -20.324 -1.596  18.734  1.00 62.73  ? 498 GLU C N     1 
ATOM   5108 C CA    . GLU C 2 3   ? -21.157 -0.838  17.808  1.00 63.88  ? 498 GLU C CA    1 
ATOM   5109 C C     . GLU C 2 3   ? -22.546 -0.644  18.403  1.00 61.12  ? 498 GLU C C     1 
ATOM   5110 O O     . GLU C 2 3   ? -23.092 0.459   18.381  1.00 60.42  ? 498 GLU C O     1 
ATOM   5111 C CB    . GLU C 2 3   ? -21.260 -1.553  16.460  1.00 63.71  ? 498 GLU C CB    1 
ATOM   5112 C CG    . GLU C 2 3   ? -22.009 -0.762  15.398  1.00 80.36  ? 498 GLU C CG    1 
ATOM   5113 C CD    . GLU C 2 3   ? -22.302 -1.581  14.154  1.00 93.20  ? 498 GLU C CD    1 
ATOM   5114 O OE1   . GLU C 2 3   ? -22.472 -0.981  13.071  1.00 83.89  ? 498 GLU C OE1   1 
ATOM   5115 O OE2   . GLU C 2 3   ? -22.363 -2.825  14.260  1.00 99.61  ? 498 GLU C OE2   1 
ATOM   5116 N N     . GLY C 2 4   ? -23.111 -1.723  18.936  1.00 54.75  ? 499 GLY C N     1 
ATOM   5117 C CA    . GLY C 2 4   ? -24.415 -1.666  19.570  1.00 58.96  ? 499 GLY C CA    1 
ATOM   5118 C C     . GLY C 2 4   ? -24.436 -0.636  20.680  1.00 59.69  ? 499 GLY C C     1 
ATOM   5119 O O     . GLY C 2 4   ? -25.373 0.156   20.791  1.00 57.63  ? 499 GLY C O     1 
ATOM   5120 N N     . LEU C 2 5   ? -23.390 -0.648  21.500  1.00 58.18  ? 500 LEU C N     1 
ATOM   5121 C CA    . LEU C 2 5   ? -23.246 0.312   22.587  1.00 51.76  ? 500 LEU C CA    1 
ATOM   5122 C C     . LEU C 2 5   ? -23.216 1.745   22.065  1.00 52.72  ? 500 LEU C C     1 
ATOM   5123 O O     . LEU C 2 5   ? -24.012 2.586   22.484  1.00 54.97  ? 500 LEU C O     1 
ATOM   5124 C CB    . LEU C 2 5   ? -21.975 0.018   23.383  1.00 43.45  ? 500 LEU C CB    1 
ATOM   5125 C CG    . LEU C 2 5   ? -21.606 1.020   24.480  1.00 39.28  ? 500 LEU C CG    1 
ATOM   5126 C CD1   . LEU C 2 5   ? -22.770 1.238   25.436  1.00 28.71  ? 500 LEU C CD1   1 
ATOM   5127 C CD2   . LEU C 2 5   ? -20.369 0.548   25.229  1.00 31.22  ? 500 LEU C CD2   1 
ATOM   5128 N N     . VAL C 2 6   ? -22.290 2.017   21.151  1.00 43.27  ? 501 VAL C N     1 
ATOM   5129 C CA    . VAL C 2 6   ? -22.172 3.339   20.546  1.00 40.62  ? 501 VAL C CA    1 
ATOM   5130 C C     . VAL C 2 6   ? -23.496 3.781   19.935  1.00 39.84  ? 501 VAL C C     1 
ATOM   5131 O O     . VAL C 2 6   ? -23.875 4.948   20.023  1.00 37.33  ? 501 VAL C O     1 
ATOM   5132 C CB    . VAL C 2 6   ? -21.082 3.363   19.460  1.00 35.66  ? 501 VAL C CB    1 
ATOM   5133 C CG1   . VAL C 2 6   ? -21.088 4.698   18.731  1.00 32.21  ? 501 VAL C CG1   1 
ATOM   5134 C CG2   . VAL C 2 6   ? -19.717 3.083   20.071  1.00 34.53  ? 501 VAL C CG2   1 
ATOM   5135 N N     . GLU C 2 7   ? -24.195 2.838   19.312  1.00 40.93  ? 502 GLU C N     1 
ATOM   5136 C CA    . GLU C 2 7   ? -25.495 3.115   18.720  1.00 42.16  ? 502 GLU C CA    1 
ATOM   5137 C C     . GLU C 2 7   ? -26.471 3.560   19.796  1.00 37.95  ? 502 GLU C C     1 
ATOM   5138 O O     . GLU C 2 7   ? -27.131 4.592   19.664  1.00 27.42  ? 502 GLU C O     1 
ATOM   5139 C CB    . GLU C 2 7   ? -26.032 1.873   18.011  1.00 74.93  ? 502 GLU C CB    1 
ATOM   5140 C CG    . GLU C 2 7   ? -27.424 2.045   17.428  1.00 110.40 ? 502 GLU C CG    1 
ATOM   5141 C CD    . GLU C 2 7   ? -27.916 0.800   16.719  1.00 132.56 ? 502 GLU C CD    1 
ATOM   5142 O OE1   . GLU C 2 7   ? -27.136 -0.171  16.610  1.00 131.96 ? 502 GLU C OE1   1 
ATOM   5143 O OE2   . GLU C 2 7   ? -29.082 0.791   16.269  1.00 144.29 ? 502 GLU C OE2   1 
ATOM   5144 N N     . LEU C 2 8   ? -26.551 2.770   20.864  1.00 45.06  ? 503 LEU C N     1 
ATOM   5145 C CA    . LEU C 2 8   ? -27.419 3.070   21.997  1.00 30.06  ? 503 LEU C CA    1 
ATOM   5146 C C     . LEU C 2 8   ? -27.103 4.441   22.582  1.00 23.24  ? 503 LEU C C     1 
ATOM   5147 O O     . LEU C 2 8   ? -28.000 5.253   22.807  1.00 25.39  ? 503 LEU C O     1 
ATOM   5148 C CB    . LEU C 2 8   ? -27.268 1.998   23.077  1.00 28.84  ? 503 LEU C CB    1 
ATOM   5149 C CG    . LEU C 2 8   ? -28.191 2.105   24.292  1.00 36.75  ? 503 LEU C CG    1 
ATOM   5150 C CD1   . LEU C 2 8   ? -29.652 2.128   23.864  1.00 25.44  ? 503 LEU C CD1   1 
ATOM   5151 C CD2   . LEU C 2 8   ? -27.932 0.960   25.257  1.00 35.03  ? 503 LEU C CD2   1 
ATOM   5152 N N     . LEU C 2 9   ? -25.821 4.690   22.825  1.00 17.88  ? 504 LEU C N     1 
ATOM   5153 C CA    . LEU C 2 9   ? -25.374 5.979   23.336  1.00 24.16  ? 504 LEU C CA    1 
ATOM   5154 C C     . LEU C 2 9   ? -25.883 7.129   22.476  1.00 37.48  ? 504 LEU C C     1 
ATOM   5155 O O     . LEU C 2 9   ? -26.417 8.112   22.989  1.00 52.13  ? 504 LEU C O     1 
ATOM   5156 C CB    . LEU C 2 9   ? -23.848 6.023   23.408  1.00 25.27  ? 504 LEU C CB    1 
ATOM   5157 C CG    . LEU C 2 9   ? -23.218 5.325   24.612  1.00 29.74  ? 504 LEU C CG    1 
ATOM   5158 C CD1   . LEU C 2 9   ? -21.713 5.191   24.439  1.00 35.31  ? 504 LEU C CD1   1 
ATOM   5159 C CD2   . LEU C 2 9   ? -23.553 6.085   25.881  1.00 11.48  ? 504 LEU C CD2   1 
ATOM   5160 N N     . ASN C 2 10  ? -25.715 6.999   21.166  1.00 32.41  ? 505 ASN C N     1 
ATOM   5161 C CA    . ASN C 2 10  ? -26.094 8.058   20.241  1.00 43.10  ? 505 ASN C CA    1 
ATOM   5162 C C     . ASN C 2 10  ? -27.579 8.404   20.283  1.00 50.29  ? 505 ASN C C     1 
ATOM   5163 O O     . ASN C 2 10  ? -27.948 9.579   20.231  1.00 45.38  ? 505 ASN C O     1 
ATOM   5164 C CB    . ASN C 2 10  ? -25.670 7.703   18.816  1.00 42.42  ? 505 ASN C CB    1 
ATOM   5165 C CG    . ASN C 2 10  ? -24.177 7.851   18.603  1.00 45.48  ? 505 ASN C CG    1 
ATOM   5166 O OD1   . ASN C 2 10  ? -23.507 8.588   19.326  1.00 38.04  ? 505 ASN C OD1   1 
ATOM   5167 N ND2   . ASN C 2 10  ? -23.647 7.154   17.604  1.00 56.05  ? 505 ASN C ND2   1 
ATOM   5168 N N     . ARG C 2 11  ? -28.428 7.386   20.383  1.00 48.55  ? 506 ARG C N     1 
ATOM   5169 C CA    . ARG C 2 11  ? -29.871 7.604   20.344  1.00 52.11  ? 506 ARG C CA    1 
ATOM   5170 C C     . ARG C 2 11  ? -30.451 8.010   21.700  1.00 40.65  ? 506 ARG C C     1 
ATOM   5171 O O     . ARG C 2 11  ? -31.475 8.690   21.763  1.00 45.98  ? 506 ARG C O     1 
ATOM   5172 C CB    . ARG C 2 11  ? -30.599 6.374   19.788  1.00 59.27  ? 506 ARG C CB    1 
ATOM   5173 C CG    . ARG C 2 11  ? -30.428 5.105   20.604  1.00 76.86  ? 506 ARG C CG    1 
ATOM   5174 C CD    . ARG C 2 11  ? -31.283 3.978   20.039  1.00 93.90  ? 506 ARG C CD    1 
ATOM   5175 N NE    . ARG C 2 11  ? -31.191 2.758   20.838  1.00 110.69 ? 506 ARG C NE    1 
ATOM   5176 C CZ    . ARG C 2 11  ? -31.931 1.673   20.633  1.00 112.40 ? 506 ARG C CZ    1 
ATOM   5177 N NH1   . ARG C 2 11  ? -32.824 1.654   19.655  1.00 118.94 ? 506 ARG C NH1   1 
ATOM   5178 N NH2   . ARG C 2 11  ? -31.781 0.608   21.408  1.00 107.49 ? 506 ARG C NH2   1 
ATOM   5179 N N     . VAL C 2 12  ? -29.792 7.602   22.779  1.00 32.88  ? 507 VAL C N     1 
ATOM   5180 C CA    . VAL C 2 12  ? -30.270 7.919   24.123  1.00 37.13  ? 507 VAL C CA    1 
ATOM   5181 C C     . VAL C 2 12  ? -29.880 9.329   24.563  1.00 44.85  ? 507 VAL C C     1 
ATOM   5182 O O     . VAL C 2 12  ? -30.659 10.019  25.222  1.00 36.64  ? 507 VAL C O     1 
ATOM   5183 C CB    . VAL C 2 12  ? -29.762 6.901   25.160  1.00 32.14  ? 507 VAL C CB    1 
ATOM   5184 C CG1   . VAL C 2 12  ? -30.163 7.330   26.565  1.00 23.44  ? 507 VAL C CG1   1 
ATOM   5185 C CG2   . VAL C 2 12  ? -30.303 5.518   24.850  1.00 33.67  ? 507 VAL C CG2   1 
ATOM   5186 N N     . GLN C 2 13  ? -28.675 9.753   24.197  1.00 40.91  ? 508 GLN C N     1 
ATOM   5187 C CA    . GLN C 2 13  ? -28.194 11.079  24.567  1.00 31.96  ? 508 GLN C CA    1 
ATOM   5188 C C     . GLN C 2 13  ? -28.490 12.108  23.482  1.00 45.79  ? 508 GLN C C     1 
ATOM   5189 O O     . GLN C 2 13  ? -28.134 13.278  23.615  1.00 54.24  ? 508 GLN C O     1 
ATOM   5190 C CB    . GLN C 2 13  ? -26.691 11.049  24.851  1.00 37.92  ? 508 GLN C CB    1 
ATOM   5191 C CG    . GLN C 2 13  ? -26.279 10.072  25.941  1.00 54.39  ? 508 GLN C CG    1 
ATOM   5192 C CD    . GLN C 2 13  ? -24.841 10.267  26.386  1.00 67.54  ? 508 GLN C CD    1 
ATOM   5193 O OE1   . GLN C 2 13  ? -24.280 9.432   27.096  1.00 81.51  ? 508 GLN C OE1   1 
ATOM   5194 N NE2   . GLN C 2 13  ? -24.236 11.377  25.972  1.00 58.58  ? 508 GLN C NE2   1 
ATOM   5195 N N     . SER C 2 14  ? -29.145 11.668  22.411  1.00 51.05  ? 509 SER C N     1 
ATOM   5196 C CA    . SER C 2 14  ? -29.399 12.532  21.264  1.00 65.04  ? 509 SER C CA    1 
ATOM   5197 C C     . SER C 2 14  ? -30.275 13.729  21.621  1.00 82.81  ? 509 SER C C     1 
ATOM   5198 O O     . SER C 2 14  ? -31.495 13.606  21.725  1.00 89.41  ? 509 SER C O     1 
ATOM   5199 C CB    . SER C 2 14  ? -30.039 11.738  20.125  1.00 70.27  ? 509 SER C CB    1 
ATOM   5200 O OG    . SER C 2 14  ? -30.188 12.546  18.970  1.00 76.92  ? 509 SER C OG    1 
ATOM   5201 N N     . SER C 2 15  ? -29.637 14.884  21.797  1.00 92.73  ? 510 SER C N     1 
ATOM   5202 C CA    . SER C 2 15  ? -30.331 16.129  22.123  1.00 103.18 ? 510 SER C CA    1 
ATOM   5203 C C     . SER C 2 15  ? -31.482 15.917  23.102  1.00 121.95 ? 510 SER C C     1 
ATOM   5204 O O     . SER C 2 15  ? -32.622 16.290  22.826  1.00 134.36 ? 510 SER C O     1 
ATOM   5205 C CB    . SER C 2 15  ? -30.837 16.815  20.851  1.00 96.98  ? 510 SER C CB    1 
ATOM   5206 O OG    . SER C 2 15  ? -31.766 15.997  20.161  1.00 96.56  ? 510 SER C OG    1 
ATOM   5207 N N     . HIS C 2 18  ? -33.820 20.215  21.790  1.00 102.40 ? 513 HIS C N     1 
ATOM   5208 C CA    . HIS C 2 18  ? -34.682 20.248  20.615  1.00 115.61 ? 513 HIS C CA    1 
ATOM   5209 C C     . HIS C 2 18  ? -34.961 21.683  20.183  1.00 110.90 ? 513 HIS C C     1 
ATOM   5210 O O     . HIS C 2 18  ? -34.116 22.335  19.568  1.00 93.07  ? 513 HIS C O     1 
ATOM   5211 C CB    . HIS C 2 18  ? -36.002 19.525  20.897  1.00 128.08 ? 513 HIS C CB    1 
ATOM   5212 C CG    . HIS C 2 18  ? -35.833 18.102  21.331  1.00 140.56 ? 513 HIS C CG    1 
ATOM   5213 N ND1   . HIS C 2 18  ? -35.691 17.063  20.436  1.00 145.30 ? 513 HIS C ND1   1 
ATOM   5214 C CD2   . HIS C 2 18  ? -35.791 17.544  22.564  1.00 143.20 ? 513 HIS C CD2   1 
ATOM   5215 C CE1   . HIS C 2 18  ? -35.564 15.928  21.099  1.00 145.18 ? 513 HIS C CE1   1 
ATOM   5216 N NE2   . HIS C 2 18  ? -35.621 16.192  22.392  1.00 143.29 ? 513 HIS C NE2   1 
ATOM   5217 N N     . ASP C 2 19  ? -36.156 22.166  20.508  1.00 116.44 ? 514 ASP C N     1 
ATOM   5218 C CA    . ASP C 2 19  ? -36.550 23.530  20.181  1.00 111.57 ? 514 ASP C CA    1 
ATOM   5219 C C     . ASP C 2 19  ? -36.539 24.410  21.425  1.00 86.81  ? 514 ASP C C     1 
ATOM   5220 O O     . ASP C 2 19  ? -37.297 25.374  21.519  1.00 80.02  ? 514 ASP C O     1 
ATOM   5221 C CB    . ASP C 2 19  ? -37.938 23.551  19.538  1.00 128.18 ? 514 ASP C CB    1 
ATOM   5222 C CG    . ASP C 2 19  ? -37.966 22.862  18.186  1.00 144.75 ? 514 ASP C CG    1 
ATOM   5223 O OD1   . ASP C 2 19  ? -36.889 22.453  17.703  1.00 153.64 ? 514 ASP C OD1   1 
ATOM   5224 O OD2   . ASP C 2 19  ? -39.065 22.733  17.605  1.00 141.94 ? 514 ASP C OD2   1 
ATOM   5225 N N     . GLN C 2 20  ? -35.677 24.069  22.378  1.00 66.81  ? 515 GLN C N     1 
ATOM   5226 C CA    . GLN C 2 20  ? -35.564 24.834  23.614  1.00 57.14  ? 515 GLN C CA    1 
ATOM   5227 C C     . GLN C 2 20  ? -34.105 25.035  24.021  1.00 61.67  ? 515 GLN C C     1 
ATOM   5228 O O     . GLN C 2 20  ? -33.784 25.115  25.207  1.00 44.87  ? 515 GLN C O     1 
ATOM   5229 C CB    . GLN C 2 20  ? -36.355 24.162  24.737  1.00 54.06  ? 515 GLN C CB    1 
ATOM   5230 C CG    . GLN C 2 20  ? -37.842 24.042  24.440  1.00 59.88  ? 515 GLN C CG    1 
ATOM   5231 C CD    . GLN C 2 20  ? -38.618 23.372  25.556  1.00 57.43  ? 515 GLN C CD    1 
ATOM   5232 O OE1   . GLN C 2 20  ? -39.540 22.595  25.304  1.00 34.39  ? 515 GLN C OE1   1 
ATOM   5233 N NE2   . GLN C 2 20  ? -38.250 23.669  26.797  1.00 61.29  ? 515 GLN C NE2   1 
ATOM   5234 N N     . ARG C 2 21  ? -33.232 25.117  23.021  1.00 67.43  ? 516 ARG C N     1 
ATOM   5235 C CA    . ARG C 2 21  ? -31.815 25.391  23.233  1.00 48.78  ? 516 ARG C CA    1 
ATOM   5236 C C     . ARG C 2 21  ? -31.405 26.646  22.465  1.00 50.35  ? 516 ARG C C     1 
ATOM   5237 O O     . ARG C 2 21  ? -32.163 27.150  21.636  1.00 52.18  ? 516 ARG C O     1 
ATOM   5238 C CB    . ARG C 2 21  ? -30.964 24.205  22.769  1.00 57.36  ? 516 ARG C CB    1 
ATOM   5239 C CG    . ARG C 2 21  ? -31.023 22.976  23.669  1.00 77.94  ? 516 ARG C CG    1 
ATOM   5240 C CD    . ARG C 2 21  ? -29.995 23.050  24.796  1.00 93.21  ? 516 ARG C CD    1 
ATOM   5241 N NE    . ARG C 2 21  ? -29.949 21.816  25.579  1.00 104.36 ? 516 ARG C NE    1 
ATOM   5242 C CZ    . ARG C 2 21  ? -29.106 21.594  26.584  1.00 110.12 ? 516 ARG C CZ    1 
ATOM   5243 N NH1   . ARG C 2 21  ? -28.227 22.523  26.936  1.00 116.73 ? 516 ARG C NH1   1 
ATOM   5244 N NH2   . ARG C 2 21  ? -29.140 20.439  27.237  1.00 100.90 ? 516 ARG C NH2   1 
ATOM   5245 N N     . GLY C 2 22  ? -30.206 27.145  22.748  1.00 60.07  ? 517 GLY C N     1 
ATOM   5246 C CA    . GLY C 2 22  ? -29.645 28.279  22.032  1.00 56.78  ? 517 GLY C CA    1 
ATOM   5247 C C     . GLY C 2 22  ? -30.545 29.497  21.927  1.00 51.01  ? 517 GLY C C     1 
ATOM   5248 O O     . GLY C 2 22  ? -31.447 29.695  22.742  1.00 44.39  ? 517 GLY C O     1 
ATOM   5249 N N     . LEU C 2 23  ? -30.290 30.320  20.914  1.00 48.91  ? 518 LEU C N     1 
ATOM   5250 C CA    . LEU C 2 23  ? -31.063 31.536  20.691  1.00 51.35  ? 518 LEU C CA    1 
ATOM   5251 C C     . LEU C 2 23  ? -32.353 31.243  19.936  1.00 60.22  ? 518 LEU C C     1 
ATOM   5252 O O     . LEU C 2 23  ? -32.564 30.128  19.457  1.00 66.69  ? 518 LEU C O     1 
ATOM   5253 C CB    . LEU C 2 23  ? -30.233 32.558  19.915  1.00 56.79  ? 518 LEU C CB    1 
ATOM   5254 C CG    . LEU C 2 23  ? -29.027 33.146  20.647  1.00 74.07  ? 518 LEU C CG    1 
ATOM   5255 C CD1   . LEU C 2 23  ? -28.120 33.894  19.682  1.00 89.39  ? 518 LEU C CD1   1 
ATOM   5256 C CD2   . LEU C 2 23  ? -29.483 34.054  21.782  1.00 69.88  ? 518 LEU C CD2   1 
ATOM   5257 N N     . LEU C 2 24  ? -33.214 32.250  19.832  1.00 59.77  ? 519 LEU C N     1 
ATOM   5258 C CA    . LEU C 2 24  ? -34.464 32.106  19.097  1.00 63.26  ? 519 LEU C CA    1 
ATOM   5259 C C     . LEU C 2 24  ? -34.211 31.829  17.624  1.00 67.84  ? 519 LEU C C     1 
ATOM   5260 O O     . LEU C 2 24  ? -33.149 32.150  17.090  1.00 67.41  ? 519 LEU C O     1 
ATOM   5261 C CB    . LEU C 2 24  ? -35.327 33.361  19.229  1.00 60.93  ? 519 LEU C CB    1 
ATOM   5262 C CG    . LEU C 2 24  ? -36.284 33.444  20.417  1.00 63.89  ? 519 LEU C CG    1 
ATOM   5263 C CD1   . LEU C 2 24  ? -35.511 33.461  21.711  1.00 78.36  ? 519 LEU C CD1   1 
ATOM   5264 C CD2   . LEU C 2 24  ? -37.158 34.680  20.305  1.00 70.42  ? 519 LEU C CD2   1 
ATOM   5265 N N     . ARG C 2 25  ? -35.200 31.230  16.974  1.00 74.21  ? 520 ARG C N     1 
ATOM   5266 C CA    . ARG C 2 25  ? -35.170 31.040  15.534  1.00 75.22  ? 520 ARG C CA    1 
ATOM   5267 C C     . ARG C 2 25  ? -36.543 31.350  14.954  1.00 79.37  ? 520 ARG C C     1 
ATOM   5268 O O     . ARG C 2 25  ? -37.562 31.139  15.611  1.00 82.65  ? 520 ARG C O     1 
ATOM   5269 C CB    . ARG C 2 25  ? -34.735 29.617  15.178  1.00 81.68  ? 520 ARG C CB    1 
ATOM   5270 C CG    . ARG C 2 25  ? -33.242 29.376  15.337  1.00 90.75  ? 520 ARG C CG    1 
ATOM   5271 C CD    . ARG C 2 25  ? -32.441 30.459  14.626  1.00 103.59 ? 520 ARG C CD    1 
ATOM   5272 N NE    . ARG C 2 25  ? -32.877 30.641  13.243  1.00 116.62 ? 520 ARG C NE    1 
ATOM   5273 C CZ    . ARG C 2 25  ? -32.486 31.641  12.458  1.00 106.17 ? 520 ARG C CZ    1 
ATOM   5274 N NH1   . ARG C 2 25  ? -31.647 32.560  12.917  1.00 112.13 ? 520 ARG C NH1   1 
ATOM   5275 N NH2   . ARG C 2 25  ? -32.937 31.723  11.214  1.00 81.84  ? 520 ARG C NH2   1 
ATOM   5276 N N     . LYS C 2 26  ? -36.565 31.860  13.728  1.00 85.90  ? 521 LYS C N     1 
ATOM   5277 C CA    . LYS C 2 26  ? -37.813 32.246  13.081  1.00 96.83  ? 521 LYS C CA    1 
ATOM   5278 C C     . LYS C 2 26  ? -38.773 31.063  12.981  1.00 109.52 ? 521 LYS C C     1 
ATOM   5279 O O     . LYS C 2 26  ? -39.950 31.227  12.661  1.00 123.08 ? 521 LYS C O     1 
ATOM   5280 C CB    . LYS C 2 26  ? -37.530 32.826  11.694  1.00 101.74 ? 521 LYS C CB    1 
ATOM   5281 C CG    . LYS C 2 26  ? -36.555 33.995  11.711  1.00 107.50 ? 521 LYS C CG    1 
ATOM   5282 C CD    . LYS C 2 26  ? -36.201 34.453  10.305  1.00 107.44 ? 521 LYS C CD    1 
ATOM   5283 C CE    . LYS C 2 26  ? -35.170 35.571  10.337  1.00 93.06  ? 521 LYS C CE    1 
ATOM   5284 N NZ    . LYS C 2 26  ? -34.765 35.996  8.969   1.00 78.62  ? 521 LYS C NZ    1 
ATOM   5285 N N     . GLU C 2 27  ? -38.258 29.873  13.269  1.00 104.12 ? 522 GLU C N     1 
ATOM   5286 C CA    . GLU C 2 27  ? -39.045 28.648  13.213  1.00 98.31  ? 522 GLU C CA    1 
ATOM   5287 C C     . GLU C 2 27  ? -39.812 28.425  14.514  1.00 90.29  ? 522 GLU C C     1 
ATOM   5288 O O     . GLU C 2 27  ? -40.899 27.850  14.515  1.00 86.84  ? 522 GLU C O     1 
ATOM   5289 C CB    . GLU C 2 27  ? -38.125 27.461  12.937  1.00 101.11 ? 522 GLU C CB    1 
ATOM   5290 C CG    . GLU C 2 27  ? -37.231 27.655  11.724  1.00 100.52 ? 522 GLU C CG    1 
ATOM   5291 C CD    . GLU C 2 27  ? -35.893 26.957  11.867  1.00 101.89 ? 522 GLU C CD    1 
ATOM   5292 O OE1   . GLU C 2 27  ? -35.271 26.647  10.830  1.00 106.94 ? 522 GLU C OE1   1 
ATOM   5293 O OE2   . GLU C 2 27  ? -35.463 26.721  13.017  1.00 98.81  ? 522 GLU C OE2   1 
ATOM   5294 N N     . ASP C 2 28  ? -39.235 28.885  15.619  1.00 89.92  ? 523 ASP C N     1 
ATOM   5295 C CA    . ASP C 2 28  ? -39.850 28.733  16.933  1.00 88.99  ? 523 ASP C CA    1 
ATOM   5296 C C     . ASP C 2 28  ? -40.875 29.833  17.196  1.00 84.20  ? 523 ASP C C     1 
ATOM   5297 O O     . ASP C 2 28  ? -41.568 29.817  18.213  1.00 81.98  ? 523 ASP C O     1 
ATOM   5298 C CB    . ASP C 2 28  ? -38.780 28.758  18.028  1.00 97.91  ? 523 ASP C CB    1 
ATOM   5299 C CG    . ASP C 2 28  ? -37.715 27.695  17.832  1.00 108.41 ? 523 ASP C CG    1 
ATOM   5300 O OD1   . ASP C 2 28  ? -37.929 26.778  17.010  1.00 108.91 ? 523 ASP C OD1   1 
ATOM   5301 O OD2   . ASP C 2 28  ? -36.664 27.775  18.503  1.00 110.56 ? 523 ASP C OD2   1 
ATOM   5302 N N     . LEU C 2 29  ? -40.967 30.785  16.273  1.00 83.37  ? 524 LEU C N     1 
ATOM   5303 C CA    . LEU C 2 29  ? -41.833 31.946  16.454  1.00 75.51  ? 524 LEU C CA    1 
ATOM   5304 C C     . LEU C 2 29  ? -43.121 31.850  15.643  1.00 79.26  ? 524 LEU C C     1 
ATOM   5305 O O     . LEU C 2 29  ? -43.892 32.809  15.570  1.00 76.06  ? 524 LEU C O     1 
ATOM   5306 C CB    . LEU C 2 29  ? -41.080 33.228  16.095  1.00 68.12  ? 524 LEU C CB    1 
ATOM   5307 C CG    . LEU C 2 29  ? -39.846 33.524  16.948  1.00 78.68  ? 524 LEU C CG    1 
ATOM   5308 C CD1   . LEU C 2 29  ? -39.051 34.683  16.366  1.00 90.76  ? 524 LEU C CD1   1 
ATOM   5309 C CD2   . LEU C 2 29  ? -40.244 33.807  18.389  1.00 75.23  ? 524 LEU C CD2   1 
ATOM   5310 N N     . VAL C 2 30  ? -43.353 30.692  15.034  1.00 76.73  ? 525 VAL C N     1 
ATOM   5311 C CA    . VAL C 2 30  ? -44.568 30.472  14.261  1.00 71.28  ? 525 VAL C CA    1 
ATOM   5312 C C     . VAL C 2 30  ? -45.782 30.332  15.178  1.00 62.78  ? 525 VAL C C     1 
ATOM   5313 O O     . VAL C 2 30  ? -45.813 29.471  16.057  1.00 70.46  ? 525 VAL C O     1 
ATOM   5314 C CB    . VAL C 2 30  ? -44.446 29.230  13.353  1.00 79.35  ? 525 VAL C CB    1 
ATOM   5315 C CG1   . VAL C 2 30  ? -43.436 29.484  12.245  1.00 79.47  ? 525 VAL C CG1   1 
ATOM   5316 C CG2   . VAL C 2 30  ? -44.054 28.006  14.169  1.00 86.16  ? 525 VAL C CG2   1 
ATOM   5317 N N     . LEU C 2 31  ? -46.776 31.190  14.971  1.00 55.53  ? 526 LEU C N     1 
ATOM   5318 C CA    . LEU C 2 31  ? -47.979 31.186  15.798  1.00 58.09  ? 526 LEU C CA    1 
ATOM   5319 C C     . LEU C 2 31  ? -48.713 29.851  15.690  1.00 66.25  ? 526 LEU C C     1 
ATOM   5320 O O     . LEU C 2 31  ? -49.033 29.403  14.590  1.00 70.74  ? 526 LEU C O     1 
ATOM   5321 C CB    . LEU C 2 31  ? -48.907 32.337  15.393  1.00 58.37  ? 526 LEU C CB    1 
ATOM   5322 C CG    . LEU C 2 31  ? -50.117 32.630  16.285  1.00 63.30  ? 526 LEU C CG    1 
ATOM   5323 C CD1   . LEU C 2 31  ? -49.673 33.076  17.668  1.00 66.31  ? 526 LEU C CD1   1 
ATOM   5324 C CD2   . LEU C 2 31  ? -51.016 33.683  15.655  1.00 53.26  ? 526 LEU C CD2   1 
ATOM   5325 N N     . PRO C 2 32  ? -48.979 29.208  16.839  1.00 65.83  ? 527 PRO C N     1 
ATOM   5326 C CA    . PRO C 2 32  ? -49.694 27.928  16.867  1.00 73.45  ? 527 PRO C CA    1 
ATOM   5327 C C     . PRO C 2 32  ? -51.042 28.020  16.157  1.00 86.92  ? 527 PRO C C     1 
ATOM   5328 O O     . PRO C 2 32  ? -51.624 29.102  16.075  1.00 89.66  ? 527 PRO C O     1 
ATOM   5329 C CB    . PRO C 2 32  ? -49.887 27.659  18.367  1.00 61.77  ? 527 PRO C CB    1 
ATOM   5330 C CG    . PRO C 2 32  ? -49.634 28.969  19.045  1.00 50.72  ? 527 PRO C CG    1 
ATOM   5331 C CD    . PRO C 2 32  ? -48.635 29.674  18.192  1.00 57.57  ? 527 PRO C CD    1 
ATOM   5332 N N     . GLU C 2 33  ? -51.526 26.888  15.654  1.00 89.06  ? 528 GLU C N     1 
ATOM   5333 C CA    . GLU C 2 33  ? -52.719 26.861  14.811  1.00 89.56  ? 528 GLU C CA    1 
ATOM   5334 C C     . GLU C 2 33  ? -53.959 27.457  15.477  1.00 91.73  ? 528 GLU C C     1 
ATOM   5335 O O     . GLU C 2 33  ? -54.745 28.144  14.826  1.00 103.17 ? 528 GLU C O     1 
ATOM   5336 C CB    . GLU C 2 33  ? -53.013 25.433  14.344  1.00 90.96  ? 528 GLU C CB    1 
ATOM   5337 C CG    . GLU C 2 33  ? -54.144 25.332  13.334  1.00 94.51  ? 528 GLU C CG    1 
ATOM   5338 C CD    . GLU C 2 33  ? -54.407 23.905  12.895  1.00 111.89 ? 528 GLU C CD    1 
ATOM   5339 O OE1   . GLU C 2 33  ? -53.924 22.975  13.574  1.00 117.09 ? 528 GLU C OE1   1 
ATOM   5340 O OE2   . GLU C 2 33  ? -55.100 23.714  11.873  1.00 117.74 ? 528 GLU C OE2   1 
ATOM   5341 N N     . PHE C 2 34  ? -54.134 27.196  16.768  1.00 82.34  ? 529 PHE C N     1 
ATOM   5342 C CA    . PHE C 2 34  ? -55.330 27.651  17.470  1.00 85.15  ? 529 PHE C CA    1 
ATOM   5343 C C     . PHE C 2 34  ? -55.342 29.164  17.688  1.00 81.13  ? 529 PHE C C     1 
ATOM   5344 O O     . PHE C 2 34  ? -56.153 29.682  18.456  1.00 74.86  ? 529 PHE C O     1 
ATOM   5345 C CB    . PHE C 2 34  ? -55.500 26.910  18.800  1.00 101.25 ? 529 PHE C CB    1 
ATOM   5346 C CG    . PHE C 2 34  ? -54.446 27.235  19.818  1.00 118.51 ? 529 PHE C CG    1 
ATOM   5347 C CD1   . PHE C 2 34  ? -53.198 26.639  19.758  1.00 129.07 ? 529 PHE C CD1   1 
ATOM   5348 C CD2   . PHE C 2 34  ? -54.708 28.128  20.844  1.00 119.56 ? 529 PHE C CD2   1 
ATOM   5349 C CE1   . PHE C 2 34  ? -52.228 26.934  20.698  1.00 133.13 ? 529 PHE C CE1   1 
ATOM   5350 C CE2   . PHE C 2 34  ? -53.744 28.427  21.787  1.00 120.40 ? 529 PHE C CE2   1 
ATOM   5351 C CZ    . PHE C 2 34  ? -52.502 27.830  21.714  1.00 129.25 ? 529 PHE C CZ    1 
ATOM   5352 N N     . LEU C 2 35  ? -54.442 29.867  17.006  1.00 83.53  ? 530 LEU C N     1 
ATOM   5353 C CA    . LEU C 2 35  ? -54.399 31.324  17.063  1.00 83.06  ? 530 LEU C CA    1 
ATOM   5354 C C     . LEU C 2 35  ? -54.310 31.926  15.662  1.00 82.42  ? 530 LEU C C     1 
ATOM   5355 O O     . LEU C 2 35  ? -55.238 31.805  14.859  1.00 64.83  ? 530 LEU C O     1 
ATOM   5356 C CB    . LEU C 2 35  ? -53.222 31.802  17.920  1.00 77.74  ? 530 LEU C CB    1 
ATOM   5357 C CG    . LEU C 2 35  ? -53.263 31.460  19.412  1.00 77.30  ? 530 LEU C CG    1 
ATOM   5358 C CD1   . LEU C 2 35  ? -52.009 31.956  20.120  1.00 64.80  ? 530 LEU C CD1   1 
ATOM   5359 C CD2   . LEU C 2 35  ? -54.508 32.039  20.062  1.00 81.29  ? 530 LEU C CD2   1 
ATOM   5360 N N     . GLU D 2 3   ? -1.106  36.167  18.949  1.00 116.79 ? 498 GLU D N     1 
ATOM   5361 C CA    . GLU D 2 3   ? -2.117  36.640  19.888  1.00 123.87 ? 498 GLU D CA    1 
ATOM   5362 C C     . GLU D 2 3   ? -1.834  38.067  20.343  1.00 125.39 ? 498 GLU D C     1 
ATOM   5363 O O     . GLU D 2 3   ? -2.639  38.675  21.049  1.00 121.53 ? 498 GLU D O     1 
ATOM   5364 C CB    . GLU D 2 3   ? -2.200  35.712  21.101  1.00 131.01 ? 498 GLU D CB    1 
ATOM   5365 C CG    . GLU D 2 3   ? -2.612  34.288  20.769  1.00 136.51 ? 498 GLU D CG    1 
ATOM   5366 C CD    . GLU D 2 3   ? -2.727  33.414  22.002  1.00 141.28 ? 498 GLU D CD    1 
ATOM   5367 O OE1   . GLU D 2 3   ? -2.442  33.909  23.113  1.00 146.84 ? 498 GLU D OE1   1 
ATOM   5368 O OE2   . GLU D 2 3   ? -3.103  32.231  21.860  1.00 138.57 ? 498 GLU D OE2   1 
ATOM   5369 N N     . GLY D 2 4   ? -0.685  38.597  19.934  1.00 124.73 ? 499 GLY D N     1 
ATOM   5370 C CA    . GLY D 2 4   ? -0.298  39.950  20.291  1.00 119.32 ? 499 GLY D CA    1 
ATOM   5371 C C     . GLY D 2 4   ? -1.172  40.996  19.626  1.00 118.80 ? 499 GLY D C     1 
ATOM   5372 O O     . GLY D 2 4   ? -1.088  42.182  19.945  1.00 111.89 ? 499 GLY D O     1 
ATOM   5373 N N     . LEU D 2 5   ? -2.014  40.553  18.698  1.00 126.74 ? 500 LEU D N     1 
ATOM   5374 C CA    . LEU D 2 5   ? -2.912  41.452  17.983  1.00 124.32 ? 500 LEU D CA    1 
ATOM   5375 C C     . LEU D 2 5   ? -4.332  41.350  18.529  1.00 103.07 ? 500 LEU D C     1 
ATOM   5376 O O     . LEU D 2 5   ? -5.133  42.272  18.379  1.00 98.60  ? 500 LEU D O     1 
ATOM   5377 C CB    . LEU D 2 5   ? -2.901  41.142  16.485  1.00 136.77 ? 500 LEU D CB    1 
ATOM   5378 C CG    . LEU D 2 5   ? -1.522  41.046  15.829  1.00 145.83 ? 500 LEU D CG    1 
ATOM   5379 C CD1   . LEU D 2 5   ? -1.657  40.801  14.335  1.00 145.94 ? 500 LEU D CD1   1 
ATOM   5380 C CD2   . LEU D 2 5   ? -0.704  42.300  16.098  1.00 146.61 ? 500 LEU D CD2   1 
ATOM   5381 N N     . VAL D 2 6   ? -4.636  40.221  19.160  1.00 90.88  ? 501 VAL D N     1 
ATOM   5382 C CA    . VAL D 2 6   ? -5.935  40.019  19.786  1.00 88.90  ? 501 VAL D CA    1 
ATOM   5383 C C     . VAL D 2 6   ? -6.025  40.864  21.049  1.00 90.70  ? 501 VAL D C     1 
ATOM   5384 O O     . VAL D 2 6   ? -7.114  41.216  21.504  1.00 85.92  ? 501 VAL D O     1 
ATOM   5385 C CB    . VAL D 2 6   ? -6.157  38.542  20.152  1.00 89.79  ? 501 VAL D CB    1 
ATOM   5386 C CG1   . VAL D 2 6   ? -7.553  38.339  20.724  1.00 87.56  ? 501 VAL D CG1   1 
ATOM   5387 C CG2   . VAL D 2 6   ? -5.942  37.659  18.934  1.00 90.49  ? 501 VAL D CG2   1 
ATOM   5388 N N     . GLU D 2 7   ? -4.864  41.185  21.607  1.00 97.17  ? 502 GLU D N     1 
ATOM   5389 C CA    . GLU D 2 7   ? -4.784  42.001  22.810  1.00 103.50 ? 502 GLU D CA    1 
ATOM   5390 C C     . GLU D 2 7   ? -5.331  43.401  22.550  1.00 96.49  ? 502 GLU D C     1 
ATOM   5391 O O     . GLU D 2 7   ? -6.001  43.986  23.402  1.00 89.97  ? 502 GLU D O     1 
ATOM   5392 C CB    . GLU D 2 7   ? -3.334  42.082  23.289  1.00 112.41 ? 502 GLU D CB    1 
ATOM   5393 C CG    . GLU D 2 7   ? -2.667  40.725  23.449  1.00 125.44 ? 502 GLU D CG    1 
ATOM   5394 C CD    . GLU D 2 7   ? -1.180  40.833  23.723  1.00 140.95 ? 502 GLU D CD    1 
ATOM   5395 O OE1   . GLU D 2 7   ? -0.666  41.969  23.789  1.00 149.20 ? 502 GLU D OE1   1 
ATOM   5396 O OE2   . GLU D 2 7   ? -0.524  39.780  23.872  1.00 142.01 ? 502 GLU D OE2   1 
ATOM   5397 N N     . LEU D 2 8   ? -5.044  43.930  21.365  1.00 93.90  ? 503 LEU D N     1 
ATOM   5398 C CA    . LEU D 2 8   ? -5.477  45.273  20.994  1.00 88.12  ? 503 LEU D CA    1 
ATOM   5399 C C     . LEU D 2 8   ? -6.977  45.327  20.717  1.00 90.85  ? 503 LEU D C     1 
ATOM   5400 O O     . LEU D 2 8   ? -7.648  46.293  21.080  1.00 98.38  ? 503 LEU D O     1 
ATOM   5401 C CB    . LEU D 2 8   ? -4.698  45.767  19.773  1.00 81.96  ? 503 LEU D CB    1 
ATOM   5402 C CG    . LEU D 2 8   ? -3.177  45.831  19.925  1.00 85.73  ? 503 LEU D CG    1 
ATOM   5403 C CD1   . LEU D 2 8   ? -2.517  46.238  18.616  1.00 83.51  ? 503 LEU D CD1   1 
ATOM   5404 C CD2   . LEU D 2 8   ? -2.789  46.784  21.044  1.00 92.17  ? 503 LEU D CD2   1 
ATOM   5405 N N     . LEU D 2 9   ? -7.497  44.285  20.077  1.00 85.28  ? 504 LEU D N     1 
ATOM   5406 C CA    . LEU D 2 9   ? -8.911  44.230  19.717  1.00 89.63  ? 504 LEU D CA    1 
ATOM   5407 C C     . LEU D 2 9   ? -9.832  44.334  20.930  1.00 91.80  ? 504 LEU D C     1 
ATOM   5408 O O     . LEU D 2 9   ? -10.962 44.810  20.821  1.00 93.59  ? 504 LEU D O     1 
ATOM   5409 C CB    . LEU D 2 9   ? -9.213  42.949  18.935  1.00 96.47  ? 504 LEU D CB    1 
ATOM   5410 C CG    . LEU D 2 9   ? -8.668  42.886  17.506  1.00 90.03  ? 504 LEU D CG    1 
ATOM   5411 C CD1   . LEU D 2 9   ? -8.784  41.480  16.940  1.00 88.62  ? 504 LEU D CD1   1 
ATOM   5412 C CD2   . LEU D 2 9   ? -9.389  43.888  16.618  1.00 85.13  ? 504 LEU D CD2   1 
ATOM   5413 N N     . ASN D 2 10  ? -9.347  43.887  22.084  1.00 94.26  ? 505 ASN D N     1 
ATOM   5414 C CA    . ASN D 2 10  ? -10.140 43.927  23.308  1.00 95.18  ? 505 ASN D CA    1 
ATOM   5415 C C     . ASN D 2 10  ? -10.187 45.316  23.937  1.00 94.53  ? 505 ASN D C     1 
ATOM   5416 O O     . ASN D 2 10  ? -11.205 45.713  24.506  1.00 94.51  ? 505 ASN D O     1 
ATOM   5417 C CB    . ASN D 2 10  ? -9.619  42.905  24.322  1.00 95.77  ? 505 ASN D CB    1 
ATOM   5418 C CG    . ASN D 2 10  ? -9.844  41.473  23.875  1.00 90.71  ? 505 ASN D CG    1 
ATOM   5419 O OD1   . ASN D 2 10  ? -10.454 41.223  22.835  1.00 96.57  ? 505 ASN D OD1   1 
ATOM   5420 N ND2   . ASN D 2 10  ? -9.355  40.523  24.664  1.00 75.61  ? 505 ASN D ND2   1 
ATOM   5421 N N     . ARG D 2 11  ? -9.086  46.053  23.830  1.00 92.56  ? 506 ARG D N     1 
ATOM   5422 C CA    . ARG D 2 11  ? -8.996  47.380  24.432  1.00 98.76  ? 506 ARG D CA    1 
ATOM   5423 C C     . ARG D 2 11  ? -9.447  48.484  23.479  1.00 98.20  ? 506 ARG D C     1 
ATOM   5424 O O     . ARG D 2 11  ? -9.864  49.557  23.915  1.00 98.22  ? 506 ARG D O     1 
ATOM   5425 C CB    . ARG D 2 11  ? -7.574  47.657  24.923  1.00 103.97 ? 506 ARG D CB    1 
ATOM   5426 C CG    . ARG D 2 11  ? -6.516  47.615  23.835  1.00 111.54 ? 506 ARG D CG    1 
ATOM   5427 C CD    . ARG D 2 11  ? -5.151  47.978  24.394  1.00 115.92 ? 506 ARG D CD    1 
ATOM   5428 N NE    . ARG D 2 11  ? -4.788  47.134  25.529  1.00 114.26 ? 506 ARG D NE    1 
ATOM   5429 C CZ    . ARG D 2 11  ? -4.073  46.018  25.432  1.00 107.01 ? 506 ARG D CZ    1 
ATOM   5430 N NH1   . ARG D 2 11  ? -3.637  45.607  24.249  1.00 112.72 ? 506 ARG D NH1   1 
ATOM   5431 N NH2   . ARG D 2 11  ? -3.792  45.312  26.519  1.00 95.35  ? 506 ARG D NH2   1 
ATOM   5432 N N     . VAL D 2 12  ? -9.359  48.222  22.180  1.00 97.70  ? 507 VAL D N     1 
ATOM   5433 C CA    . VAL D 2 12  ? -9.789  49.193  21.181  1.00 100.18 ? 507 VAL D CA    1 
ATOM   5434 C C     . VAL D 2 12  ? -11.301 49.130  20.980  1.00 93.19  ? 507 VAL D C     1 
ATOM   5435 O O     . VAL D 2 12  ? -11.952 50.155  20.775  1.00 88.39  ? 507 VAL D O     1 
ATOM   5436 C CB    . VAL D 2 12  ? -9.072  48.980  19.832  1.00 108.85 ? 507 VAL D CB    1 
ATOM   5437 C CG1   . VAL D 2 12  ? -9.633  49.920  18.778  1.00 113.82 ? 507 VAL D CG1   1 
ATOM   5438 C CG2   . VAL D 2 12  ? -7.574  49.187  19.990  1.00 104.04 ? 507 VAL D CG2   1 
ATOM   5439 N N     . GLN D 2 13  ? -11.855 47.923  21.046  1.00 93.36  ? 508 GLN D N     1 
ATOM   5440 C CA    . GLN D 2 13  ? -13.297 47.733  20.921  1.00 99.64  ? 508 GLN D CA    1 
ATOM   5441 C C     . GLN D 2 13  ? -13.938 47.475  22.282  1.00 107.52 ? 508 GLN D C     1 
ATOM   5442 O O     . GLN D 2 13  ? -14.568 46.440  22.495  1.00 113.02 ? 508 GLN D O     1 
ATOM   5443 C CB    . GLN D 2 13  ? -13.613 46.578  19.969  1.00 99.37  ? 508 GLN D CB    1 
ATOM   5444 C CG    . GLN D 2 13  ? -13.049 46.750  18.570  1.00 105.19 ? 508 GLN D CG    1 
ATOM   5445 C CD    . GLN D 2 13  ? -13.593 45.726  17.592  1.00 105.50 ? 508 GLN D CD    1 
ATOM   5446 O OE1   . GLN D 2 13  ? -14.480 44.941  17.926  1.00 109.55 ? 508 GLN D OE1   1 
ATOM   5447 N NE2   . GLN D 2 13  ? -13.065 45.733  16.373  1.00 96.44  ? 508 GLN D NE2   1 
ATOM   5448 N N     . SER D 2 14  ? -13.773 48.425  23.197  1.00 105.40 ? 509 SER D N     1 
ATOM   5449 C CA    . SER D 2 14  ? -14.329 48.306  24.538  1.00 110.45 ? 509 SER D CA    1 
ATOM   5450 C C     . SER D 2 14  ? -15.827 48.599  24.544  1.00 110.82 ? 509 SER D C     1 
ATOM   5451 O O     . SER D 2 14  ? -16.334 49.291  25.432  1.00 105.39 ? 509 SER D O     1 
ATOM   5452 C CB    . SER D 2 14  ? -13.606 49.253  25.497  1.00 119.16 ? 509 SER D CB    1 
ATOM   5453 O OG    . SER D 2 14  ? -13.729 50.598  25.073  1.00 123.87 ? 509 SER D OG    1 
ATOM   5454 N N     . ASP D 2 19  ? -21.593 55.084  29.800  1.00 95.10  ? 514 ASP D N     1 
ATOM   5455 C CA    . ASP D 2 19  ? -22.167 54.190  28.799  1.00 110.00 ? 514 ASP D CA    1 
ATOM   5456 C C     . ASP D 2 19  ? -23.526 54.710  28.339  1.00 113.19 ? 514 ASP D C     1 
ATOM   5457 O O     . ASP D 2 19  ? -24.478 54.757  29.119  1.00 114.74 ? 514 ASP D O     1 
ATOM   5458 C CB    . ASP D 2 19  ? -22.298 52.772  29.359  1.00 113.34 ? 514 ASP D CB    1 
ATOM   5459 C CG    . ASP D 2 19  ? -20.968 52.200  29.819  1.00 117.06 ? 514 ASP D CG    1 
ATOM   5460 O OD1   . ASP D 2 19  ? -19.974 52.956  29.866  1.00 118.07 ? 514 ASP D OD1   1 
ATOM   5461 O OD2   . ASP D 2 19  ? -20.917 50.993  30.136  1.00 115.23 ? 514 ASP D OD2   1 
ATOM   5462 N N     . GLN D 2 20  ? -23.611 55.095  27.068  1.00 96.53  ? 515 GLN D N     1 
ATOM   5463 C CA    . GLN D 2 20  ? -24.809 55.750  26.548  1.00 70.65  ? 515 GLN D CA    1 
ATOM   5464 C C     . GLN D 2 20  ? -25.569 54.909  25.532  1.00 56.74  ? 515 GLN D C     1 
ATOM   5465 O O     . GLN D 2 20  ? -25.979 55.420  24.490  1.00 54.69  ? 515 GLN D O     1 
ATOM   5466 C CB    . GLN D 2 20  ? -24.449 57.091  25.908  1.00 63.41  ? 515 GLN D CB    1 
ATOM   5467 C CG    . GLN D 2 20  ? -23.697 58.040  26.817  1.00 69.24  ? 515 GLN D CG    1 
ATOM   5468 C CD    . GLN D 2 20  ? -23.318 59.326  26.116  1.00 64.38  ? 515 GLN D CD    1 
ATOM   5469 O OE1   . GLN D 2 20  ? -24.064 59.836  25.282  1.00 70.34  ? 515 GLN D OE1   1 
ATOM   5470 N NE2   . GLN D 2 20  ? -22.152 59.858  26.452  1.00 56.05  ? 515 GLN D NE2   1 
ATOM   5471 N N     . ARG D 2 21  ? -25.761 53.629  25.826  1.00 52.27  ? 516 ARG D N     1 
ATOM   5472 C CA    . ARG D 2 21  ? -26.561 52.780  24.949  1.00 55.71  ? 516 ARG D CA    1 
ATOM   5473 C C     . ARG D 2 21  ? -27.315 51.686  25.701  1.00 54.68  ? 516 ARG D C     1 
ATOM   5474 O O     . ARG D 2 21  ? -26.957 51.326  26.822  1.00 51.28  ? 516 ARG D O     1 
ATOM   5475 C CB    . ARG D 2 21  ? -25.711 52.201  23.813  1.00 60.63  ? 516 ARG D CB    1 
ATOM   5476 C CG    . ARG D 2 21  ? -24.403 51.564  24.241  1.00 71.82  ? 516 ARG D CG    1 
ATOM   5477 C CD    . ARG D 2 21  ? -23.426 51.538  23.072  1.00 76.31  ? 516 ARG D CD    1 
ATOM   5478 N NE    . ARG D 2 21  ? -24.072 51.106  21.834  1.00 73.59  ? 516 ARG D NE    1 
ATOM   5479 C CZ    . ARG D 2 21  ? -23.520 51.198  20.628  1.00 62.62  ? 516 ARG D CZ    1 
ATOM   5480 N NH1   . ARG D 2 21  ? -22.306 51.711  20.490  1.00 51.91  ? 516 ARG D NH1   1 
ATOM   5481 N NH2   . ARG D 2 21  ? -24.183 50.779  19.559  1.00 67.70  ? 516 ARG D NH2   1 
ATOM   5482 N N     . GLY D 2 22  ? -28.369 51.172  25.075  1.00 56.76  ? 517 GLY D N     1 
ATOM   5483 C CA    . GLY D 2 22  ? -29.244 50.205  25.709  1.00 58.83  ? 517 GLY D CA    1 
ATOM   5484 C C     . GLY D 2 22  ? -30.402 50.900  26.398  1.00 59.23  ? 517 GLY D C     1 
ATOM   5485 O O     . GLY D 2 22  ? -30.525 52.124  26.337  1.00 61.03  ? 517 GLY D O     1 
ATOM   5486 N N     . LEU D 2 23  ? -31.260 50.123  27.051  1.00 57.13  ? 518 LEU D N     1 
ATOM   5487 C CA    . LEU D 2 23  ? -32.371 50.695  27.800  1.00 54.95  ? 518 LEU D CA    1 
ATOM   5488 C C     . LEU D 2 23  ? -31.853 51.485  28.995  1.00 73.00  ? 518 LEU D C     1 
ATOM   5489 O O     . LEU D 2 23  ? -30.768 51.212  29.512  1.00 74.92  ? 518 LEU D O     1 
ATOM   5490 C CB    . LEU D 2 23  ? -33.340 49.604  28.260  1.00 46.07  ? 518 LEU D CB    1 
ATOM   5491 C CG    . LEU D 2 23  ? -34.188 48.946  27.169  1.00 40.22  ? 518 LEU D CG    1 
ATOM   5492 C CD1   . LEU D 2 23  ? -35.047 47.837  27.753  1.00 36.88  ? 518 LEU D CD1   1 
ATOM   5493 C CD2   . LEU D 2 23  ? -35.053 49.979  26.463  1.00 29.84  ? 518 LEU D CD2   1 
ATOM   5494 N N     . LEU D 2 24  ? -32.634 52.468  29.429  1.00 80.05  ? 519 LEU D N     1 
ATOM   5495 C CA    . LEU D 2 24  ? -32.235 53.332  30.530  1.00 68.44  ? 519 LEU D CA    1 
ATOM   5496 C C     . LEU D 2 24  ? -32.065 52.540  31.823  1.00 77.15  ? 519 LEU D C     1 
ATOM   5497 O O     . LEU D 2 24  ? -33.030 51.998  32.361  1.00 87.26  ? 519 LEU D O     1 
ATOM   5498 C CB    . LEU D 2 24  ? -33.261 54.450  30.726  1.00 45.15  ? 519 LEU D CB    1 
ATOM   5499 C CG    . LEU D 2 24  ? -32.818 55.631  31.589  1.00 45.47  ? 519 LEU D CG    1 
ATOM   5500 C CD1   . LEU D 2 24  ? -31.584 56.287  30.994  1.00 50.71  ? 519 LEU D CD1   1 
ATOM   5501 C CD2   . LEU D 2 24  ? -33.945 56.639  31.733  1.00 62.07  ? 519 LEU D CD2   1 
ATOM   5502 N N     . ARG D 2 25  ? -30.831 52.471  32.313  1.00 75.68  ? 520 ARG D N     1 
ATOM   5503 C CA    . ARG D 2 25  ? -30.543 51.783  33.566  1.00 66.67  ? 520 ARG D CA    1 
ATOM   5504 C C     . ARG D 2 25  ? -30.645 52.748  34.742  1.00 65.00  ? 520 ARG D C     1 
ATOM   5505 O O     . ARG D 2 25  ? -30.178 53.883  34.662  1.00 65.47  ? 520 ARG D O     1 
ATOM   5506 C CB    . ARG D 2 25  ? -29.150 51.151  33.523  1.00 70.23  ? 520 ARG D CB    1 
ATOM   5507 C CG    . ARG D 2 25  ? -28.971 50.107  32.431  1.00 86.25  ? 520 ARG D CG    1 
ATOM   5508 C CD    . ARG D 2 25  ? -27.614 49.425  32.530  1.00 103.12 ? 520 ARG D CD    1 
ATOM   5509 N NE    . ARG D 2 25  ? -27.481 48.332  31.569  1.00 122.64 ? 520 ARG D NE    1 
ATOM   5510 C CZ    . ARG D 2 25  ? -26.443 47.503  31.517  1.00 129.35 ? 520 ARG D CZ    1 
ATOM   5511 N NH1   . ARG D 2 25  ? -25.441 47.635  32.375  1.00 130.74 ? 520 ARG D NH1   1 
ATOM   5512 N NH2   . ARG D 2 25  ? -26.408 46.537  30.609  1.00 127.99 ? 520 ARG D NH2   1 
ATOM   5513 N N     . LYS D 2 26  ? -31.259 52.296  35.832  1.00 78.21  ? 521 LYS D N     1 
ATOM   5514 C CA    . LYS D 2 26  ? -31.402 53.122  37.028  1.00 86.43  ? 521 LYS D CA    1 
ATOM   5515 C C     . LYS D 2 26  ? -30.037 53.502  37.590  1.00 77.13  ? 521 LYS D C     1 
ATOM   5516 O O     . LYS D 2 26  ? -29.915 54.420  38.401  1.00 68.71  ? 521 LYS D O     1 
ATOM   5517 C CB    . LYS D 2 26  ? -32.234 52.396  38.087  1.00 99.35  ? 521 LYS D CB    1 
ATOM   5518 C CG    . LYS D 2 26  ? -33.647 52.063  37.635  1.00 118.97 ? 521 LYS D CG    1 
ATOM   5519 C CD    . LYS D 2 26  ? -34.424 51.329  38.714  1.00 131.90 ? 521 LYS D CD    1 
ATOM   5520 C CE    . LYS D 2 26  ? -35.826 50.978  38.239  1.00 138.40 ? 521 LYS D CE    1 
ATOM   5521 N NZ    . LYS D 2 26  ? -36.604 50.249  39.280  1.00 143.41 ? 521 LYS D NZ    1 
ATOM   5522 N N     . GLU D 2 27  ? -29.012 52.783  37.147  1.00 76.85  ? 522 GLU D N     1 
ATOM   5523 C CA    . GLU D 2 27  ? -27.640 53.060  37.544  1.00 79.26  ? 522 GLU D CA    1 
ATOM   5524 C C     . GLU D 2 27  ? -27.141 54.330  36.862  1.00 77.33  ? 522 GLU D C     1 
ATOM   5525 O O     . GLU D 2 27  ? -26.176 54.950  37.310  1.00 77.30  ? 522 GLU D O     1 
ATOM   5526 C CB    . GLU D 2 27  ? -26.744 51.880  37.167  1.00 90.91  ? 522 GLU D CB    1 
ATOM   5527 C CG    . GLU D 2 27  ? -27.230 50.541  37.705  1.00 102.58 ? 522 GLU D CG    1 
ATOM   5528 C CD    . GLU D 2 27  ? -26.606 49.359  36.986  1.00 111.05 ? 522 GLU D CD    1 
ATOM   5529 O OE1   . GLU D 2 27  ? -26.173 49.525  35.826  1.00 110.14 ? 522 GLU D OE1   1 
ATOM   5530 O OE2   . GLU D 2 27  ? -26.556 48.260  37.579  1.00 114.86 ? 522 GLU D OE2   1 
ATOM   5531 N N     . ASP D 2 28  ? -27.809 54.710  35.777  1.00 77.35  ? 523 ASP D N     1 
ATOM   5532 C CA    . ASP D 2 28  ? -27.427 55.884  35.001  1.00 74.75  ? 523 ASP D CA    1 
ATOM   5533 C C     . ASP D 2 28  ? -28.215 57.115  35.431  1.00 74.56  ? 523 ASP D C     1 
ATOM   5534 O O     . ASP D 2 28  ? -28.008 58.207  34.905  1.00 75.60  ? 523 ASP D O     1 
ATOM   5535 C CB    . ASP D 2 28  ? -27.657 55.635  33.507  1.00 88.20  ? 523 ASP D CB    1 
ATOM   5536 C CG    . ASP D 2 28  ? -26.903 54.425  32.992  1.00 111.94 ? 523 ASP D CG    1 
ATOM   5537 O OD1   . ASP D 2 28  ? -26.035 53.906  33.724  1.00 128.02 ? 523 ASP D OD1   1 
ATOM   5538 O OD2   . ASP D 2 28  ? -27.180 53.995  31.852  1.00 108.37 ? 523 ASP D OD2   1 
ATOM   5539 N N     . LEU D 2 29  ? -29.121 56.933  36.387  1.00 79.07  ? 524 LEU D N     1 
ATOM   5540 C CA    . LEU D 2 29  ? -30.000 58.012  36.823  1.00 72.44  ? 524 LEU D CA    1 
ATOM   5541 C C     . LEU D 2 29  ? -29.520 58.668  38.114  1.00 68.97  ? 524 LEU D C     1 
ATOM   5542 O O     . LEU D 2 29  ? -30.257 59.422  38.748  1.00 67.56  ? 524 LEU D O     1 
ATOM   5543 C CB    . LEU D 2 29  ? -31.428 57.496  36.995  1.00 71.54  ? 524 LEU D CB    1 
ATOM   5544 C CG    . LEU D 2 29  ? -32.084 56.963  35.721  1.00 71.33  ? 524 LEU D CG    1 
ATOM   5545 C CD1   . LEU D 2 29  ? -33.393 56.262  36.041  1.00 70.97  ? 524 LEU D CD1   1 
ATOM   5546 C CD2   . LEU D 2 29  ? -32.299 58.089  34.720  1.00 68.45  ? 524 LEU D CD2   1 
ATOM   5547 N N     . VAL D 2 30  ? -28.283 58.377  38.498  1.00 65.54  ? 525 VAL D N     1 
ATOM   5548 C CA    . VAL D 2 30  ? -27.705 58.963  39.700  1.00 61.56  ? 525 VAL D CA    1 
ATOM   5549 C C     . VAL D 2 30  ? -27.415 60.445  39.495  1.00 66.36  ? 525 VAL D C     1 
ATOM   5550 O O     . VAL D 2 30  ? -26.560 60.816  38.691  1.00 82.26  ? 525 VAL D O     1 
ATOM   5551 C CB    . VAL D 2 30  ? -26.410 58.248  40.109  1.00 57.00  ? 525 VAL D CB    1 
ATOM   5552 C CG1   . VAL D 2 30  ? -25.746 58.983  41.263  1.00 65.11  ? 525 VAL D CG1   1 
ATOM   5553 C CG2   . VAL D 2 30  ? -26.699 56.800  40.479  1.00 45.70  ? 525 VAL D CG2   1 
ATOM   5554 N N     . LEU D 2 31  ? -28.134 61.287  40.228  1.00 48.91  ? 526 LEU D N     1 
ATOM   5555 C CA    . LEU D 2 31  ? -27.975 62.731  40.115  1.00 47.73  ? 526 LEU D CA    1 
ATOM   5556 C C     . LEU D 2 31  ? -26.528 63.143  40.364  1.00 54.46  ? 526 LEU D C     1 
ATOM   5557 O O     . LEU D 2 31  ? -25.913 62.704  41.335  1.00 49.81  ? 526 LEU D O     1 
ATOM   5558 C CB    . LEU D 2 31  ? -28.898 63.441  41.108  1.00 48.66  ? 526 LEU D CB    1 
ATOM   5559 C CG    . LEU D 2 31  ? -29.030 64.958  40.975  1.00 41.97  ? 526 LEU D CG    1 
ATOM   5560 C CD1   . LEU D 2 31  ? -29.717 65.315  39.673  1.00 45.40  ? 526 LEU D CD1   1 
ATOM   5561 C CD2   . LEU D 2 31  ? -29.802 65.526  42.150  1.00 32.71  ? 526 LEU D CD2   1 
ATOM   5562 N N     . PRO D 2 32  ? -25.977 63.986  39.478  1.00 71.99  ? 527 PRO D N     1 
ATOM   5563 C CA    . PRO D 2 32  ? -24.618 64.510  39.655  1.00 77.96  ? 527 PRO D CA    1 
ATOM   5564 C C     . PRO D 2 32  ? -24.523 65.379  40.905  1.00 68.95  ? 527 PRO D C     1 
ATOM   5565 O O     . PRO D 2 32  ? -25.520 65.975  41.314  1.00 64.11  ? 527 PRO D O     1 
ATOM   5566 C CB    . PRO D 2 32  ? -24.398 65.353  38.394  1.00 75.18  ? 527 PRO D CB    1 
ATOM   5567 C CG    . PRO D 2 32  ? -25.768 65.671  37.896  1.00 65.26  ? 527 PRO D CG    1 
ATOM   5568 C CD    . PRO D 2 32  ? -26.607 64.484  38.245  1.00 68.40  ? 527 PRO D CD    1 
ATOM   5569 N N     . GLU D 2 33  ? -23.337 65.446  41.500  1.00 69.44  ? 528 GLU D N     1 
ATOM   5570 C CA    . GLU D 2 33  ? -23.155 66.140  42.771  1.00 70.38  ? 528 GLU D CA    1 
ATOM   5571 C C     . GLU D 2 33  ? -23.462 67.634  42.703  1.00 56.34  ? 528 GLU D C     1 
ATOM   5572 O O     . GLU D 2 33  ? -24.043 68.196  43.632  1.00 57.16  ? 528 GLU D O     1 
ATOM   5573 C CB    . GLU D 2 33  ? -21.739 65.921  43.308  1.00 85.23  ? 528 GLU D CB    1 
ATOM   5574 C CG    . GLU D 2 33  ? -21.455 64.493  43.736  1.00 98.24  ? 528 GLU D CG    1 
ATOM   5575 C CD    . GLU D 2 33  ? -20.102 64.345  44.399  1.00 107.98 ? 528 GLU D CD    1 
ATOM   5576 O OE1   . GLU D 2 33  ? -19.347 65.339  44.439  1.00 108.17 ? 528 GLU D OE1   1 
ATOM   5577 O OE2   . GLU D 2 33  ? -19.793 63.236  44.882  1.00 115.99 ? 528 GLU D OE2   1 
ATOM   5578 N N     . PHE D 2 34  ? -23.072 68.277  41.609  1.00 43.28  ? 529 PHE D N     1 
ATOM   5579 C CA    . PHE D 2 34  ? -23.252 69.720  41.487  1.00 49.51  ? 529 PHE D CA    1 
ATOM   5580 C C     . PHE D 2 34  ? -24.730 70.099  41.460  1.00 44.04  ? 529 PHE D C     1 
ATOM   5581 O O     . PHE D 2 34  ? -25.078 71.276  41.557  1.00 46.97  ? 529 PHE D O     1 
ATOM   5582 C CB    . PHE D 2 34  ? -22.538 70.259  40.247  1.00 49.99  ? 529 PHE D CB    1 
ATOM   5583 C CG    . PHE D 2 34  ? -23.264 69.990  38.963  1.00 59.67  ? 529 PHE D CG    1 
ATOM   5584 C CD1   . PHE D 2 34  ? -24.002 70.989  38.349  1.00 58.77  ? 529 PHE D CD1   1 
ATOM   5585 C CD2   . PHE D 2 34  ? -23.209 68.741  38.368  1.00 60.79  ? 529 PHE D CD2   1 
ATOM   5586 C CE1   . PHE D 2 34  ? -24.670 70.749  37.165  1.00 52.27  ? 529 PHE D CE1   1 
ATOM   5587 C CE2   . PHE D 2 34  ? -23.876 68.493  37.185  1.00 52.40  ? 529 PHE D CE2   1 
ATOM   5588 C CZ    . PHE D 2 34  ? -24.608 69.499  36.582  1.00 54.15  ? 529 PHE D CZ    1 
ATOM   5589 N N     . LEU D 2 35  ? -25.592 69.096  41.330  1.00 43.25  ? 530 LEU D N     1 
ATOM   5590 C CA    . LEU D 2 35  ? -27.035 69.315  41.350  1.00 43.16  ? 530 LEU D CA    1 
ATOM   5591 C C     . LEU D 2 35  ? -27.656 68.774  42.633  1.00 60.98  ? 530 LEU D C     1 
ATOM   5592 O O     . LEU D 2 35  ? -28.845 68.457  42.670  1.00 68.70  ? 530 LEU D O     1 
ATOM   5593 C CB    . LEU D 2 35  ? -27.701 68.664  40.136  1.00 22.58  ? 530 LEU D CB    1 
ATOM   5594 C CG    . LEU D 2 35  ? -27.416 69.285  38.767  1.00 25.76  ? 530 LEU D CG    1 
ATOM   5595 C CD1   . LEU D 2 35  ? -28.049 68.455  37.658  1.00 30.90  ? 530 LEU D CD1   1 
ATOM   5596 C CD2   . LEU D 2 35  ? -27.906 70.725  38.710  1.00 18.69  ? 530 LEU D CD2   1 
ATOM   5597 N N     . GLN D 2 36  ? -26.846 68.668  43.681  1.00 65.20  ? 531 GLN D N     1 
ATOM   5598 C CA    . GLN D 2 36  ? -27.326 68.185  44.971  1.00 70.69  ? 531 GLN D CA    1 
ATOM   5599 C C     . GLN D 2 36  ? -27.378 69.311  45.996  1.00 69.38  ? 531 GLN D C     1 
ATOM   5600 O O     . GLN D 2 36  ? -28.035 70.329  45.777  1.00 74.48  ? 531 GLN D O     1 
ATOM   5601 C CB    . GLN D 2 36  ? -26.443 67.046  45.484  1.00 76.21  ? 531 GLN D CB    1 
ATOM   5602 C CG    . GLN D 2 36  ? -26.492 65.789  44.632  1.00 75.58  ? 531 GLN D CG    1 
ATOM   5603 C CD    . GLN D 2 36  ? -25.611 64.684  45.176  1.00 80.96  ? 531 GLN D CD    1 
ATOM   5604 O OE1   . GLN D 2 36  ? -24.887 64.877  46.153  1.00 80.24  ? 531 GLN D OE1   1 
ATOM   5605 N NE2   . GLN D 2 36  ? -25.666 63.517  44.545  1.00 91.44  ? 531 GLN D NE2   1 
HETATM 5606 P PB    . GDP E 3 .   ? -28.004 17.097  29.685  1.00 31.49  ? 355 GDP A PB    1 
HETATM 5607 O O1B   . GDP E 3 .   ? -26.902 18.060  29.315  1.00 35.07  ? 355 GDP A O1B   1 
HETATM 5608 O O2B   . GDP E 3 .   ? -28.653 16.557  28.435  1.00 36.46  ? 355 GDP A O2B   1 
HETATM 5609 O O3B   . GDP E 3 .   ? -27.436 15.940  30.468  1.00 25.75  ? 355 GDP A O3B   1 
HETATM 5610 O O3A   . GDP E 3 .   ? -29.104 17.847  30.586  1.00 60.53  ? 355 GDP A O3A   1 
HETATM 5611 P PA    . GDP E 3 .   ? -28.807 19.314  31.171  1.00 29.52  ? 355 GDP A PA    1 
HETATM 5612 O O1A   . GDP E 3 .   ? -28.576 20.292  30.045  1.00 41.10  ? 355 GDP A O1A   1 
HETATM 5613 O O2A   . GDP E 3 .   ? -27.625 19.296  32.107  1.00 17.23  ? 355 GDP A O2A   1 
HETATM 5614 O "O5'" . GDP E 3 .   ? -30.166 19.677  31.950  1.00 34.64  ? 355 GDP A "O5'" 1 
HETATM 5615 C "C5'" . GDP E 3 .   ? -31.154 20.447  31.270  1.00 39.32  ? 355 GDP A "C5'" 1 
HETATM 5616 C "C4'" . GDP E 3 .   ? -31.851 21.387  32.240  1.00 34.83  ? 355 GDP A "C4'" 1 
HETATM 5617 O "O4'" . GDP E 3 .   ? -32.315 20.654  33.370  1.00 35.14  ? 355 GDP A "O4'" 1 
HETATM 5618 C "C3'" . GDP E 3 .   ? -30.884 22.441  32.753  1.00 64.53  ? 355 GDP A "C3'" 1 
HETATM 5619 O "O3'" . GDP E 3 .   ? -31.194 23.713  32.182  1.00 83.99  ? 355 GDP A "O3'" 1 
HETATM 5620 C "C2'" . GDP E 3 .   ? -31.081 22.484  34.252  1.00 68.61  ? 355 GDP A "C2'" 1 
HETATM 5621 O "O2'" . GDP E 3 .   ? -31.559 23.772  34.644  1.00 84.95  ? 355 GDP A "O2'" 1 
HETATM 5622 C "C1'" . GDP E 3 .   ? -32.127 21.425  34.557  1.00 49.99  ? 355 GDP A "C1'" 1 
HETATM 5623 N N9    . GDP E 3 .   ? -31.643 20.560  35.657  1.00 32.82  ? 355 GDP A N9    1 
HETATM 5624 C C8    . GDP E 3 .   ? -30.606 19.704  35.596  1.00 29.25  ? 355 GDP A C8    1 
HETATM 5625 N N7    . GDP E 3 .   ? -30.432 19.065  36.781  1.00 32.56  ? 355 GDP A N7    1 
HETATM 5626 C C5    . GDP E 3 .   ? -31.381 19.514  37.623  1.00 33.46  ? 355 GDP A C5    1 
HETATM 5627 C C6    . GDP E 3 .   ? -31.772 19.257  39.027  1.00 28.73  ? 355 GDP A C6    1 
HETATM 5628 O O6    . GDP E 3 .   ? -31.144 18.433  39.724  1.00 42.92  ? 355 GDP A O6    1 
HETATM 5629 N N1    . GDP E 3 .   ? -32.817 19.934  39.522  1.00 29.77  ? 355 GDP A N1    1 
HETATM 5630 C C2    . GDP E 3 .   ? -33.510 20.827  38.789  1.00 37.80  ? 355 GDP A C2    1 
HETATM 5631 N N2    . GDP E 3 .   ? -34.555 21.471  39.361  1.00 47.27  ? 355 GDP A N2    1 
HETATM 5632 N N3    . GDP E 3 .   ? -33.209 21.113  37.497  1.00 34.12  ? 355 GDP A N3    1 
HETATM 5633 C C4    . GDP E 3 .   ? -32.176 20.498  36.876  1.00 36.42  ? 355 GDP A C4    1 
HETATM 5634 S S     . SO4 F 4 .   ? -14.672 39.072  38.592  1.00 176.28 ? 2   SO4 A S     1 
HETATM 5635 O O1    . SO4 F 4 .   ? -13.474 38.894  37.778  1.00 177.98 ? 2   SO4 A O1    1 
HETATM 5636 O O2    . SO4 F 4 .   ? -15.774 39.517  37.745  1.00 172.47 ? 2   SO4 A O2    1 
HETATM 5637 O O3    . SO4 F 4 .   ? -15.021 37.803  39.225  1.00 176.29 ? 2   SO4 A O3    1 
HETATM 5638 O O4    . SO4 F 4 .   ? -14.416 40.076  39.622  1.00 177.09 ? 2   SO4 A O4    1 
HETATM 5639 C C1    . GOL G 5 .   ? -27.236 14.132  50.752  1.00 59.01  ? 3   GOL A C1    1 
HETATM 5640 O O1    . GOL G 5 .   ? -27.904 15.355  50.531  1.00 48.46  ? 3   GOL A O1    1 
HETATM 5641 C C2    . GOL G 5 .   ? -27.117 13.389  49.426  1.00 52.52  ? 3   GOL A C2    1 
HETATM 5642 O O2    . GOL G 5 .   ? -28.174 12.463  49.328  1.00 44.90  ? 3   GOL A O2    1 
HETATM 5643 C C3    . GOL G 5 .   ? -25.790 12.647  49.331  1.00 52.38  ? 3   GOL A C3    1 
HETATM 5644 O O3    . GOL G 5 .   ? -25.665 12.093  48.044  1.00 51.78  ? 3   GOL A O3    1 
HETATM 5645 P PB    . GDP H 3 .   ? -20.142 50.441  17.163  1.00 49.49  ? 356 GDP B PB    1 
HETATM 5646 O O1B   . GDP H 3 .   ? -20.795 49.231  16.538  1.00 47.63  ? 356 GDP B O1B   1 
HETATM 5647 O O2B   . GDP H 3 .   ? -19.464 50.035  18.450  1.00 71.23  ? 356 GDP B O2B   1 
HETATM 5648 O O3B   . GDP H 3 .   ? -19.122 51.013  16.206  1.00 22.85  ? 356 GDP B O3B   1 
HETATM 5649 O O3A   . GDP H 3 .   ? -21.252 51.558  17.486  1.00 105.21 ? 356 GDP B O3A   1 
HETATM 5650 P PA    . GDP H 3 .   ? -21.946 52.365  16.282  1.00 47.23  ? 356 GDP B PA    1 
HETATM 5651 O O1A   . GDP H 3 .   ? -23.245 51.714  15.881  1.00 44.08  ? 356 GDP B O1A   1 
HETATM 5652 O O2A   . GDP H 3 .   ? -21.014 52.476  15.105  1.00 43.26  ? 356 GDP B O2A   1 
HETATM 5653 O "O5'" . GDP H 3 .   ? -22.223 53.813  16.920  1.00 63.56  ? 356 GDP B "O5'" 1 
HETATM 5654 C "C5'" . GDP H 3 .   ? -21.807 54.979  16.220  1.00 47.41  ? 356 GDP B "C5'" 1 
HETATM 5655 C "C4'" . GDP H 3 .   ? -22.751 56.119  16.555  1.00 48.76  ? 356 GDP B "C4'" 1 
HETATM 5656 O "O4'" . GDP H 3 .   ? -22.440 57.211  15.694  1.00 66.05  ? 356 GDP B "O4'" 1 
HETATM 5657 C "C3'" . GDP H 3 .   ? -24.183 55.711  16.279  1.00 41.78  ? 356 GDP B "C3'" 1 
HETATM 5658 O "O3'" . GDP H 3 .   ? -25.014 56.176  17.344  1.00 46.34  ? 356 GDP B "O3'" 1 
HETATM 5659 C "C2'" . GDP H 3 .   ? -24.561 56.400  14.984  1.00 59.20  ? 356 GDP B "C2'" 1 
HETATM 5660 O "O2'" . GDP H 3 .   ? -25.862 56.984  15.083  1.00 68.34  ? 356 GDP B "O2'" 1 
HETATM 5661 C "C1'" . GDP H 3 .   ? -23.511 57.480  14.786  1.00 62.90  ? 356 GDP B "C1'" 1 
HETATM 5662 N N9    . GDP H 3 .   ? -22.968 57.435  13.408  1.00 52.60  ? 356 GDP B N9    1 
HETATM 5663 C C8    . GDP H 3 .   ? -22.419 56.358  12.814  1.00 49.56  ? 356 GDP B C8    1 
HETATM 5664 N N7    . GDP H 3 .   ? -22.004 56.654  11.555  1.00 43.82  ? 356 GDP B N7    1 
HETATM 5665 C C5    . GDP H 3 .   ? -22.279 57.953  11.337  1.00 38.32  ? 356 GDP B C5    1 
HETATM 5666 C C6    . GDP H 3 .   ? -22.101 58.908  10.221  1.00 44.50  ? 356 GDP B C6    1 
HETATM 5667 O O6    . GDP H 3 .   ? -21.572 58.545  9.149   1.00 52.66  ? 356 GDP B O6    1 
HETATM 5668 N N1    . GDP H 3 .   ? -22.524 60.166  10.398  1.00 38.14  ? 356 GDP B N1    1 
HETATM 5669 C C2    . GDP H 3 .   ? -23.097 60.579  11.545  1.00 40.31  ? 356 GDP B C2    1 
HETATM 5670 N N2    . GDP H 3 .   ? -23.498 61.869  11.645  1.00 53.04  ? 356 GDP B N2    1 
HETATM 5671 N N3    . GDP H 3 .   ? -23.291 59.760  12.608  1.00 34.64  ? 356 GDP B N3    1 
HETATM 5672 C C4    . GDP H 3 .   ? -22.910 58.463  12.562  1.00 39.37  ? 356 GDP B C4    1 
HETATM 5673 S S     . SO4 I 4 .   ? -23.200 79.633  29.313  1.00 164.96 ? 1   SO4 B S     1 
HETATM 5674 O O1    . SO4 I 4 .   ? -22.170 80.246  28.479  1.00 170.54 ? 1   SO4 B O1    1 
HETATM 5675 O O2    . SO4 I 4 .   ? -24.479 79.675  28.610  1.00 167.49 ? 1   SO4 B O2    1 
HETATM 5676 O O3    . SO4 I 4 .   ? -22.838 78.246  29.590  1.00 165.43 ? 1   SO4 B O3    1 
HETATM 5677 O O4    . SO4 I 4 .   ? -23.312 80.367  30.570  1.00 156.75 ? 1   SO4 B O4    1 
HETATM 5678 O O     . HOH J 6 .   ? -42.857 17.857  33.594  1.00 13.51  ? 4   HOH A O     1 
HETATM 5679 O O     . HOH J 6 .   ? -22.717 7.591   13.673  1.00 31.91  ? 6   HOH A O     1 
HETATM 5680 O O     . HOH J 6 .   ? -37.256 12.659  24.115  1.00 41.92  ? 7   HOH A O     1 
HETATM 5681 O O     . HOH J 6 .   ? -30.181 -1.990  45.687  1.00 37.45  ? 8   HOH A O     1 
HETATM 5682 O O     . HOH J 6 .   ? -18.106 0.531   40.130  1.00 39.29  ? 12  HOH A O     1 
HETATM 5683 O O     . HOH J 6 .   ? -18.291 -3.363  33.243  1.00 38.97  ? 14  HOH A O     1 
HETATM 5684 O O     . HOH J 6 .   ? -48.940 16.398  23.436  1.00 35.60  ? 15  HOH A O     1 
HETATM 5685 O O     . HOH J 6 .   ? -32.598 49.185  35.996  1.00 24.75  ? 17  HOH A O     1 
HETATM 5686 O O     . HOH J 6 .   ? -37.384 17.392  27.248  1.00 27.32  ? 19  HOH A O     1 
HETATM 5687 O O     . HOH J 6 .   ? -37.121 4.367   22.826  1.00 35.34  ? 20  HOH A O     1 
HETATM 5688 O O     . HOH J 6 .   ? -19.451 26.123  30.629  1.00 38.38  ? 25  HOH A O     1 
HETATM 5689 O O     . HOH J 6 .   ? -12.339 4.584   41.731  1.00 34.70  ? 356 HOH A O     1 
HETATM 5690 O O     . HOH J 6 .   ? -20.794 1.977   47.580  1.00 49.90  ? 357 HOH A O     1 
HETATM 5691 O O     . HOH J 6 .   ? -19.394 4.461   13.945  1.00 40.49  ? 358 HOH A O     1 
HETATM 5692 O O     . HOH J 6 .   ? -24.608 13.192  23.775  1.00 41.41  ? 359 HOH A O     1 
HETATM 5693 O O     . HOH J 6 .   ? -56.388 41.124  33.375  1.00 31.60  ? 360 HOH A O     1 
HETATM 5694 O O     . HOH J 6 .   ? -24.306 11.740  21.346  1.00 48.71  ? 361 HOH A O     1 
HETATM 5695 O O     . HOH J 6 .   ? -23.874 -3.332  42.518  1.00 46.09  ? 362 HOH A O     1 
HETATM 5696 O O     . HOH J 6 .   ? -23.419 35.060  41.427  1.00 28.22  ? 363 HOH A O     1 
HETATM 5697 O O     . HOH K 6 .   ? -17.255 62.589  22.325  1.00 21.46  ? 2   HOH B O     1 
HETATM 5698 O O     . HOH K 6 .   ? -24.260 78.805  23.397  1.00 28.18  ? 5   HOH B O     1 
HETATM 5699 O O     . HOH K 6 .   ? -12.215 58.593  23.883  1.00 33.89  ? 10  HOH B O     1 
HETATM 5700 O O     . HOH K 6 .   ? -16.087 76.133  31.386  1.00 37.44  ? 11  HOH B O     1 
HETATM 5701 O O     . HOH K 6 .   ? -47.395 52.772  22.364  1.00 33.14  ? 13  HOH B O     1 
HETATM 5702 O O     . HOH K 6 .   ? -16.901 69.261  0.429   1.00 26.17  ? 16  HOH B O     1 
HETATM 5703 O O     . HOH K 6 .   ? -2.827  57.321  0.311   1.00 41.20  ? 18  HOH B O     1 
HETATM 5704 O O     . HOH K 6 .   ? -11.795 67.565  28.430  1.00 31.54  ? 21  HOH B O     1 
HETATM 5705 O O     . HOH K 6 .   ? -20.402 79.869  15.639  1.00 36.38  ? 26  HOH B O     1 
HETATM 5706 O O     . HOH K 6 .   ? -44.932 59.281  24.622  1.00 19.04  ? 355 HOH B O     1 
HETATM 5707 O O     . HOH K 6 .   ? -10.720 44.147  31.299  1.00 38.19  ? 357 HOH B O     1 
HETATM 5708 O O     . HOH K 6 .   ? -15.892 69.156  18.168  1.00 43.94  ? 358 HOH B O     1 
HETATM 5709 O O     . HOH K 6 .   ? -1.013  57.658  -1.790  1.00 41.31  ? 359 HOH B O     1 
HETATM 5710 O O     . HOH L 6 .   ? -32.860 33.516  8.970   1.00 38.45  ? 22  HOH C O     1 
HETATM 5711 O O     . HOH L 6 .   ? -20.002 -0.210  11.440  1.00 45.08  ? 32  HOH C O     1 
HETATM 5712 O O     . HOH M 6 .   ? -37.933 47.785  40.356  1.00 39.43  ? 9   HOH D O     1 
HETATM 5713 O O     . HOH M 6 .   ? -11.058 50.897  25.918  1.00 49.45  ? 30  HOH D O     1 
HETATM 5714 O O     . HOH M 6 .   ? -0.304  38.258  17.198  1.00 48.59  ? 37  HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 4   ? 0.9420 1.2863 1.1267 -0.0486 0.0359  -0.2593 30  GLY A N   
2    C CA  . GLY A 4   ? 1.0688 1.3972 1.2416 -0.0408 0.0298  -0.2435 30  GLY A CA  
3    C C   . GLY A 4   ? 1.1778 1.5093 1.3381 -0.0292 0.0204  -0.2333 30  GLY A C   
4    O O   . GLY A 4   ? 1.1867 1.4999 1.3382 -0.0276 0.0193  -0.2204 30  GLY A O   
5    N N   . ALA A 5   ? 1.3007 1.6564 1.4597 -0.0210 0.0141  -0.2392 31  ALA A N   
6    C CA  . ALA A 5   ? 1.3852 1.7457 1.5322 -0.0091 0.0058  -0.2304 31  ALA A CA  
7    C C   . ALA A 5   ? 1.2817 1.6180 1.4161 -0.0044 0.0028  -0.2126 31  ALA A C   
8    O O   . ALA A 5   ? 1.3062 1.6422 1.4369 -0.0002 0.0001  -0.2096 31  ALA A O   
9    C CB  . ALA A 5   ? 1.4686 1.8322 1.6152 -0.0098 0.0062  -0.2312 31  ALA A CB  
10   N N   . ARG A 6   ? 1.0810 1.3982 1.2089 -0.0056 0.0036  -0.2015 32  ARG A N   
11   C CA  . ARG A 6   ? 0.7344 1.0305 0.8504 -0.0027 0.0017  -0.1854 32  ARG A CA  
12   C C   . ARG A 6   ? 0.6492 0.9222 0.7645 -0.0113 0.0073  -0.1779 32  ARG A C   
13   O O   . ARG A 6   ? 0.4906 0.7620 0.6118 -0.0172 0.0115  -0.1825 32  ARG A O   
14   C CB  . ARG A 6   ? 0.5307 0.8291 0.6356 0.0072  -0.0043 -0.1771 32  ARG A CB  
15   C CG  . ARG A 6   ? 0.8025 1.0812 0.8958 0.0094  -0.0054 -0.1615 32  ARG A CG  
16   C CD  . ARG A 6   ? 1.0049 1.2849 1.0879 0.0184  -0.0101 -0.1538 32  ARG A CD  
17   N NE  . ARG A 6   ? 1.0584 1.3178 1.1297 0.0187  -0.0091 -0.1398 32  ARG A NE  
18   C CZ  . ARG A 6   ? 1.0235 1.2779 1.0842 0.0249  -0.0113 -0.1312 32  ARG A CZ  
19   N NH1 . ARG A 6   ? 1.0054 1.2732 1.0652 0.0322  -0.0149 -0.1345 32  ARG A NH1 
20   N NH2 . ARG A 6   ? 0.9961 1.2322 1.0466 0.0233  -0.0092 -0.1199 32  ARG A NH2 
21   N N   . GLU A 7   ? 0.6973 0.9533 0.8049 -0.0121 0.0079  -0.1665 33  GLU A N   
22   C CA  . GLU A 7   ? 0.6672 0.9028 0.7712 -0.0190 0.0127  -0.1581 33  GLU A CA  
23   C C   . GLU A 7   ? 0.6526 0.8769 0.7432 -0.0153 0.0097  -0.1437 33  GLU A C   
24   O O   . GLU A 7   ? 0.8157 1.0396 0.9007 -0.0115 0.0071  -0.1385 33  GLU A O   
25   C CB  . GLU A 7   ? 0.8252 1.0518 0.9330 -0.0259 0.0180  -0.1594 33  GLU A CB  
26   C CG  . GLU A 7   ? 0.9941 1.2008 1.0966 -0.0324 0.0231  -0.1508 33  GLU A CG  
27   C CD  . GLU A 7   ? 1.1445 1.3429 1.2507 -0.0393 0.0292  -0.1530 33  GLU A CD  
28   O OE1 . GLU A 7   ? 1.1050 1.3133 1.2219 -0.0410 0.0311  -0.1642 33  GLU A OE1 
29   O OE2 . GLU A 7   ? 1.2212 1.4042 1.3192 -0.0430 0.0322  -0.1440 33  GLU A OE2 
30   N N   . VAL A 8   ? 0.4399 0.6558 0.5262 -0.0168 0.0107  -0.1379 34  VAL A N   
31   C CA  . VAL A 8   ? 0.3565 0.5641 0.4309 -0.0139 0.0084  -0.1253 34  VAL A CA  
32   C C   . VAL A 8   ? 0.4491 0.6408 0.5172 -0.0205 0.0124  -0.1168 34  VAL A C   
33   O O   . VAL A 8   ? 0.5171 0.7036 0.5879 -0.0249 0.0156  -0.1186 34  VAL A O   
34   C CB  . VAL A 8   ? 0.3602 0.5731 0.4324 -0.0090 0.0052  -0.1245 34  VAL A CB  
35   C CG1 . VAL A 8   ? 0.5068 0.7104 0.5676 -0.0076 0.0042  -0.1116 34  VAL A CG1 
36   C CG2 . VAL A 8   ? 0.4446 0.6742 0.5196 -0.0012 0.0007  -0.1312 34  VAL A CG2 
37   N N   . LYS A 9   ? 0.3834 0.5684 0.4430 -0.0216 0.0124  -0.1079 35  LYS A N   
38   C CA  . LYS A 9   ? 0.3837 0.5566 0.4352 -0.0280 0.0157  -0.0996 35  LYS A CA  
39   C C   . LYS A 9   ? 0.4677 0.6388 0.5094 -0.0266 0.0136  -0.0895 35  LYS A C   
40   O O   . LYS A 9   ? 0.5622 0.7359 0.6000 -0.0237 0.0114  -0.0852 35  LYS A O   
41   C CB  . LYS A 9   ? 0.3742 0.5413 0.4225 -0.0331 0.0186  -0.0973 35  LYS A CB  
42   C CG  . LYS A 9   ? 0.1892 0.3456 0.2270 -0.0406 0.0217  -0.0890 35  LYS A CG  
43   C CD  . LYS A 9   ? 0.2476 0.3974 0.2822 -0.0470 0.0255  -0.0886 35  LYS A CD  
44   C CE  . LYS A 9   ? 0.2657 0.4063 0.2870 -0.0553 0.0278  -0.0803 35  LYS A CE  
45   N NZ  . LYS A 9   ? 0.2953 0.4274 0.3117 -0.0626 0.0322  -0.0809 35  LYS A NZ  
46   N N   . LEU A 10  ? 0.4642 0.6313 0.5023 -0.0289 0.0145  -0.0860 36  LEU A N   
47   C CA  . LEU A 10  ? 0.3445 0.5122 0.3738 -0.0280 0.0124  -0.0763 36  LEU A CA  
48   C C   . LEU A 10  ? 0.2994 0.4622 0.3189 -0.0350 0.0139  -0.0674 36  LEU A C   
49   O O   . LEU A 10  ? 0.4084 0.5657 0.4285 -0.0377 0.0180  -0.0682 36  LEU A O   
50   C CB  . LEU A 10  ? 0.2547 0.4252 0.2870 -0.0234 0.0113  -0.0788 36  LEU A CB  
51   C CG  . LEU A 10  ? 0.2633 0.4420 0.3042 -0.0176 0.0086  -0.0876 36  LEU A CG  
52   C CD1 . LEU A 10  ? 0.2186 0.3971 0.2621 -0.0145 0.0105  -0.0907 36  LEU A CD1 
53   C CD2 . LEU A 10  ? 0.3398 0.5228 0.3763 -0.0126 0.0057  -0.0828 36  LEU A CD2 
54   N N   . LEU A 11  ? 0.2709 0.4360 0.2820 -0.0373 0.0124  -0.0575 37  LEU A N   
55   C CA  . LEU A 11  ? 0.3669 0.5321 0.3681 -0.0451 0.0121  -0.0475 37  LEU A CA  
56   C C   . LEU A 11  ? 0.4280 0.6012 0.4251 -0.0437 0.0097  -0.0366 37  LEU A C   
57   O O   . LEU A 11  ? 0.5949 0.7717 0.5920 -0.0420 0.0079  -0.0349 37  LEU A O   
58   C CB  . LEU A 11  ? 0.2888 0.4496 0.2840 -0.0534 0.0135  -0.0449 37  LEU A CB  
59   C CG  . LEU A 11  ? 0.3394 0.5015 0.3240 -0.0638 0.0122  -0.0352 37  LEU A CG  
60   C CD1 . LEU A 11  ? 0.3365 0.4968 0.3215 -0.0637 0.0144  -0.0347 37  LEU A CD1 
61   C CD2 . LEU A 11  ? 0.3051 0.4599 0.2823 -0.0737 0.0140  -0.0350 37  LEU A CD2 
62   N N   . LEU A 12  ? 0.3071 0.4839 0.3066 -0.0436 0.0123  -0.0270 38  LEU A N   
63   C CA  . LEU A 12  ? 0.2121 0.3997 0.2127 -0.0419 0.0108  -0.0144 38  LEU A CA  
64   C C   . LEU A 12  ? 0.4394 0.6360 0.4313 -0.0519 0.0066  -0.0028 38  LEU A C   
65   O O   . LEU A 12  ? 0.5669 0.7647 0.5573 -0.0579 0.0072  0.0022  38  LEU A O   
66   C CB  . LEU A 12  ? 0.1008 0.2907 0.1147 -0.0352 0.0162  -0.0085 38  LEU A CB  
67   C CG  . LEU A 12  ? 0.3378 0.5217 0.3608 -0.0261 0.0200  -0.0178 38  LEU A CG  
68   C CD1 . LEU A 12  ? 0.4335 0.6166 0.4696 -0.0213 0.0277  -0.0120 38  LEU A CD1 
69   C CD2 . LEU A 12  ? 0.2576 0.4464 0.2777 -0.0219 0.0168  -0.0168 38  LEU A CD2 
70   N N   . LEU A 13  ? 0.5494 0.7532 0.5366 -0.0546 0.0022  0.0011  39  LEU A N   
71   C CA  . LEU A 13  ? 0.5406 0.7562 0.5225 -0.0658 -0.0024 0.0117  39  LEU A CA  
72   C C   . LEU A 13  ? 0.5919 0.8232 0.5786 -0.0623 -0.0040 0.0239  39  LEU A C   
73   O O   . LEU A 13  ? 0.6491 0.8790 0.6416 -0.0517 -0.0014 0.0228  39  LEU A O   
74   C CB  . LEU A 13  ? 0.4942 0.7023 0.4701 -0.0751 -0.0019 0.0059  39  LEU A CB  
75   C CG  . LEU A 13  ? 0.3928 0.5851 0.3645 -0.0791 0.0015  -0.0041 39  LEU A CG  
76   C CD1 . LEU A 13  ? 0.5302 0.7147 0.4947 -0.0886 0.0028  -0.0069 39  LEU A CD1 
77   C CD2 . LEU A 13  ? 0.4959 0.6898 0.4636 -0.0855 0.0003  -0.0008 39  LEU A CD2 
78   N N   . GLY A 14  ? 0.4466 0.6941 0.4316 -0.0718 -0.0081 0.0354  40  GLY A N   
79   C CA  . GLY A 14  ? 0.3077 0.5739 0.2986 -0.0695 -0.0098 0.0484  40  GLY A CA  
80   C C   . GLY A 14  ? 0.3211 0.6075 0.3162 -0.0741 -0.0113 0.0642  40  GLY A C   
81   O O   . GLY A 14  ? 0.2365 0.5203 0.2343 -0.0728 -0.0086 0.0664  40  GLY A O   
82   N N   . ALA A 15  ? 0.2944 0.6028 0.2916 -0.0796 -0.0154 0.0758  41  ALA A N   
83   C CA  . ALA A 15  ? 0.2648 0.5985 0.2670 -0.0848 -0.0176 0.0926  41  ALA A CA  
84   C C   . ALA A 15  ? 0.3619 0.6996 0.3787 -0.0705 -0.0111 0.1033  41  ALA A C   
85   O O   . ALA A 15  ? 0.4732 0.7963 0.4973 -0.0573 -0.0048 0.0984  41  ALA A O   
86   C CB  . ALA A 15  ? 0.2256 0.5847 0.2297 -0.0919 -0.0222 0.1032  41  ALA A CB  
87   N N   . ARG A 16  ? 0.3118 0.6696 0.3335 -0.0740 -0.0117 0.1180  42  ARG A N   
88   C CA  . ARG A 16  ? 0.1721 0.5372 0.2100 -0.0608 -0.0042 0.1313  42  ARG A CA  
89   C C   . ARG A 16  ? 0.3827 0.7541 0.4337 -0.0480 0.0004  0.1385  42  ARG A C   
90   O O   . ARG A 16  ? 0.4392 0.8257 0.4890 -0.0519 -0.0043 0.1429  42  ARG A O   
91   C CB  . ARG A 16  ? 0.1639 0.5579 0.2047 -0.0674 -0.0068 0.1499  42  ARG A CB  
92   C CG  . ARG A 16  ? 0.6706 1.0972 0.7117 -0.0762 -0.0139 0.1626  42  ARG A CG  
93   C CD  . ARG A 16  ? 0.8445 1.2947 0.8775 -0.0926 -0.0208 0.1712  42  ARG A CD  
94   N NE  . ARG A 16  ? 0.8284 1.3098 0.8604 -0.1041 -0.0278 0.1805  42  ARG A NE  
95   C CZ  . ARG A 16  ? 0.6732 1.1501 0.6933 -0.1178 -0.0332 0.1682  42  ARG A CZ  
96   N NH1 . ARG A 16  ? 0.4869 0.9298 0.4957 -0.1203 -0.0325 0.1471  42  ARG A NH1 
97   N NH2 . ARG A 16  ? 0.5423 1.0489 0.5622 -0.1291 -0.0383 0.1773  42  ARG A NH2 
98   N N   . GLU A 17  ? 0.4111 0.7699 0.4747 -0.0333 0.0104  0.1391  43  GLU A N   
99   C CA  . GLU A 17  ? 0.3211 0.6836 0.3981 -0.0202 0.0169  0.1461  43  GLU A CA  
100  C C   . GLU A 17  ? 0.3163 0.6634 0.3862 -0.0195 0.0148  0.1313  43  GLU A C   
101  O O   . GLU A 17  ? 0.3807 0.7375 0.4567 -0.0142 0.0160  0.1380  43  GLU A O   
102  C CB  . GLU A 17  ? 0.3600 0.7582 0.4469 -0.0201 0.0153  0.1690  43  GLU A CB  
103  C CG  . GLU A 17  ? 0.3372 0.7558 0.4309 -0.0207 0.0172  0.1864  43  GLU A CG  
104  C CD  . GLU A 17  ? 0.5103 0.9159 0.6177 -0.0053 0.0309  0.1912  43  GLU A CD  
105  O OE1 . GLU A 17  ? 0.5735 0.9814 0.6814 -0.0062 0.0336  0.1977  43  GLU A OE1 
106  O OE2 . GLU A 17  ? 0.7066 1.0985 0.8233 0.0072  0.0397  0.1883  43  GLU A OE2 
107  N N   . SER A 18  ? 0.2682 0.5922 0.3253 -0.0244 0.0121  0.1120  44  SER A N   
108  C CA  . SER A 18  ? 0.2107 0.5203 0.2603 -0.0233 0.0105  0.0982  44  SER A CA  
109  C C   . SER A 18  ? 0.3663 0.6527 0.4209 -0.0124 0.0185  0.0857  44  SER A C   
110  O O   . SER A 18  ? 0.4582 0.7338 0.5086 -0.0093 0.0185  0.0752  44  SER A O   
111  C CB  . SER A 18  ? 0.2231 0.5254 0.2550 -0.0360 0.0025  0.0859  44  SER A CB  
112  O OG  . SER A 18  ? 0.1959 0.4804 0.2226 -0.0381 0.0037  0.0739  44  SER A OG  
113  N N   . GLY A 19  ? 0.3438 0.6230 0.4070 -0.0073 0.0256  0.0866  45  GLY A N   
114  C CA  . GLY A 19  ? 0.2599 0.5188 0.3292 0.0017  0.0343  0.0753  45  GLY A CA  
115  C C   . GLY A 19  ? 0.4074 0.6474 0.4710 -0.0020 0.0347  0.0584  45  GLY A C   
116  O O   . GLY A 19  ? 0.5057 0.7296 0.5730 0.0032  0.0409  0.0464  45  GLY A O   
117  N N   . LYS A 20  ? 0.2563 0.4989 0.3109 -0.0116 0.0285  0.0572  46  LYS A N   
118  C CA  . LYS A 20  ? 0.2484 0.4746 0.2975 -0.0156 0.0287  0.0417  46  LYS A CA  
119  C C   . LYS A 20  ? 0.1859 0.4004 0.2462 -0.0096 0.0391  0.0385  46  LYS A C   
120  O O   . LYS A 20  ? 0.3879 0.5875 0.4498 -0.0069 0.0427  0.0234  46  LYS A O   
121  C CB  . LYS A 20  ? 0.4056 0.6370 0.4443 -0.0268 0.0222  0.0439  46  LYS A CB  
122  C CG  . LYS A 20  ? 0.3189 0.5578 0.3444 -0.0350 0.0132  0.0437  46  LYS A CG  
123  C CD  . LYS A 20  ? 0.3232 0.5638 0.3374 -0.0472 0.0083  0.0438  46  LYS A CD  
124  C CE  . LYS A 20  ? 0.3822 0.6377 0.4020 -0.0499 0.0091  0.0595  46  LYS A CE  
125  N NZ  . LYS A 20  ? 0.3549 0.6340 0.3798 -0.0496 0.0064  0.0765  46  LYS A NZ  
126  N N   . SER A 21  ? 0.2705 0.4926 0.3386 -0.0080 0.0442  0.0528  47  SER A N   
127  C CA  . SER A 21  ? 0.3718 0.5816 0.4500 -0.0028 0.0559  0.0509  47  SER A CA  
128  C C   . SER A 21  ? 0.4901 0.6887 0.5769 0.0061  0.0650  0.0447  47  SER A C   
129  O O   . SER A 21  ? 0.5477 0.7297 0.6388 0.0076  0.0734  0.0330  47  SER A O   
130  C CB  . SER A 21  ? 0.3501 0.5726 0.4360 -0.0003 0.0612  0.0711  47  SER A CB  
131  O OG  . SER A 21  ? 0.7082 0.9443 0.8034 0.0080  0.0650  0.0870  47  SER A OG  
132  N N   . THR A 22  ? 0.4172 0.6247 0.5060 0.0111  0.0638  0.0521  48  THR A N   
133  C CA  . THR A 22  ? 0.2695 0.4667 0.3651 0.0191  0.0726  0.0469  48  THR A CA  
134  C C   . THR A 22  ? 0.2650 0.4472 0.3540 0.0157  0.0699  0.0242  48  THR A C   
135  O O   . THR A 22  ? 0.2435 0.4115 0.3379 0.0184  0.0794  0.0139  48  THR A O   
136  C CB  . THR A 22  ? 0.1340 0.3450 0.2319 0.0244  0.0708  0.0593  48  THR A CB  
137  O OG1 . THR A 22  ? 0.4529 0.6817 0.5590 0.0280  0.0735  0.0815  48  THR A OG1 
138  C CG2 . THR A 22  ? 0.1891 0.3877 0.2931 0.0324  0.0810  0.0536  48  THR A CG2 
139  N N   . ILE A 23  ? 0.3731 0.5596 0.4505 0.0095  0.0577  0.0168  49  ILE A N   
140  C CA  . ILE A 23  ? 0.3153 0.4919 0.3866 0.0068  0.0540  -0.0031 49  ILE A CA  
141  C C   . ILE A 23  ? 0.3363 0.5007 0.4113 0.0036  0.0593  -0.0157 49  ILE A C   
142  O O   . ILE A 23  ? 0.3048 0.4600 0.3829 0.0042  0.0637  -0.0296 49  ILE A O   
143  C CB  . ILE A 23  ? 0.3121 0.4950 0.3702 0.0010  0.0416  -0.0070 49  ILE A CB  
144  C CG1 . ILE A 23  ? 0.4152 0.6102 0.4693 0.0027  0.0368  0.0047  49  ILE A CG1 
145  C CG2 . ILE A 23  ? 0.1329 0.3083 0.1863 -0.0001 0.0382  -0.0258 49  ILE A CG2 
146  C CD1 . ILE A 23  ? 0.4627 0.6554 0.5192 0.0094  0.0397  0.0015  49  ILE A CD1 
147  N N   . VAL A 24  ? 0.1608 0.3261 0.2352 -0.0007 0.0589  -0.0110 50  VAL A N   
148  C CA  . VAL A 24  ? 0.3977 0.5519 0.4760 -0.0042 0.0646  -0.0218 50  VAL A CA  
149  C C   . VAL A 24  ? 0.5002 0.6436 0.5900 0.0006  0.0790  -0.0231 50  VAL A C   
150  O O   . VAL A 24  ? 0.5051 0.6383 0.5983 -0.0019 0.0839  -0.0390 50  VAL A O   
151  C CB  . VAL A 24  ? 0.3483 0.5054 0.4244 -0.0087 0.0636  -0.0132 50  VAL A CB  
152  C CG1 . VAL A 24  ? 0.2533 0.3978 0.3342 -0.0120 0.0710  -0.0241 50  VAL A CG1 
153  C CG2 . VAL A 24  ? 0.0287 0.1938 0.0921 -0.0150 0.0512  -0.0134 50  VAL A CG2 
154  N N   . LYS A 25  ? 0.3879 0.5346 0.4842 0.0071  0.0865  -0.0062 51  LYS A N   
155  C CA  . LYS A 25  ? 0.2681 0.4030 0.3750 0.0128  0.1029  -0.0049 51  LYS A CA  
156  C C   . LYS A 25  ? 0.3956 0.5231 0.5031 0.0145  0.1061  -0.0176 51  LYS A C   
157  O O   . LYS A 25  ? 0.5315 0.6450 0.6453 0.0155  0.1196  -0.0253 51  LYS A O   
158  C CB  . LYS A 25  ? 0.3782 0.5211 0.4919 0.0211  0.1099  0.0184  51  LYS A CB  
159  C CG  . LYS A 25  ? 0.5155 0.6676 0.6290 0.0190  0.1077  0.0319  51  LYS A CG  
160  C CD  . LYS A 25  ? 0.5008 0.6721 0.6184 0.0253  0.1070  0.0562  51  LYS A CD  
161  C CE  . LYS A 25  ? 0.5398 0.7057 0.6700 0.0367  0.1247  0.0687  51  LYS A CE  
162  N NZ  . LYS A 25  ? 0.5924 0.7812 0.7283 0.0433  0.1239  0.0941  51  LYS A NZ  
163  N N   . GLN A 26  ? 0.2975 0.4343 0.3978 0.0142  0.0945  -0.0201 52  GLN A N   
164  C CA  . GLN A 26  ? 0.3366 0.4688 0.4357 0.0150  0.0957  -0.0327 52  GLN A CA  
165  C C   . GLN A 26  ? 0.3975 0.5239 0.4950 0.0075  0.0937  -0.0544 52  GLN A C   
166  O O   . GLN A 26  ? 0.5732 0.6918 0.6740 0.0064  0.1014  -0.0666 52  GLN A O   
167  C CB  . GLN A 26  ? 0.2702 0.4145 0.3613 0.0169  0.0838  -0.0285 52  GLN A CB  
168  C CG  . GLN A 26  ? 0.3329 0.4832 0.4279 0.0249  0.0883  -0.0105 52  GLN A CG  
169  C CD  . GLN A 26  ? 0.4434 0.5828 0.5448 0.0304  0.1020  -0.0132 52  GLN A CD  
170  O OE1 . GLN A 26  ? 0.5130 0.6394 0.6165 0.0274  0.1099  -0.0281 52  GLN A OE1 
171  N NE2 . GLN A 26  ? 0.5593 0.7041 0.6639 0.0379  0.1057  0.0010  52  GLN A NE2 
172  N N   . MET A 27  ? 0.2213 0.3528 0.3138 0.0019  0.0836  -0.0591 53  MET A N   
173  C CA  . MET A 27  ? 0.2927 0.4230 0.3851 -0.0050 0.0805  -0.0782 53  MET A CA  
174  C C   . MET A 27  ? 0.5466 0.6646 0.6485 -0.0084 0.0945  -0.0867 53  MET A C   
175  O O   . MET A 27  ? 0.6748 0.7912 0.7799 -0.0131 0.0975  -0.1032 53  MET A O   
176  C CB  . MET A 27  ? 0.4192 0.5561 0.5053 -0.0093 0.0691  -0.0791 53  MET A CB  
177  C CG  . MET A 27  ? 0.5804 0.7276 0.6559 -0.0072 0.0567  -0.0718 53  MET A CG  
178  S SD  . MET A 27  ? 0.5825 0.7365 0.6538 -0.0048 0.0499  -0.0819 53  MET A SD  
179  C CE  . MET A 27  ? 0.9637 1.1158 1.0368 0.0024  0.0569  -0.0693 53  MET A CE  
180  N N   . LYS A 28  ? 0.5889 0.6993 0.6951 -0.0065 0.1037  -0.0753 54  LYS A N   
181  C CA  . LYS A 28  ? 0.6267 0.7230 0.7412 -0.0093 0.1193  -0.0819 54  LYS A CA  
182  C C   . LYS A 28  ? 0.7383 0.8245 0.8574 -0.0066 0.1330  -0.0860 54  LYS A C   
183  O O   . LYS A 28  ? 0.9392 1.0137 1.0636 -0.0115 0.1456  -0.0986 54  LYS A O   
184  C CB  . LYS A 28  ? 0.7299 0.8209 0.8474 -0.0061 0.1268  -0.0661 54  LYS A CB  
185  C CG  . LYS A 28  ? 1.0479 1.1221 1.1731 -0.0089 0.1444  -0.0724 54  LYS A CG  
186  C CD  . LYS A 28  ? 1.2436 1.3158 1.3695 -0.0092 0.1468  -0.0623 54  LYS A CD  
187  C CE  . LYS A 28  ? 1.3566 1.4357 1.4822 -0.0001 0.1473  -0.0376 54  LYS A CE  
188  N NZ  . LYS A 28  ? 1.3881 1.4665 1.5141 -0.0007 0.1505  -0.0273 54  LYS A NZ  
189  N N   . ILE A 29  ? 0.6539 0.7442 0.7706 0.0006  0.1313  -0.0760 55  ILE A N   
190  C CA  . ILE A 29  ? 0.5838 0.6640 0.7036 0.0038  0.1447  -0.0789 55  ILE A CA  
191  C C   . ILE A 29  ? 0.5436 0.6290 0.6594 -0.0018 0.1386  -0.0977 55  ILE A C   
192  O O   . ILE A 29  ? 0.5679 0.6433 0.6864 -0.0056 0.1507  -0.1105 55  ILE A O   
193  C CB  . ILE A 29  ? 0.4882 0.5714 0.6083 0.0147  0.1469  -0.0587 55  ILE A CB  
194  C CG1 . ILE A 29  ? 0.5403 0.6207 0.6664 0.0211  0.1555  -0.0390 55  ILE A CG1 
195  C CG2 . ILE A 29  ? 0.3364 0.4089 0.4582 0.0179  0.1600  -0.0630 55  ILE A CG2 
196  C CD1 . ILE A 29  ? 0.5694 0.6577 0.6982 0.0320  0.1572  -0.0173 55  ILE A CD1 
197  N N   . ILE A 30  ? 0.4430 0.5443 0.5519 -0.0025 0.1205  -0.0990 56  ILE A N   
198  C CA  . ILE A 30  ? 0.4419 0.5520 0.5466 -0.0060 0.1131  -0.1141 56  ILE A CA  
199  C C   . ILE A 30  ? 0.5659 0.6822 0.6732 -0.0156 0.1094  -0.1330 56  ILE A C   
200  O O   . ILE A 30  ? 0.5022 0.6177 0.6123 -0.0212 0.1161  -0.1488 56  ILE A O   
201  C CB  . ILE A 30  ? 0.3377 0.4621 0.4337 -0.0016 0.0965  -0.1067 56  ILE A CB  
202  C CG1 . ILE A 30  ? 0.3254 0.4471 0.4200 0.0073  0.1002  -0.0890 56  ILE A CG1 
203  C CG2 . ILE A 30  ? 0.3998 0.5350 0.4917 -0.0044 0.0888  -0.1217 56  ILE A CG2 
204  C CD1 . ILE A 30  ? 0.2204 0.3549 0.3062 0.0109  0.0858  -0.0819 56  ILE A CD1 
205  N N   . HIS A 31  ? 0.5872 0.7106 0.6938 -0.0178 0.0993  -0.1314 57  HIS A N   
206  C CA  . HIS A 31  ? 0.5416 0.6753 0.6516 -0.0257 0.0937  -0.1476 57  HIS A CA  
207  C C   . HIS A 31  ? 0.6397 0.7637 0.7576 -0.0322 0.1042  -0.1531 57  HIS A C   
208  O O   . HIS A 31  ? 0.7614 0.8944 0.8829 -0.0382 0.0990  -0.1631 57  HIS A O   
209  C CB  . HIS A 31  ? 0.3917 0.5399 0.4957 -0.0241 0.0764  -0.1442 57  HIS A CB  
210  C CG  . HIS A 31  ? 0.5102 0.6688 0.6065 -0.0186 0.0664  -0.1413 57  HIS A CG  
211  N ND1 . HIS A 31  ? 0.6197 0.7771 0.7076 -0.0121 0.0605  -0.1257 57  HIS A ND1 
212  C CD2 . HIS A 31  ? 0.6286 0.7993 0.7241 -0.0187 0.0621  -0.1521 57  HIS A CD2 
213  C CE1 . HIS A 31  ? 0.8115 0.9781 0.8936 -0.0085 0.0532  -0.1270 57  HIS A CE1 
214  N NE2 . HIS A 31  ? 0.8464 1.0213 0.9329 -0.0119 0.0539  -0.1425 57  HIS A NE2 
215  N N   . GLU A 32  ? 0.6652 0.7713 0.7862 -0.0303 0.1197  -0.1461 58  GLU A N   
216  C CA  . GLU A 32  ? 0.5260 0.6200 0.6543 -0.0361 0.1327  -0.1513 58  GLU A CA  
217  C C   . GLU A 32  ? 0.7247 0.8005 0.8569 -0.0365 0.1533  -0.1544 58  GLU A C   
218  O O   . GLU A 32  ? 0.9235 0.9992 1.0537 -0.0356 0.1565  -0.1592 58  GLU A O   
219  C CB  . GLU A 32  ? 0.5114 0.5999 0.6385 -0.0323 0.1317  -0.1354 58  GLU A CB  
220  C CG  . GLU A 32  ? 0.7280 0.8313 0.8495 -0.0326 0.1134  -0.1326 58  GLU A CG  
221  C CD  . GLU A 32  ? 0.9387 1.0368 1.0579 -0.0303 0.1133  -0.1182 58  GLU A CD  
222  O OE1 . GLU A 32  ? 0.7996 0.9073 0.9116 -0.0289 0.1000  -0.1114 58  GLU A OE1 
223  O OE2 . GLU A 32  ? 1.0564 1.1411 1.1806 -0.0301 0.1273  -0.1135 58  GLU A OE2 
224  N N   . ALA A 33  ? 0.6721 0.7312 0.8093 -0.0379 0.1685  -0.1517 59  ALA A N   
225  C CA  . ALA A 33  ? 0.8676 0.9059 1.0082 -0.0382 0.1911  -0.1544 59  ALA A CA  
226  C C   . ALA A 33  ? 0.8136 0.8403 0.9531 -0.0253 0.1998  -0.1322 59  ALA A C   
227  O O   . ALA A 33  ? 0.8316 0.8383 0.9739 -0.0227 0.2207  -0.1297 59  ALA A O   
228  C CB  . ALA A 33  ? 0.9722 0.9969 1.1187 -0.0462 0.2057  -0.1635 59  ALA A CB  
229  N N   . GLY A 34  ? 0.6727 0.7566 0.8755 -0.1119 0.0571  0.0435  60  GLY A N   
230  C CA  . GLY A 34  ? 0.5717 0.6366 0.7610 -0.1061 0.0563  0.0470  60  GLY A CA  
231  C C   . GLY A 34  ? 0.6213 0.6666 0.8045 -0.1126 0.0606  0.0524  60  GLY A C   
232  O O   . GLY A 34  ? 0.5834 0.6327 0.7709 -0.1190 0.0663  0.0567  60  GLY A O   
233  N N   . TYR A 35  ? 0.7301 0.7549 0.9025 -0.1102 0.0580  0.0525  61  TYR A N   
234  C CA  . TYR A 35  ? 0.7358 0.7399 0.9009 -0.1153 0.0617  0.0580  61  TYR A CA  
235  C C   . TYR A 35  ? 0.8016 0.7903 0.9688 -0.1225 0.0580  0.0535  61  TYR A C   
236  O O   . TYR A 35  ? 0.8908 0.8729 1.0543 -0.1178 0.0512  0.0470  61  TYR A O   
237  C CB  . TYR A 35  ? 0.6794 0.6699 0.8294 -0.1062 0.0618  0.0622  61  TYR A CB  
238  C CG  . TYR A 35  ? 0.5205 0.5230 0.6693 -0.0995 0.0651  0.0664  61  TYR A CG  
239  C CD1 . TYR A 35  ? 0.4936 0.5078 0.6441 -0.0910 0.0617  0.0641  61  TYR A CD1 
240  C CD2 . TYR A 35  ? 0.6792 0.6815 0.8257 -0.1013 0.0713  0.0727  61  TYR A CD2 
241  C CE1 . TYR A 35  ? 0.6469 0.6703 0.7982 -0.0853 0.0639  0.0674  61  TYR A CE1 
242  C CE2 . TYR A 35  ? 0.7295 0.7423 0.8754 -0.0945 0.0731  0.0750  61  TYR A CE2 
243  C CZ  . TYR A 35  ? 0.7241 0.7464 0.8731 -0.0869 0.0690  0.0720  61  TYR A CZ  
244  O OH  . TYR A 35  ? 0.6342 0.6654 0.7847 -0.0805 0.0701  0.0737  61  TYR A OH  
245  N N   . SER A 36  ? 0.7205 0.7039 0.8945 -0.1338 0.0624  0.0570  62  SER A N   
246  C CA  . SER A 36  ? 0.8593 0.8260 1.0379 -0.1420 0.0590  0.0534  62  SER A CA  
247  C C   . SER A 36  ? 0.9136 0.8529 1.0766 -0.1375 0.0573  0.0562  62  SER A C   
248  O O   . SER A 36  ? 0.6615 0.5947 0.8115 -0.1310 0.0612  0.0633  62  SER A O   
249  C CB  . SER A 36  ? 0.8792 0.8474 1.0706 -0.1559 0.0652  0.0585  62  SER A CB  
250  O OG  . SER A 36  ? 0.9201 0.8808 1.1031 -0.1565 0.0738  0.0705  62  SER A OG  
251  N N   . GLU A 37  ? 1.1626 1.0856 1.3272 -0.1404 0.0508  0.0497  63  GLU A N   
252  C CA  . GLU A 37  ? 1.0938 0.9895 1.2439 -0.1359 0.0483  0.0514  63  GLU A CA  
253  C C   . GLU A 37  ? 0.8690 0.7510 1.0099 -0.1379 0.0569  0.0645  63  GLU A C   
254  O O   . GLU A 37  ? 0.8217 0.6901 0.9462 -0.1291 0.0571  0.0682  63  GLU A O   
255  C CB  . GLU A 37  ? 1.2349 1.1134 1.3923 -0.1425 0.0413  0.0438  63  GLU A CB  
256  C CG  . GLU A 37  ? 1.3357 1.1837 1.4788 -0.1384 0.0385  0.0456  63  GLU A CG  
257  C CD  . GLU A 37  ? 1.4923 1.3210 1.6449 -0.1464 0.0318  0.0386  63  GLU A CD  
258  O OE1 . GLU A 37  ? 1.5981 1.3997 1.7402 -0.1437 0.0289  0.0397  63  GLU A OE1 
259  O OE2 . GLU A 37  ? 1.5140 1.3545 1.6850 -0.1550 0.0289  0.0314  63  GLU A OE2 
260  N N   . GLU A 38  ? 0.8563 0.7437 1.0079 -0.1489 0.0643  0.0715  64  GLU A N   
261  C CA  . GLU A 38  ? 0.9428 0.8206 1.0863 -0.1504 0.0734  0.0848  64  GLU A CA  
262  C C   . GLU A 38  ? 0.7350 0.6258 0.8667 -0.1394 0.0772  0.0890  64  GLU A C   
263  O O   . GLU A 38  ? 0.6226 0.5003 0.7385 -0.1321 0.0797  0.0952  64  GLU A O   
264  C CB  . GLU A 38  ? 1.1900 1.0754 1.3494 -0.1644 0.0807  0.0915  64  GLU A CB  
265  C CG  . GLU A 38  ? 1.3711 1.2485 1.5225 -0.1659 0.0910  0.1066  64  GLU A CG  
266  C CD  . GLU A 38  ? 1.5002 1.3453 1.6401 -0.1653 0.0906  0.1123  64  GLU A CD  
267  O OE1 . GLU A 38  ? 1.4834 1.3118 1.6243 -0.1658 0.0821  0.1039  64  GLU A OE1 
268  O OE2 . GLU A 38  ? 1.6091 1.4459 1.7384 -0.1634 0.0986  0.1249  64  GLU A OE2 
269  N N   . GLU A 39  ? 0.6599 0.5764 0.7998 -0.1378 0.0773  0.0850  65  GLU A N   
270  C CA  . GLU A 39  ? 0.6939 0.6238 0.8260 -0.1279 0.0799  0.0876  65  GLU A CA  
271  C C   . GLU A 39  ? 0.7472 0.6669 0.8647 -0.1155 0.0747  0.0846  65  GLU A C   
272  O O   . GLU A 39  ? 0.7641 0.6831 0.8708 -0.1074 0.0772  0.0890  65  GLU A O   
273  C CB  . GLU A 39  ? 0.8129 0.7703 0.9576 -0.1280 0.0794  0.0827  65  GLU A CB  
274  C CG  . GLU A 39  ? 1.1449 1.1170 1.3034 -0.1385 0.0855  0.0862  65  GLU A CG  
275  C CD  . GLU A 39  ? 1.2613 1.2603 1.4317 -0.1377 0.0842  0.0806  65  GLU A CD  
276  O OE1 . GLU A 39  ? 1.3464 1.3509 1.5180 -0.1320 0.0776  0.0729  65  GLU A OE1 
277  O OE2 . GLU A 39  ? 1.1837 1.1990 1.3620 -0.1420 0.0900  0.0843  65  GLU A OE2 
278  N N   . CYS A 40  ? 0.6337 0.5467 0.7514 -0.1137 0.0671  0.0767  66  CYS A N   
279  C CA  . CYS A 40  ? 0.4926 0.3977 0.5977 -0.1021 0.0619  0.0735  66  CYS A CA  
280  C C   . CYS A 40  ? 0.5149 0.3963 0.6044 -0.0986 0.0635  0.0794  66  CYS A C   
281  O O   . CYS A 40  ? 0.6826 0.5609 0.7604 -0.0883 0.0624  0.0800  66  CYS A O   
282  C CB  . CYS A 40  ? 0.5831 0.4874 0.6916 -0.1004 0.0535  0.0637  66  CYS A CB  
283  S SG  . CYS A 40  ? 1.0111 0.9450 1.1349 -0.1004 0.0506  0.0567  66  CYS A SG  
284  N N   . LYS A 41  ? 0.5230 0.3878 0.6131 -0.1071 0.0663  0.0838  67  LYS A N   
285  C CA  . LYS A 41  ? 0.6226 0.4632 0.6977 -0.1039 0.0682  0.0904  67  LYS A CA  
286  C C   . LYS A 41  ? 0.7500 0.5952 0.8155 -0.0983 0.0753  0.0993  67  LYS A C   
287  O O   . LYS A 41  ? 0.8208 0.6509 0.8706 -0.0906 0.0759  0.1034  67  LYS A O   
288  C CB  . LYS A 41  ? 0.6029 0.4250 0.6835 -0.1154 0.0701  0.0945  67  LYS A CB  
289  C CG  . LYS A 41  ? 0.7166 0.5312 0.8064 -0.1202 0.0617  0.0843  67  LYS A CG  
290  C CD  . LYS A 41  ? 0.8745 0.6683 0.9715 -0.1320 0.0632  0.0885  67  LYS A CD  
291  C CE  . LYS A 41  ? 0.8802 0.6659 0.9869 -0.1358 0.0533  0.0763  67  LYS A CE  
292  N NZ  . LYS A 41  ? 0.8258 0.5889 0.9417 -0.1479 0.0539  0.0799  67  LYS A NZ  
293  N N   . GLN A 42  ? 0.7585 0.6254 0.8330 -0.1012 0.0803  0.1015  68  GLN A N   
294  C CA  . GLN A 42  ? 0.7719 0.6462 0.8385 -0.0953 0.0865  0.1085  68  GLN A CA  
295  C C   . GLN A 42  ? 0.8720 0.7496 0.9285 -0.0817 0.0823  0.1043  68  GLN A C   
296  O O   . GLN A 42  ? 1.0264 0.8998 1.0703 -0.0737 0.0849  0.1088  68  GLN A O   
297  C CB  . GLN A 42  ? 0.9231 0.8218 1.0030 -0.1007 0.0915  0.1099  68  GLN A CB  
298  C CG  . GLN A 42  ? 1.1231 1.0232 1.2164 -0.1148 0.0958  0.1137  68  GLN A CG  
299  C CD  . GLN A 42  ? 1.1811 1.0691 1.2681 -0.1186 0.1041  0.1260  68  GLN A CD  
300  O OE1 . GLN A 42  ? 1.3598 1.2428 1.4318 -0.1095 0.1074  0.1321  68  GLN A OE1 
301  N NE2 . GLN A 42  ? 1.0173 0.9014 1.1165 -0.1318 0.1074  0.1301  68  GLN A NE2 
302  N N   . TYR A 43  ? 0.7926 0.6787 0.8552 -0.0790 0.0757  0.0957  69  TYR A N   
303  C CA  . TYR A 43  ? 0.6090 0.5013 0.6665 -0.0675 0.0717  0.0916  69  TYR A CA  
304  C C   . TYR A 43  ? 0.6329 0.5069 0.6765 -0.0598 0.0670  0.0898  69  TYR A C   
305  O O   . TYR A 43  ? 0.7701 0.6480 0.8092 -0.0502 0.0637  0.0868  69  TYR A O   
306  C CB  . TYR A 43  ? 0.6295 0.5406 0.7004 -0.0676 0.0675  0.0849  69  TYR A CB  
307  C CG  . TYR A 43  ? 0.7584 0.6894 0.8422 -0.0727 0.0714  0.0859  69  TYR A CG  
308  C CD1 . TYR A 43  ? 0.8640 0.7999 0.9581 -0.0833 0.0736  0.0861  69  TYR A CD1 
309  C CD2 . TYR A 43  ? 0.8394 0.7847 0.9259 -0.0666 0.0722  0.0858  69  TYR A CD2 
310  C CE1 . TYR A 43  ? 0.9534 0.9088 1.0591 -0.0873 0.0769  0.0867  69  TYR A CE1 
311  C CE2 . TYR A 43  ? 0.8847 0.8480 0.9824 -0.0703 0.0752  0.0862  69  TYR A CE2 
312  C CZ  . TYR A 43  ? 0.9694 0.9382 1.0761 -0.0803 0.0778  0.0868  69  TYR A CZ  
313  O OH  . TYR A 43  ? 1.0606 1.0484 1.1782 -0.0832 0.0807  0.0869  69  TYR A OH  
314  N N   . LYS A 44  ? 0.5751 0.4292 0.6131 -0.0639 0.0664  0.0913  70  LYS A N   
315  C CA  . LYS A 44  ? 0.6651 0.5007 0.6893 -0.0561 0.0616  0.0893  70  LYS A CA  
316  C C   . LYS A 44  ? 0.6222 0.4550 0.6326 -0.0451 0.0631  0.0925  70  LYS A C   
317  O O   . LYS A 44  ? 0.5351 0.3649 0.5377 -0.0355 0.0581  0.0883  70  LYS A O   
318  C CB  . LYS A 44  ? 0.9236 0.7354 0.9434 -0.0623 0.0618  0.0922  70  LYS A CB  
319  C CG  . LYS A 44  ? 1.0283 0.8197 1.0335 -0.0538 0.0561  0.0893  70  LYS A CG  
320  C CD  . LYS A 44  ? 1.1624 0.9292 1.1659 -0.0607 0.0553  0.0913  70  LYS A CD  
321  C CE  . LYS A 44  ? 1.1667 0.9132 1.1558 -0.0512 0.0485  0.0872  70  LYS A CE  
322  N NZ  . LYS A 44  ? 1.1819 0.9036 1.1718 -0.0580 0.0461  0.0873  70  LYS A NZ  
323  N N   . ALA A 45  ? 0.6608 0.4964 0.6684 -0.0459 0.0698  0.0997  71  ALA A N   
324  C CA  . ALA A 45  ? 0.7565 0.5909 0.7507 -0.0346 0.0712  0.1023  71  ALA A CA  
325  C C   . ALA A 45  ? 0.8411 0.6944 0.8406 -0.0268 0.0673  0.0955  71  ALA A C   
326  O O   . ALA A 45  ? 0.7855 0.6358 0.7766 -0.0166 0.0631  0.0921  71  ALA A O   
327  C CB  . ALA A 45  ? 0.7589 0.5949 0.7494 -0.0367 0.0795  0.1115  71  ALA A CB  
328  N N   . VAL A 46  ? 0.8328 0.7054 0.8474 -0.0318 0.0684  0.0937  72  VAL A N   
329  C CA  . VAL A 46  ? 0.7543 0.6444 0.7769 -0.0255 0.0649  0.0881  72  VAL A CA  
330  C C   . VAL A 46  ? 0.7557 0.6469 0.7824 -0.0224 0.0582  0.0819  72  VAL A C   
331  O O   . VAL A 46  ? 0.8911 0.7904 0.9201 -0.0147 0.0546  0.0780  72  VAL A O   
332  C CB  . VAL A 46  ? 0.7491 0.6586 0.7873 -0.0316 0.0675  0.0878  72  VAL A CB  
333  C CG1 . VAL A 46  ? 0.9434 0.8560 0.9931 -0.0418 0.0671  0.0867  72  VAL A CG1 
334  C CG2 . VAL A 46  ? 0.6840 0.6091 0.7311 -0.0248 0.0636  0.0824  72  VAL A CG2 
335  N N   . VAL A 47  ? 0.5984 0.4824 0.6266 -0.0280 0.0565  0.0809  73  VAL A N   
336  C CA  . VAL A 47  ? 0.6214 0.5076 0.6521 -0.0240 0.0505  0.0755  73  VAL A CA  
337  C C   . VAL A 47  ? 0.5754 0.4502 0.5919 -0.0136 0.0472  0.0741  73  VAL A C   
338  O O   . VAL A 47  ? 0.5886 0.4727 0.6083 -0.0066 0.0434  0.0705  73  VAL A O   
339  C CB  . VAL A 47  ? 0.6455 0.5256 0.6788 -0.0305 0.0485  0.0736  73  VAL A CB  
340  C CG1 . VAL A 47  ? 0.4841 0.3655 0.5158 -0.0238 0.0423  0.0683  73  VAL A CG1 
341  C CG2 . VAL A 47  ? 0.5700 0.4654 0.6189 -0.0395 0.0507  0.0734  73  VAL A CG2 
342  N N   . TYR A 48  ? 0.5052 0.3602 0.5067 -0.0126 0.0488  0.0775  74  TYR A N   
343  C CA  . TYR A 48  ? 0.5983 0.4417 0.5845 -0.0018 0.0460  0.0766  74  TYR A CA  
344  C C   . TYR A 48  ? 0.7350 0.5907 0.7217 0.0064  0.0459  0.0753  74  TYR A C   
345  O O   . TYR A 48  ? 0.9328 0.7916 0.9169 0.0153  0.0413  0.0709  74  TYR A O   
346  C CB  . TYR A 48  ? 0.5971 0.4173 0.5674 -0.0021 0.0492  0.0825  74  TYR A CB  
347  C CG  . TYR A 48  ? 0.6912 0.4944 0.6592 -0.0078 0.0472  0.0822  74  TYR A CG  
348  C CD1 . TYR A 48  ? 0.8148 0.6167 0.7826 -0.0038 0.0405  0.0754  74  TYR A CD1 
349  C CD2 . TYR A 48  ? 0.7068 0.4958 0.6737 -0.0168 0.0519  0.0885  74  TYR A CD2 
350  C CE1 . TYR A 48  ? 0.9811 0.7674 0.9469 -0.0079 0.0376  0.0735  74  TYR A CE1 
351  C CE2 . TYR A 48  ? 0.8564 0.6288 0.8232 -0.0222 0.0491  0.0871  74  TYR A CE2 
352  C CZ  . TYR A 48  ? 1.0463 0.8170 1.0122 -0.0174 0.0415  0.0789  74  TYR A CZ  
353  O OH  . TYR A 48  ? 1.1248 0.8791 1.0907 -0.0217 0.0375  0.0759  74  TYR A OH  
354  N N   . SER A 49  ? 0.5080 0.3715 0.4988 0.0036  0.0505  0.0785  75  SER A N   
355  C CA  . SER A 49  ? 0.5250 0.4005 0.5173 0.0116  0.0497  0.0761  75  SER A CA  
356  C C   . SER A 49  ? 0.6987 0.5909 0.7066 0.0138  0.0446  0.0697  75  SER A C   
357  O O   . SER A 49  ? 0.6635 0.5578 0.6691 0.0226  0.0402  0.0654  75  SER A O   
358  C CB  . SER A 49  ? 0.7357 0.6193 0.7318 0.0078  0.0552  0.0798  75  SER A CB  
359  O OG  . SER A 49  ? 1.1105 0.9801 1.0922 0.0068  0.0607  0.0872  75  SER A OG  
360  N N   . ASN A 50  ? 0.7239 0.6285 0.7481 0.0058  0.0454  0.0696  76  ASN A N   
361  C CA  . ASN A 50  ? 0.6482 0.5690 0.6893 0.0069  0.0416  0.0655  76  ASN A CA  
362  C C   . ASN A 50  ? 0.6716 0.5908 0.7106 0.0125  0.0368  0.0626  76  ASN A C   
363  O O   . ASN A 50  ? 0.6620 0.5920 0.7104 0.0176  0.0332  0.0593  76  ASN A O   
364  C CB  . ASN A 50  ? 0.6844 0.6156 0.7403 -0.0024 0.0434  0.0671  76  ASN A CB  
365  C CG  . ASN A 50  ? 0.6854 0.6211 0.7448 -0.0077 0.0480  0.0696  76  ASN A CG  
366  O OD1 . ASN A 50  ? 0.7803 0.7252 0.8512 -0.0147 0.0497  0.0707  76  ASN A OD1 
367  N ND2 . ASN A 50  ? 0.7206 0.6509 0.7696 -0.0036 0.0501  0.0707  76  ASN A ND2 
368  N N   . THR A 51  ? 0.6433 0.5495 0.6710 0.0117  0.0365  0.0636  77  THR A N   
369  C CA  . THR A 51  ? 0.5266 0.4308 0.5498 0.0181  0.0320  0.0606  77  THR A CA  
370  C C   . THR A 51  ? 0.5892 0.4910 0.6040 0.0286  0.0293  0.0578  77  THR A C   
371  O O   . THR A 51  ? 0.7303 0.6442 0.7540 0.0337  0.0256  0.0544  77  THR A O   
372  C CB  . THR A 51  ? 0.4563 0.3430 0.4657 0.0168  0.0316  0.0613  77  THR A CB  
373  O OG1 . THR A 51  ? 0.4048 0.2944 0.4226 0.0072  0.0335  0.0627  77  THR A OG1 
374  C CG2 . THR A 51  ? 0.4608 0.3472 0.4652 0.0247  0.0265  0.0575  77  THR A CG2 
375  N N   . ILE A 52  ? 0.5486 0.4355 0.5470 0.0318  0.0311  0.0595  78  ILE A N   
376  C CA  . ILE A 52  ? 0.5410 0.4249 0.5288 0.0430  0.0286  0.0567  78  ILE A CA  
377  C C   . ILE A 52  ? 0.6114 0.5125 0.6130 0.0461  0.0268  0.0528  78  ILE A C   
378  O O   . ILE A 52  ? 0.5838 0.4916 0.5875 0.0543  0.0223  0.0477  78  ILE A O   
379  C CB  . ILE A 52  ? 0.5348 0.4004 0.5023 0.0458  0.0321  0.0610  78  ILE A CB  
380  C CG1 . ILE A 52  ? 0.6810 0.5273 0.6369 0.0420  0.0332  0.0647  78  ILE A CG1 
381  C CG2 . ILE A 52  ? 0.8272 0.6907 0.7824 0.0590  0.0291  0.0577  78  ILE A CG2 
382  C CD1 . ILE A 52  ? 0.8680 0.6947 0.8055 0.0436  0.0374  0.0710  78  ILE A CD1 
383  N N   . GLN A 53  ? 0.5883 0.4968 0.6001 0.0396  0.0301  0.0547  79  GLN A N   
384  C CA  . GLN A 53  ? 0.6504 0.5741 0.6766 0.0423  0.0279  0.0503  79  GLN A CA  
385  C C   . GLN A 53  ? 0.5700 0.5082 0.6160 0.0419  0.0235  0.0467  79  GLN A C   
386  O O   . GLN A 53  ? 0.6661 0.6145 0.7229 0.0471  0.0193  0.0413  79  GLN A O   
387  C CB  . GLN A 53  ? 0.7568 0.6859 0.7905 0.0352  0.0321  0.0531  79  GLN A CB  
388  C CG  . GLN A 53  ? 0.7453 0.6634 0.7616 0.0356  0.0373  0.0577  79  GLN A CG  
389  C CD  . GLN A 53  ? 0.7020 0.6278 0.7266 0.0286  0.0417  0.0605  79  GLN A CD  
390  O OE1 . GLN A 53  ? 0.7631 0.7012 0.8059 0.0234  0.0406  0.0587  79  GLN A OE1 
391  N NE2 . GLN A 53  ? 0.6759 0.5951 0.6872 0.0287  0.0470  0.0655  79  GLN A NE2 
392  N N   . SER A 54  ? 0.4833 0.4229 0.5348 0.0360  0.0243  0.0497  80  SER A N   
393  C CA  . SER A 54  ? 0.4557 0.4101 0.5260 0.0354  0.0213  0.0486  80  SER A CA  
394  C C   . SER A 54  ? 0.5995 0.5551 0.6658 0.0442  0.0169  0.0447  80  SER A C   
395  O O   . SER A 54  ? 0.6462 0.6144 0.7277 0.0474  0.0133  0.0412  80  SER A O   
396  C CB  . SER A 54  ? 0.3068 0.2642 0.3823 0.0281  0.0238  0.0531  80  SER A CB  
397  O OG  . SER A 54  ? 0.4365 0.3965 0.5192 0.0201  0.0274  0.0561  80  SER A OG  
398  N N   . ILE A 55  ? 0.5304 0.4729 0.5771 0.0481  0.0168  0.0451  81  ILE A N   
399  C CA  . ILE A 55  ? 0.5610 0.5046 0.6019 0.0574  0.0125  0.0414  81  ILE A CA  
400  C C   . ILE A 55  ? 0.5680 0.5138 0.6078 0.0657  0.0091  0.0357  81  ILE A C   
401  O O   . ILE A 55  ? 0.4882 0.4456 0.5377 0.0712  0.0048  0.0313  81  ILE A O   
402  C CB  . ILE A 55  ? 0.5819 0.5080 0.5998 0.0611  0.0126  0.0423  81  ILE A CB  
403  C CG1 . ILE A 55  ? 0.6606 0.5893 0.6723 0.0718  0.0078  0.0379  81  ILE A CG1 
404  C CG2 . ILE A 55  ? 0.6901 0.5970 0.6889 0.0617  0.0153  0.0442  81  ILE A CG2 
405  C CD1 . ILE A 55  ? 0.6938 0.6433 0.7248 0.0716  0.0057  0.0373  81  ILE A CD1 
406  N N   . ILE A 56  ? 0.5195 0.4557 0.5481 0.0669  0.0110  0.0357  82  ILE A N   
407  C CA  . ILE A 56  ? 0.4447 0.3842 0.4713 0.0759  0.0075  0.0296  82  ILE A CA  
408  C C   . ILE A 56  ? 0.5441 0.5023 0.5976 0.0740  0.0040  0.0249  82  ILE A C   
409  O O   . ILE A 56  ? 0.6599 0.6269 0.7203 0.0814  -0.0015 0.0178  82  ILE A O   
410  C CB  . ILE A 56  ? 0.5717 0.5002 0.5826 0.0774  0.0111  0.0317  82  ILE A CB  
411  C CG1 . ILE A 56  ? 0.7928 0.7012 0.7773 0.0808  0.0140  0.0364  82  ILE A CG1 
412  C CG2 . ILE A 56  ? 0.5433 0.4795 0.5553 0.0871  0.0071  0.0243  82  ILE A CG2 
413  C CD1 . ILE A 56  ? 0.7606 0.6588 0.7283 0.0838  0.0182  0.0400  82  ILE A CD1 
414  N N   . ALA A 57  ? 0.4876 0.4517 0.5569 0.0641  0.0068  0.0285  83  ALA A N   
415  C CA  . ALA A 57  ? 0.4547 0.4345 0.5510 0.0612  0.0037  0.0252  83  ALA A CA  
416  C C   . ALA A 57  ? 0.5071 0.4993 0.6203 0.0625  -0.0002 0.0234  83  ALA A C   
417  O O   . ALA A 57  ? 0.4360 0.4394 0.5677 0.0652  -0.0052 0.0175  83  ALA A O   
418  C CB  . ALA A 57  ? 0.5354 0.5182 0.6439 0.0506  0.0079  0.0309  83  ALA A CB  
419  N N   . ILE A 58  ? 0.3743 0.3655 0.4820 0.0609  0.0019  0.0284  84  ILE A N   
420  C CA  . ILE A 58  ? 0.4284 0.4331 0.5505 0.0627  -0.0008 0.0280  84  ILE A CA  
421  C C   . ILE A 58  ? 0.5862 0.5914 0.7001 0.0736  -0.0060 0.0205  84  ILE A C   
422  O O   . ILE A 58  ? 0.6705 0.6898 0.8035 0.0760  -0.0103 0.0162  84  ILE A O   
423  C CB  . ILE A 58  ? 0.3430 0.3478 0.4591 0.0600  0.0026  0.0347  84  ILE A CB  
424  C CG1 . ILE A 58  ? 0.3346 0.3429 0.4620 0.0499  0.0072  0.0418  84  ILE A CG1 
425  C CG2 . ILE A 58  ? 0.2600 0.2802 0.3881 0.0639  0.0001  0.0345  84  ILE A CG2 
426  C CD1 . ILE A 58  ? 0.3711 0.3828 0.4947 0.0483  0.0098  0.0474  84  ILE A CD1 
427  N N   . ILE A 59  ? 0.5639 0.5536 0.6500 0.0803  -0.0056 0.0192  85  ILE A N   
428  C CA  . ILE A 59  ? 0.6651 0.6541 0.7397 0.0921  -0.0104 0.0122  85  ILE A CA  
429  C C   . ILE A 59  ? 0.7182 0.7165 0.8064 0.0966  -0.0156 0.0037  85  ILE A C   
430  O O   . ILE A 59  ? 0.7374 0.7481 0.8371 0.1022  -0.0210 -0.0027 85  ILE A O   
431  C CB  . ILE A 59  ? 0.6961 0.6643 0.7379 0.0987  -0.0086 0.0132  85  ILE A CB  
432  C CG1 . ILE A 59  ? 0.6579 0.6159 0.6874 0.0948  -0.0048 0.0200  85  ILE A CG1 
433  C CG2 . ILE A 59  ? 0.5413 0.5092 0.5706 0.1123  -0.0138 0.0059  85  ILE A CG2 
434  C CD1 . ILE A 59  ? 0.6117 0.5817 0.6488 0.0973  -0.0072 0.0194  85  ILE A CD1 
435  N N   . ARG A 60  ? 0.6906 0.6841 0.7782 0.0944  -0.0144 0.0029  86  ARG A N   
436  C CA  . ARG A 60  ? 0.7498 0.7522 0.8503 0.0994  -0.0202 -0.0065 86  ARG A CA  
437  C C   . ARG A 60  ? 0.6986 0.7188 0.8340 0.0939  -0.0242 -0.0094 86  ARG A C   
438  O O   . ARG A 60  ? 0.6026 0.6332 0.7519 0.0998  -0.0311 -0.0190 86  ARG A O   
439  C CB  . ARG A 60  ? 0.8448 0.8408 0.9401 0.0974  -0.0177 -0.0061 86  ARG A CB  
440  C CG  . ARG A 60  ? 1.0860 1.0669 1.1491 0.1053  -0.0147 -0.0047 86  ARG A CG  
441  C CD  . ARG A 60  ? 1.1749 1.1567 1.2362 0.1084  -0.0150 -0.0084 86  ARG A CD  
442  N NE  . ARG A 60  ? 1.3363 1.3054 1.3672 0.1167  -0.0114 -0.0056 86  ARG A NE  
443  C CZ  . ARG A 60  ? 1.4541 1.4120 1.4708 0.1112  -0.0038 0.0037  86  ARG A CZ  
444  N NH1 . ARG A 60  ? 1.4442 1.4025 1.4737 0.0981  0.0004  0.0099  86  ARG A NH1 
445  N NH2 . ARG A 60  ? 1.4893 1.4362 1.4798 0.1190  -0.0003 0.0072  86  ARG A NH2 
446  N N   . ALA A 61  ? 0.5909 0.6150 0.7412 0.0829  -0.0199 -0.0009 87  ALA A N   
447  C CA  . ALA A 61  ? 0.5230 0.5632 0.7073 0.0767  -0.0224 -0.0006 87  ALA A CA  
448  C C   . ALA A 61  ? 0.5571 0.6094 0.7500 0.0818  -0.0263 -0.0039 87  ALA A C   
449  O O   . ALA A 61  ? 0.5674 0.6337 0.7877 0.0810  -0.0314 -0.0089 87  ALA A O   
450  C CB  . ALA A 61  ? 0.5102 0.5521 0.7044 0.0656  -0.0160 0.0108  87  ALA A CB  
451  N N   . MET A 62  ? 0.4869 0.5340 0.6570 0.0871  -0.0242 -0.0015 88  MET A N   
452  C CA  . MET A 62  ? 0.4512 0.5105 0.6264 0.0929  -0.0276 -0.0044 88  MET A CA  
453  C C   . MET A 62  ? 0.6046 0.6703 0.7853 0.1021  -0.0356 -0.0171 88  MET A C   
454  O O   . MET A 62  ? 0.7801 0.8621 0.9804 0.1041  -0.0399 -0.0212 88  MET A O   
455  C CB  . MET A 62  ? 0.4566 0.5062 0.6022 0.0988  -0.0247 -0.0008 88  MET A CB  
456  C CG  . MET A 62  ? 0.5580 0.6009 0.6964 0.0911  -0.0178 0.0099  88  MET A CG  
457  S SD  . MET A 62  ? 0.7355 0.7688 0.8437 0.0986  -0.0161 0.0124  88  MET A SD  
458  C CE  . MET A 62  ? 0.8358 0.8943 0.9637 0.1028  -0.0192 0.0113  88  MET A CE  
459  N N   . GLY A 63  ? 0.6326 0.6867 0.7963 0.1083  -0.0377 -0.0235 89  GLY A N   
460  C CA  . GLY A 63  ? 0.6646 0.7249 0.8314 0.1186  -0.0458 -0.0367 89  GLY A CA  
461  C C   . GLY A 63  ? 0.6726 0.7462 0.8753 0.1134  -0.0513 -0.0432 89  GLY A C   
462  O O   . GLY A 63  ? 0.6491 0.7368 0.8708 0.1177  -0.0586 -0.0527 89  GLY A O   
463  N N   . ARG A 64  ? 0.5898 0.6589 0.8029 0.1041  -0.0482 -0.0383 90  ARG A N   
464  C CA  . ARG A 64  ? 0.4928 0.5715 0.7397 0.0989  -0.0536 -0.0442 90  ARG A CA  
465  C C   . ARG A 64  ? 0.5043 0.5978 0.7860 0.0892  -0.0536 -0.0389 90  ARG A C   
466  O O   . ARG A 64  ? 0.6170 0.7210 0.9309 0.0864  -0.0599 -0.0455 90  ARG A O   
467  C CB  . ARG A 64  ? 0.6453 0.7140 0.8902 0.0932  -0.0503 -0.0407 90  ARG A CB  
468  C CG  . ARG A 64  ? 0.9079 0.9663 1.1257 0.1034  -0.0518 -0.0478 90  ARG A CG  
469  C CD  . ARG A 64  ? 1.0808 1.1313 1.2964 0.0978  -0.0478 -0.0436 90  ARG A CD  
470  N NE  . ARG A 64  ? 1.1488 1.1889 1.3466 0.0904  -0.0378 -0.0297 90  ARG A NE  
471  C CZ  . ARG A 64  ? 1.0610 1.1014 1.2732 0.0786  -0.0330 -0.0203 90  ARG A CZ  
472  N NH1 . ARG A 64  ? 0.9598 1.0093 1.2044 0.0726  -0.0366 -0.0221 90  ARG A NH1 
473  N NH2 . ARG A 64  ? 1.0135 1.0451 1.2083 0.0732  -0.0248 -0.0094 90  ARG A NH2 
474  N N   . LEU A 65  ? 0.4259 0.5206 0.7017 0.0845  -0.0465 -0.0268 91  LEU A N   
475  C CA  . LEU A 65  ? 0.4324 0.5431 0.7391 0.0762  -0.0449 -0.0194 91  LEU A CA  
476  C C   . LEU A 65  ? 0.4514 0.5755 0.7595 0.0826  -0.0476 -0.0225 91  LEU A C   
477  O O   . LEU A 65  ? 0.4280 0.5685 0.7616 0.0771  -0.0463 -0.0166 91  LEU A O   
478  C CB  . LEU A 65  ? 0.4830 0.5906 0.7857 0.0673  -0.0355 -0.0038 91  LEU A CB  
479  C CG  . LEU A 65  ? 0.4697 0.5665 0.7737 0.0600  -0.0322 0.0008  91  LEU A CG  
480  C CD1 . LEU A 65  ? 0.1930 0.2905 0.4956 0.0522  -0.0235 0.0158  91  LEU A CD1 
481  C CD2 . LEU A 65  ? 0.5941 0.6966 0.9323 0.0552  -0.0378 -0.0043 91  LEU A CD2 
482  N N   . LYS A 66  ? 0.5329 0.6509 0.8135 0.0947  -0.0509 -0.0313 92  LYS A N   
483  C CA  . LYS A 66  ? 0.7342 0.8647 1.0134 0.1029  -0.0544 -0.0362 92  LYS A CA  
484  C C   . LYS A 66  ? 0.8087 0.9455 1.0825 0.1004  -0.0475 -0.0241 92  LYS A C   
485  O O   . LYS A 66  ? 0.8976 1.0537 1.1914 0.1000  -0.0486 -0.0230 92  LYS A O   
486  C CB  . LYS A 66  ? 0.8970 1.0469 1.2147 0.1015  -0.0622 -0.0451 92  LYS A CB  
487  C CG  . LYS A 66  ? 1.0520 1.2137 1.3662 0.1132  -0.0688 -0.0561 92  LYS A CG  
488  C CD  . LYS A 66  ? 1.1436 1.2944 1.4331 0.1263  -0.0753 -0.0701 92  LYS A CD  
489  C CE  . LYS A 66  ? 1.2012 1.3658 1.4900 0.1387  -0.0829 -0.0823 92  LYS A CE  
490  N NZ  . LYS A 66  ? 1.2120 1.3681 1.4783 0.1528  -0.0897 -0.0962 92  LYS A NZ  
491  N N   . ILE A 67  ? 0.7492 0.8707 0.9963 0.0991  -0.0408 -0.0155 93  ILE A N   
492  C CA  . ILE A 67  ? 0.6857 0.8119 0.9241 0.0983  -0.0348 -0.0052 93  ILE A CA  
493  C C   . ILE A 67  ? 0.7818 0.8977 0.9841 0.1104  -0.0355 -0.0088 93  ILE A C   
494  O O   . ILE A 67  ? 0.7853 0.8815 0.9606 0.1156  -0.0361 -0.0127 93  ILE A O   
495  C CB  . ILE A 67  ? 0.6776 0.7951 0.9128 0.0887  -0.0272 0.0068  93  ILE A CB  
496  C CG1 . ILE A 67  ? 0.4620 0.5896 0.7331 0.0772  -0.0262 0.0118  93  ILE A CG1 
497  C CG2 . ILE A 67  ? 0.7125 0.8351 0.9360 0.0900  -0.0220 0.0157  93  ILE A CG2 
498  C CD1 . ILE A 67  ? 0.2185 0.3394 0.4877 0.0685  -0.0190 0.0233  93  ILE A CD1 
499  N N   . ASP A 68  ? 0.8028 0.9325 1.0050 0.1154  -0.0353 -0.0070 94  ASP A N   
500  C CA  . ASP A 68  ? 0.8778 0.9986 1.0472 0.1277  -0.0367 -0.0107 94  ASP A CA  
501  C C   . ASP A 68  ? 0.8385 0.9468 0.9855 0.1264  -0.0307 -0.0017 94  ASP A C   
502  O O   . ASP A 68  ? 0.8282 0.9433 0.9886 0.1174  -0.0256 0.0077  94  ASP A O   
503  C CB  . ASP A 68  ? 0.9162 1.0593 1.0959 0.1355  -0.0405 -0.0150 94  ASP A CB  
504  C CG  . ASP A 68  ? 0.9121 1.0663 1.1101 0.1393  -0.0479 -0.0266 94  ASP A CG  
505  O OD1 . ASP A 68  ? 0.9331 1.0757 1.1309 0.1380  -0.0507 -0.0324 94  ASP A OD1 
506  O OD2 . ASP A 68  ? 0.8600 1.0356 1.0729 0.1440  -0.0513 -0.0305 94  ASP A OD2 
507  N N   . PHE A 69  ? 0.7278 0.8178 0.8410 0.1360  -0.0318 -0.0049 95  PHE A N   
508  C CA  . PHE A 69  ? 0.6876 0.7647 0.7788 0.1362  -0.0277 0.0015  95  PHE A CA  
509  C C   . PHE A 69  ? 0.8334 0.9296 0.9290 0.1408  -0.0273 0.0042  95  PHE A C   
510  O O   . PHE A 69  ? 0.8248 0.9370 0.9265 0.1488  -0.0312 -0.0010 95  PHE A O   
511  C CB  . PHE A 69  ? 0.6375 0.6880 0.6929 0.1452  -0.0294 -0.0027 95  PHE A CB  
512  C CG  . PHE A 69  ? 0.8269 0.8577 0.8741 0.1407  -0.0281 -0.0030 95  PHE A CG  
513  C CD1 . PHE A 69  ? 0.9124 0.9269 0.9509 0.1323  -0.0230 0.0038  95  PHE A CD1 
514  C CD2 . PHE A 69  ? 0.9348 0.9653 0.9832 0.1456  -0.0320 -0.0105 95  PHE A CD2 
515  C CE1 . PHE A 69  ? 0.8528 0.8515 0.8843 0.1284  -0.0213 0.0041  95  PHE A CE1 
516  C CE2 . PHE A 69  ? 0.9862 1.0011 1.0264 0.1428  -0.0306 -0.0104 95  PHE A CE2 
517  C CZ  . PHE A 69  ? 0.8738 0.8730 0.9057 0.1339  -0.0249 -0.0027 95  PHE A CZ  
518  N N   . GLY A 70  ? 0.9060 1.0019 0.9985 0.1365  -0.0228 0.0121  96  GLY A N   
519  C CA  . GLY A 70  ? 0.9416 1.0561 1.0355 0.1422  -0.0221 0.0151  96  GLY A CA  
520  C C   . GLY A 70  ? 1.0082 1.1144 1.0746 0.1569  -0.0267 0.0078  96  GLY A C   
521  O O   . GLY A 70  ? 0.9318 1.0579 1.0017 0.1652  -0.0285 0.0063  96  GLY A O   
522  N N   . ASP A 71  ? 1.1831 1.2599 1.2222 0.1604  -0.0285 0.0037  97  ASP A N   
523  C CA  . ASP A 71  ? 1.3905 1.4545 1.4015 0.1747  -0.0333 -0.0030 97  ASP A CA  
524  C C   . ASP A 71  ? 1.5275 1.5749 1.5269 0.1789  -0.0364 -0.0093 97  ASP A C   
525  O O   . ASP A 71  ? 1.6344 1.6625 1.6282 0.1721  -0.0342 -0.0074 97  ASP A O   
526  C CB  . ASP A 71  ? 1.5377 1.5797 1.5236 0.1767  -0.0324 -0.0010 97  ASP A CB  
527  C CG  . ASP A 71  ? 1.7254 1.7548 1.6835 0.1922  -0.0377 -0.0076 97  ASP A CG  
528  O OD1 . ASP A 71  ? 1.8095 1.8496 1.7673 0.2021  -0.0416 -0.0134 97  ASP A OD1 
529  O OD2 . ASP A 71  ? 1.7762 1.7848 1.7132 0.1948  -0.0382 -0.0073 97  ASP A OD2 
530  N N   . SER A 72  ? 1.5034 1.5598 1.4990 0.1908  -0.0416 -0.0168 98  SER A N   
531  C CA  . SER A 72  ? 1.3862 1.4313 1.3716 0.1971  -0.0452 -0.0235 98  SER A CA  
532  C C   . SER A 72  ? 1.2496 1.2601 1.2014 0.2017  -0.0447 -0.0227 98  SER A C   
533  O O   . SER A 72  ? 1.0607 1.0586 1.0014 0.2060  -0.0462 -0.0261 98  SER A O   
534  C CB  . SER A 72  ? 1.3783 1.4413 1.3648 0.2107  -0.0512 -0.0322 98  SER A CB  
535  O OG  . SER A 72  ? 1.3877 1.4471 1.3529 0.2225  -0.0533 -0.0337 98  SER A OG  
536  N N   . ALA A 73  ? 1.2882 1.2838 1.2244 0.2011  -0.0428 -0.0183 99  ALA A N   
537  C CA  . ALA A 73  ? 1.2660 1.2277 1.1724 0.2043  -0.0422 -0.0165 99  ALA A CA  
538  C C   . ALA A 73  ? 1.1706 1.1169 1.0800 0.1910  -0.0369 -0.0103 99  ALA A C   
539  O O   . ALA A 73  ? 0.9556 0.8770 0.8449 0.1930  -0.0359 -0.0087 99  ALA A O   
540  C CB  . ALA A 73  ? 1.2729 1.2245 1.1640 0.2084  -0.0431 -0.0153 99  ALA A CB  
541  N N   . ARG A 74  ? 1.3238 1.2857 1.2585 0.1778  -0.0333 -0.0063 100 ARG A N   
542  C CA  . ARG A 74  ? 1.3537 1.3042 1.2934 0.1649  -0.0283 -0.0006 100 ARG A CA  
543  C C   . ARG A 74  ? 1.3052 1.2509 1.2437 0.1661  -0.0284 -0.0029 100 ARG A C   
544  O O   . ARG A 74  ? 1.2834 1.2142 1.2173 0.1591  -0.0246 0.0014  100 ARG A O   
545  C CB  . ARG A 74  ? 1.2653 1.2364 1.2337 0.1523  -0.0250 0.0037  100 ARG A CB  
546  C CG  . ARG A 74  ? 1.2316 1.2116 1.2026 0.1517  -0.0244 0.0064  100 ARG A CG  
547  C CD  . ARG A 74  ? 1.2107 1.1674 1.1643 0.1478  -0.0223 0.0100  100 ARG A CD  
548  N NE  . ARG A 74  ? 1.2817 1.2136 1.2065 0.1579  -0.0254 0.0068  100 ARG A NE  
549  C CZ  . ARG A 74  ? 1.3775 1.3071 1.2884 0.1684  -0.0294 0.0033  100 ARG A CZ  
550  N NH1 . ARG A 74  ? 1.3875 1.3403 1.3102 0.1706  -0.0304 0.0026  100 ARG A NH1 
551  N NH2 . ARG A 74  ? 1.3921 1.2965 1.2771 0.1774  -0.0322 0.0008  100 ARG A NH2 
552  N N   . ALA A 75  ? 1.2408 1.2004 1.1836 0.1757  -0.0331 -0.0101 101 ALA A N   
553  C CA  . ALA A 75  ? 1.2844 1.2430 1.2265 0.1793  -0.0346 -0.0142 101 ALA A CA  
554  C C   . ALA A 75  ? 1.3044 1.2345 1.2183 0.1827  -0.0319 -0.0104 101 ALA A C   
555  O O   . ALA A 75  ? 1.3167 1.2418 1.2323 0.1777  -0.0290 -0.0083 101 ALA A O   
556  C CB  . ALA A 75  ? 1.3668 1.3415 1.3111 0.1925  -0.0412 -0.0238 101 ALA A CB  
557  N N   . ASP A 76  ? 1.3773 1.2893 1.2657 0.1915  -0.0327 -0.0093 102 ASP A N   
558  C CA  . ASP A 76  ? 1.4313 1.3148 1.2930 0.1950  -0.0298 -0.0041 102 ASP A CA  
559  C C   . ASP A 76  ? 1.3028 1.1728 1.1676 0.1799  -0.0233 0.0047  102 ASP A C   
560  O O   . ASP A 76  ? 1.3369 1.1941 1.1933 0.1774  -0.0192 0.0095  102 ASP A O   
561  C CB  . ASP A 76  ? 1.6199 1.4857 1.4560 0.2070  -0.0326 -0.0044 102 ASP A CB  
562  C CG  . ASP A 76  ? 1.7857 1.6209 1.5945 0.2112  -0.0294 0.0021  102 ASP A CG  
563  O OD1 . ASP A 76  ? 1.8260 1.6582 1.6329 0.2096  -0.0260 0.0051  102 ASP A OD1 
564  O OD2 . ASP A 76  ? 1.8245 1.6388 1.6140 0.2164  -0.0304 0.0044  102 ASP A OD2 
565  N N   . ASP A 77  ? 1.1034 0.9781 0.9803 0.1705  -0.0223 0.0069  103 ASP A N   
566  C CA  . ASP A 77  ? 0.9699 0.8341 0.8513 0.1563  -0.0168 0.0142  103 ASP A CA  
567  C C   . ASP A 77  ? 0.9829 0.8561 0.8802 0.1471  -0.0130 0.0163  103 ASP A C   
568  O O   . ASP A 77  ? 1.0521 0.9111 0.9440 0.1398  -0.0081 0.0224  103 ASP A O   
569  C CB  . ASP A 77  ? 1.0068 0.8811 0.9015 0.1495  -0.0172 0.0145  103 ASP A CB  
570  C CG  . ASP A 77  ? 1.1009 0.9621 0.9777 0.1578  -0.0206 0.0128  103 ASP A CG  
571  O OD1 . ASP A 77  ? 1.2106 1.0514 1.0644 0.1674  -0.0222 0.0125  103 ASP A OD1 
572  O OD2 . ASP A 77  ? 1.0026 0.8740 0.8878 0.1556  -0.0219 0.0119  103 ASP A OD2 
573  N N   . ALA A 78  ? 0.9717 0.8688 0.8894 0.1475  -0.0156 0.0110  104 ALA A N   
574  C CA  . ALA A 78  ? 0.9924 0.8987 0.9256 0.1407  -0.0134 0.0112  104 ALA A CA  
575  C C   . ALA A 78  ? 1.0174 0.9094 0.9314 0.1471  -0.0118 0.0123  104 ALA A C   
576  O O   . ALA A 78  ? 1.0441 0.9310 0.9594 0.1399  -0.0072 0.0169  104 ALA A O   
577  C CB  . ALA A 78  ? 1.0210 0.9533 0.9784 0.1424  -0.0180 0.0039  104 ALA A CB  
578  N N   . ARG A 79  ? 0.9991 0.8857 0.8948 0.1616  -0.0154 0.0083  105 ARG A N   
579  C CA  . ARG A 79  ? 1.0950 0.9680 0.9692 0.1703  -0.0137 0.0102  105 ARG A CA  
580  C C   . ARG A 79  ? 1.1253 0.9725 0.9817 0.1646  -0.0072 0.0210  105 ARG A C   
581  O O   . ARG A 79  ? 1.0832 0.9233 0.9338 0.1618  -0.0021 0.0266  105 ARG A O   
582  C CB  . ARG A 79  ? 1.1068 0.9790 0.9637 0.1880  -0.0191 0.0041  105 ARG A CB  
583  C CG  . ARG A 79  ? 1.0768 0.9750 0.9528 0.1936  -0.0262 -0.0073 105 ARG A CG  
584  C CD  . ARG A 79  ? 0.9659 0.8636 0.8237 0.2119  -0.0318 -0.0137 105 ARG A CD  
585  N NE  . ARG A 79  ? 1.0094 0.9330 0.8876 0.2161  -0.0388 -0.0245 105 ARG A NE  
586  C CZ  . ARG A 79  ? 1.2424 1.1848 1.1359 0.2199  -0.0431 -0.0333 105 ARG A CZ  
587  N NH1 . ARG A 79  ? 1.3066 1.2455 1.1953 0.2212  -0.0413 -0.0330 105 ARG A NH1 
588  N NH2 . ARG A 79  ? 1.3089 1.2745 1.2232 0.2226  -0.0495 -0.0428 105 ARG A NH2 
589  N N   . GLN A 80  ? 1.0879 0.9221 0.9366 0.1631  -0.0075 0.0235  106 GLN A N   
590  C CA  . GLN A 80  ? 1.0980 0.9069 0.9329 0.1566  -0.0024 0.0328  106 GLN A CA  
591  C C   . GLN A 80  ? 1.0836 0.8952 0.9337 0.1407  0.0034  0.0384  106 GLN A C   
592  O O   . GLN A 80  ? 0.9938 0.7899 0.8342 0.1365  0.0091  0.0465  106 GLN A O   
593  C CB  . GLN A 80  ? 1.0128 0.8117 0.8432 0.1564  -0.0054 0.0320  106 GLN A CB  
594  C CG  . GLN A 80  ? 1.2038 0.9948 1.0148 0.1728  -0.0107 0.0277  106 GLN A CG  
595  C CD  . GLN A 80  ? 1.5132 1.2782 1.2979 0.1808  -0.0081 0.0343  106 GLN A CD  
596  O OE1 . GLN A 80  ? 1.5359 1.2872 1.3169 0.1730  -0.0018 0.0430  106 GLN A OE1 
597  N NE2 . GLN A 80  ? 1.6689 1.4276 1.4352 0.1969  -0.0126 0.0306  106 GLN A NE2 
598  N N   . LEU A 81  ? 0.9494 0.7812 0.8236 0.1322  0.0022  0.0346  107 LEU A N   
599  C CA  . LEU A 81  ? 0.8226 0.6593 0.7126 0.1177  0.0071  0.0391  107 LEU A CA  
600  C C   . LEU A 81  ? 1.0234 0.8578 0.9086 0.1176  0.0117  0.0431  107 LEU A C   
601  O O   . LEU A 81  ? 1.0475 0.8695 0.9279 0.1097  0.0176  0.0509  107 LEU A O   
602  C CB  . LEU A 81  ? 0.4975 0.3591 0.4142 0.1119  0.0046  0.0340  107 LEU A CB  
603  C CG  . LEU A 81  ? 0.5966 0.4658 0.5309 0.0982  0.0091  0.0378  107 LEU A CG  
604  C CD1 . LEU A 81  ? 0.7377 0.5912 0.6666 0.0885  0.0133  0.0445  107 LEU A CD1 
605  C CD2 . LEU A 81  ? 0.5354 0.4278 0.4958 0.0935  0.0065  0.0339  107 LEU A CD2 
606  N N   . PHE A 82  ? 1.0515 0.8992 0.9384 0.1269  0.0088  0.0374  108 PHE A N   
607  C CA  . PHE A 82  ? 1.0138 0.8636 0.8967 0.1290  0.0124  0.0397  108 PHE A CA  
608  C C   . PHE A 82  ? 0.9777 0.8062 0.8340 0.1352  0.0172  0.0481  108 PHE A C   
609  O O   . PHE A 82  ? 0.9791 0.8043 0.8313 0.1318  0.0232  0.0549  108 PHE A O   
610  C CB  . PHE A 82  ? 0.9607 0.8300 0.8514 0.1394  0.0067  0.0296  108 PHE A CB  
611  C CG  . PHE A 82  ? 0.8977 0.7878 0.8174 0.1322  0.0028  0.0228  108 PHE A CG  
612  C CD1 . PHE A 82  ? 0.8655 0.7674 0.8020 0.1252  0.0043  0.0221  108 PHE A CD1 
613  C CD2 . PHE A 82  ? 0.8944 0.7927 0.8250 0.1327  -0.0022 0.0177  108 PHE A CD2 
614  C CE1 . PHE A 82  ? 0.9115 0.8307 0.8753 0.1186  0.0008  0.0168  108 PHE A CE1 
615  C CE2 . PHE A 82  ? 0.9723 0.8897 0.9306 0.1258  -0.0051 0.0133  108 PHE A CE2 
616  C CZ  . PHE A 82  ? 0.9953 0.9223 0.9705 0.1185  -0.0036 0.0130  108 PHE A CZ  
617  N N   . VAL A 83  ? 0.9412 0.7557 0.7797 0.1446  0.0146  0.0481  109 VAL A N   
618  C CA  . VAL A 83  ? 0.9121 0.7038 0.7250 0.1510  0.0191  0.0572  109 VAL A CA  
619  C C   . VAL A 83  ? 0.8780 0.6503 0.6901 0.1372  0.0251  0.0675  109 VAL A C   
620  O O   . VAL A 83  ? 0.8783 0.6407 0.6826 0.1338  0.0321  0.0774  109 VAL A O   
621  C CB  . VAL A 83  ? 1.0066 0.7879 0.8008 0.1658  0.0139  0.0539  109 VAL A CB  
622  C CG1 . VAL A 83  ? 0.9611 0.7164 0.7292 0.1720  0.0190  0.0649  109 VAL A CG1 
623  C CG2 . VAL A 83  ? 1.1106 0.9120 0.9060 0.1800  0.0076  0.0431  109 VAL A CG2 
624  N N   . LEU A 84  ? 0.9680 0.7363 0.7888 0.1296  0.0221  0.0649  110 LEU A N   
625  C CA  . LEU A 84  ? 0.9258 0.6769 0.7484 0.1165  0.0261  0.0722  110 LEU A CA  
626  C C   . LEU A 84  ? 0.8690 0.6304 0.7082 0.1025  0.0319  0.0763  110 LEU A C   
627  O O   . LEU A 84  ? 0.7655 0.5131 0.6041 0.0924  0.0373  0.0846  110 LEU A O   
628  C CB  . LEU A 84  ? 0.9319 0.6818 0.7619 0.1131  0.0205  0.0661  110 LEU A CB  
629  C CG  . LEU A 84  ? 1.0099 0.7505 0.8243 0.1269  0.0142  0.0612  110 LEU A CG  
630  C CD1 . LEU A 84  ? 1.1399 0.8861 0.9646 0.1238  0.0087  0.0544  110 LEU A CD1 
631  C CD2 . LEU A 84  ? 0.9882 0.6986 0.7795 0.1321  0.0164  0.0691  110 LEU A CD2 
632  N N   . ALA A 85  ? 0.8798 0.6656 0.7349 0.1019  0.0304  0.0702  111 ALA A N   
633  C CA  . ALA A 85  ? 0.8129 0.6107 0.6836 0.0905  0.0352  0.0731  111 ALA A CA  
634  C C   . ALA A 85  ? 1.0573 0.8571 0.9185 0.0959  0.0404  0.0784  111 ALA A C   
635  O O   . ALA A 85  ? 1.1389 0.9421 1.0064 0.0871  0.0464  0.0842  111 ALA A O   
636  C CB  . ALA A 85  ? 0.5210 0.3428 0.4144 0.0872  0.0309  0.0644  111 ALA A CB  
637  N N   . GLY A 86  ? 1.0207 0.8201 0.8664 0.1113  0.0380  0.0761  112 GLY A N   
638  C CA  . GLY A 86  ? 0.9754 0.7768 0.8085 0.1193  0.0428  0.0813  112 GLY A CA  
639  C C   . GLY A 86  ? 1.1189 0.8966 0.9336 0.1180  0.0501  0.0950  112 GLY A C   
640  O O   . GLY A 86  ? 1.2921 1.0699 1.0976 0.1209  0.0568  0.1034  112 GLY A O   
641  N N   . ALA A 87  ? 1.1481 0.9058 0.9586 0.1136  0.0488  0.0973  113 ALA A N   
642  C CA  . ALA A 87  ? 1.2412 0.9726 1.0347 0.1130  0.0545  0.1099  113 ALA A CA  
643  C C   . ALA A 87  ? 1.3805 1.0998 1.1855 0.0947  0.0590  0.1170  113 ALA A C   
644  O O   . ALA A 87  ? 1.3608 1.0637 1.1579 0.0905  0.0662  0.1296  113 ALA A O   
645  C CB  . ALA A 87  ? 1.1390 0.8526 0.9151 0.1248  0.0491  0.1076  113 ALA A CB  
646  N N   . ALA A 88  ? 1.4638 1.1917 1.2879 0.0841  0.0549  0.1092  114 ALA A N   
647  C CA  . ALA A 88  ? 1.4557 1.1760 1.2929 0.0671  0.0582  0.1138  114 ALA A CA  
648  C C   . ALA A 88  ? 1.3917 1.1271 1.2402 0.0582  0.0655  0.1194  114 ALA A C   
649  O O   . ALA A 88  ? 1.2315 0.9804 1.0752 0.0660  0.0683  0.1206  114 ALA A O   
650  C CB  . ALA A 88  ? 1.4027 1.1296 1.2552 0.0607  0.0513  0.1035  114 ALA A CB  
651  N N   . GLU A 89  ? 1.4733 1.2074 1.3369 0.0425  0.0681  0.1218  115 GLU A N   
652  C CA  . GLU A 89  ? 1.5263 1.2738 1.4007 0.0334  0.0755  0.1278  115 GLU A CA  
653  C C   . GLU A 89  ? 1.5047 1.2617 1.4011 0.0183  0.0743  0.1234  115 GLU A C   
654  O O   . GLU A 89  ? 1.3546 1.1137 1.2588 0.0169  0.0674  0.1142  115 GLU A O   
655  C CB  . GLU A 89  ? 1.5178 1.2484 1.3822 0.0302  0.0842  0.1427  115 GLU A CB  
656  C CG  . GLU A 89  ? 1.5264 1.2324 1.3936 0.0192  0.0841  0.1469  115 GLU A CG  
657  C CD  . GLU A 89  ? 1.6190 1.3086 1.4802 0.0140  0.0935  0.1630  115 GLU A CD  
658  O OE1 . GLU A 89  ? 1.6594 1.3482 1.5045 0.0247  0.0988  0.1717  115 GLU A OE1 
659  O OE2 . GLU A 89  ? 1.6568 1.3350 1.5299 -0.0004 0.0955  0.1671  115 GLU A OE2 
660  N N   . GLU A 90  ? 1.5708 1.3349 1.4769 0.0078  0.0814  0.1303  116 GLU A N   
661  C CA  . GLU A 90  ? 1.6187 1.3923 1.5453 -0.0064 0.0810  0.1269  116 GLU A CA  
662  C C   . GLU A 90  ? 1.6751 1.4273 1.6046 -0.0164 0.0799  0.1290  116 GLU A C   
663  O O   . GLU A 90  ? 1.6688 1.3993 1.5873 -0.0162 0.0832  0.1376  116 GLU A O   
664  C CB  . GLU A 90  ? 1.5502 1.3406 1.4863 -0.0133 0.0887  0.1330  116 GLU A CB  
665  C CG  . GLU A 90  ? 1.4704 1.2808 1.4028 -0.0025 0.0898  0.1310  116 GLU A CG  
666  C CD  . GLU A 90  ? 1.3792 1.2059 1.3189 -0.0079 0.0976  0.1375  116 GLU A CD  
667  O OE1 . GLU A 90  ? 1.2991 1.1255 1.2509 -0.0216 0.1016  0.1418  116 GLU A OE1 
668  O OE2 . GLU A 90  ? 1.3239 1.1648 1.2577 0.0020  0.0995  0.1375  116 GLU A OE2 
669  N N   . GLY A 91  ? 1.6191 1.3775 1.5638 -0.0244 0.0750  0.1209  117 GLY A N   
670  C CA  . GLY A 91  ? 1.5586 1.2990 1.5083 -0.0334 0.0723  0.1201  117 GLY A CA  
671  C C   . GLY A 91  ? 1.5281 1.2432 1.4614 -0.0251 0.0676  0.1195  117 GLY A C   
672  O O   . GLY A 91  ? 1.4880 1.1806 1.4199 -0.0308 0.0677  0.1235  117 GLY A O   
673  N N   . PHE A 92  ? 1.5385 1.2576 1.4605 -0.0114 0.0630  0.1141  118 PHE A N   
674  C CA  . PHE A 92  ? 1.4875 1.1850 1.3925 -0.0012 0.0582  0.1128  118 PHE A CA  
675  C C   . PHE A 92  ? 1.2855 0.9949 1.1887 0.0094  0.0502  0.1014  118 PHE A C   
676  O O   . PHE A 92  ? 1.3554 1.0822 1.2571 0.0172  0.0503  0.0992  118 PHE A O   
677  C CB  . PHE A 92  ? 1.6400 1.3265 1.5266 0.0078  0.0637  0.1229  118 PHE A CB  
678  C CG  . PHE A 92  ? 1.6921 1.3482 1.5625 0.0134  0.0616  0.1266  118 PHE A CG  
679  C CD1 . PHE A 92  ? 1.7095 1.3572 1.5729 0.0219  0.0526  0.1172  118 PHE A CD1 
680  C CD2 . PHE A 92  ? 1.7497 1.3862 1.6120 0.0108  0.0687  0.1402  118 PHE A CD2 
681  C CE1 . PHE A 92  ? 1.7912 1.4101 1.6392 0.0280  0.0500  0.1201  118 PHE A CE1 
682  C CE2 . PHE A 92  ? 1.8382 1.4449 1.6858 0.0163  0.0666  0.1443  118 PHE A CE2 
683  C CZ  . PHE A 92  ? 1.8410 1.4384 1.6811 0.0251  0.0569  0.1337  118 PHE A CZ  
684  N N   . MET A 93  ? 1.0155 0.7162 0.9196 0.0097  0.0431  0.0941  119 MET A N   
685  C CA  . MET A 93  ? 0.9363 0.6496 0.8399 0.0193  0.0358  0.0840  119 MET A CA  
686  C C   . MET A 93  ? 1.1279 0.8205 1.0164 0.0289  0.0293  0.0802  119 MET A C   
687  O O   . MET A 93  ? 1.3867 1.0708 1.2788 0.0259  0.0241  0.0748  119 MET A O   
688  C CB  . MET A 93  ? 0.8881 0.6206 0.8105 0.0117  0.0330  0.0771  119 MET A CB  
689  C CG  . MET A 93  ? 0.8880 0.6386 0.8128 0.0208  0.0271  0.0686  119 MET A CG  
690  S SD  . MET A 93  ? 1.2825 1.0517 1.2057 0.0298  0.0293  0.0696  119 MET A SD  
691  C CE  . MET A 93  ? 0.6053 0.3961 0.5373 0.0367  0.0226  0.0605  119 MET A CE  
692  N N   . THR A 94  ? 0.9759 0.6612 0.8475 0.0413  0.0290  0.0822  120 THR A N   
693  C CA  . THR A 94  ? 0.9437 0.6091 0.7991 0.0522  0.0229  0.0788  120 THR A CA  
694  C C   . THR A 94  ? 0.9883 0.6672 0.8482 0.0580  0.0147  0.0672  120 THR A C   
695  O O   . THR A 94  ? 0.8675 0.5731 0.7385 0.0587  0.0143  0.0630  120 THR A O   
696  C CB  . THR A 94  ? 0.9618 0.6209 0.7980 0.0660  0.0242  0.0827  120 THR A CB  
697  O OG1 . THR A 94  ? 0.8754 0.5604 0.7148 0.0743  0.0219  0.0763  120 THR A OG1 
698  C CG2 . THR A 94  ? 1.0557 0.7075 0.8874 0.0619  0.0332  0.0949  120 THR A CG2 
699  N N   . ALA A 95  ? 1.0558 0.7166 0.9076 0.0626  0.0083  0.0625  121 ALA A N   
700  C CA  . ALA A 95  ? 0.9372 0.6107 0.7910 0.0700  0.0005  0.0517  121 ALA A CA  
701  C C   . ALA A 95  ? 0.9932 0.6821 0.8393 0.0839  -0.0014 0.0487  121 ALA A C   
702  O O   . ALA A 95  ? 1.1011 0.8119 0.9544 0.0886  -0.0053 0.0418  121 ALA A O   
703  C CB  . ALA A 95  ? 0.9203 0.5693 0.7648 0.0739  -0.0066 0.0467  121 ALA A CB  
704  N N   . GLU A 96  ? 0.8072 0.4854 0.6392 0.0907  0.0015  0.0543  122 GLU A N   
705  C CA  . GLU A 96  ? 0.7726 0.4651 0.5975 0.1041  -0.0005 0.0510  122 GLU A CA  
706  C C   . GLU A 96  ? 0.8657 0.5885 0.7076 0.0999  0.0029  0.0505  122 GLU A C   
707  O O   . GLU A 96  ? 0.8808 0.6251 0.7288 0.1064  -0.0006 0.0444  122 GLU A O   
708  C CB  . GLU A 96  ? 0.8273 0.5001 0.6318 0.1133  0.0016  0.0570  122 GLU A CB  
709  C CG  . GLU A 96  ? 1.1819 0.8693 0.9785 0.1282  -0.0011 0.0526  122 GLU A CG  
710  C CD  . GLU A 96  ? 1.5436 1.2133 1.3192 0.1383  0.0013  0.0588  122 GLU A CD  
711  O OE1 . GLU A 96  ? 1.7162 1.3605 1.4828 0.1339  0.0054  0.0676  122 GLU A OE1 
712  O OE2 . GLU A 96  ? 1.5637 1.2453 1.3323 0.1509  -0.0008 0.0550  122 GLU A OE2 
713  N N   . LEU A 97  ? 0.8628 0.5873 0.7131 0.0889  0.0095  0.0571  123 LEU A N   
714  C CA  . LEU A 97  ? 0.8644 0.6152 0.7311 0.0846  0.0125  0.0567  123 LEU A CA  
715  C C   . LEU A 97  ? 0.7608 0.5327 0.6466 0.0788  0.0100  0.0514  123 LEU A C   
716  O O   . LEU A 97  ? 0.6566 0.4514 0.5533 0.0822  0.0084  0.0475  123 LEU A O   
717  C CB  . LEU A 97  ? 0.7909 0.5384 0.6618 0.0743  0.0200  0.0648  123 LEU A CB  
718  C CG  . LEU A 97  ? 0.7297 0.5026 0.6178 0.0695  0.0230  0.0643  123 LEU A CG  
719  C CD1 . LEU A 97  ? 0.7114 0.4987 0.5974 0.0815  0.0201  0.0596  123 LEU A CD1 
720  C CD2 . LEU A 97  ? 0.6478 0.4163 0.5372 0.0610  0.0304  0.0724  123 LEU A CD2 
721  N N   . ALA A 98  ? 0.6570 0.4214 0.5475 0.0704  0.0095  0.0514  124 ALA A N   
722  C CA  . ALA A 98  ? 0.7267 0.5105 0.6332 0.0662  0.0071  0.0467  124 ALA A CA  
723  C C   . ALA A 98  ? 0.9202 0.7155 0.8240 0.0781  0.0011  0.0402  124 ALA A C   
724  O O   . ALA A 98  ? 1.1258 0.9459 1.0439 0.0784  0.0005  0.0379  124 ALA A O   
725  C CB  . ALA A 98  ? 0.8482 0.6197 0.7572 0.0577  0.0063  0.0462  124 ALA A CB  
726  N N   . GLY A 99  ? 0.8795 0.6568 0.7651 0.0883  -0.0031 0.0376  125 GLY A N   
727  C CA  . GLY A 99  ? 0.7644 0.5520 0.6452 0.1010  -0.0089 0.0313  125 GLY A CA  
728  C C   . GLY A 99  ? 0.8437 0.6532 0.7314 0.1066  -0.0082 0.0307  125 GLY A C   
729  O O   . GLY A 99  ? 0.9214 0.7537 0.8193 0.1107  -0.0106 0.0270  125 GLY A O   
730  N N   . VAL A 100 ? 0.8352 0.6385 0.7181 0.1069  -0.0049 0.0342  126 VAL A N   
731  C CA  . VAL A 100 ? 0.6822 0.5054 0.5730 0.1118  -0.0048 0.0325  126 VAL A CA  
732  C C   . VAL A 100 ? 0.5895 0.4380 0.5054 0.1025  -0.0025 0.0332  126 VAL A C   
733  O O   . VAL A 100 ? 0.5978 0.4684 0.5263 0.1062  -0.0048 0.0299  126 VAL A O   
734  C CB  . VAL A 100 ? 0.7173 0.5293 0.5977 0.1142  -0.0018 0.0359  126 VAL A CB  
735  C CG1 . VAL A 100 ? 0.7685 0.6033 0.6621 0.1169  -0.0020 0.0331  126 VAL A CG1 
736  C CG2 . VAL A 100 ? 0.4962 0.2861 0.3516 0.1264  -0.0045 0.0355  126 VAL A CG2 
737  N N   . ILE A 101 ? 0.5184 0.3639 0.4422 0.0905  0.0023  0.0379  127 ILE A N   
738  C CA  . ILE A 101 ? 0.5853 0.4524 0.5322 0.0815  0.0047  0.0391  127 ILE A CA  
739  C C   . ILE A 101 ? 0.6934 0.5768 0.6507 0.0821  0.0021  0.0369  127 ILE A C   
740  O O   . ILE A 101 ? 0.7897 0.6960 0.7650 0.0813  0.0022  0.0368  127 ILE A O   
741  C CB  . ILE A 101 ? 0.7192 0.5787 0.6705 0.0691  0.0098  0.0442  127 ILE A CB  
742  C CG1 . ILE A 101 ? 0.6848 0.5295 0.6250 0.0690  0.0132  0.0476  127 ILE A CG1 
743  C CG2 . ILE A 101 ? 0.8535 0.7352 0.8279 0.0609  0.0120  0.0455  127 ILE A CG2 
744  C CD1 . ILE A 101 ? 0.6688 0.5066 0.6128 0.0571  0.0186  0.0531  127 ILE A CD1 
745  N N   . LYS A 102 ? 0.6735 0.5453 0.6199 0.0839  -0.0003 0.0353  128 LYS A N   
746  C CA  . LYS A 102 ? 0.6998 0.5870 0.6534 0.0861  -0.0028 0.0330  128 LYS A CA  
747  C C   . LYS A 102 ? 0.7267 0.6324 0.6835 0.0967  -0.0061 0.0300  128 LYS A C   
748  O O   . LYS A 102 ? 0.7508 0.6812 0.7252 0.0957  -0.0052 0.0314  128 LYS A O   
749  C CB  . LYS A 102 ? 0.8630 0.7318 0.8020 0.0881  -0.0062 0.0300  128 LYS A CB  
750  C CG  . LYS A 102 ? 1.0941 0.9795 1.0393 0.0912  -0.0091 0.0269  128 LYS A CG  
751  C CD  . LYS A 102 ? 1.3012 1.1669 1.2326 0.0934  -0.0136 0.0221  128 LYS A CD  
752  C CE  . LYS A 102 ? 1.3972 1.2815 1.3335 0.0985  -0.0171 0.0181  128 LYS A CE  
753  N NZ  . LYS A 102 ? 1.4552 1.3204 1.3786 0.1018  -0.0230 0.0114  128 LYS A NZ  
754  N N   . ARG A 103 ? 0.7645 0.6586 0.7048 0.1071  -0.0095 0.0264  129 ARG A N   
755  C CA  . ARG A 103 ? 0.8177 0.7293 0.7601 0.1180  -0.0130 0.0228  129 ARG A CA  
756  C C   . ARG A 103 ? 0.9767 0.9106 0.9403 0.1147  -0.0107 0.0246  129 ARG A C   
757  O O   . ARG A 103 ? 1.1022 1.0599 1.0798 0.1180  -0.0117 0.0241  129 ARG A O   
758  C CB  . ARG A 103 ? 0.8534 0.7471 0.7734 0.1300  -0.0170 0.0185  129 ARG A CB  
759  C CG  . ARG A 103 ? 0.9969 0.8700 0.8973 0.1355  -0.0208 0.0157  129 ARG A CG  
760  C CD  . ARG A 103 ? 1.0002 0.8586 0.8793 0.1494  -0.0253 0.0114  129 ARG A CD  
761  N NE  . ARG A 103 ? 1.0123 0.8525 0.8815 0.1488  -0.0230 0.0142  129 ARG A NE  
762  C CZ  . ARG A 103 ? 1.0439 0.8551 0.8987 0.1454  -0.0215 0.0176  129 ARG A CZ  
763  N NH1 . ARG A 103 ? 0.9664 0.7623 0.8165 0.1415  -0.0227 0.0175  129 ARG A NH1 
764  N NH2 . ARG A 103 ? 1.1111 0.9093 0.9570 0.1462  -0.0187 0.0212  129 ARG A NH2 
765  N N   . LEU A 104 ? 0.8814 0.8076 0.8479 0.1083  -0.0079 0.0267  130 LEU A N   
766  C CA  . LEU A 104 ? 0.7534 0.6982 0.7409 0.1047  -0.0066 0.0273  130 LEU A CA  
767  C C   . LEU A 104 ? 0.7816 0.7457 0.7922 0.0954  -0.0035 0.0319  130 LEU A C   
768  O O   . LEU A 104 ? 0.8454 0.8317 0.8759 0.0955  -0.0038 0.0325  130 LEU A O   
769  C CB  . LEU A 104 ? 0.7550 0.6868 0.7388 0.1008  -0.0044 0.0280  130 LEU A CB  
770  C CG  . LEU A 104 ? 0.7266 0.6446 0.6910 0.1113  -0.0071 0.0241  130 LEU A CG  
771  C CD1 . LEU A 104 ? 0.7657 0.6704 0.7241 0.1073  -0.0038 0.0265  130 LEU A CD1 
772  C CD2 . LEU A 104 ? 0.6103 0.5469 0.5844 0.1197  -0.0113 0.0184  130 LEU A CD2 
773  N N   . TRP A 105 ? 0.7334 0.6891 0.7419 0.0877  -0.0006 0.0354  131 TRP A N   
774  C CA  . TRP A 105 ? 0.7542 0.7269 0.7823 0.0796  0.0025  0.0401  131 TRP A CA  
775  C C   . TRP A 105 ? 0.7698 0.7627 0.8049 0.0851  0.0012  0.0408  131 TRP A C   
776  O O   . TRP A 105 ? 0.7757 0.7884 0.8301 0.0808  0.0038  0.0457  131 TRP A O   
777  C CB  . TRP A 105 ? 0.8044 0.7635 0.8264 0.0715  0.0052  0.0424  131 TRP A CB  
778  C CG  . TRP A 105 ? 0.7971 0.7732 0.8374 0.0641  0.0083  0.0471  131 TRP A CG  
779  C CD1 . TRP A 105 ? 0.8086 0.7872 0.8472 0.0625  0.0086  0.0480  131 TRP A CD1 
780  C CD2 . TRP A 105 ? 0.7117 0.7045 0.7746 0.0582  0.0111  0.0513  131 TRP A CD2 
781  N NE1 . TRP A 105 ? 0.7161 0.7127 0.7739 0.0564  0.0119  0.0532  131 TRP A NE1 
782  C CE2 . TRP A 105 ? 0.6021 0.6068 0.6753 0.0534  0.0136  0.0557  131 TRP A CE2 
783  C CE3 . TRP A 105 ? 0.6302 0.6288 0.7061 0.0571  0.0111  0.0512  131 TRP A CE3 
784  C CZ2 . TRP A 105 ? 0.4776 0.4986 0.5729 0.0475  0.0167  0.0612  131 TRP A CZ2 
785  C CZ3 . TRP A 105 ? 0.4650 0.4791 0.5641 0.0507  0.0136  0.0558  131 TRP A CZ3 
786  C CH2 . TRP A 105 ? 0.3911 0.4157 0.4995 0.0459  0.0166  0.0613  131 TRP A CH2 
787  N N   . LYS A 106 ? 0.8147 0.8031 0.8338 0.0956  -0.0028 0.0364  132 LYS A N   
788  C CA  . LYS A 106 ? 0.9753 0.9839 0.9985 0.1029  -0.0042 0.0365  132 LYS A CA  
789  C C   . LYS A 106 ? 0.8314 0.8603 0.8680 0.1083  -0.0053 0.0362  132 LYS A C   
790  O O   . LYS A 106 ? 0.7400 0.7940 0.7922 0.1099  -0.0040 0.0401  132 LYS A O   
791  C CB  . LYS A 106 ? 1.2603 1.2546 1.2595 0.1122  -0.0086 0.0311  132 LYS A CB  
792  C CG  . LYS A 106 ? 1.5375 1.5531 1.5379 0.1219  -0.0106 0.0303  132 LYS A CG  
793  C CD  . LYS A 106 ? 1.7224 1.7493 1.7220 0.1324  -0.0135 0.0272  132 LYS A CD  
794  C CE  . LYS A 106 ? 1.7725 1.8237 1.7739 0.1425  -0.0150 0.0271  132 LYS A CE  
795  N NZ  . LYS A 106 ? 1.7709 1.8358 1.7732 0.1526  -0.0176 0.0241  132 LYS A NZ  
796  N N   . ASP A 107 ? 0.7346 0.7536 0.7655 0.1113  -0.0077 0.0318  133 ASP A N   
797  C CA  . ASP A 107 ? 0.7449 0.7820 0.7881 0.1170  -0.0098 0.0296  133 ASP A CA  
798  C C   . ASP A 107 ? 0.8060 0.8698 0.8804 0.1101  -0.0066 0.0358  133 ASP A C   
799  O O   . ASP A 107 ? 0.9256 0.9887 1.0138 0.0998  -0.0033 0.0402  133 ASP A O   
800  C CB  . ASP A 107 ? 0.9413 0.9649 0.9782 0.1189  -0.0123 0.0243  133 ASP A CB  
801  C CG  . ASP A 107 ? 1.0973 1.1390 1.1457 0.1260  -0.0158 0.0200  133 ASP A CG  
802  O OD1 . ASP A 107 ? 1.0718 1.1305 1.1231 0.1328  -0.0171 0.0198  133 ASP A OD1 
803  O OD2 . ASP A 107 ? 1.2326 1.2729 1.2878 0.1252  -0.0174 0.0164  133 ASP A OD2 
804  N N   . SER A 108 ? 0.8539 0.9414 0.9399 0.1160  -0.0075 0.0367  134 SER A N   
805  C CA  . SER A 108 ? 0.7689 0.8830 0.8861 0.1099  -0.0040 0.0441  134 SER A CA  
806  C C   . SER A 108 ? 0.8033 0.9181 0.9411 0.1028  -0.0047 0.0428  134 SER A C   
807  O O   . SER A 108 ? 0.8981 1.0223 1.0595 0.0934  -0.0013 0.0493  134 SER A O   
808  C CB  . SER A 108 ? 0.6858 0.8259 0.8109 0.1185  -0.0047 0.0453  134 SER A CB  
809  O OG  . SER A 108 ? 0.7154 0.8546 0.8341 0.1269  -0.0099 0.0369  134 SER A OG  
810  N N   . GLY A 109 ? 0.7384 0.8431 0.8671 0.1082  -0.0094 0.0340  135 GLY A N   
811  C CA  . GLY A 109 ? 0.7755 0.8801 0.9212 0.1035  -0.0115 0.0303  135 GLY A CA  
812  C C   . GLY A 109 ? 0.8004 0.8880 0.9450 0.0944  -0.0091 0.0322  135 GLY A C   
813  O O   . GLY A 109 ? 0.7766 0.8710 0.9450 0.0864  -0.0082 0.0344  135 GLY A O   
814  N N   . VAL A 110 ? 0.7180 0.7836 0.8356 0.0957  -0.0081 0.0314  136 VAL A N   
815  C CA  . VAL A 110 ? 0.6469 0.6972 0.7616 0.0872  -0.0052 0.0338  136 VAL A CA  
816  C C   . VAL A 110 ? 0.7280 0.7906 0.8628 0.0777  -0.0005 0.0425  136 VAL A C   
817  O O   . VAL A 110 ? 0.8273 0.8894 0.9767 0.0697  0.0011  0.0446  136 VAL A O   
818  C CB  . VAL A 110 ? 0.5690 0.5952 0.6529 0.0897  -0.0044 0.0327  136 VAL A CB  
819  C CG1 . VAL A 110 ? 0.4100 0.4241 0.4934 0.0800  -0.0006 0.0364  136 VAL A CG1 
820  C CG2 . VAL A 110 ? 0.6434 0.6553 0.7068 0.0992  -0.0084 0.0254  136 VAL A CG2 
821  N N   . GLN A 111 ? 0.6645 0.7387 0.7993 0.0795  0.0015  0.0476  137 GLN A N   
822  C CA  . GLN A 111 ? 0.5907 0.6791 0.7436 0.0725  0.0062  0.0568  137 GLN A CA  
823  C C   . GLN A 111 ? 0.6206 0.7274 0.8063 0.0673  0.0069  0.0608  137 GLN A C   
824  O O   . GLN A 111 ? 0.4772 0.5862 0.6790 0.0589  0.0098  0.0663  137 GLN A O   
825  C CB  . GLN A 111 ? 0.4205 0.5215 0.5668 0.0782  0.0077  0.0609  137 GLN A CB  
826  C CG  . GLN A 111 ? 0.4660 0.5496 0.5858 0.0805  0.0076  0.0585  137 GLN A CG  
827  C CD  . GLN A 111 ? 0.5611 0.6350 0.6824 0.0710  0.0109  0.0619  137 GLN A CD  
828  O OE1 . GLN A 111 ? 0.5057 0.5941 0.6430 0.0662  0.0146  0.0693  137 GLN A OE1 
829  N NE2 . GLN A 111 ? 0.5766 0.6269 0.6816 0.0685  0.0098  0.0571  137 GLN A NE2 
830  N N   . ALA A 112 ? 0.5505 0.6702 0.7466 0.0723  0.0038  0.0578  138 ALA A N   
831  C CA  . ALA A 112 ? 0.4435 0.5803 0.6731 0.0672  0.0035  0.0607  138 ALA A CA  
832  C C   . ALA A 112 ? 0.5619 0.6862 0.8010 0.0605  0.0017  0.0568  138 ALA A C   
833  O O   . ALA A 112 ? 0.6542 0.7868 0.9200 0.0528  0.0031  0.0620  138 ALA A O   
834  C CB  . ALA A 112 ? 0.4887 0.6385 0.7254 0.0742  -0.0007 0.0552  138 ALA A CB  
835  N N   . CYS A 113 ? 0.4836 0.5880 0.7005 0.0640  -0.0016 0.0478  139 CYS A N   
836  C CA  . CYS A 113 ? 0.3534 0.4461 0.5749 0.0595  -0.0034 0.0433  139 CYS A CA  
837  C C   . CYS A 113 ? 0.3636 0.4494 0.5844 0.0515  0.0016  0.0503  139 CYS A C   
838  O O   . CYS A 113 ? 0.3834 0.4710 0.6237 0.0449  0.0019  0.0520  139 CYS A O   
839  C CB  . CYS A 113 ? 0.2878 0.3625 0.4831 0.0667  -0.0071 0.0334  139 CYS A CB  
840  S SG  . CYS A 113 ? 0.5411 0.6040 0.7399 0.0637  -0.0096 0.0270  139 CYS A SG  
841  N N   . PHE A 114 ? 0.4733 0.5512 0.6719 0.0525  0.0050  0.0537  140 PHE A N   
842  C CA  . PHE A 114 ? 0.3966 0.4693 0.5932 0.0457  0.0095  0.0598  140 PHE A CA  
843  C C   . PHE A 114 ? 0.3883 0.4784 0.6127 0.0395  0.0127  0.0690  140 PHE A C   
844  O O   . PHE A 114 ? 0.4374 0.5249 0.6701 0.0330  0.0150  0.0726  140 PHE A O   
845  C CB  . PHE A 114 ? 0.4133 0.4784 0.5850 0.0485  0.0118  0.0614  140 PHE A CB  
846  C CG  . PHE A 114 ? 0.4872 0.5513 0.6590 0.0421  0.0161  0.0675  140 PHE A CG  
847  C CD1 . PHE A 114 ? 0.4283 0.4780 0.5931 0.0369  0.0172  0.0658  140 PHE A CD1 
848  C CD2 . PHE A 114 ? 0.5501 0.6293 0.7289 0.0421  0.0192  0.0750  140 PHE A CD2 
849  C CE1 . PHE A 114 ? 0.4200 0.4701 0.5855 0.0312  0.0209  0.0708  140 PHE A CE1 
850  C CE2 . PHE A 114 ? 0.5693 0.6488 0.7477 0.0373  0.0228  0.0799  140 PHE A CE2 
851  C CZ  . PHE A 114 ? 0.5311 0.5959 0.7033 0.0315  0.0234  0.0774  140 PHE A CZ  
852  N N   . ASN A 115 ? 0.4203 0.5287 0.6592 0.0420  0.0131  0.0735  141 ASN A N   
853  C CA  . ASN A 115 ? 0.6359 0.7622 0.9024 0.0368  0.0168  0.0842  141 ASN A CA  
854  C C   . ASN A 115 ? 0.6509 0.7782 0.9450 0.0307  0.0145  0.0833  141 ASN A C   
855  O O   . ASN A 115 ? 0.6706 0.8049 0.9855 0.0246  0.0176  0.0917  141 ASN A O   
856  C CB  . ASN A 115 ? 0.7108 0.8580 0.9860 0.0415  0.0183  0.0899  141 ASN A CB  
857  C CG  . ASN A 115 ? 0.6780 0.8272 0.9291 0.0479  0.0207  0.0920  141 ASN A CG  
858  O OD1 . ASN A 115 ? 0.4878 0.6260 0.7221 0.0467  0.0224  0.0921  141 ASN A OD1 
859  N ND2 . ASN A 115 ? 0.8334 0.9976 1.0837 0.0551  0.0204  0.0930  141 ASN A ND2 
860  N N   . ARG A 116 ? 0.5195 0.6398 0.8136 0.0332  0.0086  0.0725  142 ARG A N   
861  C CA  . ARG A 116 ? 0.4381 0.5584 0.7577 0.0288  0.0047  0.0688  142 ARG A CA  
862  C C   . ARG A 116 ? 0.4408 0.5430 0.7479 0.0274  0.0029  0.0619  142 ARG A C   
863  O O   . ARG A 116 ? 0.6208 0.7185 0.9374 0.0278  -0.0026 0.0531  142 ARG A O   
864  C CB  . ARG A 116 ? 0.4324 0.5591 0.7625 0.0333  -0.0015 0.0600  142 ARG A CB  
865  C CG  . ARG A 116 ? 0.4697 0.6137 0.8034 0.0372  0.0000  0.0646  142 ARG A CG  
866  C CD  . ARG A 116 ? 0.6487 0.8086 1.0165 0.0354  -0.0039 0.0631  142 ARG A CD  
867  N NE  . ARG A 116 ? 0.6514 0.8035 1.0208 0.0387  -0.0121 0.0483  142 ARG A NE  
868  C CZ  . ARG A 116 ? 0.6823 0.8374 1.0420 0.0469  -0.0169 0.0387  142 ARG A CZ  
869  N NH1 . ARG A 116 ? 0.7763 0.9414 1.1240 0.0523  -0.0144 0.0423  142 ARG A NH1 
870  N NH2 . ARG A 116 ? 0.6003 0.7494 0.9618 0.0507  -0.0246 0.0250  142 ARG A NH2 
871  N N   . SER A 117 ? 0.3469 0.4400 0.6333 0.0261  0.0073  0.0656  143 SER A N   
872  C CA  . SER A 117 ? 0.4393 0.5169 0.7125 0.0247  0.0067  0.0604  143 SER A CA  
873  C C   . SER A 117 ? 0.4233 0.5024 0.7206 0.0188  0.0058  0.0617  143 SER A C   
874  O O   . SER A 117 ? 0.4702 0.5390 0.7602 0.0179  0.0050  0.0572  143 SER A O   
875  C CB  . SER A 117 ? 0.5162 0.5854 0.7646 0.0238  0.0117  0.0645  143 SER A CB  
876  O OG  . SER A 117 ? 0.5806 0.6599 0.8391 0.0195  0.0166  0.0750  143 SER A OG  
877  N N   . ARG A 118 ? 0.3608 0.4530 0.6873 0.0151  0.0060  0.0682  144 ARG A N   
878  C CA  . ARG A 118 ? 0.3146 0.4076 0.6669 0.0097  0.0045  0.0698  144 ARG A CA  
879  C C   . ARG A 118 ? 0.4331 0.5226 0.7989 0.0120  -0.0038 0.0575  144 ARG A C   
880  O O   . ARG A 118 ? 0.4649 0.5498 0.8445 0.0097  -0.0070 0.0539  144 ARG A O   
881  C CB  . ARG A 118 ? 0.2315 0.3392 0.6115 0.0049  0.0081  0.0828  144 ARG A CB  
882  C CG  . ARG A 118 ? 0.1952 0.3162 0.5911 0.0065  0.0064  0.0839  144 ARG A CG  
883  C CD  . ARG A 118 ? 0.2507 0.3863 0.6792 0.0009  0.0100  0.0975  144 ARG A CD  
884  N NE  . ARG A 118 ? 0.3609 0.4920 0.8175 -0.0044 0.0060  0.0961  144 ARG A NE  
885  C CZ  . ARG A 118 ? 0.3655 0.5001 0.8506 -0.0063 -0.0001 0.0910  144 ARG A CZ  
886  N NH1 . ARG A 118 ? 0.4505 0.5948 0.9396 -0.0035 -0.0025 0.0870  144 ARG A NH1 
887  N NH2 . ARG A 118 ? 0.1136 0.2425 0.6240 -0.0108 -0.0043 0.0891  144 ARG A NH2 
888  N N   . GLU A 119 ? 0.5192 0.6116 0.8807 0.0173  -0.0077 0.0503  145 GLU A N   
889  C CA  . GLU A 119 ? 0.4853 0.5771 0.8601 0.0208  -0.0163 0.0374  145 GLU A CA  
890  C C   . GLU A 119 ? 0.3889 0.4675 0.7379 0.0274  -0.0197 0.0257  145 GLU A C   
891  O O   . GLU A 119 ? 0.4773 0.5551 0.8318 0.0325  -0.0273 0.0133  145 GLU A O   
892  C CB  . GLU A 119 ? 0.6194 0.7225 1.0022 0.0244  -0.0192 0.0346  145 GLU A CB  
893  C CG  . GLU A 119 ? 0.6691 0.7880 1.0789 0.0183  -0.0154 0.0471  145 GLU A CG  
894  C CD  . GLU A 119 ? 0.6824 0.8147 1.1005 0.0221  -0.0181 0.0443  145 GLU A CD  
895  O OE1 . GLU A 119 ? 0.6818 0.8101 1.0818 0.0300  -0.0229 0.0326  145 GLU A OE1 
896  O OE2 . GLU A 119 ? 0.6964 0.8442 1.1392 0.0176  -0.0152 0.0543  145 GLU A OE2 
897  N N   . TYR A 120 ? 0.2978 0.3671 0.6193 0.0274  -0.0140 0.0297  146 TYR A N   
898  C CA  . TYR A 120 ? 0.3339 0.3914 0.6310 0.0329  -0.0155 0.0214  146 TYR A CA  
899  C C   . TYR A 120 ? 0.3356 0.3854 0.6154 0.0288  -0.0088 0.0284  146 TYR A C   
900  O O   . TYR A 120 ? 0.4363 0.4895 0.7197 0.0229  -0.0032 0.0389  146 TYR A O   
901  C CB  . TYR A 120 ? 0.2091 0.2628 0.4818 0.0415  -0.0171 0.0152  146 TYR A CB  
902  C CG  . TYR A 120 ? 0.2580 0.3110 0.5130 0.0411  -0.0114 0.0234  146 TYR A CG  
903  C CD1 . TYR A 120 ? 0.4492 0.5138 0.7173 0.0405  -0.0114 0.0275  146 TYR A CD1 
904  C CD2 . TYR A 120 ? 0.3130 0.3544 0.5392 0.0416  -0.0063 0.0268  146 TYR A CD2 
905  C CE1 . TYR A 120 ? 0.4924 0.5572 0.7438 0.0416  -0.0069 0.0339  146 TYR A CE1 
906  C CE2 . TYR A 120 ? 0.4025 0.4423 0.6132 0.0419  -0.0023 0.0328  146 TYR A CE2 
907  C CZ  . TYR A 120 ? 0.4346 0.4864 0.6573 0.0425  -0.0028 0.0359  146 TYR A CZ  
908  O OH  . TYR A 120 ? 0.4729 0.5241 0.6797 0.0442  0.0005  0.0409  146 TYR A OH  
909  N N   . GLN A 121 ? 0.5093 0.5501 0.7708 0.0325  -0.0092 0.0226  147 GLN A N   
910  C CA  . GLN A 121 ? 0.6351 0.6696 0.8817 0.0285  -0.0031 0.0284  147 GLN A CA  
911  C C   . GLN A 121 ? 0.5260 0.5535 0.7455 0.0287  0.0024  0.0334  147 GLN A C   
912  O O   . GLN A 121 ? 0.3899 0.4107 0.5897 0.0351  0.0013  0.0289  147 GLN A O   
913  C CB  . GLN A 121 ? 0.6922 0.7219 0.9320 0.0322  -0.0053 0.0210  147 GLN A CB  
914  C CG  . GLN A 121 ? 0.9111 0.9464 1.1777 0.0310  -0.0104 0.0166  147 GLN A CG  
915  C CD  . GLN A 121 ? 1.1818 1.2139 1.4400 0.0341  -0.0109 0.0113  147 GLN A CD  
916  O OE1 . GLN A 121 ? 1.2125 1.2477 1.4896 0.0333  -0.0146 0.0080  147 GLN A OE1 
917  N NE2 . GLN A 121 ? 1.3130 1.3392 1.5434 0.0378  -0.0072 0.0110  147 GLN A NE2 
918  N N   . LEU A 122 ? 0.5126 0.5414 0.7315 0.0223  0.0079  0.0426  148 LEU A N   
919  C CA  . LEU A 122 ? 0.4626 0.4845 0.6584 0.0219  0.0125  0.0469  148 LEU A CA  
920  C C   . LEU A 122 ? 0.4927 0.5146 0.6870 0.0149  0.0178  0.0537  148 LEU A C   
921  O O   . LEU A 122 ? 0.3804 0.4114 0.5935 0.0105  0.0188  0.0586  148 LEU A O   
922  C CB  . LEU A 122 ? 0.4184 0.4459 0.6160 0.0238  0.0121  0.0498  148 LEU A CB  
923  C CG  . LEU A 122 ? 0.4355 0.4553 0.6095 0.0249  0.0152  0.0526  148 LEU A CG  
924  C CD1 . LEU A 122 ? 0.5127 0.5185 0.6630 0.0307  0.0140  0.0468  148 LEU A CD1 
925  C CD2 . LEU A 122 ? 0.4335 0.4627 0.6124 0.0274  0.0147  0.0556  148 LEU A CD2 
926  N N   . ASN A 123 ? 0.5395 0.5515 0.7123 0.0139  0.0212  0.0543  149 ASN A N   
927  C CA  . ASN A 123 ? 0.5308 0.5431 0.7016 0.0074  0.0259  0.0595  149 ASN A CA  
928  C C   . ASN A 123 ? 0.5447 0.5634 0.7189 0.0048  0.0279  0.0656  149 ASN A C   
929  O O   . ASN A 123 ? 0.4083 0.4279 0.5787 0.0085  0.0265  0.0658  149 ASN A O   
930  C CB  . ASN A 123 ? 0.3783 0.3785 0.5271 0.0064  0.0289  0.0586  149 ASN A CB  
931  C CG  . ASN A 123 ? 0.5836 0.5733 0.7131 0.0094  0.0291  0.0585  149 ASN A CG  
932  O OD1 . ASN A 123 ? 0.9038 0.8967 1.0349 0.0107  0.0280  0.0601  149 ASN A OD1 
933  N ND2 . ASN A 123 ? 0.6321 0.6095 0.7433 0.0110  0.0305  0.0571  149 ASN A ND2 
934  N N   . ASP A 124 ? 0.4376 0.4624 0.6186 -0.0004 0.0309  0.0701  150 ASP A N   
935  C CA  . ASP A 124 ? 0.5710 0.6043 0.7554 -0.0016 0.0328  0.0758  150 ASP A CA  
936  C C   . ASP A 124 ? 0.6755 0.7015 0.8410 -0.0032 0.0348  0.0754  150 ASP A C   
937  O O   . ASP A 124 ? 0.7835 0.8168 0.9505 -0.0048 0.0365  0.0789  150 ASP A O   
938  C CB  . ASP A 124 ? 0.5262 0.5717 0.7297 -0.0049 0.0345  0.0812  150 ASP A CB  
939  C CG  . ASP A 124 ? 0.6059 0.6598 0.8315 -0.0033 0.0323  0.0834  150 ASP A CG  
940  O OD1 . ASP A 124 ? 0.6081 0.6639 0.8359 0.0003  0.0302  0.0829  150 ASP A OD1 
941  O OD2 . ASP A 124 ? 0.7048 0.7634 0.9465 -0.0057 0.0324  0.0855  150 ASP A OD2 
942  N N   . SER A 125 ? 0.5464 0.5581 0.6946 -0.0023 0.0344  0.0711  151 SER A N   
943  C CA  . SER A 125 ? 0.4564 0.4581 0.5873 -0.0038 0.0355  0.0703  151 SER A CA  
944  C C   . SER A 125 ? 0.6095 0.6017 0.7265 0.0022  0.0329  0.0676  151 SER A C   
945  O O   . SER A 125 ? 0.6874 0.6697 0.7900 0.0023  0.0327  0.0664  151 SER A O   
946  C CB  . SER A 125 ? 0.3746 0.3662 0.4968 -0.0087 0.0381  0.0691  151 SER A CB  
947  O OG  . SER A 125 ? 0.4924 0.4938 0.6269 -0.0137 0.0403  0.0711  151 SER A OG  
948  N N   . ALA A 126 ? 0.5933 0.5887 0.7155 0.0075  0.0304  0.0661  152 ALA A N   
949  C CA  . ALA A 126 ? 0.4989 0.4870 0.6086 0.0145  0.0275  0.0631  152 ALA A CA  
950  C C   . ALA A 126 ? 0.5986 0.5903 0.7037 0.0172  0.0266  0.0641  152 ALA A C   
951  O O   . ALA A 126 ? 0.7212 0.7001 0.8089 0.0190  0.0257  0.0619  152 ALA A O   
952  C CB  . ALA A 126 ? 0.4184 0.4140 0.5394 0.0194  0.0245  0.0610  152 ALA A CB  
953  N N   . ALA A 127 ? 0.4787 0.4880 0.5994 0.0181  0.0266  0.0676  153 ALA A N   
954  C CA  . ALA A 127 ? 0.4168 0.4337 0.5340 0.0223  0.0258  0.0689  153 ALA A CA  
955  C C   . ALA A 127 ? 0.5271 0.5360 0.6321 0.0194  0.0265  0.0676  153 ALA A C   
956  O O   . ALA A 127 ? 0.5806 0.5841 0.6723 0.0241  0.0241  0.0646  153 ALA A O   
957  C CB  . ALA A 127 ? 0.3333 0.3721 0.4708 0.0225  0.0274  0.0751  153 ALA A CB  
958  N N   . TYR A 128 ? 0.5585 0.5668 0.6687 0.0120  0.0292  0.0691  154 TYR A N   
959  C CA  . TYR A 128 ? 0.5129 0.5153 0.6150 0.0082  0.0296  0.0674  154 TYR A CA  
960  C C   . TYR A 128 ? 0.5006 0.4817 0.5831 0.0092  0.0274  0.0625  154 TYR A C   
961  O O   . TYR A 128 ? 0.5985 0.5761 0.6720 0.0124  0.0247  0.0594  154 TYR A O   
962  C CB  . TYR A 128 ? 0.3199 0.3235 0.4301 -0.0001 0.0328  0.0692  154 TYR A CB  
963  C CG  . TYR A 128 ? 0.5345 0.5326 0.6384 -0.0051 0.0331  0.0668  154 TYR A CG  
964  C CD1 . TYR A 128 ? 0.5518 0.5642 0.6626 -0.0053 0.0331  0.0674  154 TYR A CD1 
965  C CD2 . TYR A 128 ? 0.6715 0.6509 0.7634 -0.0093 0.0334  0.0639  154 TYR A CD2 
966  C CE1 . TYR A 128 ? 0.4248 0.4332 0.5313 -0.0097 0.0325  0.0638  154 TYR A CE1 
967  C CE2 . TYR A 128 ? 0.6430 0.6175 0.7319 -0.0148 0.0333  0.0615  154 TYR A CE2 
968  C CZ  . TYR A 128 ? 0.4921 0.4814 0.5887 -0.0150 0.0324  0.0606  154 TYR A CZ  
969  O OH  . TYR A 128 ? 0.5816 0.5670 0.6767 -0.0204 0.0315  0.0568  154 TYR A OH  
970  N N   . TYR A 129 ? 0.4304 0.3975 0.5066 0.0072  0.0285  0.0620  155 TYR A N   
971  C CA  . TYR A 129 ? 0.5230 0.4685 0.5810 0.0079  0.0273  0.0591  155 TYR A CA  
972  C C   . TYR A 129 ? 0.6139 0.5545 0.6610 0.0176  0.0232  0.0562  155 TYR A C   
973  O O   . TYR A 129 ? 0.7050 0.6340 0.7398 0.0200  0.0205  0.0530  155 TYR A O   
974  C CB  . TYR A 129 ? 0.5723 0.5067 0.6260 0.0050  0.0301  0.0606  155 TYR A CB  
975  C CG  . TYR A 129 ? 0.7582 0.6950 0.8195 -0.0043 0.0342  0.0630  155 TYR A CG  
976  C CD1 . TYR A 129 ? 0.8925 0.8214 0.9502 -0.0109 0.0353  0.0627  155 TYR A CD1 
977  C CD2 . TYR A 129 ? 0.7292 0.6764 0.8017 -0.0061 0.0365  0.0649  155 TYR A CD2 
978  C CE1 . TYR A 129 ? 0.8714 0.8043 0.9367 -0.0193 0.0391  0.0648  155 TYR A CE1 
979  C CE2 . TYR A 129 ? 0.7034 0.6541 0.7823 -0.0136 0.0402  0.0668  155 TYR A CE2 
980  C CZ  . TYR A 129 ? 0.7360 0.6802 0.8112 -0.0203 0.0417  0.0670  155 TYR A CZ  
981  O OH  . TYR A 129 ? 0.7033 0.6528 0.7857 -0.0278 0.0454  0.0688  155 TYR A OH  
982  N N   . LEU A 130 ? 0.5471 0.4967 0.5994 0.0232  0.0224  0.0567  156 LEU A N   
983  C CA  . LEU A 130 ? 0.5139 0.4610 0.5565 0.0329  0.0186  0.0537  156 LEU A CA  
984  C C   . LEU A 130 ? 0.5190 0.4727 0.5587 0.0378  0.0158  0.0518  156 LEU A C   
985  O O   . LEU A 130 ? 0.6125 0.5582 0.6387 0.0456  0.0121  0.0482  156 LEU A O   
986  C CB  . LEU A 130 ? 0.4971 0.4578 0.5511 0.0371  0.0181  0.0543  156 LEU A CB  
987  C CG  . LEU A 130 ? 0.5399 0.4931 0.5930 0.0362  0.0191  0.0537  156 LEU A CG  
988  C CD1 . LEU A 130 ? 0.5521 0.5208 0.6206 0.0398  0.0175  0.0530  156 LEU A CD1 
989  C CD2 . LEU A 130 ? 0.4701 0.4021 0.5012 0.0412  0.0178  0.0511  156 LEU A CD2 
990  N N   . ASN A 131 ? 0.3797 0.3489 0.4315 0.0342  0.0172  0.0541  157 ASN A N   
991  C CA  . ASN A 131 ? 0.5572 0.5353 0.6061 0.0398  0.0144  0.0520  157 ASN A CA  
992  C C   . ASN A 131 ? 0.6730 0.6333 0.7081 0.0383  0.0117  0.0469  157 ASN A C   
993  O O   . ASN A 131 ? 0.7342 0.6906 0.7583 0.0460  0.0072  0.0420  157 ASN A O   
994  C CB  . ASN A 131 ? 0.6049 0.6071 0.6711 0.0379  0.0170  0.0568  157 ASN A CB  
995  C CG  . ASN A 131 ? 0.5488 0.5704 0.6298 0.0412  0.0188  0.0621  157 ASN A CG  
996  O OD1 . ASN A 131 ? 0.4456 0.4667 0.5232 0.0473  0.0169  0.0608  157 ASN A OD1 
997  N ND2 . ASN A 131 ? 0.5129 0.5517 0.6114 0.0372  0.0222  0.0682  157 ASN A ND2 
998  N N   . ASP A 132 ? 0.7210 0.6709 0.7578 0.0286  0.0141  0.0476  158 ASP A N   
999  C CA  . ASP A 132 ? 0.7741 0.7071 0.8017 0.0250  0.0117  0.0430  158 ASP A CA  
1000 C C   . ASP A 132 ? 0.8374 0.7432 0.8501 0.0245  0.0110  0.0418  158 ASP A C   
1001 O O   . ASP A 132 ? 0.8498 0.7386 0.8579 0.0182  0.0107  0.0403  158 ASP A O   
1002 C CB  . ASP A 132 ? 0.7956 0.7331 0.8342 0.0144  0.0150  0.0446  158 ASP A CB  
1003 C CG  . ASP A 132 ? 0.9436 0.9072 0.9959 0.0157  0.0157  0.0462  158 ASP A CG  
1004 O OD1 . ASP A 132 ? 1.0339 1.0137 1.0911 0.0225  0.0160  0.0491  158 ASP A OD1 
1005 O OD2 . ASP A 132 ? 0.8156 0.7839 0.8742 0.0099  0.0162  0.0450  158 ASP A OD2 
1006 N N   . LEU A 133 ? 0.8095 0.7120 0.8154 0.0312  0.0107  0.0429  159 LEU A N   
1007 C CA  . LEU A 133 ? 0.6709 0.5490 0.6617 0.0324  0.0105  0.0429  159 LEU A CA  
1008 C C   . LEU A 133 ? 0.7246 0.5809 0.7022 0.0336  0.0062  0.0384  159 LEU A C   
1009 O O   . LEU A 133 ? 0.7791 0.6140 0.7499 0.0280  0.0078  0.0403  159 LEU A O   
1010 C CB  . LEU A 133 ? 0.6503 0.5310 0.6348 0.0425  0.0092  0.0428  159 LEU A CB  
1011 C CG  . LEU A 133 ? 0.7542 0.6111 0.7211 0.0465  0.0086  0.0429  159 LEU A CG  
1012 C CD1 . LEU A 133 ? 0.7782 0.6237 0.7452 0.0375  0.0140  0.0481  159 LEU A CD1 
1013 C CD2 . LEU A 133 ? 0.7449 0.6088 0.7078 0.0569  0.0069  0.0418  159 LEU A CD2 
1014 N N   . ASP A 134 ? 0.7895 0.6516 0.7642 0.0411  0.0007  0.0327  160 ASP A N   
1015 C CA  . ASP A 134 ? 0.9230 0.7646 0.8860 0.0438  -0.0050 0.0266  160 ASP A CA  
1016 C C   . ASP A 134 ? 0.8491 0.6788 0.8177 0.0318  -0.0040 0.0262  160 ASP A C   
1017 O O   . ASP A 134 ? 0.8477 0.6521 0.8076 0.0298  -0.0065 0.0243  160 ASP A O   
1018 C CB  . ASP A 134 ? 1.1969 1.0524 1.1581 0.0544  -0.0112 0.0196  160 ASP A CB  
1019 C CG  . ASP A 134 ? 1.4980 1.3610 1.4512 0.0672  -0.0132 0.0191  160 ASP A CG  
1020 O OD1 . ASP A 134 ? 1.4966 1.3772 1.4502 0.0766  -0.0169 0.0150  160 ASP A OD1 
1021 O OD2 . ASP A 134 ? 1.6528 1.5059 1.5996 0.0685  -0.0109 0.0226  160 ASP A OD2 
1022 N N   . ARG A 135 ? 0.8196 0.6677 0.8035 0.0240  -0.0005 0.0283  161 ARG A N   
1023 C CA  . ARG A 135 ? 0.8311 0.6726 0.8231 0.0123  0.0005  0.0276  161 ARG A CA  
1024 C C   . ARG A 135 ? 0.8302 0.6576 0.8225 0.0024  0.0071  0.0351  161 ARG A C   
1025 O O   . ARG A 135 ? 0.9077 0.7172 0.9001 -0.0058 0.0073  0.0352  161 ARG A O   
1026 C CB  . ARG A 135 ? 0.7303 0.5984 0.7378 0.0090  0.0017  0.0268  161 ARG A CB  
1027 C CG  . ARG A 135 ? 0.7000 0.5649 0.7174 -0.0028 0.0025  0.0251  161 ARG A CG  
1028 C CD  . ARG A 135 ? 0.7901 0.6828 0.8216 -0.0040 0.0032  0.0241  161 ARG A CD  
1029 N NE  . ARG A 135 ? 0.6842 0.5941 0.7233 -0.0049 0.0096  0.0320  161 ARG A NE  
1030 C CZ  . ARG A 135 ? 0.6596 0.5720 0.7074 -0.0146 0.0154  0.0373  161 ARG A CZ  
1031 N NH1 . ARG A 135 ? 0.5972 0.4976 0.6478 -0.0246 0.0165  0.0365  161 ARG A NH1 
1032 N NH2 . ARG A 135 ? 0.5784 0.5057 0.6332 -0.0141 0.0200  0.0433  161 ARG A NH2 
1033 N N   . ILE A 136 ? 0.8601 0.6967 0.8536 0.0034  0.0122  0.0412  162 ILE A N   
1034 C CA  . ILE A 136 ? 0.8161 0.6430 0.8089 -0.0037 0.0186  0.0484  162 ILE A CA  
1035 C C   . ILE A 136 ? 0.7611 0.5601 0.7374 -0.0008 0.0180  0.0504  162 ILE A C   
1036 O O   . ILE A 136 ? 0.6359 0.4197 0.6108 -0.0085 0.0221  0.0556  162 ILE A O   
1037 C CB  . ILE A 136 ? 0.7652 0.6089 0.7624 -0.0008 0.0227  0.0528  162 ILE A CB  
1038 C CG1 . ILE A 136 ? 0.7111 0.5817 0.7239 -0.0013 0.0226  0.0513  162 ILE A CG1 
1039 C CG2 . ILE A 136 ? 0.8793 0.7175 0.8773 -0.0078 0.0293  0.0594  162 ILE A CG2 
1040 C CD1 . ILE A 136 ? 0.6689 0.5470 0.6941 -0.0115 0.0244  0.0512  162 ILE A CD1 
1041 N N   . ALA A 137 ? 0.6604 0.4535 0.6246 0.0108  0.0131  0.0467  163 ALA A N   
1042 C CA  . ALA A 137 ? 0.7090 0.4762 0.6559 0.0161  0.0120  0.0486  163 ALA A CA  
1043 C C   . ALA A 137 ? 0.9227 0.6651 0.8667 0.0099  0.0098  0.0475  163 ALA A C   
1044 O O   . ALA A 137 ? 1.1142 0.8327 1.0475 0.0094  0.0117  0.0527  163 ALA A O   
1045 C CB  . ALA A 137 ? 0.5567 0.3256 0.4923 0.0305  0.0064  0.0435  163 ALA A CB  
1046 N N   . GLN A 138 ? 0.8172 0.5654 0.7714 0.0055  0.0055  0.0409  164 GLN A N   
1047 C CA  . GLN A 138 ? 0.8323 0.5581 0.7870 -0.0006 0.0018  0.0377  164 GLN A CA  
1048 C C   . GLN A 138 ? 0.8582 0.5670 0.8156 -0.0127 0.0087  0.0470  164 GLN A C   
1049 O O   . GLN A 138 ? 0.8198 0.5425 0.7860 -0.0200 0.0160  0.0535  164 GLN A O   
1050 C CB  . GLN A 138 ? 0.9760 0.7167 0.9448 -0.0048 -0.0029 0.0290  164 GLN A CB  
1051 C CG  . GLN A 138 ? 1.0173 0.7735 0.9825 0.0080  -0.0102 0.0199  164 GLN A CG  
1052 C CD  . GLN A 138 ? 1.2548 0.9894 1.2042 0.0189  -0.0178 0.0141  164 GLN A CD  
1053 O OE1 . GLN A 138 ? 1.3698 1.1139 1.3105 0.0319  -0.0214 0.0104  164 GLN A OE1 
1054 N NE2 . GLN A 138 ? 1.3079 1.0132 1.2544 0.0135  -0.0202 0.0134  164 GLN A NE2 
1055 N N   . PRO A 139 ? 0.9476 0.6265 0.8978 -0.0143 0.0064  0.0481  165 PRO A N   
1056 C CA  . PRO A 139 ? 0.8769 0.5375 0.8299 -0.0256 0.0132  0.0584  165 PRO A CA  
1057 C C   . PRO A 139 ? 0.9720 0.6440 0.9458 -0.0409 0.0160  0.0583  165 PRO A C   
1058 O O   . PRO A 139 ? 0.9351 0.6137 0.9152 -0.0494 0.0248  0.0677  165 PRO A O   
1059 C CB  . PRO A 139 ? 0.8444 0.4711 0.7884 -0.0234 0.0074  0.0566  165 PRO A CB  
1060 C CG  . PRO A 139 ? 0.8664 0.4934 0.7962 -0.0072 -0.0007 0.0478  165 PRO A CG  
1061 C CD  . PRO A 139 ? 0.9452 0.6056 0.8840 -0.0043 -0.0029 0.0400  165 PRO A CD  
1062 N N   . ASN A 140 ? 1.0855 0.7611 1.0695 -0.0433 0.0084  0.0472  166 ASN A N   
1063 C CA  . ASN A 140 ? 1.0586 0.7458 1.0629 -0.0569 0.0096  0.0451  166 ASN A CA  
1064 C C   . ASN A 140 ? 0.8455 0.5673 0.8589 -0.0571 0.0130  0.0442  166 ASN A C   
1065 O O   . ASN A 140 ? 0.6927 0.4293 0.7224 -0.0658 0.0129  0.0405  166 ASN A O   
1066 C CB  . ASN A 140 ? 1.1035 0.7820 1.1154 -0.0582 -0.0009 0.0322  166 ASN A CB  
1067 C CG  . ASN A 140 ? 0.9770 0.6700 0.9825 -0.0441 -0.0096 0.0202  166 ASN A CG  
1068 O OD1 . ASN A 140 ? 0.8844 0.5986 0.8844 -0.0359 -0.0070 0.0218  166 ASN A OD1 
1069 N ND2 . ASN A 140 ? 1.0058 0.6880 1.0128 -0.0411 -0.0200 0.0082  166 ASN A ND2 
1070 N N   . TYR A 141 ? 0.7846 0.5191 0.7882 -0.0473 0.0157  0.0474  167 TYR A N   
1071 C CA  . TYR A 141 ? 0.7319 0.4975 0.7440 -0.0463 0.0184  0.0469  167 TYR A CA  
1072 C C   . TYR A 141 ? 0.8014 0.5785 0.8270 -0.0586 0.0263  0.0534  167 TYR A C   
1073 O O   . TYR A 141 ? 0.9362 0.7035 0.9588 -0.0634 0.0332  0.0629  167 TYR A O   
1074 C CB  . TYR A 141 ? 0.7388 0.5130 0.7396 -0.0348 0.0203  0.0501  167 TYR A CB  
1075 C CG  . TYR A 141 ? 0.7711 0.5727 0.7819 -0.0361 0.0251  0.0529  167 TYR A CG  
1076 C CD1 . TYR A 141 ? 0.7688 0.5933 0.7912 -0.0358 0.0224  0.0472  167 TYR A CD1 
1077 C CD2 . TYR A 141 ? 0.6482 0.4530 0.6567 -0.0367 0.0321  0.0611  167 TYR A CD2 
1078 C CE1 . TYR A 141 ? 0.6368 0.4846 0.6689 -0.0368 0.0266  0.0502  167 TYR A CE1 
1079 C CE2 . TYR A 141 ? 0.6494 0.4779 0.6678 -0.0375 0.0357  0.0628  167 TYR A CE2 
1080 C CZ  . TYR A 141 ? 0.6876 0.5366 0.7180 -0.0379 0.0330  0.0576  167 TYR A CZ  
1081 O OH  . TYR A 141 ? 0.7256 0.5964 0.7662 -0.0384 0.0363  0.0598  167 TYR A OH  
1082 N N   . ILE A 142 ? 0.7855 0.5849 0.8255 -0.0626 0.0252  0.0484  168 ILE A N   
1083 C CA  . ILE A 142 ? 0.8483 0.6635 0.9015 -0.0725 0.0320  0.0534  168 ILE A CA  
1084 C C   . ILE A 142 ? 0.8612 0.7051 0.9207 -0.0675 0.0322  0.0512  168 ILE A C   
1085 O O   . ILE A 142 ? 0.9424 0.7982 1.0063 -0.0635 0.0264  0.0433  168 ILE A O   
1086 C CB  . ILE A 142 ? 1.0785 0.8917 1.1466 -0.0849 0.0307  0.0497  168 ILE A CB  
1087 C CG1 . ILE A 142 ? 1.1581 0.9415 1.2227 -0.0913 0.0310  0.0534  168 ILE A CG1 
1088 C CG2 . ILE A 142 ? 1.1387 0.9721 1.2207 -0.0940 0.0376  0.0542  168 ILE A CG2 
1089 C CD1 . ILE A 142 ? 1.1273 0.9073 1.2091 -0.1048 0.0296  0.0499  168 ILE A CD1 
1090 N N   . PRO A 143 ? 0.8423 0.6972 0.9021 -0.0671 0.0387  0.0582  169 PRO A N   
1091 C CA  . PRO A 143 ? 0.8576 0.7371 0.9235 -0.0619 0.0391  0.0574  169 PRO A CA  
1092 C C   . PRO A 143 ? 0.9240 0.8223 1.0042 -0.0659 0.0368  0.0518  169 PRO A C   
1093 O O   . PRO A 143 ? 1.0076 0.9101 1.0980 -0.0757 0.0396  0.0525  169 PRO A O   
1094 C CB  . PRO A 143 ? 0.7191 0.6043 0.7865 -0.0647 0.0466  0.0652  169 PRO A CB  
1095 C CG  . PRO A 143 ? 0.5972 0.4598 0.6525 -0.0657 0.0495  0.0707  169 PRO A CG  
1096 C CD  . PRO A 143 ? 0.6437 0.4889 0.6991 -0.0715 0.0460  0.0674  169 PRO A CD  
1097 N N   . THR A 144 ? 0.8204 0.7314 0.9014 -0.0578 0.0319  0.0468  170 THR A N   
1098 C CA  . THR A 144 ? 0.7486 0.6801 0.8419 -0.0592 0.0299  0.0420  170 THR A CA  
1099 C C   . THR A 144 ? 0.7613 0.7109 0.8649 -0.0630 0.0357  0.0472  170 THR A C   
1100 O O   . THR A 144 ? 0.6154 0.5633 0.7163 -0.0624 0.0403  0.0535  170 THR A O   
1101 C CB  . THR A 144 ? 0.6403 0.5841 0.7314 -0.0480 0.0244  0.0374  170 THR A CB  
1102 O OG1 . THR A 144 ? 0.8212 0.7856 0.9235 -0.0486 0.0226  0.0332  170 THR A OG1 
1103 C CG2 . THR A 144 ? 0.5895 0.5421 0.6780 -0.0403 0.0270  0.0432  170 THR A CG2 
1104 N N   . GLN A 145 ? 0.8523 0.8195 0.9677 -0.0660 0.0349  0.0439  171 GLN A N   
1105 C CA  . GLN A 145 ? 0.7578 0.7425 0.8834 -0.0690 0.0399  0.0481  171 GLN A CA  
1106 C C   . GLN A 145 ? 0.7548 0.7498 0.8797 -0.0604 0.0411  0.0526  171 GLN A C   
1107 O O   . GLN A 145 ? 0.8302 0.8323 0.9599 -0.0616 0.0455  0.0573  171 GLN A O   
1108 C CB  . GLN A 145 ? 0.7443 0.7468 0.8817 -0.0721 0.0379  0.0428  171 GLN A CB  
1109 C CG  . GLN A 145 ? 0.8039 0.8164 0.9519 -0.0806 0.0430  0.0454  171 GLN A CG  
1110 C CD  . GLN A 145 ? 0.9570 0.9825 1.1161 -0.0855 0.0403  0.0386  171 GLN A CD  
1111 O OE1 . GLN A 145 ? 1.0977 1.1266 1.2568 -0.0814 0.0342  0.0315  171 GLN A OE1 
1112 N NE2 . GLN A 145 ? 1.0312 1.0655 1.1999 -0.0936 0.0445  0.0401  171 GLN A NE2 
1113 N N   . GLN A 146 ? 0.6053 0.6015 0.7250 -0.0515 0.0372  0.0509  172 GLN A N   
1114 C CA  . GLN A 146 ? 0.4061 0.4116 0.5270 -0.0437 0.0381  0.0555  172 GLN A CA  
1115 C C   . GLN A 146 ? 0.4782 0.4691 0.5912 -0.0425 0.0402  0.0592  172 GLN A C   
1116 O O   . GLN A 146 ? 0.5429 0.5404 0.6602 -0.0395 0.0422  0.0633  172 GLN A O   
1117 C CB  . GLN A 146 ? 0.3680 0.3811 0.4861 -0.0343 0.0337  0.0532  172 GLN A CB  
1118 C CG  . GLN A 146 ? 0.3690 0.3937 0.4912 -0.0269 0.0349  0.0589  172 GLN A CG  
1119 C CD  . GLN A 146 ? 0.6238 0.6675 0.7598 -0.0276 0.0379  0.0633  172 GLN A CD  
1120 O OE1 . GLN A 146 ? 0.7188 0.7686 0.8612 -0.0246 0.0399  0.0689  172 GLN A OE1 
1121 N NE2 . GLN A 146 ? 0.5755 0.6284 0.7168 -0.0312 0.0379  0.0606  172 GLN A NE2 
1122 N N   . ASP A 147 ? 0.4681 0.4391 0.5699 -0.0444 0.0392  0.0575  173 ASP A N   
1123 C CA  . ASP A 147 ? 0.5365 0.4932 0.6290 -0.0425 0.0411  0.0608  173 ASP A CA  
1124 C C   . ASP A 147 ? 0.4888 0.4488 0.5862 -0.0474 0.0465  0.0651  173 ASP A C   
1125 O O   . ASP A 147 ? 0.4298 0.3931 0.5277 -0.0430 0.0477  0.0676  173 ASP A O   
1126 C CB  . ASP A 147 ? 0.4677 0.4016 0.5474 -0.0440 0.0396  0.0590  173 ASP A CB  
1127 C CG  . ASP A 147 ? 0.4781 0.4067 0.5499 -0.0363 0.0337  0.0544  173 ASP A CG  
1128 O OD1 . ASP A 147 ? 0.2530 0.1967 0.3287 -0.0293 0.0316  0.0536  173 ASP A OD1 
1129 O OD2 . ASP A 147 ? 0.6065 0.5160 0.6685 -0.0368 0.0313  0.0520  173 ASP A OD2 
1130 N N   . VAL A 148 ? 0.4734 0.4334 0.5751 -0.0561 0.0492  0.0653  174 VAL A N   
1131 C CA  . VAL A 148 ? 0.5706 0.5361 0.6769 -0.0605 0.0544  0.0691  174 VAL A CA  
1132 C C   . VAL A 148 ? 0.6527 0.6363 0.7691 -0.0563 0.0547  0.0700  174 VAL A C   
1133 O O   . VAL A 148 ? 0.7606 0.7463 0.8774 -0.0541 0.0570  0.0724  174 VAL A O   
1134 C CB  . VAL A 148 ? 0.5717 0.5404 0.6851 -0.0706 0.0570  0.0688  174 VAL A CB  
1135 C CG1 . VAL A 148 ? 0.5755 0.5545 0.6946 -0.0738 0.0624  0.0726  174 VAL A CG1 
1136 C CG2 . VAL A 148 ? 0.5019 0.4505 0.6073 -0.0760 0.0572  0.0690  174 VAL A CG2 
1137 N N   . LEU A 149 ? 0.6255 0.6221 0.7502 -0.0544 0.0520  0.0679  175 LEU A N   
1138 C CA  . LEU A 149 ? 0.6703 0.6833 0.8060 -0.0503 0.0520  0.0696  175 LEU A CA  
1139 C C   . LEU A 149 ? 0.7250 0.7345 0.8587 -0.0433 0.0510  0.0713  175 LEU A C   
1140 O O   . LEU A 149 ? 0.7170 0.7349 0.8592 -0.0411 0.0517  0.0729  175 LEU A O   
1141 C CB  . LEU A 149 ? 0.6081 0.6343 0.7506 -0.0478 0.0493  0.0682  175 LEU A CB  
1142 C CG  . LEU A 149 ? 0.5091 0.5527 0.6643 -0.0441 0.0497  0.0712  175 LEU A CG  
1143 C CD1 . LEU A 149 ? 0.5640 0.6159 0.7272 -0.0488 0.0527  0.0718  175 LEU A CD1 
1144 C CD2 . LEU A 149 ? 0.4936 0.5498 0.6528 -0.0402 0.0474  0.0708  175 LEU A CD2 
1145 N N   . ARG A 150 ? 0.7414 0.7384 0.8643 -0.0396 0.0488  0.0703  176 ARG A N   
1146 C CA  . ARG A 150 ? 0.7222 0.7169 0.8436 -0.0325 0.0470  0.0711  176 ARG A CA  
1147 C C   . ARG A 150 ? 0.7191 0.7025 0.8321 -0.0315 0.0485  0.0712  176 ARG A C   
1148 O O   . ARG A 150 ? 0.6274 0.6103 0.7406 -0.0255 0.0468  0.0707  176 ARG A O   
1149 C CB  . ARG A 150 ? 0.6754 0.6651 0.7897 -0.0273 0.0435  0.0696  176 ARG A CB  
1150 C CG  . ARG A 150 ? 0.5956 0.6003 0.7186 -0.0248 0.0418  0.0702  176 ARG A CG  
1151 C CD  . ARG A 150 ? 0.6813 0.7015 0.8200 -0.0228 0.0427  0.0739  176 ARG A CD  
1152 N NE  . ARG A 150 ? 0.7786 0.8131 0.9247 -0.0184 0.0415  0.0764  176 ARG A NE  
1153 C CZ  . ARG A 150 ? 0.6474 0.6880 0.7992 -0.0127 0.0404  0.0793  176 ARG A CZ  
1154 N NH1 . ARG A 150 ? 0.4899 0.5232 0.6414 -0.0108 0.0395  0.0787  176 ARG A NH1 
1155 N NH2 . ARG A 150 ? 0.5742 0.6295 0.7325 -0.0085 0.0402  0.0829  176 ARG A NH2 
1156 N N   . THR A 151 ? 0.7138 0.6894 0.8201 -0.0369 0.0518  0.0720  177 THR A N   
1157 C CA  . THR A 151 ? 0.6143 0.5800 0.7106 -0.0349 0.0539  0.0731  177 THR A CA  
1158 C C   . THR A 151 ? 0.6286 0.6050 0.7328 -0.0315 0.0544  0.0728  177 THR A C   
1159 O O   . THR A 151 ? 0.6880 0.6780 0.8055 -0.0335 0.0546  0.0726  177 THR A O   
1160 C CB  . THR A 151 ? 0.5436 0.5004 0.6326 -0.0419 0.0583  0.0758  177 THR A CB  
1161 O OG1 . THR A 151 ? 0.5666 0.5366 0.6667 -0.0481 0.0614  0.0766  177 THR A OG1 
1162 C CG2 . THR A 151 ? 0.6555 0.5998 0.7382 -0.0455 0.0569  0.0751  177 THR A CG2 
1163 N N   . ARG A 152 ? 0.6501 0.6200 0.7457 -0.0254 0.0541  0.0722  178 ARG A N   
1164 C CA  . ARG A 152 ? 0.6581 0.6370 0.7602 -0.0205 0.0532  0.0701  178 ARG A CA  
1165 C C   . ARG A 152 ? 0.7532 0.7270 0.8431 -0.0182 0.0568  0.0714  178 ARG A C   
1166 O O   . ARG A 152 ? 0.8682 0.8313 0.9446 -0.0126 0.0563  0.0715  178 ARG A O   
1167 C CB  . ARG A 152 ? 0.5340 0.5137 0.6401 -0.0127 0.0479  0.0665  178 ARG A CB  
1168 C CG  . ARG A 152 ? 0.4208 0.4063 0.5382 -0.0141 0.0452  0.0668  178 ARG A CG  
1169 C CD  . ARG A 152 ? 0.2308 0.2155 0.3500 -0.0070 0.0406  0.0642  178 ARG A CD  
1170 N NE  . ARG A 152 ? 0.4320 0.4213 0.5582 -0.0015 0.0379  0.0603  178 ARG A NE  
1171 C CZ  . ARG A 152 ? 0.4604 0.4607 0.6056 -0.0012 0.0354  0.0590  178 ARG A CZ  
1172 N NH1 . ARG A 152 ? 0.5334 0.5418 0.6915 -0.0058 0.0361  0.0627  178 ARG A NH1 
1173 N NH2 . ARG A 152 ? 0.4549 0.4580 0.6064 0.0042  0.0318  0.0539  178 ARG A NH2 
1174 N N   . VAL A 153 ? 0.6644 0.6470 0.7585 -0.0218 0.0605  0.0729  179 VAL A N   
1175 C CA  . VAL A 153 ? 0.6882 0.6692 0.7712 -0.0196 0.0650  0.0756  179 VAL A CA  
1176 C C   . VAL A 153 ? 0.7173 0.7116 0.8063 -0.0129 0.0637  0.0716  179 VAL A C   
1177 O O   . VAL A 153 ? 0.8309 0.8351 0.9347 -0.0123 0.0599  0.0676  179 VAL A O   
1178 C CB  . VAL A 153 ? 0.6898 0.6705 0.7712 -0.0294 0.0714  0.0813  179 VAL A CB  
1179 C CG1 . VAL A 153 ? 0.6959 0.6612 0.7708 -0.0353 0.0719  0.0842  179 VAL A CG1 
1180 C CG2 . VAL A 153 ? 0.5958 0.5920 0.6933 -0.0352 0.0717  0.0799  179 VAL A CG2 
1181 N N   . LYS A 154 ? 0.6721 0.6665 0.7495 -0.0072 0.0667  0.0730  180 LYS A N   
1182 C CA  . LYS A 154 ? 0.8448 0.8524 0.9261 0.0008  0.0650  0.0683  180 LYS A CA  
1183 C C   . LYS A 154 ? 0.9022 0.9241 0.9944 -0.0048 0.0680  0.0692  180 LYS A C   
1184 O O   . LYS A 154 ? 0.8653 0.8897 0.9525 -0.0104 0.0748  0.0753  180 LYS A O   
1185 C CB  . LYS A 154 ? 0.9906 0.9964 1.0546 0.0100  0.0677  0.0698  180 LYS A CB  
1186 C CG  . LYS A 154 ? 1.1235 1.1210 1.1794 0.0202  0.0621  0.0650  180 LYS A CG  
1187 C CD  . LYS A 154 ? 1.1154 1.1208 1.1864 0.0262  0.0535  0.0548  180 LYS A CD  
1188 C CE  . LYS A 154 ? 1.1038 1.1027 1.1689 0.0360  0.0475  0.0492  180 LYS A CE  
1189 N NZ  . LYS A 154 ? 1.0714 1.0776 1.1548 0.0403  0.0388  0.0394  180 LYS A NZ  
1190 N N   . THR A 155 ? 1.1083 1.1396 1.2162 -0.0031 0.0629  0.0633  181 THR A N   
1191 C CA  . THR A 155 ? 1.4007 1.4461 1.5197 -0.0070 0.0647  0.0632  181 THR A CA  
1192 C C   . THR A 155 ? 1.4909 1.5479 1.6044 0.0000  0.0672  0.0619  181 THR A C   
1193 O O   . THR A 155 ? 1.4156 1.4786 1.5324 0.0100  0.0619  0.0547  181 THR A O   
1194 C CB  . THR A 155 ? 1.4808 1.5316 1.6181 -0.0060 0.0583  0.0579  181 THR A CB  
1195 O OG1 . THR A 155 ? 1.6008 1.6499 1.7408 0.0039  0.0516  0.0510  181 THR A OG1 
1196 C CG2 . THR A 155 ? 1.3949 1.4391 1.5385 -0.0136 0.0575  0.0609  181 THR A CG2 
1197 N N   . THR A 156 ? 1.5060 1.8224 1.5260 -0.1052 0.0640  0.0340  182 THR A N   
1198 C CA  . THR A 156 ? 1.5726 1.8845 1.5957 -0.1085 0.0720  0.0282  182 THR A CA  
1199 C C   . THR A 156 ? 1.5709 1.8865 1.6156 -0.1109 0.0731  0.0246  182 THR A C   
1200 O O   . THR A 156 ? 1.6284 1.9433 1.6843 -0.1120 0.0755  0.0221  182 THR A O   
1201 C CB  . THR A 156 ? 1.5522 1.8560 1.5675 -0.1094 0.0780  0.0261  182 THR A CB  
1202 O OG1 . THR A 156 ? 1.6308 1.9304 1.6259 -0.1066 0.0761  0.0295  182 THR A OG1 
1203 C CG2 . THR A 156 ? 1.4202 1.7185 1.4368 -0.1130 0.0868  0.0202  182 THR A CG2 
1204 N N   . GLY A 157 ? 1.4077 1.7272 1.4584 -0.1114 0.0713  0.0241  183 GLY A N   
1205 C CA  . GLY A 157 ? 1.2197 1.5418 1.2898 -0.1132 0.0721  0.0204  183 GLY A CA  
1206 C C   . GLY A 157 ? 0.9944 1.3218 1.0781 -0.1111 0.0647  0.0228  183 GLY A C   
1207 O O   . GLY A 157 ? 1.0170 1.3476 1.0955 -0.1086 0.0580  0.0278  183 GLY A O   
1208 N N   . ILE A 158 ? 0.7805 1.1087 0.8815 -0.1120 0.0659  0.0190  184 ILE A N   
1209 C CA  . ILE A 158 ? 0.6788 1.0114 0.7940 -0.1099 0.0590  0.0206  184 ILE A CA  
1210 C C   . ILE A 158 ? 0.7960 1.1288 0.9143 -0.1088 0.0573  0.0216  184 ILE A C   
1211 O O   . ILE A 158 ? 0.9695 1.2998 1.0910 -0.1107 0.0630  0.0177  184 ILE A O   
1212 C CB  . ILE A 158 ? 0.6250 0.9590 0.7588 -0.1110 0.0605  0.0158  184 ILE A CB  
1213 C CG1 . ILE A 158 ? 0.7000 1.0333 0.8309 -0.1124 0.0626  0.0145  184 ILE A CG1 
1214 C CG2 . ILE A 158 ? 0.5308 0.8689 0.6786 -0.1083 0.0529  0.0175  184 ILE A CG2 
1215 C CD1 . ILE A 158 ? 0.6476 0.9813 0.7955 -0.1136 0.0650  0.0095  184 ILE A CD1 
1216 N N   . VAL A 159 ? 0.6352 0.9708 0.7525 -0.1059 0.0496  0.0265  185 VAL A N   
1217 C CA  . VAL A 159 ? 0.5198 0.8555 0.6399 -0.1047 0.0472  0.0277  185 VAL A CA  
1218 C C   . VAL A 159 ? 0.4955 0.8349 0.6346 -0.1034 0.0421  0.0264  185 VAL A C   
1219 O O   . VAL A 159 ? 0.4815 0.8234 0.6277 -0.1020 0.0376  0.0273  185 VAL A O   
1220 C CB  . VAL A 159 ? 0.4970 0.8326 0.6020 -0.1022 0.0421  0.0341  185 VAL A CB  
1221 C CG1 . VAL A 159 ? 0.3573 0.6887 0.4436 -0.1030 0.0474  0.0350  185 VAL A CG1 
1222 C CG2 . VAL A 159 ? 0.6669 1.0057 0.7706 -0.1000 0.0352  0.0384  185 VAL A CG2 
1223 N N   . GLU A 160 ? 0.5008 0.8404 0.6480 -0.1038 0.0428  0.0242  186 GLU A N   
1224 C CA  . GLU A 160 ? 0.5378 0.8811 0.7032 -0.1023 0.0379  0.0226  186 GLU A CA  
1225 C C   . GLU A 160 ? 0.5294 0.8729 0.6945 -0.1014 0.0347  0.0242  186 GLU A C   
1226 O O   . GLU A 160 ? 0.7571 1.0979 0.9167 -0.1034 0.0400  0.0225  186 GLU A O   
1227 C CB  . GLU A 160 ? 0.6732 1.0177 0.8553 -0.1045 0.0433  0.0155  186 GLU A CB  
1228 C CG  . GLU A 160 ? 0.8573 1.2061 1.0590 -0.1030 0.0387  0.0130  186 GLU A CG  
1229 C CD  . GLU A 160 ? 1.0614 1.4118 1.2799 -0.1052 0.0447  0.0056  186 GLU A CD  
1230 O OE1 . GLU A 160 ? 1.2078 1.5553 1.4217 -0.1084 0.0532  0.0024  186 GLU A OE1 
1231 O OE2 . GLU A 160 ? 1.0419 1.3965 1.2781 -0.1037 0.0409  0.0030  186 GLU A OE2 
1232 N N   . THR A 161 ? 0.3345 0.6805 0.5050 -0.0983 0.0262  0.0274  187 THR A N   
1233 C CA  . THR A 161 ? 0.4000 0.7461 0.5706 -0.0973 0.0224  0.0290  187 THR A CA  
1234 C C   . THR A 161 ? 0.3845 0.7346 0.5746 -0.0957 0.0171  0.0264  187 THR A C   
1235 O O   . THR A 161 ? 0.3825 0.7346 0.5805 -0.0934 0.0117  0.0273  187 THR A O   
1236 C CB  . THR A 161 ? 0.3652 0.7097 0.5199 -0.0947 0.0166  0.0363  187 THR A CB  
1237 O OG1 . THR A 161 ? 0.4709 0.8149 0.6255 -0.0939 0.0133  0.0376  187 THR A OG1 
1238 C CG2 . THR A 161 ? 0.3746 0.7208 0.5318 -0.0918 0.0094  0.0398  187 THR A CG2 
1239 N N   . HIS A 162 ? 0.4059 0.7570 0.6034 -0.0970 0.0186  0.0231  188 HIS A N   
1240 C CA  . HIS A 162 ? 0.3729 0.7284 0.5894 -0.0956 0.0135  0.0201  188 HIS A CA  
1241 C C   . HIS A 162 ? 0.4056 0.7608 0.6179 -0.0934 0.0062  0.0242  188 HIS A C   
1242 O O   . HIS A 162 ? 0.5183 0.8701 0.7166 -0.0945 0.0080  0.0268  188 HIS A O   
1243 C CB  . HIS A 162 ? 0.5968 0.9545 0.8268 -0.0990 0.0204  0.0126  188 HIS A CB  
1244 C CG  . HIS A 162 ? 0.9046 1.2613 1.1360 -0.1018 0.0292  0.0084  188 HIS A CG  
1245 N ND1 . HIS A 162 ? 1.0079 1.3682 1.2572 -0.1021 0.0310  0.0030  188 HIS A ND1 
1246 C CD2 . HIS A 162 ? 1.0605 1.4125 1.2772 -0.1044 0.0367  0.0088  188 HIS A CD2 
1247 C CE1 . HIS A 162 ? 1.0952 1.4530 1.3407 -0.1049 0.0394  0.0002  188 HIS A CE1 
1248 N NE2 . HIS A 162 ? 1.1700 1.5227 1.3956 -0.1064 0.0429  0.0037  188 HIS A NE2 
1249 N N   . PHE A 163 ? 0.3887 0.7467 0.6124 -0.0902 -0.0020 0.0247  189 PHE A N   
1250 C CA  . PHE A 163 ? 0.3867 0.7444 0.6080 -0.0881 -0.0094 0.0281  189 PHE A CA  
1251 C C   . PHE A 163 ? 0.3439 0.7051 0.5811 -0.0846 -0.0179 0.0271  189 PHE A C   
1252 O O   . PHE A 163 ? 0.3631 0.7258 0.6091 -0.0829 -0.0194 0.0258  189 PHE A O   
1253 C CB  . PHE A 163 ? 0.4141 0.7673 0.6149 -0.0864 -0.0126 0.0358  189 PHE A CB  
1254 C CG  . PHE A 163 ? 0.1882 0.5406 0.3857 -0.0837 -0.0168 0.0395  189 PHE A CG  
1255 C CD1 . PHE A 163 ? 0.1862 0.5388 0.3886 -0.0800 -0.0258 0.0422  189 PHE A CD1 
1256 C CD2 . PHE A 163 ? 0.1766 0.5276 0.3656 -0.0850 -0.0117 0.0403  189 PHE A CD2 
1257 C CE1 . PHE A 163 ? 0.1734 0.5244 0.3722 -0.0778 -0.0292 0.0456  189 PHE A CE1 
1258 C CE2 . PHE A 163 ? 0.3641 0.7144 0.5501 -0.0830 -0.0152 0.0435  189 PHE A CE2 
1259 C CZ  . PHE A 163 ? 0.3745 0.7247 0.5654 -0.0795 -0.0238 0.0462  189 PHE A CZ  
1260 N N   . THR A 164 ? 0.4869 0.8490 0.7273 -0.0834 -0.0236 0.0275  190 THR A N   
1261 C CA  . THR A 164 ? 0.5353 0.9004 0.7900 -0.0798 -0.0323 0.0266  190 THR A CA  
1262 C C   . THR A 164 ? 0.6022 0.9634 0.8457 -0.0761 -0.0413 0.0335  190 THR A C   
1263 O O   . THR A 164 ? 0.7576 1.1156 0.9873 -0.0768 -0.0417 0.0373  190 THR A O   
1264 C CB  . THR A 164 ? 0.6660 1.0361 0.9368 -0.0811 -0.0325 0.0205  190 THR A CB  
1265 O OG1 . THR A 164 ? 0.8329 1.2065 1.1147 -0.0846 -0.0238 0.0138  190 THR A OG1 
1266 C CG2 . THR A 164 ? 0.6897 1.0631 0.9755 -0.0768 -0.0422 0.0194  190 THR A CG2 
1267 N N   . PHE A 165 ? 0.5532 0.9142 0.8023 -0.0722 -0.0484 0.0351  191 PHE A N   
1268 C CA  . PHE A 165 ? 0.5329 0.8894 0.7716 -0.0686 -0.0569 0.0415  191 PHE A CA  
1269 C C   . PHE A 165 ? 0.5142 0.8715 0.7657 -0.0642 -0.0652 0.0407  191 PHE A C   
1270 O O   . PHE A 165 ? 0.6232 0.9813 0.8822 -0.0631 -0.0645 0.0389  191 PHE A O   
1271 C CB  . PHE A 165 ? 0.5135 0.8653 0.7345 -0.0687 -0.0549 0.0473  191 PHE A CB  
1272 C CG  . PHE A 165 ? 0.6185 0.9655 0.8291 -0.0651 -0.0629 0.0538  191 PHE A CG  
1273 C CD1 . PHE A 165 ? 0.6439 0.9885 0.8464 -0.0641 -0.0675 0.0572  191 PHE A CD1 
1274 C CD2 . PHE A 165 ? 0.5930 0.9373 0.8013 -0.0629 -0.0656 0.0565  191 PHE A CD2 
1275 C CE1 . PHE A 165 ? 0.6702 1.0097 0.8625 -0.0609 -0.0746 0.0631  191 PHE A CE1 
1276 C CE2 . PHE A 165 ? 0.6910 1.0301 0.8892 -0.0598 -0.0725 0.0623  191 PHE A CE2 
1277 C CZ  . PHE A 165 ? 0.7312 1.0679 0.9214 -0.0588 -0.0770 0.0657  191 PHE A CZ  
1278 N N   . LYS A 166 ? 0.3486 0.7054 0.6021 -0.0616 -0.0731 0.0419  192 LYS A N   
1279 C CA  . LYS A 166 ? 0.2618 0.6192 0.5275 -0.0570 -0.0818 0.0408  192 LYS A CA  
1280 C C   . LYS A 166 ? 0.2319 0.5958 0.5190 -0.0571 -0.0794 0.0332  192 LYS A C   
1281 O O   . LYS A 166 ? 0.2674 0.6310 0.5620 -0.0542 -0.0817 0.0323  192 LYS A O   
1282 C CB  . LYS A 166 ? 0.2615 0.6127 0.5177 -0.0537 -0.0860 0.0462  192 LYS A CB  
1283 C CG  . LYS A 166 ? 0.4601 0.8047 0.6974 -0.0525 -0.0905 0.0536  192 LYS A CG  
1284 C CD  . LYS A 166 ? 0.5915 0.9299 0.8224 -0.0488 -0.0959 0.0582  192 LYS A CD  
1285 C CE  . LYS A 166 ? 0.6684 1.0002 0.8813 -0.0475 -0.1005 0.0652  192 LYS A CE  
1286 N NZ  . LYS A 166 ? 0.7081 1.0331 0.9149 -0.0439 -0.1061 0.0694  192 LYS A NZ  
1287 N N   . ASP A 167 ? 0.4215 0.7912 0.7182 -0.0605 -0.0746 0.0277  193 ASP A N   
1288 C CA  . ASP A 167 ? 0.6484 1.0252 0.9669 -0.0608 -0.0721 0.0199  193 ASP A CA  
1289 C C   . ASP A 167 ? 0.5738 0.9508 0.8955 -0.0618 -0.0654 0.0180  193 ASP A C   
1290 O O   . ASP A 167 ? 0.5544 0.9359 0.8935 -0.0605 -0.0651 0.0126  193 ASP A O   
1291 C CB  . ASP A 167 ? 0.8338 1.2132 1.1668 -0.0557 -0.0823 0.0180  193 ASP A CB  
1292 C CG  . ASP A 167 ? 0.9622 1.3422 1.2941 -0.0549 -0.0890 0.0188  193 ASP A CG  
1293 O OD1 . ASP A 167 ? 1.0006 1.3798 1.3227 -0.0589 -0.0848 0.0199  193 ASP A OD1 
1294 O OD2 . ASP A 167 ? 1.0372 1.4180 1.3775 -0.0503 -0.0985 0.0184  193 ASP A OD2 
1295 N N   . LEU A 168 ? 0.4869 0.8591 0.7919 -0.0640 -0.0600 0.0222  194 LEU A N   
1296 C CA  . LEU A 168 ? 0.4353 0.8072 0.7414 -0.0655 -0.0532 0.0206  194 LEU A CA  
1297 C C   . LEU A 168 ? 0.5187 0.8908 0.8168 -0.0709 -0.0426 0.0192  194 LEU A C   
1298 O O   . LEU A 168 ? 0.6007 0.9700 0.8838 -0.0728 -0.0413 0.0229  194 LEU A O   
1299 C CB  . LEU A 168 ? 0.2717 0.6374 0.5654 -0.0629 -0.0565 0.0266  194 LEU A CB  
1300 C CG  . LEU A 168 ? 0.4019 0.7655 0.7015 -0.0573 -0.0663 0.0282  194 LEU A CG  
1301 C CD1 . LEU A 168 ? 0.4714 0.8284 0.7578 -0.0559 -0.0677 0.0338  194 LEU A CD1 
1302 C CD2 . LEU A 168 ? 0.3983 0.7672 0.7198 -0.0554 -0.0669 0.0215  194 LEU A CD2 
1303 N N   . HIS A 169 ? 0.4228 0.7977 0.7304 -0.0733 -0.0352 0.0139  195 HIS A N   
1304 C CA  . HIS A 169 ? 0.4994 0.8735 0.7991 -0.0783 -0.0248 0.0124  195 HIS A CA  
1305 C C   . HIS A 169 ? 0.5099 0.8798 0.7971 -0.0789 -0.0211 0.0156  195 HIS A C   
1306 O O   . HIS A 169 ? 0.5893 0.9598 0.8844 -0.0785 -0.0188 0.0129  195 HIS A O   
1307 C CB  . HIS A 169 ? 0.5238 0.9034 0.8408 -0.0811 -0.0180 0.0041  195 HIS A CB  
1308 C CG  . HIS A 169 ? 0.7148 1.0993 1.0442 -0.0813 -0.0206 0.0003  195 HIS A CG  
1309 N ND1 . HIS A 169 ? 0.7937 1.1784 1.1184 -0.0854 -0.0153 -0.0013 195 HIS A ND1 
1310 C CD2 . HIS A 169 ? 0.9132 1.3026 1.2592 -0.0780 -0.0280 -0.0024 195 HIS A CD2 
1311 C CE1 . HIS A 169 ? 0.9038 1.2935 1.2420 -0.0850 -0.0192 -0.0050 195 HIS A CE1 
1312 N NE2 . HIS A 169 ? 0.9540 1.3469 1.3055 -0.0804 -0.0271 -0.0058 195 HIS A NE2 
1313 N N   . PHE A 170 ? 0.4470 0.8125 0.7145 -0.0798 -0.0206 0.0214  196 PHE A N   
1314 C CA  . PHE A 170 ? 0.3383 0.7000 0.5927 -0.0804 -0.0178 0.0249  196 PHE A CA  
1315 C C   . PHE A 170 ? 0.3987 0.7599 0.6469 -0.0848 -0.0075 0.0223  196 PHE A C   
1316 O O   . PHE A 170 ? 0.3946 0.7557 0.6378 -0.0875 -0.0031 0.0212  196 PHE A O   
1317 C CB  . PHE A 170 ? 0.3511 0.7089 0.5876 -0.0788 -0.0229 0.0325  196 PHE A CB  
1318 C CG  . PHE A 170 ? 0.5056 0.8620 0.7448 -0.0743 -0.0327 0.0359  196 PHE A CG  
1319 C CD1 . PHE A 170 ? 0.5517 0.9086 0.7941 -0.0721 -0.0394 0.0370  196 PHE A CD1 
1320 C CD2 . PHE A 170 ? 0.4378 0.7918 0.6758 -0.0725 -0.0350 0.0379  196 PHE A CD2 
1321 C CE1 . PHE A 170 ? 0.4570 0.8117 0.7009 -0.0679 -0.0484 0.0402  196 PHE A CE1 
1322 C CE2 . PHE A 170 ? 0.5298 0.8814 0.7692 -0.0683 -0.0437 0.0411  196 PHE A CE2 
1323 C CZ  . PHE A 170 ? 0.5359 0.8877 0.7780 -0.0659 -0.0505 0.0423  196 PHE A CZ  
1324 N N   . LYS A 171 ? 0.3855 0.7458 0.6336 -0.0856 -0.0036 0.0211  197 LYS A N   
1325 C CA  . LYS A 171 ? 0.2637 0.6223 0.5028 -0.0895 0.0056  0.0196  197 LYS A CA  
1326 C C   . LYS A 171 ? 0.2384 0.5938 0.4629 -0.0891 0.0049  0.0244  197 LYS A C   
1327 O O   . LYS A 171 ? 0.2082 0.5633 0.4375 -0.0879 0.0035  0.0241  197 LYS A O   
1328 C CB  . LYS A 171 ? 0.3319 0.6926 0.5857 -0.0915 0.0122  0.0125  197 LYS A CB  
1329 C CG  . LYS A 171 ? 0.2611 0.6255 0.5294 -0.0928 0.0146  0.0069  197 LYS A CG  
1330 C CD  . LYS A 171 ? 0.5439 0.9098 0.8240 -0.0955 0.0229  -0.0001 197 LYS A CD  
1331 C CE  . LYS A 171 ? 0.8270 1.1967 1.1207 -0.0976 0.0264  -0.0061 197 LYS A CE  
1332 N NZ  . LYS A 171 ? 0.8807 1.2516 1.1854 -0.1005 0.0354  -0.0130 197 LYS A NZ  
1333 N N   . MET A 172 ? 0.4545 0.8075 0.6613 -0.0900 0.0058  0.0288  198 MET A N   
1334 C CA  . MET A 172 ? 0.3601 0.7109 0.5526 -0.0896 0.0048  0.0335  198 MET A CA  
1335 C C   . MET A 172 ? 0.3276 0.6769 0.5106 -0.0929 0.0131  0.0318  198 MET A C   
1336 O O   . MET A 172 ? 0.4416 0.7897 0.6154 -0.0947 0.0176  0.0316  198 MET A O   
1337 C CB  . MET A 172 ? 0.2702 0.6197 0.4491 -0.0877 -0.0006 0.0399  198 MET A CB  
1338 C CG  . MET A 172 ? 0.2725 0.6204 0.4370 -0.0873 -0.0020 0.0447  198 MET A CG  
1339 S SD  . MET A 172 ? 0.6189 0.9653 0.7688 -0.0848 -0.0084 0.0520  198 MET A SD  
1340 C CE  . MET A 172 ? 0.0607 0.4071 0.2234 -0.0813 -0.0173 0.0529  198 MET A CE  
1341 N N   . PHE A 173 ? 0.3933 0.7423 0.5778 -0.0936 0.0149  0.0306  199 PHE A N   
1342 C CA  . PHE A 173 ? 0.3797 0.7271 0.5555 -0.0967 0.0224  0.0287  199 PHE A CA  
1343 C C   . PHE A 173 ? 0.3463 0.6927 0.5056 -0.0964 0.0207  0.0337  199 PHE A C   
1344 O O   . PHE A 173 ? 0.3362 0.6830 0.4945 -0.0944 0.0146  0.0374  199 PHE A O   
1345 C CB  . PHE A 173 ? 0.4188 0.7663 0.6067 -0.0980 0.0265  0.0235  199 PHE A CB  
1346 C CG  . PHE A 173 ? 0.4377 0.7866 0.6413 -0.0990 0.0303  0.0175  199 PHE A CG  
1347 C CD1 . PHE A 173 ? 0.5192 0.8668 0.7226 -0.1024 0.0391  0.0128  199 PHE A CD1 
1348 C CD2 . PHE A 173 ? 0.4155 0.7670 0.6340 -0.0965 0.0250  0.0165  199 PHE A CD2 
1349 C CE1 . PHE A 173 ? 0.6204 0.9695 0.8386 -0.1035 0.0431  0.0070  199 PHE A CE1 
1350 C CE2 . PHE A 173 ? 0.4856 0.8394 0.7195 -0.0974 0.0284  0.0107  199 PHE A CE2 
1351 C CZ  . PHE A 173 ? 0.5526 0.9053 0.7867 -0.1011 0.0377  0.0059  199 PHE A CZ  
1352 N N   . ASP A 174 ? 0.4336 0.7785 0.5797 -0.0985 0.0262  0.0337  200 ASP A N   
1353 C CA  . ASP A 174 ? 0.4665 0.8113 0.5973 -0.0985 0.0252  0.0377  200 ASP A CA  
1354 C C   . ASP A 174 ? 0.4982 0.8412 0.6201 -0.1014 0.0327  0.0349  200 ASP A C   
1355 O O   . ASP A 174 ? 0.7072 1.0482 0.8224 -0.1025 0.0374  0.0337  200 ASP A O   
1356 C CB  . ASP A 174 ? 0.5410 0.8860 0.6596 -0.0965 0.0211  0.0431  200 ASP A CB  
1357 C CG  . ASP A 174 ? 0.7031 1.0486 0.8056 -0.0965 0.0208  0.0468  200 ASP A CG  
1358 O OD1 . ASP A 174 ? 0.6932 1.0397 0.7959 -0.0973 0.0205  0.0466  200 ASP A OD1 
1359 O OD2 . ASP A 174 ? 0.6911 1.0361 0.7808 -0.0956 0.0208  0.0498  200 ASP A OD2 
1360 N N   . VAL A 175 ? 0.0990 0.4423 0.2205 -0.1026 0.0338  0.0339  201 VAL A N   
1361 C CA  . VAL A 175 ? 0.2926 0.6341 0.4039 -0.1051 0.0399  0.0319  201 VAL A CA  
1362 C C   . VAL A 175 ? 0.5938 0.9367 0.6886 -0.1042 0.0371  0.0366  201 VAL A C   
1363 O O   . VAL A 175 ? 0.8287 1.1738 0.9225 -0.1037 0.0330  0.0390  201 VAL A O   
1364 C CB  . VAL A 175 ? 0.4483 0.7893 0.5672 -0.1071 0.0428  0.0280  201 VAL A CB  
1365 C CG1 . VAL A 175 ? 0.5022 0.8405 0.6119 -0.1100 0.0502  0.0248  201 VAL A CG1 
1366 C CG2 . VAL A 175 ? 0.3781 0.7189 0.5157 -0.1070 0.0434  0.0240  201 VAL A CG2 
1367 N N   . GLY A 176 ? 0.6268 0.9683 0.7086 -0.1040 0.0395  0.0379  202 GLY A N   
1368 C CA  . GLY A 176 ? 0.7642 1.1075 0.8306 -0.1026 0.0366  0.0425  202 GLY A CA  
1369 C C   . GLY A 176 ? 0.8866 1.2286 0.9398 -0.1041 0.0414  0.0410  202 GLY A C   
1370 O O   . GLY A 176 ? 1.2532 1.5914 1.3004 -0.1049 0.0468  0.0389  202 GLY A O   
1371 N N   . GLY A 177 ? 0.5724 0.9174 0.6208 -0.1046 0.0394  0.0422  203 GLY A N   
1372 C CA  . GLY A 177 ? 0.6553 0.9999 0.6907 -0.1058 0.0428  0.0410  203 GLY A CA  
1373 C C   . GLY A 177 ? 0.8961 1.2366 0.9346 -0.1089 0.0497  0.0354  203 GLY A C   
1374 O O   . GLY A 177 ? 0.9795 1.3208 1.0161 -0.1108 0.0511  0.0334  203 GLY A O   
1375 N N   . GLN A 178 ? 0.9283 1.2646 0.9716 -0.1094 0.0542  0.0326  204 GLN A N   
1376 C CA  . GLN A 178 ? 0.8911 1.2229 0.9373 -0.1124 0.0615  0.0271  204 GLN A CA  
1377 C C   . GLN A 178 ? 0.7558 1.0887 0.8128 -0.1144 0.0617  0.0242  204 GLN A C   
1378 O O   . GLN A 178 ? 0.8551 1.1897 0.9270 -0.1141 0.0593  0.0237  204 GLN A O   
1379 C CB  . GLN A 178 ? 0.9952 1.3235 1.0503 -0.1128 0.0653  0.0245  204 GLN A CB  
1380 C CG  . GLN A 178 ? 0.9460 1.2686 1.0013 -0.1158 0.0740  0.0188  204 GLN A CG  
1381 C CD  . GLN A 178 ? 0.9208 1.2383 0.9570 -0.1159 0.0782  0.0190  204 GLN A CD  
1382 O OE1 . GLN A 178 ? 1.1213 1.4337 1.1531 -0.1183 0.0850  0.0150  204 GLN A OE1 
1383 N NE2 . GLN A 178 ? 0.7561 1.0740 0.7804 -0.1129 0.0739  0.0235  204 GLN A NE2 
1384 N N   . ARG A 179 ? 0.6404 0.9724 0.6894 -0.1164 0.0645  0.0223  205 ARG A N   
1385 C CA  . ARG A 179 ? 0.6177 0.9496 0.6756 -0.1188 0.0660  0.0190  205 ARG A CA  
1386 C C   . ARG A 179 ? 0.6761 1.0038 0.7464 -0.1205 0.0719  0.0140  205 ARG A C   
1387 O O   . ARG A 179 ? 0.8567 1.1796 0.9216 -0.1221 0.0784  0.0107  205 ARG A O   
1388 C CB  . ARG A 179 ? 0.6500 0.9811 0.6954 -0.1207 0.0683  0.0176  205 ARG A CB  
1389 C CG  . ARG A 179 ? 0.7381 1.0682 0.7913 -0.1236 0.0706  0.0138  205 ARG A CG  
1390 C CD  . ARG A 179 ? 0.9430 1.2708 0.9833 -0.1259 0.0744  0.0114  205 ARG A CD  
1391 N NE  . ARG A 179 ? 1.2280 1.5498 1.2608 -0.1267 0.0811  0.0086  205 ARG A NE  
1392 C CZ  . ARG A 179 ? 1.2998 1.6179 1.3200 -0.1285 0.0852  0.0061  205 ARG A CZ  
1393 N NH1 . ARG A 179 ? 1.3268 1.6474 1.3411 -0.1297 0.0831  0.0061  205 ARG A NH1 
1394 N NH2 . ARG A 179 ? 1.1983 1.5099 1.2115 -0.1290 0.0915  0.0037  205 ARG A NH2 
1395 N N   . SER A 180 ? 0.5208 0.8502 0.6075 -0.1200 0.0696  0.0132  206 SER A N   
1396 C CA  . SER A 180 ? 0.5137 0.8402 0.6144 -0.1212 0.0746  0.0084  206 SER A CA  
1397 C C   . SER A 180 ? 0.4470 0.7722 0.5560 -0.1233 0.0772  0.0045  206 SER A C   
1398 O O   . SER A 180 ? 0.3254 0.6527 0.4349 -0.1232 0.0730  0.0063  206 SER A O   
1399 C CB  . SER A 180 ? 0.6182 0.9474 0.7325 -0.1188 0.0704  0.0097  206 SER A CB  
1400 O OG  . SER A 180 ? 0.6095 0.9394 0.7159 -0.1170 0.0684  0.0131  206 SER A OG  
1401 N N   . GLU A 181 ? 0.5044 0.8257 0.6197 -0.1254 0.0843  -0.0008 207 GLU A N   
1402 C CA  . GLU A 181 ? 0.5730 0.8921 0.6960 -0.1275 0.0878  -0.0049 207 GLU A CA  
1403 C C   . GLU A 181 ? 0.4879 0.8096 0.6289 -0.1257 0.0837  -0.0051 207 GLU A C   
1404 O O   . GLU A 181 ? 0.3788 0.7032 0.5289 -0.1232 0.0801  -0.0037 207 GLU A O   
1405 C CB  . GLU A 181 ? 0.9485 1.2623 1.0729 -0.1301 0.0972  -0.0107 207 GLU A CB  
1406 C CG  . GLU A 181 ? 1.2957 1.6061 1.4234 -0.1328 0.1019  -0.0150 207 GLU A CG  
1407 C CD  . GLU A 181 ? 1.4861 1.7948 1.5971 -0.1346 0.1022  -0.0140 207 GLU A CD  
1408 O OE1 . GLU A 181 ? 1.4720 1.7774 1.5836 -0.1370 0.1061  -0.0175 207 GLU A OE1 
1409 O OE2 . GLU A 181 ? 1.5867 1.8973 1.6840 -0.1336 0.0984  -0.0099 207 GLU A OE2 
1410 N N   . ARG A 182 ? 0.5739 0.8944 0.7194 -0.1268 0.0842  -0.0070 208 ARG A N   
1411 C CA  . ARG A 182 ? 0.5981 0.9199 0.7596 -0.1250 0.0806  -0.0074 208 ARG A CA  
1412 C C   . ARG A 182 ? 0.5641 0.8869 0.7416 -0.1233 0.0817  -0.0100 208 ARG A C   
1413 O O   . ARG A 182 ? 0.5991 0.9245 0.7880 -0.1203 0.0761  -0.0085 208 ARG A O   
1414 C CB  . ARG A 182 ? 0.6461 0.9645 0.8106 -0.1272 0.0843  -0.0110 208 ARG A CB  
1415 C CG  . ARG A 182 ? 0.7137 1.0322 0.8936 -0.1252 0.0810  -0.0117 208 ARG A CG  
1416 C CD  . ARG A 182 ? 0.7864 1.1004 0.9709 -0.1275 0.0868  -0.0166 208 ARG A CD  
1417 N NE  . ARG A 182 ? 0.8323 1.1456 1.0300 -0.1254 0.0837  -0.0171 208 ARG A NE  
1418 C CZ  . ARG A 182 ? 0.9743 1.2855 1.1688 -0.1260 0.0813  -0.0158 208 ARG A CZ  
1419 N NH1 . ARG A 182 ? 0.9544 1.2648 1.1337 -0.1289 0.0817  -0.0142 208 ARG A NH1 
1420 N NH2 . ARG A 182 ? 1.0818 1.3915 1.2881 -0.1236 0.0786  -0.0163 208 ARG A NH2 
1421 N N   . LYS A 183 ? 0.5324 0.8531 0.7106 -0.1252 0.0889  -0.0141 209 LYS A N   
1422 C CA  . LYS A 183 ? 0.7475 1.0694 0.9413 -0.1242 0.0911  -0.0174 209 LYS A CA  
1423 C C   . LYS A 183 ? 0.7109 1.0370 0.9073 -0.1213 0.0848  -0.0137 209 LYS A C   
1424 O O   . LYS A 183 ? 0.7253 1.0545 0.9365 -0.1187 0.0807  -0.0139 209 LYS A O   
1425 C CB  . LYS A 183 ? 1.0518 1.3698 1.2432 -0.1273 0.1007  -0.0224 209 LYS A CB  
1426 C CG  . LYS A 183 ? 1.1988 1.5119 1.3876 -0.1303 0.1075  -0.0265 209 LYS A CG  
1427 C CD  . LYS A 183 ? 1.1581 1.4666 1.3426 -0.1335 0.1172  -0.0312 209 LYS A CD  
1428 C CE  . LYS A 183 ? 1.0213 1.3244 1.2030 -0.1365 0.1240  -0.0353 209 LYS A CE  
1429 N NZ  . LYS A 183 ? 0.8312 1.1285 1.0072 -0.1398 0.1338  -0.0398 209 LYS A NZ  
1430 N N   . LYS A 184 ? 0.6603 0.9863 0.8418 -0.1216 0.0841  -0.0103 210 LYS A N   
1431 C CA  . LYS A 184 ? 0.4863 0.8155 0.6681 -0.1192 0.0788  -0.0067 210 LYS A CA  
1432 C C   . LYS A 184 ? 0.4285 0.7613 0.6153 -0.1158 0.0694  -0.0022 210 LYS A C   
1433 O O   . LYS A 184 ? 0.4308 0.7665 0.6276 -0.1133 0.0650  -0.0013 210 LYS A O   
1434 C CB  . LYS A 184 ? 0.5974 0.9252 0.7602 -0.1199 0.0797  -0.0034 210 LYS A CB  
1435 C CG  . LYS A 184 ? 0.7955 1.1188 0.9524 -0.1229 0.0887  -0.0075 210 LYS A CG  
1436 C CD  . LYS A 184 ? 0.9976 1.3189 1.1348 -0.1230 0.0889  -0.0039 210 LYS A CD  
1437 C CE  . LYS A 184 ? 1.0062 1.3217 1.1361 -0.1258 0.0982  -0.0079 210 LYS A CE  
1438 N NZ  . LYS A 184 ? 1.0485 1.3612 1.1583 -0.1255 0.0984  -0.0044 210 LYS A NZ  
1439 N N   . TRP A 185 ? 0.4217 0.7540 0.6011 -0.1158 0.0664  0.0004  211 TRP A N   
1440 C CA  . TRP A 185 ? 0.2563 0.5909 0.4386 -0.1129 0.0580  0.0048  211 TRP A CA  
1441 C C   . TRP A 185 ? 0.3971 0.7325 0.5983 -0.1106 0.0555  0.0025  211 TRP A C   
1442 O O   . TRP A 185 ? 0.5071 0.8447 0.7141 -0.1075 0.0489  0.0053  211 TRP A O   
1443 C CB  . TRP A 185 ? 0.2161 0.5495 0.3885 -0.1141 0.0567  0.0068  211 TRP A CB  
1444 C CG  . TRP A 185 ? 0.3665 0.7008 0.5207 -0.1149 0.0556  0.0108  211 TRP A CG  
1445 C CD1 . TRP A 185 ? 0.4487 0.7813 0.5901 -0.1177 0.0606  0.0096  211 TRP A CD1 
1446 C CD2 . TRP A 185 ? 0.5075 0.8446 0.6543 -0.1127 0.0490  0.0165  211 TRP A CD2 
1447 N NE1 . TRP A 185 ? 0.5480 0.8827 0.6750 -0.1171 0.0573  0.0142  211 TRP A NE1 
1448 C CE2 . TRP A 185 ? 0.5459 0.8833 0.6760 -0.1141 0.0504  0.0185  211 TRP A CE2 
1449 C CE3 . TRP A 185 ? 0.5286 0.8676 0.6810 -0.1095 0.0420  0.0202  211 TRP A CE3 
1450 C CZ2 . TRP A 185 ? 0.6084 0.9485 0.7279 -0.1124 0.0453  0.0238  211 TRP A CZ2 
1451 C CZ3 . TRP A 185 ? 0.4574 0.7984 0.5986 -0.1080 0.0371  0.0255  211 TRP A CZ3 
1452 C CH2 . TRP A 185 ? 0.5861 0.9279 0.7114 -0.1095 0.0389  0.0273  211 TRP A CH2 
1453 N N   . ILE A 186 ? 0.3915 0.7249 0.6020 -0.1120 0.0608  -0.0027 212 ILE A N   
1454 C CA  . ILE A 186 ? 0.3684 0.7025 0.5973 -0.1096 0.0589  -0.0055 212 ILE A CA  
1455 C C   . ILE A 186 ? 0.3313 0.6691 0.5713 -0.1072 0.0562  -0.0060 212 ILE A C   
1456 O O   . ILE A 186 ? 0.4772 0.8167 0.7273 -0.1037 0.0498  -0.0047 212 ILE A O   
1457 C CB  . ILE A 186 ? 0.4076 0.7393 0.6451 -0.1117 0.0667  -0.0118 212 ILE A CB  
1458 C CG1 . ILE A 186 ? 0.4536 0.7813 0.6794 -0.1146 0.0699  -0.0117 212 ILE A CG1 
1459 C CG2 . ILE A 186 ? 0.5213 0.8539 0.7778 -0.1087 0.0643  -0.0145 212 ILE A CG2 
1460 C CD1 . ILE A 186 ? 0.5132 0.8398 0.7372 -0.1129 0.0637  -0.0082 212 ILE A CD1 
1461 N N   . HIS A 187 ? 0.3349 0.6734 0.5721 -0.1092 0.0611  -0.0079 213 HIS A N   
1462 C CA  . HIS A 187 ? 0.3516 0.6936 0.5993 -0.1077 0.0596  -0.0091 213 HIS A CA  
1463 C C   . HIS A 187 ? 0.3394 0.6836 0.5819 -0.1048 0.0510  -0.0032 213 HIS A C   
1464 O O   . HIS A 187 ? 0.4528 0.8000 0.7044 -0.1030 0.0479  -0.0036 213 HIS A O   
1465 C CB  . HIS A 187 ? 0.4976 0.8388 0.7417 -0.1110 0.0677  -0.0125 213 HIS A CB  
1466 C CG  . HIS A 187 ? 0.5641 0.9028 0.8138 -0.1140 0.0766  -0.0187 213 HIS A CG  
1467 N ND1 . HIS A 187 ? 0.5182 0.8588 0.7872 -0.1133 0.0788  -0.0241 213 HIS A ND1 
1468 C CD2 . HIS A 187 ? 0.6732 1.0074 0.9114 -0.1175 0.0840  -0.0204 213 HIS A CD2 
1469 C CE1 . HIS A 187 ? 0.5572 0.8946 0.8266 -0.1164 0.0875  -0.0289 213 HIS A CE1 
1470 N NE2 . HIS A 187 ? 0.6111 0.9443 0.8616 -0.1190 0.0907  -0.0267 213 HIS A NE2 
1471 N N   . CYS A 188 ? 0.2841 0.6267 0.5121 -0.1045 0.0472  0.0021  214 CYS A N   
1472 C CA  . CYS A 188 ? 0.3135 0.6576 0.5355 -0.1018 0.0392  0.0080  214 CYS A CA  
1473 C C   . CYS A 188 ? 0.4414 0.7855 0.6711 -0.0984 0.0318  0.0101  214 CYS A C   
1474 O O   . CYS A 188 ? 0.5592 0.9049 0.7936 -0.0953 0.0252  0.0125  214 CYS A O   
1475 C CB  . CYS A 188 ? 0.4028 0.7456 0.6048 -0.1032 0.0391  0.0126  214 CYS A CB  
1476 S SG  . CYS A 188 ? 0.5192 0.8609 0.7094 -0.1065 0.0470  0.0109  214 CYS A SG  
1477 N N   . PHE A 189 ? 0.3807 0.7223 0.6109 -0.0991 0.0332  0.0090  215 PHE A N   
1478 C CA  . PHE A 189 ? 0.4340 0.7741 0.6702 -0.0960 0.0270  0.0108  215 PHE A CA  
1479 C C   . PHE A 189 ? 0.4232 0.7646 0.6789 -0.0932 0.0255  0.0068  215 PHE A C   
1480 O O   . PHE A 189 ? 0.5505 0.8911 0.8124 -0.0895 0.0188  0.0086  215 PHE A O   
1481 C CB  . PHE A 189 ? 0.5202 0.8568 0.7508 -0.0979 0.0295  0.0106  215 PHE A CB  
1482 C CG  . PHE A 189 ? 0.5318 0.8679 0.7442 -0.1008 0.0311  0.0138  215 PHE A CG  
1483 C CD1 . PHE A 189 ? 0.6055 0.9402 0.8115 -0.1046 0.0383  0.0109  215 PHE A CD1 
1484 C CD2 . PHE A 189 ? 0.5150 0.8519 0.7166 -0.0996 0.0254  0.0196  215 PHE A CD2 
1485 C CE1 . PHE A 189 ? 0.7367 1.0715 0.9263 -0.1069 0.0393  0.0137  215 PHE A CE1 
1486 C CE2 . PHE A 189 ? 0.5467 0.8839 0.7324 -0.1020 0.0267  0.0223  215 PHE A CE2 
1487 C CZ  . PHE A 189 ? 0.7128 1.0491 0.8926 -0.1055 0.0335  0.0193  215 PHE A CZ  
1488 N N   . GLU A 190 ? 0.0940 0.4373 0.3593 -0.0948 0.0318  0.0012  216 GLU A N   
1489 C CA  . GLU A 190 ? 0.1562 0.5018 0.4412 -0.0923 0.0311  -0.0033 216 GLU A CA  
1490 C C   . GLU A 190 ? 0.2768 0.6261 0.5685 -0.0891 0.0244  -0.0018 216 GLU A C   
1491 O O   . GLU A 190 ? 0.3627 0.7141 0.6490 -0.0906 0.0253  -0.0009 216 GLU A O   
1492 C CB  . GLU A 190 ? 0.3045 0.6513 0.5977 -0.0953 0.0404  -0.0100 216 GLU A CB  
1493 C CG  . GLU A 190 ? 0.4712 0.8141 0.7619 -0.0978 0.0467  -0.0127 216 GLU A CG  
1494 C CD  . GLU A 190 ? 0.5964 0.9399 0.8946 -0.1009 0.0562  -0.0193 216 GLU A CD  
1495 O OE1 . GLU A 190 ? 0.5826 0.9296 0.8873 -0.1015 0.0582  -0.0217 216 GLU A OE1 
1496 O OE2 . GLU A 190 ? 0.6791 1.0193 0.9766 -0.1030 0.0619  -0.0221 216 GLU A OE2 
1497 N N   . GLY A 191 ? 0.0427 0.3923 0.3456 -0.0847 0.0177  -0.0016 217 GLY A N   
1498 C CA  . GLY A 191 ? 0.2576 0.6107 0.5687 -0.0814 0.0109  -0.0008 217 GLY A CA  
1499 C C   . GLY A 191 ? 0.3057 0.6578 0.6028 -0.0805 0.0046  0.0059  217 GLY A C   
1500 O O   . GLY A 191 ? 0.4475 0.8022 0.7492 -0.0782 -0.0007 0.0069  217 GLY A O   
1501 N N   . VAL A 192 ? 0.3804 0.7288 0.6607 -0.0823 0.0053  0.0103  218 VAL A N   
1502 C CA  . VAL A 192 ? 0.2388 0.5862 0.5049 -0.0816 -0.0001 0.0167  218 VAL A CA  
1503 C C   . VAL A 192 ? 0.2738 0.6192 0.5429 -0.0768 -0.0096 0.0202  218 VAL A C   
1504 O O   . VAL A 192 ? 0.3307 0.6722 0.5997 -0.0752 -0.0120 0.0214  218 VAL A O   
1505 C CB  . VAL A 192 ? 0.1313 0.4758 0.3795 -0.0845 0.0028  0.0203  218 VAL A CB  
1506 C CG1 . VAL A 192 ? 0.4684 0.8091 0.7168 -0.0843 0.0030  0.0201  218 VAL A CG1 
1507 C CG2 . VAL A 192 ? 0.1006 0.4444 0.3352 -0.0835 -0.0029 0.0268  218 VAL A CG2 
1508 N N   . THR A 193 ? 0.2070 0.5545 0.4783 -0.0747 -0.0149 0.0218  219 THR A N   
1509 C CA  . THR A 193 ? 0.0764 0.4217 0.3498 -0.0700 -0.0243 0.0252  219 THR A CA  
1510 C C   . THR A 193 ? 0.2739 0.6141 0.5310 -0.0697 -0.0277 0.0315  219 THR A C   
1511 O O   . THR A 193 ? 0.3502 0.6860 0.6079 -0.0665 -0.0332 0.0337  219 THR A O   
1512 C CB  . THR A 193 ? 0.1048 0.4534 0.3813 -0.0685 -0.0289 0.0259  219 THR A CB  
1513 O OG1 . THR A 193 ? 0.2513 0.6052 0.5434 -0.0691 -0.0253 0.0196  219 THR A OG1 
1514 C CG2 . THR A 193 ? 0.1473 0.4930 0.4258 -0.0634 -0.0388 0.0291  219 THR A CG2 
1515 N N   . ALA A 194 ? 0.3795 0.7199 0.6218 -0.0730 -0.0243 0.0345  220 ALA A N   
1516 C CA  . ALA A 194 ? 0.1894 0.5259 0.4161 -0.0733 -0.0268 0.0402  220 ALA A CA  
1517 C C   . ALA A 194 ? 0.2179 0.5558 0.4309 -0.0775 -0.0208 0.0414  220 ALA A C   
1518 O O   . ALA A 194 ? 0.2138 0.5551 0.4257 -0.0795 -0.0166 0.0397  220 ALA A O   
1519 C CB  . ALA A 194 ? 0.0588 0.3935 0.2803 -0.0701 -0.0348 0.0452  220 ALA A CB  
1520 N N   . ILE A 195 ? 0.1979 0.5329 0.4004 -0.0788 -0.0203 0.0442  221 ILE A N   
1521 C CA  . ILE A 195 ? 0.1882 0.5248 0.3770 -0.0823 -0.0156 0.0458  221 ILE A CA  
1522 C C   . ILE A 195 ? 0.3902 0.7260 0.5655 -0.0814 -0.0203 0.0520  221 ILE A C   
1523 O O   . ILE A 195 ? 0.5007 0.8328 0.6729 -0.0797 -0.0252 0.0553  221 ILE A O   
1524 C CB  . ILE A 195 ? 0.2084 0.5432 0.3940 -0.0850 -0.0114 0.0444  221 ILE A CB  
1525 C CG1 . ILE A 195 ? 0.0972 0.4328 0.2946 -0.0864 -0.0056 0.0381  221 ILE A CG1 
1526 C CG2 . ILE A 195 ? 0.2548 0.5913 0.4249 -0.0881 -0.0081 0.0467  221 ILE A CG2 
1527 C CD1 . ILE A 195 ? 0.1104 0.4441 0.3043 -0.0893 -0.0010 0.0363  221 ILE A CD1 
1528 N N   . ILE A 196 ? 0.3987 0.7372 0.5655 -0.0825 -0.0185 0.0534  222 ILE A N   
1529 C CA  . ILE A 196 ? 0.2249 0.5631 0.3783 -0.0818 -0.0221 0.0591  222 ILE A CA  
1530 C C   . ILE A 196 ? 0.3051 0.6448 0.4460 -0.0848 -0.0179 0.0603  222 ILE A C   
1531 O O   . ILE A 196 ? 0.3554 0.6979 0.4905 -0.0867 -0.0133 0.0592  222 ILE A O   
1532 C CB  . ILE A 196 ? 0.1586 0.4986 0.3096 -0.0807 -0.0234 0.0605  222 ILE A CB  
1533 C CG1 . ILE A 196 ? 0.1328 0.4720 0.2971 -0.0779 -0.0276 0.0588  222 ILE A CG1 
1534 C CG2 . ILE A 196 ? 0.2418 0.5811 0.3787 -0.0798 -0.0270 0.0664  222 ILE A CG2 
1535 C CD1 . ILE A 196 ? 0.2513 0.5920 0.4142 -0.0771 -0.0288 0.0595  222 ILE A CD1 
1536 N N   . PHE A 197 ? 0.3761 0.4233 0.5491 -0.0059 0.0395  -0.0654 223 PHE A N   
1537 C CA  . PHE A 197 ? 0.4017 0.4571 0.5676 -0.0086 0.0411  -0.0686 223 PHE A CA  
1538 C C   . PHE A 197 ? 0.4162 0.4823 0.5672 -0.0031 0.0367  -0.0638 223 PHE A C   
1539 O O   . PHE A 197 ? 0.4531 0.5244 0.6063 -0.0004 0.0334  -0.0568 223 PHE A O   
1540 C CB  . PHE A 197 ? 0.2092 0.2661 0.3884 -0.0149 0.0431  -0.0685 223 PHE A CB  
1541 C CG  . PHE A 197 ? 0.2250 0.2884 0.3984 -0.0200 0.0449  -0.0726 223 PHE A CG  
1542 C CD1 . PHE A 197 ? 0.2795 0.3358 0.4525 -0.0239 0.0493  -0.0807 223 PHE A CD1 
1543 C CD2 . PHE A 197 ? 0.2773 0.3549 0.4458 -0.0208 0.0420  -0.0680 223 PHE A CD2 
1544 C CE1 . PHE A 197 ? 0.3517 0.4132 0.5186 -0.0290 0.0503  -0.0844 223 PHE A CE1 
1545 C CE2 . PHE A 197 ? 0.2347 0.3199 0.3985 -0.0263 0.0430  -0.0712 223 PHE A CE2 
1546 C CZ  . PHE A 197 ? 0.1791 0.2553 0.3417 -0.0306 0.0469  -0.0796 223 PHE A CZ  
1547 N N   . CYS A 198 ? 0.2832 0.3527 0.4182 -0.0008 0.0369  -0.0674 224 CYS A N   
1548 C CA  . CYS A 198 ? 0.2288 0.3082 0.3469 0.0065  0.0330  -0.0633 224 CYS A CA  
1549 C C   . CYS A 198 ? 0.3997 0.4956 0.5156 0.0042  0.0338  -0.0632 224 CYS A C   
1550 O O   . CYS A 198 ? 0.4409 0.5377 0.5566 -0.0010 0.0369  -0.0694 224 CYS A O   
1551 C CB  . CYS A 198 ? 0.1853 0.2567 0.2836 0.0124  0.0315  -0.0663 224 CYS A CB  
1552 S SG  . CYS A 198 ? 0.5350 0.5881 0.6343 0.0133  0.0295  -0.0656 224 CYS A SG  
1553 N N   . VAL A 199 ? 0.5011 0.6106 0.6150 0.0081  0.0309  -0.0558 225 VAL A N   
1554 C CA  . VAL A 199 ? 0.4446 0.5737 0.5573 0.0058  0.0311  -0.0538 225 VAL A CA  
1555 C C   . VAL A 199 ? 0.4467 0.5893 0.5412 0.0170  0.0280  -0.0490 225 VAL A C   
1556 O O   . VAL A 199 ? 0.4830 0.6252 0.5725 0.0248  0.0250  -0.0428 225 VAL A O   
1557 C CB  . VAL A 199 ? 0.2012 0.3384 0.3307 -0.0014 0.0308  -0.0481 225 VAL A CB  
1558 C CG1 . VAL A 199 ? 0.1574 0.3179 0.2850 -0.0041 0.0302  -0.0444 225 VAL A CG1 
1559 C CG2 . VAL A 199 ? 0.0989 0.2219 0.2442 -0.0116 0.0338  -0.0530 225 VAL A CG2 
1560 N N   . ALA A 200 ? 0.3860 0.5402 0.4696 0.0184  0.0286  -0.0518 226 ALA A N   
1561 C CA  . ALA A 200 ? 0.3966 0.5657 0.4621 0.0302  0.0261  -0.0473 226 ALA A CA  
1562 C C   . ALA A 200 ? 0.4034 0.5982 0.4767 0.0291  0.0254  -0.0389 226 ALA A C   
1563 O O   . ALA A 200 ? 0.6096 0.8206 0.6891 0.0216  0.0266  -0.0392 226 ALA A O   
1564 C CB  . ALA A 200 ? 0.6028 0.7742 0.6527 0.0333  0.0268  -0.0535 226 ALA A CB  
1565 N N   . LEU A 201 ? 0.3927 0.5910 0.4651 0.0359  0.0232  -0.0310 227 LEU A N   
1566 C CA  . LEU A 201 ? 0.3735 0.5966 0.4535 0.0350  0.0226  -0.0219 227 LEU A CA  
1567 C C   . LEU A 201 ? 0.3478 0.5980 0.4175 0.0402  0.0226  -0.0193 227 LEU A C   
1568 O O   . LEU A 201 ? 0.3486 0.6224 0.4289 0.0331  0.0231  -0.0141 227 LEU A O   
1569 C CB  . LEU A 201 ? 0.3358 0.5566 0.4119 0.0445  0.0203  -0.0141 227 LEU A CB  
1570 C CG  . LEU A 201 ? 0.3033 0.5043 0.3940 0.0381  0.0199  -0.0137 227 LEU A CG  
1571 C CD1 . LEU A 201 ? 0.4484 0.6429 0.5295 0.0498  0.0168  -0.0074 227 LEU A CD1 
1572 C CD2 . LEU A 201 ? 0.1573 0.3681 0.2696 0.0245  0.0212  -0.0104 227 LEU A CD2 
1573 N N   . SER A 202 ? 0.2166 0.4633 0.2650 0.0523  0.0219  -0.0227 228 SER A N   
1574 C CA  . SER A 202 ? 0.4772 0.7494 0.5132 0.0602  0.0217  -0.0202 228 SER A CA  
1575 C C   . SER A 202 ? 0.4300 0.7139 0.4742 0.0484  0.0234  -0.0250 228 SER A C   
1576 O O   . SER A 202 ? 0.3686 0.6769 0.4058 0.0527  0.0231  -0.0227 228 SER A O   
1577 C CB  . SER A 202 ? 0.7353 0.9963 0.7433 0.0773  0.0200  -0.0230 228 SER A CB  
1578 O OG  . SER A 202 ? 0.8299 1.0636 0.8321 0.0738  0.0203  -0.0328 228 SER A OG  
1579 N N   . ASP A 203 ? 0.3566 0.6233 0.4150 0.0341  0.0249  -0.0316 229 ASP A N   
1580 C CA  . ASP A 203 ? 0.3964 0.6692 0.4612 0.0222  0.0261  -0.0369 229 ASP A CA  
1581 C C   . ASP A 203 ? 0.4059 0.7022 0.4878 0.0097  0.0256  -0.0302 229 ASP A C   
1582 O O   . ASP A 203 ? 0.4038 0.7049 0.4919 -0.0022 0.0259  -0.0337 229 ASP A O   
1583 C CB  . ASP A 203 ? 0.3662 0.6097 0.4370 0.0130  0.0282  -0.0467 229 ASP A CB  
1584 C CG  . ASP A 203 ? 0.4777 0.7016 0.5307 0.0222  0.0287  -0.0542 229 ASP A CG  
1585 O OD1 . ASP A 203 ? 0.5839 0.8142 0.6182 0.0359  0.0270  -0.0522 229 ASP A OD1 
1586 O OD2 . ASP A 203 ? 0.4173 0.6190 0.4740 0.0158  0.0307  -0.0620 229 ASP A OD2 
1587 N N   . TYR A 204 ? 0.3242 0.6341 0.4125 0.0119  0.0246  -0.0205 230 TYR A N   
1588 C CA  . TYR A 204 ? 0.3534 0.6838 0.4580 -0.0013 0.0237  -0.0131 230 TYR A CA  
1589 C C   . TYR A 204 ? 0.4269 0.7924 0.5287 -0.0022 0.0226  -0.0082 230 TYR A C   
1590 O O   . TYR A 204 ? 0.5154 0.8949 0.6293 -0.0174 0.0215  -0.0053 230 TYR A O   
1591 C CB  . TYR A 204 ? 0.1305 0.4658 0.2420 0.0016  0.0230  -0.0036 230 TYR A CB  
1592 C CG  . TYR A 204 ? 0.0994 0.4620 0.2002 0.0166  0.0224  0.0056  230 TYR A CG  
1593 C CD1 . TYR A 204 ? 0.3572 0.7096 0.4408 0.0348  0.0223  0.0051  230 TYR A CD1 
1594 C CD2 . TYR A 204 ? 0.2385 0.6372 0.3455 0.0125  0.0217  0.0153  230 TYR A CD2 
1595 C CE1 . TYR A 204 ? 0.2387 0.6145 0.3101 0.0502  0.0218  0.0134  230 TYR A CE1 
1596 C CE2 . TYR A 204 ? 0.3580 0.7837 0.4551 0.0276  0.0216  0.0242  230 TYR A CE2 
1597 C CZ  . TYR A 204 ? 0.3091 0.7224 0.3877 0.0471  0.0219  0.0229  230 TYR A CZ  
1598 O OH  . TYR A 204 ? 0.3712 0.8097 0.4376 0.0637  0.0220  0.0315  230 TYR A OH  
1599 N N   . ASP A 205 ? 0.3110 0.6905 0.3961 0.0141  0.0226  -0.0071 231 ASP A N   
1600 C CA  . ASP A 205 ? 0.3089 0.7258 0.3911 0.0160  0.0216  -0.0011 231 ASP A CA  
1601 C C   . ASP A 205 ? 0.3848 0.8017 0.4552 0.0183  0.0216  -0.0092 231 ASP A C   
1602 O O   . ASP A 205 ? 0.4690 0.9168 0.5348 0.0222  0.0206  -0.0049 231 ASP A O   
1603 C CB  . ASP A 205 ? 0.4070 0.8471 0.4787 0.0343  0.0216  0.0085  231 ASP A CB  
1604 C CG  . ASP A 205 ? 0.5067 0.9309 0.5544 0.0547  0.0220  0.0033  231 ASP A CG  
1605 O OD1 . ASP A 205 ? 0.5667 0.9585 0.6080 0.0538  0.0223  -0.0071 231 ASP A OD1 
1606 O OD2 . ASP A 205 ? 0.4823 0.9259 0.5164 0.0718  0.0218  0.0099  231 ASP A OD2 
1607 N N   . LEU A 206 ? 0.4178 0.8013 0.4832 0.0162  0.0226  -0.0206 232 LEU A N   
1608 C CA  . LEU A 206 ? 0.3642 0.7440 0.4171 0.0185  0.0228  -0.0290 232 LEU A CA  
1609 C C   . LEU A 206 ? 0.4313 0.8254 0.4947 0.0018  0.0216  -0.0301 232 LEU A C   
1610 O O   . LEU A 206 ? 0.6248 1.0115 0.7041 -0.0150 0.0212  -0.0301 232 LEU A O   
1611 C CB  . LEU A 206 ? 0.1718 0.5120 0.2169 0.0201  0.0245  -0.0403 232 LEU A CB  
1612 C CG  . LEU A 206 ? 0.4070 0.7292 0.4364 0.0368  0.0247  -0.0409 232 LEU A CG  
1613 C CD1 . LEU A 206 ? 0.3913 0.6773 0.4157 0.0346  0.0262  -0.0516 232 LEU A CD1 
1614 C CD2 . LEU A 206 ? 0.4679 0.8071 0.4755 0.0549  0.0234  -0.0381 232 LEU A CD2 
1615 N N   . VAL A 207 ? 0.3728 0.7866 0.4260 0.0065  0.0205  -0.0309 233 VAL A N   
1616 C CA  . VAL A 207 ? 0.3071 0.7323 0.3671 -0.0090 0.0187  -0.0329 233 VAL A CA  
1617 C C   . VAL A 207 ? 0.3790 0.7681 0.4368 -0.0171 0.0201  -0.0457 233 VAL A C   
1618 O O   . VAL A 207 ? 0.6021 0.9719 0.6449 -0.0064 0.0219  -0.0536 233 VAL A O   
1619 C CB  . VAL A 207 ? 0.1618 0.6185 0.2105 -0.0002 0.0170  -0.0304 233 VAL A CB  
1620 C CG1 . VAL A 207 ? 0.1705 0.6391 0.2266 -0.0175 0.0143  -0.0321 233 VAL A CG1 
1621 C CG2 . VAL A 207 ? 0.1182 0.6125 0.1678 0.0107  0.0163  -0.0173 233 VAL A CG2 
1622 N N   . LEU A 208 ? 0.4092 0.7884 0.4807 -0.0359 0.0194  -0.0477 234 LEU A N   
1623 C CA  . LEU A 208 ? 0.4838 0.8278 0.5538 -0.0434 0.0213  -0.0594 234 LEU A CA  
1624 C C   . LEU A 208 ? 0.4324 0.7745 0.4881 -0.0406 0.0213  -0.0674 234 LEU A C   
1625 O O   . LEU A 208 ? 0.5389 0.9091 0.5902 -0.0394 0.0186  -0.0637 234 LEU A O   
1626 C CB  . LEU A 208 ? 0.3272 0.6617 0.4118 -0.0635 0.0199  -0.0594 234 LEU A CB  
1627 C CG  . LEU A 208 ? 0.2365 0.5845 0.3221 -0.0781 0.0162  -0.0597 234 LEU A CG  
1628 C CD1 . LEU A 208 ? 0.2028 0.5302 0.2983 -0.0969 0.0149  -0.0618 234 LEU A CD1 
1629 C CD2 . LEU A 208 ? 0.2728 0.6643 0.3616 -0.0783 0.0125  -0.0480 234 LEU A CD2 
1630 N N   . ALA A 209 ? 0.2552 0.5651 0.3040 -0.0394 0.0243  -0.0781 235 ALA A N   
1631 C CA  . ALA A 209 ? 0.3734 0.6768 0.4079 -0.0372 0.0247  -0.0867 235 ALA A CA  
1632 C C   . ALA A 209 ? 0.4294 0.7399 0.4685 -0.0533 0.0219  -0.0884 235 ALA A C   
1633 O O   . ALA A 209 ? 0.4396 0.7548 0.4924 -0.0673 0.0198  -0.0839 235 ALA A O   
1634 C CB  . ALA A 209 ? 0.3400 0.6074 0.3675 -0.0336 0.0288  -0.0969 235 ALA A CB  
1635 N N   . GLU A 210 ? 0.4653 0.7750 0.4914 -0.0517 0.0215  -0.0949 236 GLU A N   
1636 C CA  . GLU A 210 ? 0.5699 0.8859 0.5978 -0.0664 0.0182  -0.0968 236 GLU A CA  
1637 C C   . GLU A 210 ? 0.4247 0.7054 0.4539 -0.0779 0.0204  -0.1065 236 GLU A C   
1638 O O   . GLU A 210 ? 0.5299 0.8086 0.5589 -0.0913 0.0176  -0.1092 236 GLU A O   
1639 C CB  . GLU A 210 ? 0.6976 1.0305 0.7106 -0.0594 0.0163  -0.0990 236 GLU A CB  
1640 C CG  . GLU A 210 ? 0.9424 1.2521 0.9379 -0.0463 0.0200  -0.1086 236 GLU A CG  
1641 C CD  . GLU A 210 ? 1.1816 1.5075 1.1614 -0.0392 0.0177  -0.1106 236 GLU A CD  
1642 O OE1 . GLU A 210 ? 1.2389 1.5961 1.2225 -0.0441 0.0132  -0.1042 236 GLU A OE1 
1643 O OE2 . GLU A 210 ? 1.2626 1.5704 1.2259 -0.0289 0.0202  -0.1181 236 GLU A OE2 
1644 N N   . ASP A 211 ? 0.3571 0.6101 0.3868 -0.0726 0.0252  -0.1114 237 ASP A N   
1645 C CA  . ASP A 211 ? 0.5600 0.7798 0.5905 -0.0809 0.0283  -0.1205 237 ASP A CA  
1646 C C   . ASP A 211 ? 0.7634 0.9682 0.8083 -0.0864 0.0299  -0.1180 237 ASP A C   
1647 O O   . ASP A 211 ? 0.8319 1.0103 0.8786 -0.0936 0.0322  -0.1243 237 ASP A O   
1648 C CB  . ASP A 211 ? 0.7172 0.9151 0.7346 -0.0705 0.0332  -0.1299 237 ASP A CB  
1649 C CG  . ASP A 211 ? 0.8917 1.0844 0.9091 -0.0573 0.0362  -0.1278 237 ASP A CG  
1650 O OD1 . ASP A 211 ? 1.0502 1.2597 1.0755 -0.0537 0.0344  -0.1190 237 ASP A OD1 
1651 O OD2 . ASP A 211 ? 0.9287 1.1005 0.9376 -0.0509 0.0403  -0.1347 237 ASP A OD2 
1652 N N   . GLU A 212 ? 0.7946 1.0158 0.8487 -0.0823 0.0287  -0.1087 238 GLU A N   
1653 C CA  . GLU A 212 ? 0.6720 0.8805 0.7395 -0.0870 0.0298  -0.1055 238 GLU A CA  
1654 C C   . GLU A 212 ? 0.4154 0.6389 0.4933 -0.1013 0.0248  -0.0976 238 GLU A C   
1655 O O   . GLU A 212 ? 0.3494 0.6010 0.4263 -0.1048 0.0205  -0.0916 238 GLU A O   
1656 C CB  . GLU A 212 ? 0.7452 0.9564 0.8158 -0.0737 0.0319  -0.1009 238 GLU A CB  
1657 C CG  . GLU A 212 ? 0.9799 1.2235 1.0489 -0.0654 0.0290  -0.0914 238 GLU A CG  
1658 C CD  . GLU A 212 ? 1.0872 1.3290 1.1576 -0.0527 0.0307  -0.0871 238 GLU A CD  
1659 O OE1 . GLU A 212 ? 1.0301 1.2956 1.0972 -0.0436 0.0288  -0.0796 238 GLU A OE1 
1660 O OE2 . GLU A 212 ? 1.1118 1.3286 1.1860 -0.0516 0.0338  -0.0911 238 GLU A OE2 
1661 N N   . GLU A 213 ? 0.5074 0.7119 0.5947 -0.1096 0.0253  -0.0972 239 GLU A N   
1662 C CA  . GLU A 213 ? 0.3715 0.5825 0.4664 -0.1255 0.0203  -0.0908 239 GLU A CA  
1663 C C   . GLU A 213 ? 0.3613 0.5882 0.4683 -0.1249 0.0188  -0.0797 239 GLU A C   
1664 O O   . GLU A 213 ? 0.4462 0.6796 0.5599 -0.1383 0.0145  -0.0731 239 GLU A O   
1665 C CB  . GLU A 213 ? 0.4068 0.5834 0.5010 -0.1361 0.0210  -0.0979 239 GLU A CB  
1666 C CG  . GLU A 213 ? 0.7986 0.9485 0.8974 -0.1280 0.0265  -0.1022 239 GLU A CG  
1667 C CD  . GLU A 213 ? 1.0956 1.2111 1.1912 -0.1356 0.0280  -0.1101 239 GLU A CD  
1668 O OE1 . GLU A 213 ? 1.2239 1.3341 1.3139 -0.1490 0.0237  -0.1112 239 GLU A OE1 
1669 O OE2 . GLU A 213 ? 1.1187 1.2125 1.2166 -0.1279 0.0333  -0.1151 239 GLU A OE2 
1670 N N   . MET A 214 ? 0.3859 0.6178 0.4946 -0.1100 0.0220  -0.0776 240 MET A N   
1671 C CA  . MET A 214 ? 0.4253 0.6714 0.5441 -0.1077 0.0210  -0.0672 240 MET A CA  
1672 C C   . MET A 214 ? 0.5777 0.8432 0.6925 -0.0904 0.0225  -0.0631 240 MET A C   
1673 O O   . MET A 214 ? 0.9683 1.2632 1.0789 -0.0869 0.0203  -0.0579 240 MET A O   
1674 C CB  . MET A 214 ? 0.3548 0.5729 0.4819 -0.1099 0.0231  -0.0688 240 MET A CB  
1675 C CG  . MET A 214 ? 0.5664 0.7555 0.6893 -0.1011 0.0283  -0.0791 240 MET A CG  
1676 S SD  . MET A 214 ? 0.5734 0.7305 0.7061 -0.1049 0.0305  -0.0811 240 MET A SD  
1677 C CE  . MET A 214 ? 0.6883 0.8315 0.8189 -0.1237 0.0272  -0.0840 240 MET A CE  
1678 N N   . ASN A 215 ? 0.6177 0.8667 0.7330 -0.0794 0.0259  -0.0650 241 ASN A N   
1679 C CA  . ASN A 215 ? 0.7203 0.9801 0.8281 -0.0623 0.0271  -0.0625 241 ASN A CA  
1680 C C   . ASN A 215 ? 0.6351 0.8703 0.7441 -0.0539 0.0303  -0.0656 241 ASN A C   
1681 O O   . ASN A 215 ? 0.6658 0.8837 0.7854 -0.0604 0.0311  -0.0659 241 ASN A O   
1682 C CB  . ASN A 215 ? 0.7189 1.0119 0.8297 -0.0588 0.0243  -0.0503 241 ASN A CB  
1683 C CG  . ASN A 215 ? 0.9437 1.2370 1.0687 -0.0663 0.0231  -0.0426 241 ASN A CG  
1684 O OD1 . ASN A 215 ? 1.2660 1.5335 1.3970 -0.0684 0.0248  -0.0458 241 ASN A OD1 
1685 N ND2 . ASN A 215 ? 0.8003 1.1239 0.9305 -0.0701 0.0202  -0.0318 241 ASN A ND2 
1686 N N   . ARG A 216 ? 0.4834 0.7164 0.5806 -0.0396 0.0316  -0.0678 242 ARG A N   
1687 C CA  . ARG A 216 ? 0.5996 0.8086 0.6963 -0.0325 0.0340  -0.0712 242 ARG A CA  
1688 C C   . ARG A 216 ? 0.6320 0.8350 0.7428 -0.0352 0.0337  -0.0655 242 ARG A C   
1689 O O   . ARG A 216 ? 0.7307 0.9108 0.8478 -0.0371 0.0359  -0.0695 242 ARG A O   
1690 C CB  . ARG A 216 ? 0.6449 0.8559 0.7254 -0.0166 0.0338  -0.0711 242 ARG A CB  
1691 C CG  . ARG A 216 ? 0.6738 0.8715 0.7405 -0.0132 0.0356  -0.0805 242 ARG A CG  
1692 C CD  . ARG A 216 ? 0.7719 0.9547 0.8260 -0.0009 0.0359  -0.0820 242 ARG A CD  
1693 N NE  . ARG A 216 ? 0.7270 0.9246 0.7643 0.0124  0.0332  -0.0774 242 ARG A NE  
1694 C CZ  . ARG A 216 ? 0.5740 0.7711 0.5923 0.0199  0.0329  -0.0817 242 ARG A CZ  
1695 N NH1 . ARG A 216 ? 0.6490 0.8323 0.6636 0.0146  0.0351  -0.0906 242 ARG A NH1 
1696 N NH2 . ARG A 216 ? 0.3926 0.6019 0.3946 0.0331  0.0295  -0.0768 242 ARG A NH2 
1697 N N   . MET A 217 ? 0.4456 0.6700 0.5611 -0.0352 0.0311  -0.0557 243 MET A N   
1698 C CA  . MET A 217 ? 0.2414 0.4617 0.3693 -0.0378 0.0304  -0.0494 243 MET A CA  
1699 C C   . MET A 217 ? 0.4064 0.6097 0.5468 -0.0520 0.0311  -0.0525 243 MET A C   
1700 O O   . MET A 217 ? 0.7900 0.9721 0.9371 -0.0518 0.0327  -0.0547 243 MET A O   
1701 C CB  . MET A 217 ? 0.5106 0.7597 0.6409 -0.0366 0.0277  -0.0379 243 MET A CB  
1702 C CG  . MET A 217 ? 0.6839 0.9295 0.8253 -0.0379 0.0268  -0.0307 243 MET A CG  
1703 S SD  . MET A 217 ? 0.5077 0.7320 0.6447 -0.0238 0.0279  -0.0321 243 MET A SD  
1704 C CE  . MET A 217 ? 0.8718 1.1165 0.9904 -0.0067 0.0266  -0.0277 243 MET A CE  
1705 N N   . HIS A 218 ? 0.3489 0.5609 0.4912 -0.0641 0.0296  -0.0525 244 HIS A N   
1706 C CA  . HIS A 218 ? 0.2448 0.4388 0.3953 -0.0778 0.0294  -0.0555 244 HIS A CA  
1707 C C   . HIS A 218 ? 0.4500 0.6160 0.5976 -0.0772 0.0332  -0.0668 244 HIS A C   
1708 O O   . HIS A 218 ? 0.5492 0.6933 0.7036 -0.0816 0.0345  -0.0696 244 HIS A O   
1709 C CB  . HIS A 218 ? 0.1728 0.3823 0.3233 -0.0915 0.0260  -0.0527 244 HIS A CB  
1710 C CG  . HIS A 218 ? 0.3683 0.6018 0.5256 -0.0966 0.0224  -0.0406 244 HIS A CG  
1711 N ND1 . HIS A 218 ? 0.3764 0.6408 0.5310 -0.0883 0.0213  -0.0328 244 HIS A ND1 
1712 C CD2 . HIS A 218 ? 0.3601 0.5912 0.5261 -0.1089 0.0197  -0.0346 244 HIS A CD2 
1713 C CE1 . HIS A 218 ? 0.5276 0.8095 0.6901 -0.0955 0.0184  -0.0223 244 HIS A CE1 
1714 N NE2 . HIS A 218 ? 0.4910 0.7528 0.6604 -0.1086 0.0172  -0.0231 244 HIS A NE2 
1715 N N   . GLU A 219 ? 0.4250 0.5919 0.5619 -0.0712 0.0349  -0.0732 245 GLU A N   
1716 C CA  . GLU A 219 ? 0.3489 0.4914 0.4822 -0.0691 0.0390  -0.0834 245 GLU A CA  
1717 C C   . GLU A 219 ? 0.4272 0.5541 0.5670 -0.0619 0.0414  -0.0832 245 GLU A C   
1718 O O   . GLU A 219 ? 0.2900 0.3956 0.4351 -0.0644 0.0442  -0.0883 245 GLU A O   
1719 C CB  . GLU A 219 ? 0.3835 0.5311 0.5031 -0.0617 0.0403  -0.0887 245 GLU A CB  
1720 C CG  . GLU A 219 ? 0.5503 0.7061 0.6627 -0.0694 0.0389  -0.0922 245 GLU A CG  
1721 C CD  . GLU A 219 ? 0.8657 1.0205 0.9639 -0.0619 0.0408  -0.0990 245 GLU A CD  
1722 O OE1 . GLU A 219 ? 1.1087 1.2754 1.1991 -0.0655 0.0390  -0.1006 245 GLU A OE1 
1723 O OE2 . GLU A 219 ? 0.8912 1.0333 0.9856 -0.0529 0.0437  -0.1025 245 GLU A OE2 
1724 N N   . SER A 220 ? 0.4458 0.5838 0.5847 -0.0524 0.0400  -0.0771 246 SER A N   
1725 C CA  . SER A 220 ? 0.3552 0.4807 0.4998 -0.0457 0.0411  -0.0756 246 SER A CA  
1726 C C   . SER A 220 ? 0.3360 0.4521 0.4946 -0.0526 0.0407  -0.0724 246 SER A C   
1727 O O   . SER A 220 ? 0.3276 0.4255 0.4929 -0.0512 0.0431  -0.0752 246 SER A O   
1728 C CB  . SER A 220 ? 0.1967 0.3360 0.3353 -0.0349 0.0386  -0.0687 246 SER A CB  
1729 O OG  . SER A 220 ? 0.4603 0.5855 0.6002 -0.0276 0.0394  -0.0690 246 SER A OG  
1730 N N   . MET A 221 ? 0.1218 0.2507 0.2844 -0.0602 0.0377  -0.0661 247 MET A N   
1731 C CA  . MET A 221 ? 0.2654 0.3846 0.4390 -0.0676 0.0366  -0.0625 247 MET A CA  
1732 C C   . MET A 221 ? 0.4720 0.5681 0.6474 -0.0750 0.0390  -0.0705 247 MET A C   
1733 O O   . MET A 221 ? 0.5619 0.6402 0.7448 -0.0753 0.0402  -0.0712 247 MET A O   
1734 C CB  . MET A 221 ? 0.3116 0.4502 0.4874 -0.0760 0.0325  -0.0539 247 MET A CB  
1735 C CG  . MET A 221 ? 0.1401 0.3012 0.3151 -0.0680 0.0304  -0.0447 247 MET A CG  
1736 S SD  . MET A 221 ? 0.5033 0.6889 0.6829 -0.0788 0.0261  -0.0334 247 MET A SD  
1737 C CE  . MET A 221 ? 0.6498 0.8113 0.8402 -0.0893 0.0252  -0.0323 247 MET A CE  
1738 N N   . LYS A 222 ? 0.6071 0.7032 0.7745 -0.0802 0.0396  -0.0765 248 LYS A N   
1739 C CA  . LYS A 222 ? 0.5443 0.6177 0.7102 -0.0864 0.0419  -0.0846 248 LYS A CA  
1740 C C   . LYS A 222 ? 0.4993 0.5551 0.6668 -0.0774 0.0471  -0.0913 248 LYS A C   
1741 O O   . LYS A 222 ? 0.4124 0.4476 0.5838 -0.0789 0.0495  -0.0951 248 LYS A O   
1742 C CB  . LYS A 222 ? 0.4927 0.5709 0.6481 -0.0931 0.0411  -0.0894 248 LYS A CB  
1743 C CG  . LYS A 222 ? 0.6194 0.6730 0.7707 -0.1004 0.0428  -0.0974 248 LYS A CG  
1744 C CD  . LYS A 222 ? 0.6809 0.7395 0.8209 -0.1073 0.0413  -0.1019 248 LYS A CD  
1745 C CE  . LYS A 222 ? 0.7616 0.7931 0.8950 -0.1141 0.0427  -0.1100 248 LYS A CE  
1746 N NZ  . LYS A 222 ? 0.8682 0.9029 0.9896 -0.1206 0.0411  -0.1148 248 LYS A NZ  
1747 N N   . LEU A 223 ? 0.4345 0.4987 0.5983 -0.0681 0.0487  -0.0923 249 LEU A N   
1748 C CA  . LEU A 223 ? 0.3532 0.4043 0.5187 -0.0601 0.0532  -0.0972 249 LEU A CA  
1749 C C   . LEU A 223 ? 0.4344 0.4788 0.6119 -0.0562 0.0531  -0.0925 249 LEU A C   
1750 O O   . LEU A 223 ? 0.4084 0.4362 0.5920 -0.0555 0.0563  -0.0960 249 LEU A O   
1751 C CB  . LEU A 223 ? 0.2545 0.3159 0.4111 -0.0521 0.0536  -0.0982 249 LEU A CB  
1752 C CG  . LEU A 223 ? 0.3459 0.3971 0.5040 -0.0445 0.0571  -0.1012 249 LEU A CG  
1753 C CD1 . LEU A 223 ? 0.4761 0.5103 0.6357 -0.0467 0.0624  -0.1094 249 LEU A CD1 
1754 C CD2 . LEU A 223 ? 0.2936 0.3532 0.4393 -0.0379 0.0563  -0.1017 249 LEU A CD2 
1755 N N   . PHE A 224 ? 0.4606 0.5183 0.6408 -0.0531 0.0494  -0.0843 250 PHE A N   
1756 C CA  . PHE A 224 ? 0.3338 0.3866 0.5246 -0.0493 0.0485  -0.0789 250 PHE A CA  
1757 C C   . PHE A 224 ? 0.3968 0.4347 0.5959 -0.0555 0.0490  -0.0791 250 PHE A C   
1758 O O   . PHE A 224 ? 0.3819 0.4077 0.5894 -0.0517 0.0506  -0.0792 250 PHE A O   
1759 C CB  . PHE A 224 ? 0.2543 0.3239 0.4447 -0.0466 0.0440  -0.0697 250 PHE A CB  
1760 C CG  . PHE A 224 ? 0.3159 0.3806 0.5162 -0.0428 0.0425  -0.0638 250 PHE A CG  
1761 C CD1 . PHE A 224 ? 0.3788 0.4404 0.5799 -0.0342 0.0427  -0.0631 250 PHE A CD1 
1762 C CD2 . PHE A 224 ? 0.3649 0.4273 0.5728 -0.0485 0.0405  -0.0587 250 PHE A CD2 
1763 C CE1 . PHE A 224 ? 0.2510 0.3082 0.4610 -0.0309 0.0409  -0.0575 250 PHE A CE1 
1764 C CE2 . PHE A 224 ? 0.3193 0.3767 0.5358 -0.0447 0.0389  -0.0533 250 PHE A CE2 
1765 C CZ  . PHE A 224 ? 0.1733 0.2285 0.3912 -0.0357 0.0392  -0.0528 250 PHE A CZ  
1766 N N   . ASP A 225 ? 0.4160 0.4545 0.6117 -0.0650 0.0470  -0.0790 251 ASP A N   
1767 C CA  . ASP A 225 ? 0.3580 0.3795 0.5577 -0.0718 0.0466  -0.0793 251 ASP A CA  
1768 C C   . ASP A 225 ? 0.4408 0.4409 0.6417 -0.0683 0.0516  -0.0874 251 ASP A C   
1769 O O   . ASP A 225 ? 0.5163 0.5042 0.7252 -0.0644 0.0528  -0.0865 251 ASP A O   
1770 C CB  . ASP A 225 ? 0.4378 0.4621 0.6304 -0.0840 0.0434  -0.0789 251 ASP A CB  
1771 C CG  . ASP A 225 ? 0.6727 0.6764 0.8660 -0.0920 0.0418  -0.0789 251 ASP A CG  
1772 O OD1 . ASP A 225 ? 0.8878 0.8765 1.0879 -0.0871 0.0434  -0.0788 251 ASP A OD1 
1773 O OD2 . ASP A 225 ? 0.5796 0.5818 0.7660 -0.1034 0.0386  -0.0788 251 ASP A OD2 
1774 N N   . SER A 226 ? 0.4253 0.4218 0.6179 -0.0691 0.0547  -0.0952 252 SER A N   
1775 C CA  . SER A 226 ? 0.4454 0.4228 0.6374 -0.0654 0.0601  -0.1031 252 SER A CA  
1776 C C   . SER A 226 ? 0.4195 0.3965 0.6211 -0.0549 0.0636  -0.1026 252 SER A C   
1777 O O   . SER A 226 ? 0.5420 0.5042 0.7484 -0.0509 0.0672  -0.1056 252 SER A O   
1778 C CB  . SER A 226 ? 0.6034 0.5804 0.7841 -0.0671 0.0628  -0.1109 252 SER A CB  
1779 O OG  . SER A 226 ? 0.7089 0.6874 0.8807 -0.0775 0.0590  -0.1111 252 SER A OG  
1780 N N   . ILE A 227 ? 0.3355 0.3287 0.5390 -0.0504 0.0622  -0.0985 253 ILE A N   
1781 C CA  . ILE A 227 ? 0.4755 0.4698 0.6872 -0.0418 0.0642  -0.0971 253 ILE A CA  
1782 C C   . ILE A 227 ? 0.5067 0.4937 0.7305 -0.0393 0.0632  -0.0922 253 ILE A C   
1783 O O   . ILE A 227 ? 0.5785 0.5543 0.8086 -0.0351 0.0671  -0.0951 253 ILE A O   
1784 C CB  . ILE A 227 ? 0.5234 0.5341 0.7319 -0.0381 0.0613  -0.0927 253 ILE A CB  
1785 C CG1 . ILE A 227 ? 0.5488 0.5655 0.7444 -0.0390 0.0626  -0.0979 253 ILE A CG1 
1786 C CG2 . ILE A 227 ? 0.2830 0.2935 0.4995 -0.0309 0.0621  -0.0902 253 ILE A CG2 
1787 C CD1 . ILE A 227 ? 0.4667 0.4745 0.6606 -0.0366 0.0684  -0.1054 253 ILE A CD1 
1788 N N   . CYS A 228 ? 0.4112 0.4052 0.6378 -0.0411 0.0581  -0.0847 254 CYS A N   
1789 C CA  . CYS A 228 ? 0.6127 0.6008 0.8502 -0.0383 0.0564  -0.0793 254 CYS A CA  
1790 C C   . CYS A 228 ? 0.6376 0.6085 0.8760 -0.0427 0.0568  -0.0808 254 CYS A C   
1791 O O   . CYS A 228 ? 0.7865 0.7499 1.0326 -0.0405 0.0554  -0.0767 254 CYS A O   
1792 C CB  . CYS A 228 ? 0.7139 0.7149 0.9529 -0.0383 0.0509  -0.0704 254 CYS A CB  
1793 S SG  . CYS A 228 ? 0.3651 0.3712 0.5986 -0.0484 0.0465  -0.0657 254 CYS A SG  
1794 N N   . ASN A 229 ? 0.5137 0.4767 0.7427 -0.0488 0.0582  -0.0866 255 ASN A N   
1795 C CA  . ASN A 229 ? 0.5343 0.4768 0.7602 -0.0531 0.0582  -0.0889 255 ASN A CA  
1796 C C   . ASN A 229 ? 0.4634 0.3899 0.6865 -0.0483 0.0643  -0.0975 255 ASN A C   
1797 O O   . ASN A 229 ? 0.5243 0.4302 0.7431 -0.0493 0.0649  -0.1003 255 ASN A O   
1798 C CB  . ASN A 229 ? 0.6901 0.6326 0.9057 -0.0651 0.0539  -0.0879 255 ASN A CB  
1799 C CG  . ASN A 229 ? 0.6475 0.6033 0.8667 -0.0699 0.0481  -0.0783 255 ASN A CG  
1800 O OD1 . ASN A 229 ? 0.6849 0.6520 0.9126 -0.0638 0.0472  -0.0728 255 ASN A OD1 
1801 N ND2 . ASN A 229 ? 0.7150 0.6697 0.9273 -0.0813 0.0439  -0.0759 255 ASN A ND2 
1802 N N   . ASN A 230 ? 0.4154 0.3506 0.6395 -0.0427 0.0687  -0.1015 256 ASN A N   
1803 C CA  . ASN A 230 ? 0.5175 0.4406 0.7398 -0.0370 0.0752  -0.1091 256 ASN A CA  
1804 C C   . ASN A 230 ? 0.4482 0.3663 0.6827 -0.0274 0.0781  -0.1072 256 ASN A C   
1805 O O   . ASN A 230 ? 0.4167 0.3485 0.6620 -0.0224 0.0778  -0.1027 256 ASN A O   
1806 C CB  . ASN A 230 ? 0.6108 0.5456 0.8294 -0.0352 0.0789  -0.1135 256 ASN A CB  
1807 C CG  . ASN A 230 ? 0.7520 0.6742 0.9652 -0.0313 0.0857  -0.1219 256 ASN A CG  
1808 O OD1 . ASN A 230 ? 0.7444 0.6476 0.9531 -0.0308 0.0873  -0.1253 256 ASN A OD1 
1809 N ND2 . ASN A 230 ? 0.9856 0.9174 1.1978 -0.0282 0.0898  -0.1252 256 ASN A ND2 
1810 N N   . LYS A 231 ? 0.4553 0.3531 0.6869 -0.0246 0.0805  -0.1107 257 LYS A N   
1811 C CA  . LYS A 231 ? 0.4457 0.3374 0.6879 -0.0147 0.0832  -0.1088 257 LYS A CA  
1812 C C   . LYS A 231 ? 0.4497 0.3560 0.7027 -0.0060 0.0885  -0.1093 257 LYS A C   
1813 O O   . LYS A 231 ? 0.3882 0.2988 0.6540 0.0014  0.0893  -0.1051 257 LYS A O   
1814 C CB  . LYS A 231 ? 0.3573 0.2229 0.5902 -0.0118 0.0858  -0.1141 257 LYS A CB  
1815 C CG  . LYS A 231 ? 0.5577 0.4152 0.7999 -0.0008 0.0880  -0.1119 257 LYS A CG  
1816 C CD  . LYS A 231 ? 0.8307 0.6599 1.0600 0.0036  0.0909  -0.1178 257 LYS A CD  
1817 C CE  . LYS A 231 ? 1.0929 0.9155 1.3311 0.0168  0.0937  -0.1158 257 LYS A CE  
1818 N NZ  . LYS A 231 ? 1.2105 1.0045 1.4341 0.0237  0.0972  -0.1220 257 LYS A NZ  
1819 N N   . TRP A 232 ? 0.3954 0.3098 0.6431 -0.0075 0.0919  -0.1139 258 TRP A N   
1820 C CA  . TRP A 232 ? 0.4582 0.3859 0.7143 -0.0008 0.0970  -0.1144 258 TRP A CA  
1821 C C   . TRP A 232 ? 0.4458 0.3928 0.7118 -0.0015 0.0928  -0.1072 258 TRP A C   
1822 O O   . TRP A 232 ? 0.3878 0.3464 0.6624 0.0031  0.0955  -0.1056 258 TRP A O   
1823 C CB  . TRP A 232 ? 0.5417 0.4698 0.7869 -0.0026 0.1018  -0.1218 258 TRP A CB  
1824 C CG  . TRP A 232 ? 0.5443 0.4801 0.7961 0.0050  0.1091  -0.1238 258 TRP A CG  
1825 C CD1 . TRP A 232 ? 0.5645 0.4967 0.8247 0.0145  0.1144  -0.1240 258 TRP A CD1 
1826 C CD2 . TRP A 232 ? 0.5095 0.4586 0.7595 0.0038  0.1119  -0.1254 258 TRP A CD2 
1827 N NE1 . TRP A 232 ? 0.6150 0.5596 0.8800 0.0189  0.1205  -0.1252 258 TRP A NE1 
1828 C CE2 . TRP A 232 ? 0.5841 0.5383 0.8427 0.0119  0.1189  -0.1261 258 TRP A CE2 
1829 C CE3 . TRP A 232 ? 0.5936 0.5509 0.8349 -0.0030 0.1090  -0.1262 258 TRP A CE3 
1830 C CZ2 . TRP A 232 ? 0.5925 0.5594 0.8512 0.0120  0.1230  -0.1272 258 TRP A CZ2 
1831 C CZ3 . TRP A 232 ? 0.5922 0.5597 0.8323 -0.0022 0.1128  -0.1278 258 TRP A CZ3 
1832 C CH2 . TRP A 232 ? 0.5562 0.5283 0.8051 0.0046  0.1196  -0.1281 258 TRP A CH2 
1833 N N   . PHE A 233 ? 0.5377 0.4877 0.8015 -0.0074 0.0860  -0.1024 259 PHE A N   
1834 C CA  . PHE A 233 ? 0.5302 0.4958 0.8002 -0.0077 0.0813  -0.0956 259 PHE A CA  
1835 C C   . PHE A 233 ? 0.4337 0.3985 0.7142 -0.0051 0.0769  -0.0882 259 PHE A C   
1836 O O   . PHE A 233 ? 0.5191 0.4941 0.8031 -0.0056 0.0720  -0.0820 259 PHE A O   
1837 C CB  . PHE A 233 ? 0.5443 0.5170 0.8030 -0.0146 0.0769  -0.0950 259 PHE A CB  
1838 C CG  . PHE A 233 ? 0.5780 0.5538 0.8263 -0.0166 0.0803  -0.1013 259 PHE A CG  
1839 C CD1 . PHE A 233 ? 0.5788 0.5630 0.8287 -0.0135 0.0829  -0.1018 259 PHE A CD1 
1840 C CD2 . PHE A 233 ? 0.6326 0.6026 0.8687 -0.0224 0.0806  -0.1063 259 PHE A CD2 
1841 C CE1 . PHE A 233 ? 0.5674 0.5535 0.8067 -0.0154 0.0860  -0.1076 259 PHE A CE1 
1842 C CE2 . PHE A 233 ? 0.6711 0.6435 0.8970 -0.0239 0.0836  -0.1121 259 PHE A CE2 
1843 C CZ  . PHE A 233 ? 0.6468 0.6269 0.8741 -0.0202 0.0864  -0.1129 259 PHE A CZ  
1844 N N   . THR A 234 ? 0.3370 0.2881 0.6210 -0.0020 0.0786  -0.0891 260 THR A N   
1845 C CA  . THR A 234 ? 0.5116 0.4594 0.8046 0.0007  0.0745  -0.0826 260 THR A CA  
1846 C C   . THR A 234 ? 0.6409 0.6034 0.9457 0.0045  0.0717  -0.0757 260 THR A C   
1847 O O   . THR A 234 ? 0.8026 0.7692 1.1088 0.0023  0.0657  -0.0694 260 THR A O   
1848 C CB  . THR A 234 ? 0.4394 0.3712 0.7356 0.0072  0.0782  -0.0850 260 THR A CB  
1849 O OG1 . THR A 234 ? 0.4264 0.3403 0.7092 0.0022  0.0785  -0.0900 260 THR A OG1 
1850 C CG2 . THR A 234 ? 0.3123 0.2419 0.6188 0.0113  0.0742  -0.0780 260 THR A CG2 
1851 N N   . ASP A 235 ? 0.4812 0.4517 0.7938 0.0099  0.0758  -0.0767 261 ASP A N   
1852 C CA  . ASP A 235 ? 0.6585 0.6420 0.9824 0.0129  0.0728  -0.0700 261 ASP A CA  
1853 C C   . ASP A 235 ? 0.6664 0.6611 0.9837 0.0080  0.0686  -0.0676 261 ASP A C   
1854 O O   . ASP A 235 ? 0.7406 0.7437 1.0635 0.0090  0.0641  -0.0614 261 ASP A O   
1855 C CB  . ASP A 235 ? 0.9356 0.9254 1.2709 0.0198  0.0784  -0.0708 261 ASP A CB  
1856 C CG  . ASP A 235 ? 1.1732 1.1529 1.5159 0.0273  0.0815  -0.0714 261 ASP A CG  
1857 O OD1 . ASP A 235 ? 1.1935 1.1606 1.5332 0.0266  0.0781  -0.0701 261 ASP A OD1 
1858 O OD2 . ASP A 235 ? 1.2953 1.2797 1.6461 0.0343  0.0874  -0.0730 261 ASP A OD2 
1859 N N   . THR A 236 ? 0.5814 0.5751 0.8854 0.0030  0.0697  -0.0725 262 THR A N   
1860 C CA  . THR A 236 ? 0.4077 0.4101 0.7023 -0.0006 0.0660  -0.0710 262 THR A CA  
1861 C C   . THR A 236 ? 0.6081 0.6111 0.8970 -0.0032 0.0592  -0.0658 262 THR A C   
1862 O O   . THR A 236 ? 0.6879 0.6857 0.9718 -0.0063 0.0587  -0.0670 262 THR A O   
1863 C CB  . THR A 236 ? 0.3725 0.3746 0.6547 -0.0041 0.0700  -0.0783 262 THR A CB  
1864 O OG1 . THR A 236 ? 0.6051 0.6085 0.8919 -0.0014 0.0765  -0.0825 262 THR A OG1 
1865 C CG2 . THR A 236 ? 0.3816 0.3911 0.6518 -0.0069 0.0657  -0.0766 262 THR A CG2 
1866 N N   . SER A 237 ? 0.5629 0.5725 0.8518 -0.0020 0.0538  -0.0597 263 SER A N   
1867 C CA  . SER A 237 ? 0.6123 0.6233 0.8953 -0.0028 0.0475  -0.0540 263 SER A CA  
1868 C C   . SER A 237 ? 0.5545 0.5693 0.8212 -0.0060 0.0464  -0.0562 263 SER A C   
1869 O O   . SER A 237 ? 0.5323 0.5504 0.7902 -0.0063 0.0473  -0.0592 263 SER A O   
1870 C CB  . SER A 237 ? 0.7547 0.7694 1.0405 0.0002  0.0417  -0.0468 263 SER A CB  
1871 O OG  . SER A 237 ? 0.8814 0.8942 1.1830 0.0033  0.0420  -0.0439 263 SER A OG  
1872 N N   . ILE A 238 ? 0.5472 0.5623 0.8098 -0.0085 0.0445  -0.0544 264 ILE A N   
1873 C CA  . ILE A 238 ? 0.4314 0.4528 0.6797 -0.0111 0.0435  -0.0558 264 ILE A CA  
1874 C C   . ILE A 238 ? 0.4504 0.4787 0.6903 -0.0081 0.0375  -0.0489 264 ILE A C   
1875 O O   . ILE A 238 ? 0.5598 0.5882 0.8046 -0.0069 0.0340  -0.0426 264 ILE A O   
1876 C CB  . ILE A 238 ? 0.3513 0.3712 0.5989 -0.0166 0.0449  -0.0577 264 ILE A CB  
1877 C CG1 . ILE A 238 ? 0.4695 0.4796 0.7216 -0.0189 0.0507  -0.0650 264 ILE A CG1 
1878 C CG2 . ILE A 238 ? 0.1596 0.1894 0.3934 -0.0191 0.0435  -0.0581 264 ILE A CG2 
1879 C CD1 . ILE A 238 ? 0.5769 0.5883 0.8219 -0.0188 0.0547  -0.0720 264 ILE A CD1 
1880 N N   . ILE A 239 ? 0.4581 0.4913 0.6840 -0.0063 0.0362  -0.0502 265 ILE A N   
1881 C CA  . ILE A 239 ? 0.4048 0.4433 0.6188 -0.0019 0.0307  -0.0442 265 ILE A CA  
1882 C C   . ILE A 239 ? 0.4480 0.4955 0.6474 -0.0022 0.0308  -0.0457 265 ILE A C   
1883 O O   . ILE A 239 ? 0.6635 0.7114 0.8542 -0.0028 0.0331  -0.0515 265 ILE A O   
1884 C CB  . ILE A 239 ? 0.3103 0.3442 0.5172 0.0022  0.0275  -0.0429 265 ILE A CB  
1885 C CG1 . ILE A 239 ? 0.2733 0.3011 0.4956 0.0023  0.0268  -0.0403 265 ILE A CG1 
1886 C CG2 . ILE A 239 ? 0.1502 0.1867 0.3408 0.0078  0.0216  -0.0373 265 ILE A CG2 
1887 C CD1 . ILE A 239 ? 0.3027 0.3262 0.5197 0.0041  0.0235  -0.0389 265 ILE A CD1 
1888 N N   . LEU A 240 ? 0.3338 0.3898 0.5307 -0.0014 0.0282  -0.0402 266 LEU A N   
1889 C CA  . LEU A 240 ? 0.2729 0.3411 0.4575 -0.0013 0.0282  -0.0404 266 LEU A CA  
1890 C C   . LEU A 240 ? 0.2867 0.3594 0.4536 0.0074  0.0240  -0.0365 266 LEU A C   
1891 O O   . LEU A 240 ? 0.4356 0.5074 0.6007 0.0124  0.0201  -0.0299 266 LEU A O   
1892 C CB  . LEU A 240 ? 0.3048 0.3822 0.4965 -0.0060 0.0280  -0.0360 266 LEU A CB  
1893 C CG  . LEU A 240 ? 0.2791 0.3725 0.4618 -0.0079 0.0284  -0.0357 266 LEU A CG  
1894 C CD1 . LEU A 240 ? 0.3042 0.3953 0.4844 -0.0128 0.0321  -0.0444 266 LEU A CD1 
1895 C CD2 . LEU A 240 ? 0.2435 0.3460 0.4343 -0.0141 0.0275  -0.0299 266 LEU A CD2 
1896 N N   . PHE A 241 ? 0.3143 0.3905 0.4665 0.0096  0.0248  -0.0407 267 PHE A N   
1897 C CA  . PHE A 241 ? 0.2351 0.3138 0.3666 0.0189  0.0209  -0.0377 267 PHE A CA  
1898 C C   . PHE A 241 ? 0.3852 0.4813 0.5068 0.0211  0.0214  -0.0366 267 PHE A C   
1899 O O   . PHE A 241 ? 0.4120 0.5109 0.5232 0.0216  0.0229  -0.0417 267 PHE A O   
1900 C CB  . PHE A 241 ? 0.1596 0.2262 0.2785 0.0211  0.0204  -0.0431 267 PHE A CB  
1901 C CG  . PHE A 241 ? 0.3429 0.3951 0.4625 0.0228  0.0170  -0.0407 267 PHE A CG  
1902 C CD1 . PHE A 241 ? 0.4869 0.5364 0.6233 0.0206  0.0161  -0.0364 267 PHE A CD1 
1903 C CD2 . PHE A 241 ? 0.3413 0.3822 0.4441 0.0262  0.0142  -0.0426 267 PHE A CD2 
1904 C CE1 . PHE A 241 ? 0.4902 0.5278 0.6278 0.0217  0.0124  -0.0339 267 PHE A CE1 
1905 C CE2 . PHE A 241 ? 0.3028 0.3310 0.4060 0.0263  0.0102  -0.0399 267 PHE A CE2 
1906 C CZ  . PHE A 241 ? 0.3642 0.3916 0.4855 0.0242  0.0094  -0.0354 267 PHE A CZ  
1907 N N   . LEU A 242 ? 0.4551 0.5640 0.5803 0.0224  0.0200  -0.0294 268 LEU A N   
1908 C CA  . LEU A 242 ? 0.3915 0.5205 0.5074 0.0256  0.0200  -0.0265 268 LEU A CA  
1909 C C   . LEU A 242 ? 0.3448 0.4733 0.4363 0.0382  0.0172  -0.0257 268 LEU A C   
1910 O O   . LEU A 242 ? 0.2734 0.4016 0.3553 0.0472  0.0137  -0.0194 268 LEU A O   
1911 C CB  . LEU A 242 ? 0.2261 0.3694 0.3512 0.0242  0.0191  -0.0179 268 LEU A CB  
1912 C CG  . LEU A 242 ? 0.2576 0.3980 0.4042 0.0115  0.0213  -0.0186 268 LEU A CG  
1913 C CD1 . LEU A 242 ? 0.3939 0.5483 0.5482 0.0093  0.0200  -0.0095 268 LEU A CD1 
1914 C CD2 . LEU A 242 ? 0.1336 0.2771 0.2844 0.0024  0.0246  -0.0255 268 LEU A CD2 
1915 N N   . ASN A 243 ? 0.2961 0.4226 0.3762 0.0392  0.0184  -0.0323 269 ASN A N   
1916 C CA  . ASN A 243 ? 0.3513 0.4713 0.4059 0.0507  0.0155  -0.0331 269 ASN A CA  
1917 C C   . ASN A 243 ? 0.3658 0.5059 0.4051 0.0596  0.0151  -0.0299 269 ASN A C   
1918 O O   . ASN A 243 ? 0.3246 0.4860 0.3746 0.0552  0.0173  -0.0274 269 ASN A O   
1919 C CB  . ASN A 243 ? 0.3581 0.4625 0.4068 0.0473  0.0168  -0.0419 269 ASN A CB  
1920 C CG  . ASN A 243 ? 0.5203 0.6100 0.5423 0.0576  0.0127  -0.0425 269 ASN A CG  
1921 O OD1 . ASN A 243 ? 0.6256 0.7067 0.6377 0.0648  0.0083  -0.0373 269 ASN A OD1 
1922 N ND2 . ASN A 243 ? 0.5299 0.6149 0.5385 0.0582  0.0137  -0.0490 269 ASN A ND2 
1923 N N   . LYS A 244 ? 0.3054 0.4383 0.3187 0.0722  0.0119  -0.0298 270 LYS A N   
1924 C CA  . LYS A 244 ? 0.3153 0.4664 0.3107 0.0837  0.0114  -0.0266 270 LYS A CA  
1925 C C   . LYS A 244 ? 0.3716 0.5436 0.3726 0.0884  0.0110  -0.0169 270 LYS A C   
1926 O O   . LYS A 244 ? 0.4819 0.6794 0.4811 0.0922  0.0125  -0.0134 270 LYS A O   
1927 C CB  . LYS A 244 ? 0.3293 0.4954 0.3278 0.0784  0.0148  -0.0318 270 LYS A CB  
1928 C CG  . LYS A 244 ? 0.3281 0.4756 0.3152 0.0767  0.0151  -0.0410 270 LYS A CG  
1929 C CD  . LYS A 244 ? 0.2724 0.4355 0.2617 0.0720  0.0182  -0.0457 270 LYS A CD  
1930 C CE  . LYS A 244 ? 0.2949 0.4384 0.2718 0.0698  0.0157  -0.0527 270 LYS A CE  
1931 N NZ  . LYS A 244 ? 0.3733 0.5309 0.3535 0.0644  0.0178  -0.0571 270 LYS A NZ  
1932 N N   . LYS A 245 ? 0.2735 0.4357 0.2814 0.0880  0.0090  -0.0123 271 LYS A N   
1933 C CA  . LYS A 245 ? 0.3509 0.5307 0.3638 0.0923  0.0087  -0.0027 271 LYS A CA  
1934 C C   . LYS A 245 ? 0.4045 0.5974 0.3923 0.1099  0.0071  0.0024  271 LYS A C   
1935 O O   . LYS A 245 ? 0.5706 0.7899 0.5624 0.1134  0.0086  0.0098  271 LYS A O   
1936 C CB  . LYS A 245 ? 0.3046 0.4667 0.3238 0.0913  0.0060  0.0009  271 LYS A CB  
1937 C CG  . LYS A 245 ? 0.3976 0.5333 0.3936 0.1014  0.0010  -0.0004 271 LYS A CG  
1938 C CD  . LYS A 245 ? 0.4318 0.5545 0.4322 0.1022  -0.0024 0.0051  271 LYS A CD  
1939 C CE  . LYS A 245 ? 0.6614 0.7574 0.6357 0.1121  -0.0084 0.0045  271 LYS A CE  
1940 N NZ  . LYS A 245 ? 0.6777 0.7623 0.6529 0.1146  -0.0124 0.0108  271 LYS A NZ  
1941 N N   . ASP A 246 ? 0.1822 0.3566 0.1432 0.1211  0.0041  -0.0012 272 ASP A N   
1942 C CA  . ASP A 246 ? 0.2565 0.4388 0.1893 0.1400  0.0022  0.0030  272 ASP A CA  
1943 C C   . ASP A 246 ? 0.5600 0.7722 0.4924 0.1426  0.0057  0.0032  272 ASP A C   
1944 O O   . ASP A 246 ? 0.5375 0.7747 0.4636 0.1534  0.0066  0.0106  272 ASP A O   
1945 C CB  . ASP A 246 ? 0.3115 0.4623 0.2132 0.1505  -0.0026 -0.0015 272 ASP A CB  
1946 C CG  . ASP A 246 ? 0.4770 0.6161 0.3754 0.1437  -0.0018 -0.0112 272 ASP A CG  
1947 O OD1 . ASP A 246 ? 0.5331 0.6691 0.4554 0.1274  0.0007  -0.0160 272 ASP A OD1 
1948 O OD2 . ASP A 246 ? 0.3930 0.5250 0.2750 0.1551  -0.0051 -0.0125 272 ASP A OD2 
1949 N N   . LEU A 247 ? 0.4509 0.6617 0.3900 0.1328  0.0076  -0.0048 273 LEU A N   
1950 C CA  . LEU A 247 ? 0.3105 0.5489 0.2506 0.1333  0.0105  -0.0053 273 LEU A CA  
1951 C C   . LEU A 247 ? 0.3456 0.6156 0.3127 0.1227  0.0136  0.0011  273 LEU A C   
1952 O O   . LEU A 247 ? 0.4253 0.7265 0.3911 0.1280  0.0150  0.0064  273 LEU A O   
1953 C CB  . LEU A 247 ? 0.2843 0.5105 0.2255 0.1240  0.0116  -0.0157 273 LEU A CB  
1954 C CG  . LEU A 247 ? 0.4110 0.6061 0.3294 0.1321  0.0051  -0.0201 273 LEU A CG  
1955 C CD1 . LEU A 247 ? 0.4494 0.6370 0.3722 0.1221  0.0052  -0.0283 273 LEU A CD1 
1956 C CD2 . LEU A 247 ? 0.5704 0.7707 0.4677 0.1535  0.0009  -0.0148 273 LEU A CD2 
1957 N N   . PHE A 248 ? 0.3556 0.6174 0.3465 0.1076  0.0144  0.0009  274 PHE A N   
1958 C CA  . PHE A 248 ? 0.3993 0.6860 0.4148 0.0958  0.0165  0.0071  274 PHE A CA  
1959 C C   . PHE A 248 ? 0.4268 0.7368 0.4371 0.1073  0.0162  0.0186  274 PHE A C   
1960 O O   . PHE A 248 ? 0.4129 0.7558 0.4322 0.1046  0.0179  0.0250  274 PHE A O   
1961 C CB  . PHE A 248 ? 0.3869 0.6546 0.4241 0.0806  0.0168  0.0051  274 PHE A CB  
1962 C CG  . PHE A 248 ? 0.3412 0.6293 0.4020 0.0675  0.0183  0.0113  274 PHE A CG  
1963 C CD1 . PHE A 248 ? 0.2586 0.5634 0.3320 0.0547  0.0201  0.0095  274 PHE A CD1 
1964 C CD2 . PHE A 248 ? 0.2611 0.5497 0.3301 0.0673  0.0175  0.0190  274 PHE A CD2 
1965 C CE1 . PHE A 248 ? 0.2678 0.5891 0.3609 0.0414  0.0207  0.0156  274 PHE A CE1 
1966 C CE2 . PHE A 248 ? 0.3656 0.6712 0.4547 0.0545  0.0185  0.0250  274 PHE A CE2 
1967 C CZ  . PHE A 248 ? 0.4090 0.7305 0.5098 0.0412  0.0199  0.0234  274 PHE A CZ  
1968 N N   . GLU A 249 ? 0.4062 0.6993 0.4011 0.1200  0.0137  0.0213  275 GLU A N   
1969 C CA  . GLU A 249 ? 0.3982 0.7098 0.3855 0.1327  0.0135  0.0321  275 GLU A CA  
1970 C C   . GLU A 249 ? 0.4147 0.7559 0.3859 0.1470  0.0147  0.0362  275 GLU A C   
1971 O O   . GLU A 249 ? 0.4993 0.8731 0.4764 0.1500  0.0166  0.0458  275 GLU A O   
1972 C CB  . GLU A 249 ? 0.4694 0.7525 0.4380 0.1451  0.0098  0.0330  275 GLU A CB  
1973 C CG  . GLU A 249 ? 0.7497 1.0487 0.7096 0.1585  0.0096  0.0441  275 GLU A CG  
1974 C CD  . GLU A 249 ? 0.8285 1.0956 0.7698 0.1685  0.0059  0.0445  275 GLU A CD  
1975 O OE1 . GLU A 249 ? 0.7443 0.9785 0.6809 0.1640  0.0031  0.0367  275 GLU A OE1 
1976 O OE2 . GLU A 249 ? 0.8870 1.1611 0.8173 0.1792  0.0078  0.0517  275 GLU A OE2 
1977 N N   . GLU A 250 ? 0.5356 0.8660 0.4861 0.1558  0.0137  0.0291  276 GLU A N   
1978 C CA  . GLU A 250 ? 0.5009 0.8570 0.4334 0.1713  0.0146  0.0322  276 GLU A CA  
1979 C C   . GLU A 250 ? 0.4736 0.8648 0.4263 0.1592  0.0176  0.0335  276 GLU A C   
1980 O O   . GLU A 250 ? 0.6008 1.0264 0.5484 0.1688  0.0190  0.0402  276 GLU A O   
1981 C CB  . GLU A 250 ? 0.8149 1.1451 0.7220 0.1840  0.0116  0.0238  276 GLU A CB  
1982 C CG  . GLU A 250 ? 1.3444 1.6366 1.2374 0.1944  0.0090  0.0210  276 GLU A CG  
1983 C CD  . GLU A 250 ? 1.6834 1.9458 1.5612 0.2024  0.0058  0.0120  276 GLU A CD  
1984 O OE1 . GLU A 250 ? 1.7196 1.9931 1.5968 0.2037  0.0052  0.0089  276 GLU A OE1 
1985 O OE2 . GLU A 250 ? 1.7860 2.0131 1.6518 0.2068  0.0034  0.0085  276 GLU A OE2 
1986 N N   . LYS A 251 ? 0.3737 0.7562 0.3483 0.1383  0.0182  0.0273  277 LYS A N   
1987 C CA  . LYS A 251 ? 0.3020 0.7134 0.2955 0.1242  0.0201  0.0279  277 LYS A CA  
1988 C C   . LYS A 251 ? 0.3842 0.8246 0.4002 0.1139  0.0214  0.0387  277 LYS A C   
1989 O O   . LYS A 251 ? 0.3719 0.8497 0.3952 0.1114  0.0225  0.0451  277 LYS A O   
1990 C CB  . LYS A 251 ? 0.2271 0.6158 0.2331 0.1063  0.0202  0.0171  277 LYS A CB  
1991 C CG  . LYS A 251 ? 0.1609 0.5312 0.1473 0.1132  0.0195  0.0070  277 LYS A CG  
1992 C CD  . LYS A 251 ? 0.3003 0.6594 0.3015 0.0947  0.0205  -0.0021 277 LYS A CD  
1993 C CE  . LYS A 251 ? 0.4860 0.8324 0.4679 0.1012  0.0201  -0.0112 277 LYS A CE  
1994 N NZ  . LYS A 251 ? 0.4180 0.7600 0.4133 0.0842  0.0213  -0.0191 277 LYS A NZ  
1995 N N   . ILE A 252 ? 0.3191 0.7427 0.3459 0.1075  0.0210  0.0409  278 ILE A N   
1996 C CA  . ILE A 252 ? 0.2402 0.6862 0.2882 0.0959  0.0218  0.0507  278 ILE A CA  
1997 C C   . ILE A 252 ? 0.3964 0.8812 0.4378 0.1093  0.0231  0.0632  278 ILE A C   
1998 O O   . ILE A 252 ? 0.4102 0.9227 0.4684 0.0996  0.0240  0.0727  278 ILE A O   
1999 C CB  . ILE A 252 ? 0.2856 0.7042 0.3424 0.0902  0.0209  0.0510  278 ILE A CB  
2000 C CG1 . ILE A 252 ? 0.3760 0.8093 0.4582 0.0710  0.0214  0.0575  278 ILE A CG1 
2001 C CG2 . ILE A 252 ? 0.5164 0.9300 0.5553 0.1097  0.0201  0.0569  278 ILE A CG2 
2002 C CD1 . ILE A 252 ? 0.3726 0.8040 0.4708 0.0507  0.0215  0.0512  278 ILE A CD1 
2003 N N   . LYS A 253 ? 0.4470 0.9335 0.4628 0.1318  0.0230  0.0633  279 LYS A N   
2004 C CA  . LYS A 253 ? 0.4130 0.9357 0.4191 0.1482  0.0246  0.0749  279 LYS A CA  
2005 C C   . LYS A 253 ? 0.5165 1.0838 0.5314 0.1439  0.0261  0.0799  279 LYS A C   
2006 O O   . LYS A 253 ? 0.6887 1.2949 0.7121 0.1447  0.0279  0.0920  279 LYS A O   
2007 C CB  . LYS A 253 ? 0.3685 0.8757 0.3411 0.1750  0.0236  0.0730  279 LYS A CB  
2008 C CG  . LYS A 253 ? 0.3525 0.8234 0.3141 0.1821  0.0216  0.0720  279 LYS A CG  
2009 C CD  . LYS A 253 ? 0.4231 0.8794 0.3483 0.2089  0.0200  0.0711  279 LYS A CD  
2010 C CE  . LYS A 253 ? 0.4230 0.8410 0.3381 0.2138  0.0199  0.0688  279 LYS A CE  
2011 N NZ  . LYS A 253 ? 0.5629 0.9630 0.4509 0.2383  0.0226  0.0642  279 LYS A NZ  
2012 N N   . LYS A 254 ? 0.5670 1.1294 0.5797 0.1392  0.0254  0.0709  280 LYS A N   
2013 C CA  . LYS A 254 ? 0.5829 1.1862 0.6022 0.1354  0.0262  0.0749  280 LYS A CA  
2014 C C   . LYS A 254 ? 0.4391 1.0427 0.4822 0.1083  0.0251  0.0705  280 LYS A C   
2015 O O   . LYS A 254 ? 0.4874 1.1282 0.5437 0.0983  0.0251  0.0769  280 LYS A O   
2016 C CB  . LYS A 254 ? 0.6841 1.2886 0.6777 0.1554  0.0260  0.0698  280 LYS A CB  
2017 C CG  . LYS A 254 ? 0.9827 1.5907 0.9496 0.1838  0.0268  0.0752  280 LYS A CG  
2018 C CD  . LYS A 254 ? 1.1899 1.8088 1.1323 0.2037  0.0267  0.0726  280 LYS A CD  
2019 C CE  . LYS A 254 ? 1.2810 1.9054 1.2002 0.2332  0.0271  0.0787  280 LYS A CE  
2020 N NZ  . LYS A 254 ? 1.2792 1.9161 1.1851 0.2543  0.0267  0.0759  280 LYS A NZ  
2021 N N   . SER A 255 ? 0.3493 0.9114 0.3970 0.0967  0.0240  0.0599  281 SER A N   
2022 C CA  . SER A 255 ? 0.4140 0.9697 0.4816 0.0719  0.0230  0.0548  281 SER A CA  
2023 C C   . SER A 255 ? 0.5013 1.0448 0.5884 0.0553  0.0226  0.0582  281 SER A C   
2024 O O   . SER A 255 ? 0.5781 1.0865 0.6632 0.0567  0.0225  0.0531  281 SER A O   
2025 C CB  . SER A 255 ? 0.3809 0.8996 0.4398 0.0703  0.0224  0.0401  281 SER A CB  
2026 O OG  . SER A 255 ? 0.4775 1.0049 0.5170 0.0853  0.0224  0.0366  281 SER A OG  
2027 N N   . PRO A 256 ? 0.3887 0.9613 0.4940 0.0392  0.0220  0.0671  282 PRO A N   
2028 C CA  . PRO A 256 ? 0.3883 0.9500 0.5114 0.0222  0.0212  0.0709  282 PRO A CA  
2029 C C   . PRO A 256 ? 0.3693 0.8911 0.4999 0.0065  0.0201  0.0591  282 PRO A C   
2030 O O   . PRO A 256 ? 0.3653 0.8787 0.4928 0.0021  0.0196  0.0501  282 PRO A O   
2031 C CB  . PRO A 256 ? 0.3219 0.9259 0.4598 0.0075  0.0201  0.0824  282 PRO A CB  
2032 C CG  . PRO A 256 ? 0.3364 0.9646 0.4681 0.0105  0.0197  0.0805  282 PRO A CG  
2033 C CD  . PRO A 256 ? 0.3379 0.9562 0.4474 0.0360  0.0216  0.0748  282 PRO A CD  
2034 N N   . LEU A 257 ? 0.3208 0.8185 0.4604 -0.0010 0.0198  0.0593  283 LEU A N   
2035 C CA  . LEU A 257 ? 0.2523 0.7121 0.3990 -0.0142 0.0191  0.0488  283 LEU A CA  
2036 C C   . LEU A 257 ? 0.4474 0.9148 0.6071 -0.0368 0.0171  0.0489  283 LEU A C   
2037 O O   . LEU A 257 ? 0.4863 0.9256 0.6495 -0.0477 0.0165  0.0394  283 LEU A O   
2038 C CB  . LEU A 257 ? 0.2375 0.6722 0.3900 -0.0148 0.0191  0.0502  283 LEU A CB  
2039 C CG  . LEU A 257 ? 0.2983 0.6937 0.4583 -0.0263 0.0188  0.0403  283 LEU A CG  
2040 C CD1 . LEU A 257 ? 0.2925 0.6646 0.4421 -0.0190 0.0200  0.0276  283 LEU A CD1 
2041 C CD2 . LEU A 257 ? 0.2623 0.6379 0.4274 -0.0244 0.0187  0.0432  283 LEU A CD2 
2042 N N   . THR A 258 ? 0.4788 0.9843 0.6446 -0.0436 0.0158  0.0601  284 THR A N   
2043 C CA  . THR A 258 ? 0.2935 0.8090 0.4703 -0.0663 0.0127  0.0620  284 THR A CA  
2044 C C   . THR A 258 ? 0.3070 0.8159 0.4783 -0.0701 0.0120  0.0516  284 THR A C   
2045 O O   . THR A 258 ? 0.3345 0.8329 0.5120 -0.0889 0.0094  0.0481  284 THR A O   
2046 C CB  . THR A 258 ? 0.1032 0.6664 0.2868 -0.0717 0.0113  0.0772  284 THR A CB  
2047 O OG1 . THR A 258 ? 0.2479 0.8162 0.4361 -0.0684 0.0122  0.0869  284 THR A OG1 
2048 C CG2 . THR A 258 ? 0.3522 0.9236 0.5462 -0.0973 0.0070  0.0798  284 THR A CG2 
2049 N N   . ILE A 259 ? 0.2976 0.8109 0.4556 -0.0521 0.0141  0.0467  285 ILE A N   
2050 C CA  . ILE A 259 ? 0.3801 0.8873 0.5310 -0.0536 0.0136  0.0368  285 ILE A CA  
2051 C C   . ILE A 259 ? 0.4028 0.8649 0.5545 -0.0620 0.0140  0.0240  285 ILE A C   
2052 O O   . ILE A 259 ? 0.6834 1.1370 0.8344 -0.0724 0.0127  0.0168  285 ILE A O   
2053 C CB  . ILE A 259 ? 0.5090 1.0245 0.6428 -0.0309 0.0158  0.0336  285 ILE A CB  
2054 C CG1 . ILE A 259 ? 0.7370 1.2980 0.8686 -0.0199 0.0159  0.0466  285 ILE A CG1 
2055 C CG2 . ILE A 259 ? 0.4821 0.9919 0.6084 -0.0332 0.0152  0.0237  285 ILE A CG2 
2056 C CD1 . ILE A 259 ? 0.7313 1.3007 0.8435 0.0037  0.0177  0.0441  285 ILE A CD1 
2057 N N   . CYS A 260 ? 0.2200 0.6539 0.3730 -0.0571 0.0157  0.0214  286 CYS A N   
2058 C CA  . CYS A 260 ? 0.2748 0.6677 0.4295 -0.0634 0.0166  0.0102  286 CYS A CA  
2059 C C   . CYS A 260 ? 0.4479 0.8276 0.6158 -0.0812 0.0147  0.0131  286 CYS A C   
2060 O O   . CYS A 260 ? 0.5165 0.8757 0.6869 -0.0946 0.0137  0.0063  286 CYS A O   
2061 C CB  . CYS A 260 ? 0.1134 0.4817 0.2607 -0.0470 0.0193  0.0049  286 CYS A CB  
2062 S SG  . CYS A 260 ? 0.4290 0.7509 0.5779 -0.0522 0.0211  -0.0087 286 CYS A SG  
2063 N N   . TYR A 261 ? 0.4227 0.8128 0.5973 -0.0809 0.0141  0.0232  287 TYR A N   
2064 C CA  . TYR A 261 ? 0.4397 0.8182 0.6254 -0.0973 0.0119  0.0273  287 TYR A CA  
2065 C C   . TYR A 261 ? 0.4780 0.8926 0.6702 -0.1075 0.0090  0.0410  287 TYR A C   
2066 O O   . TYR A 261 ? 0.3394 0.7713 0.5342 -0.1008 0.0096  0.0508  287 TYR A O   
2067 C CB  . TYR A 261 ? 0.4037 0.7583 0.5924 -0.0898 0.0136  0.0272  287 TYR A CB  
2068 C CG  . TYR A 261 ? 0.3892 0.7101 0.5729 -0.0805 0.0163  0.0150  287 TYR A CG  
2069 C CD1 . TYR A 261 ? 0.4689 0.7570 0.6568 -0.0898 0.0164  0.0071  287 TYR A CD1 
2070 C CD2 . TYR A 261 ? 0.3488 0.6705 0.5225 -0.0622 0.0186  0.0118  287 TYR A CD2 
2071 C CE1 . TYR A 261 ? 0.5499 0.8103 0.7343 -0.0814 0.0192  -0.0033 287 TYR A CE1 
2072 C CE2 . TYR A 261 ? 0.4035 0.6957 0.5728 -0.0550 0.0207  0.0015  287 TYR A CE2 
2073 C CZ  . TYR A 261 ? 0.5119 0.7752 0.6876 -0.0648 0.0212  -0.0058 287 TYR A CZ  
2074 O OH  . TYR A 261 ? 0.4032 0.6404 0.5756 -0.0578 0.0237  -0.0152 287 TYR A OH  
2075 N N   . PRO A 262 ? 0.5078 0.9342 0.7022 -0.1241 0.0056  0.0420  288 PRO A N   
2076 C CA  . PRO A 262 ? 0.4937 0.9575 0.6944 -0.1366 0.0022  0.0553  288 PRO A CA  
2077 C C   . PRO A 262 ? 0.5380 1.0003 0.7475 -0.1459 0.0006  0.0653  288 PRO A C   
2078 O O   . PRO A 262 ? 0.6089 1.1064 0.8231 -0.1468 -0.0002 0.0783  288 PRO A O   
2079 C CB  . PRO A 262 ? 0.4231 0.8823 0.6235 -0.1560 -0.0020 0.0512  288 PRO A CB  
2080 C CG  . PRO A 262 ? 0.4581 0.8925 0.6494 -0.1468 0.0006  0.0365  288 PRO A CG  
2081 C CD  . PRO A 262 ? 0.3669 0.7711 0.5567 -0.1321 0.0048  0.0303  288 PRO A CD  
2082 N N   . GLU A 263 ? 0.5206 0.9431 0.7318 -0.1522 0.0002  0.0593  289 GLU A N   
2083 C CA  . GLU A 263 ? 0.5083 0.9241 0.7264 -0.1621 -0.0018 0.0678  289 GLU A CA  
2084 C C   . GLU A 263 ? 0.5754 0.9940 0.7949 -0.1448 0.0016  0.0725  289 GLU A C   
2085 O O   . GLU A 263 ? 0.5813 0.9857 0.8054 -0.1493 0.0008  0.0770  289 GLU A O   
2086 C CB  . GLU A 263 ? 0.6641 1.0351 0.8820 -0.1748 -0.0039 0.0596  289 GLU A CB  
2087 C CG  . GLU A 263 ? 0.9942 1.3284 1.2091 -0.1603 0.0001  0.0474  289 GLU A CG  
2088 C CD  . GLU A 263 ? 1.0992 1.4270 1.3070 -0.1514 0.0027  0.0355  289 GLU A CD  
2089 O OE1 . GLU A 263 ? 1.1847 1.5294 1.3894 -0.1591 0.0007  0.0350  289 GLU A OE1 
2090 O OE2 . GLU A 263 ? 0.9378 1.2439 1.1429 -0.1373 0.0064  0.0269  289 GLU A OE2 
2091 N N   . TYR A 264 ? 0.6140 1.0495 0.8278 -0.1249 0.0052  0.0716  290 TYR A N   
2092 C CA  . TYR A 264 ? 0.5173 0.9547 0.7293 -0.1070 0.0081  0.0757  290 TYR A CA  
2093 C C   . TYR A 264 ? 0.6598 1.1393 0.8748 -0.1055 0.0079  0.0912  290 TYR A C   
2094 O O   . TYR A 264 ? 0.5667 1.0821 0.7794 -0.1020 0.0083  0.0962  290 TYR A O   
2095 C CB  . TYR A 264 ? 0.3049 0.7355 0.5062 -0.0859 0.0115  0.0669  290 TYR A CB  
2096 C CG  . TYR A 264 ? 0.2928 0.7251 0.4888 -0.0665 0.0138  0.0710  290 TYR A CG  
2097 C CD1 . TYR A 264 ? 0.4249 0.8260 0.6228 -0.0630 0.0141  0.0682  290 TYR A CD1 
2098 C CD2 . TYR A 264 ? 0.3772 0.8417 0.5653 -0.0512 0.0153  0.0778  290 TYR A CD2 
2099 C CE1 . TYR A 264 ? 0.3509 0.7518 0.5426 -0.0459 0.0155  0.0720  290 TYR A CE1 
2100 C CE2 . TYR A 264 ? 0.4020 0.8654 0.5825 -0.0330 0.0170  0.0814  290 TYR A CE2 
2101 C CZ  . TYR A 264 ? 0.3664 0.7974 0.5486 -0.0310 0.0169  0.0785  290 TYR A CZ  
2102 O OH  . TYR A 264 ? 0.3487 0.7770 0.5221 -0.0135 0.0179  0.0821  290 TYR A OH  
2103 N N   . ALA A 265 ? 0.7039 1.1794 0.9239 -0.1075 0.0076  0.0990  291 ALA A N   
2104 C CA  . ALA A 265 ? 0.7008 1.2149 0.9241 -0.1068 0.0078  0.1145  291 ALA A CA  
2105 C C   . ALA A 265 ? 0.6266 1.1415 0.8442 -0.0854 0.0110  0.1181  291 ALA A C   
2106 O O   . ALA A 265 ? 0.6242 1.1596 0.8449 -0.0850 0.0113  0.1304  291 ALA A O   
2107 C CB  . ALA A 265 ? 0.6984 1.2123 0.9314 -0.1295 0.0040  0.1232  291 ALA A CB  
2108 N N   . GLY A 266 ? 0.4825 0.9744 0.6907 -0.0681 0.0131  0.1076  292 GLY A N   
2109 C CA  . GLY A 266 ? 0.4199 0.9090 0.6195 -0.0472 0.0154  0.1100  292 GLY A CA  
2110 C C   . GLY A 266 ? 0.3464 0.8669 0.5343 -0.0287 0.0178  0.1133  292 GLY A C   
2111 O O   . GLY A 266 ? 0.5104 1.0535 0.6976 -0.0316 0.0178  0.1126  292 GLY A O   
2112 N N   . SER A 267 ? 0.2124 0.7336 0.3898 -0.0091 0.0196  0.1170  293 SER A N   
2113 C CA  . SER A 267 ? 0.4178 0.9657 0.5807 0.0114  0.0218  0.1203  293 SER A CA  
2114 C C   . SER A 267 ? 0.4755 1.0013 0.6245 0.0236  0.0220  0.1071  293 SER A C   
2115 O O   . SER A 267 ? 0.5097 0.9971 0.6589 0.0206  0.0209  0.0964  293 SER A O   
2116 C CB  . SER A 267 ? 0.5640 1.1183 0.7177 0.0286  0.0233  0.1292  293 SER A CB  
2117 O OG  . SER A 267 ? 0.7189 1.2319 0.8679 0.0342  0.0222  0.1226  293 SER A OG  
2118 N N   . ASN A 268 ? 0.4930 1.0441 0.6300 0.0373  0.0234  0.1082  294 ASN A N   
2119 C CA  . ASN A 268 ? 0.4938 1.0259 0.6152 0.0495  0.0235  0.0965  294 ASN A CA  
2120 C C   . ASN A 268 ? 0.4799 0.9872 0.5821 0.0708  0.0235  0.0937  294 ASN A C   
2121 O O   . ASN A 268 ? 0.3906 0.9079 0.4734 0.0906  0.0244  0.0945  294 ASN A O   
2122 C CB  . ASN A 268 ? 0.6256 1.1930 0.7400 0.0564  0.0245  0.0987  294 ASN A CB  
2123 C CG  . ASN A 268 ? 0.6442 1.2283 0.7748 0.0346  0.0233  0.0982  294 ASN A CG  
2124 O OD1 . ASN A 268 ? 0.4481 1.0087 0.5914 0.0159  0.0217  0.0925  294 ASN A OD1 
2125 N ND2 . ASN A 268 ? 0.7542 1.3787 0.8834 0.0375  0.0239  0.1042  294 ASN A ND2 
2126 N N   . THR A 269 ? 0.4332 0.9077 0.5399 0.0665  0.0222  0.0907  295 THR A N   
2127 C CA  . THR A 269 ? 0.3867 0.8336 0.4759 0.0838  0.0212  0.0878  295 THR A CA  
2128 C C   . THR A 269 ? 0.4935 0.8992 0.5825 0.0788  0.0195  0.0747  295 THR A C   
2129 O O   . THR A 269 ? 0.6885 1.0822 0.7948 0.0608  0.0192  0.0699  295 THR A O   
2130 C CB  . THR A 269 ? 0.4646 0.9084 0.5577 0.0854  0.0208  0.0966  295 THR A CB  
2131 O OG1 . THR A 269 ? 0.4327 0.8636 0.5475 0.0647  0.0199  0.0958  295 THR A OG1 
2132 C CG2 . THR A 269 ? 0.6616 1.1471 0.7530 0.0925  0.0230  0.1104  295 THR A CG2 
2133 N N   . TYR A 270 ? 0.4642 0.8480 0.5324 0.0948  0.0181  0.0692  296 TYR A N   
2134 C CA  . TYR A 270 ? 0.3004 0.6464 0.3672 0.0909  0.0164  0.0577  296 TYR A CA  
2135 C C   . TYR A 270 ? 0.3789 0.7036 0.4634 0.0781  0.0153  0.0573  296 TYR A C   
2136 O O   . TYR A 270 ? 0.6039 0.9103 0.7007 0.0651  0.0153  0.0495  296 TYR A O   
2137 C CB  . TYR A 270 ? 0.3170 0.6420 0.3570 0.1102  0.0141  0.0543  296 TYR A CB  
2138 C CG  . TYR A 270 ? 0.3861 0.6723 0.4251 0.1060  0.0118  0.0446  296 TYR A CG  
2139 C CD1 . TYR A 270 ? 0.5807 0.8548 0.6186 0.1006  0.0122  0.0345  296 TYR A CD1 
2140 C CD2 . TYR A 270 ? 0.3648 0.6274 0.4038 0.1075  0.0091  0.0461  296 TYR A CD2 
2141 C CE1 . TYR A 270 ? 0.6553 0.8968 0.6931 0.0966  0.0103  0.0264  296 TYR A CE1 
2142 C CE2 . TYR A 270 ? 0.5426 0.7728 0.5819 0.1033  0.0068  0.0381  296 TYR A CE2 
2143 C CZ  . TYR A 270 ? 0.6353 0.8558 0.6742 0.0978  0.0076  0.0285  296 TYR A CZ  
2144 O OH  . TYR A 270 ? 0.6677 0.8586 0.7075 0.0934  0.0056  0.0213  296 TYR A OH  
2145 N N   . GLU A 271 ? 0.3358 0.6632 0.4208 0.0826  0.0146  0.0660  297 GLU A N   
2146 C CA  . GLU A 271 ? 0.3088 0.6151 0.4081 0.0731  0.0131  0.0664  297 GLU A CA  
2147 C C   . GLU A 271 ? 0.4405 0.7531 0.5638 0.0522  0.0144  0.0666  297 GLU A C   
2148 O O   . GLU A 271 ? 0.4933 0.7819 0.6281 0.0418  0.0137  0.0601  297 GLU A O   
2149 C CB  . GLU A 271 ? 0.1767 0.4861 0.2695 0.0832  0.0119  0.0763  297 GLU A CB  
2150 C CG  . GLU A 271 ? 0.1995 0.4920 0.2669 0.1030  0.0093  0.0754  297 GLU A CG  
2151 C CD  . GLU A 271 ? 0.4504 0.7635 0.4966 0.1190  0.0106  0.0776  297 GLU A CD  
2152 O OE1 . GLU A 271 ? 0.5827 0.9295 0.6352 0.1164  0.0137  0.0828  297 GLU A OE1 
2153 O OE2 . GLU A 271 ? 0.4089 0.7044 0.4312 0.1344  0.0081  0.0743  297 GLU A OE2 
2154 N N   . GLU A 272 ? 0.4199 0.7647 0.5499 0.0464  0.0161  0.0743  298 GLU A N   
2155 C CA  . GLU A 272 ? 0.5924 0.9431 0.7425 0.0260  0.0164  0.0760  298 GLU A CA  
2156 C C   . GLU A 272 ? 0.5338 0.8800 0.6896 0.0146  0.0170  0.0664  298 GLU A C   
2157 O O   . GLU A 272 ? 0.5103 0.8436 0.6798 -0.0014 0.0165  0.0631  298 GLU A O   
2158 C CB  . GLU A 272 ? 0.6717 1.0593 0.8267 0.0222  0.0173  0.0887  298 GLU A CB  
2159 C CG  . GLU A 272 ? 0.7860 1.1777 0.9597 0.0002  0.0166  0.0920  298 GLU A CG  
2160 C CD  . GLU A 272 ? 0.9616 1.3893 1.1401 -0.0041 0.0171  0.1061  298 GLU A CD  
2161 O OE1 . GLU A 272 ? 1.0477 1.4846 1.2391 -0.0231 0.0161  0.1099  298 GLU A OE1 
2162 O OE2 . GLU A 272 ? 0.9428 1.3893 1.1110 0.0115  0.0184  0.1138  298 GLU A OE2 
2163 N N   . ALA A 273 ? 0.3495 0.7049 0.4929 0.0236  0.0179  0.0621  299 ALA A N   
2164 C CA  . ALA A 273 ? 0.3876 0.7389 0.5339 0.0144  0.0185  0.0529  299 ALA A CA  
2165 C C   . ALA A 273 ? 0.4581 0.7720 0.6048 0.0130  0.0183  0.0413  299 ALA A C   
2166 O O   . ALA A 273 ? 0.4241 0.7253 0.5816 -0.0008 0.0186  0.0350  299 ALA A O   
2167 C CB  . ALA A 273 ? 0.2289 0.6020 0.3610 0.0252  0.0195  0.0522  299 ALA A CB  
2168 N N   . ALA A 274 ? 0.4415 0.7381 0.5757 0.0273  0.0175  0.0389  300 ALA A N   
2169 C CA  . ALA A 274 ? 0.3406 0.6043 0.4748 0.0267  0.0171  0.0291  300 ALA A CA  
2170 C C   . ALA A 274 ? 0.4596 0.7057 0.6115 0.0145  0.0167  0.0288  300 ALA A C   
2171 O O   . ALA A 274 ? 0.6297 0.8567 0.7892 0.0063  0.0175  0.0206  300 ALA A O   
2172 C CB  . ALA A 274 ? 0.1834 0.4329 0.3001 0.0433  0.0152  0.0287  300 ALA A CB  
2173 N N   . ALA A 275 ? 0.3627 0.6150 0.5200 0.0141  0.0156  0.0379  301 ALA A N   
2174 C CA  . ALA A 275 ? 0.3103 0.5468 0.4832 0.0031  0.0149  0.0387  301 ALA A CA  
2175 C C   . ALA A 275 ? 0.4302 0.6694 0.6153 -0.0139 0.0160  0.0359  301 ALA A C   
2176 O O   . ALA A 275 ? 0.5514 0.7691 0.7463 -0.0226 0.0161  0.0310  301 ALA A O   
2177 C CB  . ALA A 275 ? 0.2630 0.5090 0.4379 0.0056  0.0135  0.0498  301 ALA A CB  
2178 N N   . TYR A 276 ? 0.4258 0.6913 0.6091 -0.0181 0.0166  0.0393  302 TYR A N   
2179 C CA  . TYR A 276 ? 0.3384 0.6075 0.5305 -0.0349 0.0168  0.0372  302 TYR A CA  
2180 C C   . TYR A 276 ? 0.3386 0.5882 0.5296 -0.0377 0.0182  0.0247  302 TYR A C   
2181 O O   . TYR A 276 ? 0.3187 0.5496 0.5180 -0.0490 0.0182  0.0198  302 TYR A O   
2182 C CB  . TYR A 276 ? 0.3090 0.6138 0.4988 -0.0380 0.0166  0.0443  302 TYR A CB  
2183 C CG  . TYR A 276 ? 0.4084 0.7184 0.6061 -0.0567 0.0157  0.0435  302 TYR A CG  
2184 C CD1 . TYR A 276 ? 0.4184 0.7275 0.6261 -0.0714 0.0136  0.0499  302 TYR A CD1 
2185 C CD2 . TYR A 276 ? 0.6024 0.9171 0.7961 -0.0600 0.0163  0.0365  302 TYR A CD2 
2186 C CE1 . TYR A 276 ? 0.6104 0.9218 0.8229 -0.0893 0.0118  0.0494  302 TYR A CE1 
2187 C CE2 . TYR A 276 ? 0.6815 0.9994 0.8807 -0.0775 0.0147  0.0358  302 TYR A CE2 
2188 C CZ  . TYR A 276 ? 0.7937 1.1094 1.0018 -0.0924 0.0122  0.0423  302 TYR A CZ  
2189 O OH  . TYR A 276 ? 0.8648 1.1811 1.0761 -0.1106 0.0097  0.0418  302 TYR A OH  
2190 N N   . ILE A 277 ? 0.2407 0.4941 0.4202 -0.0269 0.0193  0.0198  303 ILE A N   
2191 C CA  . ILE A 277 ? 0.2878 0.5240 0.4646 -0.0284 0.0209  0.0083  303 ILE A CA  
2192 C C   . ILE A 277 ? 0.4465 0.6515 0.6304 -0.0299 0.0215  0.0022  303 ILE A C   
2193 O O   . ILE A 277 ? 0.6979 0.8878 0.8874 -0.0389 0.0228  -0.0049 303 ILE A O   
2194 C CB  . ILE A 277 ? 0.1864 0.4274 0.3475 -0.0144 0.0216  0.0045  303 ILE A CB  
2195 C CG1 . ILE A 277 ? 0.1078 0.3804 0.2618 -0.0126 0.0214  0.0093  303 ILE A CG1 
2196 C CG2 . ILE A 277 ? 0.0901 0.3104 0.2488 -0.0158 0.0234  -0.0072 303 ILE A CG2 
2197 C CD1 . ILE A 277 ? 0.0249 0.3016 0.1613 0.0017  0.0219  0.0055  303 ILE A CD1 
2198 N N   . GLN A 278 ? 0.3117 0.5078 0.4947 -0.0207 0.0205  0.0054  304 GLN A N   
2199 C CA  . GLN A 278 ? 0.4426 0.6121 0.6333 -0.0213 0.0207  0.0012  304 GLN A CA  
2200 C C   . GLN A 278 ? 0.5499 0.7098 0.7538 -0.0349 0.0210  0.0010  304 GLN A C   
2201 O O   . GLN A 278 ? 0.6700 0.8099 0.8792 -0.0389 0.0226  -0.0064 304 GLN A O   
2202 C CB  . GLN A 278 ? 0.4977 0.6627 0.6864 -0.0113 0.0185  0.0072  304 GLN A CB  
2203 C CG  . GLN A 278 ? 0.5461 0.6870 0.7449 -0.0126 0.0182  0.0048  304 GLN A CG  
2204 C CD  . GLN A 278 ? 0.5037 0.6405 0.7002 -0.0036 0.0153  0.0113  304 GLN A CD  
2205 O OE1 . GLN A 278 ? 0.5448 0.6931 0.7293 0.0058  0.0137  0.0162  304 GLN A OE1 
2206 N NE2 . GLN A 278 ? 0.4849 0.6047 0.6921 -0.0057 0.0144  0.0115  304 GLN A NE2 
2207 N N   . CYS A 279 ? 0.5226 0.6961 0.7304 -0.0416 0.0193  0.0093  305 CYS A N   
2208 C CA  . CYS A 279 ? 0.5337 0.6965 0.7513 -0.0549 0.0185  0.0102  305 CYS A CA  
2209 C C   . CYS A 279 ? 0.5168 0.6744 0.7343 -0.0656 0.0197  0.0028  305 CYS A C   
2210 O O   . CYS A 279 ? 0.5623 0.6985 0.7848 -0.0729 0.0200  -0.0018 305 CYS A O   
2211 C CB  . CYS A 279 ? 0.6227 0.8034 0.8430 -0.0609 0.0161  0.0217  305 CYS A CB  
2212 S SG  . CYS A 279 ? 0.9712 1.1520 1.1926 -0.0502 0.0145  0.0306  305 CYS A SG  
2213 N N   . GLN A 280 ? 0.4670 0.6434 0.6774 -0.0658 0.0202  0.0016  306 GLN A N   
2214 C CA  . GLN A 280 ? 0.4526 0.6249 0.6611 -0.0756 0.0209  -0.0054 306 GLN A CA  
2215 C C   . GLN A 280 ? 0.5159 0.6620 0.7243 -0.0724 0.0239  -0.0166 306 GLN A C   
2216 O O   . GLN A 280 ? 0.5515 0.6816 0.7613 -0.0814 0.0245  -0.0224 306 GLN A O   
2217 C CB  . GLN A 280 ? 0.4543 0.6524 0.6546 -0.0738 0.0210  -0.0048 306 GLN A CB  
2218 C CG  . GLN A 280 ? 0.4426 0.6708 0.6433 -0.0765 0.0185  0.0068  306 GLN A CG  
2219 C CD  . GLN A 280 ? 0.6050 0.8315 0.8136 -0.0924 0.0158  0.0128  306 GLN A CD  
2220 O OE1 . GLN A 280 ? 0.6807 0.8955 0.8902 -0.1052 0.0148  0.0084  306 GLN A OE1 
2221 N NE2 . GLN A 280 ? 0.6685 0.9050 0.8813 -0.0916 0.0143  0.0229  306 GLN A NE2 
2222 N N   . PHE A 281 ? 0.4706 0.6122 0.6765 -0.0595 0.0255  -0.0193 307 PHE A N   
2223 C CA  . PHE A 281 ? 0.4187 0.5384 0.6254 -0.0558 0.0285  -0.0287 307 PHE A CA  
2224 C C   . PHE A 281 ? 0.4956 0.5938 0.7122 -0.0573 0.0287  -0.0289 307 PHE A C   
2225 O O   . PHE A 281 ? 0.5062 0.5864 0.7256 -0.0618 0.0307  -0.0355 307 PHE A O   
2226 C CB  . PHE A 281 ? 0.2218 0.3441 0.4213 -0.0428 0.0293  -0.0305 307 PHE A CB  
2227 C CG  . PHE A 281 ? 0.3080 0.4435 0.4959 -0.0403 0.0301  -0.0341 307 PHE A CG  
2228 C CD1 . PHE A 281 ? 0.4198 0.5793 0.6007 -0.0377 0.0281  -0.0277 307 PHE A CD1 
2229 C CD2 . PHE A 281 ? 0.4230 0.5475 0.6066 -0.0400 0.0330  -0.0435 307 PHE A CD2 
2230 C CE1 . PHE A 281 ? 0.5434 0.7152 0.7129 -0.0345 0.0287  -0.0309 307 PHE A CE1 
2231 C CE2 . PHE A 281 ? 0.3918 0.5273 0.5638 -0.0375 0.0335  -0.0469 307 PHE A CE2 
2232 C CZ  . PHE A 281 ? 0.5035 0.6624 0.6683 -0.0345 0.0312  -0.0407 307 PHE A CZ  
2233 N N   . GLU A 282 ? 0.3896 0.4897 0.6106 -0.0526 0.0266  -0.0215 308 GLU A N   
2234 C CA  . GLU A 282 ? 0.3019 0.3829 0.5321 -0.0526 0.0264  -0.0209 308 GLU A CA  
2235 C C   . GLU A 282 ? 0.3368 0.4062 0.5709 -0.0645 0.0257  -0.0209 308 GLU A C   
2236 O O   . GLU A 282 ? 0.4461 0.4947 0.6856 -0.0649 0.0266  -0.0242 308 GLU A O   
2237 C CB  . GLU A 282 ? 0.3891 0.4755 0.6218 -0.0460 0.0236  -0.0121 308 GLU A CB  
2238 C CG  . GLU A 282 ? 0.5153 0.6043 0.7434 -0.0337 0.0235  -0.0126 308 GLU A CG  
2239 C CD  . GLU A 282 ? 0.7328 0.8235 0.9624 -0.0272 0.0204  -0.0043 308 GLU A CD  
2240 O OE1 . GLU A 282 ? 0.8528 0.9508 1.0845 -0.0313 0.0184  0.0031  308 GLU A OE1 
2241 O OE2 . GLU A 282 ? 0.7295 0.8139 0.9573 -0.0184 0.0196  -0.0050 308 GLU A OE2 
2242 N N   . ASP A 283 ? 0.4306 0.5133 0.6609 -0.0741 0.0237  -0.0171 309 ASP A N   
2243 C CA  . ASP A 283 ? 0.5272 0.5980 0.7583 -0.0871 0.0219  -0.0165 309 ASP A CA  
2244 C C   . ASP A 283 ? 0.4889 0.5431 0.7158 -0.0920 0.0242  -0.0267 309 ASP A C   
2245 O O   . ASP A 283 ? 0.4720 0.5093 0.6971 -0.1016 0.0228  -0.0280 309 ASP A O   
2246 C CB  . ASP A 283 ? 0.5997 0.6920 0.8283 -0.0973 0.0184  -0.0079 309 ASP A CB  
2247 C CG  . ASP A 283 ? 0.7511 0.8552 0.9838 -0.0944 0.0161  0.0029  309 ASP A CG  
2248 O OD1 . ASP A 283 ? 0.7660 0.8600 1.0032 -0.0849 0.0167  0.0034  309 ASP A OD1 
2249 O OD2 . ASP A 283 ? 0.7611 0.8856 0.9927 -0.1019 0.0135  0.0113  309 ASP A OD2 
2250 N N   . LEU A 284 ? 0.3976 0.4551 0.6212 -0.0851 0.0275  -0.0337 310 LEU A N   
2251 C CA  . LEU A 284 ? 0.5148 0.5567 0.7339 -0.0879 0.0303  -0.0437 310 LEU A CA  
2252 C C   . LEU A 284 ? 0.6490 0.6661 0.8730 -0.0818 0.0333  -0.0490 310 LEU A C   
2253 O O   . LEU A 284 ? 0.8591 0.8587 1.0795 -0.0838 0.0359  -0.0568 310 LEU A O   
2254 C CB  . LEU A 284 ? 0.4343 0.4891 0.6474 -0.0826 0.0328  -0.0489 310 LEU A CB  
2255 C CG  . LEU A 284 ? 0.5275 0.6074 0.7344 -0.0875 0.0303  -0.0448 310 LEU A CG  
2256 C CD1 . LEU A 284 ? 0.5750 0.6643 0.7747 -0.0806 0.0329  -0.0505 310 LEU A CD1 
2257 C CD2 . LEU A 284 ? 0.4424 0.5194 0.6456 -0.1024 0.0275  -0.0445 310 LEU A CD2 
2258 N N   . ASN A 285 ? 0.5113 0.5247 0.5601 0.0049  -0.0871 -0.0188 311 ASN A N   
2259 C CA  . ASN A 285 ? 0.4349 0.4629 0.4826 0.0068  -0.0881 -0.0246 311 ASN A CA  
2260 C C   . ASN A 285 ? 0.5778 0.6073 0.6276 0.0150  -0.0932 -0.0243 311 ASN A C   
2261 O O   . ASN A 285 ? 0.6798 0.7081 0.7305 0.0183  -0.0941 -0.0222 311 ASN A O   
2262 C CB  . ASN A 285 ? 0.5371 0.5742 0.5831 0.0036  -0.0844 -0.0275 311 ASN A CB  
2263 C CG  . ASN A 285 ? 0.7499 0.8034 0.7951 0.0059  -0.0855 -0.0340 311 ASN A CG  
2264 O OD1 . ASN A 285 ? 0.9178 0.9771 0.9628 0.0081  -0.0879 -0.0373 311 ASN A OD1 
2265 N ND2 . ASN A 285 ? 0.5567 0.6182 0.6013 0.0055  -0.0837 -0.0362 311 ASN A ND2 
2266 N N   . LYS A 286 ? 0.6694 0.7009 0.7193 0.0183  -0.0967 -0.0263 312 LYS A N   
2267 C CA  . LYS A 286 ? 0.8314 0.8630 0.8824 0.0263  -0.1021 -0.0262 312 LYS A CA  
2268 C C   . LYS A 286 ? 0.9010 0.9475 0.9504 0.0299  -0.1033 -0.0320 312 LYS A C   
2269 O O   . LYS A 286 ? 0.8026 0.8540 0.8515 0.0358  -0.1077 -0.0350 312 LYS A O   
2270 C CB  . LYS A 286 ? 0.9396 0.9664 0.9912 0.0288  -0.1057 -0.0259 312 LYS A CB  
2271 C CG  . LYS A 286 ? 1.0600 1.0717 1.1136 0.0265  -0.1054 -0.0200 312 LYS A CG  
2272 C CD  . LYS A 286 ? 1.0500 1.0571 1.1043 0.0297  -0.1095 -0.0199 312 LYS A CD  
2273 C CE  . LYS A 286 ? 1.0049 1.0218 1.0569 0.0275  -0.1086 -0.0255 312 LYS A CE  
2274 N NZ  . LYS A 286 ? 0.9444 0.9569 0.9969 0.0309  -0.1127 -0.0254 312 LYS A NZ  
2275 N N   . ARG A 287 ? 1.0652 1.1190 1.1137 0.0267  -0.0996 -0.0339 313 ARG A N   
2276 C CA  . ARG A 287 ? 1.1276 1.1965 1.1747 0.0297  -0.1003 -0.0399 313 ARG A CA  
2277 C C   . ARG A 287 ? 1.2549 1.3251 1.3016 0.0286  -0.0977 -0.0388 313 ARG A C   
2278 O O   . ARG A 287 ? 1.1987 1.2778 1.2445 0.0234  -0.0936 -0.0422 313 ARG A O   
2279 C CB  . ARG A 287 ? 1.0745 1.1576 1.1204 0.0251  -0.0978 -0.0466 313 ARG A CB  
2280 C CG  . ARG A 287 ? 1.0825 1.1662 1.1284 0.0262  -0.1002 -0.0484 313 ARG A CG  
2281 C CD  . ARG A 287 ? 1.2582 1.3556 1.3025 0.0203  -0.0969 -0.0547 313 ARG A CD  
2282 N NE  . ARG A 287 ? 1.4618 1.5595 1.5059 0.0208  -0.0988 -0.0562 313 ARG A NE  
2283 C CZ  . ARG A 287 ? 1.5315 1.6394 1.5739 0.0155  -0.0961 -0.0612 313 ARG A CZ  
2284 N NH1 . ARG A 287 ? 1.4580 1.5766 1.4988 0.0090  -0.0914 -0.0651 313 ARG A NH1 
2285 N NH2 . ARG A 287 ? 1.5816 1.6890 1.6236 0.0165  -0.0981 -0.0622 313 ARG A NH2 
2286 N N   . LYS A 288 ? 1.4695 1.5306 1.5164 0.0333  -0.1001 -0.0341 314 LYS A N   
2287 C CA  . LYS A 288 ? 1.6932 1.7547 1.7395 0.0330  -0.0980 -0.0327 314 LYS A CA  
2288 C C   . LYS A 288 ? 1.8512 1.9291 1.8957 0.0348  -0.0979 -0.0395 314 LYS A C   
2289 O O   . LYS A 288 ? 1.8581 1.9410 1.9022 0.0313  -0.0942 -0.0406 314 LYS A O   
2290 C CB  . LYS A 288 ? 1.7435 1.7933 1.7897 0.0385  -0.1012 -0.0270 314 LYS A CB  
2291 C CG  . LYS A 288 ? 1.6777 1.7118 1.7261 0.0362  -0.1009 -0.0201 314 LYS A CG  
2292 C CD  . LYS A 288 ? 1.5407 1.5643 1.5886 0.0414  -0.1043 -0.0150 314 LYS A CD  
2293 C CE  . LYS A 288 ? 1.4069 1.4326 1.4529 0.0425  -0.1028 -0.0143 314 LYS A CE  
2294 N NZ  . LYS A 288 ? 1.3177 1.3328 1.3621 0.0472  -0.1060 -0.0092 314 LYS A NZ  
2295 N N   . ASP A 289 ? 1.9489 2.0354 1.9925 0.0406  -0.1020 -0.0443 315 ASP A N   
2296 C CA  . ASP A 289 ? 1.9221 2.0251 1.9641 0.0438  -0.1028 -0.0513 315 ASP A CA  
2297 C C   . ASP A 289 ? 1.7635 1.8816 1.8061 0.0376  -0.0992 -0.0579 315 ASP A C   
2298 O O   . ASP A 289 ? 1.6674 1.7957 1.7096 0.0341  -0.0959 -0.0615 315 ASP A O   
2299 C CB  . ASP A 289 ? 2.0130 2.1186 2.0531 0.0536  -0.1094 -0.0539 315 ASP A CB  
2300 C CG  . ASP A 289 ? 2.0833 2.1731 2.1218 0.0593  -0.1132 -0.0474 315 ASP A CG  
2301 O OD1 . ASP A 289 ? 2.1063 2.1857 2.1454 0.0561  -0.1105 -0.0415 315 ASP A OD1 
2302 O OD2 . ASP A 289 ? 2.1090 2.1967 2.1452 0.0670  -0.1189 -0.0482 315 ASP A OD2 
2303 N N   . THR A 290 ? 1.7028 1.8222 1.7460 0.0361  -0.0999 -0.0596 316 THR A N   
2304 C CA  . THR A 290 ? 1.6465 1.7802 1.6898 0.0300  -0.0966 -0.0659 316 THR A CA  
2305 C C   . THR A 290 ? 1.5826 1.7135 1.6255 0.0198  -0.0902 -0.0643 316 THR A C   
2306 O O   . THR A 290 ? 1.5633 1.7036 1.6056 0.0165  -0.0871 -0.0676 316 THR A O   
2307 C CB  . THR A 290 ? 1.6271 1.7604 1.6707 0.0303  -0.0985 -0.0671 316 THR A CB  
2308 O OG1 . THR A 290 ? 1.6175 1.7526 1.6609 0.0401  -0.1048 -0.0688 316 THR A OG1 
2309 C CG2 . THR A 290 ? 1.5806 1.7299 1.6237 0.0239  -0.0951 -0.0741 316 THR A CG2 
2310 N N   . LYS A 291 ? 1.4846 1.6023 1.5277 0.0151  -0.0885 -0.0593 317 LYS A N   
2311 C CA  . LYS A 291 ? 1.3525 1.4655 1.3943 0.0056  -0.0829 -0.0576 317 LYS A CA  
2312 C C   . LYS A 291 ? 1.2443 1.3521 1.2859 0.0045  -0.0806 -0.0543 317 LYS A C   
2313 O O   . LYS A 291 ? 1.2811 1.3834 1.3240 0.0107  -0.0833 -0.0509 317 LYS A O   
2314 C CB  . LYS A 291 ? 1.3523 1.4504 1.3939 0.0025  -0.0824 -0.0525 317 LYS A CB  
2315 C CG  . LYS A 291 ? 1.2719 1.3754 1.3124 0.0003  -0.0827 -0.0561 317 LYS A CG  
2316 C CD  . LYS A 291 ? 1.1750 1.2902 1.2126 -0.0083 -0.0779 -0.0617 317 LYS A CD  
2317 C CE  . LYS A 291 ? 0.9829 1.1033 1.0189 -0.0111 -0.0778 -0.0651 317 LYS A CE  
2318 N NZ  . LYS A 291 ? 0.8077 0.9387 0.8402 -0.0204 -0.0727 -0.0703 317 LYS A NZ  
2319 N N   . GLU A 292 ? 1.1463 1.2556 1.1861 -0.0037 -0.0756 -0.0554 318 GLU A N   
2320 C CA  . GLU A 292 ? 1.0429 1.1473 1.0822 -0.0056 -0.0730 -0.0526 318 GLU A CA  
2321 C C   . GLU A 292 ? 0.9305 1.0272 0.9671 -0.0149 -0.0682 -0.0509 318 GLU A C   
2322 O O   . GLU A 292 ? 1.1192 1.2246 1.1531 -0.0215 -0.0648 -0.0556 318 GLU A O   
2323 C CB  . GLU A 292 ? 1.1812 1.3011 1.2203 -0.0044 -0.0725 -0.0582 318 GLU A CB  
2324 C CG  . GLU A 292 ? 1.3770 1.4925 1.4167 -0.0009 -0.0726 -0.0549 318 GLU A CG  
2325 C CD  . GLU A 292 ? 1.5309 1.6364 1.5691 -0.0075 -0.0683 -0.0511 318 GLU A CD  
2326 O OE1 . GLU A 292 ? 1.6925 1.7995 1.7284 -0.0155 -0.0646 -0.0533 318 GLU A OE1 
2327 O OE2 . GLU A 292 ? 1.4695 1.5657 1.5085 -0.0047 -0.0686 -0.0460 318 GLU A OE2 
2328 N N   . ILE A 293 ? 0.6534 0.7336 0.6901 -0.0153 -0.0682 -0.0444 319 ILE A N   
2329 C CA  . ILE A 293 ? 0.5568 0.6273 0.5902 -0.0231 -0.0644 -0.0424 319 ILE A CA  
2330 C C   . ILE A 293 ? 0.5963 0.6653 0.6276 -0.0272 -0.0608 -0.0419 319 ILE A C   
2331 O O   . ILE A 293 ? 0.7271 0.7932 0.7606 -0.0231 -0.0615 -0.0390 319 ILE A O   
2332 C CB  . ILE A 293 ? 0.6036 0.6575 0.6380 -0.0215 -0.0659 -0.0360 319 ILE A CB  
2333 C CG1 . ILE A 293 ? 0.6043 0.6591 0.6406 -0.0173 -0.0697 -0.0364 319 ILE A CG1 
2334 C CG2 . ILE A 293 ? 0.5597 0.6032 0.5896 -0.0290 -0.0625 -0.0344 319 ILE A CG2 
2335 C CD1 . ILE A 293 ? 0.6152 0.6545 0.6529 -0.0153 -0.0716 -0.0305 319 ILE A CD1 
2336 N N   . TYR A 294 ? 0.4257 0.4963 0.4525 -0.0354 -0.0570 -0.0448 320 TYR A N   
2337 C CA  . TYR A 294 ? 0.4187 0.4873 0.4426 -0.0401 -0.0535 -0.0448 320 TYR A CA  
2338 C C   . TYR A 294 ? 0.5936 0.6449 0.6139 -0.0442 -0.0518 -0.0401 320 TYR A C   
2339 O O   . TYR A 294 ? 0.8801 0.9273 0.8953 -0.0509 -0.0496 -0.0413 320 TYR A O   
2340 C CB  . TYR A 294 ? 0.5208 0.6027 0.5412 -0.0470 -0.0504 -0.0517 320 TYR A CB  
2341 C CG  . TYR A 294 ? 0.6062 0.7068 0.6297 -0.0432 -0.0522 -0.0575 320 TYR A CG  
2342 C CD1 . TYR A 294 ? 0.6961 0.8058 0.7224 -0.0384 -0.0532 -0.0592 320 TYR A CD1 
2343 C CD2 . TYR A 294 ? 0.7160 0.8254 0.7395 -0.0443 -0.0531 -0.0615 320 TYR A CD2 
2344 C CE1 . TYR A 294 ? 0.8386 0.9655 0.8675 -0.0344 -0.0553 -0.0649 320 TYR A CE1 
2345 C CE2 . TYR A 294 ? 0.7122 0.8393 0.7385 -0.0403 -0.0550 -0.0673 320 TYR A CE2 
2346 C CZ  . TYR A 294 ? 0.7655 0.9012 0.7944 -0.0352 -0.0562 -0.0691 320 TYR A CZ  
2347 O OH  . TYR A 294 ? 0.6608 0.8141 0.6921 -0.0307 -0.0585 -0.0752 320 TYR A OH  
2348 N N   . THR A 295 ? 0.5232 0.5645 0.5459 -0.0400 -0.0527 -0.0348 321 THR A N   
2349 C CA  . THR A 295 ? 0.3896 0.4146 0.4096 -0.0424 -0.0517 -0.0302 321 THR A CA  
2350 C C   . THR A 295 ? 0.4311 0.4524 0.4465 -0.0475 -0.0483 -0.0306 321 THR A C   
2351 O O   . THR A 295 ? 0.4209 0.4501 0.4374 -0.0468 -0.0473 -0.0324 321 THR A O   
2352 C CB  . THR A 295 ? 0.4305 0.4467 0.4556 -0.0355 -0.0545 -0.0243 321 THR A CB  
2353 O OG1 . THR A 295 ? 0.5071 0.5264 0.5363 -0.0305 -0.0579 -0.0240 321 THR A OG1 
2354 C CG2 . THR A 295 ? 0.4678 0.4681 0.4905 -0.0374 -0.0538 -0.0201 321 THR A CG2 
2355 N N   . HIS A 296 ? 0.3328 0.3416 0.3426 -0.0524 -0.0467 -0.0291 322 HIS A N   
2356 C CA  . HIS A 296 ? 0.3048 0.3075 0.3090 -0.0573 -0.0438 -0.0293 322 HIS A CA  
2357 C C   . HIS A 296 ? 0.4156 0.4007 0.4163 -0.0577 -0.0440 -0.0250 322 HIS A C   
2358 O O   . HIS A 296 ? 0.5946 0.5722 0.5928 -0.0592 -0.0448 -0.0240 322 HIS A O   
2359 C CB  . HIS A 296 ? 0.3929 0.4015 0.3905 -0.0658 -0.0408 -0.0347 322 HIS A CB  
2360 C CG  . HIS A 296 ? 0.6461 0.6731 0.6467 -0.0657 -0.0404 -0.0398 322 HIS A CG  
2361 N ND1 . HIS A 296 ? 0.6836 0.7186 0.6845 -0.0665 -0.0388 -0.0423 322 HIS A ND1 
2362 C CD2 . HIS A 296 ? 0.6859 0.7255 0.6894 -0.0647 -0.0416 -0.0433 322 HIS A CD2 
2363 C CE1 . HIS A 296 ? 0.5793 0.6310 0.5831 -0.0659 -0.0391 -0.0471 322 HIS A CE1 
2364 N NE2 . HIS A 296 ? 0.6973 0.7523 0.7028 -0.0647 -0.0408 -0.0479 322 HIS A NE2 
2365 N N   . PHE A 297 ? 0.4248 0.4036 0.4253 -0.0562 -0.0433 -0.0225 323 PHE A N   
2366 C CA  . PHE A 297 ? 0.5282 0.4909 0.5250 -0.0563 -0.0435 -0.0190 323 PHE A CA  
2367 C C   . PHE A 297 ? 0.5592 0.5145 0.5460 -0.0636 -0.0409 -0.0212 323 PHE A C   
2368 O O   . PHE A 297 ? 0.8078 0.7636 0.7925 -0.0649 -0.0392 -0.0221 323 PHE A O   
2369 C CB  . PHE A 297 ? 0.4684 0.4283 0.4707 -0.0502 -0.0445 -0.0150 323 PHE A CB  
2370 C CG  . PHE A 297 ? 0.3958 0.3600 0.4069 -0.0434 -0.0473 -0.0122 323 PHE A CG  
2371 C CD1 . PHE A 297 ? 0.4480 0.4251 0.4643 -0.0403 -0.0479 -0.0134 323 PHE A CD1 
2372 C CD2 . PHE A 297 ? 0.3855 0.3403 0.3992 -0.0400 -0.0495 -0.0083 323 PHE A CD2 
2373 C CE1 . PHE A 297 ? 0.4977 0.4772 0.5210 -0.0342 -0.0507 -0.0107 323 PHE A CE1 
2374 C CE2 . PHE A 297 ? 0.3236 0.2817 0.3449 -0.0342 -0.0520 -0.0057 323 PHE A CE2 
2375 C CZ  . PHE A 297 ? 0.4247 0.3947 0.4506 -0.0315 -0.0526 -0.0068 323 PHE A CZ  
2376 N N   . THR A 298 ? 0.3693 0.3172 0.3493 -0.0685 -0.0405 -0.0222 324 THR A N   
2377 C CA  . THR A 298 ? 0.5077 0.4489 0.4767 -0.0767 -0.0379 -0.0249 324 THR A CA  
2378 C C   . THR A 298 ? 0.5281 0.4499 0.4889 -0.0778 -0.0385 -0.0223 324 THR A C   
2379 O O   . THR A 298 ? 0.4789 0.3929 0.4424 -0.0730 -0.0409 -0.0189 324 THR A O   
2380 C CB  . THR A 298 ? 0.4445 0.3929 0.4096 -0.0833 -0.0365 -0.0290 324 THR A CB  
2381 O OG1 . THR A 298 ? 0.4102 0.3533 0.3753 -0.0820 -0.0383 -0.0273 324 THR A OG1 
2382 C CG2 . THR A 298 ? 0.3843 0.3527 0.3568 -0.0821 -0.0361 -0.0324 324 THR A CG2 
2383 N N   . CYS A 299 ? 0.4398 0.3539 0.3904 -0.0842 -0.0364 -0.0242 325 CYS A N   
2384 C CA  . CYS A 299 ? 0.4513 0.3462 0.3912 -0.0867 -0.0368 -0.0228 325 CYS A CA  
2385 C C   . CYS A 299 ? 0.5528 0.4446 0.4814 -0.0966 -0.0344 -0.0263 325 CYS A C   
2386 O O   . CYS A 299 ? 0.5717 0.4630 0.4934 -0.1026 -0.0320 -0.0289 325 CYS A O   
2387 C CB  . CYS A 299 ? 0.3100 0.1957 0.2465 -0.0848 -0.0368 -0.0215 325 CYS A CB  
2388 S SG  . CYS A 299 ? 0.5995 0.4605 0.5215 -0.0871 -0.0378 -0.0202 325 CYS A SG  
2389 N N   . ALA A 300 ? 0.4251 0.3149 0.3515 -0.0985 -0.0349 -0.0263 326 ALA A N   
2390 C CA  . ALA A 300 ? 0.4079 0.2978 0.3249 -0.1081 -0.0324 -0.0298 326 ALA A CA  
2391 C C   . ALA A 300 ? 0.5389 0.4132 0.4409 -0.1157 -0.0307 -0.0308 326 ALA A C   
2392 O O   . ALA A 300 ? 0.6400 0.5165 0.5340 -0.1249 -0.0278 -0.0343 326 ALA A O   
2393 C CB  . ALA A 300 ? 0.4528 0.3399 0.3691 -0.1080 -0.0337 -0.0288 326 ALA A CB  
2394 N N   . THR A 301 ? 0.4655 0.3239 0.3631 -0.1118 -0.0324 -0.0279 327 THR A N   
2395 C CA  . THR A 301 ? 0.5087 0.3499 0.3910 -0.1180 -0.0314 -0.0286 327 THR A CA  
2396 C C   . THR A 301 ? 0.7019 0.5477 0.5839 -0.1199 -0.0296 -0.0306 327 THR A C   
2397 O O   . THR A 301 ? 0.8519 0.6875 0.7214 -0.1271 -0.0281 -0.0325 327 THR A O   
2398 C CB  . THR A 301 ? 0.5167 0.3374 0.3930 -0.1128 -0.0344 -0.0250 327 THR A CB  
2399 O OG1 . THR A 301 ? 0.5686 0.3933 0.4564 -0.1028 -0.0367 -0.0224 327 THR A OG1 
2400 C CG2 . THR A 301 ? 0.4676 0.2814 0.3412 -0.1125 -0.0359 -0.0235 327 THR A CG2 
2401 N N   . ASP A 302 ? 0.6549 0.5157 0.5503 -0.1136 -0.0301 -0.0303 328 ASP A N   
2402 C CA  . ASP A 302 ? 0.6025 0.4698 0.4990 -0.1146 -0.0285 -0.0323 328 ASP A CA  
2403 C C   . ASP A 302 ? 0.5437 0.4272 0.4411 -0.1221 -0.0254 -0.0369 328 ASP A C   
2404 O O   . ASP A 302 ? 0.5768 0.4784 0.4855 -0.1193 -0.0253 -0.0380 328 ASP A O   
2405 C CB  . ASP A 302 ? 0.5989 0.4753 0.5089 -0.1046 -0.0302 -0.0299 328 ASP A CB  
2406 C CG  . ASP A 302 ? 0.5845 0.4659 0.4951 -0.1047 -0.0289 -0.0315 328 ASP A CG  
2407 O OD1 . ASP A 302 ? 0.6480 0.5238 0.5482 -0.1122 -0.0270 -0.0343 328 ASP A OD1 
2408 O OD2 . ASP A 302 ? 0.6770 0.5676 0.5982 -0.0974 -0.0298 -0.0300 328 ASP A OD2 
2409 N N   . THR A 303 ? 0.4681 0.3449 0.3532 -0.1316 -0.0231 -0.0399 329 THR A N   
2410 C CA  . THR A 303 ? 0.5294 0.4214 0.4142 -0.1399 -0.0199 -0.0449 329 THR A CA  
2411 C C   . THR A 303 ? 0.5855 0.4968 0.4821 -0.1359 -0.0194 -0.0468 329 THR A C   
2412 O O   . THR A 303 ? 0.6060 0.5360 0.5117 -0.1352 -0.0189 -0.0492 329 THR A O   
2413 C CB  . THR A 303 ? 0.4300 0.3102 0.2990 -0.1510 -0.0175 -0.0476 329 THR A CB  
2414 O OG1 . THR A 303 ? 0.4625 0.3263 0.3197 -0.1560 -0.0176 -0.0464 329 THR A OG1 
2415 C CG2 . THR A 303 ? 0.3364 0.2347 0.2067 -0.1593 -0.0141 -0.0532 329 THR A CG2 
2416 N N   . LYS A 304 ? 0.6304 0.5370 0.5264 -0.1330 -0.0199 -0.0461 330 LYS A N   
2417 C CA  . LYS A 304 ? 0.6188 0.5419 0.5250 -0.1286 -0.0196 -0.0476 330 LYS A CA  
2418 C C   . LYS A 304 ? 0.3766 0.3151 0.2970 -0.1207 -0.0211 -0.0463 330 LYS A C   
2419 O O   . LYS A 304 ? 0.5387 0.4958 0.4662 -0.1209 -0.0202 -0.0496 330 LYS A O   
2420 C CB  . LYS A 304 ? 0.8546 0.7680 0.7598 -0.1234 -0.0208 -0.0452 330 LYS A CB  
2421 C CG  . LYS A 304 ? 1.1193 1.0485 1.0342 -0.1187 -0.0205 -0.0466 330 LYS A CG  
2422 C CD  . LYS A 304 ? 1.2239 1.1434 1.1382 -0.1128 -0.0218 -0.0438 330 LYS A CD  
2423 C CE  . LYS A 304 ? 1.1823 1.1173 1.1060 -0.1078 -0.0215 -0.0449 330 LYS A CE  
2424 N NZ  . LYS A 304 ? 1.0865 1.0133 1.0103 -0.1016 -0.0227 -0.0421 330 LYS A NZ  
2425 N N   . ASN A 305 ? 0.3376 0.2680 0.2618 -0.1135 -0.0237 -0.0417 331 ASN A N   
2426 C CA  . ASN A 305 ? 0.4011 0.3435 0.3377 -0.1060 -0.0256 -0.0400 331 ASN A CA  
2427 C C   . ASN A 305 ? 0.4162 0.3715 0.3548 -0.1102 -0.0246 -0.0433 331 ASN A C   
2428 O O   . ASN A 305 ? 0.3017 0.2749 0.2480 -0.1086 -0.0243 -0.0461 331 ASN A O   
2429 C CB  . ASN A 305 ? 0.5833 0.5131 0.5218 -0.0994 -0.0284 -0.0347 331 ASN A CB  
2430 C CG  . ASN A 305 ? 0.6839 0.6245 0.6347 -0.0917 -0.0305 -0.0327 331 ASN A CG  
2431 O OD1 . ASN A 305 ? 0.8403 0.7764 0.7924 -0.0897 -0.0321 -0.0306 331 ASN A OD1 
2432 N ND2 . ASN A 305 ? 0.6027 0.5573 0.5621 -0.0873 -0.0306 -0.0334 331 ASN A ND2 
2433 N N   . VAL A 306 ? 0.4973 0.4434 0.4284 -0.1153 -0.0243 -0.0432 332 VAL A N   
2434 C CA  . VAL A 306 ? 0.5124 0.4698 0.4445 -0.1196 -0.0234 -0.0464 332 VAL A CA  
2435 C C   . VAL A 306 ? 0.5157 0.4914 0.4494 -0.1249 -0.0208 -0.0523 332 VAL A C   
2436 O O   . VAL A 306 ? 0.5132 0.5063 0.4548 -0.1228 -0.0211 -0.0549 332 VAL A O   
2437 C CB  . VAL A 306 ? 0.4493 0.3928 0.3696 -0.1271 -0.0224 -0.0464 332 VAL A CB  
2438 C CG1 . VAL A 306 ? 0.2676 0.2248 0.1881 -0.1330 -0.0207 -0.0506 332 VAL A CG1 
2439 C CG2 . VAL A 306 ? 0.2729 0.2010 0.1930 -0.1211 -0.0253 -0.0411 332 VAL A CG2 
2440 N N   . GLN A 307 ? 0.4966 0.4684 0.4226 -0.1316 -0.0185 -0.0546 333 GLN A N   
2441 C CA  . GLN A 307 ? 0.4179 0.4067 0.3449 -0.1371 -0.0160 -0.0605 333 GLN A CA  
2442 C C   . GLN A 307 ? 0.4471 0.4543 0.3872 -0.1287 -0.0175 -0.0615 333 GLN A C   
2443 O O   . GLN A 307 ? 0.5820 0.6076 0.5275 -0.1293 -0.0170 -0.0657 333 GLN A O   
2444 C CB  . GLN A 307 ? 0.2840 0.2639 0.2015 -0.1437 -0.0140 -0.0620 333 GLN A CB  
2445 C CG  . GLN A 307 ? 0.4649 0.4623 0.3832 -0.1500 -0.0114 -0.0684 333 GLN A CG  
2446 C CD  . GLN A 307 ? 0.6404 0.6280 0.5487 -0.1570 -0.0094 -0.0699 333 GLN A CD  
2447 O OE1 . GLN A 307 ? 0.8814 0.8801 0.7876 -0.1643 -0.0069 -0.0753 333 GLN A OE1 
2448 N NE2 . GLN A 307 ? 0.6264 0.5933 0.5283 -0.1546 -0.0107 -0.0654 333 GLN A NE2 
2449 N N   . PHE A 308 ? 0.5060 0.5077 0.4505 -0.1207 -0.0194 -0.0576 334 PHE A N   
2450 C CA  . PHE A 308 ? 0.4714 0.4877 0.4270 -0.1122 -0.0210 -0.0577 334 PHE A CA  
2451 C C   . PHE A 308 ? 0.4262 0.4518 0.3902 -0.1063 -0.0232 -0.0570 334 PHE A C   
2452 O O   . PHE A 308 ? 0.4518 0.4952 0.4224 -0.1039 -0.0236 -0.0605 334 PHE A O   
2453 C CB  . PHE A 308 ? 0.5248 0.5314 0.4828 -0.1050 -0.0225 -0.0530 334 PHE A CB  
2454 C CG  . PHE A 308 ? 0.5628 0.5822 0.5315 -0.0959 -0.0243 -0.0523 334 PHE A CG  
2455 C CD1 . PHE A 308 ? 0.5400 0.5718 0.5109 -0.0959 -0.0233 -0.0559 334 PHE A CD1 
2456 C CD2 . PHE A 308 ? 0.3498 0.3681 0.3257 -0.0876 -0.0271 -0.0480 334 PHE A CD2 
2457 C CE1 . PHE A 308 ? 0.4663 0.5088 0.4459 -0.0875 -0.0251 -0.0552 334 PHE A CE1 
2458 C CE2 . PHE A 308 ? 0.2476 0.2762 0.2321 -0.0797 -0.0288 -0.0472 334 PHE A CE2 
2459 C CZ  . PHE A 308 ? 0.4352 0.4757 0.4213 -0.0795 -0.0278 -0.0507 334 PHE A CZ  
2460 N N   . VAL A 309 ? 0.4260 0.4392 0.3894 -0.1036 -0.0249 -0.0525 335 VAL A N   
2461 C CA  . VAL A 309 ? 0.4327 0.4526 0.4033 -0.0979 -0.0273 -0.0514 335 VAL A CA  
2462 C C   . VAL A 309 ? 0.4357 0.4712 0.4066 -0.1028 -0.0261 -0.0571 335 VAL A C   
2463 O O   . VAL A 309 ? 0.4673 0.5183 0.4459 -0.0979 -0.0276 -0.0593 335 VAL A O   
2464 C CB  . VAL A 309 ? 0.3337 0.3372 0.3020 -0.0962 -0.0290 -0.0465 335 VAL A CB  
2465 C CG1 . VAL A 309 ? 0.3226 0.3333 0.2984 -0.0903 -0.0316 -0.0456 335 VAL A CG1 
2466 C CG2 . VAL A 309 ? 0.1692 0.1584 0.1377 -0.0911 -0.0302 -0.0413 335 VAL A CG2 
2467 N N   . PHE A 310 ? 0.5381 0.5693 0.4999 -0.1126 -0.0235 -0.0597 336 PHE A N   
2468 C CA  . PHE A 310 ? 0.6028 0.6486 0.5640 -0.1183 -0.0220 -0.0653 336 PHE A CA  
2469 C C   . PHE A 310 ? 0.6953 0.7619 0.6614 -0.1188 -0.0210 -0.0711 336 PHE A C   
2470 O O   . PHE A 310 ? 0.6689 0.7527 0.6404 -0.1172 -0.0216 -0.0752 336 PHE A O   
2471 C CB  . PHE A 310 ? 0.3216 0.3578 0.2711 -0.1298 -0.0189 -0.0668 336 PHE A CB  
2472 C CG  . PHE A 310 ? 0.3283 0.3775 0.2768 -0.1356 -0.0174 -0.0717 336 PHE A CG  
2473 C CD1 . PHE A 310 ? 0.3901 0.4354 0.3386 -0.1340 -0.0188 -0.0698 336 PHE A CD1 
2474 C CD2 . PHE A 310 ? 0.4987 0.5649 0.4465 -0.1426 -0.0146 -0.0784 336 PHE A CD2 
2475 C CE1 . PHE A 310 ? 0.5929 0.6509 0.5406 -0.1392 -0.0174 -0.0744 336 PHE A CE1 
2476 C CE2 . PHE A 310 ? 0.5183 0.5979 0.4655 -0.1480 -0.0131 -0.0833 336 PHE A CE2 
2477 C CZ  . PHE A 310 ? 0.5885 0.6639 0.5356 -0.1463 -0.0145 -0.0812 336 PHE A CZ  
2478 N N   . ASP A 311 ? 0.6702 0.7353 0.6341 -0.1206 -0.0196 -0.0718 337 ASP A N   
2479 C CA  . ASP A 311 ? 0.6130 0.6969 0.5816 -0.1202 -0.0189 -0.0772 337 ASP A CA  
2480 C C   . ASP A 311 ? 0.5667 0.6627 0.5461 -0.1089 -0.0223 -0.0767 337 ASP A C   
2481 O O   . ASP A 311 ? 0.5760 0.6912 0.5601 -0.1078 -0.0226 -0.0821 337 ASP A O   
2482 C CB  . ASP A 311 ? 0.7220 0.7994 0.6871 -0.1219 -0.0176 -0.0767 337 ASP A CB  
2483 C CG  . ASP A 311 ? 0.8654 0.9618 0.8350 -0.1214 -0.0169 -0.0823 337 ASP A CG  
2484 O OD1 . ASP A 311 ? 1.0744 1.1893 1.0477 -0.1224 -0.0167 -0.0878 337 ASP A OD1 
2485 O OD2 . ASP A 311 ? 0.7579 0.8513 0.7272 -0.1197 -0.0167 -0.0815 337 ASP A OD2 
2486 N N   . ALA A 312 ? 0.5012 0.5856 0.4840 -0.1006 -0.0249 -0.0704 338 ALA A N   
2487 C CA  . ALA A 312 ? 0.4098 0.5023 0.4017 -0.0899 -0.0284 -0.0689 338 ALA A CA  
2488 C C   . ALA A 312 ? 0.5521 0.6541 0.5472 -0.0883 -0.0300 -0.0711 338 ALA A C   
2489 O O   . ALA A 312 ? 0.6489 0.7668 0.6499 -0.0831 -0.0318 -0.0746 338 ALA A O   
2490 C CB  . ALA A 312 ? 0.3060 0.3827 0.3000 -0.0829 -0.0306 -0.0615 338 ALA A CB  
2491 N N   . VAL A 313 ? 0.5368 0.6286 0.5277 -0.0924 -0.0295 -0.0692 339 VAL A N   
2492 C CA  . VAL A 313 ? 0.4918 0.5915 0.4849 -0.0915 -0.0308 -0.0712 339 VAL A CA  
2493 C C   . VAL A 313 ? 0.4572 0.5780 0.4508 -0.0961 -0.0292 -0.0794 339 VAL A C   
2494 O O   . VAL A 313 ? 0.5542 0.6895 0.5535 -0.0909 -0.0314 -0.0825 339 VAL A O   
2495 C CB  . VAL A 313 ? 0.4808 0.5659 0.4674 -0.0970 -0.0298 -0.0685 339 VAL A CB  
2496 C CG1 . VAL A 313 ? 0.3936 0.4887 0.3819 -0.0972 -0.0308 -0.0716 339 VAL A CG1 
2497 C CG2 . VAL A 313 ? 0.5144 0.5802 0.5015 -0.0915 -0.0320 -0.0609 339 VAL A CG2 
2498 N N   . THR A 314 ? 0.3016 0.4240 0.2890 -0.1059 -0.0254 -0.0829 340 THR A N   
2499 C CA  . THR A 314 ? 0.3115 0.4544 0.2990 -0.1117 -0.0233 -0.0911 340 THR A CA  
2500 C C   . THR A 314 ? 0.4927 0.6543 0.4885 -0.1034 -0.0257 -0.0949 340 THR A C   
2501 O O   . THR A 314 ? 0.6399 0.8178 0.6400 -0.1005 -0.0272 -0.0995 340 THR A O   
2502 C CB  . THR A 314 ? 0.4488 0.5895 0.4287 -0.1228 -0.0190 -0.0939 340 THR A CB  
2503 O OG1 . THR A 314 ? 0.5908 0.7138 0.5616 -0.1308 -0.0169 -0.0907 340 THR A OG1 
2504 C CG2 . THR A 314 ? 0.2811 0.4446 0.2617 -0.1290 -0.0168 -0.1028 340 THR A CG2 
2505 N N   . ASP A 315 ? 0.4979 0.6566 0.4954 -0.0993 -0.0263 -0.0931 341 ASP A N   
2506 C CA  . ASP A 315 ? 0.6470 0.8213 0.6514 -0.0910 -0.0288 -0.0962 341 ASP A CA  
2507 C C   . ASP A 315 ? 0.6608 0.8408 0.6712 -0.0813 -0.0330 -0.0955 341 ASP A C   
2508 O O   . ASP A 315 ? 0.7945 0.9933 0.8088 -0.0780 -0.0345 -0.1015 341 ASP A O   
2509 C CB  . ASP A 315 ? 0.7440 0.9090 0.7492 -0.0862 -0.0295 -0.0919 341 ASP A CB  
2510 C CG  . ASP A 315 ? 0.9887 1.1519 0.9886 -0.0946 -0.0258 -0.0940 341 ASP A CG  
2511 O OD1 . ASP A 315 ? 1.1977 1.3700 1.1940 -0.1039 -0.0228 -0.0998 341 ASP A OD1 
2512 O OD2 . ASP A 315 ? 0.9641 1.1168 0.9632 -0.0922 -0.0258 -0.0900 341 ASP A OD2 
2513 N N   . VAL A 316 ? 0.4790 0.6426 0.4899 -0.0766 -0.0351 -0.0884 342 VAL A N   
2514 C CA  . VAL A 316 ? 0.5738 0.7400 0.5898 -0.0674 -0.0393 -0.0870 342 VAL A CA  
2515 C C   . VAL A 316 ? 0.6909 0.8726 0.7076 -0.0696 -0.0395 -0.0932 342 VAL A C   
2516 O O   . VAL A 316 ? 0.7672 0.9607 0.7886 -0.0619 -0.0430 -0.0960 342 VAL A O   
2517 C CB  . VAL A 316 ? 0.5679 0.7135 0.5833 -0.0645 -0.0408 -0.0788 342 VAL A CB  
2518 C CG1 . VAL A 316 ? 0.5006 0.6489 0.5206 -0.0562 -0.0451 -0.0779 342 VAL A CG1 
2519 C CG2 . VAL A 316 ? 0.4700 0.6025 0.4859 -0.0608 -0.0412 -0.0729 342 VAL A CG2 
2520 N N   . ILE A 317 ? 0.6409 0.8221 0.6525 -0.0800 -0.0358 -0.0955 343 ILE A N   
2521 C CA  . ILE A 317 ? 0.6632 0.8590 0.6748 -0.0834 -0.0354 -0.1015 343 ILE A CA  
2522 C C   . ILE A 317 ? 0.6682 0.8884 0.6825 -0.0842 -0.0347 -0.1104 343 ILE A C   
2523 O O   . ILE A 317 ? 0.8663 1.1030 0.8842 -0.0803 -0.0368 -0.1156 343 ILE A O   
2524 C CB  . ILE A 317 ? 0.6125 0.8001 0.6168 -0.0951 -0.0314 -0.1012 343 ILE A CB  
2525 C CG1 . ILE A 317 ? 0.5516 0.7154 0.5531 -0.0936 -0.0324 -0.0927 343 ILE A CG1 
2526 C CG2 . ILE A 317 ? 0.7981 1.0019 0.8024 -0.0987 -0.0307 -0.1076 343 ILE A CG2 
2527 C CD1 . ILE A 317 ? 0.6280 0.7812 0.6212 -0.1043 -0.0289 -0.0919 343 ILE A CD1 
2528 N N   . ILE A 318 ? 0.4754 0.6981 0.4878 -0.0891 -0.0320 -0.1124 344 ILE A N   
2529 C CA  . ILE A 318 ? 0.4945 0.7402 0.5093 -0.0901 -0.0313 -0.1210 344 ILE A CA  
2530 C C   . ILE A 318 ? 0.6654 0.9213 0.6869 -0.0771 -0.0362 -0.1224 344 ILE A C   
2531 O O   . ILE A 318 ? 0.7848 1.0618 0.8098 -0.0742 -0.0376 -0.1299 344 ILE A O   
2532 C CB  . ILE A 318 ? 0.5251 0.7692 0.5362 -0.0981 -0.0275 -0.1223 344 ILE A CB  
2533 C CG1 . ILE A 318 ? 0.5942 0.8265 0.5972 -0.1112 -0.0229 -0.1209 344 ILE A CG1 
2534 C CG2 . ILE A 318 ? 0.5253 0.7942 0.5393 -0.0992 -0.0269 -0.1316 344 ILE A CG2 
2535 C CD1 . ILE A 318 ? 0.5701 0.8005 0.5683 -0.1200 -0.0192 -0.1227 344 ILE A CD1 
2536 N N   . LYS A 319 ? 0.6972 0.9378 0.7200 -0.0693 -0.0388 -0.1152 345 LYS A N   
2537 C CA  . LYS A 319 ? 0.7509 0.9972 0.7786 -0.0568 -0.0435 -0.1153 345 LYS A CA  
2538 C C   . LYS A 319 ? 0.7601 1.0154 0.7910 -0.0496 -0.0475 -0.1177 345 LYS A C   
2539 O O   . LYS A 319 ? 0.7931 1.0633 0.8273 -0.0417 -0.0509 -0.1226 345 LYS A O   
2540 C CB  . LYS A 319 ? 0.9183 1.1441 0.9459 -0.0509 -0.0453 -0.1062 345 LYS A CB  
2541 C CG  . LYS A 319 ? 1.0689 1.2956 1.1004 -0.0379 -0.0506 -0.1044 345 LYS A CG  
2542 C CD  . LYS A 319 ? 1.2604 1.4657 1.2917 -0.0334 -0.0520 -0.0949 345 LYS A CD  
2543 C CE  . LYS A 319 ? 1.3960 1.6005 1.4302 -0.0213 -0.0574 -0.0928 345 LYS A CE  
2544 N NZ  . LYS A 319 ? 1.4630 1.6471 1.4971 -0.0176 -0.0585 -0.0836 345 LYS A NZ  
2545 N N   . ASN A 320 ? 0.7101 0.9561 0.7396 -0.0520 -0.0474 -0.1145 346 ASN A N   
2546 C CA  . ASN A 320 ? 0.5662 0.8181 0.5985 -0.0450 -0.0514 -0.1159 346 ASN A CA  
2547 C C   . ASN A 320 ? 0.6980 0.9743 0.7317 -0.0473 -0.0510 -0.1258 346 ASN A C   
2548 O O   . ASN A 320 ? 0.9439 1.2246 0.9781 -0.0467 -0.0522 -0.1276 346 ASN A O   
2549 C CB  . ASN A 320 ? 0.5493 0.7835 0.5797 -0.0469 -0.0514 -0.1094 346 ASN A CB  
2550 C CG  . ASN A 320 ? 0.6024 0.8140 0.6323 -0.0433 -0.0524 -0.1000 346 ASN A CG  
2551 O OD1 . ASN A 320 ? 0.5650 0.7738 0.5959 -0.0395 -0.0531 -0.0980 346 ASN A OD1 
2552 N ND2 . ASN A 320 ? 0.6556 0.8514 0.6841 -0.0446 -0.0526 -0.0942 346 ASN A ND2 
2553 N N   . ASN A 321 ? 0.7215 1.0142 0.7558 -0.0499 -0.0493 -0.1325 347 ASN A N   
2554 C CA  . ASN A 321 ? 0.8060 1.1244 0.8423 -0.0514 -0.0490 -0.1428 347 ASN A CA  
2555 C C   . ASN A 321 ? 0.7031 1.0380 0.7431 -0.0421 -0.0526 -0.1485 347 ASN A C   
2556 O O   . ASN A 321 ? 0.4240 0.7570 0.4636 -0.0416 -0.0519 -0.1478 347 ASN A O   
2557 C CB  . ASN A 321 ? 0.9041 1.2301 0.9371 -0.0658 -0.0428 -0.1473 347 ASN A CB  
2558 C CG  . ASN A 321 ? 0.9441 1.2604 0.9731 -0.0747 -0.0398 -0.1445 347 ASN A CG  
2559 O OD1 . ASN A 321 ? 1.0886 1.4084 1.1137 -0.0870 -0.0348 -0.1473 347 ASN A OD1 
2560 N ND2 . ASN A 321 ? 0.7881 1.0918 0.8176 -0.0687 -0.0429 -0.1389 347 ASN A ND2 
2561 N N   . VAL B 8   ? 1.2307 1.3279 1.0728 0.3013  -0.0670 -0.2684 34  VAL B N   
2562 C CA  . VAL B 8   ? 1.3051 1.4066 1.1525 0.3004  -0.0609 -0.2736 34  VAL B CA  
2563 C C   . VAL B 8   ? 1.3519 1.4521 1.2002 0.3015  -0.0610 -0.2733 34  VAL B C   
2564 O O   . VAL B 8   ? 1.4512 1.5471 1.2963 0.3016  -0.0627 -0.2666 34  VAL B O   
2565 C CB  . VAL B 8   ? 1.3422 1.4447 1.1916 0.2970  -0.0529 -0.2700 34  VAL B CB  
2566 C CG1 . VAL B 8   ? 1.3235 1.4216 1.1710 0.2957  -0.0514 -0.2602 34  VAL B CG1 
2567 C CG2 . VAL B 8   ? 1.3613 1.4684 1.2164 0.2960  -0.0468 -0.2760 34  VAL B CG2 
2568 N N   . LYS B 9   ? 1.2817 1.3857 1.1342 0.3022  -0.0592 -0.2808 35  LYS B N   
2569 C CA  . LYS B 9   ? 1.2289 1.3317 1.0818 0.3032  -0.0596 -0.2816 35  LYS B CA  
2570 C C   . LYS B 9   ? 1.1357 1.2422 0.9941 0.3017  -0.0526 -0.2855 35  LYS B C   
2571 O O   . LYS B 9   ? 1.0857 1.1967 0.9482 0.3022  -0.0519 -0.2935 35  LYS B O   
2572 C CB  . LYS B 9   ? 1.3629 1.4653 1.2145 0.3064  -0.0672 -0.2874 35  LYS B CB  
2573 C CG  . LYS B 9   ? 1.3689 1.4695 1.2201 0.3075  -0.0683 -0.2887 35  LYS B CG  
2574 C CD  . LYS B 9   ? 1.4081 1.5078 1.2576 0.3107  -0.0765 -0.2944 35  LYS B CD  
2575 C CE  . LYS B 9   ? 1.4451 1.5420 1.2930 0.3117  -0.0781 -0.2954 35  LYS B CE  
2576 N NZ  . LYS B 9   ? 1.4824 1.5778 1.3283 0.3147  -0.0866 -0.3008 35  LYS B NZ  
2577 N N   . LEU B 10  ? 1.1226 1.2272 0.9812 0.3000  -0.0474 -0.2798 36  LEU B N   
2578 C CA  . LEU B 10  ? 1.0731 1.1804 0.9363 0.2984  -0.0407 -0.2828 36  LEU B CA  
2579 C C   . LEU B 10  ? 1.0122 1.1181 0.8753 0.2999  -0.0419 -0.2849 36  LEU B C   
2580 O O   . LEU B 10  ? 0.9298 1.0311 0.7888 0.3006  -0.0442 -0.2796 36  LEU B O   
2581 C CB  . LEU B 10  ? 1.0765 1.1827 0.9406 0.2955  -0.0340 -0.2757 36  LEU B CB  
2582 C CG  . LEU B 10  ? 1.1795 1.2867 1.0434 0.2936  -0.0320 -0.2733 36  LEU B CG  
2583 C CD1 . LEU B 10  ? 1.3211 1.4262 1.1855 0.2909  -0.0260 -0.2659 36  LEU B CD1 
2584 C CD2 . LEU B 10  ? 1.0876 1.2001 0.9554 0.2929  -0.0298 -0.2815 36  LEU B CD2 
2585 N N   . LEU B 11  ? 0.9960 1.1055 0.8633 0.3002  -0.0402 -0.2926 37  LEU B N   
2586 C CA  . LEU B 11  ? 0.9752 1.0833 0.8423 0.3015  -0.0415 -0.2954 37  LEU B CA  
2587 C C   . LEU B 11  ? 0.9157 1.0252 0.7867 0.2995  -0.0340 -0.2961 37  LEU B C   
2588 O O   . LEU B 11  ? 0.9450 1.0592 0.8213 0.2982  -0.0297 -0.3007 37  LEU B O   
2589 C CB  . LEU B 11  ? 0.9557 1.0662 0.8242 0.3039  -0.0472 -0.3043 37  LEU B CB  
2590 C CG  . LEU B 11  ? 0.9085 1.0169 0.7760 0.3055  -0.0499 -0.3077 37  LEU B CG  
2591 C CD1 . LEU B 11  ? 0.7456 0.8475 0.6061 0.3062  -0.0531 -0.3009 37  LEU B CD1 
2592 C CD2 . LEU B 11  ? 0.9640 1.0749 0.8335 0.3080  -0.0562 -0.3164 37  LEU B CD2 
2593 N N   . LEU B 12  ? 0.8346 0.9402 0.7033 0.2993  -0.0322 -0.2916 38  LEU B N   
2594 C CA  . LEU B 12  ? 0.8445 0.9508 0.7165 0.2975  -0.0252 -0.2918 38  LEU B CA  
2595 C C   . LEU B 12  ? 0.9941 1.1011 0.8675 0.2987  -0.0263 -0.2990 38  LEU B C   
2596 O O   . LEU B 12  ? 1.0737 1.1771 0.9429 0.3005  -0.0310 -0.2993 38  LEU B O   
2597 C CB  . LEU B 12  ? 0.7550 0.8567 0.6242 0.2965  -0.0220 -0.2832 38  LEU B CB  
2598 C CG  . LEU B 12  ? 0.6369 0.7382 0.5063 0.2946  -0.0188 -0.2759 38  LEU B CG  
2599 C CD1 . LEU B 12  ? 0.4502 0.5471 0.3176 0.2939  -0.0159 -0.2680 38  LEU B CD1 
2600 C CD2 . LEU B 12  ? 0.6787 0.7841 0.5533 0.2924  -0.0129 -0.2782 38  LEU B CD2 
2601 N N   . LEU B 13  ? 0.9416 1.0530 0.8208 0.2975  -0.0219 -0.3045 39  LEU B N   
2602 C CA  . LEU B 13  ? 0.7723 0.8846 0.6536 0.2983  -0.0223 -0.3113 39  LEU B CA  
2603 C C   . LEU B 13  ? 0.7835 0.8965 0.6684 0.2959  -0.0144 -0.3110 39  LEU B C   
2604 O O   . LEU B 13  ? 0.7117 0.8252 0.5981 0.2937  -0.0089 -0.3061 39  LEU B O   
2605 C CB  . LEU B 13  ? 0.6405 0.7579 0.5262 0.2994  -0.0258 -0.3203 39  LEU B CB  
2606 C CG  . LEU B 13  ? 0.7167 0.8334 0.5993 0.3020  -0.0341 -0.3219 39  LEU B CG  
2607 C CD1 . LEU B 13  ? 0.7037 0.8258 0.5918 0.3032  -0.0370 -0.3314 39  LEU B CD1 
2608 C CD2 . LEU B 13  ? 0.7415 0.8523 0.6176 0.3040  -0.0397 -0.3196 39  LEU B CD2 
2609 N N   . GLY B 14  ? 0.8913 1.0043 0.7777 0.2964  -0.0141 -0.3162 40  GLY B N   
2610 C CA  . GLY B 14  ? 0.9364 1.0498 0.8262 0.2943  -0.0071 -0.3164 40  GLY B CA  
2611 C C   . GLY B 14  ? 0.8264 0.9351 0.7126 0.2951  -0.0073 -0.3160 40  GLY B C   
2612 O O   . GLY B 14  ? 0.6311 0.7353 0.5112 0.2968  -0.0118 -0.3131 40  GLY B O   
2613 N N   . ALA B 15  ? 0.4379 0.5473 0.3275 0.2938  -0.0024 -0.3188 41  ALA B N   
2614 C CA  . ALA B 15  ? 0.5835 0.6884 0.4697 0.2944  -0.0021 -0.3190 41  ALA B CA  
2615 C C   . ALA B 15  ? 0.6137 0.7132 0.4947 0.2941  0.0003  -0.3104 41  ALA B C   
2616 O O   . ALA B 15  ? 0.6793 0.7789 0.5603 0.2932  0.0024  -0.3042 41  ALA B O   
2617 C CB  . ALA B 15  ? 0.6208 0.7276 0.5121 0.2928  0.0034  -0.3235 41  ALA B CB  
2618 N N   . ARG B 16  ? 0.5891 0.6837 0.4655 0.2949  -0.0002 -0.3102 42  ARG B N   
2619 C CA  . ARG B 16  ? 0.6756 0.7651 0.5474 0.2947  0.0024  -0.3026 42  ARG B CA  
2620 C C   . ARG B 16  ? 0.8669 0.9573 0.7431 0.2924  0.0107  -0.2986 42  ARG B C   
2621 O O   . ARG B 16  ? 0.9483 1.0409 0.8291 0.2912  0.0147  -0.3027 42  ARG B O   
2622 C CB  . ARG B 16  ? 0.7307 0.8149 0.5967 0.2957  0.0006  -0.3040 42  ARG B CB  
2623 C CG  . ARG B 16  ? 1.1545 1.2333 1.0156 0.2955  0.0034  -0.2966 42  ARG B CG  
2624 C CD  . ARG B 16  ? 1.4866 1.5597 1.3404 0.2966  0.0005  -0.2983 42  ARG B CD  
2625 N NE  . ARG B 16  ? 1.7261 1.7989 1.5814 0.2963  0.0027  -0.3044 42  ARG B NE  
2626 C CZ  . ARG B 16  ? 1.8266 1.8968 1.6818 0.2952  0.0089  -0.3030 42  ARG B CZ  
2627 N NH1 . ARG B 16  ? 1.8861 1.9540 1.7403 0.2945  0.0136  -0.2957 42  ARG B NH1 
2628 N NH2 . ARG B 16  ? 1.7989 1.8687 1.6552 0.2949  0.0103  -0.3089 42  ARG B NH2 
2629 N N   . GLU B 17  ? 0.4813 0.5109 0.4769 0.0175  0.0550  0.0086  43  GLU B N   
2630 C CA  . GLU B 17  ? 0.5570 0.5875 0.5559 0.0110  0.0495  0.0034  43  GLU B CA  
2631 C C   . GLU B 17  ? 0.6324 0.6642 0.6307 0.0060  0.0457  0.0009  43  GLU B C   
2632 O O   . GLU B 17  ? 0.6061 0.6419 0.6043 0.0018  0.0405  -0.0023 43  GLU B O   
2633 C CB  . GLU B 17  ? 0.5573 0.5969 0.5559 0.0116  0.0452  0.0027  43  GLU B CB  
2634 C CG  . GLU B 17  ? 0.5308 0.5700 0.5291 0.0162  0.0488  0.0050  43  GLU B CG  
2635 C CD  . GLU B 17  ? 0.6413 0.6733 0.6441 0.0131  0.0509  0.0017  43  GLU B CD  
2636 O OE1 . GLU B 17  ? 0.7947 0.8214 0.7973 0.0159  0.0570  0.0036  43  GLU B OE1 
2637 O OE2 . GLU B 17  ? 0.6130 0.6447 0.6194 0.0079  0.0469  -0.0031 43  GLU B OE2 
2638 N N   . SER B 18  ? 0.6800 0.7080 0.6773 0.0065  0.0488  0.0021  44  SER B N   
2639 C CA  . SER B 18  ? 0.5789 0.6079 0.5748 0.0016  0.0460  -0.0003 44  SER B CA  
2640 C C   . SER B 18  ? 0.5243 0.5445 0.5221 -0.0036 0.0466  -0.0038 44  SER B C   
2641 O O   . SER B 18  ? 0.6067 0.6270 0.6027 -0.0088 0.0434  -0.0066 44  SER B O   
2642 C CB  . SER B 18  ? 0.6116 0.6436 0.6054 0.0050  0.0488  0.0024  44  SER B CB  
2643 O OG  . SER B 18  ? 0.7101 0.7336 0.7046 0.0085  0.0554  0.0049  44  SER B OG  
2644 N N   . GLY B 19  ? 0.3887 0.4016 0.3899 -0.0025 0.0511  -0.0041 45  GLY B N   
2645 C CA  . GLY B 19  ? 0.2427 0.2492 0.2469 -0.0072 0.0520  -0.0083 45  GLY B CA  
2646 C C   . GLY B 19  ? 0.5132 0.5115 0.5193 -0.0062 0.0593  -0.0077 45  GLY B C   
2647 O O   . GLY B 19  ? 0.5778 0.5715 0.5871 -0.0102 0.0610  -0.0118 45  GLY B O   
2648 N N   . LYS B 20  ? 0.5887 0.5855 0.5927 -0.0007 0.0642  -0.0029 46  LYS B N   
2649 C CA  . LYS B 20  ? 0.5531 0.5409 0.5575 0.0007  0.0723  -0.0018 46  LYS B CA  
2650 C C   . LYS B 20  ? 0.7289 0.7093 0.7382 -0.0026 0.0769  -0.0057 46  LYS B C   
2651 O O   . LYS B 20  ? 0.7973 0.7737 0.8094 -0.0072 0.0786  -0.0099 46  LYS B O   
2652 C CB  . LYS B 20  ? 0.5786 0.5654 0.5789 0.0084  0.0774  0.0045  46  LYS B CB  
2653 C CG  . LYS B 20  ? 0.5451 0.5403 0.5416 0.0120  0.0743  0.0075  46  LYS B CG  
2654 C CD  . LYS B 20  ? 0.5355 0.5305 0.5276 0.0209  0.0799  0.0137  46  LYS B CD  
2655 C CE  . LYS B 20  ? 0.6300 0.6259 0.6207 0.0247  0.0805  0.0160  46  LYS B CE  
2656 N NZ  . LYS B 20  ? 0.5518 0.5593 0.5439 0.0226  0.0719  0.0141  46  LYS B NZ  
2657 N N   . SER B 21  ? 0.8082 0.7878 0.8187 -0.0006 0.0792  -0.0049 47  SER B N   
2658 C CA  . SER B 21  ? 0.7361 0.7097 0.7519 -0.0039 0.0847  -0.0092 47  SER B CA  
2659 C C   . SER B 21  ? 0.6135 0.5917 0.6357 -0.0102 0.0795  -0.0165 47  SER B C   
2660 O O   . SER B 21  ? 0.5451 0.5197 0.5727 -0.0143 0.0837  -0.0218 47  SER B O   
2661 C CB  . SER B 21  ? 0.7302 0.7031 0.7455 -0.0008 0.0879  -0.0072 47  SER B CB  
2662 O OG  . SER B 21  ? 0.8110 0.7935 0.8266 -0.0001 0.0801  -0.0073 47  SER B OG  
2663 N N   . THR B 22  ? 0.6378 0.6242 0.6591 -0.0107 0.0708  -0.0172 48  THR B N   
2664 C CA  . THR B 22  ? 0.6995 0.6906 0.7256 -0.0153 0.0656  -0.0236 48  THR B CA  
2665 C C   . THR B 22  ? 0.6797 0.6680 0.7061 -0.0191 0.0667  -0.0265 48  THR B C   
2666 O O   . THR B 22  ? 0.4623 0.4529 0.4946 -0.0228 0.0660  -0.0329 48  THR B O   
2667 C CB  . THR B 22  ? 0.7420 0.7407 0.7650 -0.0149 0.0570  -0.0229 48  THR B CB  
2668 O OG1 . THR B 22  ? 0.9071 0.9090 0.9298 -0.0116 0.0561  -0.0205 48  THR B OG1 
2669 C CG2 . THR B 22  ? 0.6193 0.6224 0.6470 -0.0183 0.0524  -0.0293 48  THR B CG2 
2670 N N   . ILE B 23  ? 0.6887 0.6734 0.7095 -0.0178 0.0684  -0.0224 49  ILE B N   
2671 C CA  . ILE B 23  ? 0.5485 0.5301 0.5689 -0.0213 0.0702  -0.0250 49  ILE B CA  
2672 C C   . ILE B 23  ? 0.6403 0.6153 0.6661 -0.0232 0.0785  -0.0285 49  ILE B C   
2673 O O   . ILE B 23  ? 0.7480 0.7239 0.7782 -0.0278 0.0790  -0.0346 49  ILE B O   
2674 C CB  . ILE B 23  ? 0.5182 0.4982 0.5320 -0.0191 0.0706  -0.0202 49  ILE B CB  
2675 C CG1 . ILE B 23  ? 0.5986 0.5858 0.6073 -0.0192 0.0628  -0.0184 49  ILE B CG1 
2676 C CG2 . ILE B 23  ? 0.4709 0.4467 0.4847 -0.0227 0.0740  -0.0230 49  ILE B CG2 
2677 C CD1 . ILE B 23  ? 0.6291 0.6191 0.6366 -0.0245 0.0574  -0.0227 49  ILE B CD1 
2678 N N   . VAL B 24  ? 0.6565 0.6250 0.6816 -0.0198 0.0857  -0.0248 50  VAL B N   
2679 C CA  . VAL B 24  ? 0.6587 0.6192 0.6879 -0.0220 0.0953  -0.0279 50  VAL B CA  
2680 C C   . VAL B 24  ? 0.7376 0.7025 0.7756 -0.0270 0.0949  -0.0362 50  VAL B C   
2681 O O   . VAL B 24  ? 0.8945 0.8574 0.9377 -0.0317 0.0996  -0.0423 50  VAL B O   
2682 C CB  . VAL B 24  ? 0.5674 0.5200 0.5932 -0.0171 0.1031  -0.0224 50  VAL B CB  
2683 C CG1 . VAL B 24  ? 0.5209 0.4641 0.5505 -0.0204 0.1142  -0.0264 50  VAL B CG1 
2684 C CG2 . VAL B 24  ? 0.6325 0.5822 0.6506 -0.0112 0.1042  -0.0148 50  VAL B CG2 
2685 N N   . LYS B 25  ? 0.6422 0.6142 0.6827 -0.0260 0.0895  -0.0369 51  LYS B N   
2686 C CA  . LYS B 25  ? 0.7079 0.6866 0.7581 -0.0298 0.0884  -0.0453 51  LYS B CA  
2687 C C   . LYS B 25  ? 0.7418 0.7277 0.7961 -0.0333 0.0828  -0.0515 51  LYS B C   
2688 O O   . LYS B 25  ? 0.7537 0.7435 0.8169 -0.0371 0.0850  -0.0599 51  LYS B O   
2689 C CB  . LYS B 25  ? 0.7170 0.7022 0.7685 -0.0271 0.0830  -0.0445 51  LYS B CB  
2690 C CG  . LYS B 25  ? 0.8909 0.8701 0.9379 -0.0234 0.0884  -0.0385 51  LYS B CG  
2691 C CD  . LYS B 25  ? 0.8675 0.8536 0.9135 -0.0203 0.0819  -0.0363 51  LYS B CD  
2692 C CE  . LYS B 25  ? 0.8409 0.8347 0.8970 -0.0228 0.0800  -0.0445 51  LYS B CE  
2693 N NZ  . LYS B 25  ? 0.7889 0.7885 0.8438 -0.0196 0.0745  -0.0425 51  LYS B NZ  
2694 N N   . GLN B 26  ? 0.6496 0.6377 0.6970 -0.0319 0.0761  -0.0477 52  GLN B N   
2695 C CA  . GLN B 26  ? 0.5384 0.5323 0.5871 -0.0347 0.0712  -0.0525 52  GLN B CA  
2696 C C   . GLN B 26  ? 0.7178 0.7078 0.7689 -0.0388 0.0775  -0.0564 52  GLN B C   
2697 O O   . GLN B 26  ? 0.7480 0.7443 0.8052 -0.0417 0.0762  -0.0641 52  GLN B O   
2698 C CB  . GLN B 26  ? 0.4455 0.4402 0.4843 -0.0334 0.0648  -0.0469 52  GLN B CB  
2699 C CG  . GLN B 26  ? 0.4636 0.4636 0.5005 -0.0305 0.0574  -0.0454 52  GLN B CG  
2700 C CD  . GLN B 26  ? 0.5556 0.5574 0.5963 -0.0315 0.0472  -0.0523 52  GLN B CD  
2701 O OE1 . GLN B 26  ? 0.5205 0.5239 0.5689 -0.0334 0.0482  -0.0594 52  GLN B OE1 
2702 N NE2 . GLN B 26  ? 0.6075 0.6090 0.6426 -0.0299 0.0374  -0.0506 52  GLN B NE2 
2703 N N   . MET B 27  ? 0.7861 0.7661 0.8322 -0.0382 0.0842  -0.0517 53  MET B N   
2704 C CA  . MET B 27  ? 0.8071 0.7818 0.8549 -0.0419 0.0912  -0.0552 53  MET B CA  
2705 C C   . MET B 27  ? 0.7871 0.7640 0.8457 -0.0460 0.0969  -0.0641 53  MET B C   
2706 O O   . MET B 27  ? 0.8021 0.7839 0.8661 -0.0503 0.0974  -0.0715 53  MET B O   
2707 C CB  . MET B 27  ? 0.8834 0.8465 0.9248 -0.0390 0.0984  -0.0485 53  MET B CB  
2708 C CG  . MET B 27  ? 0.8136 0.7763 0.8457 -0.0348 0.0934  -0.0408 53  MET B CG  
2709 S SD  . MET B 27  ? 0.9582 0.9240 0.9859 -0.0383 0.0889  -0.0426 53  MET B SD  
2710 C CE  . MET B 27  ? 0.5312 0.5082 0.5592 -0.0403 0.0784  -0.0456 53  MET B CE  
2711 N N   . LYS B 28  ? 0.8010 0.7754 0.8630 -0.0449 0.1013  -0.0640 54  LYS B N   
2712 C CA  . LYS B 28  ? 0.8724 0.8493 0.9452 -0.0494 0.1077  -0.0731 54  LYS B CA  
2713 C C   . LYS B 28  ? 0.9531 0.9455 1.0359 -0.0512 0.1001  -0.0824 54  LYS B C   
2714 O O   . LYS B 28  ? 1.1988 1.1968 1.2917 -0.0556 0.1037  -0.0925 54  LYS B O   
2715 C CB  . LYS B 28  ? 0.9801 0.9516 1.0533 -0.0478 0.1135  -0.0708 54  LYS B CB  
2716 C CG  . LYS B 28  ? 1.2223 1.1961 1.3065 -0.0532 0.1213  -0.0810 54  LYS B CG  
2717 C CD  . LYS B 28  ? 1.3861 1.3492 1.4671 -0.0525 0.1311  -0.0775 54  LYS B CD  
2718 C CE  . LYS B 28  ? 1.4612 1.4261 1.5372 -0.0466 0.1250  -0.0702 54  LYS B CE  
2719 N NZ  . LYS B 28  ? 1.4811 1.4359 1.5532 -0.0456 0.1348  -0.0668 54  LYS B NZ  
2720 N N   . ILE B 29  ? 0.7899 0.7893 0.8699 -0.0471 0.0896  -0.0796 55  ILE B N   
2721 C CA  . ILE B 29  ? 0.7787 0.7892 0.8649 -0.0462 0.0801  -0.0882 55  ILE B CA  
2722 C C   . ILE B 29  ? 0.8284 0.8388 0.9117 -0.0492 0.0746  -0.0912 55  ILE B C   
2723 O O   . ILE B 29  ? 1.0095 1.0260 1.1007 -0.0519 0.0716  -0.1011 55  ILE B O   
2724 C CB  . ILE B 29  ? 0.7226 0.7349 0.8034 -0.0413 0.0684  -0.0835 55  ILE B CB  
2725 C CG1 . ILE B 29  ? 0.7468 0.7611 0.8316 -0.0385 0.0725  -0.0823 55  ILE B CG1 
2726 C CG2 . ILE B 29  ? 0.6686 0.6866 0.7519 -0.0408 0.0546  -0.0904 55  ILE B CG2 
2727 C CD1 . ILE B 29  ? 0.6686 0.6850 0.7492 -0.0340 0.0615  -0.0786 55  ILE B CD1 
2728 N N   . ILE B 30  ? 0.7022 0.7066 0.7744 -0.0487 0.0733  -0.0831 56  ILE B N   
2729 C CA  . ILE B 30  ? 0.6639 0.6673 0.7309 -0.0515 0.0674  -0.0847 56  ILE B CA  
2730 C C   . ILE B 30  ? 0.8413 0.8439 0.9134 -0.0566 0.0769  -0.0904 56  ILE B C   
2731 O O   . ILE B 30  ? 1.0076 1.0152 1.0845 -0.0596 0.0727  -0.0991 56  ILE B O   
2732 C CB  . ILE B 30  ? 0.5945 0.5919 0.6481 -0.0503 0.0646  -0.0749 56  ILE B CB  
2733 C CG1 . ILE B 30  ? 0.6697 0.6677 0.7175 -0.0462 0.0544  -0.0703 56  ILE B CG1 
2734 C CG2 . ILE B 30  ? 0.4904 0.4860 0.5379 -0.0540 0.0602  -0.0767 56  ILE B CG2 
2735 C CD1 . ILE B 30  ? 0.5984 0.5917 0.6338 -0.0456 0.0523  -0.0614 56  ILE B CD1 
2736 N N   . HIS B 31  ? 0.7676 0.7640 0.8383 -0.0573 0.0895  -0.0857 57  HIS B N   
2737 C CA  . HIS B 31  ? 0.8241 0.8175 0.8976 -0.0622 0.0993  -0.0899 57  HIS B CA  
2738 C C   . HIS B 31  ? 0.8172 0.8084 0.9005 -0.0654 0.1095  -0.0965 57  HIS B C   
2739 O O   . HIS B 31  ? 0.8961 0.8789 0.9794 -0.0691 0.1189  -0.0984 57  HIS B O   
2740 C CB  . HIS B 31  ? 0.9339 0.9149 0.9962 -0.0611 0.1032  -0.0813 57  HIS B CB  
2741 C CG  . HIS B 31  ? 0.9738 0.9571 1.0265 -0.0593 0.0947  -0.0753 57  HIS B CG  
2742 N ND1 . HIS B 31  ? 1.0430 1.0248 1.0885 -0.0544 0.0892  -0.0673 57  HIS B ND1 
2743 C CD2 . HIS B 31  ? 1.0442 1.0295 1.0925 -0.0629 0.0898  -0.0765 57  HIS B CD2 
2744 C CE1 . HIS B 31  ? 1.1049 1.0886 1.1426 -0.0554 0.0829  -0.0640 57  HIS B CE1 
2745 N NE2 . HIS B 31  ? 1.1126 1.0969 1.1509 -0.0604 0.0823  -0.0692 57  HIS B NE2 
2746 N N   . GLU B 32  ? 0.7058 0.7037 0.7967 -0.0641 0.1077  -0.1005 58  GLU B N   
2747 C CA  . GLU B 32  ? 0.8099 0.8072 0.9107 -0.0682 0.1170  -0.1080 58  GLU B CA  
2748 C C   . GLU B 32  ? 1.0191 1.0318 1.1318 -0.0678 0.1112  -0.1189 58  GLU B C   
2749 O O   . GLU B 32  ? 1.0513 1.0708 1.1629 -0.0652 0.0972  -0.1206 58  GLU B O   
2750 C CB  . GLU B 32  ? 0.7797 0.7631 0.8748 -0.0662 0.1242  -0.1001 58  GLU B CB  
2751 C CG  . GLU B 32  ? 0.8857 0.8530 0.9686 -0.0641 0.1295  -0.0903 58  GLU B CG  
2752 C CD  . GLU B 32  ? 1.0621 1.0165 1.1394 -0.0609 0.1369  -0.0831 58  GLU B CD  
2753 O OE1 . GLU B 32  ? 1.1046 1.0488 1.1715 -0.0561 0.1379  -0.0734 58  GLU B OE1 
2754 O OE2 . GLU B 32  ? 1.1952 1.1504 1.2785 -0.0629 0.1418  -0.0875 58  GLU B OE2 
2755 N N   . ALA B 33  ? 1.0923 1.1065 1.2146 -0.0715 0.1191  -0.1255 59  ALA B N   
2756 C CA  . ALA B 33  ? 1.1919 1.2206 1.3266 -0.0712 0.1141  -0.1375 59  ALA B CA  
2757 C C   . ALA B 33  ? 1.1891 1.2204 1.3218 -0.0648 0.1055  -0.1323 59  ALA B C   
2758 O O   . ALA B 33  ? 1.2090 1.2512 1.3511 -0.0637 0.0989  -0.1407 59  ALA B O   
2759 C CB  . ALA B 33  ? 1.2438 1.2740 1.3900 -0.0784 0.1269  -0.1472 59  ALA B CB  
2760 N N   . GLY B 34  ? 1.1471 1.1684 1.2678 -0.0612 0.1046  -0.1184 60  GLY B N   
2761 C CA  . GLY B 34  ? 1.1465 1.1695 1.2642 -0.0555 0.0973  -0.1127 60  GLY B CA  
2762 C C   . GLY B 34  ? 1.1140 1.1365 1.2377 -0.0573 0.1041  -0.1149 60  GLY B C   
2763 O O   . GLY B 34  ? 1.0495 1.0606 1.1705 -0.0611 0.1158  -0.1127 60  GLY B O   
2764 N N   . TYR B 35  ? 1.0965 1.1296 1.2271 -0.0540 0.0969  -0.1198 61  TYR B N   
2765 C CA  . TYR B 35  ? 1.0810 1.1155 1.2181 -0.0559 0.1027  -0.1234 61  TYR B CA  
2766 C C   . TYR B 35  ? 1.1652 1.2157 1.3190 -0.0578 0.1007  -0.1396 61  TYR B C   
2767 O O   . TYR B 35  ? 1.2420 1.3023 1.3997 -0.0530 0.0882  -0.1455 61  TYR B O   
2768 C CB  . TYR B 35  ? 1.0132 1.0460 1.1438 -0.0503 0.0967  -0.1148 61  TYR B CB  
2769 C CG  . TYR B 35  ? 0.9768 0.9947 1.0916 -0.0480 0.0993  -0.1001 61  TYR B CG  
2770 C CD1 . TYR B 35  ? 0.9214 0.9382 1.0268 -0.0432 0.0903  -0.0918 61  TYR B CD1 
2771 C CD2 . TYR B 35  ? 0.9976 1.0023 1.1064 -0.0501 0.1109  -0.0952 61  TYR B CD2 
2772 C CE1 . TYR B 35  ? 0.8999 0.9051 0.9920 -0.0407 0.0922  -0.0797 61  TYR B CE1 
2773 C CE2 . TYR B 35  ? 1.0321 1.0242 1.1269 -0.0463 0.1125  -0.0826 61  TYR B CE2 
2774 C CZ  . TYR B 35  ? 1.0006 0.9940 1.0878 -0.0417 0.1028  -0.0752 61  TYR B CZ  
2775 O OH  . TYR B 35  ? 1.0021 0.9852 1.0768 -0.0376 0.1041  -0.0639 61  TYR B OH  
2776 N N   . SER B 36  ? 1.1424 1.1933 1.3045 -0.0645 0.1124  -0.1475 62  SER B N   
2777 C CA  . SER B 36  ? 1.1221 1.1897 1.3016 -0.0670 0.1119  -0.1643 62  SER B CA  
2778 C C   . SER B 36  ? 1.0170 1.0927 1.2022 -0.0633 0.1066  -0.1670 62  SER B C   
2779 O O   . SER B 36  ? 0.9606 1.0277 1.1361 -0.0602 0.1058  -0.1558 62  SER B O   
2780 C CB  . SER B 36  ? 1.1346 1.1995 1.3208 -0.0767 0.1277  -0.1728 62  SER B CB  
2781 O OG  . SER B 36  ? 1.1236 1.1734 1.3018 -0.0797 0.1390  -0.1655 62  SER B OG  
2782 N N   . GLU B 37  ? 1.0187 1.1112 1.2196 -0.0633 0.1028  -0.1827 63  GLU B N   
2783 C CA  . GLU B 37  ? 0.9971 1.0991 1.2055 -0.0598 0.0976  -0.1874 63  GLU B CA  
2784 C C   . GLU B 37  ? 0.8745 0.9685 1.0808 -0.0652 0.1104  -0.1836 63  GLU B C   
2785 O O   . GLU B 37  ? 0.8941 0.9879 1.0979 -0.0616 0.1069  -0.1792 63  GLU B O   
2786 C CB  . GLU B 37  ? 1.2307 1.3523 1.4575 -0.0598 0.0918  -0.2065 63  GLU B CB  
2787 C CG  . GLU B 37  ? 1.5095 1.6374 1.7363 -0.0541 0.0742  -0.2091 63  GLU B CG  
2788 C CD  . GLU B 37  ? 1.7065 1.8299 1.9234 -0.0448 0.0591  -0.1992 63  GLU B CD  
2789 O OE1 . GLU B 37  ? 1.7393 1.8608 1.9548 -0.0424 0.0605  -0.1948 63  GLU B OE1 
2790 O OE2 . GLU B 37  ? 1.7931 1.9145 2.0030 -0.0402 0.0462  -0.1960 63  GLU B OE2 
2791 N N   . GLU B 38  ? 0.8420 0.9277 1.0477 -0.0739 0.1255  -0.1856 64  GLU B N   
2792 C CA  . GLU B 38  ? 0.8258 0.9001 1.0266 -0.0791 0.1388  -0.1826 64  GLU B CA  
2793 C C   . GLU B 38  ? 0.7614 0.8166 0.9424 -0.0747 0.1391  -0.1637 64  GLU B C   
2794 O O   . GLU B 38  ? 0.7291 0.7796 0.9052 -0.0735 0.1415  -0.1589 64  GLU B O   
2795 C CB  . GLU B 38  ? 0.9174 0.9853 1.1212 -0.0893 0.1553  -0.1901 64  GLU B CB  
2796 C CG  . GLU B 38  ? 1.0721 1.1276 1.2707 -0.0950 0.1704  -0.1889 64  GLU B CG  
2797 C CD  . GLU B 38  ? 1.2142 1.2847 1.4254 -0.0959 0.1692  -0.1996 64  GLU B CD  
2798 O OE1 . GLU B 38  ? 1.1753 1.2674 1.4027 -0.0937 0.1591  -0.2119 64  GLU B OE1 
2799 O OE2 . GLU B 38  ? 1.3239 1.3846 1.5285 -0.0982 0.1784  -0.1960 64  GLU B OE2 
2800 N N   . GLU B 39  ? 0.7499 0.7951 0.9200 -0.0723 0.1366  -0.1536 65  GLU B N   
2801 C CA  . GLU B 39  ? 0.7429 0.7721 0.8951 -0.0673 0.1357  -0.1365 65  GLU B CA  
2802 C C   . GLU B 39  ? 0.7926 0.8288 0.9428 -0.0598 0.1228  -0.1312 65  GLU B C   
2803 O O   . GLU B 39  ? 0.8174 0.8455 0.9579 -0.0570 0.1242  -0.1220 65  GLU B O   
2804 C CB  . GLU B 39  ? 0.7026 0.7229 0.8457 -0.0660 0.1343  -0.1289 65  GLU B CB  
2805 C CG  . GLU B 39  ? 0.9094 0.9178 1.0505 -0.0727 0.1485  -0.1312 65  GLU B CG  
2806 C CD  . GLU B 39  ? 1.0782 1.0788 1.2111 -0.0712 0.1466  -0.1243 65  GLU B CD  
2807 O OE1 . GLU B 39  ? 1.1320 1.1442 1.2718 -0.0711 0.1385  -0.1299 65  GLU B OE1 
2808 O OE2 . GLU B 39  ? 1.0997 1.0829 1.2193 -0.0696 0.1533  -0.1137 65  GLU B OE2 
2809 N N   . CYS B 40  ? 0.8191 0.8701 0.9781 -0.0563 0.1102  -0.1374 66  CYS B N   
2810 C CA  . CYS B 40  ? 0.8187 0.8762 0.9766 -0.0492 0.0979  -0.1340 66  CYS B CA  
2811 C C   . CYS B 40  ? 0.8166 0.8771 0.9785 -0.0499 0.1014  -0.1369 66  CYS B C   
2812 O O   . CYS B 40  ? 0.9244 0.9806 1.0777 -0.0459 0.0981  -0.1280 66  CYS B O   
2813 C CB  . CYS B 40  ? 0.8038 0.8759 0.9718 -0.0449 0.0850  -0.1432 66  CYS B CB  
2814 S SG  . CYS B 40  ? 0.7857 0.8532 0.9454 -0.0424 0.0782  -0.1382 66  CYS B SG  
2815 N N   . LYS B 41  ? 0.6227 0.6914 0.7979 -0.0554 0.1084  -0.1502 67  LYS B N   
2816 C CA  . LYS B 41  ? 0.5998 0.6723 0.7800 -0.0571 0.1131  -0.1548 67  LYS B CA  
2817 C C   . LYS B 41  ? 0.6761 0.7314 0.8405 -0.0579 0.1222  -0.1420 67  LYS B C   
2818 O O   . LYS B 41  ? 0.6111 0.6673 0.7735 -0.0560 0.1218  -0.1400 67  LYS B O   
2819 C CB  . LYS B 41  ? 0.7594 0.8415 0.9552 -0.0648 0.1224  -0.1712 67  LYS B CB  
2820 C CG  . LYS B 41  ? 0.8560 0.9580 1.0693 -0.0630 0.1129  -0.1861 67  LYS B CG  
2821 C CD  . LYS B 41  ? 0.9724 1.0854 1.2020 -0.0712 0.1231  -0.2035 67  LYS B CD  
2822 C CE  . LYS B 41  ? 1.0371 1.1715 1.2846 -0.0682 0.1130  -0.2194 67  LYS B CE  
2823 N NZ  . LYS B 41  ? 1.0599 1.2076 1.3247 -0.0765 0.1231  -0.2379 67  LYS B NZ  
2824 N N   . GLN B 42  ? 0.7731 0.8129 0.9260 -0.0599 0.1303  -0.1338 68  GLN B N   
2825 C CA  . GLN B 42  ? 0.7435 0.7660 0.8805 -0.0592 0.1391  -0.1217 68  GLN B CA  
2826 C C   . GLN B 42  ? 0.6089 0.6296 0.7352 -0.0512 0.1292  -0.1094 68  GLN B C   
2827 O O   . GLN B 42  ? 0.6844 0.6983 0.8018 -0.0494 0.1334  -0.1027 68  GLN B O   
2828 C CB  . GLN B 42  ? 0.8425 0.8489 0.9699 -0.0614 0.1483  -0.1157 68  GLN B CB  
2829 C CG  . GLN B 42  ? 0.9781 0.9852 1.1153 -0.0699 0.1590  -0.1279 68  GLN B CG  
2830 C CD  . GLN B 42  ? 1.1171 1.1230 1.2586 -0.0763 0.1718  -0.1360 68  GLN B CD  
2831 O OE1 . GLN B 42  ? 1.0788 1.0774 1.2114 -0.0743 0.1757  -0.1295 68  GLN B OE1 
2832 N NE2 . GLN B 42  ? 1.2100 1.2236 1.3651 -0.0843 0.1789  -0.1507 68  GLN B NE2 
2833 N N   . TYR B 43  ? 0.6155 0.6425 0.7422 -0.0467 0.1165  -0.1070 69  TYR B N   
2834 C CA  . TYR B 43  ? 0.6139 0.6396 0.7305 -0.0400 0.1072  -0.0962 69  TYR B CA  
2835 C C   . TYR B 43  ? 0.5036 0.5417 0.6272 -0.0371 0.0987  -0.1007 69  TYR B C   
2836 O O   . TYR B 43  ? 0.4599 0.4991 0.5771 -0.0319 0.0899  -0.0939 69  TYR B O   
2837 C CB  . TYR B 43  ? 0.5827 0.6078 0.6950 -0.0369 0.0987  -0.0912 69  TYR B CB  
2838 C CG  . TYR B 43  ? 0.5192 0.5312 0.6225 -0.0384 0.1061  -0.0848 69  TYR B CG  
2839 C CD1 . TYR B 43  ? 0.5164 0.5277 0.6264 -0.0436 0.1121  -0.0920 69  TYR B CD1 
2840 C CD2 . TYR B 43  ? 0.4882 0.4893 0.5770 -0.0343 0.1071  -0.0721 69  TYR B CD2 
2841 C CE1 . TYR B 43  ? 0.6526 0.6512 0.7545 -0.0448 0.1191  -0.0865 69  TYR B CE1 
2842 C CE2 . TYR B 43  ? 0.5763 0.5655 0.6575 -0.0347 0.1137  -0.0667 69  TYR B CE2 
2843 C CZ  . TYR B 43  ? 0.7221 0.7093 0.8095 -0.0400 0.1198  -0.0738 69  TYR B CZ  
2844 O OH  . TYR B 43  ? 0.8103 0.7851 0.8901 -0.0403 0.1267  -0.0687 69  TYR B OH  
2845 N N   . LYS B 44  ? 0.4767 0.5241 0.6135 -0.0407 0.1017  -0.1128 70  LYS B N   
2846 C CA  . LYS B 44  ? 0.4084 0.4678 0.5531 -0.0379 0.0939  -0.1186 70  LYS B CA  
2847 C C   . LYS B 44  ? 0.4742 0.5282 0.6083 -0.0354 0.0956  -0.1097 70  LYS B C   
2848 O O   . LYS B 44  ? 0.6903 0.7490 0.8226 -0.0305 0.0861  -0.1069 70  LYS B O   
2849 C CB  . LYS B 44  ? 0.3538 0.4249 0.5154 -0.0425 0.0982  -0.1343 70  LYS B CB  
2850 C CG  . LYS B 44  ? 0.3815 0.4668 0.5539 -0.0388 0.0889  -0.1424 70  LYS B CG  
2851 C CD  . LYS B 44  ? 0.6661 0.7641 0.8561 -0.0436 0.0938  -0.1590 70  LYS B CD  
2852 C CE  . LYS B 44  ? 0.8413 0.9535 1.0425 -0.0390 0.0842  -0.1676 70  LYS B CE  
2853 N NZ  . LYS B 44  ? 1.0037 1.1298 1.2228 -0.0437 0.0896  -0.1846 70  LYS B NZ  
2854 N N   . ALA B 45  ? 0.3332 0.3766 0.4596 -0.0385 0.1080  -0.1055 71  ALA B N   
2855 C CA  . ALA B 45  ? 0.4374 0.4757 0.5533 -0.0359 0.1106  -0.0975 71  ALA B CA  
2856 C C   . ALA B 45  ? 0.5493 0.5818 0.6513 -0.0296 0.1038  -0.0841 71  ALA B C   
2857 O O   . ALA B 45  ? 0.5951 0.6307 0.6925 -0.0258 0.0987  -0.0799 71  ALA B O   
2858 C CB  . ALA B 45  ? 0.4473 0.4741 0.5568 -0.0401 0.1261  -0.0961 71  ALA B CB  
2859 N N   . VAL B 46  ? 0.5039 0.5284 0.5996 -0.0289 0.1041  -0.0782 72  VAL B N   
2860 C CA  . VAL B 46  ? 0.4985 0.5181 0.5816 -0.0235 0.0985  -0.0664 72  VAL B CA  
2861 C C   . VAL B 46  ? 0.5052 0.5346 0.5916 -0.0204 0.0849  -0.0673 72  VAL B C   
2862 O O   . VAL B 46  ? 0.3871 0.4158 0.4645 -0.0162 0.0795  -0.0594 72  VAL B O   
2863 C CB  . VAL B 46  ? 0.3946 0.4033 0.4708 -0.0236 0.1029  -0.0607 72  VAL B CB  
2864 C CG1 . VAL B 46  ? 0.7099 0.7232 0.7954 -0.0267 0.0989  -0.0678 72  VAL B CG1 
2865 C CG2 . VAL B 46  ? 0.4292 0.4337 0.4927 -0.0177 0.0983  -0.0490 72  VAL B CG2 
2866 N N   . VAL B 47  ? 0.5149 0.5535 0.6141 -0.0222 0.0797  -0.0776 73  VAL B N   
2867 C CA  . VAL B 47  ? 0.3240 0.3708 0.4264 -0.0187 0.0674  -0.0796 73  VAL B CA  
2868 C C   . VAL B 47  ? 0.3298 0.3825 0.4332 -0.0164 0.0641  -0.0807 73  VAL B C   
2869 O O   . VAL B 47  ? 0.3443 0.3979 0.4415 -0.0127 0.0572  -0.0756 73  VAL B O   
2870 C CB  . VAL B 47  ? 0.3180 0.3730 0.4339 -0.0196 0.0623  -0.0908 73  VAL B CB  
2871 C CG1 . VAL B 47  ? 0.2940 0.3564 0.4135 -0.0148 0.0500  -0.0941 73  VAL B CG1 
2872 C CG2 . VAL B 47  ? 0.3026 0.3528 0.4164 -0.0211 0.0632  -0.0892 73  VAL B CG2 
2873 N N   . TYR B 48  ? 0.3112 0.3682 0.4228 -0.0191 0.0696  -0.0881 74  TYR B N   
2874 C CA  . TYR B 48  ? 0.4432 0.5057 0.5560 -0.0175 0.0680  -0.0897 74  TYR B CA  
2875 C C   . TYR B 48  ? 0.4758 0.5316 0.5738 -0.0152 0.0707  -0.0780 74  TYR B C   
2876 O O   . TYR B 48  ? 0.5819 0.6416 0.6765 -0.0119 0.0646  -0.0756 74  TYR B O   
2877 C CB  . TYR B 48  ? 0.6352 0.7025 0.7583 -0.0217 0.0759  -0.0994 74  TYR B CB  
2878 C CG  . TYR B 48  ? 0.6664 0.7443 0.8065 -0.0231 0.0720  -0.1132 74  TYR B CG  
2879 C CD1 . TYR B 48  ? 0.4669 0.5517 0.6128 -0.0185 0.0595  -0.1171 74  TYR B CD1 
2880 C CD2 . TYR B 48  ? 0.6816 0.7628 0.8319 -0.0286 0.0810  -0.1229 74  TYR B CD2 
2881 C CE1 . TYR B 48  ? 0.4739 0.5689 0.6353 -0.0181 0.0550  -0.1300 74  TYR B CE1 
2882 C CE2 . TYR B 48  ? 0.6818 0.7748 0.8486 -0.0294 0.0770  -0.1366 74  TYR B CE2 
2883 C CZ  . TYR B 48  ? 0.5797 0.6799 0.7521 -0.0235 0.0635  -0.1400 74  TYR B CZ  
2884 O OH  . TYR B 48  ? 0.5015 0.6140 0.6903 -0.0227 0.0586  -0.1540 74  TYR B OH  
2885 N N   . SER B 49  ? 0.3380 0.3840 0.4274 -0.0163 0.0797  -0.0713 75  SER B N   
2886 C CA  . SER B 49  ? 0.4069 0.4469 0.4822 -0.0129 0.0823  -0.0604 75  SER B CA  
2887 C C   . SER B 49  ? 0.4893 0.5306 0.5576 -0.0087 0.0729  -0.0537 75  SER B C   
2888 O O   . SER B 49  ? 0.5705 0.6159 0.6339 -0.0057 0.0690  -0.0503 75  SER B O   
2889 C CB  . SER B 49  ? 0.5457 0.5734 0.6129 -0.0136 0.0931  -0.0546 75  SER B CB  
2890 O OG  . SER B 49  ? 0.5752 0.6004 0.6465 -0.0178 0.1036  -0.0603 75  SER B OG  
2891 N N   . ASN B 50  ? 0.4491 0.4873 0.5171 -0.0090 0.0698  -0.0524 76  ASN B N   
2892 C CA  . ASN B 50  ? 0.5352 0.5744 0.5967 -0.0061 0.0618  -0.0468 76  ASN B CA  
2893 C C   . ASN B 50  ? 0.5247 0.5723 0.5897 -0.0047 0.0528  -0.0506 76  ASN B C   
2894 O O   . ASN B 50  ? 0.6896 0.7393 0.7475 -0.0021 0.0489  -0.0456 76  ASN B O   
2895 C CB  . ASN B 50  ? 0.4026 0.4381 0.4651 -0.0075 0.0601  -0.0470 76  ASN B CB  
2896 C CG  . ASN B 50  ? 0.4276 0.4534 0.4840 -0.0079 0.0683  -0.0415 76  ASN B CG  
2897 O OD1 . ASN B 50  ? 0.4631 0.4854 0.5217 -0.0100 0.0693  -0.0430 76  ASN B OD1 
2898 N ND2 . ASN B 50  ? 0.4821 0.5035 0.5308 -0.0054 0.0743  -0.0354 76  ASN B ND2 
2899 N N   . THR B 51  ? 0.3003 0.3532 0.3769 -0.0060 0.0497  -0.0601 77  THR B N   
2900 C CA  . THR B 51  ? 0.3411 0.4008 0.4219 -0.0039 0.0413  -0.0647 77  THR B CA  
2901 C C   . THR B 51  ? 0.4394 0.5024 0.5156 -0.0024 0.0421  -0.0619 77  THR B C   
2902 O O   . THR B 51  ? 0.4723 0.5372 0.5430 -0.0003 0.0369  -0.0588 77  THR B O   
2903 C CB  . THR B 51  ? 0.3093 0.3750 0.4046 -0.0045 0.0387  -0.0762 77  THR B CB  
2904 O OG1 . THR B 51  ? 0.1874 0.2514 0.2874 -0.0054 0.0374  -0.0795 77  THR B OG1 
2905 C CG2 . THR B 51  ? 0.4329 0.5037 0.5319 -0.0010 0.0295  -0.0808 77  THR B CG2 
2906 N N   . ILE B 52  ? 0.3122 0.3760 0.3905 -0.0039 0.0493  -0.0636 78  ILE B N   
2907 C CA  . ILE B 52  ? 0.3366 0.4040 0.4107 -0.0026 0.0509  -0.0616 78  ILE B CA  
2908 C C   . ILE B 52  ? 0.5480 0.6129 0.6088 0.0001  0.0510  -0.0512 78  ILE B C   
2909 O O   . ILE B 52  ? 0.5582 0.6281 0.6153 0.0021  0.0465  -0.0497 78  ILE B O   
2910 C CB  . ILE B 52  ? 0.3310 0.3979 0.4078 -0.0050 0.0605  -0.0642 78  ILE B CB  
2911 C CG1 . ILE B 52  ? 0.4328 0.5041 0.5244 -0.0081 0.0609  -0.0759 78  ILE B CG1 
2912 C CG2 . ILE B 52  ? 0.2957 0.3670 0.3680 -0.0034 0.0619  -0.0626 78  ILE B CG2 
2913 C CD1 . ILE B 52  ? 0.4299 0.5003 0.5248 -0.0117 0.0716  -0.0798 78  ILE B CD1 
2914 N N   . GLN B 53  ? 0.6001 0.6576 0.6541 0.0004  0.0564  -0.0447 79  GLN B N   
2915 C CA  . GLN B 53  ? 0.4647 0.5206 0.5070 0.0039  0.0563  -0.0354 79  GLN B CA  
2916 C C   . GLN B 53  ? 0.4377 0.4982 0.4779 0.0049  0.0475  -0.0345 79  GLN B C   
2917 O O   . GLN B 53  ? 0.5423 0.6073 0.5757 0.0074  0.0455  -0.0302 79  GLN B O   
2918 C CB  . GLN B 53  ? 0.4826 0.5293 0.5200 0.0044  0.0620  -0.0299 79  GLN B CB  
2919 C CG  . GLN B 53  ? 0.7328 0.7730 0.7700 0.0036  0.0724  -0.0299 79  GLN B CG  
2920 C CD  . GLN B 53  ? 0.8855 0.9153 0.9193 0.0035  0.0782  -0.0261 79  GLN B CD  
2921 O OE1 . GLN B 53  ? 0.8775 0.9060 0.9124 0.0027  0.0741  -0.0257 79  GLN B OE1 
2922 N NE2 . GLN B 53  ? 0.9016 0.9235 0.9308 0.0042  0.0883  -0.0235 79  GLN B NE2 
2923 N N   . SER B 54  ? 0.3396 0.3992 0.3856 0.0028  0.0428  -0.0390 80  SER B N   
2924 C CA  . SER B 54  ? 0.1985 0.2605 0.2421 0.0032  0.0355  -0.0387 80  SER B CA  
2925 C C   . SER B 54  ? 0.4269 0.4960 0.4720 0.0040  0.0312  -0.0422 80  SER B C   
2926 O O   . SER B 54  ? 0.6007 0.6736 0.6393 0.0050  0.0289  -0.0389 80  SER B O   
2927 C CB  . SER B 54  ? 0.2541 0.3129 0.3035 0.0016  0.0319  -0.0432 80  SER B CB  
2928 O OG  . SER B 54  ? 0.4119 0.4646 0.4601 0.0004  0.0360  -0.0404 80  SER B OG  
2929 N N   . ILE B 55  ? 0.4569 0.5284 0.5113 0.0035  0.0301  -0.0498 81  ILE B N   
2930 C CA  . ILE B 55  ? 0.4519 0.5295 0.5089 0.0045  0.0261  -0.0541 81  ILE B CA  
2931 C C   . ILE B 55  ? 0.4394 0.5220 0.4902 0.0053  0.0296  -0.0502 81  ILE B C   
2932 O O   . ILE B 55  ? 0.4567 0.5447 0.5052 0.0060  0.0264  -0.0508 81  ILE B O   
2933 C CB  . ILE B 55  ? 0.3756 0.4554 0.4449 0.0045  0.0244  -0.0636 81  ILE B CB  
2934 C CG1 . ILE B 55  ? 0.2035 0.2890 0.2755 0.0059  0.0202  -0.0683 81  ILE B CG1 
2935 C CG2 . ILE B 55  ? 0.3590 0.4392 0.4324 0.0027  0.0318  -0.0652 81  ILE B CG2 
2936 C CD1 . ILE B 55  ? 0.1839 0.2675 0.2526 0.0076  0.0136  -0.0683 81  ILE B CD1 
2937 N N   . ILE B 56  ? 0.4048 0.4854 0.4529 0.0055  0.0363  -0.0465 82  ILE B N   
2938 C CA  . ILE B 56  ? 0.3316 0.4165 0.3730 0.0074  0.0400  -0.0422 82  ILE B CA  
2939 C C   . ILE B 56  ? 0.3175 0.4053 0.3495 0.0096  0.0375  -0.0355 82  ILE B C   
2940 O O   . ILE B 56  ? 0.2144 0.3100 0.2433 0.0108  0.0354  -0.0354 82  ILE B O   
2941 C CB  . ILE B 56  ? 0.3145 0.3946 0.3538 0.0079  0.0486  -0.0391 82  ILE B CB  
2942 C CG1 . ILE B 56  ? 0.4081 0.4890 0.4565 0.0053  0.0522  -0.0468 82  ILE B CG1 
2943 C CG2 . ILE B 56  ? 0.1623 0.2455 0.1915 0.0117  0.0519  -0.0322 82  ILE B CG2 
2944 C CD1 . ILE B 56  ? 0.4525 0.5283 0.4981 0.0050  0.0621  -0.0445 82  ILE B CD1 
2945 N N   . ALA B 57  ? 0.4900 0.5724 0.5181 0.0101  0.0377  -0.0308 83  ALA B N   
2946 C CA  . ALA B 57  ? 0.3954 0.4814 0.4159 0.0120  0.0353  -0.0254 83  ALA B CA  
2947 C C   . ALA B 57  ? 0.3261 0.4185 0.3473 0.0101  0.0291  -0.0291 83  ALA B C   
2948 O O   . ALA B 57  ? 0.3887 0.4889 0.4049 0.0113  0.0275  -0.0271 83  ALA B O   
2949 C CB  . ALA B 57  ? 0.3051 0.3841 0.3235 0.0118  0.0360  -0.0216 83  ALA B CB  
2950 N N   . ILE B 58  ? 0.3841 0.4733 0.4116 0.0075  0.0260  -0.0351 84  ILE B N   
2951 C CA  . ILE B 58  ? 0.3927 0.4857 0.4211 0.0059  0.0210  -0.0393 84  ILE B CA  
2952 C C   . ILE B 58  ? 0.3383 0.4394 0.3679 0.0065  0.0207  -0.0426 84  ILE B C   
2953 O O   . ILE B 58  ? 0.4884 0.5958 0.5147 0.0057  0.0185  -0.0433 84  ILE B O   
2954 C CB  . ILE B 58  ? 0.3794 0.4662 0.4147 0.0048  0.0178  -0.0451 84  ILE B CB  
2955 C CG1 . ILE B 58  ? 0.2889 0.3684 0.3226 0.0039  0.0180  -0.0422 84  ILE B CG1 
2956 C CG2 . ILE B 58  ? 0.1986 0.2865 0.2334 0.0037  0.0128  -0.0492 84  ILE B CG2 
2957 C CD1 . ILE B 58  ? 0.4568 0.5292 0.4957 0.0035  0.0131  -0.0475 84  ILE B CD1 
2958 N N   . ILE B 59  ? 0.3576 0.4589 0.3922 0.0073  0.0234  -0.0452 85  ILE B N   
2959 C CA  . ILE B 59  ? 0.4530 0.5621 0.4891 0.0077  0.0237  -0.0487 85  ILE B CA  
2960 C C   . ILE B 59  ? 0.4883 0.6056 0.5162 0.0096  0.0255  -0.0434 85  ILE B C   
2961 O O   . ILE B 59  ? 0.5828 0.7084 0.6094 0.0092  0.0235  -0.0457 85  ILE B O   
2962 C CB  . ILE B 59  ? 0.4891 0.5973 0.5319 0.0079  0.0274  -0.0524 85  ILE B CB  
2963 C CG1 . ILE B 59  ? 0.3831 0.4863 0.4361 0.0068  0.0246  -0.0595 85  ILE B CG1 
2964 C CG2 . ILE B 59  ? 0.4341 0.5509 0.4773 0.0083  0.0285  -0.0555 85  ILE B CG2 
2965 C CD1 . ILE B 59  ? 0.4063 0.5113 0.4634 0.0070  0.0186  -0.0654 85  ILE B CD1 
2966 N N   . ARG B 60  ? 0.5124 0.6275 0.5351 0.0120  0.0293  -0.0367 86  ARG B N   
2967 C CA  . ARG B 60  ? 0.5148 0.6380 0.5298 0.0155  0.0306  -0.0314 86  ARG B CA  
2968 C C   . ARG B 60  ? 0.5390 0.6694 0.5512 0.0145  0.0260  -0.0315 86  ARG B C   
2969 O O   . ARG B 60  ? 0.4612 0.6030 0.4709 0.0154  0.0249  -0.0323 86  ARG B O   
2970 C CB  . ARG B 60  ? 0.4920 0.6097 0.5021 0.0192  0.0353  -0.0242 86  ARG B CB  
2971 C CG  . ARG B 60  ? 0.7168 0.8281 0.7282 0.0201  0.0417  -0.0240 86  ARG B CG  
2972 C CD  . ARG B 60  ? 0.8581 0.9695 0.8610 0.0258  0.0474  -0.0167 86  ARG B CD  
2973 N NE  . ARG B 60  ? 0.8688 0.9747 0.8716 0.0260  0.0545  -0.0171 86  ARG B NE  
2974 C CZ  . ARG B 60  ? 0.7704 0.8646 0.7744 0.0248  0.0602  -0.0162 86  ARG B CZ  
2975 N NH1 . ARG B 60  ? 0.7076 0.7947 0.7131 0.0238  0.0591  -0.0146 86  ARG B NH1 
2976 N NH2 . ARG B 60  ? 0.5437 0.6335 0.5473 0.0242  0.0676  -0.0174 86  ARG B NH2 
2977 N N   . ALA B 61  ? 0.5245 0.6488 0.5370 0.0122  0.0237  -0.0311 87  ALA B N   
2978 C CA  . ALA B 61  ? 0.4216 0.5516 0.4315 0.0100  0.0202  -0.0316 87  ALA B CA  
2979 C C   . ALA B 61  ? 0.3869 0.5236 0.3989 0.0070  0.0178  -0.0380 87  ALA B C   
2980 O O   . ALA B 61  ? 0.3528 0.4996 0.3620 0.0058  0.0163  -0.0389 87  ALA B O   
2981 C CB  . ALA B 61  ? 0.4151 0.5357 0.4254 0.0071  0.0188  -0.0313 87  ALA B CB  
2982 N N   . MET B 62  ? 0.4629 0.5945 0.4804 0.0057  0.0175  -0.0431 88  MET B N   
2983 C CA  . MET B 62  ? 0.4573 0.5936 0.4774 0.0033  0.0156  -0.0497 88  MET B CA  
2984 C C   . MET B 62  ? 0.5345 0.6839 0.5526 0.0047  0.0167  -0.0501 88  MET B C   
2985 O O   . MET B 62  ? 0.5629 0.7198 0.5808 0.0022  0.0153  -0.0546 88  MET B O   
2986 C CB  . MET B 62  ? 0.3557 0.4848 0.3836 0.0034  0.0151  -0.0553 88  MET B CB  
2987 C CG  . MET B 62  ? 0.3819 0.4992 0.4125 0.0030  0.0135  -0.0560 88  MET B CG  
2988 S SD  . MET B 62  ? 0.9628 1.0719 1.0034 0.0036  0.0096  -0.0633 88  MET B SD  
2989 C CE  . MET B 62  ? 0.0933 0.2031 0.1323 0.0009  0.0045  -0.0689 88  MET B CE  
2990 N N   . GLY B 63  ? 0.6707 0.8229 0.6869 0.0087  0.0195  -0.0457 89  GLY B N   
2991 C CA  . GLY B 63  ? 0.6361 0.8011 0.6495 0.0111  0.0208  -0.0455 89  GLY B CA  
2992 C C   . GLY B 63  ? 0.6597 0.8355 0.6673 0.0131  0.0199  -0.0417 89  GLY B C   
2993 O O   . GLY B 63  ? 0.9149 1.1044 0.9209 0.0135  0.0193  -0.0440 89  GLY B O   
2994 N N   . ARG B 64  ? 0.5328 0.7035 0.5379 0.0144  0.0199  -0.0367 90  ARG B N   
2995 C CA  . ARG B 64  ? 0.4977 0.6791 0.4985 0.0168  0.0190  -0.0336 90  ARG B CA  
2996 C C   . ARG B 64  ? 0.5810 0.7676 0.5829 0.0110  0.0159  -0.0382 90  ARG B C   
2997 O O   . ARG B 64  ? 0.8767 1.0768 0.8766 0.0117  0.0150  -0.0385 90  ARG B O   
2998 C CB  . ARG B 64  ? 0.6685 0.8424 0.6664 0.0209  0.0209  -0.0266 90  ARG B CB  
2999 C CG  . ARG B 64  ? 0.8669 1.0373 0.8616 0.0273  0.0254  -0.0214 90  ARG B CG  
3000 C CD  . ARG B 64  ? 0.9940 1.1555 0.9858 0.0311  0.0281  -0.0148 90  ARG B CD  
3001 N NE  . ARG B 64  ? 0.9993 1.1446 0.9948 0.0272  0.0290  -0.0152 90  ARG B NE  
3002 C CZ  . ARG B 64  ? 0.8607 0.9997 0.8581 0.0235  0.0268  -0.0157 90  ARG B CZ  
3003 N NH1 . ARG B 64  ? 0.9224 1.0692 0.9185 0.0227  0.0238  -0.0159 90  ARG B NH1 
3004 N NH2 . ARG B 64  ? 0.5862 0.7119 0.5871 0.0206  0.0278  -0.0165 90  ARG B NH2 
3005 N N   . LEU B 65  ? 0.4440 0.6200 0.4489 0.0054  0.0148  -0.0422 91  LEU B N   
3006 C CA  . LEU B 65  ? 0.5157 0.6931 0.5204 -0.0009 0.0130  -0.0464 91  LEU B CA  
3007 C C   . LEU B 65  ? 0.5224 0.7030 0.5289 -0.0052 0.0125  -0.0536 91  LEU B C   
3008 O O   . LEU B 65  ? 0.5763 0.7557 0.5810 -0.0111 0.0119  -0.0578 91  LEU B O   
3009 C CB  . LEU B 65  ? 0.6029 0.7646 0.6074 -0.0039 0.0126  -0.0453 91  LEU B CB  
3010 C CG  . LEU B 65  ? 0.5756 0.7331 0.5784 -0.0009 0.0132  -0.0389 91  LEU B CG  
3011 C CD1 . LEU B 65  ? 0.4280 0.5699 0.4305 -0.0043 0.0128  -0.0387 91  LEU B CD1 
3012 C CD2 . LEU B 65  ? 0.5387 0.7093 0.5390 -0.0006 0.0129  -0.0376 91  LEU B CD2 
3013 N N   . LYS B 66  ? 0.4253 0.6087 0.4342 -0.0024 0.0133  -0.0553 92  LYS B N   
3014 C CA  . LYS B 66  ? 0.4300 0.6164 0.4411 -0.0058 0.0131  -0.0626 92  LYS B CA  
3015 C C   . LYS B 66  ? 0.4330 0.6029 0.4438 -0.0098 0.0120  -0.0670 92  LYS B C   
3016 O O   . LYS B 66  ? 0.5948 0.7622 0.6031 -0.0152 0.0097  -0.0723 92  LYS B O   
3017 C CB  . LYS B 66  ? 0.6891 0.8914 0.6982 -0.0090 0.0128  -0.0663 92  LYS B CB  
3018 C CG  . LYS B 66  ? 0.8706 1.0786 0.8813 -0.0118 0.0131  -0.0738 92  LYS B CG  
3019 C CD  . LYS B 66  ? 0.9836 1.2003 0.9967 -0.0066 0.0142  -0.0731 92  LYS B CD  
3020 C CE  . LYS B 66  ? 0.9287 1.1532 0.9437 -0.0097 0.0147  -0.0811 92  LYS B CE  
3021 N NZ  . LYS B 66  ? 0.7277 0.9614 0.7441 -0.0051 0.0160  -0.0807 92  LYS B NZ  
3022 N N   . ILE B 67  ? 0.3453 0.5021 0.3583 -0.0075 0.0117  -0.0644 93  ILE B N   
3023 C CA  . ILE B 67  ? 0.3758 0.5148 0.3902 -0.0105 0.0067  -0.0671 93  ILE B CA  
3024 C C   . ILE B 67  ? 0.4706 0.6057 0.4925 -0.0078 0.0058  -0.0710 93  ILE B C   
3025 O O   . ILE B 67  ? 0.4452 0.5830 0.4721 -0.0034 0.0089  -0.0691 93  ILE B O   
3026 C CB  . ILE B 67  ? 0.3818 0.5088 0.3945 -0.0102 0.0055  -0.0624 93  ILE B CB  
3027 C CG1 . ILE B 67  ? 0.4563 0.5876 0.4619 -0.0130 0.0068  -0.0590 93  ILE B CG1 
3028 C CG2 . ILE B 67  ? 0.2967 0.4050 0.3094 -0.0125 -0.0004 -0.0652 93  ILE B CG2 
3029 C CD1 . ILE B 67  ? 0.2572 0.3775 0.2607 -0.0131 0.0061  -0.0545 93  ILE B CD1 
3030 N N   . ASP B 68  ? 0.3877 0.5164 0.4104 -0.0107 0.0018  -0.0769 94  ASP B N   
3031 C CA  . ASP B 68  ? 0.2899 0.4161 0.3206 -0.0082 0.0006  -0.0820 94  ASP B CA  
3032 C C   . ASP B 68  ? 0.5166 0.6270 0.5512 -0.0063 -0.0039 -0.0827 94  ASP B C   
3033 O O   . ASP B 68  ? 0.4729 0.5718 0.5024 -0.0077 -0.0070 -0.0797 94  ASP B O   
3034 C CB  . ASP B 68  ? 0.3210 0.4475 0.3511 -0.0115 -0.0016 -0.0887 94  ASP B CB  
3035 C CG  . ASP B 68  ? 0.6977 0.8422 0.7255 -0.0130 0.0026  -0.0895 94  ASP B CG  
3036 O OD1 . ASP B 68  ? 0.8793 1.0358 0.9053 -0.0107 0.0069  -0.0846 94  ASP B OD1 
3037 O OD2 . ASP B 68  ? 0.7921 0.9389 0.8197 -0.0161 0.0017  -0.0954 94  ASP B OD2 
3038 N N   . PHE B 69  ? 0.5457 0.6563 0.5892 -0.0030 -0.0042 -0.0872 95  PHE B N   
3039 C CA  . PHE B 69  ? 0.4415 0.5394 0.4902 -0.0005 -0.0091 -0.0897 95  PHE B CA  
3040 C C   . PHE B 69  ? 0.4360 0.5201 0.4819 -0.0017 -0.0163 -0.0944 95  PHE B C   
3041 O O   . PHE B 69  ? 0.5819 0.6684 0.6266 -0.0037 -0.0165 -0.0985 95  PHE B O   
3042 C CB  . PHE B 69  ? 0.5791 0.6840 0.6394 0.0033  -0.0064 -0.0940 95  PHE B CB  
3043 C CG  . PHE B 69  ? 0.5429 0.6572 0.6051 0.0047  0.0009  -0.0894 95  PHE B CG  
3044 C CD1 . PHE B 69  ? 0.6610 0.7695 0.7239 0.0059  0.0013  -0.0857 95  PHE B CD1 
3045 C CD2 . PHE B 69  ? 0.4590 0.5869 0.5214 0.0050  0.0076  -0.0888 95  PHE B CD2 
3046 C CE1 . PHE B 69  ? 0.6876 0.8027 0.7513 0.0071  0.0086  -0.0815 95  PHE B CE1 
3047 C CE2 . PHE B 69  ? 0.5538 0.6875 0.6158 0.0066  0.0145  -0.0840 95  PHE B CE2 
3048 C CZ  . PHE B 69  ? 0.5740 0.7002 0.6362 0.0072  0.0147  -0.0802 95  PHE B CZ  
3049 N N   . GLY B 70  ? 0.4196 0.4886 0.4636 -0.0003 -0.0221 -0.0940 96  GLY B N   
3050 C CA  . GLY B 70  ? 0.6021 0.6552 0.6425 0.0001  -0.0291 -0.0978 96  GLY B CA  
3051 C C   . GLY B 70  ? 0.7993 0.8559 0.8493 0.0033  -0.0307 -0.1062 96  GLY B C   
3052 O O   . GLY B 70  ? 0.8075 0.8601 0.8549 0.0019  -0.0323 -0.1098 96  GLY B O   
3053 N N   . ASP B 71  ? 0.8829 0.9475 0.9447 0.0075  -0.0295 -0.1091 97  ASP B N   
3054 C CA  . ASP B 71  ? 0.8687 0.9402 0.9416 0.0105  -0.0294 -0.1173 97  ASP B CA  
3055 C C   . ASP B 71  ? 0.6285 0.7191 0.7069 0.0090  -0.0205 -0.1168 97  ASP B C   
3056 O O   . ASP B 71  ? 0.5573 0.6551 0.6381 0.0093  -0.0155 -0.1128 97  ASP B O   
3057 C CB  . ASP B 71  ? 1.0470 1.1147 1.1301 0.0161  -0.0342 -0.1226 97  ASP B CB  
3058 C CG  . ASP B 71  ? 1.2489 1.3240 1.3445 0.0193  -0.0345 -0.1323 97  ASP B CG  
3059 O OD1 . ASP B 71  ? 1.2305 1.3125 1.3260 0.0170  -0.0312 -0.1346 97  ASP B OD1 
3060 O OD2 . ASP B 71  ? 1.3796 1.4545 1.4854 0.0241  -0.0382 -0.1382 97  ASP B OD2 
3061 N N   . SER B 72  ? 0.5870 0.6849 0.6663 0.0074  -0.0184 -0.1209 98  SER B N   
3062 C CA  . SER B 72  ? 0.4891 0.6044 0.5716 0.0062  -0.0103 -0.1205 98  SER B CA  
3063 C C   . SER B 72  ? 0.5656 0.6888 0.6595 0.0091  -0.0064 -0.1237 98  SER B C   
3064 O O   . SER B 72  ? 0.6160 0.7509 0.7103 0.0084  0.0012  -0.1210 98  SER B O   
3065 C CB  . SER B 72  ? 0.6418 0.7630 0.7244 0.0042  -0.0096 -0.1260 98  SER B CB  
3066 O OG  . SER B 72  ? 0.8384 0.9524 0.9282 0.0068  -0.0149 -0.1345 98  SER B OG  
3067 N N   . ALA B 73  ? 0.5965 0.7129 0.6991 0.0126  -0.0115 -0.1296 99  ALA B N   
3068 C CA  . ALA B 73  ? 0.4790 0.6031 0.5937 0.0148  -0.0079 -0.1345 99  ALA B CA  
3069 C C   . ALA B 73  ? 0.4141 0.5391 0.5272 0.0143  -0.0033 -0.1279 99  ALA B C   
3070 O O   . ALA B 73  ? 0.3009 0.4339 0.4213 0.0143  0.0030  -0.1302 99  ALA B O   
3071 C CB  . ALA B 73  ? 0.5062 0.6239 0.6310 0.0191  -0.0155 -0.1435 99  ALA B CB  
3072 N N   . ARG B 74  ? 0.5283 0.6446 0.6316 0.0134  -0.0059 -0.1202 100 ARG B N   
3073 C CA  . ARG B 74  ? 0.4752 0.5909 0.5762 0.0130  -0.0019 -0.1137 100 ARG B CA  
3074 C C   . ARG B 74  ? 0.4901 0.6164 0.5870 0.0111  0.0080  -0.1083 100 ARG B C   
3075 O O   . ARG B 74  ? 0.4701 0.5965 0.5659 0.0104  0.0126  -0.1038 100 ARG B O   
3076 C CB  . ARG B 74  ? 0.2383 0.3422 0.3290 0.0122  -0.0072 -0.1071 100 ARG B CB  
3077 C CG  . ARG B 74  ? 0.3878 0.4784 0.4791 0.0144  -0.0173 -0.1112 100 ARG B CG  
3078 C CD  . ARG B 74  ? 0.4873 0.5755 0.5878 0.0177  -0.0199 -0.1154 100 ARG B CD  
3079 N NE  . ARG B 74  ? 0.5040 0.6031 0.6184 0.0194  -0.0165 -0.1237 100 ARG B NE  
3080 C CZ  . ARG B 74  ? 0.5527 0.6519 0.6756 0.0226  -0.0217 -0.1329 100 ARG B CZ  
3081 N NH1 . ARG B 74  ? 0.3981 0.4855 0.5161 0.0250  -0.0308 -0.1344 100 ARG B NH1 
3082 N NH2 . ARG B 74  ? 0.7910 0.9016 0.9270 0.0235  -0.0176 -0.1409 100 ARG B NH2 
3083 N N   . ALA B 75  ? 0.3807 0.5144 0.4738 0.0098  0.0103  -0.1084 101 ALA B N   
3084 C CA  . ALA B 75  ? 0.4314 0.5735 0.5180 0.0079  0.0175  -0.1029 101 ALA B CA  
3085 C C   . ALA B 75  ? 0.6075 0.7520 0.6999 0.0069  0.0225  -0.1053 101 ALA B C   
3086 O O   . ALA B 75  ? 0.5992 0.7432 0.6852 0.0057  0.0278  -0.0989 101 ALA B O   
3087 C CB  . ALA B 75  ? 0.3807 0.5315 0.4638 0.0070  0.0182  -0.1047 101 ALA B CB  
3088 N N   . ASP B 76  ? 0.6579 0.8045 0.7623 0.0076  0.0210  -0.1151 102 ASP B N   
3089 C CA  . ASP B 76  ? 0.6392 0.7889 0.7510 0.0060  0.0261  -0.1195 102 ASP B CA  
3090 C C   . ASP B 76  ? 0.6270 0.7699 0.7399 0.0055  0.0275  -0.1166 102 ASP B C   
3091 O O   . ASP B 76  ? 0.6138 0.7566 0.7240 0.0030  0.0347  -0.1136 102 ASP B O   
3092 C CB  . ASP B 76  ? 0.7032 0.8573 0.8294 0.0073  0.0230  -0.1319 102 ASP B CB  
3093 C CG  . ASP B 76  ? 0.9096 1.0679 1.0452 0.0051  0.0284  -0.1382 102 ASP B CG  
3094 O OD1 . ASP B 76  ? 0.9130 1.0741 1.0429 0.0018  0.0366  -0.1347 102 ASP B OD1 
3095 O OD2 . ASP B 76  ? 1.0494 1.2081 1.1979 0.0068  0.0247  -0.1470 102 ASP B OD2 
3096 N N   . ASP B 77  ? 0.4809 0.6176 0.5973 0.0079  0.0210  -0.1176 103 ASP B N   
3097 C CA  . ASP B 77  ? 0.3765 0.5074 0.4945 0.0075  0.0216  -0.1155 103 ASP B CA  
3098 C C   . ASP B 77  ? 0.4039 0.5306 0.5090 0.0055  0.0270  -0.1042 103 ASP B C   
3099 O O   . ASP B 77  ? 0.4695 0.5930 0.5748 0.0037  0.0319  -0.1023 103 ASP B O   
3100 C CB  . ASP B 77  ? 0.2473 0.3715 0.3687 0.0111  0.0128  -0.1176 103 ASP B CB  
3101 C CG  . ASP B 77  ? 0.5725 0.6990 0.7074 0.0146  0.0067  -0.1293 103 ASP B CG  
3102 O OD1 . ASP B 77  ? 0.7865 0.9212 0.9291 0.0135  0.0096  -0.1363 103 ASP B OD1 
3103 O OD2 . ASP B 77  ? 0.6371 0.7563 0.7738 0.0185  -0.0012 -0.1318 103 ASP B OD2 
3104 N N   . ALA B 78  ? 0.3923 0.5193 0.4864 0.0060  0.0263  -0.0973 104 ALA B N   
3105 C CA  . ALA B 78  ? 0.2675 0.3915 0.3492 0.0054  0.0304  -0.0867 104 ALA B CA  
3106 C C   . ALA B 78  ? 0.4114 0.5373 0.4899 0.0039  0.0389  -0.0844 104 ALA B C   
3107 O O   . ALA B 78  ? 0.2258 0.3460 0.2998 0.0034  0.0437  -0.0789 104 ALA B O   
3108 C CB  . ALA B 78  ? 0.2164 0.3433 0.2887 0.0063  0.0276  -0.0818 104 ALA B CB  
3109 N N   . ARG B 79  ? 0.3630 0.4963 0.4435 0.0033  0.0412  -0.0888 105 ARG B N   
3110 C CA  . ARG B 79  ? 0.3456 0.4804 0.4230 0.0019  0.0500  -0.0875 105 ARG B CA  
3111 C C   . ARG B 79  ? 0.3889 0.5195 0.4750 -0.0006 0.0546  -0.0925 105 ARG B C   
3112 O O   . ARG B 79  ? 0.4662 0.5913 0.5470 -0.0017 0.0620  -0.0878 105 ARG B O   
3113 C CB  . ARG B 79  ? 0.5182 0.6624 0.5978 0.0013  0.0512  -0.0932 105 ARG B CB  
3114 C CG  . ARG B 79  ? 0.7293 0.8795 0.8041 0.0031  0.0456  -0.0918 105 ARG B CG  
3115 C CD  . ARG B 79  ? 0.7356 0.8953 0.8132 0.0022  0.0473  -0.0981 105 ARG B CD  
3116 N NE  . ARG B 79  ? 0.8584 1.0237 0.9362 0.0032  0.0411  -0.1006 105 ARG B NE  
3117 C CZ  . ARG B 79  ? 1.0131 1.1834 1.0809 0.0042  0.0402  -0.0951 105 ARG B CZ  
3118 N NH1 . ARG B 79  ? 1.0184 1.1890 1.0750 0.0056  0.0443  -0.0864 105 ARG B NH1 
3119 N NH2 . ARG B 79  ? 1.0758 1.2510 1.1448 0.0042  0.0353  -0.0988 105 ARG B NH2 
3120 N N   . GLN B 80  ? 0.3267 0.4601 0.4266 -0.0013 0.0502  -0.1025 106 GLN B N   
3121 C CA  . GLN B 80  ? 0.5230 0.6554 0.6339 -0.0038 0.0537  -0.1096 106 GLN B CA  
3122 C C   . GLN B 80  ? 0.4624 0.5858 0.5691 -0.0044 0.0559  -0.1035 106 GLN B C   
3123 O O   . GLN B 80  ? 0.4041 0.5249 0.5139 -0.0075 0.0632  -0.1057 106 GLN B O   
3124 C CB  . GLN B 80  ? 0.7973 0.9346 0.9233 -0.0024 0.0459  -0.1208 106 GLN B CB  
3125 C CG  . GLN B 80  ? 0.9386 1.0850 1.0717 -0.0021 0.0449  -0.1293 106 GLN B CG  
3126 C CD  . GLN B 80  ? 1.0259 1.1775 1.1636 -0.0063 0.0545  -0.1350 106 GLN B CD  
3127 O OE1 . GLN B 80  ? 0.9031 1.0528 1.0452 -0.0093 0.0603  -0.1375 106 GLN B OE1 
3128 N NE2 . GLN B 80  ? 1.1229 1.2811 1.2595 -0.0069 0.0567  -0.1375 106 GLN B NE2 
3129 N N   . LEU B 81  ? 0.5475 0.6661 0.6473 -0.0018 0.0500  -0.0964 107 LEU B N   
3130 C CA  . LEU B 81  ? 0.5552 0.6654 0.6508 -0.0021 0.0514  -0.0905 107 LEU B CA  
3131 C C   . LEU B 81  ? 0.5658 0.6706 0.6526 -0.0037 0.0617  -0.0840 107 LEU B C   
3132 O O   . LEU B 81  ? 0.6443 0.7445 0.7347 -0.0064 0.0675  -0.0858 107 LEU B O   
3133 C CB  . LEU B 81  ? 0.5054 0.6121 0.5925 0.0007  0.0446  -0.0831 107 LEU B CB  
3134 C CG  . LEU B 81  ? 0.4352 0.5336 0.5172 0.0006  0.0456  -0.0765 107 LEU B CG  
3135 C CD1 . LEU B 81  ? 0.4841 0.5807 0.5773 -0.0010 0.0447  -0.0835 107 LEU B CD1 
3136 C CD2 . LEU B 81  ? 0.4175 0.5140 0.4915 0.0029  0.0393  -0.0702 107 LEU B CD2 
3137 N N   . PHE B 82  ? 0.4859 0.5912 0.5610 -0.0018 0.0642  -0.0766 108 PHE B N   
3138 C CA  . PHE B 82  ? 0.4248 0.5238 0.4894 -0.0016 0.0737  -0.0694 108 PHE B CA  
3139 C C   . PHE B 82  ? 0.3834 0.4824 0.4530 -0.0056 0.0831  -0.0759 108 PHE B C   
3140 O O   . PHE B 82  ? 0.3923 0.4830 0.4569 -0.0071 0.0923  -0.0729 108 PHE B O   
3141 C CB  . PHE B 82  ? 0.4468 0.5485 0.4984 0.0025  0.0732  -0.0612 108 PHE B CB  
3142 C CG  . PHE B 82  ? 0.4670 0.5695 0.5136 0.0057  0.0651  -0.0554 108 PHE B CG  
3143 C CD1 . PHE B 82  ? 0.5084 0.6039 0.5460 0.0084  0.0666  -0.0465 108 PHE B CD1 
3144 C CD2 . PHE B 82  ? 0.3332 0.4430 0.3841 0.0059  0.0566  -0.0593 108 PHE B CD2 
3145 C CE1 . PHE B 82  ? 0.3725 0.4697 0.4061 0.0107  0.0597  -0.0420 108 PHE B CE1 
3146 C CE2 . PHE B 82  ? 0.4275 0.5377 0.4735 0.0079  0.0502  -0.0546 108 PHE B CE2 
3147 C CZ  . PHE B 82  ? 0.2910 0.3955 0.3286 0.0101  0.0517  -0.0462 108 PHE B CZ  
3148 N N   . VAL B 83  ? 0.4469 0.5551 0.5262 -0.0074 0.0812  -0.0853 109 VAL B N   
3149 C CA  . VAL B 83  ? 0.6433 0.7536 0.7292 -0.0119 0.0900  -0.0934 109 VAL B CA  
3150 C C   . VAL B 83  ? 0.6720 0.7784 0.7678 -0.0159 0.0938  -0.0996 109 VAL B C   
3151 O O   . VAL B 83  ? 0.7256 0.8251 0.8179 -0.0193 0.1046  -0.0990 109 VAL B O   
3152 C CB  . VAL B 83  ? 0.7211 0.8434 0.8183 -0.0128 0.0858  -0.1039 109 VAL B CB  
3153 C CG1 . VAL B 83  ? 0.6642 0.7897 0.7700 -0.0181 0.0950  -0.1139 109 VAL B CG1 
3154 C CG2 . VAL B 83  ? 0.8653 0.9924 0.9532 -0.0097 0.0831  -0.0990 109 VAL B CG2 
3155 N N   . LEU B 84  ? 0.5333 0.6440 0.6411 -0.0154 0.0850  -0.1059 110 LEU B N   
3156 C CA  . LEU B 84  ? 0.4624 0.5728 0.5822 -0.0188 0.0870  -0.1139 110 LEU B CA  
3157 C C   . LEU B 84  ? 0.5428 0.6417 0.6546 -0.0194 0.0914  -0.1060 110 LEU B C   
3158 O O   . LEU B 84  ? 0.7193 0.8147 0.8352 -0.0239 0.0998  -0.1102 110 LEU B O   
3159 C CB  . LEU B 84  ? 0.4838 0.6019 0.6171 -0.0163 0.0753  -0.1220 110 LEU B CB  
3160 C CG  . LEU B 84  ? 0.5787 0.7074 0.7201 -0.0146 0.0697  -0.1299 110 LEU B CG  
3161 C CD1 . LEU B 84  ? 0.8039 0.9373 0.9564 -0.0106 0.0576  -0.1365 110 LEU B CD1 
3162 C CD2 . LEU B 84  ? 0.3672 0.5031 0.5181 -0.0192 0.0781  -0.1404 110 LEU B CD2 
3163 N N   . ALA B 85  ? 0.5581 0.6514 0.6588 -0.0152 0.0861  -0.0952 111 ALA B N   
3164 C CA  . ALA B 85  ? 0.6534 0.7358 0.7461 -0.0150 0.0897  -0.0872 111 ALA B CA  
3165 C C   . ALA B 85  ? 0.7385 0.8117 0.8213 -0.0171 0.1029  -0.0826 111 ALA B C   
3166 O O   . ALA B 85  ? 0.6111 0.6759 0.6931 -0.0198 0.1101  -0.0821 111 ALA B O   
3167 C CB  . ALA B 85  ? 0.6640 0.7435 0.7462 -0.0100 0.0820  -0.0769 111 ALA B CB  
3168 N N   . GLY B 86  ? 0.7958 0.8704 0.8704 -0.0156 0.1064  -0.0793 112 GLY B N   
3169 C CA  . GLY B 86  ? 0.7162 0.7813 0.7792 -0.0166 0.1191  -0.0744 112 GLY B CA  
3170 C C   . GLY B 86  ? 0.7312 0.7962 0.8026 -0.0238 0.1295  -0.0848 112 GLY B C   
3171 O O   . GLY B 86  ? 0.8612 0.9159 0.9233 -0.0261 0.1420  -0.0822 112 GLY B O   
3172 N N   . ALA B 87  ? 0.7591 0.8354 0.8479 -0.0271 0.1247  -0.0972 113 ALA B N   
3173 C CA  . ALA B 87  ? 0.8452 0.9248 0.9450 -0.0344 0.1339  -0.1094 113 ALA B CA  
3174 C C   . ALA B 87  ? 0.8263 0.9112 0.9428 -0.0374 0.1301  -0.1195 113 ALA B C   
3175 O O   . ALA B 87  ? 0.8356 0.9316 0.9680 -0.0412 0.1303  -0.1330 113 ALA B O   
3176 C CB  . ALA B 87  ? 0.8756 0.9670 0.9821 -0.0356 0.1331  -0.1174 113 ALA B CB  
3177 N N   . ALA B 88  ? 0.8806 0.9584 0.9937 -0.0353 0.1267  -0.1133 114 ALA B N   
3178 C CA  . ALA B 88  ? 0.9386 1.0214 1.0661 -0.0374 0.1225  -0.1220 114 ALA B CA  
3179 C C   . ALA B 88  ? 0.9384 1.0093 1.0614 -0.0412 0.1321  -0.1195 114 ALA B C   
3180 O O   . ALA B 88  ? 0.8967 0.9542 1.0040 -0.0387 0.1358  -0.1072 114 ALA B O   
3181 C CB  . ALA B 88  ? 0.9741 1.0614 1.1038 -0.0313 0.1073  -0.1188 114 ALA B CB  
3182 N N   . GLU B 89  ? 1.0231 1.0993 1.1604 -0.0470 0.1362  -0.1319 115 GLU B N   
3183 C CA  . GLU B 89  ? 1.2197 1.2857 1.3548 -0.0516 0.1458  -0.1318 115 GLU B CA  
3184 C C   . GLU B 89  ? 1.3049 1.3681 1.4388 -0.0475 0.1366  -0.1260 115 GLU B C   
3185 O O   . GLU B 89  ? 1.4305 1.5050 1.5774 -0.0460 0.1263  -0.1332 115 GLU B O   
3186 C CB  . GLU B 89  ? 1.2787 1.3539 1.4312 -0.0596 0.1528  -0.1487 115 GLU B CB  
3187 C CG  . GLU B 89  ? 1.3316 1.4102 1.4865 -0.0650 0.1633  -0.1563 115 GLU B CG  
3188 C CD  . GLU B 89  ? 1.2933 1.3823 1.4662 -0.0735 0.1707  -0.1742 115 GLU B CD  
3189 O OE1 . GLU B 89  ? 1.2419 1.3365 1.4260 -0.0744 0.1668  -0.1808 115 GLU B OE1 
3190 O OE2 . GLU B 89  ? 1.2246 1.3170 1.4008 -0.0793 0.1806  -0.1823 115 GLU B OE2 
3191 N N   . GLU B 90  ? 1.1841 1.2320 1.3020 -0.0453 0.1405  -0.1131 116 GLU B N   
3192 C CA  . GLU B 90  ? 1.1093 1.1537 1.2247 -0.0418 0.1329  -0.1071 116 GLU B CA  
3193 C C   . GLU B 90  ? 0.9824 1.0327 1.1125 -0.0467 0.1333  -0.1185 116 GLU B C   
3194 O O   . GLU B 90  ? 0.8774 0.9254 1.0124 -0.0535 0.1449  -0.1263 116 GLU B O   
3195 C CB  . GLU B 90  ? 1.1648 1.1918 1.2621 -0.0394 0.1397  -0.0935 116 GLU B CB  
3196 C CG  . GLU B 90  ? 1.2429 1.2573 1.3364 -0.0454 0.1558  -0.0954 116 GLU B CG  
3197 C CD  . GLU B 90  ? 1.3052 1.3020 1.3813 -0.0416 0.1612  -0.0822 116 GLU B CD  
3198 O OE1 . GLU B 90  ? 1.3035 1.2880 1.3759 -0.0459 0.1735  -0.0831 116 GLU B OE1 
3199 O OE2 . GLU B 90  ? 1.3430 1.3386 1.4094 -0.0342 0.1533  -0.0714 116 GLU B OE2 
3200 N N   . GLY B 91  ? 0.9182 0.9759 1.0547 -0.0432 0.1208  -0.1198 117 GLY B N   
3201 C CA  . GLY B 91  ? 0.7995 0.8652 0.9504 -0.0464 0.1191  -0.1310 117 GLY B CA  
3202 C C   . GLY B 91  ? 0.7049 0.7888 0.8735 -0.0459 0.1115  -0.1448 117 GLY B C   
3203 O O   . GLY B 91  ? 0.7032 0.7972 0.8861 -0.0477 0.1091  -0.1565 117 GLY B O   
3204 N N   . PHE B 92  ? 0.6631 0.7515 0.8307 -0.0428 0.1075  -0.1438 118 PHE B N   
3205 C CA  . PHE B 92  ? 0.7063 0.8113 0.8899 -0.0411 0.0996  -0.1565 118 PHE B CA  
3206 C C   . PHE B 92  ? 0.6296 0.7365 0.8078 -0.0350 0.0908  -0.1507 118 PHE B C   
3207 O O   . PHE B 92  ? 0.5568 0.6572 0.7240 -0.0355 0.0964  -0.1432 118 PHE B O   
3208 C CB  . PHE B 92  ? 0.5786 0.6912 0.7740 -0.0480 0.1104  -0.1698 118 PHE B CB  
3209 C CG  . PHE B 92  ? 0.5670 0.6981 0.7808 -0.0460 0.1026  -0.1846 118 PHE B CG  
3210 C CD1 . PHE B 92  ? 0.7970 0.9412 1.0283 -0.0468 0.0993  -0.1989 118 PHE B CD1 
3211 C CD2 . PHE B 92  ? 0.4521 0.5880 0.6660 -0.0427 0.0984  -0.1846 118 PHE B CD2 
3212 C CE1 . PHE B 92  ? 0.7889 0.9505 1.0374 -0.0436 0.0914  -0.2131 118 PHE B CE1 
3213 C CE2 . PHE B 92  ? 0.5061 0.6586 0.7371 -0.0401 0.0910  -0.1986 118 PHE B CE2 
3214 C CZ  . PHE B 92  ? 0.6550 0.8203 0.9034 -0.0401 0.0873  -0.2128 118 PHE B CZ  
3215 N N   . MET B 93  ? 0.5188 0.6341 0.7042 -0.0291 0.0773  -0.1546 119 MET B N   
3216 C CA  . MET B 93  ? 0.3853 0.5027 0.5668 -0.0236 0.0686  -0.1508 119 MET B CA  
3217 C C   . MET B 93  ? 0.4052 0.5372 0.6032 -0.0220 0.0636  -0.1650 119 MET B C   
3218 O O   . MET B 93  ? 0.3941 0.5354 0.6059 -0.0200 0.0575  -0.1760 119 MET B O   
3219 C CB  . MET B 93  ? 0.3973 0.5100 0.5712 -0.0174 0.0569  -0.1426 119 MET B CB  
3220 C CG  . MET B 93  ? 0.4185 0.5325 0.5882 -0.0121 0.0484  -0.1394 119 MET B CG  
3221 S SD  . MET B 93  ? 0.9108 1.0170 1.0693 -0.0061 0.0368  -0.1294 119 MET B SD  
3222 C CE  . MET B 93  ? 0.1117 0.2056 0.2540 -0.0098 0.0458  -0.1152 119 MET B CE  
3223 N N   . THR B 94  ? 0.4677 0.6020 0.6641 -0.0223 0.0661  -0.1652 120 THR B N   
3224 C CA  . THR B 94  ? 0.4083 0.5564 0.6200 -0.0205 0.0617  -0.1785 120 THR B CA  
3225 C C   . THR B 94  ? 0.4005 0.5513 0.6143 -0.0119 0.0463  -0.1790 120 THR B C   
3226 O O   . THR B 94  ? 0.2695 0.4109 0.4707 -0.0082 0.0405  -0.1675 120 THR B O   
3227 C CB  . THR B 94  ? 0.3974 0.5468 0.6060 -0.0239 0.0698  -0.1785 120 THR B CB  
3228 O OG1 . THR B 94  ? 0.7720 0.9359 0.9971 -0.0226 0.0661  -0.1930 120 THR B OG1 
3229 C CG2 . THR B 94  ? 0.2864 0.4273 0.4786 -0.0203 0.0664  -0.1648 120 THR B CG2 
3230 N N   . ALA B 95  ? 0.3908 0.5541 0.6205 -0.0086 0.0400  -0.1927 121 ALA B N   
3231 C CA  . ALA B 95  ? 0.3461 0.5108 0.5783 0.0005  0.0253  -0.1946 121 ALA B CA  
3232 C C   . ALA B 95  ? 0.4792 0.6370 0.6991 0.0030  0.0224  -0.1849 121 ALA B C   
3233 O O   . ALA B 95  ? 0.6082 0.7581 0.8195 0.0085  0.0132  -0.1779 121 ALA B O   
3234 C CB  . ALA B 95  ? 0.3242 0.5039 0.5763 0.0040  0.0198  -0.2121 121 ALA B CB  
3235 N N   . GLU B 96  ? 0.5283 0.6891 0.7471 -0.0012 0.0305  -0.1851 122 GLU B N   
3236 C CA  . GLU B 96  ? 0.6460 0.8025 0.8544 0.0008  0.0284  -0.1775 122 GLU B CA  
3237 C C   . GLU B 96  ? 0.5166 0.6601 0.7060 0.0005  0.0293  -0.1613 122 GLU B C   
3238 O O   . GLU B 96  ? 0.4925 0.6312 0.6737 0.0046  0.0224  -0.1552 122 GLU B O   
3239 C CB  . GLU B 96  ? 0.8360 0.9986 1.0463 -0.0040 0.0377  -0.1811 122 GLU B CB  
3240 C CG  . GLU B 96  ? 1.0890 1.2495 1.2903 -0.0016 0.0351  -0.1753 122 GLU B CG  
3241 C CD  . GLU B 96  ? 1.4825 1.6515 1.6889 -0.0053 0.0425  -0.1819 122 GLU B CD  
3242 O OE1 . GLU B 96  ? 1.6563 1.8332 1.8744 -0.0094 0.0490  -0.1923 122 GLU B OE1 
3243 O OE2 . GLU B 96  ? 1.5886 1.7567 1.7872 -0.0043 0.0421  -0.1773 122 GLU B OE2 
3244 N N   . LEU B 97  ? 0.4108 0.5488 0.5935 -0.0044 0.0380  -0.1550 123 LEU B N   
3245 C CA  . LEU B 97  ? 0.4174 0.5440 0.5830 -0.0045 0.0391  -0.1404 123 LEU B CA  
3246 C C   . LEU B 97  ? 0.4158 0.5375 0.5789 0.0005  0.0285  -0.1373 123 LEU B C   
3247 O O   . LEU B 97  ? 0.2836 0.3988 0.4349 0.0028  0.0247  -0.1281 123 LEU B O   
3248 C CB  . LEU B 97  ? 0.3382 0.4589 0.4981 -0.0099 0.0502  -0.1354 123 LEU B CB  
3249 C CG  . LEU B 97  ? 0.4075 0.5170 0.5502 -0.0094 0.0517  -0.1208 123 LEU B CG  
3250 C CD1 . LEU B 97  ? 0.0294 0.1379 0.1613 -0.0073 0.0505  -0.1133 123 LEU B CD1 
3251 C CD2 . LEU B 97  ? 0.5750 0.6775 0.7123 -0.0141 0.0632  -0.1165 123 LEU B CD2 
3252 N N   . ALA B 98  ? 0.3855 0.5105 0.5596 0.0021  0.0239  -0.1456 124 ALA B N   
3253 C CA  . ALA B 98  ? 0.2099 0.3298 0.3819 0.0074  0.0134  -0.1439 124 ALA B CA  
3254 C C   . ALA B 98  ? 0.3247 0.4425 0.4938 0.0133  0.0037  -0.1438 124 ALA B C   
3255 O O   . ALA B 98  ? 0.3732 0.4816 0.5305 0.0157  -0.0011 -0.1355 124 ALA B O   
3256 C CB  . ALA B 98  ? 0.0842 0.2102 0.2700 0.0092  0.0094  -0.1552 124 ALA B CB  
3257 N N   . GLY B 99  ? 0.3292 0.4552 0.5089 0.0153  0.0013  -0.1535 125 GLY B N   
3258 C CA  . GLY B 99  ? 0.3975 0.5207 0.5750 0.0208  -0.0073 -0.1545 125 GLY B CA  
3259 C C   . GLY B 99  ? 0.4517 0.5698 0.6154 0.0187  -0.0036 -0.1438 125 GLY B C   
3260 O O   . GLY B 99  ? 0.4565 0.5664 0.6115 0.0223  -0.0103 -0.1400 125 GLY B O   
3261 N N   . VAL B 100 ? 0.3924 0.5141 0.5526 0.0128  0.0071  -0.1395 126 VAL B N   
3262 C CA  . VAL B 100 ? 0.3989 0.5174 0.5458 0.0110  0.0109  -0.1296 126 VAL B CA  
3263 C C   . VAL B 100 ? 0.4234 0.5323 0.5575 0.0118  0.0084  -0.1191 126 VAL B C   
3264 O O   . VAL B 100 ? 0.6447 0.7493 0.7715 0.0144  0.0034  -0.1156 126 VAL B O   
3265 C CB  . VAL B 100 ? 0.5060 0.6277 0.6494 0.0054  0.0225  -0.1262 126 VAL B CB  
3266 C CG1 . VAL B 100 ? 0.5026 0.6201 0.6302 0.0046  0.0256  -0.1146 126 VAL B CG1 
3267 C CG2 . VAL B 100 ? 0.4465 0.5777 0.6004 0.0041  0.0258  -0.1360 126 VAL B CG2 
3268 N N   . ILE B 101 ? 0.3924 0.4979 0.5238 0.0093  0.0125  -0.1149 127 ILE B N   
3269 C CA  . ILE B 101 ? 0.4513 0.5485 0.5713 0.0096  0.0111  -0.1055 127 ILE B CA  
3270 C C   . ILE B 101 ? 0.4096 0.5003 0.5281 0.0145  0.0005  -0.1074 127 ILE B C   
3271 O O   . ILE B 101 ? 0.4857 0.5697 0.5925 0.0141  -0.0028 -0.1001 127 ILE B O   
3272 C CB  . ILE B 101 ? 0.4534 0.5477 0.5735 0.0067  0.0161  -0.1031 127 ILE B CB  
3273 C CG1 . ILE B 101 ? 0.3622 0.4580 0.4795 0.0021  0.0272  -0.0998 127 ILE B CG1 
3274 C CG2 . ILE B 101 ? 0.5114 0.5976 0.6208 0.0073  0.0139  -0.0946 127 ILE B CG2 
3275 C CD1 . ILE B 101 ? 0.1952 0.2866 0.3119 -0.0010 0.0334  -0.0975 127 ILE B CD1 
3276 N N   . LYS B 102 ? 0.4109 0.5018 0.5391 0.0172  -0.0065 -0.1164 128 LYS B N   
3277 C CA  . LYS B 102 ? 0.4071 0.4883 0.5310 0.0207  -0.0188 -0.1172 128 LYS B CA  
3278 C C   . LYS B 102 ? 0.4358 0.5125 0.5527 0.0219  -0.0238 -0.1157 128 LYS B C   
3279 O O   . LYS B 102 ? 0.6103 0.6759 0.7150 0.0218  -0.0294 -0.1099 128 LYS B O   
3280 C CB  . LYS B 102 ? 0.5186 0.6029 0.6553 0.0247  -0.0254 -0.1284 128 LYS B CB  
3281 C CG  . LYS B 102 ? 0.6978 0.7704 0.8285 0.0293  -0.0386 -0.1292 128 LYS B CG  
3282 C CD  . LYS B 102 ? 0.8239 0.9015 0.9677 0.0341  -0.0451 -0.1406 128 LYS B CD  
3283 C CE  . LYS B 102 ? 0.8794 0.9437 1.0149 0.0395  -0.0585 -0.1406 128 LYS B CE  
3284 N NZ  . LYS B 102 ? 0.8280 0.8982 0.9759 0.0452  -0.0658 -0.1519 128 LYS B NZ  
3285 N N   . ARG B 103 ? 0.3283 0.4132 0.4527 0.0226  -0.0214 -0.1213 129 ARG B N   
3286 C CA  . ARG B 103 ? 0.3007 0.3823 0.4198 0.0235  -0.0256 -0.1212 129 ARG B CA  
3287 C C   . ARG B 103 ? 0.4117 0.4905 0.5171 0.0197  -0.0215 -0.1111 129 ARG B C   
3288 O O   . ARG B 103 ? 0.4492 0.5211 0.5463 0.0195  -0.0263 -0.1092 129 ARG B O   
3289 C CB  . ARG B 103 ? 0.1947 0.2875 0.3254 0.0245  -0.0225 -0.1296 129 ARG B CB  
3290 C CG  . ARG B 103 ? 0.3669 0.4621 0.5108 0.0294  -0.0293 -0.1413 129 ARG B CG  
3291 C CD  . ARG B 103 ? 0.4575 0.5614 0.6104 0.0306  -0.0280 -0.1494 129 ARG B CD  
3292 N NE  . ARG B 103 ? 0.4011 0.5183 0.5606 0.0265  -0.0161 -0.1508 129 ARG B NE  
3293 C CZ  . ARG B 103 ? 0.5819 0.7098 0.7555 0.0258  -0.0122 -0.1592 129 ARG B CZ  
3294 N NH1 . ARG B 103 ? 0.7536 0.8824 0.9377 0.0302  -0.0193 -0.1683 129 ARG B NH1 
3295 N NH2 . ARG B 103 ? 0.5383 0.6751 0.7140 0.0200  -0.0018 -0.1587 129 ARG B NH2 
3296 N N   . LEU B 104 ? 0.3899 0.4741 0.4930 0.0167  -0.0125 -0.1051 130 LEU B N   
3297 C CA  . LEU B 104 ? 0.4221 0.5057 0.5131 0.0137  -0.0086 -0.0960 130 LEU B CA  
3298 C C   . LEU B 104 ? 0.4975 0.5698 0.5779 0.0126  -0.0133 -0.0898 130 LEU B C   
3299 O O   . LEU B 104 ? 0.4373 0.5051 0.5075 0.0107  -0.0154 -0.0854 130 LEU B O   
3300 C CB  . LEU B 104 ? 0.4395 0.5320 0.5309 0.0120  0.0026  -0.0918 130 LEU B CB  
3301 C CG  . LEU B 104 ? 0.5778 0.6806 0.6756 0.0117  0.0084  -0.0961 130 LEU B CG  
3302 C CD1 . LEU B 104 ? 0.5709 0.6757 0.6643 0.0082  0.0170  -0.0902 130 LEU B CD1 
3303 C CD2 . LEU B 104 ? 0.6657 0.7721 0.7589 0.0118  0.0072  -0.0960 130 LEU B CD2 
3304 N N   . TRP B 105 ? 0.4452 0.5135 0.5283 0.0133  -0.0145 -0.0901 131 TRP B N   
3305 C CA  . TRP B 105 ? 0.4607 0.5183 0.5340 0.0121  -0.0188 -0.0847 131 TRP B CA  
3306 C C   . TRP B 105 ? 0.5987 0.6441 0.6653 0.0134  -0.0292 -0.0866 131 TRP B C   
3307 O O   . TRP B 105 ? 0.7327 0.7683 0.7873 0.0111  -0.0321 -0.0813 131 TRP B O   
3308 C CB  . TRP B 105 ? 0.5026 0.5594 0.5812 0.0127  -0.0180 -0.0860 131 TRP B CB  
3309 C CG  . TRP B 105 ? 0.5076 0.5536 0.5764 0.0114  -0.0225 -0.0811 131 TRP B CG  
3310 C CD1 . TRP B 105 ? 0.4698 0.5068 0.5377 0.0135  -0.0309 -0.0842 131 TRP B CD1 
3311 C CD2 . TRP B 105 ? 0.6032 0.6464 0.6611 0.0079  -0.0187 -0.0726 131 TRP B CD2 
3312 N NE1 . TRP B 105 ? 0.5632 0.5915 0.6199 0.0111  -0.0322 -0.0777 131 TRP B NE1 
3313 C CE2 . TRP B 105 ? 0.6619 0.6941 0.7128 0.0073  -0.0247 -0.0710 131 TRP B CE2 
3314 C CE3 . TRP B 105 ? 0.5214 0.5710 0.5748 0.0057  -0.0110 -0.0666 131 TRP B CE3 
3315 C CZ2 . TRP B 105 ? 0.5999 0.6275 0.6402 0.0038  -0.0227 -0.0639 131 TRP B CZ2 
3316 C CZ3 . TRP B 105 ? 0.4918 0.5376 0.5353 0.0029  -0.0096 -0.0599 131 TRP B CZ3 
3317 C CH2 . TRP B 105 ? 0.4336 0.4686 0.4709 0.0016  -0.0151 -0.0587 131 TRP B CH2 
3318 N N   . LYS B 106 ? 0.4870 0.5323 0.5609 0.0170  -0.0344 -0.0943 132 LYS B N   
3319 C CA  . LYS B 106 ? 0.2430 0.2755 0.3106 0.0195  -0.0440 -0.0958 132 LYS B CA  
3320 C C   . LYS B 106 ? 0.3695 0.4007 0.4309 0.0174  -0.0433 -0.0947 132 LYS B C   
3321 O O   . LYS B 106 ? 0.6956 0.7155 0.7511 0.0191  -0.0501 -0.0960 132 LYS B O   
3322 C CB  . LYS B 106 ? 0.2592 0.2916 0.3377 0.0256  -0.0509 -0.1052 132 LYS B CB  
3323 C CG  . LYS B 106 ? 0.5580 0.5897 0.6413 0.0281  -0.0539 -0.1073 132 LYS B CG  
3324 C CD  . LYS B 106 ? 0.8757 0.9061 0.9677 0.0350  -0.0630 -0.1171 132 LYS B CD  
3325 C CE  . LYS B 106 ? 1.1752 1.2034 1.2695 0.0377  -0.0678 -0.1192 132 LYS B CE  
3326 N NZ  . LYS B 106 ? 1.2615 1.2878 1.3628 0.0455  -0.0783 -0.1294 132 LYS B NZ  
3327 N N   . ASP B 107 ? 0.3675 0.4101 0.4295 0.0138  -0.0352 -0.0926 133 ASP B N   
3328 C CA  . ASP B 107 ? 0.4123 0.4566 0.4693 0.0114  -0.0338 -0.0923 133 ASP B CA  
3329 C C   . ASP B 107 ? 0.4918 0.5288 0.5346 0.0069  -0.0335 -0.0850 133 ASP B C   
3330 O O   . ASP B 107 ? 0.5643 0.6044 0.6028 0.0042  -0.0292 -0.0794 133 ASP B O   
3331 C CB  . ASP B 107 ? 0.2793 0.3406 0.3436 0.0105  -0.0251 -0.0928 133 ASP B CB  
3332 C CG  . ASP B 107 ? 0.4640 0.5291 0.5236 0.0080  -0.0236 -0.0931 133 ASP B CG  
3333 O OD1 . ASP B 107 ? 0.5164 0.5776 0.5783 0.0094  -0.0281 -0.0991 133 ASP B OD1 
3334 O OD2 . ASP B 107 ? 0.6107 0.6830 0.6645 0.0049  -0.0181 -0.0878 133 ASP B OD2 
3335 N N   . SER B 108 ? 0.4833 0.5105 0.5188 0.0058  -0.0376 -0.0857 134 SER B N   
3336 C CA  . SER B 108 ? 0.5516 0.5711 0.5735 0.0007  -0.0369 -0.0800 134 SER B CA  
3337 C C   . SER B 108 ? 0.6004 0.6345 0.6208 -0.0037 -0.0290 -0.0765 134 SER B C   
3338 O O   . SER B 108 ? 0.5492 0.5819 0.5615 -0.0074 -0.0268 -0.0711 134 SER B O   
3339 C CB  . SER B 108 ? 0.5477 0.5551 0.5623 -0.0005 -0.0413 -0.0828 134 SER B CB  
3340 O OG  . SER B 108 ? 0.6912 0.7088 0.7134 0.0002  -0.0393 -0.0884 134 SER B OG  
3341 N N   . GLY B 109 ? 0.6042 0.6528 0.6322 -0.0029 -0.0251 -0.0801 135 GLY B N   
3342 C CA  . GLY B 109 ? 0.5491 0.6129 0.5760 -0.0054 -0.0180 -0.0769 135 GLY B CA  
3343 C C   . GLY B 109 ? 0.4898 0.5586 0.5177 -0.0043 -0.0138 -0.0712 135 GLY B C   
3344 O O   . GLY B 109 ? 0.5138 0.5862 0.5350 -0.0070 -0.0107 -0.0663 135 GLY B O   
3345 N N   . VAL B 110 ? 0.4333 0.5024 0.4697 -0.0004 -0.0133 -0.0724 136 VAL B N   
3346 C CA  . VAL B 110 ? 0.5732 0.6455 0.6110 0.0006  -0.0088 -0.0677 136 VAL B CA  
3347 C C   . VAL B 110 ? 0.5547 0.6162 0.5841 -0.0018 -0.0118 -0.0635 136 VAL B C   
3348 O O   . VAL B 110 ? 0.5464 0.6116 0.5723 -0.0028 -0.0075 -0.0582 136 VAL B O   
3349 C CB  . VAL B 110 ? 0.4500 0.5232 0.4989 0.0042  -0.0080 -0.0713 136 VAL B CB  
3350 C CG1 . VAL B 110 ? 0.2612 0.3359 0.3108 0.0047  -0.0029 -0.0667 136 VAL B CG1 
3351 C CG2 . VAL B 110 ? 0.4785 0.5626 0.5353 0.0060  -0.0040 -0.0757 136 VAL B CG2 
3352 N N   . GLN B 111 ? 0.4676 0.5151 0.4929 -0.0025 -0.0193 -0.0660 137 GLN B N   
3353 C CA  . GLN B 111 ? 0.4063 0.4419 0.4224 -0.0050 -0.0223 -0.0619 137 GLN B CA  
3354 C C   . GLN B 111 ? 0.5420 0.5789 0.5480 -0.0101 -0.0196 -0.0580 137 GLN B C   
3355 O O   . GLN B 111 ? 0.5068 0.5421 0.5070 -0.0127 -0.0177 -0.0535 137 GLN B O   
3356 C CB  . GLN B 111 ? 0.3999 0.4195 0.4136 -0.0029 -0.0302 -0.0641 137 GLN B CB  
3357 C CG  . GLN B 111 ? 0.4651 0.4833 0.4882 0.0021  -0.0335 -0.0678 137 GLN B CG  
3358 C CD  . GLN B 111 ? 0.5496 0.5680 0.5726 0.0016  -0.0313 -0.0642 137 GLN B CD  
3359 O OE1 . GLN B 111 ? 0.5762 0.5885 0.5894 -0.0018 -0.0307 -0.0589 137 GLN B OE1 
3360 N NE2 . GLN B 111 ? 0.6343 0.6597 0.6683 0.0044  -0.0295 -0.0677 137 GLN B NE2 
3361 N N   . ALA B 112 ? 0.5805 0.6211 0.5850 -0.0119 -0.0192 -0.0604 138 ALA B N   
3362 C CA  . ALA B 112 ? 0.4528 0.4977 0.4494 -0.0172 -0.0160 -0.0582 138 ALA B CA  
3363 C C   . ALA B 112 ? 0.4419 0.5018 0.4395 -0.0172 -0.0102 -0.0549 138 ALA B C   
3364 O O   . ALA B 112 ? 0.5308 0.5913 0.5221 -0.0207 -0.0082 -0.0514 138 ALA B O   
3365 C CB  . ALA B 112 ? 0.3453 0.3954 0.3425 -0.0187 -0.0157 -0.0625 138 ALA B CB  
3366 N N   . CYS B 113 ? 0.3895 0.4612 0.3956 -0.0126 -0.0066 -0.0551 139 CYS B N   
3367 C CA  . CYS B 113 ? 0.3965 0.4812 0.4040 -0.0105 -0.0001 -0.0506 139 CYS B CA  
3368 C C   . CYS B 113 ? 0.4973 0.5758 0.5038 -0.0099 0.0007  -0.0464 139 CYS B C   
3369 O O   . CYS B 113 ? 0.7384 0.8228 0.7415 -0.0103 0.0045  -0.0424 139 CYS B O   
3370 C CB  . CYS B 113 ? 0.4532 0.5485 0.4689 -0.0056 0.0040  -0.0515 139 CYS B CB  
3371 S SG  . CYS B 113 ? 0.5525 0.6614 0.5678 -0.0016 0.0121  -0.0455 139 CYS B SG  
3372 N N   . PHE B 114 ? 0.3353 0.4024 0.3452 -0.0086 -0.0030 -0.0479 140 PHE B N   
3373 C CA  . PHE B 114 ? 0.4503 0.5107 0.4594 -0.0084 -0.0027 -0.0448 140 PHE B CA  
3374 C C   . PHE B 114 ? 0.4979 0.5521 0.4968 -0.0133 -0.0043 -0.0422 140 PHE B C   
3375 O O   . PHE B 114 ? 0.4838 0.5390 0.4809 -0.0136 -0.0012 -0.0384 140 PHE B O   
3376 C CB  . PHE B 114 ? 0.4885 0.5384 0.5027 -0.0065 -0.0077 -0.0484 140 PHE B CB  
3377 C CG  . PHE B 114 ? 0.5758 0.6174 0.5881 -0.0070 -0.0088 -0.0462 140 PHE B CG  
3378 C CD1 . PHE B 114 ? 0.6589 0.7061 0.6751 -0.0055 -0.0027 -0.0432 140 PHE B CD1 
3379 C CD2 . PHE B 114 ? 0.5220 0.5495 0.5276 -0.0090 -0.0159 -0.0473 140 PHE B CD2 
3380 C CE1 . PHE B 114 ? 0.6218 0.6619 0.6366 -0.0064 -0.0034 -0.0417 140 PHE B CE1 
3381 C CE2 . PHE B 114 ? 0.4379 0.4584 0.4414 -0.0096 -0.0170 -0.0455 140 PHE B CE2 
3382 C CZ  . PHE B 114 ? 0.5440 0.5714 0.5526 -0.0085 -0.0107 -0.0430 140 PHE B CZ  
3383 N N   . ASN B 115 ? 0.4241 0.4713 0.4161 -0.0173 -0.0086 -0.0445 141 ASN B N   
3384 C CA  . ASN B 115 ? 0.4159 0.4566 0.3984 -0.0227 -0.0088 -0.0418 141 ASN B CA  
3385 C C   . ASN B 115 ? 0.5949 0.6502 0.5752 -0.0250 -0.0033 -0.0401 141 ASN B C   
3386 O O   . ASN B 115 ? 0.8560 0.9101 0.8308 -0.0289 -0.0017 -0.0377 141 ASN B O   
3387 C CB  . ASN B 115 ? 0.4979 0.5260 0.4738 -0.0261 -0.0130 -0.0437 141 ASN B CB  
3388 C CG  . ASN B 115 ? 0.6285 0.6419 0.6055 -0.0225 -0.0194 -0.0455 141 ASN B CG  
3389 O OD1 . ASN B 115 ? 0.2630 0.2710 0.2419 -0.0199 -0.0213 -0.0442 141 ASN B OD1 
3390 N ND2 . ASN B 115 ? 0.7631 0.7706 0.7392 -0.0221 -0.0229 -0.0490 141 ASN B ND2 
3391 N N   . ARG B 116 ? 0.4703 0.5403 0.4554 -0.0221 -0.0004 -0.0416 142 ARG B N   
3392 C CA  . ARG B 116 ? 0.3386 0.4248 0.3227 -0.0223 0.0046  -0.0402 142 ARG B CA  
3393 C C   . ARG B 116 ? 0.4028 0.4969 0.3914 -0.0167 0.0095  -0.0356 142 ARG B C   
3394 O O   . ARG B 116 ? 0.5272 0.6354 0.5198 -0.0141 0.0119  -0.0334 142 ARG B O   
3395 C CB  . ARG B 116 ? 0.2382 0.3368 0.2252 -0.0214 0.0056  -0.0434 142 ARG B CB  
3396 C CG  . ARG B 116 ? 0.3385 0.4286 0.3230 -0.0263 0.0017  -0.0478 142 ARG B CG  
3397 C CD  . ARG B 116 ? 0.5158 0.6149 0.4967 -0.0320 0.0037  -0.0498 142 ARG B CD  
3398 N NE  . ARG B 116 ? 0.5874 0.7079 0.5730 -0.0289 0.0071  -0.0507 142 ARG B NE  
3399 C CZ  . ARG B 116 ? 0.5744 0.7023 0.5629 -0.0278 0.0070  -0.0545 142 ARG B CZ  
3400 N NH1 . ARG B 116 ? 0.5889 0.7045 0.5767 -0.0296 0.0037  -0.0580 142 ARG B NH1 
3401 N NH2 . ARG B 116 ? 0.5373 0.6848 0.5298 -0.0245 0.0096  -0.0547 142 ARG B NH2 
3402 N N   . SER B 117 ? 0.3599 0.4438 0.3509 -0.0149 0.0089  -0.0337 143 SER B N   
3403 C CA  . SER B 117 ? 0.4166 0.5046 0.4123 -0.0101 0.0133  -0.0294 143 SER B CA  
3404 C C   . SER B 117 ? 0.5030 0.5971 0.4971 -0.0106 0.0142  -0.0255 143 SER B C   
3405 O O   . SER B 117 ? 0.4766 0.5720 0.4728 -0.0063 0.0160  -0.0216 143 SER B O   
3406 C CB  . SER B 117 ? 0.4561 0.5318 0.4542 -0.0093 0.0126  -0.0294 143 SER B CB  
3407 O OG  . SER B 117 ? 0.7394 0.8038 0.7315 -0.0142 0.0084  -0.0297 143 SER B OG  
3408 N N   . ARG B 118 ? 0.5160 0.6126 0.5053 -0.0160 0.0131  -0.0272 144 ARG B N   
3409 C CA  . ARG B 118 ? 0.3587 0.4637 0.3475 -0.0166 0.0140  -0.0252 144 ARG B CA  
3410 C C   . ARG B 118 ? 0.3992 0.5205 0.3908 -0.0120 0.0144  -0.0249 144 ARG B C   
3411 O O   . ARG B 118 ? 0.3703 0.5007 0.3619 -0.0097 0.0151  -0.0232 144 ARG B O   
3412 C CB  . ARG B 118 ? 0.0930 0.1955 0.0758 -0.0248 0.0134  -0.0279 144 ARG B CB  
3413 C CG  . ARG B 118 ? 0.3532 0.4579 0.3330 -0.0295 0.0122  -0.0324 144 ARG B CG  
3414 C CD  . ARG B 118 ? 0.3290 0.4283 0.3013 -0.0386 0.0120  -0.0347 144 ARG B CD  
3415 N NE  . ARG B 118 ? 0.4573 0.5717 0.4317 -0.0404 0.0143  -0.0355 144 ARG B NE  
3416 C CZ  . ARG B 118 ? 0.5174 0.6445 0.4916 -0.0447 0.0154  -0.0398 144 ARG B CZ  
3417 N NH1 . ARG B 118 ? 0.4728 0.5980 0.4445 -0.0481 0.0148  -0.0434 144 ARG B NH1 
3418 N NH2 . ARG B 118 ? 0.2539 0.3958 0.2304 -0.0457 0.0170  -0.0413 144 ARG B NH2 
3419 N N   . GLU B 119 ? 0.3364 0.4615 0.3298 -0.0104 0.0138  -0.0268 145 GLU B N   
3420 C CA  . GLU B 119 ? 0.3683 0.5091 0.3629 -0.0064 0.0139  -0.0271 145 GLU B CA  
3421 C C   . GLU B 119 ? 0.4231 0.5639 0.4192 0.0017  0.0153  -0.0229 145 GLU B C   
3422 O O   . GLU B 119 ? 0.5627 0.7149 0.5586 0.0059  0.0155  -0.0227 145 GLU B O   
3423 C CB  . GLU B 119 ? 0.3987 0.5451 0.3936 -0.0105 0.0129  -0.0325 145 GLU B CB  
3424 C CG  . GLU B 119 ? 0.4118 0.5548 0.4030 -0.0194 0.0125  -0.0365 145 GLU B CG  
3425 C CD  . GLU B 119 ? 0.6003 0.7439 0.5901 -0.0238 0.0119  -0.0419 145 GLU B CD  
3426 O OE1 . GLU B 119 ? 0.4462 0.6009 0.4393 -0.0204 0.0119  -0.0435 145 GLU B OE1 
3427 O OE2 . GLU B 119 ? 0.6368 0.7681 0.6210 -0.0306 0.0110  -0.0445 145 GLU B OE2 
3428 N N   . TYR B 120 ? 0.4023 0.5301 0.3990 0.0034  0.0167  -0.0198 146 TYR B N   
3429 C CA  . TYR B 120 ? 0.3480 0.4731 0.3449 0.0100  0.0194  -0.0155 146 TYR B CA  
3430 C C   . TYR B 120 ? 0.5776 0.6892 0.5750 0.0103  0.0214  -0.0126 146 TYR B C   
3431 O O   . TYR B 120 ? 0.7266 0.8314 0.7243 0.0055  0.0201  -0.0143 146 TYR B O   
3432 C CB  . TYR B 120 ? 0.3537 0.4779 0.3528 0.0108  0.0198  -0.0176 146 TYR B CB  
3433 C CG  . TYR B 120 ? 0.4371 0.5515 0.4395 0.0060  0.0184  -0.0221 146 TYR B CG  
3434 C CD1 . TYR B 120 ? 0.5713 0.6884 0.5741 0.0013  0.0158  -0.0272 146 TYR B CD1 
3435 C CD2 . TYR B 120 ? 0.4043 0.5074 0.4096 0.0065  0.0202  -0.0216 146 TYR B CD2 
3436 C CE1 . TYR B 120 ? 0.5470 0.6551 0.5523 -0.0016 0.0148  -0.0313 146 TYR B CE1 
3437 C CE2 . TYR B 120 ? 0.3555 0.4517 0.3647 0.0034  0.0187  -0.0263 146 TYR B CE2 
3438 C CZ  . TYR B 120 ? 0.3913 0.4899 0.4003 0.0000  0.0159  -0.0310 146 TYR B CZ  
3439 O OH  . TYR B 120 ? 0.3293 0.4208 0.3417 -0.0014 0.0144  -0.0360 146 TYR B OH  
3440 N N   . GLN B 121 ? 0.6109 0.7184 0.6077 0.0156  0.0252  -0.0084 147 GLN B N   
3441 C CA  . GLN B 121 ? 0.6454 0.7406 0.6430 0.0157  0.0280  -0.0060 147 GLN B CA  
3442 C C   . GLN B 121 ? 0.4994 0.5847 0.5012 0.0126  0.0285  -0.0092 147 GLN B C   
3443 O O   . GLN B 121 ? 0.4947 0.5800 0.4982 0.0141  0.0303  -0.0100 147 GLN B O   
3444 C CB  . GLN B 121 ? 0.7258 0.8198 0.7204 0.0226  0.0330  -0.0003 147 GLN B CB  
3445 C CG  . GLN B 121 ? 0.8213 0.9251 0.8122 0.0269  0.0327  0.0026  147 GLN B CG  
3446 C CD  . GLN B 121 ? 1.0072 1.1077 0.9942 0.0347  0.0384  0.0086  147 GLN B CD  
3447 O OE1 . GLN B 121 ? 1.0576 1.1629 1.0420 0.0387  0.0391  0.0111  147 GLN B OE1 
3448 N NE2 . GLN B 121 ? 1.1156 1.2076 1.1019 0.0369  0.0430  0.0105  147 GLN B NE2 
3449 N N   . LEU B 122 ? 0.4344 0.5123 0.4381 0.0083  0.0270  -0.0115 148 LEU B N   
3450 C CA  . LEU B 122 ? 0.5254 0.5958 0.5340 0.0058  0.0271  -0.0155 148 LEU B CA  
3451 C C   . LEU B 122 ? 0.5644 0.6257 0.5744 0.0039  0.0284  -0.0154 148 LEU B C   
3452 O O   . LEU B 122 ? 0.5579 0.6181 0.5654 0.0013  0.0264  -0.0153 148 LEU B O   
3453 C CB  . LEU B 122 ? 0.3644 0.4375 0.3748 0.0025  0.0228  -0.0208 148 LEU B CB  
3454 C CG  . LEU B 122 ? 0.5380 0.6056 0.5550 0.0013  0.0220  -0.0262 148 LEU B CG  
3455 C CD1 . LEU B 122 ? 0.6490 0.7167 0.6707 0.0035  0.0252  -0.0270 148 LEU B CD1 
3456 C CD2 . LEU B 122 ? 0.5519 0.6216 0.5697 -0.0004 0.0179  -0.0313 148 LEU B CD2 
3457 N N   . ASN B 123 ? 0.4635 0.5187 0.4772 0.0047  0.0323  -0.0157 149 ASN B N   
3458 C CA  . ASN B 123 ? 0.4167 0.4641 0.4325 0.0027  0.0341  -0.0163 149 ASN B CA  
3459 C C   . ASN B 123 ? 0.4338 0.4801 0.4524 -0.0009 0.0297  -0.0214 149 ASN B C   
3460 O O   . ASN B 123 ? 0.3918 0.4409 0.4139 -0.0012 0.0266  -0.0258 149 ASN B O   
3461 C CB  . ASN B 123 ? 0.3518 0.3938 0.3722 0.0033  0.0398  -0.0172 149 ASN B CB  
3462 C CG  . ASN B 123 ? 0.5256 0.5688 0.5538 0.0015  0.0384  -0.0240 149 ASN B CG  
3463 O OD1 . ASN B 123 ? 0.4553 0.4958 0.4894 -0.0009 0.0379  -0.0286 149 ASN B OD1 
3464 N ND2 . ASN B 123 ? 0.5417 0.5903 0.5707 0.0028  0.0377  -0.0251 149 ASN B ND2 
3465 N N   . ASP B 124 ? 0.5352 0.5770 0.5521 -0.0029 0.0297  -0.0208 150 ASP B N   
3466 C CA  . ASP B 124 ? 0.6065 0.6468 0.6237 -0.0057 0.0259  -0.0250 150 ASP B CA  
3467 C C   . ASP B 124 ? 0.6065 0.6434 0.6317 -0.0056 0.0251  -0.0308 150 ASP B C   
3468 O O   . ASP B 124 ? 0.5669 0.5973 0.5907 -0.0079 0.0183  -0.0334 150 ASP B O   
3469 C CB  . ASP B 124 ? 0.6958 0.7330 0.7064 -0.0084 0.0259  -0.0222 150 ASP B CB  
3470 C CG  . ASP B 124 ? 0.8275 0.8692 0.8316 -0.0085 0.0252  -0.0181 150 ASP B CG  
3471 O OD1 . ASP B 124 ? 0.9706 1.0183 0.9750 -0.0063 0.0246  -0.0173 150 ASP B OD1 
3472 O OD2 . ASP B 124 ? 0.8298 0.8701 0.8291 -0.0109 0.0250  -0.0163 150 ASP B OD2 
3473 N N   . SER B 125 ? 0.6196 0.6576 0.6514 -0.0042 0.0288  -0.0321 151 SER B N   
3474 C CA  . SER B 125 ? 0.3900 0.4275 0.4315 -0.0042 0.0283  -0.0391 151 SER B CA  
3475 C C   . SER B 125 ? 0.5427 0.5849 0.5897 -0.0021 0.0249  -0.0440 151 SER B C   
3476 O O   . SER B 125 ? 0.7717 0.8141 0.8271 -0.0019 0.0223  -0.0507 151 SER B O   
3477 C CB  . SER B 125 ? 0.2459 0.2806 0.2912 -0.0055 0.0352  -0.0387 151 SER B CB  
3478 O OG  . SER B 125 ? 0.4985 0.5280 0.5399 -0.0071 0.0381  -0.0354 151 SER B OG  
3479 N N   . ALA B 126 ? 0.5095 0.5551 0.5515 -0.0012 0.0239  -0.0407 152 ALA B N   
3480 C CA  . ALA B 126 ? 0.3075 0.3577 0.3540 0.0005  0.0212  -0.0449 152 ALA B CA  
3481 C C   . ALA B 126 ? 0.4207 0.4660 0.4699 0.0003  0.0112  -0.0509 152 ALA B C   
3482 O O   . ALA B 126 ? 0.4740 0.5214 0.5326 0.0016  0.0098  -0.0574 152 ALA B O   
3483 C CB  . ALA B 126 ? 0.3143 0.3685 0.3535 0.0009  0.0208  -0.0406 152 ALA B CB  
3484 N N   . ALA B 127 ? 0.4997 0.5382 0.5403 -0.0013 0.0042  -0.0489 153 ALA B N   
3485 C CA  . ALA B 127 ? 0.4824 0.5136 0.5223 -0.0009 -0.0059 -0.0535 153 ALA B CA  
3486 C C   . ALA B 127 ? 0.5679 0.5967 0.6149 0.0000  -0.0085 -0.0587 153 ALA B C   
3487 O O   . ALA B 127 ? 0.5424 0.5697 0.5944 0.0025  -0.0153 -0.0651 153 ALA B O   
3488 C CB  . ALA B 127 ? 0.4248 0.4471 0.4517 -0.0036 -0.0114 -0.0496 153 ALA B CB  
3489 N N   . TYR B 128 ? 0.6179 0.6469 0.6653 -0.0017 -0.0030 -0.0566 154 TYR B N   
3490 C CA  . TYR B 128 ? 0.4953 0.5233 0.5495 -0.0015 -0.0045 -0.0619 154 TYR B CA  
3491 C C   . TYR B 128 ? 0.5153 0.5506 0.5833 0.0009  -0.0039 -0.0702 154 TYR B C   
3492 O O   . TYR B 128 ? 0.5728 0.6071 0.6456 0.0030  -0.0117 -0.0771 154 TYR B O   
3493 C CB  . TYR B 128 ? 0.4945 0.5230 0.5484 -0.0041 0.0039  -0.0585 154 TYR B CB  
3494 C CG  . TYR B 128 ? 0.6785 0.7069 0.7398 -0.0046 0.0032  -0.0646 154 TYR B CG  
3495 C CD1 . TYR B 128 ? 0.7944 0.8160 0.8501 -0.0054 -0.0042 -0.0654 154 TYR B CD1 
3496 C CD2 . TYR B 128 ? 0.7163 0.7515 0.7894 -0.0047 0.0104  -0.0699 154 TYR B CD2 
3497 C CE1 . TYR B 128 ? 0.7947 0.8176 0.8572 -0.0058 -0.0051 -0.0716 154 TYR B CE1 
3498 C CE2 . TYR B 128 ? 0.6258 0.6625 0.7064 -0.0058 0.0102  -0.0766 154 TYR B CE2 
3499 C CZ  . TYR B 128 ? 0.7176 0.7488 0.7933 -0.0061 0.0021  -0.0775 154 TYR B CZ  
3500 O OH  . TYR B 128 ? 0.7275 0.7613 0.8107 -0.0071 0.0015  -0.0847 154 TYR B OH  
3501 N N   . TYR B 129 ? 0.5272 0.5697 0.6008 0.0007  0.0053  -0.0699 155 TYR B N   
3502 C CA  . TYR B 129 ? 0.4352 0.4854 0.5218 0.0020  0.0076  -0.0781 155 TYR B CA  
3503 C C   . TYR B 129 ? 0.5743 0.6264 0.6632 0.0050  0.0003  -0.0821 155 TYR B C   
3504 O O   . TYR B 129 ? 0.7721 0.8271 0.8701 0.0072  -0.0053 -0.0907 155 TYR B O   
3505 C CB  . TYR B 129 ? 0.4054 0.4608 0.4949 0.0002  0.0203  -0.0757 155 TYR B CB  
3506 C CG  . TYR B 129 ? 0.4521 0.5044 0.5401 -0.0034 0.0276  -0.0723 155 TYR B CG  
3507 C CD1 . TYR B 129 ? 0.4551 0.5088 0.5520 -0.0051 0.0289  -0.0795 155 TYR B CD1 
3508 C CD2 . TYR B 129 ? 0.4191 0.4665 0.4965 -0.0050 0.0331  -0.0626 155 TYR B CD2 
3509 C CE1 . TYR B 129 ? 0.4148 0.4648 0.5102 -0.0087 0.0361  -0.0768 155 TYR B CE1 
3510 C CE2 . TYR B 129 ? 0.3571 0.3995 0.4323 -0.0078 0.0396  -0.0597 155 TYR B CE2 
3511 C CZ  . TYR B 129 ? 0.2885 0.3319 0.3728 -0.0100 0.0414  -0.0667 155 TYR B CZ  
3512 O OH  . TYR B 129 ? 0.2626 0.3005 0.3449 -0.0130 0.0484  -0.0643 155 TYR B OH  
3513 N N   . LEU B 130 ? 0.5494 0.6003 0.6302 0.0051  0.0003  -0.0763 156 LEU B N   
3514 C CA  . LEU B 130 ? 0.6216 0.6741 0.7040 0.0075  -0.0052 -0.0797 156 LEU B CA  
3515 C C   . LEU B 130 ? 0.5498 0.5955 0.6315 0.0102  -0.0175 -0.0845 156 LEU B C   
3516 O O   . LEU B 130 ? 0.6506 0.6980 0.7371 0.0132  -0.0226 -0.0901 156 LEU B O   
3517 C CB  . LEU B 130 ? 0.4708 0.5228 0.5432 0.0065  -0.0033 -0.0725 156 LEU B CB  
3518 C CG  . LEU B 130 ? 0.3092 0.3687 0.3821 0.0055  0.0080  -0.0683 156 LEU B CG  
3519 C CD1 . LEU B 130 ? 0.2712 0.3313 0.3336 0.0049  0.0091  -0.0614 156 LEU B CD1 
3520 C CD2 . LEU B 130 ? 0.1896 0.2571 0.2732 0.0066  0.0123  -0.0747 156 LEU B CD2 
3521 N N   . ASN B 131 ? 0.4377 0.4752 0.5129 0.0097  -0.0224 -0.0825 157 ASN B N   
3522 C CA  . ASN B 131 ? 0.6582 0.6881 0.7311 0.0133  -0.0341 -0.0860 157 ASN B CA  
3523 C C   . ASN B 131 ? 0.6916 0.7276 0.7777 0.0164  -0.0372 -0.0957 157 ASN B C   
3524 O O   . ASN B 131 ? 0.8296 0.8663 0.9212 0.0213  -0.0449 -0.1024 157 ASN B O   
3525 C CB  . ASN B 131 ? 0.7683 0.7867 0.8272 0.0117  -0.0378 -0.0788 157 ASN B CB  
3526 C CG  . ASN B 131 ? 0.6152 0.6264 0.6608 0.0094  -0.0379 -0.0713 157 ASN B CG  
3527 O OD1 . ASN B 131 ? 0.4629 0.4751 0.5087 0.0105  -0.0390 -0.0724 157 ASN B OD1 
3528 N ND2 . ASN B 131 ? 0.5242 0.5289 0.5586 0.0058  -0.0364 -0.0644 157 ASN B ND2 
3529 N N   . ASP B 132 ? 0.6060 0.6469 0.6977 0.0137  -0.0310 -0.0972 158 ASP B N   
3530 C CA  . ASP B 132 ? 0.7451 0.7939 0.8505 0.0157  -0.0326 -0.1075 158 ASP B CA  
3531 C C   . ASP B 132 ? 0.6673 0.7285 0.7869 0.0151  -0.0249 -0.1143 158 ASP B C   
3532 O O   . ASP B 132 ? 0.6219 0.6913 0.7520 0.0127  -0.0178 -0.1197 158 ASP B O   
3533 C CB  . ASP B 132 ? 0.8972 0.9459 1.0026 0.0123  -0.0283 -0.1065 158 ASP B CB  
3534 C CG  . ASP B 132 ? 1.1136 1.1507 1.2046 0.0124  -0.0346 -0.0991 158 ASP B CG  
3535 O OD1 . ASP B 132 ? 1.2657 1.2937 1.3456 0.0144  -0.0412 -0.0940 158 ASP B OD1 
3536 O OD2 . ASP B 132 ? 1.1389 1.1754 1.2292 0.0099  -0.0323 -0.0986 158 ASP B OD2 
3537 N N   . LEU B 133 ? 0.7360 0.7983 0.8556 0.0169  -0.0259 -0.1143 159 LEU B N   
3538 C CA  . LEU B 133 ? 0.8003 0.8738 0.9311 0.0158  -0.0176 -0.1191 159 LEU B CA  
3539 C C   . LEU B 133 ? 0.8359 0.9200 0.9836 0.0182  -0.0199 -0.1327 159 LEU B C   
3540 O O   . LEU B 133 ? 0.7199 0.8138 0.8783 0.0150  -0.0103 -0.1380 159 LEU B O   
3541 C CB  . LEU B 133 ? 0.6773 0.7493 0.8029 0.0170  -0.0184 -0.1155 159 LEU B CB  
3542 C CG  . LEU B 133 ? 0.6199 0.7010 0.7511 0.0145  -0.0075 -0.1161 159 LEU B CG  
3543 C CD1 . LEU B 133 ? 0.6444 0.7263 0.7728 0.0097  0.0044  -0.1099 159 LEU B CD1 
3544 C CD2 . LEU B 133 ? 0.6940 0.7728 0.8174 0.0153  -0.0090 -0.1111 159 LEU B CD2 
3545 N N   . ASP B 134 ? 0.8846 0.9668 1.0342 0.0239  -0.0326 -0.1386 160 ASP B N   
3546 C CA  . ASP B 134 ? 0.7074 0.8011 0.8736 0.0273  -0.0364 -0.1526 160 ASP B CA  
3547 C C   . ASP B 134 ? 0.5960 0.6966 0.7706 0.0243  -0.0320 -0.1582 160 ASP B C   
3548 O O   . ASP B 134 ? 0.4972 0.6112 0.6879 0.0238  -0.0286 -0.1698 160 ASP B O   
3549 C CB  . ASP B 134 ? 0.6882 0.7764 0.8523 0.0353  -0.0521 -0.1570 160 ASP B CB  
3550 C CG  . ASP B 134 ? 0.8251 0.9082 0.9843 0.0384  -0.0560 -0.1548 160 ASP B CG  
3551 O OD1 . ASP B 134 ? 0.9020 0.9749 1.0535 0.0444  -0.0680 -0.1546 160 ASP B OD1 
3552 O OD2 . ASP B 134 ? 0.8606 0.9492 1.0228 0.0348  -0.0469 -0.1533 160 ASP B OD2 
3553 N N   . ARG B 135 ? 0.6319 0.7238 0.7959 0.0220  -0.0318 -0.1504 161 ARG B N   
3554 C CA  . ARG B 135 ? 0.5836 0.6808 0.7541 0.0186  -0.0273 -0.1549 161 ARG B CA  
3555 C C   . ARG B 135 ? 0.5751 0.6780 0.7509 0.0114  -0.0108 -0.1541 161 ARG B C   
3556 O O   . ARG B 135 ? 0.3466 0.4594 0.5351 0.0083  -0.0048 -0.1635 161 ARG B O   
3557 C CB  . ARG B 135 ? 0.5338 0.6191 0.6902 0.0183  -0.0321 -0.1467 161 ARG B CB  
3558 C CG  . ARG B 135 ? 0.4454 0.5353 0.6072 0.0140  -0.0264 -0.1504 161 ARG B CG  
3559 C CD  . ARG B 135 ? 0.4182 0.4973 0.5668 0.0145  -0.0330 -0.1438 161 ARG B CD  
3560 N NE  . ARG B 135 ? 0.5610 0.6280 0.6937 0.0116  -0.0288 -0.1296 161 ARG B NE  
3561 C CZ  . ARG B 135 ? 0.5712 0.6361 0.7005 0.0057  -0.0175 -0.1236 161 ARG B CZ  
3562 N NH1 . ARG B 135 ? 0.4126 0.4855 0.5526 0.0017  -0.0083 -0.1297 161 ARG B NH1 
3563 N NH2 . ARG B 135 ? 0.6546 0.7098 0.7699 0.0039  -0.0149 -0.1118 161 ARG B NH2 
3564 N N   . ILE B 136 ? 0.7031 0.7993 0.8686 0.0088  -0.0035 -0.1432 162 ILE B N   
3565 C CA  . ILE B 136 ? 0.7082 0.8063 0.8746 0.0025  0.0118  -0.1398 162 ILE B CA  
3566 C C   . ILE B 136 ? 0.4120 0.5209 0.5905 -0.0003 0.0185  -0.1475 162 ILE B C   
3567 O O   . ILE B 136 ? 0.3715 0.4841 0.5559 -0.0065 0.0292  -0.1509 162 ILE B O   
3568 C CB  . ILE B 136 ? 0.9066 0.9947 1.0570 0.0009  0.0160  -0.1249 162 ILE B CB  
3569 C CG1 . ILE B 136 ? 0.9406 1.0183 1.0787 0.0023  0.0103  -0.1175 162 ILE B CG1 
3570 C CG2 . ILE B 136 ? 1.0221 1.1093 1.1705 -0.0060 0.0299  -0.1201 162 ILE B CG2 
3571 C CD1 . ILE B 136 ? 0.9430 1.0200 1.0832 -0.0011 0.0144  -0.1193 162 ILE B CD1 
3572 N N   . ALA B 137 ? 0.3128 0.4251 0.4940 0.0039  0.0124  -0.1505 163 ALA B N   
3573 C CA  . ALA B 137 ? 0.4299 0.5506 0.6195 0.0008  0.0189  -0.1561 163 ALA B CA  
3574 C C   . ALA B 137 ? 0.5804 0.7153 0.7892 0.0011  0.0182  -0.1727 163 ALA B C   
3575 O O   . ALA B 137 ? 0.7508 0.8936 0.9682 0.0031  0.0158  -0.1803 163 ALA B O   
3576 C CB  . ALA B 137 ? 0.5415 0.6601 0.7253 0.0046  0.0139  -0.1519 163 ALA B CB  
3577 N N   . GLN B 138 ? 0.5671 0.7060 0.7832 -0.0012 0.0205  -0.1792 164 GLN B N   
3578 C CA  . GLN B 138 ? 0.6740 0.8283 0.9093 -0.0018 0.0211  -0.1963 164 GLN B CA  
3579 C C   . GLN B 138 ? 0.7901 0.9472 1.0304 -0.0115 0.0357  -0.1999 164 GLN B C   
3580 O O   . GLN B 138 ? 0.9031 1.0504 1.1335 -0.0153 0.0414  -0.1911 164 GLN B O   
3581 C CB  . GLN B 138 ? 0.7338 0.8923 0.9754 0.0061  0.0076  -0.2050 164 GLN B CB  
3582 C CG  . GLN B 138 ? 0.8520 1.0064 1.0889 0.0150  -0.0078 -0.2031 164 GLN B CG  
3583 C CD  . GLN B 138 ? 1.0715 1.2297 1.3138 0.0220  -0.0227 -0.2115 164 GLN B CD  
3584 O OE1 . GLN B 138 ? 1.2260 1.3923 1.4771 0.0202  -0.0218 -0.2197 164 GLN B OE1 
3585 N NE2 . GLN B 138 ? 1.0953 1.2473 1.3316 0.0303  -0.0364 -0.2096 164 GLN B NE2 
3586 N N   . PRO B 139 ? 0.7320 0.9020 0.9875 -0.0156 0.0421  -0.2134 165 PRO B N   
3587 C CA  . PRO B 139 ? 0.8161 0.9881 1.0766 -0.0256 0.0570  -0.2187 165 PRO B CA  
3588 C C   . PRO B 139 ? 0.8940 1.0680 1.1587 -0.0267 0.0567  -0.2231 165 PRO B C   
3589 O O   . PRO B 139 ? 0.9453 1.1094 1.2018 -0.0333 0.0669  -0.2164 165 PRO B O   
3590 C CB  . PRO B 139 ? 0.9753 1.1644 1.2544 -0.0278 0.0601  -0.2360 165 PRO B CB  
3591 C CG  . PRO B 139 ? 0.9445 1.1428 1.2314 -0.0171 0.0440  -0.2421 165 PRO B CG  
3592 C CD  . PRO B 139 ? 0.7407 0.9238 1.0094 -0.0111 0.0358  -0.2252 165 PRO B CD  
3593 N N   . ASN B 140 ? 1.0225 1.2085 1.2991 -0.0197 0.0448  -0.2344 166 ASN B N   
3594 C CA  . ASN B 140 ? 1.0326 1.2208 1.3123 -0.0194 0.0425  -0.2390 166 ASN B CA  
3595 C C   . ASN B 140 ? 0.8589 1.0315 1.1209 -0.0144 0.0339  -0.2241 166 ASN B C   
3596 O O   . ASN B 140 ? 0.7375 0.9113 0.9992 -0.0076 0.0190  -0.2258 166 ASN B O   
3597 C CB  . ASN B 140 ? 1.1918 1.3990 1.4904 -0.0147 0.0321  -0.2576 166 ASN B CB  
3598 C CG  . ASN B 140 ? 1.1973 1.4078 1.4974 -0.0041 0.0159  -0.2592 166 ASN B CG  
3599 O OD1 . ASN B 140 ? 1.3158 1.5126 1.6010 0.0006  0.0099  -0.2456 166 ASN B OD1 
3600 N ND2 . ASN B 140 ? 0.8944 1.1234 1.2129 -0.0002 0.0087  -0.2766 166 ASN B ND2 
3601 N N   . TYR B 141 ? 0.8502 1.0078 1.0966 -0.0190 0.0425  -0.2086 167 TYR B N   
3602 C CA  . TYR B 141 ? 0.7241 0.8669 0.9533 -0.0154 0.0365  -0.1941 167 TYR B CA  
3603 C C   . TYR B 141 ? 0.6490 0.7826 0.8703 -0.0225 0.0475  -0.1867 167 TYR B C   
3604 O O   . TYR B 141 ? 0.6107 0.7395 0.8294 -0.0300 0.0609  -0.1831 167 TYR B O   
3605 C CB  . TYR B 141 ? 0.6142 0.7473 0.8302 -0.0122 0.0335  -0.1809 167 TYR B CB  
3606 C CG  . TYR B 141 ? 0.7046 0.8221 0.9021 -0.0128 0.0348  -0.1643 167 TYR B CG  
3607 C CD1 . TYR B 141 ? 0.7679 0.8783 0.9565 -0.0077 0.0243  -0.1599 167 TYR B CD1 
3608 C CD2 . TYR B 141 ? 0.7594 0.8679 0.9469 -0.0183 0.0462  -0.1536 167 TYR B CD2 
3609 C CE1 . TYR B 141 ? 0.6663 0.7638 0.8390 -0.0085 0.0260  -0.1459 167 TYR B CE1 
3610 C CE2 . TYR B 141 ? 0.6462 0.7419 0.8176 -0.0182 0.0471  -0.1395 167 TYR B CE2 
3611 C CZ  . TYR B 141 ? 0.6398 0.7315 0.8051 -0.0135 0.0374  -0.1360 167 TYR B CZ  
3612 O OH  . TYR B 141 ? 0.5058 0.5861 0.6561 -0.0138 0.0387  -0.1231 167 TYR B OH  
3613 N N   . ILE B 142 ? 0.6277 0.7567 0.8436 -0.0201 0.0415  -0.1846 168 ILE B N   
3614 C CA  . ILE B 142 ? 0.5215 0.6406 0.7285 -0.0257 0.0505  -0.1765 168 ILE B CA  
3615 C C   . ILE B 142 ? 0.5109 0.6167 0.7007 -0.0212 0.0428  -0.1626 168 ILE B C   
3616 O O   . ILE B 142 ? 0.5065 0.6125 0.6939 -0.0162 0.0288  -0.1632 168 ILE B O   
3617 C CB  . ILE B 142 ? 0.5195 0.6461 0.7367 -0.0292 0.0522  -0.1883 168 ILE B CB  
3618 C CG1 . ILE B 142 ? 0.6028 0.7445 0.8385 -0.0337 0.0597  -0.2047 168 ILE B CG1 
3619 C CG2 . ILE B 142 ? 0.4712 0.5867 0.6792 -0.0351 0.0627  -0.1802 168 ILE B CG2 
3620 C CD1 . ILE B 142 ? 0.5894 0.7409 0.8368 -0.0383 0.0617  -0.2176 168 ILE B CD1 
3621 N N   . PRO B 143 ? 0.6235 0.7178 0.8006 -0.0242 0.0508  -0.1488 169 PRO B N   
3622 C CA  . PRO B 143 ? 0.6743 0.7574 0.8355 -0.0206 0.0449  -0.1359 169 PRO B CA  
3623 C C   . PRO B 143 ? 0.6722 0.7516 0.8299 -0.0211 0.0413  -0.1363 169 PRO B C   
3624 O O   . PRO B 143 ? 0.6133 0.6937 0.7756 -0.0262 0.0501  -0.1406 169 PRO B O   
3625 C CB  . PRO B 143 ? 0.6244 0.6976 0.7752 -0.0247 0.0560  -0.1237 169 PRO B CB  
3626 C CG  . PRO B 143 ? 0.6079 0.6825 0.7665 -0.0317 0.0687  -0.1301 169 PRO B CG  
3627 C CD  . PRO B 143 ? 0.6889 0.7783 0.8644 -0.0313 0.0654  -0.1452 169 PRO B CD  
3628 N N   . THR B 144 ? 0.5816 0.6564 0.7305 -0.0168 0.0283  -0.1316 170 THR B N   
3629 C CA  . THR B 144 ? 0.5160 0.5866 0.6595 -0.0176 0.0234  -0.1306 170 THR B CA  
3630 C C   . THR B 144 ? 0.6354 0.6966 0.7692 -0.0218 0.0340  -0.1208 170 THR B C   
3631 O O   . THR B 144 ? 0.7400 0.7969 0.8691 -0.0225 0.0429  -0.1133 170 THR B O   
3632 C CB  . THR B 144 ? 0.6149 0.6799 0.7480 -0.0123 0.0080  -0.1263 170 THR B CB  
3633 O OG1 . THR B 144 ? 0.5859 0.6417 0.7061 -0.0112 0.0085  -0.1142 170 THR B OG1 
3634 C CG2 . THR B 144 ? 0.7790 0.8518 0.9205 -0.0069 -0.0032 -0.1357 170 THR B CG2 
3635 N N   . GLN B 145 ? 0.7562 0.8146 0.8870 -0.0240 0.0329  -0.1212 171 GLN B N   
3636 C CA  . GLN B 145 ? 0.8148 0.8644 0.9367 -0.0275 0.0422  -0.1126 171 GLN B CA  
3637 C C   . GLN B 145 ? 0.7430 0.7840 0.8504 -0.0246 0.0388  -0.0999 171 GLN B C   
3638 O O   . GLN B 145 ? 0.6282 0.6630 0.7284 -0.0260 0.0475  -0.0915 171 GLN B O   
3639 C CB  . GLN B 145 ? 0.8655 0.9145 0.9869 -0.0303 0.0400  -0.1163 171 GLN B CB  
3640 C CG  . GLN B 145 ? 0.8970 0.9392 1.0140 -0.0350 0.0524  -0.1113 171 GLN B CG  
3641 C CD  . GLN B 145 ? 1.1095 1.1528 1.2281 -0.0384 0.0510  -0.1169 171 GLN B CD  
3642 O OE1 . GLN B 145 ? 1.1566 1.2055 1.2782 -0.0368 0.0397  -0.1238 171 GLN B OE1 
3643 N NE2 . GLN B 145 ? 1.2333 1.2709 1.3494 -0.0427 0.0623  -0.1141 171 GLN B NE2 
3644 N N   . GLN B 146 ? 0.6522 0.6929 0.7552 -0.0205 0.0261  -0.0990 172 GLN B N   
3645 C CA  . GLN B 146 ? 0.4501 0.4838 0.5402 -0.0183 0.0224  -0.0884 172 GLN B CA  
3646 C C   . GLN B 146 ? 0.4511 0.4867 0.5425 -0.0168 0.0286  -0.0848 172 GLN B C   
3647 O O   . GLN B 146 ? 0.5000 0.5312 0.5826 -0.0165 0.0329  -0.0757 172 GLN B O   
3648 C CB  . GLN B 146 ? 0.5295 0.5605 0.6137 -0.0147 0.0075  -0.0892 172 GLN B CB  
3649 C CG  . GLN B 146 ? 0.7194 0.7425 0.7895 -0.0137 0.0038  -0.0792 172 GLN B CG  
3650 C CD  . GLN B 146 ? 0.7834 0.7997 0.8427 -0.0170 0.0067  -0.0722 172 GLN B CD  
3651 O OE1 . GLN B 146 ? 0.7931 0.8047 0.8421 -0.0173 0.0070  -0.0643 172 GLN B OE1 
3652 N NE2 . GLN B 146 ? 0.6920 0.7087 0.7540 -0.0196 0.0091  -0.0756 172 GLN B NE2 
3653 N N   . ASP B 147 ? 0.4286 0.4717 0.5312 -0.0156 0.0289  -0.0926 173 ASP B N   
3654 C CA  . ASP B 147 ? 0.3913 0.4370 0.4959 -0.0146 0.0353  -0.0904 173 ASP B CA  
3655 C C   . ASP B 147 ? 0.4800 0.5215 0.5811 -0.0185 0.0482  -0.0835 173 ASP B C   
3656 O O   . ASP B 147 ? 0.4393 0.4764 0.5318 -0.0178 0.0506  -0.0746 173 ASP B O   
3657 C CB  . ASP B 147 ? 0.4274 0.4825 0.5461 -0.0141 0.0351  -0.1015 173 ASP B CB  
3658 C CG  . ASP B 147 ? 0.4988 0.5570 0.6197 -0.0097 0.0209  -0.1064 173 ASP B CG  
3659 O OD1 . ASP B 147 ? 0.6349 0.6863 0.7452 -0.0074 0.0117  -0.1007 173 ASP B OD1 
3660 O OD2 . ASP B 147 ? 0.3031 0.3700 0.4361 -0.0085 0.0193  -0.1161 173 ASP B OD2 
3661 N N   . VAL B 148 ? 0.5400 0.5810 0.6464 -0.0228 0.0553  -0.0877 174 VAL B N   
3662 C CA  . VAL B 148 ? 0.5980 0.6300 0.6989 -0.0267 0.0666  -0.0816 174 VAL B CA  
3663 C C   . VAL B 148 ? 0.6563 0.6799 0.7436 -0.0251 0.0659  -0.0705 174 VAL B C   
3664 O O   . VAL B 148 ? 0.6932 0.7081 0.7724 -0.0251 0.0724  -0.0628 174 VAL B O   
3665 C CB  . VAL B 148 ? 0.4955 0.5276 0.6043 -0.0318 0.0739  -0.0892 174 VAL B CB  
3666 C CG1 . VAL B 148 ? 0.4243 0.4439 0.5261 -0.0350 0.0861  -0.0832 174 VAL B CG1 
3667 C CG2 . VAL B 148 ? 0.5303 0.5733 0.6541 -0.0336 0.0741  -0.1020 174 VAL B CG2 
3668 N N   . LEU B 149 ? 0.7145 0.7402 0.7988 -0.0231 0.0579  -0.0702 175 LEU B N   
3669 C CA  . LEU B 149 ? 0.7837 0.8032 0.8561 -0.0222 0.0569  -0.0611 175 LEU B CA  
3670 C C   . LEU B 149 ? 0.5976 0.6164 0.6620 -0.0188 0.0537  -0.0536 175 LEU B C   
3671 O O   . LEU B 149 ? 0.4529 0.4664 0.5077 -0.0180 0.0555  -0.0456 175 LEU B O   
3672 C CB  . LEU B 149 ? 0.8435 0.8638 0.9137 -0.0217 0.0495  -0.0642 175 LEU B CB  
3673 C CG  . LEU B 149 ? 0.7924 0.8070 0.8513 -0.0225 0.0493  -0.0566 175 LEU B CG  
3674 C CD1 . LEU B 149 ? 0.7358 0.7448 0.7937 -0.0253 0.0593  -0.0532 175 LEU B CD1 
3675 C CD2 . LEU B 149 ? 0.7361 0.7485 0.7913 -0.0243 0.0391  -0.0592 175 LEU B CD2 
3676 N N   . ARG B 150 ? 0.4740 0.4988 0.5427 -0.0165 0.0488  -0.0571 176 ARG B N   
3677 C CA  . ARG B 150 ? 0.4196 0.4452 0.4817 -0.0136 0.0454  -0.0513 176 ARG B CA  
3678 C C   . ARG B 150 ? 0.4750 0.4986 0.5357 -0.0132 0.0515  -0.0477 176 ARG B C   
3679 O O   . ARG B 150 ? 0.4233 0.4476 0.4777 -0.0108 0.0498  -0.0423 176 ARG B O   
3680 C CB  . ARG B 150 ? 0.4290 0.4598 0.4946 -0.0106 0.0365  -0.0570 176 ARG B CB  
3681 C CG  . ARG B 150 ? 0.3824 0.4083 0.4405 -0.0112 0.0264  -0.0558 176 ARG B CG  
3682 C CD  . ARG B 150 ? 0.5557 0.5784 0.6023 -0.0117 0.0280  -0.0471 176 ARG B CD  
3683 N NE  . ARG B 150 ? 0.7128 0.7300 0.7507 -0.0131 0.0186  -0.0457 176 ARG B NE  
3684 C CZ  . ARG B 150 ? 0.7430 0.7587 0.7747 -0.0123 0.0118  -0.0441 176 ARG B CZ  
3685 N NH1 . ARG B 150 ? 0.7567 0.7773 0.7912 -0.0100 0.0129  -0.0438 176 ARG B NH1 
3686 N NH2 . ARG B 150 ? 0.8370 0.8455 0.8592 -0.0143 0.0042  -0.0429 176 ARG B NH2 
3687 N N   . THR B 151 ? 0.5054 0.5268 0.5717 -0.0157 0.0590  -0.0510 177 THR B N   
3688 C CA  . THR B 151 ? 0.4275 0.4453 0.4913 -0.0151 0.0660  -0.0478 177 THR B CA  
3689 C C   . THR B 151 ? 0.6287 0.6386 0.6807 -0.0123 0.0697  -0.0378 177 THR B C   
3690 O O   . THR B 151 ? 0.8051 0.8113 0.8526 -0.0123 0.0689  -0.0346 177 THR B O   
3691 C CB  . THR B 151 ? 0.4289 0.4444 0.5005 -0.0189 0.0749  -0.0541 177 THR B CB  
3692 O OG1 . THR B 151 ? 0.5940 0.6020 0.6638 -0.0212 0.0804  -0.0532 177 THR B OG1 
3693 C CG2 . THR B 151 ? 0.3748 0.4003 0.4598 -0.0210 0.0709  -0.0655 177 THR B CG2 
3694 N N   . ARG B 152 ? 0.6158 0.6238 0.6629 -0.0096 0.0735  -0.0333 178 ARG B N   
3695 C CA  . ARG B 152 ? 0.5835 0.5860 0.6201 -0.0052 0.0764  -0.0241 178 ARG B CA  
3696 C C   . ARG B 152 ? 0.5352 0.5307 0.5681 -0.0034 0.0862  -0.0212 178 ARG B C   
3697 O O   . ARG B 152 ? 0.5363 0.5350 0.5703 -0.0029 0.0874  -0.0225 178 ARG B O   
3698 C CB  . ARG B 152 ? 0.6107 0.6203 0.6420 -0.0017 0.0685  -0.0200 178 ARG B CB  
3699 C CG  . ARG B 152 ? 0.7214 0.7395 0.7579 -0.0026 0.0629  -0.0249 178 ARG B CG  
3700 C CD  . ARG B 152 ? 0.6973 0.7220 0.7297 -0.0009 0.0545  -0.0228 178 ARG B CD  
3701 N NE  . ARG B 152 ? 0.6773 0.7034 0.7014 0.0035  0.0552  -0.0157 178 ARG B NE  
3702 C CZ  . ARG B 152 ? 0.7071 0.7321 0.7251 0.0057  0.0549  -0.0105 178 ARG B CZ  
3703 N NH1 . ARG B 152 ? 0.8099 0.8311 0.8282 0.0034  0.0541  -0.0112 178 ARG B NH1 
3704 N NH2 . ARG B 152 ? 0.6547 0.6834 0.6665 0.0105  0.0553  -0.0051 178 ARG B NH2 
3705 N N   . VAL B 153 ? 0.6737 0.6592 0.7018 -0.0022 0.0938  -0.0174 179 VAL B N   
3706 C CA  . VAL B 153 ? 0.8177 0.7938 0.8403 0.0000  0.1047  -0.0140 179 VAL B CA  
3707 C C   . VAL B 153 ? 0.9701 0.9411 0.9815 0.0074  0.1070  -0.0045 179 VAL B C   
3708 O O   . VAL B 153 ? 0.8447 0.8189 0.8542 0.0094  0.1012  -0.0016 179 VAL B O   
3709 C CB  . VAL B 153 ? 0.6354 0.6021 0.6624 -0.0053 0.1146  -0.0193 179 VAL B CB  
3710 C CG1 . VAL B 153 ? 0.3343 0.3077 0.3731 -0.0119 0.1138  -0.0296 179 VAL B CG1 
3711 C CG2 . VAL B 153 ? 0.5454 0.5082 0.5730 -0.0067 0.1140  -0.0193 179 VAL B CG2 
3712 N N   . LYS B 154 ? 1.1220 1.0855 1.1257 0.0116  0.1157  0.0000  180 LYS B N   
3713 C CA  . LYS B 154 ? 1.2501 1.2089 1.2426 0.0200  0.1188  0.0089  180 LYS B CA  
3714 C C   . LYS B 154 ? 1.2300 1.1760 1.2198 0.0200  0.1269  0.0104  180 LYS B C   
3715 O O   . LYS B 154 ? 1.1849 1.1250 1.1810 0.0132  0.1313  0.0044  180 LYS B O   
3716 C CB  . LYS B 154 ? 1.3923 1.3477 1.3758 0.0255  0.1253  0.0135  180 LYS B CB  
3717 C CG  . LYS B 154 ? 1.4633 1.4313 1.4495 0.0252  0.1181  0.0117  180 LYS B CG  
3718 C CD  . LYS B 154 ? 1.4753 1.4403 1.4513 0.0312  0.1246  0.0166  180 LYS B CD  
3719 C CE  . LYS B 154 ? 1.4362 1.4032 1.4011 0.0417  0.1237  0.0253  180 LYS B CE  
3720 N NZ  . LYS B 154 ? 1.2745 1.2399 1.2283 0.0483  0.1292  0.0300  180 LYS B NZ  
3721 N N   . THR B 155 ? 1.2576 1.2003 1.2383 0.0279  0.1288  0.0178  181 THR B N   
3722 C CA  . THR B 155 ? 1.3273 1.2581 1.3047 0.0289  0.1363  0.0195  181 THR B CA  
3723 C C   . THR B 155 ? 1.4411 1.3566 1.4062 0.0352  0.1495  0.0253  181 THR B C   
3724 O O   . THR B 155 ? 1.4306 1.3475 1.3865 0.0431  0.1505  0.0312  181 THR B O   
3725 C CB  . THR B 155 ? 1.2976 1.2356 1.2741 0.0331  0.1292  0.0229  181 THR B CB  
3726 O OG1 . THR B 155 ? 1.2437 1.1935 1.2297 0.0268  0.1180  0.0175  181 THR B OG1 
3727 C CG2 . THR B 155 ? 1.3797 1.3054 1.3531 0.0341  0.1373  0.0244  181 THR B CG2 
3728 N N   . THR B 156 ? 1.5413 1.4416 1.5054 0.0317  0.1602  0.0233  182 THR B N   
3729 C CA  . THR B 156 ? 1.6563 1.5386 1.6071 0.0371  0.1746  0.0285  182 THR B CA  
3730 C C   . THR B 156 ? 1.5131 1.3861 1.4574 0.0425  0.1796  0.0330  182 THR B C   
3731 O O   . THR B 156 ? 1.5574 1.4125 1.4960 0.0413  0.1925  0.0330  182 THR B O   
3732 C CB  . THR B 156 ? 1.7966 1.6659 1.7492 0.0284  0.1862  0.0223  182 THR B CB  
3733 O OG1 . THR B 156 ? 1.8557 1.7244 1.8196 0.0193  0.1862  0.0146  182 THR B OG1 
3734 C CG2 . THR B 156 ? 1.7265 1.6046 1.6844 0.0239  0.1827  0.0180  182 THR B CG2 
3735 N N   . GLY B 157 ? 2.0278 1.2621 1.3817 0.0004  0.1262  -0.1605 183 GLY B N   
3736 C CA  . GLY B 157 ? 1.9613 1.1918 1.3196 0.0138  0.1024  -0.1592 183 GLY B CA  
3737 C C   . GLY B 157 ? 1.9047 1.2119 1.3360 0.0109  0.1055  -0.1681 183 GLY B C   
3738 O O   . GLY B 157 ? 1.7521 1.1296 1.2424 0.0188  0.0949  -0.1693 183 GLY B O   
3739 N N   . ILE B 158 ? 2.0323 1.3213 1.4551 -0.0009 0.1200  -0.1744 184 ILE B N   
3740 C CA  . ILE B 158 ? 1.9815 1.3355 1.4673 -0.0042 0.1231  -0.1834 184 ILE B CA  
3741 C C   . ILE B 158 ? 1.8590 1.2863 1.4057 -0.0138 0.1395  -0.1912 184 ILE B C   
3742 O O   . ILE B 158 ? 1.8912 1.3110 1.4304 -0.0310 0.1669  -0.1972 184 ILE B O   
3743 C CB  . ILE B 158 ? 2.0014 1.3181 1.4629 -0.0202 0.1429  -0.1902 184 ILE B CB  
3744 C CG1 . ILE B 158 ? 1.9074 1.1345 1.2935 -0.0122 0.1286  -0.1827 184 ILE B CG1 
3745 C CG2 . ILE B 158 ? 1.9259 1.3051 1.4488 -0.0198 0.1398  -0.1986 184 ILE B CG2 
3746 C CD1 . ILE B 158 ? 1.8038 0.9807 1.1532 -0.0293 0.1490  -0.1884 184 ILE B CD1 
3747 N N   . VAL B 159 ? 1.6260 1.1221 1.2317 -0.0027 0.1223  -0.1925 185 VAL B N   
3748 C CA  . VAL B 159 ? 1.5806 1.1448 1.2434 -0.0086 0.1320  -0.2003 185 VAL B CA  
3749 C C   . VAL B 159 ? 1.6518 1.2759 1.3695 -0.0038 0.1208  -0.2058 185 VAL B C   
3750 O O   . VAL B 159 ? 1.7235 1.3621 1.4516 0.0113  0.0965  -0.2003 185 VAL B O   
3751 C CB  . VAL B 159 ? 1.4687 1.0515 1.1383 0.0015  0.1202  -0.1936 185 VAL B CB  
3752 C CG1 . VAL B 159 ? 1.2158 0.8681 0.9443 -0.0014 0.1245  -0.2020 185 VAL B CG1 
3753 C CG2 . VAL B 159 ? 1.6397 1.1663 1.2568 -0.0049 0.1339  -0.1895 185 VAL B CG2 
3754 N N   . GLU B 160 ? 1.6087 1.2674 1.3618 -0.0171 0.1389  -0.2183 186 GLU B N   
3755 C CA  . GLU B 160 ? 1.5354 1.2470 1.3366 -0.0139 0.1295  -0.2244 186 GLU B CA  
3756 C C   . GLU B 160 ? 1.4136 1.1677 1.2573 -0.0276 0.1480  -0.2398 186 GLU B C   
3757 O O   . GLU B 160 ? 1.3195 1.0581 1.1554 -0.0424 0.1722  -0.2484 186 GLU B O   
3758 C CB  . GLU B 160 ? 1.6657 1.3515 1.4505 -0.0111 0.1225  -0.2232 186 GLU B CB  
3759 C CG  . GLU B 160 ? 1.8714 1.5066 1.6209 -0.0265 0.1448  -0.2281 186 GLU B CG  
3760 C CD  . GLU B 160 ? 1.9775 1.6468 1.7644 -0.0423 0.1643  -0.2431 186 GLU B CD  
3761 O OE1 . GLU B 160 ? 2.0576 1.6917 1.8213 -0.0595 0.1883  -0.2500 186 GLU B OE1 
3762 O OE2 . GLU B 160 ? 1.9627 1.6916 1.8003 -0.0382 0.1557  -0.2487 186 GLU B OE2 
3763 N N   . THR B 161 ? 1.3621 1.1688 1.2505 -0.0226 0.1362  -0.2448 187 THR B N   
3764 C CA  . THR B 161 ? 1.3381 1.1881 1.2704 -0.0324 0.1478  -0.2610 187 THR B CA  
3765 C C   . THR B 161 ? 1.2775 1.1558 1.2365 -0.0304 0.1383  -0.2656 187 THR B C   
3766 O O   . THR B 161 ? 1.1987 1.0819 1.1551 -0.0188 0.1189  -0.2566 187 THR B O   
3767 C CB  . THR B 161 ? 1.2209 1.1116 1.1835 -0.0269 0.1408  -0.2646 187 THR B CB  
3768 O OG1 . THR B 161 ? 1.1474 1.0784 1.1537 -0.0347 0.1495  -0.2830 187 THR B OG1 
3769 C CG2 . THR B 161 ? 1.1517 1.0662 1.1228 -0.0113 0.1135  -0.2529 187 THR B CG2 
3770 N N   . HIS B 162 ? 1.2996 1.1971 1.2854 -0.0425 0.1528  -0.2811 188 HIS B N   
3771 C CA  . HIS B 162 ? 1.3131 1.2354 1.3230 -0.0421 0.1456  -0.2870 188 HIS B CA  
3772 C C   . HIS B 162 ? 1.2909 1.2675 1.3486 -0.0415 0.1399  -0.3002 188 HIS B C   
3773 O O   . HIS B 162 ? 1.3456 1.3381 1.4255 -0.0496 0.1527  -0.3141 188 HIS B O   
3774 C CB  . HIS B 162 ? 1.4187 1.3131 1.4165 -0.0563 0.1647  -0.2946 188 HIS B CB  
3775 C CG  . HIS B 162 ? 1.6409 1.4742 1.5857 -0.0561 0.1680  -0.2826 188 HIS B CG  
3776 N ND1 . HIS B 162 ? 1.7267 1.5427 1.6531 -0.0445 0.1506  -0.2726 188 HIS B ND1 
3777 C CD2 . HIS B 162 ? 1.7642 1.5465 1.6681 -0.0657 0.1857  -0.2803 188 HIS B CD2 
3778 C CE1 . HIS B 162 ? 1.8136 1.5702 1.6906 -0.0449 0.1545  -0.2647 188 HIS B CE1 
3779 N NE2 . HIS B 162 ? 1.8389 1.5712 1.6978 -0.0583 0.1761  -0.2682 188 HIS B NE2 
3780 N N   . PHE B 163 ? 1.1796 1.1827 1.2523 -0.0319 0.1202  -0.2974 189 PHE B N   
3781 C CA  . PHE B 163 ? 1.2126 1.2603 1.3229 -0.0294 0.1102  -0.3089 189 PHE B CA  
3782 C C   . PHE B 163 ? 1.2614 1.3262 1.3798 -0.0244 0.0952  -0.3080 189 PHE B C   
3783 O O   . PHE B 163 ? 1.2801 1.3301 1.3778 -0.0188 0.0872  -0.2960 189 PHE B O   
3784 C CB  . PHE B 163 ? 1.2537 1.3155 1.3670 -0.0197 0.0975  -0.3045 189 PHE B CB  
3785 C CG  . PHE B 163 ? 1.3113 1.3653 1.4020 -0.0084 0.0797  -0.2868 189 PHE B CG  
3786 C CD1 . PHE B 163 ? 1.2605 1.3377 1.3603 -0.0016 0.0612  -0.2852 189 PHE B CD1 
3787 C CD2 . PHE B 163 ? 1.4065 1.4293 1.4666 -0.0059 0.0813  -0.2718 189 PHE B CD2 
3788 C CE1 . PHE B 163 ? 1.2523 1.3245 1.3343 0.0056  0.0474  -0.2698 189 PHE B CE1 
3789 C CE2 . PHE B 163 ? 1.3909 1.4110 1.4365 0.0034  0.0649  -0.2570 189 PHE B CE2 
3790 C CZ  . PHE B 163 ? 1.3210 1.3673 1.3791 0.0082  0.0493  -0.2565 189 PHE B CZ  
3791 N N   . THR B 164 ? 1.2878 1.3837 1.4372 -0.0265 0.0912  -0.3225 190 THR B N   
3792 C CA  . THR B 164 ? 1.2770 1.3885 1.4327 -0.0229 0.0776  -0.3233 190 THR B CA  
3793 C C   . THR B 164 ? 1.2035 1.3373 1.3653 -0.0132 0.0568  -0.3224 190 THR B C   
3794 O O   . THR B 164 ? 1.1617 1.3111 1.3403 -0.0107 0.0524  -0.3309 190 THR B O   
3795 C CB  . THR B 164 ? 1.3291 1.4547 1.5100 -0.0321 0.0856  -0.3404 190 THR B CB  
3796 O OG1 . THR B 164 ? 1.3534 1.4525 1.5234 -0.0426 0.1059  -0.3412 190 THR B OG1 
3797 C CG2 . THR B 164 ? 1.3202 1.4582 1.5032 -0.0285 0.0719  -0.3408 190 THR B CG2 
3798 N N   . PHE B 165 ? 1.1334 1.2666 1.2803 -0.0081 0.0441  -0.3134 191 PHE B N   
3799 C CA  . PHE B 165 ? 1.1202 1.2664 1.2635 -0.0009 0.0250  -0.3116 191 PHE B CA  
3800 C C   . PHE B 165 ? 1.1807 1.3290 1.3139 -0.0012 0.0170  -0.3095 191 PHE B C   
3801 O O   . PHE B 165 ? 1.2282 1.3662 1.3484 -0.0021 0.0207  -0.2992 191 PHE B O   
3802 C CB  . PHE B 165 ? 1.0580 1.1930 1.1818 0.0054  0.0195  -0.2983 191 PHE B CB  
3803 C CG  . PHE B 165 ? 1.0350 1.1768 1.1490 0.0118  0.0005  -0.2960 191 PHE B CG  
3804 C CD1 . PHE B 165 ? 1.0310 1.1876 1.1596 0.0154  -0.0112 -0.3081 191 PHE B CD1 
3805 C CD2 . PHE B 165 ? 1.0121 1.1447 1.1028 0.0141  -0.0063 -0.2812 191 PHE B CD2 
3806 C CE1 . PHE B 165 ? 1.0599 1.2147 1.1718 0.0218  -0.0305 -0.3056 191 PHE B CE1 
3807 C CE2 . PHE B 165 ? 1.0548 1.1877 1.1306 0.0181  -0.0222 -0.2783 191 PHE B CE2 
3808 C CZ  . PHE B 165 ? 1.0988 1.2393 1.1813 0.0222  -0.0350 -0.2903 191 PHE B CZ  
3809 N N   . LYS B 166 ? 1.1323 1.2948 1.2733 -0.0003 0.0053  -0.3192 192 LYS B N   
3810 C CA  . LYS B 166 ? 1.1497 1.3127 1.2793 -0.0023 -0.0010 -0.3193 192 LYS B CA  
3811 C C   . LYS B 166 ? 1.2662 1.4266 1.4027 -0.0085 0.0126  -0.3213 192 LYS B C   
3812 O O   . LYS B 166 ? 1.2168 1.3722 1.3417 -0.0097 0.0144  -0.3135 192 LYS B O   
3813 C CB  . LYS B 166 ? 1.1002 1.2549 1.2040 0.0001  -0.0080 -0.3043 192 LYS B CB  
3814 C CG  . LYS B 166 ? 1.0993 1.2518 1.1892 0.0058  -0.0240 -0.3020 192 LYS B CG  
3815 C CD  . LYS B 166 ? 1.1322 1.2742 1.1944 0.0050  -0.0282 -0.2884 192 LYS B CD  
3816 C CE  . LYS B 166 ? 1.2068 1.3402 1.2488 0.0101  -0.0451 -0.2857 192 LYS B CE  
3817 N NZ  . LYS B 166 ? 1.1790 1.2988 1.1910 0.0064  -0.0467 -0.2736 192 LYS B NZ  
3818 N N   . ASP B 167 ? 1.4365 1.6015 1.5944 -0.0129 0.0225  -0.3320 193 ASP B N   
3819 C CA  . ASP B 167 ? 1.5956 1.7542 1.7583 -0.0191 0.0352  -0.3355 193 ASP B CA  
3820 C C   . ASP B 167 ? 1.5440 1.6820 1.6903 -0.0183 0.0437  -0.3227 193 ASP B C   
3821 O O   . ASP B 167 ? 1.4231 1.5541 1.5659 -0.0201 0.0479  -0.3220 193 ASP B O   
3822 C CB  . ASP B 167 ? 1.7109 1.8775 1.8729 -0.0208 0.0285  -0.3416 193 ASP B CB  
3823 C CG  . ASP B 167 ? 1.7644 1.9483 1.9437 -0.0214 0.0190  -0.3562 193 ASP B CG  
3824 O OD1 . ASP B 167 ? 1.7833 1.9761 1.9790 -0.0198 0.0169  -0.3628 193 ASP B OD1 
3825 O OD2 . ASP B 167 ? 1.7520 1.9403 1.9292 -0.0231 0.0130  -0.3624 193 ASP B OD2 
3826 N N   . LEU B 168 ? 1.5579 1.6859 1.6947 -0.0146 0.0446  -0.3129 194 LEU B N   
3827 C CA  . LEU B 168 ? 1.4571 1.5634 1.5774 -0.0122 0.0492  -0.3007 194 LEU B CA  
3828 C C   . LEU B 168 ? 1.3740 1.4602 1.4882 -0.0143 0.0607  -0.2989 194 LEU B C   
3829 O O   . LEU B 168 ? 1.4043 1.4956 1.5220 -0.0135 0.0605  -0.2994 194 LEU B O   
3830 C CB  . LEU B 168 ? 1.4289 1.5378 1.5367 -0.0056 0.0379  -0.2891 194 LEU B CB  
3831 C CG  . LEU B 168 ? 1.4510 1.5737 1.5585 -0.0057 0.0302  -0.2906 194 LEU B CG  
3832 C CD1 . LEU B 168 ? 1.4559 1.5802 1.5509 -0.0019 0.0218  -0.2812 194 LEU B CD1 
3833 C CD2 . LEU B 168 ? 1.4226 1.5394 1.5326 -0.0069 0.0354  -0.2941 194 LEU B CD2 
3834 N N   . HIS B 169 ? 1.3048 1.3648 1.4071 -0.0169 0.0707  -0.2975 195 HIS B N   
3835 C CA  . HIS B 169 ? 1.3823 1.4140 1.4700 -0.0209 0.0839  -0.2959 195 HIS B CA  
3836 C C   . HIS B 169 ? 1.3845 1.3936 1.4475 -0.0128 0.0780  -0.2811 195 HIS B C   
3837 O O   . HIS B 169 ? 1.3624 1.3487 1.4077 -0.0077 0.0740  -0.2751 195 HIS B O   
3838 C CB  . HIS B 169 ? 1.4356 1.4407 1.5141 -0.0288 0.0978  -0.3026 195 HIS B CB  
3839 C CG  . HIS B 169 ? 1.4695 1.4959 1.5739 -0.0384 0.1051  -0.3177 195 HIS B CG  
3840 N ND1 . HIS B 169 ? 1.4403 1.4754 1.5617 -0.0488 0.1184  -0.3289 195 HIS B ND1 
3841 C CD2 . HIS B 169 ? 1.4265 1.4684 1.5446 -0.0393 0.1007  -0.3248 195 HIS B CD2 
3842 C CE1 . HIS B 169 ? 1.3528 1.4085 1.4985 -0.0553 0.1207  -0.3426 195 HIS B CE1 
3843 N NE2 . HIS B 169 ? 1.3545 1.4132 1.4966 -0.0496 0.1099  -0.3394 195 HIS B NE2 
3844 N N   . PHE B 170 ? 1.3195 1.3347 1.3821 -0.0107 0.0760  -0.2768 196 PHE B N   
3845 C CA  . PHE B 170 ? 1.2462 1.2420 1.2865 -0.0029 0.0693  -0.2635 196 PHE B CA  
3846 C C   . PHE B 170 ? 1.3617 1.3156 1.3744 -0.0064 0.0823  -0.2607 196 PHE B C   
3847 O O   . PHE B 170 ? 1.3243 1.2721 1.3394 -0.0163 0.0986  -0.2694 196 PHE B O   
3848 C CB  . PHE B 170 ? 1.1650 1.1835 1.2139 0.0012  0.0603  -0.2597 196 PHE B CB  
3849 C CG  . PHE B 170 ? 1.0760 1.1230 1.1375 0.0055  0.0458  -0.2588 196 PHE B CG  
3850 C CD1 . PHE B 170 ? 1.0720 1.1451 1.1534 0.0021  0.0436  -0.2691 196 PHE B CD1 
3851 C CD2 . PHE B 170 ? 1.0178 1.0627 1.0689 0.0123  0.0347  -0.2494 196 PHE B CD2 
3852 C CE1 . PHE B 170 ? 1.1394 1.2311 1.2240 0.0047  0.0313  -0.2683 196 PHE B CE1 
3853 C CE2 . PHE B 170 ? 1.0177 1.0850 1.0764 0.0133  0.0248  -0.2500 196 PHE B CE2 
3854 C CZ  . PHE B 170 ? 1.1319 1.2200 1.2042 0.0092  0.0235  -0.2586 196 PHE B CZ  
3855 N N   . LYS B 171 ? 1.5173 1.4406 1.5026 0.0016  0.0750  -0.2504 197 LYS B N   
3856 C CA  . LYS B 171 ? 1.6125 1.4878 1.5616 0.0000  0.0841  -0.2459 197 LYS B CA  
3857 C C   . LYS B 171 ? 1.4913 1.3554 1.4230 0.0111  0.0706  -0.2338 197 LYS B C   
3858 O O   . LYS B 171 ? 1.5783 1.4215 1.4930 0.0212  0.0575  -0.2283 197 LYS B O   
3859 C CB  . LYS B 171 ? 1.7782 1.6109 1.7006 -0.0007 0.0876  -0.2474 197 LYS B CB  
3860 C CG  . LYS B 171 ? 1.8839 1.7199 1.8181 -0.0135 0.1034  -0.2598 197 LYS B CG  
3861 C CD  . LYS B 171 ? 1.9145 1.6987 1.8139 -0.0148 0.1071  -0.2597 197 LYS B CD  
3862 C CE  . LYS B 171 ? 1.8359 1.6225 1.7467 -0.0297 0.1243  -0.2713 197 LYS B CE  
3863 N NZ  . LYS B 171 ? 1.7986 1.5290 1.6703 -0.0317 0.1279  -0.2707 197 LYS B NZ  
3864 N N   . MET B 172 ? 1.3291 1.2077 1.2670 0.0099  0.0727  -0.2314 198 MET B N   
3865 C CA  . MET B 172 ? 1.3033 1.1757 1.2278 0.0196  0.0599  -0.2206 198 MET B CA  
3866 C C   . MET B 172 ? 1.2631 1.0819 1.1446 0.0205  0.0655  -0.2147 198 MET B C   
3867 O O   . MET B 172 ? 1.3543 1.1549 1.2231 0.0107  0.0835  -0.2184 198 MET B O   
3868 C CB  . MET B 172 ? 1.3369 1.2447 1.2836 0.0188  0.0583  -0.2208 198 MET B CB  
3869 C CG  . MET B 172 ? 1.3533 1.2545 1.2858 0.0275  0.0465  -0.2101 198 MET B CG  
3870 S SD  . MET B 172 ? 1.3494 1.2898 1.3060 0.0278  0.0417  -0.2110 198 MET B SD  
3871 C CE  . MET B 172 ? 0.6530 0.6325 0.6374 0.0286  0.0300  -0.2152 198 MET B CE  
3872 N N   . PHE B 173 ? 1.1658 0.9581 1.0242 0.0320  0.0500  -0.2075 199 PHE B N   
3873 C CA  . PHE B 173 ? 1.2343 0.9681 1.0447 0.0350  0.0511  -0.2015 199 PHE B CA  
3874 C C   . PHE B 173 ? 1.2860 1.0179 1.0870 0.0449  0.0373  -0.1925 199 PHE B C   
3875 O O   . PHE B 173 ? 1.3167 1.0691 1.1329 0.0557  0.0182  -0.1903 199 PHE B O   
3876 C CB  . PHE B 173 ? 1.2435 0.9356 1.0270 0.0422  0.0417  -0.2022 199 PHE B CB  
3877 C CG  . PHE B 173 ? 1.3328 1.0124 1.1139 0.0315  0.0569  -0.2104 199 PHE B CG  
3878 C CD1 . PHE B 173 ? 1.4739 1.0994 1.2129 0.0208  0.0747  -0.2108 199 PHE B CD1 
3879 C CD2 . PHE B 173 ? 1.2598 0.9802 1.0788 0.0306  0.0544  -0.2174 199 PHE B CD2 
3880 C CE1 . PHE B 173 ? 1.4472 1.0607 1.1838 0.0091  0.0897  -0.2183 199 PHE B CE1 
3881 C CE2 . PHE B 173 ? 1.2979 1.0066 1.1149 0.0206  0.0681  -0.2254 199 PHE B CE2 
3882 C CZ  . PHE B 173 ? 1.3326 0.9885 1.1094 0.0097  0.0856  -0.2258 199 PHE B CZ  
3883 N N   . ASP B 174 ? 1.3102 1.0172 1.0864 0.0401  0.0483  -0.1890 200 ASP B N   
3884 C CA  . ASP B 174 ? 1.3495 1.0492 1.1121 0.0487  0.0367  -0.1805 200 ASP B CA  
3885 C C   . ASP B 174 ? 1.4552 1.0859 1.1607 0.0534  0.0339  -0.1750 200 ASP B C   
3886 O O   . ASP B 174 ? 1.4280 1.0158 1.0992 0.0432  0.0526  -0.1770 200 ASP B O   
3887 C CB  . ASP B 174 ? 1.3723 1.0984 1.1511 0.0412  0.0490  -0.1810 200 ASP B CB  
3888 C CG  . ASP B 174 ? 1.4512 1.1649 1.2118 0.0491  0.0388  -0.1722 200 ASP B CG  
3889 O OD1 . ASP B 174 ? 1.5049 1.2099 1.2568 0.0612  0.0184  -0.1665 200 ASP B OD1 
3890 O OD2 . ASP B 174 ? 1.4546 1.1682 1.2116 0.0433  0.0511  -0.1727 200 ASP B OD2 
3891 N N   . VAL B 175 ? 1.5023 1.1203 1.1961 0.0684  0.0106  -0.1695 201 VAL B N   
3892 C CA  . VAL B 175 ? 1.6207 1.1702 1.2579 0.0763  0.0018  -0.1645 201 VAL B CA  
3893 C C   . VAL B 175 ? 1.6756 1.1895 1.2755 0.0669  0.0197  -0.1600 201 VAL B C   
3894 O O   . VAL B 175 ? 1.7674 1.2317 1.3265 0.0568  0.0368  -0.1603 201 VAL B O   
3895 C CB  . VAL B 175 ? 1.7529 1.3045 1.3926 0.0944  -0.0276 -0.1615 201 VAL B CB  
3896 C CG1 . VAL B 175 ? 1.8836 1.3602 1.4616 0.1040  -0.0397 -0.1568 201 VAL B CG1 
3897 C CG2 . VAL B 175 ? 1.7197 1.3063 1.3976 0.1029  -0.0436 -0.1691 201 VAL B CG2 
3898 N N   . GLY B 176 ? 1.7136 1.2522 1.3267 0.0693  0.0166  -0.1558 202 GLY B N   
3899 C CA  . GLY B 176 ? 1.8200 1.3304 1.4025 0.0612  0.0331  -0.1528 202 GLY B CA  
3900 C C   . GLY B 176 ? 1.9462 1.4241 1.4955 0.0735  0.0151  -0.1441 202 GLY B C   
3901 O O   . GLY B 176 ? 1.8847 1.3569 1.4323 0.0887  -0.0111 -0.1417 202 GLY B O   
3902 N N   . GLY B 177 ? 2.1048 1.5624 1.6296 0.0668  0.0292  -0.1412 203 GLY B N   
3903 C CA  . GLY B 177 ? 2.1874 1.6122 1.6781 0.0773  0.0139  -0.1331 203 GLY B CA  
3904 C C   . GLY B 177 ? 2.2950 1.6411 1.7203 0.0846  0.0021  -0.1283 203 GLY B C   
3905 O O   . GLY B 177 ? 2.3912 1.7091 1.7902 0.0981  -0.0198 -0.1225 203 GLY B O   
3906 N N   . GLN B 178 ? 2.2943 1.6018 1.6912 0.0760  0.0153  -0.1312 204 GLN B N   
3907 C CA  . GLN B 178 ? 2.3734 1.5973 1.7007 0.0828  0.0034  -0.1271 204 GLN B CA  
3908 C C   . GLN B 178 ? 2.3783 1.6066 1.7205 0.0999  -0.0262 -0.1297 204 GLN B C   
3909 O O   . GLN B 178 ? 2.3840 1.6725 1.7838 0.0996  -0.0268 -0.1359 204 GLN B O   
3910 C CB  . GLN B 178 ? 2.3975 1.5662 1.6761 0.0630  0.0343  -0.1291 204 GLN B CB  
3911 C CG  . GLN B 178 ? 2.2745 1.4897 1.5992 0.0479  0.0570  -0.1383 204 GLN B CG  
3912 C CD  . GLN B 178 ? 2.1530 1.3831 1.5008 0.0589  0.0370  -0.1412 204 GLN B CD  
3913 O OE1 . GLN B 178 ? 2.1784 1.3494 1.4800 0.0699  0.0181  -0.1385 204 GLN B OE1 
3914 N NE2 . GLN B 178 ? 2.0480 1.3550 1.4660 0.0566  0.0401  -0.1478 204 GLN B NE2 
3915 N N   . ARG B 179 ? 2.3236 1.4867 1.6130 0.1153  -0.0514 -0.1264 205 ARG B N   
3916 C CA  . ARG B 179 ? 2.1885 1.3499 1.4895 0.1337  -0.0819 -0.1317 205 ARG B CA  
3917 C C   . ARG B 179 ? 2.0647 1.1717 1.3250 0.1285  -0.0747 -0.1341 205 ARG B C   
3918 O O   . ARG B 179 ? 2.0428 1.0698 1.2292 0.1207  -0.0635 -0.1291 205 ARG B O   
3919 C CB  . ARG B 179 ? 2.2346 1.3562 1.5049 0.1562  -0.1182 -0.1299 205 ARG B CB  
3920 C CG  . ARG B 179 ? 2.3108 1.3318 1.4880 0.1563  -0.1188 -0.1222 205 ARG B CG  
3921 C CD  . ARG B 179 ? 2.3529 1.3338 1.5015 0.1816  -0.1600 -0.1224 205 ARG B CD  
3922 N NE  . ARG B 179 ? 2.4403 1.3170 1.4917 0.1822  -0.1624 -0.1147 205 ARG B NE  
3923 C CZ  . ARG B 179 ? 2.4906 1.3417 1.5067 0.1759  -0.1524 -0.1069 205 ARG B CZ  
3924 N NH1 . ARG B 179 ? 2.4411 1.3643 1.5130 0.1698  -0.1409 -0.1057 205 ARG B NH1 
3925 N NH2 . ARG B 179 ? 2.5780 1.3279 1.4995 0.1758  -0.1543 -0.1004 205 ARG B NH2 
3926 N N   . SER B 180 ? 2.0201 1.1678 1.3258 0.1318  -0.0801 -0.1420 206 SER B N   
3927 C CA  . SER B 180 ? 2.1660 1.2669 1.4384 0.1274  -0.0746 -0.1451 206 SER B CA  
3928 C C   . SER B 180 ? 2.2405 1.2666 1.4582 0.1496  -0.1098 -0.1460 206 SER B C   
3929 O O   . SER B 180 ? 2.0586 1.0815 1.2769 0.1694  -0.1400 -0.1464 206 SER B O   
3930 C CB  . SER B 180 ? 2.1949 1.3669 1.5363 0.1236  -0.0685 -0.1540 206 SER B CB  
3931 O OG  . SER B 180 ? 2.2679 1.3955 1.5777 0.1177  -0.0608 -0.1571 206 SER B OG  
3932 N N   . GLU B 181 ? 2.4547 1.4194 1.6250 0.1467  -0.1070 -0.1474 207 GLU B N   
3933 C CA  . GLU B 181 ? 2.5785 1.4644 1.6914 0.1688  -0.1424 -0.1495 207 GLU B CA  
3934 C C   . GLU B 181 ? 2.6125 1.5508 1.7874 0.1945  -0.1792 -0.1615 207 GLU B C   
3935 O O   . GLU B 181 ? 2.4884 1.5200 1.7461 0.1917  -0.1730 -0.1677 207 GLU B O   
3936 C CB  . GLU B 181 ? 2.5574 1.3683 1.6081 0.1585  -0.1298 -0.1491 207 GLU B CB  
3937 C CG  . GLU B 181 ? 2.5401 1.2775 1.5123 0.1340  -0.0962 -0.1394 207 GLU B CG  
3938 C CD  . GLU B 181 ? 2.5603 1.2112 1.4606 0.1241  -0.0864 -0.1395 207 GLU B CD  
3939 O OE1 . GLU B 181 ? 2.5285 1.1869 1.4489 0.1352  -0.1030 -0.1470 207 GLU B OE1 
3940 O OE2 . GLU B 181 ? 2.5812 1.1549 1.4034 0.1043  -0.0611 -0.1328 207 GLU B OE2 
3941 N N   . ARG B 182 ? 2.7471 1.6226 1.8800 0.2193  -0.2177 -0.1662 208 ARG B N   
3942 C CA  . ARG B 182 ? 2.7237 1.6439 1.9139 0.2456  -0.2554 -0.1812 208 ARG B CA  
3943 C C   . ARG B 182 ? 2.5912 1.5613 1.8362 0.2444  -0.2509 -0.1924 208 ARG B C   
3944 O O   . ARG B 182 ? 2.4131 1.4574 1.7337 0.2560  -0.2660 -0.2056 208 ARG B O   
3945 C CB  . ARG B 182 ? 2.8579 1.6913 1.9856 0.2739  -0.2998 -0.1858 208 ARG B CB  
3946 C CG  . ARG B 182 ? 2.9213 1.6949 1.9857 0.2765  -0.3070 -0.1749 208 ARG B CG  
3947 C CD  . ARG B 182 ? 2.9976 1.6811 1.9975 0.3065  -0.3549 -0.1808 208 ARG B CD  
3948 N NE  . ARG B 182 ? 2.9306 1.6685 1.9999 0.3348  -0.3956 -0.2002 208 ARG B NE  
3949 C CZ  . ARG B 182 ? 2.8477 1.6244 1.9540 0.3475  -0.4158 -0.2055 208 ARG B CZ  
3950 N NH1 . ARG B 182 ? 2.7472 1.5126 1.8256 0.3357  -0.4006 -0.1914 208 ARG B NH1 
3951 N NH2 . ARG B 182 ? 2.8380 1.6654 2.0107 0.3715  -0.4505 -0.2264 208 ARG B NH2 
3952 N N   . LYS B 183 ? 2.6098 1.5382 1.8157 0.2291  -0.2288 -0.1881 209 LYS B N   
3953 C CA  . LYS B 183 ? 2.4700 1.4340 1.7179 0.2284  -0.2255 -0.1985 209 LYS B CA  
3954 C C   . LYS B 183 ? 2.3480 1.3607 1.6261 0.1981  -0.1805 -0.1934 209 LYS B C   
3955 O O   . LYS B 183 ? 2.2337 1.2753 1.5438 0.1938  -0.1730 -0.2008 209 LYS B O   
3956 C CB  . LYS B 183 ? 2.5081 1.3776 1.6865 0.2415  -0.2464 -0.2021 209 LYS B CB  
3957 C CG  . LYS B 183 ? 2.5090 1.3269 1.6579 0.2750  -0.2964 -0.2103 209 LYS B CG  
3958 C CD  . LYS B 183 ? 2.5546 1.2711 1.6275 0.2885  -0.3184 -0.2136 209 LYS B CD  
3959 C CE  . LYS B 183 ? 2.6096 1.2717 1.6522 0.3245  -0.3722 -0.2236 209 LYS B CE  
3960 N NZ  . LYS B 183 ? 2.6796 1.2347 1.6414 0.3398  -0.3975 -0.2272 209 LYS B NZ  
3961 N N   . LYS B 184 ? 2.3464 1.3685 1.6156 0.1781  -0.1519 -0.1822 210 LYS B N   
3962 C CA  . LYS B 184 ? 2.2224 1.2921 1.5227 0.1504  -0.1109 -0.1795 210 LYS B CA  
3963 C C   . LYS B 184 ? 1.9595 1.1392 1.3534 0.1485  -0.1061 -0.1852 210 LYS B C   
3964 O O   . LYS B 184 ? 1.8935 1.1227 1.3268 0.1313  -0.0808 -0.1874 210 LYS B O   
3965 C CB  . LYS B 184 ? 2.2429 1.2753 1.4951 0.1293  -0.0812 -0.1682 210 LYS B CB  
3966 C CG  . LYS B 184 ? 2.3345 1.2653 1.4972 0.1176  -0.0676 -0.1635 210 LYS B CG  
3967 C CD  . LYS B 184 ? 2.3853 1.2933 1.5131 0.0922  -0.0312 -0.1558 210 LYS B CD  
3968 C CE  . LYS B 184 ? 2.5240 1.3341 1.5648 0.0747  -0.0105 -0.1531 210 LYS B CE  
3969 N NZ  . LYS B 184 ? 2.5876 1.3777 1.5973 0.0480  0.0282  -0.1486 210 LYS B NZ  
3970 N N   . TRP B 185 ? 1.7889 1.0035 1.2156 0.1657  -0.1307 -0.1882 211 TRP B N   
3971 C CA  . TRP B 185 ? 1.6778 0.9892 1.1860 0.1638  -0.1276 -0.1937 211 TRP B CA  
3972 C C   . TRP B 185 ? 1.7199 1.0773 1.2778 0.1647  -0.1281 -0.2057 211 TRP B C   
3973 O O   . TRP B 185 ? 1.5590 0.9856 1.1708 0.1523  -0.1106 -0.2081 211 TRP B O   
3974 C CB  . TRP B 185 ? 1.6081 0.9399 1.1376 0.1824  -0.1559 -0.1972 211 TRP B CB  
3975 C CG  . TRP B 185 ? 1.7161 1.0262 1.2145 0.1790  -0.1520 -0.1857 211 TRP B CG  
3976 C CD1 . TRP B 185 ? 1.9425 1.1729 1.3710 0.1871  -0.1643 -0.1788 211 TRP B CD1 
3977 C CD2 . TRP B 185 ? 1.6513 1.0169 1.1842 0.1670  -0.1353 -0.1801 211 TRP B CD2 
3978 N NE1 . TRP B 185 ? 1.9218 1.1575 1.3417 0.1803  -0.1550 -0.1695 211 TRP B NE1 
3979 C CE2 . TRP B 185 ? 1.7476 1.0663 1.2320 0.1685  -0.1377 -0.1703 211 TRP B CE2 
3980 C CE3 . TRP B 185 ? 1.4636 0.9100 1.0600 0.1557  -0.1198 -0.1827 211 TRP B CE3 
3981 C CZ2 . TRP B 185 ? 1.6378 0.9905 1.1386 0.1594  -0.1249 -0.1635 211 TRP B CZ2 
3982 C CZ3 . TRP B 185 ? 1.3669 0.8435 0.9764 0.1472  -0.1086 -0.1757 211 TRP B CZ3 
3983 C CH2 . TRP B 185 ? 1.4551 0.8866 1.0189 0.1494  -0.1111 -0.1664 211 TRP B CH2 
3984 N N   . ILE B 186 ? 1.8293 1.1447 1.3659 0.1800  -0.1494 -0.2136 212 ILE B N   
3985 C CA  . ILE B 186 ? 1.7291 1.0836 1.3110 0.1837  -0.1532 -0.2268 212 ILE B CA  
3986 C C   . ILE B 186 ? 1.5727 0.9601 1.1748 0.1603  -0.1197 -0.2246 212 ILE B C   
3987 O O   . ILE B 186 ? 1.4781 0.9325 1.1393 0.1568  -0.1145 -0.2330 212 ILE B O   
3988 C CB  . ILE B 186 ? 1.9150 1.2028 1.4566 0.2023  -0.1787 -0.2346 212 ILE B CB  
3989 C CG1 . ILE B 186 ? 1.9004 1.1472 1.4160 0.2272  -0.2151 -0.2380 212 ILE B CG1 
3990 C CG2 . ILE B 186 ? 1.9757 1.3100 1.5709 0.2087  -0.1853 -0.2507 212 ILE B CG2 
3991 C CD1 . ILE B 186 ? 1.7622 1.0823 1.3476 0.2397  -0.2328 -0.2502 212 ILE B CD1 
3992 N N   . HIS B 187 ? 1.6486 0.9877 1.2012 0.1437  -0.0969 -0.2145 213 HIS B N   
3993 C CA  . HIS B 187 ? 1.6949 1.0604 1.2646 0.1211  -0.0653 -0.2143 213 HIS B CA  
3994 C C   . HIS B 187 ? 1.6621 1.1193 1.3029 0.1124  -0.0533 -0.2172 213 HIS B C   
3995 O O   . HIS B 187 ? 1.7208 1.2204 1.4002 0.1054  -0.0439 -0.2243 213 HIS B O   
3996 C CB  . HIS B 187 ? 1.8480 1.1610 1.3633 0.1017  -0.0388 -0.2044 213 HIS B CB  
3997 C CG  . HIS B 187 ? 2.1536 1.3700 1.5918 0.1037  -0.0432 -0.2019 213 HIS B CG  
3998 N ND1 . HIS B 187 ? 2.2603 1.4498 1.6828 0.0964  -0.0344 -0.2069 213 HIS B ND1 
3999 C CD2 . HIS B 187 ? 2.3413 1.4766 1.7086 0.1118  -0.0558 -0.1949 213 HIS B CD2 
4000 C CE1 . HIS B 187 ? 2.4052 1.4990 1.7486 0.0996  -0.0413 -0.2029 213 HIS B CE1 
4001 N NE2 . HIS B 187 ? 2.4808 1.5389 1.7880 0.1091  -0.0547 -0.1955 213 HIS B NE2 
4002 N N   . CYS B 188 ? 1.6153 1.0988 1.2692 0.1130  -0.0545 -0.2115 214 CYS B N   
4003 C CA  . CYS B 188 ? 1.5512 1.1128 1.2629 0.1044  -0.0439 -0.2126 214 CYS B CA  
4004 C C   . CYS B 188 ? 1.5789 1.1935 1.3415 0.1165  -0.0626 -0.2224 214 CYS B C   
4005 O O   . CYS B 188 ? 1.6155 1.2905 1.4243 0.1082  -0.0534 -0.2262 214 CYS B O   
4006 C CB  . CYS B 188 ? 1.4622 1.0293 1.1665 0.1003  -0.0385 -0.2031 214 CYS B CB  
4007 S SG  . CYS B 188 ? 2.4652 2.0179 2.1595 0.1212  -0.0688 -0.2013 214 CYS B SG  
4008 N N   . PHE B 189 ? 1.5409 1.1307 1.2937 0.1359  -0.0889 -0.2283 215 PHE B N   
4009 C CA  . PHE B 189 ? 1.5162 1.1547 1.3187 0.1473  -0.1059 -0.2416 215 PHE B CA  
4010 C C   . PHE B 189 ? 1.5800 1.2349 1.4064 0.1475  -0.1047 -0.2536 215 PHE B C   
4011 O O   . PHE B 189 ? 1.5644 1.2723 1.4396 0.1497  -0.1089 -0.2655 215 PHE B O   
4012 C CB  . PHE B 189 ? 1.4936 1.1037 1.2835 0.1689  -0.1362 -0.2468 215 PHE B CB  
4013 C CG  . PHE B 189 ? 1.3541 0.9553 1.1270 0.1698  -0.1396 -0.2367 215 PHE B CG  
4014 C CD1 . PHE B 189 ? 1.3794 0.9110 1.0947 0.1792  -0.1519 -0.2291 215 PHE B CD1 
4015 C CD2 . PHE B 189 ? 1.2498 0.9082 1.0603 0.1609  -0.1308 -0.2348 215 PHE B CD2 
4016 C CE1 . PHE B 189 ? 1.4100 0.9328 1.1089 0.1800  -0.1550 -0.2201 215 PHE B CE1 
4017 C CE2 . PHE B 189 ? 1.2802 0.9297 1.0749 0.1618  -0.1343 -0.2258 215 PHE B CE2 
4018 C CZ  . PHE B 189 ? 1.3345 0.9180 1.0750 0.1715  -0.1462 -0.2186 215 PHE B CZ  
4019 N N   . GLU B 190 ? 1.6756 1.2830 1.4656 0.1441  -0.0978 -0.2510 216 GLU B N   
4020 C CA  . GLU B 190 ? 1.7777 1.3936 1.5848 0.1445  -0.0968 -0.2619 216 GLU B CA  
4021 C C   . GLU B 190 ? 1.7711 1.4447 1.6169 0.1253  -0.0725 -0.2619 216 GLU B C   
4022 O O   . GLU B 190 ? 1.7923 1.4599 1.6232 0.1088  -0.0509 -0.2528 216 GLU B O   
4023 C CB  . GLU B 190 ? 1.9552 1.4954 1.7053 0.1460  -0.0972 -0.2588 216 GLU B CB  
4024 C CG  . GLU B 190 ? 2.1175 1.5935 1.8251 0.1680  -0.1265 -0.2606 216 GLU B CG  
4025 C CD  . GLU B 190 ? 2.2336 1.6262 1.8756 0.1679  -0.1264 -0.2567 216 GLU B CD  
4026 O OE1 . GLU B 190 ? 2.2677 1.6519 1.8958 0.1478  -0.0996 -0.2512 216 GLU B OE1 
4027 O OE2 . GLU B 190 ? 2.2618 1.5950 1.8650 0.1878  -0.1536 -0.2602 216 GLU B OE2 
4028 N N   . GLY B 191 ? 1.7320 1.4604 1.6273 0.1277  -0.0765 -0.2740 217 GLY B N   
4029 C CA  . GLY B 191 ? 1.6557 1.4344 1.5848 0.1116  -0.0573 -0.2759 217 GLY B CA  
4030 C C   . GLY B 191 ? 1.4952 1.3144 1.4414 0.0985  -0.0440 -0.2671 217 GLY B C   
4031 O O   . GLY B 191 ? 1.4764 1.3324 1.4454 0.0853  -0.0293 -0.2677 217 GLY B O   
4032 N N   . VAL B 192 ? 1.4056 1.2157 1.3392 0.1030  -0.0508 -0.2596 218 VAL B N   
4033 C CA  . VAL B 192 ? 1.3379 1.1819 1.2845 0.0924  -0.0408 -0.2514 218 VAL B CA  
4034 C C   . VAL B 192 ? 1.2194 1.1217 1.2092 0.0871  -0.0387 -0.2596 218 VAL B C   
4035 O O   . VAL B 192 ? 1.2796 1.1996 1.2908 0.0954  -0.0506 -0.2708 218 VAL B O   
4036 C CB  . VAL B 192 ? 1.2975 1.1236 1.2261 0.1003  -0.0516 -0.2440 218 VAL B CB  
4037 C CG1 . VAL B 192 ? 1.3091 1.1348 1.2493 0.1170  -0.0739 -0.2551 218 VAL B CG1 
4038 C CG2 . VAL B 192 ? 1.1637 1.0262 1.1075 0.0902  -0.0429 -0.2368 218 VAL B CG2 
4039 N N   . THR B 193 ? 1.0563 0.9861 1.0578 0.0729  -0.0236 -0.2559 219 THR B N   
4040 C CA  . THR B 193 ? 1.0295 1.0066 1.0627 0.0658  -0.0201 -0.2628 219 THR B CA  
4041 C C   . THR B 193 ? 1.0468 1.0447 1.0880 0.0659  -0.0255 -0.2606 219 THR B C   
4042 O O   . THR B 193 ? 1.0312 1.0505 1.0925 0.0685  -0.0315 -0.2713 219 THR B O   
4043 C CB  . THR B 193 ? 1.0235 1.0184 1.0623 0.0520  -0.0055 -0.2598 219 THR B CB  
4044 O OG1 . THR B 193 ? 1.0832 1.0599 1.1162 0.0504  0.0007  -0.2636 219 THR B OG1 
4045 C CG2 . THR B 193 ? 0.9300 0.9657 0.9931 0.0447  -0.0032 -0.2667 219 THR B CG2 
4046 N N   . ALA B 194 ? 1.0655 1.0568 1.0916 0.0623  -0.0224 -0.2483 220 ALA B N   
4047 C CA  . ALA B 194 ? 1.0774 1.0837 1.1065 0.0618  -0.0272 -0.2448 220 ALA B CA  
4048 C C   . ALA B 194 ? 1.1381 1.1148 1.1422 0.0678  -0.0320 -0.2337 220 ALA B C   
4049 O O   . ALA B 194 ? 1.2399 1.1887 1.2233 0.0678  -0.0266 -0.2270 220 ALA B O   
4050 C CB  . ALA B 194 ? 0.9402 0.9750 0.9776 0.0495  -0.0188 -0.2420 220 ALA B CB  
4051 N N   . ILE B 195 ? 1.0111 0.9928 1.0163 0.0718  -0.0409 -0.2330 221 ILE B N   
4052 C CA  . ILE B 195 ? 0.9386 0.8934 0.9196 0.0774  -0.0462 -0.2226 221 ILE B CA  
4053 C C   . ILE B 195 ? 0.8639 0.8372 0.8457 0.0703  -0.0433 -0.2152 221 ILE B C   
4054 O O   . ILE B 195 ? 0.8266 0.8280 0.8253 0.0651  -0.0442 -0.2202 221 ILE B O   
4055 C CB  . ILE B 195 ? 1.0325 0.9691 1.0096 0.0910  -0.0631 -0.2285 221 ILE B CB  
4056 C CG1 . ILE B 195 ? 1.1243 1.0363 1.0968 0.1005  -0.0694 -0.2366 221 ILE B CG1 
4057 C CG2 . ILE B 195 ? 0.9889 0.8950 0.9374 0.0965  -0.0688 -0.2174 221 ILE B CG2 
4058 C CD1 . ILE B 195 ? 1.1384 1.0293 1.1072 0.1168  -0.0901 -0.2445 221 ILE B CD1 
4059 N N   . ILE B 196 ? 0.9012 0.8562 0.8627 0.0695  -0.0391 -0.2042 222 ILE B N   
4060 C CA  . ILE B 196 ? 0.7351 0.7028 0.6945 0.0648  -0.0380 -0.1971 222 ILE B CA  
4061 C C   . ILE B 196 ? 0.7026 0.6466 0.6419 0.0722  -0.0463 -0.1900 222 ILE B C   
4062 O O   . ILE B 196 ? 0.7469 0.6644 0.6647 0.0743  -0.0425 -0.1830 222 ILE B O   
4063 C CB  . ILE B 196 ? 0.7077 0.6790 0.6651 0.0578  -0.0265 -0.1930 222 ILE B CB  
4064 C CG1 . ILE B 196 ? 0.7378 0.7299 0.7138 0.0511  -0.0195 -0.2008 222 ILE B CG1 
4065 C CG2 . ILE B 196 ? 0.6563 0.6393 0.6115 0.0550  -0.0283 -0.1873 222 ILE B CG2 
4066 C CD1 . ILE B 196 ? 0.6474 0.6450 0.6263 0.0450  -0.0098 -0.2010 222 ILE B CD1 
4067 N N   . PHE B 197 ? 0.7292 0.6823 0.6753 0.0753  -0.0568 -0.1934 223 PHE B N   
4068 C CA  . PHE B 197 ? 0.8059 0.7378 0.7346 0.0828  -0.0668 -0.1882 223 PHE B CA  
4069 C C   . PHE B 197 ? 0.7522 0.6911 0.6735 0.0776  -0.0642 -0.1789 223 PHE B C   
4070 O O   . PHE B 197 ? 0.6763 0.6404 0.6101 0.0703  -0.0635 -0.1806 223 PHE B O   
4071 C CB  . PHE B 197 ? 0.7308 0.6706 0.6739 0.0885  -0.0800 -0.1992 223 PHE B CB  
4072 C CG  . PHE B 197 ? 0.6510 0.5632 0.5758 0.0992  -0.0938 -0.1966 223 PHE B CG  
4073 C CD1 . PHE B 197 ? 0.7488 0.6234 0.6537 0.1113  -0.1026 -0.1967 223 PHE B CD1 
4074 C CD2 . PHE B 197 ? 0.6654 0.5856 0.5895 0.0971  -0.0987 -0.1937 223 PHE B CD2 
4075 C CE1 . PHE B 197 ? 0.7900 0.6362 0.6751 0.1219  -0.1172 -0.1936 223 PHE B CE1 
4076 C CE2 . PHE B 197 ? 0.7610 0.6563 0.6690 0.1072  -0.1123 -0.1911 223 PHE B CE2 
4077 C CZ  . PHE B 197 ? 0.7374 0.5957 0.6259 0.1200  -0.1221 -0.1910 223 PHE B CZ  
4078 N N   . CYS B 198 ? 0.7228 0.6362 0.6210 0.0810  -0.0624 -0.1698 224 CYS B N   
4079 C CA  . CYS B 198 ? 0.7156 0.6331 0.6063 0.0776  -0.0603 -0.1619 224 CYS B CA  
4080 C C   . CYS B 198 ? 0.7832 0.6867 0.6599 0.0833  -0.0714 -0.1574 224 CYS B C   
4081 O O   . CYS B 198 ? 0.8630 0.7380 0.7224 0.0916  -0.0781 -0.1564 224 CYS B O   
4082 C CB  . CYS B 198 ? 0.7056 0.6080 0.5837 0.0762  -0.0489 -0.1576 224 CYS B CB  
4083 S SG  . CYS B 198 ? 0.8300 0.7470 0.7253 0.0690  -0.0354 -0.1647 224 CYS B SG  
4084 N N   . VAL B 199 ? 0.6293 0.5495 0.5106 0.0788  -0.0742 -0.1549 225 VAL B N   
4085 C CA  . VAL B 199 ? 0.7354 0.6451 0.6052 0.0826  -0.0844 -0.1511 225 VAL B CA  
4086 C C   . VAL B 199 ? 0.7268 0.6359 0.5854 0.0801  -0.0828 -0.1423 225 VAL B C   
4087 O O   . VAL B 199 ? 0.7180 0.6458 0.5843 0.0730  -0.0809 -0.1421 225 VAL B O   
4088 C CB  . VAL B 199 ? 0.7430 0.6722 0.6303 0.0790  -0.0916 -0.1597 225 VAL B CB  
4089 C CG1 . VAL B 199 ? 0.7405 0.6609 0.6175 0.0810  -0.1012 -0.1563 225 VAL B CG1 
4090 C CG2 . VAL B 199 ? 0.7870 0.7158 0.6877 0.0845  -0.0966 -0.1714 225 VAL B CG2 
4091 N N   . ALA B 200 ? 0.7062 0.5902 0.5437 0.0863  -0.0840 -0.1356 226 ALA B N   
4092 C CA  . ALA B 200 ? 0.5777 0.4589 0.4045 0.0859  -0.0840 -0.1287 226 ALA B CA  
4093 C C   . ALA B 200 ? 0.5210 0.4073 0.3467 0.0839  -0.0937 -0.1263 226 ALA B C   
4094 O O   . ALA B 200 ? 0.5802 0.4520 0.3964 0.0885  -0.1022 -0.1251 226 ALA B O   
4095 C CB  . ALA B 200 ? 0.6637 0.5154 0.4674 0.0922  -0.0815 -0.1238 226 ALA B CB  
4096 N N   . LEU B 201 ? 0.6132 0.5173 0.4464 0.0766  -0.0926 -0.1263 227 LEU B N   
4097 C CA  . LEU B 201 ? 0.6532 0.5593 0.4821 0.0716  -0.0989 -0.1244 227 LEU B CA  
4098 C C   . LEU B 201 ? 0.6072 0.4919 0.4164 0.0777  -0.1053 -0.1163 227 LEU B C   
4099 O O   . LEU B 201 ? 0.6012 0.4802 0.4058 0.0768  -0.1122 -0.1158 227 LEU B O   
4100 C CB  . LEU B 201 ? 0.6523 0.5706 0.4820 0.0626  -0.0960 -0.1243 227 LEU B CB  
4101 C CG  . LEU B 201 ? 0.6940 0.6326 0.5401 0.0543  -0.0896 -0.1326 227 LEU B CG  
4102 C CD1 . LEU B 201 ? 0.7447 0.6861 0.5818 0.0463  -0.0885 -0.1314 227 LEU B CD1 
4103 C CD2 . LEU B 201 ? 0.6473 0.5963 0.5059 0.0485  -0.0900 -0.1411 227 LEU B CD2 
4104 N N   . SER B 202 ? 0.6938 0.5679 0.4930 0.0834  -0.1026 -0.1121 228 SER B N   
4105 C CA  . SER B 202 ? 0.8656 0.7196 0.6458 0.0893  -0.1075 -0.1053 228 SER B CA  
4106 C C   . SER B 202 ? 0.8500 0.6833 0.6176 0.0955  -0.1126 -0.1033 228 SER B C   
4107 O O   . SER B 202 ? 1.0087 0.8238 0.7593 0.0999  -0.1177 -0.0978 228 SER B O   
4108 C CB  . SER B 202 ? 0.8297 0.6803 0.6057 0.0938  -0.1021 -0.1056 228 SER B CB  
4109 O OG  . SER B 202 ? 0.7362 0.5865 0.5176 0.0950  -0.0925 -0.1103 228 SER B OG  
4110 N N   . ASP B 203 ? 0.6093 0.4425 0.3834 0.0968  -0.1128 -0.1085 229 ASP B N   
4111 C CA  . ASP B 203 ? 0.5836 0.3922 0.3424 0.1045  -0.1208 -0.1082 229 ASP B CA  
4112 C C   . ASP B 203 ? 0.6173 0.4302 0.3818 0.1035  -0.1331 -0.1110 229 ASP B C   
4113 O O   . ASP B 203 ? 0.6923 0.4873 0.4477 0.1107  -0.1438 -0.1135 229 ASP B O   
4114 C CB  . ASP B 203 ? 0.6241 0.4246 0.3840 0.1080  -0.1185 -0.1139 229 ASP B CB  
4115 C CG  . ASP B 203 ? 0.9132 0.6988 0.6600 0.1088  -0.1053 -0.1114 229 ASP B CG  
4116 O OD1 . ASP B 203 ? 1.1284 0.9134 0.8689 0.1074  -0.0987 -0.1073 229 ASP B OD1 
4117 O OD2 . ASP B 203 ? 0.8154 0.5893 0.5588 0.1105  -0.1013 -0.1150 229 ASP B OD2 
4118 N N   . TYR B 204 ? 0.6065 0.4409 0.3843 0.0941  -0.1318 -0.1120 230 TYR B N   
4119 C CA  . TYR B 204 ? 0.6901 0.5323 0.4762 0.0893  -0.1400 -0.1175 230 TYR B CA  
4120 C C   . TYR B 204 ? 0.6915 0.5115 0.4579 0.0941  -0.1488 -0.1110 230 TYR B C   
4121 O O   . TYR B 204 ? 0.6677 0.4869 0.4385 0.0944  -0.1590 -0.1171 230 TYR B O   
4122 C CB  . TYR B 204 ? 0.6611 0.5260 0.4588 0.0749  -0.1332 -0.1203 230 TYR B CB  
4123 C CG  . TYR B 204 ? 0.5824 0.4365 0.3613 0.0712  -0.1317 -0.1102 230 TYR B CG  
4124 C CD1 . TYR B 204 ? 0.6193 0.4697 0.3904 0.0737  -0.1261 -0.1036 230 TYR B CD1 
4125 C CD2 . TYR B 204 ? 0.5292 0.3757 0.2982 0.0655  -0.1370 -0.1091 230 TYR B CD2 
4126 C CE1 . TYR B 204 ? 0.7394 0.5773 0.4933 0.0726  -0.1277 -0.0965 230 TYR B CE1 
4127 C CE2 . TYR B 204 ? 0.5203 0.3520 0.2689 0.0629  -0.1371 -0.1001 230 TYR B CE2 
4128 C CZ  . TYR B 204 ? 0.6759 0.5025 0.4169 0.0674  -0.1333 -0.0940 230 TYR B CZ  
4129 O OH  . TYR B 204 ? 0.5969 0.4065 0.3177 0.0670  -0.1362 -0.0872 230 TYR B OH  
4130 N N   . ASP B 205 ? 0.7214 0.5243 0.4682 0.0980  -0.1453 -0.1006 231 ASP B N   
4131 C CA  . ASP B 205 ? 0.6739 0.4551 0.4010 0.1019  -0.1522 -0.0940 231 ASP B CA  
4132 C C   . ASP B 205 ? 0.6257 0.3770 0.3311 0.1140  -0.1571 -0.0907 231 ASP B C   
4133 O O   . ASP B 205 ? 0.7521 0.4822 0.4391 0.1184  -0.1631 -0.0856 231 ASP B O   
4134 C CB  . ASP B 205 ? 0.8496 0.6278 0.5671 0.0989  -0.1469 -0.0866 231 ASP B CB  
4135 C CG  . ASP B 205 ? 1.0316 0.8031 0.7418 0.1056  -0.1394 -0.0835 231 ASP B CG  
4136 O OD1 . ASP B 205 ? 1.0998 0.8717 0.8129 0.1088  -0.1348 -0.0867 231 ASP B OD1 
4137 O OD2 . ASP B 205 ? 0.9250 0.6902 0.6261 0.1071  -0.1383 -0.0796 231 ASP B OD2 
4138 N N   . LEU B 206 ? 0.7659 0.5118 0.4695 0.1187  -0.1541 -0.0937 232 LEU B N   
4139 C CA  . LEU B 206 ? 0.6540 0.3641 0.3284 0.1285  -0.1572 -0.0908 232 LEU B CA  
4140 C C   . LEU B 206 ? 0.7509 0.4411 0.4136 0.1354  -0.1746 -0.0927 232 LEU B C   
4141 O O   . LEU B 206 ? 0.8539 0.5596 0.5367 0.1347  -0.1851 -0.1017 232 LEU B O   
4142 C CB  . LEU B 206 ? 0.4922 0.1955 0.1641 0.1308  -0.1514 -0.0952 232 LEU B CB  
4143 C CG  . LEU B 206 ? 0.7544 0.4743 0.4372 0.1246  -0.1339 -0.0950 232 LEU B CG  
4144 C CD1 . LEU B 206 ? 0.8506 0.5581 0.5285 0.1265  -0.1284 -0.0996 232 LEU B CD1 
4145 C CD2 . LEU B 206 ? 0.7910 0.4999 0.4576 0.1245  -0.1239 -0.0893 232 LEU B CD2 
4146 N N   . VAL B 207 ? 0.7893 0.4460 0.4207 0.1419  -0.1779 -0.0862 233 VAL B N   
4147 C CA  . VAL B 207 ? 0.7242 0.3564 0.3398 0.1500  -0.1961 -0.0881 233 VAL B CA  
4148 C C   . VAL B 207 ? 0.9411 0.5507 0.5436 0.1589  -0.2074 -0.0951 233 VAL B C   
4149 O O   . VAL B 207 ? 1.0034 0.5917 0.5851 0.1609  -0.1983 -0.0933 233 VAL B O   
4150 C CB  . VAL B 207 ? 0.5670 0.1646 0.1482 0.1547  -0.1958 -0.0793 233 VAL B CB  
4151 C CG1 . VAL B 207 ? 0.5452 0.1127 0.1064 0.1643  -0.2162 -0.0819 233 VAL B CG1 
4152 C CG2 . VAL B 207 ? 0.6075 0.2233 0.2011 0.1477  -0.1883 -0.0744 233 VAL B CG2 
4153 N N   . LEU B 208 ? 1.1079 0.7204 0.7225 0.1643  -0.2274 -0.1048 234 LEU B N   
4154 C CA  . LEU B 208 ? 1.1203 0.7098 0.7251 0.1753  -0.2431 -0.1141 234 LEU B CA  
4155 C C   . LEU B 208 ? 1.3724 0.9022 0.9228 0.1854  -0.2457 -0.1055 234 LEU B C   
4156 O O   . LEU B 208 ? 1.5035 1.0074 1.0253 0.1884  -0.2505 -0.0994 234 LEU B O   
4157 C CB  . LEU B 208 ? 0.9507 0.5540 0.5813 0.1810  -0.2667 -0.1276 234 LEU B CB  
4158 C CG  . LEU B 208 ? 0.9638 0.5560 0.6029 0.1939  -0.2847 -0.1399 234 LEU B CG  
4159 C CD1 . LEU B 208 ? 0.8789 0.4985 0.5446 0.1882  -0.2710 -0.1443 234 LEU B CD1 
4160 C CD2 . LEU B 208 ? 0.9645 0.5768 0.6369 0.1992  -0.3081 -0.1568 234 LEU B CD2 
4161 N N   . ALA B 209 ? 1.4167 0.9216 0.9497 0.1896  -0.2416 -0.1055 235 ALA B N   
4162 C CA  . ALA B 209 ? 1.5276 0.9694 1.0021 0.1964  -0.2404 -0.0977 235 ALA B CA  
4163 C C   . ALA B 209 ? 1.5490 0.9477 0.9943 0.2119  -0.2694 -0.1010 235 ALA B C   
4164 O O   . ALA B 209 ? 1.4484 0.8709 0.9249 0.2177  -0.2906 -0.1108 235 ALA B O   
4165 C CB  . ALA B 209 ? 1.6582 1.0816 1.1194 0.1951  -0.2282 -0.0977 235 ALA B CB  
4166 N N   . GLU B 210 ? 1.7028 1.0363 1.0872 0.2179  -0.2698 -0.0939 236 GLU B N   
4167 C CA  . GLU B 210 ? 1.8797 1.1614 1.2247 0.2334  -0.2979 -0.0956 236 GLU B CA  
4168 C C   . GLU B 210 ? 1.8137 1.0960 1.1789 0.2483  -0.3284 -0.1097 236 GLU B C   
4169 O O   . GLU B 210 ? 1.7176 1.0192 1.1100 0.2564  -0.3526 -0.1196 236 GLU B O   
4170 C CB  . GLU B 210 ? 2.1313 1.3358 1.3996 0.2351  -0.2896 -0.0857 236 GLU B CB  
4171 C CG  . GLU B 210 ? 2.2440 1.4454 1.4922 0.2215  -0.2599 -0.0751 236 GLU B CG  
4172 C CD  . GLU B 210 ? 2.4314 1.5550 1.6028 0.2206  -0.2483 -0.0676 236 GLU B CD  
4173 O OE1 . GLU B 210 ? 2.5034 1.6202 1.6561 0.2098  -0.2233 -0.0613 236 GLU B OE1 
4174 O OE2 . GLU B 210 ? 2.4510 1.5181 1.5791 0.2306  -0.2641 -0.0690 236 GLU B OE2 
4175 N N   . ASP B 211 ? 1.6015 1.5166 1.4108 0.2312  -0.2059 -0.1598 237 ASP B N   
4176 C CA  . ASP B 211 ? 1.7108 1.6255 1.5137 0.2387  -0.2036 -0.1545 237 ASP B CA  
4177 C C   . ASP B 211 ? 1.5784 1.4988 1.3889 0.2359  -0.2039 -0.1539 237 ASP B C   
4178 O O   . ASP B 211 ? 1.4824 1.4112 1.2930 0.2404  -0.2074 -0.1512 237 ASP B O   
4179 C CB  . ASP B 211 ? 1.9666 1.8641 1.7548 0.2449  -0.1920 -0.1518 237 ASP B CB  
4180 C CG  . ASP B 211 ? 2.2037 2.0897 1.9934 0.2381  -0.1811 -0.1552 237 ASP B CG  
4181 O OD1 . ASP B 211 ? 2.2651 2.1579 2.0676 0.2296  -0.1839 -0.1605 237 ASP B OD1 
4182 O OD2 . ASP B 211 ? 2.3001 2.1696 2.0773 0.2416  -0.1696 -0.1532 237 ASP B OD2 
4183 N N   . GLU B 212 ? 1.5186 1.4357 1.3356 0.2287  -0.2003 -0.1572 238 GLU B N   
4184 C CA  . GLU B 212 ? 1.4852 1.4058 1.3081 0.2263  -0.1994 -0.1566 238 GLU B CA  
4185 C C   . GLU B 212 ? 1.3939 1.3280 1.2230 0.2249  -0.2087 -0.1557 238 GLU B C   
4186 O O   . GLU B 212 ? 1.2299 1.1697 1.0621 0.2215  -0.2162 -0.1577 238 GLU B O   
4187 C CB  . GLU B 212 ? 1.5352 1.4523 1.3648 0.2191  -0.1961 -0.1620 238 GLU B CB  
4188 C CG  . GLU B 212 ? 1.6524 1.5750 1.4882 0.2138  -0.2042 -0.1670 238 GLU B CG  
4189 C CD  . GLU B 212 ? 1.7393 1.6600 1.5810 0.2091  -0.2015 -0.1739 238 GLU B CD  
4190 O OE1 . GLU B 212 ? 1.7469 1.6712 1.5920 0.2063  -0.2087 -0.1784 238 GLU B OE1 
4191 O OE2 . GLU B 212 ? 1.7523 1.6675 1.5944 0.2086  -0.1922 -0.1755 238 GLU B OE2 
4192 N N   . GLU B 213 ? 1.4338 1.3725 1.2642 0.2271  -0.2074 -0.1532 239 GLU B N   
4193 C CA  . GLU B 213 ? 1.3943 1.3465 1.2306 0.2252  -0.2142 -0.1532 239 GLU B CA  
4194 C C   . GLU B 213 ? 1.3585 1.3118 1.2015 0.2165  -0.2164 -0.1555 239 GLU B C   
4195 O O   . GLU B 213 ? 1.5372 1.4939 1.3823 0.2113  -0.2224 -0.1575 239 GLU B O   
4196 C CB  . GLU B 213 ? 1.4150 1.3733 1.2496 0.2322  -0.2121 -0.1507 239 GLU B CB  
4197 C CG  . GLU B 213 ? 1.5199 1.4689 1.3517 0.2342  -0.2038 -0.1487 239 GLU B CG  
4198 C CD  . GLU B 213 ? 1.6456 1.6002 1.4742 0.2428  -0.2024 -0.1464 239 GLU B CD  
4199 O OE1 . GLU B 213 ? 1.7268 1.6938 1.5555 0.2480  -0.2080 -0.1472 239 GLU B OE1 
4200 O OE2 . GLU B 213 ? 1.6321 1.5793 1.4581 0.2447  -0.1958 -0.1447 239 GLU B OE2 
4201 N N   . MET B 214 ? 1.0725 1.0214 0.9170 0.2153  -0.2112 -0.1553 240 MET B N   
4202 C CA  . MET B 214 ? 0.8605 0.8087 0.7090 0.2087  -0.2129 -0.1574 240 MET B CA  
4203 C C   . MET B 214 ? 0.8663 0.8063 0.7143 0.2060  -0.2131 -0.1616 240 MET B C   
4204 O O   . MET B 214 ? 0.8937 0.8285 0.7402 0.2082  -0.2089 -0.1631 240 MET B O   
4205 C CB  . MET B 214 ? 0.7263 0.6752 0.5770 0.2092  -0.2079 -0.1560 240 MET B CB  
4206 C CG  . MET B 214 ? 0.5737 0.5146 0.4224 0.2130  -0.1997 -0.1557 240 MET B CG  
4207 S SD  . MET B 214 ? 1.1592 1.1006 1.0107 0.2133  -0.1942 -0.1546 240 MET B SD  
4208 C CE  . MET B 214 ? 0.7893 0.7434 0.6412 0.2173  -0.1974 -0.1510 240 MET B CE  
4209 N N   . ASN B 215 ? 0.9263 0.8648 0.7745 0.2016  -0.2177 -0.1642 241 ASN B N   
4210 C CA  . ASN B 215 ? 1.0127 0.9453 0.8600 0.2007  -0.2196 -0.1698 241 ASN B CA  
4211 C C   . ASN B 215 ? 1.0100 0.9403 0.8610 0.2015  -0.2134 -0.1736 241 ASN B C   
4212 O O   . ASN B 215 ? 1.0256 0.9568 0.8787 0.2021  -0.2079 -0.1712 241 ASN B O   
4213 C CB  . ASN B 215 ? 1.0035 0.9325 0.8462 0.1977  -0.2265 -0.1716 241 ASN B CB  
4214 C CG  . ASN B 215 ? 0.9671 0.8947 0.8088 0.1959  -0.2252 -0.1703 241 ASN B CG  
4215 O OD1 . ASN B 215 ? 1.0417 0.9720 0.8879 0.1970  -0.2196 -0.1695 241 ASN B OD1 
4216 N ND2 . ASN B 215 ? 0.7746 0.6964 0.6090 0.1931  -0.2297 -0.1703 241 ASN B ND2 
4217 N N   . ARG B 216 ? 0.9278 0.8560 0.7800 0.2015  -0.2142 -0.1807 242 ARG B N   
4218 C CA  . ARG B 216 ? 0.9403 0.8681 0.7977 0.2014  -0.2077 -0.1870 242 ARG B CA  
4219 C C   . ARG B 216 ? 0.8454 0.7739 0.7046 0.2011  -0.2064 -0.1871 242 ARG B C   
4220 O O   . ARG B 216 ? 0.8509 0.7793 0.7142 0.2009  -0.1985 -0.1879 242 ARG B O   
4221 C CB  . ARG B 216 ? 1.0765 1.0056 0.9362 0.2016  -0.2110 -0.1971 242 ARG B CB  
4222 C CG  . ARG B 216 ? 1.2615 1.1903 1.1217 0.2013  -0.2084 -0.1993 242 ARG B CG  
4223 C CD  . ARG B 216 ? 1.4247 1.3502 1.2870 0.2000  -0.1962 -0.1989 242 ARG B CD  
4224 N NE  . ARG B 216 ? 1.5875 1.5146 1.4567 0.1980  -0.1895 -0.2068 242 ARG B NE  
4225 C CZ  . ARG B 216 ? 1.6654 1.5968 1.5413 0.1961  -0.1872 -0.2190 242 ARG B CZ  
4226 N NH1 . ARG B 216 ? 1.6755 1.6096 1.5516 0.1961  -0.1911 -0.2242 242 ARG B NH1 
4227 N NH2 . ARG B 216 ? 1.6197 1.5542 1.5029 0.1940  -0.1809 -0.2272 242 ARG B NH2 
4228 N N   . MET B 217 ? 0.8139 0.7414 0.6686 0.2011  -0.2135 -0.1863 243 MET B N   
4229 C CA  . MET B 217 ? 0.9002 0.8273 0.7548 0.2012  -0.2129 -0.1867 243 MET B CA  
4230 C C   . MET B 217 ? 0.8204 0.7496 0.6774 0.2002  -0.2068 -0.1797 243 MET B C   
4231 O O   . MET B 217 ? 0.7191 0.6493 0.5801 0.2006  -0.2016 -0.1813 243 MET B O   
4232 C CB  . MET B 217 ? 0.7918 0.7136 0.6371 0.2015  -0.2208 -0.1861 243 MET B CB  
4233 C CG  . MET B 217 ? 0.8534 0.7729 0.6961 0.2025  -0.2205 -0.1873 243 MET B CG  
4234 S SD  . MET B 217 ? 0.8833 0.8060 0.7307 0.2070  -0.2206 -0.1995 243 MET B SD  
4235 C CE  . MET B 217 ? 0.9174 0.8353 0.7558 0.2113  -0.2306 -0.2062 243 MET B CE  
4236 N N   . HIS B 218 ? 0.8330 0.7639 0.6878 0.1995  -0.2078 -0.1729 244 HIS B N   
4237 C CA  . HIS B 218 ? 0.8850 0.8198 0.7417 0.2000  -0.2032 -0.1673 244 HIS B CA  
4238 C C   . HIS B 218 ? 0.8387 0.7723 0.6981 0.2029  -0.1951 -0.1671 244 HIS B C   
4239 O O   . HIS B 218 ? 0.9659 0.9005 0.8266 0.2043  -0.1901 -0.1645 244 HIS B O   
4240 C CB  . HIS B 218 ? 0.9419 0.8815 0.7964 0.1992  -0.2067 -0.1625 244 HIS B CB  
4241 C CG  . HIS B 218 ? 0.9229 0.8622 0.7739 0.1948  -0.2113 -0.1620 244 HIS B CG  
4242 N ND1 . HIS B 218 ? 0.7709 0.7041 0.6159 0.1925  -0.2170 -0.1642 244 HIS B ND1 
4243 C CD2 . HIS B 218 ? 0.8379 0.7807 0.6890 0.1921  -0.2101 -0.1598 244 HIS B CD2 
4244 C CE1 . HIS B 218 ? 0.7087 0.6392 0.5487 0.1884  -0.2185 -0.1630 244 HIS B CE1 
4245 N NE2 . HIS B 218 ? 0.7966 0.7337 0.6410 0.1875  -0.2141 -0.1606 244 HIS B NE2 
4246 N N   . GLU B 219 ? 0.7142 0.6442 0.5731 0.2036  -0.1931 -0.1699 245 GLU B N   
4247 C CA  . GLU B 219 ? 0.7227 0.6473 0.5815 0.2054  -0.1836 -0.1706 245 GLU B CA  
4248 C C   . GLU B 219 ? 0.8196 0.7430 0.6834 0.2036  -0.1780 -0.1758 245 GLU B C   
4249 O O   . GLU B 219 ? 0.8362 0.7551 0.6993 0.2049  -0.1698 -0.1742 245 GLU B O   
4250 C CB  . GLU B 219 ? 0.8597 0.7800 0.7171 0.2049  -0.1817 -0.1746 245 GLU B CB  
4251 C CG  . GLU B 219 ? 1.0682 0.9889 0.9201 0.2075  -0.1858 -0.1697 245 GLU B CG  
4252 C CD  . GLU B 219 ? 1.2175 1.1330 1.0673 0.2070  -0.1827 -0.1736 245 GLU B CD  
4253 O OE1 . GLU B 219 ? 1.2397 1.1544 1.0840 0.2099  -0.1849 -0.1698 245 GLU B OE1 
4254 O OE2 . GLU B 219 ? 1.3008 1.2141 1.1548 0.2037  -0.1778 -0.1813 245 GLU B OE2 
4255 N N   . SER B 220 ? 0.8309 0.7576 0.6987 0.2015  -0.1829 -0.1823 246 SER B N   
4256 C CA  . SER B 220 ? 0.7943 0.7221 0.6676 0.2004  -0.1792 -0.1890 246 SER B CA  
4257 C C   . SER B 220 ? 0.8441 0.7737 0.7168 0.2013  -0.1796 -0.1839 246 SER B C   
4258 O O   . SER B 220 ? 0.9095 0.8387 0.7859 0.2011  -0.1734 -0.1862 246 SER B O   
4259 C CB  . SER B 220 ? 0.7263 0.6581 0.6023 0.2001  -0.1857 -0.1985 246 SER B CB  
4260 O OG  . SER B 220 ? 0.6983 0.6333 0.5804 0.2000  -0.1827 -0.2066 246 SER B OG  
4261 N N   . MET B 221 ? 0.7863 0.7180 0.6547 0.2016  -0.1863 -0.1778 247 MET B N   
4262 C CA  . MET B 221 ? 0.7313 0.6656 0.5991 0.2017  -0.1865 -0.1733 247 MET B CA  
4263 C C   . MET B 221 ? 0.7250 0.6595 0.5935 0.2039  -0.1795 -0.1682 247 MET B C   
4264 O O   . MET B 221 ? 0.6185 0.5537 0.4893 0.2045  -0.1754 -0.1681 247 MET B O   
4265 C CB  . MET B 221 ? 0.6805 0.6165 0.5432 0.2000  -0.1937 -0.1690 247 MET B CB  
4266 C CG  . MET B 221 ? 0.4928 0.4247 0.3505 0.1990  -0.2005 -0.1732 247 MET B CG  
4267 S SD  . MET B 221 ? 1.0577 0.9874 0.9069 0.1955  -0.2063 -0.1683 247 MET B SD  
4268 C CE  . MET B 221 ? 0.6834 0.6168 0.5338 0.1938  -0.2020 -0.1646 247 MET B CE  
4269 N N   . LYS B 222 ? 0.6448 0.5783 0.5102 0.2061  -0.1785 -0.1643 248 LYS B N   
4270 C CA  . LYS B 222 ? 0.8089 0.7410 0.6716 0.2106  -0.1726 -0.1596 248 LYS B CA  
4271 C C   . LYS B 222 ? 0.8866 0.8100 0.7495 0.2113  -0.1628 -0.1625 248 LYS B C   
4272 O O   . LYS B 222 ? 0.9222 0.8440 0.7837 0.2142  -0.1579 -0.1600 248 LYS B O   
4273 C CB  . LYS B 222 ? 0.9363 0.8673 0.7933 0.2146  -0.1736 -0.1559 248 LYS B CB  
4274 C CG  . LYS B 222 ? 1.0171 0.9458 0.8681 0.2219  -0.1688 -0.1512 248 LYS B CG  
4275 C CD  . LYS B 222 ? 1.1515 1.0789 0.9950 0.2275  -0.1706 -0.1482 248 LYS B CD  
4276 C CE  . LYS B 222 ? 1.2627 1.1864 1.0972 0.2373  -0.1664 -0.1441 248 LYS B CE  
4277 N NZ  . LYS B 222 ? 1.2718 1.1938 1.0970 0.2448  -0.1685 -0.1417 248 LYS B NZ  
4278 N N   . LEU B 223 ? 0.8803 0.7984 0.7449 0.2083  -0.1595 -0.1687 249 LEU B N   
4279 C CA  . LEU B 223 ? 0.8918 0.8017 0.7576 0.2069  -0.1488 -0.1737 249 LEU B CA  
4280 C C   . LEU B 223 ? 0.8936 0.8082 0.7662 0.2052  -0.1481 -0.1774 249 LEU B C   
4281 O O   . LEU B 223 ? 0.9670 0.8762 0.8386 0.2063  -0.1403 -0.1769 249 LEU B O   
4282 C CB  . LEU B 223 ? 0.8469 0.7536 0.7156 0.2028  -0.1455 -0.1820 249 LEU B CB  
4283 C CG  . LEU B 223 ? 0.8953 0.7952 0.7674 0.1991  -0.1335 -0.1900 249 LEU B CG  
4284 C CD1 . LEU B 223 ? 1.0073 0.8926 0.8692 0.2022  -0.1225 -0.1841 249 LEU B CD1 
4285 C CD2 . LEU B 223 ? 0.8687 0.7680 0.7450 0.1943  -0.1300 -0.2000 249 LEU B CD2 
4286 N N   . PHE B 224 ? 0.8006 0.7237 0.6783 0.2032  -0.1564 -0.1811 250 PHE B N   
4287 C CA  . PHE B 224 ? 0.7736 0.7013 0.6560 0.2026  -0.1572 -0.1846 250 PHE B CA  
4288 C C   . PHE B 224 ? 0.8655 0.7943 0.7452 0.2052  -0.1565 -0.1767 250 PHE B C   
4289 O O   . PHE B 224 ? 0.9710 0.8994 0.8533 0.2056  -0.1515 -0.1782 250 PHE B O   
4290 C CB  . PHE B 224 ? 0.7741 0.7077 0.6573 0.2020  -0.1673 -0.1882 250 PHE B CB  
4291 C CG  . PHE B 224 ? 0.9372 0.8744 0.8226 0.2027  -0.1690 -0.1915 250 PHE B CG  
4292 C CD1 . PHE B 224 ? 1.1520 1.0917 1.0439 0.2024  -0.1663 -0.2022 250 PHE B CD1 
4293 C CD2 . PHE B 224 ? 1.0015 0.9402 0.8825 0.2034  -0.1729 -0.1849 250 PHE B CD2 
4294 C CE1 . PHE B 224 ? 1.1841 1.1273 1.0772 0.2041  -0.1683 -0.2056 250 PHE B CE1 
4295 C CE2 . PHE B 224 ? 1.1876 1.1283 1.0690 0.2044  -0.1741 -0.1877 250 PHE B CE2 
4296 C CZ  . PHE B 224 ? 1.2273 1.1699 1.1142 0.2053  -0.1723 -0.1977 250 PHE B CZ  
4297 N N   . ASP B 225 ? 0.9302 0.8620 0.8055 0.2069  -0.1615 -0.1695 251 ASP B N   
4298 C CA  . ASP B 225 ? 0.9633 0.8992 0.8370 0.2097  -0.1613 -0.1632 251 ASP B CA  
4299 C C   . ASP B 225 ? 0.8536 0.7825 0.7245 0.2138  -0.1523 -0.1615 251 ASP B C   
4300 O O   . ASP B 225 ? 0.9581 0.8894 0.8294 0.2162  -0.1501 -0.1594 251 ASP B O   
4301 C CB  . ASP B 225 ? 1.1825 1.1240 1.0529 0.2109  -0.1673 -0.1581 251 ASP B CB  
4302 C CG  . ASP B 225 ? 1.3292 1.2790 1.1999 0.2132  -0.1681 -0.1540 251 ASP B CG  
4303 O OD1 . ASP B 225 ? 1.4632 1.4141 1.3362 0.2137  -0.1649 -0.1544 251 ASP B OD1 
4304 O OD2 . ASP B 225 ? 1.2952 1.2520 1.1647 0.2146  -0.1721 -0.1513 251 ASP B OD2 
4305 N N   . SER B 226 ? 0.8737 0.7925 0.7404 0.2148  -0.1465 -0.1626 252 SER B N   
4306 C CA  . SER B 226 ? 1.0292 0.9361 0.8889 0.2189  -0.1364 -0.1607 252 SER B CA  
4307 C C   . SER B 226 ? 1.2067 1.1085 1.0711 0.2155  -0.1284 -0.1668 252 SER B C   
4308 O O   . SER B 226 ? 1.3870 1.2793 1.2459 0.2187  -0.1202 -0.1653 252 SER B O   
4309 C CB  . SER B 226 ? 1.1224 1.0171 0.9734 0.2206  -0.1315 -0.1599 252 SER B CB  
4310 O OG  . SER B 226 ? 1.3328 1.2327 1.1792 0.2248  -0.1389 -0.1547 252 SER B OG  
4311 N N   . ILE B 227 ? 1.1786 1.0865 1.0523 0.2097  -0.1309 -0.1745 253 ILE B N   
4312 C CA  . ILE B 227 ? 1.1802 1.0861 1.0602 0.2062  -0.1238 -0.1828 253 ILE B CA  
4313 C C   . ILE B 227 ? 1.3038 1.2175 1.1883 0.2074  -0.1267 -0.1822 253 ILE B C   
4314 O O   . ILE B 227 ? 1.3836 1.2918 1.2669 0.2088  -0.1193 -0.1818 253 ILE B O   
4315 C CB  . ILE B 227 ? 1.0769 0.9881 0.9655 0.2009  -0.1256 -0.1937 253 ILE B CB  
4316 C CG1 . ILE B 227 ? 0.8963 0.8007 0.7811 0.1991  -0.1225 -0.1950 253 ILE B CG1 
4317 C CG2 . ILE B 227 ? 1.1163 1.0277 1.0130 0.1972  -0.1178 -0.2044 253 ILE B CG2 
4318 C CD1 . ILE B 227 ? 0.8611 0.7489 0.7387 0.1983  -0.1083 -0.1949 253 ILE B CD1 
4319 N N   . CYS B 228 ? 1.3491 1.2738 1.2371 0.2069  -0.1368 -0.1820 254 CYS B N   
4320 C CA  . CYS B 228 ? 1.4075 1.3390 1.2988 0.2076  -0.1395 -0.1822 254 CYS B CA  
4321 C C   . CYS B 228 ? 1.6244 1.5571 1.5115 0.2114  -0.1389 -0.1736 254 CYS B C   
4322 O O   . CYS B 228 ? 1.7659 1.7024 1.6554 0.2122  -0.1383 -0.1737 254 CYS B O   
4323 C CB  . CYS B 228 ? 1.2257 1.1648 1.1179 0.2064  -0.1496 -0.1841 254 CYS B CB  
4324 S SG  . CYS B 228 ? 1.4622 1.4041 1.3477 0.2066  -0.1580 -0.1754 254 CYS B SG  
4325 N N   . ASN B 229 ? 1.5812 1.5117 1.4623 0.2144  -0.1395 -0.1671 255 ASN B N   
4326 C CA  . ASN B 229 ? 1.5018 1.4361 1.3793 0.2194  -0.1399 -0.1606 255 ASN B CA  
4327 C C   . ASN B 229 ? 1.5362 1.4591 1.4067 0.2251  -0.1310 -0.1585 255 ASN B C   
4328 O O   . ASN B 229 ? 1.5296 1.4550 1.3962 0.2312  -0.1310 -0.1541 255 ASN B O   
4329 C CB  . ASN B 229 ? 1.4142 1.3562 1.2893 0.2206  -0.1473 -0.1560 255 ASN B CB  
4330 C CG  . ASN B 229 ? 1.2817 1.2330 1.1608 0.2153  -0.1548 -0.1570 255 ASN B CG  
4331 O OD1 . ASN B 229 ? 1.1701 1.1209 1.0521 0.2120  -0.1555 -0.1610 255 ASN B OD1 
4332 N ND2 . ASN B 229 ? 1.3244 1.2832 1.2024 0.2149  -0.1603 -0.1541 255 ASN B ND2 
4333 N N   . ASN B 230 ? 1.5364 1.4461 1.4045 0.2233  -0.1231 -0.1623 256 ASN B N   
4334 C CA  . ASN B 230 ? 1.5229 1.4163 1.3810 0.2280  -0.1126 -0.1606 256 ASN B CA  
4335 C C   . ASN B 230 ? 1.5919 1.4829 1.4532 0.2274  -0.1065 -0.1637 256 ASN B C   
4336 O O   . ASN B 230 ? 1.3978 1.2933 1.2692 0.2211  -0.1056 -0.1709 256 ASN B O   
4337 C CB  . ASN B 230 ? 1.3856 1.2636 1.2384 0.2249  -0.1045 -0.1640 256 ASN B CB  
4338 C CG  . ASN B 230 ? 1.2957 1.1518 1.1331 0.2302  -0.0925 -0.1613 256 ASN B CG  
4339 O OD1 . ASN B 230 ? 1.1656 1.0057 0.9979 0.2262  -0.0820 -0.1654 256 ASN B OD1 
4340 N ND2 . ASN B 230 ? 1.3702 1.2246 1.1989 0.2394  -0.0934 -0.1549 256 ASN B ND2 
4341 N N   . LYS B 231 ? 1.8085 1.6931 1.6610 0.2350  -0.1028 -0.1590 257 LYS B N   
4342 C CA  . LYS B 231 ? 1.9402 1.8221 1.7947 0.2354  -0.0971 -0.1613 257 LYS B CA  
4343 C C   . LYS B 231 ? 1.8874 1.7534 1.7415 0.2297  -0.0847 -0.1684 257 LYS B C   
4344 O O   . LYS B 231 ? 1.9267 1.7934 1.7870 0.2270  -0.0803 -0.1734 257 LYS B O   
4345 C CB  . LYS B 231 ? 2.1131 1.9897 1.9559 0.2463  -0.0957 -0.1549 257 LYS B CB  
4346 C CG  . LYS B 231 ? 2.2103 2.1072 2.0571 0.2511  -0.1071 -0.1507 257 LYS B CG  
4347 C CD  . LYS B 231 ? 2.2120 2.1150 2.0563 0.2529  -0.1143 -0.1476 257 LYS B CD  
4348 C CE  . LYS B 231 ? 2.1686 2.0930 2.0182 0.2563  -0.1242 -0.1455 257 LYS B CE  
4349 N NZ  . LYS B 231 ? 2.1283 2.0596 1.9763 0.2577  -0.1310 -0.1436 257 LYS B NZ  
4350 N N   . TRP B 232 ? 1.7673 1.6196 1.6146 0.2274  -0.0785 -0.1698 258 TRP B N   
4351 C CA  . TRP B 232 ? 1.7573 1.5934 1.6036 0.2206  -0.0646 -0.1777 258 TRP B CA  
4352 C C   . TRP B 232 ? 1.6454 1.4958 1.5102 0.2106  -0.0664 -0.1893 258 TRP B C   
4353 O O   . TRP B 232 ? 1.6018 1.4440 1.4701 0.2034  -0.0555 -0.1990 258 TRP B O   
4354 C CB  . TRP B 232 ? 1.8949 1.7104 1.7262 0.2212  -0.0564 -0.1757 258 TRP B CB  
4355 C CG  . TRP B 232 ? 2.0244 1.8205 1.8526 0.2132  -0.0395 -0.1843 258 TRP B CG  
4356 C CD1 . TRP B 232 ? 1.9862 1.7826 1.8222 0.2033  -0.0343 -0.1939 258 TRP B CD1 
4357 C CD2 . TRP B 232 ? 2.1707 1.9441 1.9870 0.2139  -0.0249 -0.1853 258 TRP B CD2 
4358 N NE1 . TRP B 232 ? 2.0213 1.7975 1.8521 0.1966  -0.0166 -0.2015 258 TRP B NE1 
4359 C CE2 . TRP B 232 ? 2.1389 1.8993 1.9568 0.2029  -0.0102 -0.1960 258 TRP B CE2 
4360 C CE3 . TRP B 232 ? 2.2188 1.9814 2.0229 0.2229  -0.0224 -0.1788 258 TRP B CE3 
4361 C CZ2 . TRP B 232 ? 2.1651 1.9004 1.9722 0.1994  0.0077  -0.2002 258 TRP B CZ2 
4362 C CZ3 . TRP B 232 ? 2.1954 1.9324 1.9877 0.2208  -0.0056 -0.1822 258 TRP B CZ3 
4363 C CH2 . TRP B 232 ? 2.1774 1.9001 1.9710 0.2087  0.0098  -0.1927 258 TRP B CH2 
4364 N N   . PHE B 233 ? 1.5867 1.4583 1.4626 0.2105  -0.0797 -0.1892 259 PHE B N   
4365 C CA  . PHE B 233 ? 1.5091 1.3948 1.4001 0.2040  -0.0836 -0.2002 259 PHE B CA  
4366 C C   . PHE B 233 ? 1.4239 1.3255 1.3226 0.2060  -0.0929 -0.1999 259 PHE B C   
4367 O O   . PHE B 233 ? 1.3624 1.2774 1.2688 0.2044  -0.1018 -0.2043 259 PHE B O   
4368 C CB  . PHE B 233 ? 1.4604 1.3526 1.3542 0.2015  -0.0906 -0.2019 259 PHE B CB  
4369 C CG  . PHE B 233 ? 1.4388 1.3165 1.3260 0.1984  -0.0812 -0.2038 259 PHE B CG  
4370 C CD1 . PHE B 233 ? 1.4231 1.2981 1.3176 0.1907  -0.0718 -0.2168 259 PHE B CD1 
4371 C CD2 . PHE B 233 ? 1.5036 1.3708 1.3773 0.2033  -0.0814 -0.1936 259 PHE B CD2 
4372 C CE1 . PHE B 233 ? 1.4172 1.2776 1.3048 0.1869  -0.0618 -0.2189 259 PHE B CE1 
4373 C CE2 . PHE B 233 ? 1.5501 1.4019 1.4156 0.2008  -0.0722 -0.1949 259 PHE B CE2 
4374 C CZ  . PHE B 233 ? 1.4824 1.3300 1.3545 0.1921  -0.0619 -0.2073 259 PHE B CZ  
4375 N N   . THR B 234 ? 1.3992 1.2980 1.2940 0.2103  -0.0904 -0.1948 260 THR B N   
4376 C CA  . THR B 234 ? 1.4129 1.3255 1.3135 0.2123  -0.0980 -0.1939 260 THR B CA  
4377 C C   . THR B 234 ? 1.4133 1.3333 1.3252 0.2082  -0.0969 -0.2058 260 THR B C   
4378 O O   . THR B 234 ? 1.3413 1.2741 1.2583 0.2087  -0.1059 -0.2080 260 THR B O   
4379 C CB  . THR B 234 ? 1.4253 1.3337 1.3194 0.2182  -0.0950 -0.1866 260 THR B CB  
4380 O OG1 . THR B 234 ? 1.3411 1.2454 1.2248 0.2237  -0.0974 -0.1770 260 THR B OG1 
4381 C CG2 . THR B 234 ? 1.4799 1.4028 1.3800 0.2195  -0.1022 -0.1861 260 THR B CG2 
4382 N N   . ASP B 235 ? 1.4625 1.3738 1.3773 0.2044  -0.0854 -0.2143 261 ASP B N   
4383 C CA  . ASP B 235 ? 1.5338 1.4538 1.4608 0.2006  -0.0835 -0.2279 261 ASP B CA  
4384 C C   . ASP B 235 ? 1.4268 1.3532 1.3620 0.1957  -0.0846 -0.2397 261 ASP B C   
4385 O O   . ASP B 235 ? 1.2968 1.2314 1.2432 0.1923  -0.0820 -0.2541 261 ASP B O   
4386 C CB  . ASP B 235 ? 1.6803 1.5890 1.6076 0.1982  -0.0696 -0.2330 261 ASP B CB  
4387 C CG  . ASP B 235 ? 1.7045 1.6100 1.6256 0.2040  -0.0697 -0.2239 261 ASP B CG  
4388 O OD1 . ASP B 235 ? 1.6867 1.6001 1.6043 0.2093  -0.0800 -0.2142 261 ASP B OD1 
4389 O OD2 . ASP B 235 ? 1.6999 1.5951 1.6198 0.2030  -0.0589 -0.2271 261 ASP B OD2 
4390 N N   . THR B 236 ? 1.4141 1.3383 1.3442 0.1957  -0.0889 -0.2347 262 THR B N   
4391 C CA  . THR B 236 ? 1.3101 1.2410 1.2473 0.1918  -0.0909 -0.2454 262 THR B CA  
4392 C C   . THR B 236 ? 1.2330 1.1780 1.1717 0.1959  -0.1063 -0.2453 262 THR B C   
4393 O O   . THR B 236 ? 1.2114 1.1559 1.1419 0.2000  -0.1144 -0.2331 262 THR B O   
4394 C CB  . THR B 236 ? 1.2940 1.2124 1.2239 0.1890  -0.0853 -0.2411 262 THR B CB  
4395 O OG1 . THR B 236 ? 1.3717 1.2724 1.2957 0.1860  -0.0699 -0.2405 262 THR B OG1 
4396 C CG2 . THR B 236 ? 1.2369 1.1635 1.1754 0.1845  -0.0865 -0.2539 262 THR B CG2 
4397 N N   . SER B 237 ? 1.1878 1.1448 1.1362 0.1950  -0.1098 -0.2599 263 SER B N   
4398 C CA  . SER B 237 ? 1.2499 1.2174 1.1967 0.2003  -0.1241 -0.2612 263 SER B CA  
4399 C C   . SER B 237 ? 1.3175 1.2834 1.2600 0.1999  -0.1294 -0.2587 263 SER B C   
4400 O O   . SER B 237 ? 1.3412 1.3108 1.2906 0.1966  -0.1264 -0.2699 263 SER B O   
4401 C CB  . SER B 237 ? 1.3553 1.3370 1.3127 0.2021  -0.1270 -0.2791 263 SER B CB  
4402 O OG  . SER B 237 ? 1.4777 1.4616 1.4390 0.2028  -0.1229 -0.2816 263 SER B OG  
4403 N N   . ILE B 238 ? 0.9898 1.4066 1.1072 0.0741  0.0111  -0.3305 264 ILE B N   
4404 C CA  . ILE B 238 ? 0.8961 1.2961 1.0049 0.0771  0.0059  -0.3121 264 ILE B CA  
4405 C C   . ILE B 238 ? 0.7532 1.1600 0.8532 0.0695  0.0070  -0.3010 264 ILE B C   
4406 O O   . ILE B 238 ? 0.6061 1.0359 0.7058 0.0627  0.0102  -0.3053 264 ILE B O   
4407 C CB  . ILE B 238 ? 0.9904 1.3939 1.1010 0.0812  0.0033  -0.3127 264 ILE B CB  
4408 C CG1 . ILE B 238 ? 0.9697 1.3628 1.0878 0.0901  0.0014  -0.3211 264 ILE B CG1 
4409 C CG2 . ILE B 238 ? 1.0736 1.4623 1.1750 0.0827  -0.0012 -0.2940 264 ILE B CG2 
4410 C CD1 . ILE B 238 ? 0.8964 1.2601 1.0111 0.0967  -0.0027 -0.3109 264 ILE B CD1 
4411 N N   . ILE B 239 ? 0.7326 1.1195 0.8254 0.0705  0.0045  -0.2866 265 ILE B N   
4412 C CA  . ILE B 239 ? 0.7128 1.1031 0.7971 0.0642  0.0053  -0.2747 265 ILE B CA  
4413 C C   . ILE B 239 ? 0.7494 1.1202 0.8260 0.0679  0.0004  -0.2565 265 ILE B C   
4414 O O   . ILE B 239 ? 0.8786 1.2248 0.9524 0.0740  -0.0036 -0.2474 265 ILE B O   
4415 C CB  . ILE B 239 ? 0.6445 1.0301 0.7264 0.0611  0.0071  -0.2730 265 ILE B CB  
4416 C CG1 . ILE B 239 ? 0.6319 1.0382 0.7213 0.0565  0.0124  -0.2918 265 ILE B CG1 
4417 C CG2 . ILE B 239 ? 0.4584 0.8468 0.5312 0.0552  0.0076  -0.2599 265 ILE B CG2 
4418 C CD1 . ILE B 239 ? 0.6519 1.0544 0.7399 0.0534  0.0145  -0.2923 265 ILE B CD1 
4419 N N   . LEU B 240 ? 0.6908 1.0729 0.7638 0.0640  0.0011  -0.2515 266 LEU B N   
4420 C CA  . LEU B 240 ? 0.4847 0.8505 0.5510 0.0667  -0.0028 -0.2355 266 LEU B CA  
4421 C C   . LEU B 240 ? 0.4926 0.8502 0.5502 0.0631  -0.0027 -0.2207 266 LEU B C   
4422 O O   . LEU B 240 ? 0.5302 0.9050 0.5859 0.0557  0.0012  -0.2221 266 LEU B O   
4423 C CB  . LEU B 240 ? 0.3488 0.7303 0.4162 0.0645  -0.0019 -0.2379 266 LEU B CB  
4424 C CG  . LEU B 240 ? 0.3890 0.7554 0.4506 0.0674  -0.0055 -0.2236 266 LEU B CG  
4425 C CD1 . LEU B 240 ? 0.3730 0.7146 0.4346 0.0763  -0.0108 -0.2187 266 LEU B CD1 
4426 C CD2 . LEU B 240 ? 0.3335 0.7180 0.3974 0.0646  -0.0039 -0.2288 266 LEU B CD2 
4427 N N   . PHE B 241 ? 0.4723 0.8041 0.5245 0.0681  -0.0070 -0.2066 267 PHE B N   
4428 C CA  . PHE B 241 ? 0.5688 0.8897 0.6130 0.0657  -0.0073 -0.1919 267 PHE B CA  
4429 C C   . PHE B 241 ? 0.5758 0.8832 0.6139 0.0675  -0.0101 -0.1771 267 PHE B C   
4430 O O   . PHE B 241 ? 0.6388 0.9228 0.6733 0.0731  -0.0144 -0.1674 267 PHE B O   
4431 C CB  . PHE B 241 ? 0.7365 1.0377 0.7790 0.0694  -0.0095 -0.1877 267 PHE B CB  
4432 C CG  . PHE B 241 ? 0.7857 1.0989 0.8297 0.0644  -0.0056 -0.1946 267 PHE B CG  
4433 C CD1 . PHE B 241 ? 0.8851 1.2212 0.9362 0.0608  -0.0016 -0.2117 267 PHE B CD1 
4434 C CD2 . PHE B 241 ? 0.5948 0.8969 0.6331 0.0632  -0.0059 -0.1845 267 PHE B CD2 
4435 C CE1 . PHE B 241 ? 0.8108 1.1589 0.8629 0.0556  0.0021  -0.2186 267 PHE B CE1 
4436 C CE2 . PHE B 241 ? 0.6648 0.9790 0.7043 0.0584  -0.0023 -0.1912 267 PHE B CE2 
4437 C CZ  . PHE B 241 ? 0.6918 1.0292 0.7380 0.0543  0.0017  -0.2083 267 PHE B CZ  
4438 N N   . LEU B 242 ? 0.5212 0.8436 0.5577 0.0622  -0.0074 -0.1757 268 LEU B N   
4439 C CA  . LEU B 242 ? 0.4753 0.7861 0.5062 0.0629  -0.0091 -0.1621 268 LEU B CA  
4440 C C   . LEU B 242 ? 0.4829 0.7786 0.5065 0.0620  -0.0096 -0.1473 268 LEU B C   
4441 O O   . LEU B 242 ? 0.5903 0.8975 0.6110 0.0560  -0.0062 -0.1445 268 LEU B O   
4442 C CB  . LEU B 242 ? 0.4633 0.7955 0.4948 0.0570  -0.0056 -0.1658 268 LEU B CB  
4443 C CG  . LEU B 242 ? 0.3557 0.7063 0.3949 0.0571  -0.0045 -0.1816 268 LEU B CG  
4444 C CD1 . LEU B 242 ? 0.1939 0.5650 0.2327 0.0508  -0.0010 -0.1841 268 LEU B CD1 
4445 C CD2 . LEU B 242 ? 0.2100 0.5447 0.2520 0.0652  -0.0091 -0.1822 268 LEU B CD2 
4446 N N   . ASN B 243 ? 0.4406 0.7108 0.4610 0.0679  -0.0138 -0.1379 269 ASN B N   
4447 C CA  . ASN B 243 ? 0.5399 0.7943 0.5542 0.0680  -0.0146 -0.1252 269 ASN B CA  
4448 C C   . ASN B 243 ? 0.7244 0.9639 0.7325 0.0684  -0.0157 -0.1096 269 ASN B C   
4449 O O   . ASN B 243 ? 0.7306 0.9706 0.7388 0.0688  -0.0161 -0.1083 269 ASN B O   
4450 C CB  . ASN B 243 ? 0.4671 0.7026 0.4808 0.0733  -0.0182 -0.1240 269 ASN B CB  
4451 C CG  . ASN B 243 ? 0.6072 0.8325 0.6163 0.0724  -0.0180 -0.1152 269 ASN B CG  
4452 O OD1 . ASN B 243 ? 0.7285 0.9687 0.7380 0.0672  -0.0143 -0.1173 269 ASN B OD1 
4453 N ND2 . ASN B 243 ? 0.5289 0.7299 0.5333 0.0770  -0.0220 -0.1053 269 ASN B ND2 
4454 N N   . LYS B 244 ? 0.7457 0.9719 0.7487 0.0685  -0.0161 -0.0983 270 LYS B N   
4455 C CA  . LYS B 244 ? 0.5802 0.7906 0.5777 0.0691  -0.0169 -0.0834 270 LYS B CA  
4456 C C   . LYS B 244 ? 0.4200 0.6459 0.4175 0.0639  -0.0130 -0.0829 270 LYS B C   
4457 O O   . LYS B 244 ? 0.3543 0.5706 0.3495 0.0647  -0.0135 -0.0753 270 LYS B O   
4458 C CB  . LYS B 244 ? 0.7590 0.9474 0.7536 0.0748  -0.0216 -0.0766 270 LYS B CB  
4459 C CG  . LYS B 244 ? 0.7826 0.9526 0.7743 0.0794  -0.0257 -0.0736 270 LYS B CG  
4460 C CD  . LYS B 244 ? 0.6740 0.8221 0.6596 0.0835  -0.0295 -0.0656 270 LYS B CD  
4461 C CE  . LYS B 244 ? 0.6914 0.8197 0.6709 0.0863  -0.0315 -0.0627 270 LYS B CE  
4462 N NZ  . LYS B 244 ? 0.7243 0.8294 0.6948 0.0878  -0.0317 -0.0559 270 LYS B NZ  
4463 N N   . LYS B 245 ? 0.4269 0.6770 0.4264 0.0579  -0.0090 -0.0912 271 LYS B N   
4464 C CA  . LYS B 245 ? 0.4925 0.7602 0.4910 0.0517  -0.0051 -0.0915 271 LYS B CA  
4465 C C   . LYS B 245 ? 0.5131 0.7704 0.5062 0.0504  -0.0040 -0.0771 271 LYS B C   
4466 O O   . LYS B 245 ? 0.6352 0.8959 0.6263 0.0475  -0.0021 -0.0731 271 LYS B O   
4467 C CB  . LYS B 245 ? 0.5170 0.8140 0.5178 0.0451  -0.0013 -0.1035 271 LYS B CB  
4468 C CG  . LYS B 245 ? 0.5180 0.8192 0.5172 0.0430  -0.0002 -0.1026 271 LYS B CG  
4469 C CD  . LYS B 245 ? 0.5289 0.8611 0.5295 0.0354  0.0037  -0.1145 271 LYS B CD  
4470 C CE  . LYS B 245 ? 0.6865 1.0249 0.6849 0.0325  0.0050  -0.1133 271 LYS B CE  
4471 N NZ  . LYS B 245 ? 0.6801 1.0503 0.6791 0.0243  0.0089  -0.1246 271 LYS B NZ  
4472 N N   . ASP B 246 ? 0.4773 0.7222 0.4681 0.0525  -0.0051 -0.0697 272 ASP B N   
4473 C CA  . ASP B 246 ? 0.6188 0.8526 0.6056 0.0522  -0.0041 -0.0562 272 ASP B CA  
4474 C C   . ASP B 246 ? 0.7164 0.9274 0.7018 0.0566  -0.0061 -0.0469 272 ASP B C   
4475 O O   . ASP B 246 ? 0.7455 0.9546 0.7286 0.0546  -0.0040 -0.0397 272 ASP B O   
4476 C CB  . ASP B 246 ? 0.6305 0.8544 0.6161 0.0545  -0.0051 -0.0510 272 ASP B CB  
4477 C CG  . ASP B 246 ? 0.6071 0.8088 0.5935 0.0614  -0.0096 -0.0497 272 ASP B CG  
4478 O OD1 . ASP B 246 ? 0.5744 0.7767 0.5630 0.0633  -0.0116 -0.0576 272 ASP B OD1 
4479 O OD2 . ASP B 246 ? 0.6071 0.7911 0.5916 0.0648  -0.0111 -0.0407 272 ASP B OD2 
4480 N N   . LEU B 247 ? 0.6084 0.8025 0.5946 0.0624  -0.0102 -0.0470 273 LEU B N   
4481 C CA  . LEU B 247 ? 0.4442 0.6176 0.4285 0.0663  -0.0125 -0.0389 273 LEU B CA  
4482 C C   . LEU B 247 ? 0.5049 0.6905 0.4905 0.0631  -0.0106 -0.0439 273 LEU B C   
4483 O O   . LEU B 247 ? 0.6805 0.8580 0.6642 0.0624  -0.0094 -0.0366 273 LEU B O   
4484 C CB  . LEU B 247 ? 0.3705 0.5231 0.3510 0.0711  -0.0154 -0.0392 273 LEU B CB  
4485 C CG  . LEU B 247 ? 0.3911 0.5237 0.3660 0.0727  -0.0150 -0.0339 273 LEU B CG  
4486 C CD1 . LEU B 247 ? 0.2183 0.3365 0.1898 0.0758  -0.0178 -0.0364 273 LEU B CD1 
4487 C CD2 . LEU B 247 ? 0.3928 0.5007 0.3607 0.0713  -0.0109 -0.0218 273 LEU B CD2 
4488 N N   . PHE B 248 ? 0.3759 0.5812 0.3650 0.0610  -0.0101 -0.0567 274 PHE B N   
4489 C CA  . PHE B 248 ? 0.5037 0.7235 0.4947 0.0575  -0.0081 -0.0631 274 PHE B CA  
4490 C C   . PHE B 248 ? 0.5154 0.7453 0.5035 0.0513  -0.0036 -0.0587 274 PHE B C   
4491 O O   . PHE B 248 ? 0.3919 0.6189 0.3787 0.0497  -0.0023 -0.0553 274 PHE B O   
4492 C CB  . PHE B 248 ? 0.6791 0.9217 0.6752 0.0557  -0.0075 -0.0786 274 PHE B CB  
4493 C CG  . PHE B 248 ? 0.7900 1.0482 0.7887 0.0526  -0.0056 -0.0864 274 PHE B CG  
4494 C CD1 . PHE B 248 ? 0.8534 1.1056 0.8549 0.0568  -0.0085 -0.0901 274 PHE B CD1 
4495 C CD2 . PHE B 248 ? 0.8292 1.1088 0.8271 0.0452  -0.0011 -0.0898 274 PHE B CD2 
4496 C CE1 . PHE B 248 ? 0.8850 1.1524 0.8894 0.0540  -0.0067 -0.0976 274 PHE B CE1 
4497 C CE2 . PHE B 248 ? 0.8244 1.1186 0.8244 0.0419  0.0007  -0.0970 274 PHE B CE2 
4498 C CZ  . PHE B 248 ? 0.8579 1.1461 0.8616 0.0465  -0.0020 -0.1012 274 PHE B CZ  
4499 N N   . GLU B 249 ? 0.6033 0.8453 0.5901 0.0474  -0.0012 -0.0586 275 GLU B N   
4500 C CA  . GLU B 249 ? 0.5005 0.7543 0.4836 0.0410  0.0029  -0.0541 275 GLU B CA  
4501 C C   . GLU B 249 ? 0.4824 0.7149 0.4623 0.0430  0.0030  -0.0407 275 GLU B C   
4502 O O   . GLU B 249 ? 0.4905 0.7292 0.4674 0.0383  0.0061  -0.0371 275 GLU B O   
4503 C CB  . GLU B 249 ? 0.4833 0.7511 0.4649 0.0374  0.0045  -0.0546 275 GLU B CB  
4504 C CG  . GLU B 249 ? 0.5959 0.8811 0.5731 0.0299  0.0084  -0.0508 275 GLU B CG  
4505 C CD  . GLU B 249 ? 0.8743 1.1790 0.8502 0.0254  0.0098  -0.0536 275 GLU B CD  
4506 O OE1 . GLU B 249 ? 0.8759 1.1805 0.8548 0.0281  0.0081  -0.0594 275 GLU B OE1 
4507 O OE2 . GLU B 249 ? 1.0073 1.3280 0.9789 0.0191  0.0126  -0.0499 275 GLU B OE2 
4508 N N   . GLU B 250 ? 0.5177 0.7251 0.4981 0.0499  -0.0002 -0.0336 276 GLU B N   
4509 C CA  . GLU B 250 ? 0.5009 0.6864 0.4792 0.0526  0.0000  -0.0217 276 GLU B CA  
4510 C C   . GLU B 250 ? 0.4354 0.6094 0.4139 0.0544  -0.0011 -0.0212 276 GLU B C   
4511 O O   . GLU B 250 ? 0.5495 0.7177 0.5261 0.0527  0.0012  -0.0158 276 GLU B O   
4512 C CB  . GLU B 250 ? 0.4844 0.6485 0.4632 0.0588  -0.0026 -0.0140 276 GLU B CB  
4513 C CG  . GLU B 250 ? 0.8615 1.0366 0.8402 0.0570  -0.0013 -0.0141 276 GLU B CG  
4514 C CD  . GLU B 250 ? 1.2331 1.3859 1.2112 0.0625  -0.0029 -0.0080 276 GLU B CD  
4515 O OE1 . GLU B 250 ? 1.2106 1.3345 1.1830 0.0649  -0.0022 -0.0052 276 GLU B OE1 
4516 O OE2 . GLU B 250 ? 1.4403 1.6015 1.4196 0.0618  -0.0024 -0.0072 276 GLU B OE2 
4517 N N   . LYS B 251 ? 0.4012 0.5726 0.3818 0.0578  -0.0046 -0.0271 277 LYS B N   
4518 C CA  . LYS B 251 ? 0.4992 0.6611 0.4799 0.0597  -0.0063 -0.0270 277 LYS B CA  
4519 C C   . LYS B 251 ? 0.6511 0.8308 0.6323 0.0537  -0.0027 -0.0332 277 LYS B C   
4520 O O   . LYS B 251 ? 0.6894 0.8603 0.6692 0.0531  -0.0018 -0.0291 277 LYS B O   
4521 C CB  . LYS B 251 ? 0.4352 0.5940 0.4177 0.0643  -0.0111 -0.0327 277 LYS B CB  
4522 C CG  . LYS B 251 ? 0.6021 0.7323 0.5774 0.0678  -0.0112 -0.0262 277 LYS B CG  
4523 C CD  . LYS B 251 ? 0.6920 0.8167 0.6662 0.0710  -0.0143 -0.0316 277 LYS B CD  
4524 C CE  . LYS B 251 ? 0.7910 0.8876 0.7571 0.0722  -0.0134 -0.0250 277 LYS B CE  
4525 N NZ  . LYS B 251 ? 0.8195 0.9109 0.7838 0.0750  -0.0164 -0.0292 277 LYS B NZ  
4526 N N   . ILE B 252 ? 0.5679 0.7729 0.5508 0.0491  -0.0007 -0.0432 278 ILE B N   
4527 C CA  . ILE B 252 ? 0.5563 0.7808 0.5400 0.0432  0.0024  -0.0506 278 ILE B CA  
4528 C C   . ILE B 252 ? 0.6311 0.8530 0.6102 0.0384  0.0063  -0.0430 278 ILE B C   
4529 O O   . ILE B 252 ? 0.6121 0.8439 0.5908 0.0340  0.0088  -0.0468 278 ILE B O   
4530 C CB  . ILE B 252 ? 0.4459 0.6987 0.4317 0.0384  0.0044  -0.0620 278 ILE B CB  
4531 C CG1 . ILE B 252 ? 0.4186 0.6912 0.4060 0.0333  0.0069  -0.0713 278 ILE B CG1 
4532 C CG2 . ILE B 252 ? 0.4202 0.6812 0.4019 0.0338  0.0073  -0.0571 278 ILE B CG2 
4533 C CD1 . ILE B 252 ? 0.0700 0.3376 0.0619 0.0377  0.0041  -0.0770 278 ILE B CD1 
4534 N N   . LYS B 253 ? 0.6100 0.8186 0.5859 0.0394  0.0070  -0.0324 279 LYS B N   
4535 C CA  . LYS B 253 ? 0.6708 0.8752 0.6424 0.0356  0.0107  -0.0245 279 LYS B CA  
4536 C C   . LYS B 253 ? 0.7423 0.9291 0.7136 0.0375  0.0105  -0.0210 279 LYS B C   
4537 O O   . LYS B 253 ? 0.6424 0.8354 0.6114 0.0323  0.0138  -0.0217 279 LYS B O   
4538 C CB  . LYS B 253 ? 0.9074 1.1005 0.8771 0.0377  0.0110  -0.0144 279 LYS B CB  
4539 C CG  . LYS B 253 ? 1.0676 1.2785 1.0372 0.0355  0.0112  -0.0173 279 LYS B CG  
4540 C CD  . LYS B 253 ? 1.0932 1.2916 1.0624 0.0390  0.0109  -0.0078 279 LYS B CD  
4541 C CE  . LYS B 253 ? 1.0890 1.3064 1.0581 0.0363  0.0109  -0.0112 279 LYS B CE  
4542 N NZ  . LYS B 253 ? 1.1020 1.3076 1.0717 0.0403  0.0103  -0.0030 279 LYS B NZ  
4543 N N   . LYS B 254 ? 0.8105 0.9760 0.7839 0.0444  0.0067  -0.0174 280 LYS B N   
4544 C CA  . LYS B 254 ? 0.7856 0.9335 0.7586 0.0463  0.0063  -0.0136 280 LYS B CA  
4545 C C   . LYS B 254 ? 0.8131 0.9663 0.7890 0.0476  0.0035  -0.0216 280 LYS B C   
4546 O O   . LYS B 254 ? 0.9499 1.1021 0.9255 0.0455  0.0047  -0.0230 280 LYS B O   
4547 C CB  . LYS B 254 ? 0.9441 1.0643 0.9168 0.0529  0.0040  -0.0033 280 LYS B CB  
4548 C CG  . LYS B 254 ? 1.1309 1.2441 1.1021 0.0526  0.0072  0.0045  280 LYS B CG  
4549 C CD  . LYS B 254 ? 1.2359 1.3202 1.2073 0.0586  0.0065  0.0126  280 LYS B CD  
4550 C CE  . LYS B 254 ? 1.3483 1.4275 1.3200 0.0591  0.0101  0.0189  280 LYS B CE  
4551 N NZ  . LYS B 254 ? 1.4352 1.4843 1.4018 0.0581  0.0141  0.0213  280 LYS B NZ  
4552 N N   . SER B 255 ? 0.6372 0.7964 0.6158 0.0510  -0.0002 -0.0273 281 SER B N   
4553 C CA  . SER B 255 ? 0.6036 0.7686 0.5856 0.0532  -0.0033 -0.0354 281 SER B CA  
4554 C C   . SER B 255 ? 0.5956 0.7890 0.5812 0.0488  -0.0013 -0.0485 281 SER B C   
4555 O O   . SER B 255 ? 0.8101 1.0166 0.7977 0.0488  -0.0017 -0.0544 281 SER B O   
4556 C CB  . SER B 255 ? 0.5174 0.6709 0.4999 0.0600  -0.0088 -0.0341 281 SER B CB  
4557 O OG  . SER B 255 ? 0.5313 0.6566 0.5084 0.0631  -0.0094 -0.0225 281 SER B OG  
4558 N N   . PRO B 256 ? 0.2939 0.4974 0.2806 0.0449  0.0010  -0.0535 282 PRO B N   
4559 C CA  . PRO B 256 ? 0.4956 0.7265 0.4859 0.0405  0.0031  -0.0663 282 PRO B CA  
4560 C C   . PRO B 256 ? 0.5824 0.8218 0.5786 0.0455  -0.0009 -0.0763 282 PRO B C   
4561 O O   . PRO B 256 ? 0.5867 0.8116 0.5838 0.0517  -0.0053 -0.0741 282 PRO B O   
4562 C CB  . PRO B 256 ? 0.4744 0.7085 0.4646 0.0366  0.0056  -0.0681 282 PRO B CB  
4563 C CG  . PRO B 256 ? 0.4296 0.6387 0.4182 0.0413  0.0030  -0.0592 282 PRO B CG  
4564 C CD  . PRO B 256 ? 0.3930 0.5827 0.3777 0.0444  0.0018  -0.0481 282 PRO B CD  
4565 N N   . LEU B 257 ? 0.5423 0.8053 0.5419 0.0426  0.0007  -0.0873 283 LEU B N   
4566 C CA  . LEU B 257 ? 0.4544 0.7272 0.4601 0.0471  -0.0025 -0.0984 283 LEU B CA  
4567 C C   . LEU B 257 ? 0.4544 0.7297 0.4642 0.0495  -0.0044 -0.1044 283 LEU B C   
4568 O O   . LEU B 257 ? 0.4197 0.6979 0.4341 0.0549  -0.0081 -0.1119 283 LEU B O   
4569 C CB  . LEU B 257 ? 0.4470 0.7461 0.4557 0.0424  0.0004  -0.1096 283 LEU B CB  
4570 C CG  . LEU B 257 ? 0.4763 0.7861 0.4915 0.0468  -0.0023 -0.1218 283 LEU B CG  
4571 C CD1 . LEU B 257 ? 0.4923 0.7835 0.5065 0.0533  -0.0065 -0.1165 283 LEU B CD1 
4572 C CD2 . LEU B 257 ? 0.5827 0.9192 0.6004 0.0410  0.0014  -0.1326 283 LEU B CD2 
4573 N N   . THR B 258 ? 0.5460 0.8204 0.5538 0.0455  -0.0018 -0.1012 284 THR B N   
4574 C CA  . THR B 258 ? 0.4962 0.7735 0.5075 0.0472  -0.0030 -0.1063 284 THR B CA  
4575 C C   . THR B 258 ? 0.7069 0.9650 0.7184 0.0553  -0.0089 -0.1021 284 THR B C   
4576 O O   . THR B 258 ? 0.7179 0.9814 0.7337 0.0590  -0.0116 -0.1092 284 THR B O   
4577 C CB  . THR B 258 ? 0.3772 0.6521 0.3851 0.0412  0.0010  -0.1014 284 THR B CB  
4578 O OG1 . THR B 258 ? 0.4115 0.7074 0.4189 0.0332  0.0061  -0.1071 284 THR B OG1 
4579 C CG2 . THR B 258 ? 0.6889 0.9642 0.7002 0.0433  -0.0007 -0.1055 284 THR B CG2 
4580 N N   . ILE B 259 ? 0.6589 0.8952 0.6652 0.0581  -0.0108 -0.0904 285 ILE B N   
4581 C CA  . ILE B 259 ? 0.4695 0.6869 0.4741 0.0652  -0.0164 -0.0851 285 ILE B CA  
4582 C C   . ILE B 259 ? 0.4919 0.7188 0.5012 0.0705  -0.0204 -0.0956 285 ILE B C   
4583 O O   . ILE B 259 ? 0.5259 0.7487 0.5361 0.0752  -0.0244 -0.0977 285 ILE B O   
4584 C CB  . ILE B 259 ? 0.3828 0.5786 0.3812 0.0668  -0.0176 -0.0724 285 ILE B CB  
4585 C CG1 . ILE B 259 ? 0.4057 0.5881 0.3993 0.0629  -0.0143 -0.0612 285 ILE B CG1 
4586 C CG2 . ILE B 259 ? 0.3939 0.5726 0.3893 0.0736  -0.0237 -0.0680 285 ILE B CG2 
4587 C CD1 . ILE B 259 ? 0.4893 0.6501 0.4774 0.0649  -0.0154 -0.0487 285 ILE B CD1 
4588 N N   . CYS B 260 ? 0.5825 0.8222 0.5947 0.0696  -0.0192 -0.1025 286 CYS B N   
4589 C CA  . CYS B 260 ? 0.3663 0.6144 0.3832 0.0744  -0.0224 -0.1131 286 CYS B CA  
4590 C C   . CYS B 260 ? 0.3349 0.6078 0.3592 0.0730  -0.0207 -0.1277 286 CYS B C   
4591 O O   . CYS B 260 ? 0.4237 0.6995 0.4515 0.0779  -0.0240 -0.1346 286 CYS B O   
4592 C CB  . CYS B 260 ? 0.1784 0.4280 0.1950 0.0740  -0.0217 -0.1139 286 CYS B CB  
4593 S SG  . CYS B 260 ? 0.5217 0.7749 0.5429 0.0805  -0.0258 -0.1248 286 CYS B SG  
4594 N N   . TYR B 261 ? 0.3539 0.6448 0.3799 0.0661  -0.0155 -0.1324 287 TYR B N   
4595 C CA  . TYR B 261 ? 0.3897 0.7052 0.4220 0.0635  -0.0131 -0.1459 287 TYR B CA  
4596 C C   . TYR B 261 ? 0.5724 0.8919 0.6030 0.0578  -0.0097 -0.1429 287 TYR B C   
4597 O O   . TYR B 261 ? 0.7030 1.0273 0.7301 0.0507  -0.0051 -0.1391 287 TYR B O   
4598 C CB  . TYR B 261 ? 0.3712 0.7072 0.4063 0.0590  -0.0095 -0.1549 287 TYR B CB  
4599 C CG  . TYR B 261 ? 0.4776 0.8116 0.5150 0.0637  -0.0121 -0.1593 287 TYR B CG  
4600 C CD1 . TYR B 261 ? 0.5078 0.8515 0.5520 0.0687  -0.0145 -0.1719 287 TYR B CD1 
4601 C CD2 . TYR B 261 ? 0.5115 0.8338 0.5444 0.0632  -0.0120 -0.1512 287 TYR B CD2 
4602 C CE1 . TYR B 261 ? 0.5159 0.8570 0.5621 0.0727  -0.0165 -0.1764 287 TYR B CE1 
4603 C CE2 . TYR B 261 ? 0.5525 0.8730 0.5875 0.0671  -0.0141 -0.1556 287 TYR B CE2 
4604 C CZ  . TYR B 261 ? 0.6206 0.9501 0.6622 0.0717  -0.0162 -0.1683 287 TYR B CZ  
4605 O OH  . TYR B 261 ? 0.7064 1.0334 0.7501 0.0752  -0.0178 -0.1731 287 TYR B OH  
4606 N N   . PRO B 262 ? 0.6649 0.9826 0.6976 0.0608  -0.0118 -0.1447 288 PRO B N   
4607 C CA  . PRO B 262 ? 0.7597 1.0803 0.7911 0.0556  -0.0087 -0.1425 288 PRO B CA  
4608 C C   . PRO B 262 ? 0.7585 1.1053 0.7930 0.0481  -0.0035 -0.1526 288 PRO B C   
4609 O O   . PRO B 262 ? 0.6471 0.9965 0.6785 0.0414  0.0007  -0.1493 288 PRO B O   
4610 C CB  . PRO B 262 ? 0.7984 1.1159 0.8331 0.0616  -0.0129 -0.1457 288 PRO B CB  
4611 C CG  . PRO B 262 ? 0.7473 1.0504 0.7813 0.0699  -0.0186 -0.1435 288 PRO B CG  
4612 C CD  . PRO B 262 ? 0.6522 0.9637 0.6879 0.0693  -0.0176 -0.1485 288 PRO B CD  
4613 N N   . GLU B 263 ? 0.8850 1.2506 0.9251 0.0491  -0.0035 -0.1649 289 GLU B N   
4614 C CA  . GLU B 263 ? 0.9265 1.3188 0.9697 0.0422  0.0011  -0.1758 289 GLU B CA  
4615 C C   . GLU B 263 ? 0.8364 1.2364 0.8755 0.0352  0.0053  -0.1739 289 GLU B C   
4616 O O   . GLU B 263 ? 0.7291 1.1526 0.7710 0.0302  0.0085  -0.1842 289 GLU B O   
4617 C CB  . GLU B 263 ? 1.0166 1.4271 1.0684 0.0466  -0.0009 -0.1913 289 GLU B CB  
4618 C CG  . GLU B 263 ? 1.1175 1.5290 1.1718 0.0508  -0.0029 -0.1960 289 GLU B CG  
4619 C CD  . GLU B 263 ? 1.2099 1.5966 1.2622 0.0592  -0.0084 -0.1880 289 GLU B CD  
4620 O OE1 . GLU B 263 ? 1.2529 1.6245 1.3035 0.0632  -0.0115 -0.1815 289 GLU B OE1 
4621 O OE2 . GLU B 263 ? 1.2198 1.6025 1.2721 0.0615  -0.0095 -0.1884 289 GLU B OE2 
4622 N N   . TYR B 264 ? 0.8712 1.2523 0.9038 0.0349  0.0052  -0.1610 290 TYR B N   
4623 C CA  . TYR B 264 ? 0.6824 1.0696 0.7103 0.0286  0.0089  -0.1579 290 TYR B CA  
4624 C C   . TYR B 264 ? 0.6839 1.0724 0.7051 0.0200  0.0137  -0.1510 290 TYR B C   
4625 O O   . TYR B 264 ? 0.7047 1.0734 0.7212 0.0204  0.0135  -0.1398 290 TYR B O   
4626 C CB  . TYR B 264 ? 0.5500 0.9173 0.5743 0.0330  0.0062  -0.1481 290 TYR B CB  
4627 C CG  . TYR B 264 ? 0.6660 1.0382 0.6848 0.0268  0.0097  -0.1434 290 TYR B CG  
4628 C CD1 . TYR B 264 ? 0.7156 1.1075 0.7369 0.0243  0.0112  -0.1527 290 TYR B CD1 
4629 C CD2 . TYR B 264 ? 0.6959 1.0534 0.7070 0.0235  0.0116  -0.1299 290 TYR B CD2 
4630 C CE1 . TYR B 264 ? 0.6750 1.0730 0.6909 0.0184  0.0142  -0.1483 290 TYR B CE1 
4631 C CE2 . TYR B 264 ? 0.7157 1.0785 0.7215 0.0181  0.0145  -0.1254 290 TYR B CE2 
4632 C CZ  . TYR B 264 ? 0.7276 1.1111 0.7356 0.0155  0.0157  -0.1344 290 TYR B CZ  
4633 O OH  . TYR B 264 ? 0.6957 1.0861 0.6981 0.0099  0.0185  -0.1298 290 TYR B OH  
4634 N N   . ALA B 265 ? 0.6646 1.0762 0.6850 0.0121  0.0181  -0.1578 291 ALA B N   
4635 C CA  . ALA B 265 ? 0.7564 1.1715 0.7699 0.0032  0.0230  -0.1522 291 ALA B CA  
4636 C C   . ALA B 265 ? 0.7210 1.1421 0.7278 -0.0028 0.0260  -0.1472 291 ALA B C   
4637 O O   . ALA B 265 ? 0.7478 1.1820 0.7496 -0.0115 0.0305  -0.1469 291 ALA B O   
4638 C CB  . ALA B 265 ? 0.8157 1.2534 0.8326 -0.0021 0.0259  -0.1635 291 ALA B CB  
4639 N N   . GLY B 266 ? 0.5999 1.0120 0.6064 0.0015  0.0235  -0.1431 292 GLY B N   
4640 C CA  . GLY B 266 ? 0.6574 1.0748 0.6577 -0.0035 0.0258  -0.1379 292 GLY B CA  
4641 C C   . GLY B 266 ? 0.7298 1.1238 0.7224 -0.0033 0.0260  -0.1216 292 GLY B C   
4642 O O   . GLY B 266 ? 0.5981 0.9707 0.5904 0.0009  0.0242  -0.1147 292 GLY B O   
4643 N N   . SER B 267 ? 0.7860 1.1847 0.7724 -0.0080 0.0281  -0.1156 293 SER B N   
4644 C CA  . SER B 267 ? 0.7131 1.0912 0.6925 -0.0078 0.0284  -0.1003 293 SER B CA  
4645 C C   . SER B 267 ? 0.6180 0.9747 0.5994 0.0008  0.0240  -0.0945 293 SER B C   
4646 O O   . SER B 267 ? 0.5125 0.8733 0.4998 0.0054  0.0212  -0.1020 293 SER B O   
4647 C CB  . SER B 267 ? 0.7424 1.1346 0.7145 -0.0154 0.0319  -0.0958 293 SER B CB  
4648 O OG  . SER B 267 ? 0.6624 1.0650 0.6360 -0.0145 0.0306  -0.0992 293 SER B OG  
4649 N N   . ASN B 268 ? 0.6738 1.0076 0.6505 0.0030  0.0236  -0.0812 294 ASN B N   
4650 C CA  . ASN B 268 ? 0.7330 1.0453 0.7110 0.0108  0.0197  -0.0745 294 ASN B CA  
4651 C C   . ASN B 268 ? 0.7458 1.0612 0.7205 0.0097  0.0201  -0.0692 294 ASN B C   
4652 O O   . ASN B 268 ? 0.8346 1.1327 0.8055 0.0115  0.0199  -0.0574 294 ASN B O   
4653 C CB  . ASN B 268 ? 0.8604 1.1449 0.8363 0.0147  0.0187  -0.0637 294 ASN B CB  
4654 C CG  . ASN B 268 ? 0.9727 1.2512 0.9531 0.0181  0.0168  -0.0688 294 ASN B CG  
4655 O OD1 . ASN B 268 ? 0.7514 1.0448 0.7374 0.0189  0.0156  -0.0803 294 ASN B OD1 
4656 N ND2 . ASN B 268 ? 1.1562 1.4135 1.1346 0.0201  0.0166  -0.0606 294 ASN B ND2 
4657 N N   . THR B 269 ? 0.6583 0.9968 0.6348 0.0065  0.0208  -0.0784 295 THR B N   
4658 C CA  . THR B 269 ? 0.6451 0.9895 0.6194 0.0055  0.0208  -0.0753 295 THR B CA  
4659 C C   . THR B 269 ? 0.4956 0.8425 0.4760 0.0105  0.0178  -0.0840 295 THR B C   
4660 O O   . THR B 269 ? 0.4318 0.7870 0.4179 0.0120  0.0168  -0.0954 295 THR B O   
4661 C CB  . THR B 269 ? 0.7706 1.1424 0.7404 -0.0040 0.0248  -0.0780 295 THR B CB  
4662 O OG1 . THR B 269 ? 0.6333 1.0287 0.6077 -0.0068 0.0256  -0.0929 295 THR B OG1 
4663 C CG2 . THR B 269 ? 0.9351 1.3061 0.8987 -0.0094 0.0281  -0.0707 295 THR B CG2 
4664 N N   . TYR B 270 ? 0.4220 0.7618 0.4015 0.0130  0.0163  -0.0788 296 TYR B N   
4665 C CA  . TYR B 270 ? 0.4586 0.7993 0.4432 0.0176  0.0137  -0.0865 296 TYR B CA  
4666 C C   . TYR B 270 ? 0.6063 0.9749 0.5949 0.0134  0.0153  -0.1020 296 TYR B C   
4667 O O   . TYR B 270 ? 0.7092 1.0785 0.7042 0.0177  0.0132  -0.1118 296 TYR B O   
4668 C CB  . TYR B 270 ? 0.3986 0.7340 0.3806 0.0185  0.0131  -0.0795 296 TYR B CB  
4669 C CG  . TYR B 270 ? 0.4312 0.7745 0.4176 0.0205  0.0116  -0.0891 296 TYR B CG  
4670 C CD1 . TYR B 270 ? 0.5324 0.8575 0.5231 0.0284  0.0078  -0.0906 296 TYR B CD1 
4671 C CD2 . TYR B 270 ? 0.3265 0.6960 0.3125 0.0142  0.0141  -0.0969 296 TYR B CD2 
4672 C CE1 . TYR B 270 ? 0.4786 0.8102 0.4732 0.0301  0.0067  -0.0997 296 TYR B CE1 
4673 C CE2 . TYR B 270 ? 0.4341 0.8108 0.4244 0.0157  0.0132  -0.1065 296 TYR B CE2 
4674 C CZ  . TYR B 270 ? 0.4784 0.8356 0.4731 0.0238  0.0096  -0.1079 296 TYR B CZ  
4675 O OH  . TYR B 270 ? 0.5076 0.8713 0.5065 0.0252  0.0089  -0.1177 296 TYR B OH  
4676 N N   . GLU B 271 ? 0.5659 0.9577 0.5509 0.0049  0.0190  -0.1040 297 GLU B N   
4677 C CA  . GLU B 271 ? 0.5973 1.0175 0.5856 0.0000  0.0211  -0.1186 297 GLU B CA  
4678 C C   . GLU B 271 ? 0.5951 1.0211 0.5894 0.0013  0.0210  -0.1295 297 GLU B C   
4679 O O   . GLU B 271 ? 0.4340 0.8645 0.4353 0.0051  0.0194  -0.1409 297 GLU B O   
4680 C CB  . GLU B 271 ? 0.4929 0.9364 0.4748 -0.0098 0.0251  -0.1170 297 GLU B CB  
4681 C CG  . GLU B 271 ? 0.4596 0.9079 0.4373 -0.0122 0.0254  -0.1111 297 GLU B CG  
4682 C CD  . GLU B 271 ? 0.6789 1.1017 0.6524 -0.0079 0.0236  -0.0950 297 GLU B CD  
4683 O OE1 . GLU B 271 ? 0.9300 1.3348 0.9019 -0.0054 0.0231  -0.0871 297 GLU B OE1 
4684 O OE2 . GLU B 271 ? 0.6159 1.0371 0.5878 -0.0072 0.0227  -0.0906 297 GLU B OE2 
4685 N N   . GLU B 272 ? 0.5394 0.9655 0.5309 -0.0018 0.0227  -0.1260 298 GLU B N   
4686 C CA  . GLU B 272 ? 0.5577 0.9920 0.5545 -0.0016 0.0230  -0.1363 298 GLU B CA  
4687 C C   . GLU B 272 ? 0.6115 1.0268 0.6148 0.0080  0.0187  -0.1386 298 GLU B C   
4688 O O   . GLU B 272 ? 0.6623 1.0876 0.6726 0.0102  0.0179  -0.1509 298 GLU B O   
4689 C CB  . GLU B 272 ? 0.7098 1.1454 0.7016 -0.0070 0.0258  -0.1308 298 GLU B CB  
4690 C CG  . GLU B 272 ? 0.9262 1.3740 0.9231 -0.0081 0.0267  -0.1419 298 GLU B CG  
4691 C CD  . GLU B 272 ? 1.0798 1.5345 1.0710 -0.0155 0.0304  -0.1381 298 GLU B CD  
4692 O OE1 . GLU B 272 ? 1.0572 1.5172 1.0520 -0.0160 0.0311  -0.1449 298 GLU B OE1 
4693 O OE2 . GLU B 272 ? 1.1663 1.6212 1.1494 -0.0209 0.0328  -0.1284 298 GLU B OE2 
4694 N N   . ALA B 273 ? 0.5968 0.9852 0.5978 0.0137  0.0159  -0.1267 299 ALA B N   
4695 C CA  . ALA B 273 ? 0.4952 0.8641 0.5009 0.0226  0.0114  -0.1269 299 ALA B CA  
4696 C C   . ALA B 273 ? 0.4760 0.8474 0.4874 0.0275  0.0089  -0.1356 299 ALA B C   
4697 O O   . ALA B 273 ? 0.4624 0.8382 0.4802 0.0314  0.0070  -0.1459 299 ALA B O   
4698 C CB  . ALA B 273 ? 0.5699 0.9100 0.5710 0.0267  0.0093  -0.1116 299 ALA B CB  
4699 N N   . ALA B 274 ? 0.3456 0.7141 0.3544 0.0272  0.0089  -0.1317 300 ALA B N   
4700 C CA  . ALA B 274 ? 0.2390 0.6092 0.2525 0.0311  0.0069  -0.1396 300 ALA B CA  
4701 C C   . ALA B 274 ? 0.3158 0.7111 0.3358 0.0288  0.0086  -0.1567 300 ALA B C   
4702 O O   . ALA B 274 ? 0.4040 0.7974 0.4302 0.0344  0.0062  -0.1655 300 ALA B O   
4703 C CB  . ALA B 274 ? 0.1587 0.5293 0.1680 0.0286  0.0080  -0.1344 300 ALA B CB  
4704 N N   . ALA B 275 ? 0.2173 0.6362 0.2356 0.0206  0.0129  -0.1612 301 ALA B N   
4705 C CA  . ALA B 275 ? 0.3948 0.8396 0.4190 0.0174  0.0150  -0.1776 301 ALA B CA  
4706 C C   . ALA B 275 ? 0.4947 0.9371 0.5256 0.0228  0.0128  -0.1851 301 ALA B C   
4707 O O   . ALA B 275 ? 0.3827 0.8336 0.4209 0.0260  0.0120  -0.1980 301 ALA B O   
4708 C CB  . ALA B 275 ? 0.2371 0.7059 0.2571 0.0073  0.0198  -0.1791 301 ALA B CB  
4709 N N   . TYR B 276 ? 0.5244 0.9553 0.5529 0.0238  0.0120  -0.1772 302 TYR B N   
4710 C CA  . TYR B 276 ? 0.5493 0.9781 0.5835 0.0286  0.0098  -0.1833 302 TYR B CA  
4711 C C   . TYR B 276 ? 0.6296 1.0435 0.6689 0.0381  0.0051  -0.1864 302 TYR B C   
4712 O O   . TYR B 276 ? 0.7602 1.1829 0.8066 0.0416  0.0039  -0.1985 302 TYR B O   
4713 C CB  . TYR B 276 ? 0.4455 0.8599 0.4753 0.0286  0.0094  -0.1722 302 TYR B CB  
4714 C CG  . TYR B 276 ? 0.5266 0.9418 0.5619 0.0326  0.0074  -0.1785 302 TYR B CG  
4715 C CD1 . TYR B 276 ? 0.6354 1.0722 0.6733 0.0274  0.0105  -0.1875 302 TYR B CD1 
4716 C CD2 . TYR B 276 ? 0.4331 0.8282 0.4707 0.0414  0.0025  -0.1755 302 TYR B CD2 
4717 C CE1 . TYR B 276 ? 0.5794 1.0180 0.6225 0.0311  0.0088  -0.1937 302 TYR B CE1 
4718 C CE2 . TYR B 276 ? 0.5523 0.9493 0.5946 0.0451  0.0005  -0.1813 302 TYR B CE2 
4719 C CZ  . TYR B 276 ? 0.6740 1.0929 0.7193 0.0400  0.0037  -0.1906 302 TYR B CZ  
4720 O OH  . TYR B 276 ? 0.7789 1.2007 0.8291 0.0437  0.0018  -0.1967 302 TYR B OH  
4721 N N   . ILE B 277 ? 0.4355 0.8268 0.4708 0.0421  0.0024  -0.1753 303 ILE B N   
4722 C CA  . ILE B 277 ? 0.4119 0.7872 0.4505 0.0505  -0.0022 -0.1766 303 ILE B CA  
4723 C C   . ILE B 277 ? 0.4189 0.8095 0.4636 0.0509  -0.0013 -0.1910 303 ILE B C   
4724 O O   . ILE B 277 ? 0.4781 0.8684 0.5290 0.0566  -0.0038 -0.2000 303 ILE B O   
4725 C CB  . ILE B 277 ? 0.5000 0.8505 0.5325 0.0534  -0.0046 -0.1622 303 ILE B CB  
4726 C CG1 . ILE B 277 ? 0.5581 0.8913 0.5849 0.0537  -0.0055 -0.1482 303 ILE B CG1 
4727 C CG2 . ILE B 277 ? 0.5733 0.9085 0.6084 0.0613  -0.0091 -0.1641 303 ILE B CG2 
4728 C CD1 . ILE B 277 ? 0.5082 0.8165 0.5289 0.0565  -0.0078 -0.1338 303 ILE B CD1 
4729 N N   . GLN B 278 ? 0.4080 0.8121 0.4510 0.0447  0.0023  -0.1931 304 GLN B N   
4730 C CA  . GLN B 278 ? 0.5411 0.9610 0.5897 0.0439  0.0039  -0.2070 304 GLN B CA  
4731 C C   . GLN B 278 ? 0.6412 1.0793 0.6977 0.0446  0.0046  -0.2226 304 GLN B C   
4732 O O   . GLN B 278 ? 0.6935 1.1321 0.7566 0.0495  0.0032  -0.2331 304 GLN B O   
4733 C CB  . GLN B 278 ? 0.6105 1.0483 0.6554 0.0351  0.0084  -0.2078 304 GLN B CB  
4734 C CG  . GLN B 278 ? 0.5709 1.0276 0.6216 0.0330  0.0107  -0.2231 304 GLN B CG  
4735 C CD  . GLN B 278 ? 0.6457 1.1234 0.6922 0.0235  0.0153  -0.2244 304 GLN B CD  
4736 O OE1 . GLN B 278 ? 0.8273 1.3071 0.8666 0.0182  0.0168  -0.2141 304 GLN B OE1 
4737 N NE2 . GLN B 278 ? 0.6963 1.1898 0.7469 0.0210  0.0175  -0.2370 304 GLN B NE2 
4738 N N   . CYS B 279 ? 0.6848 1.1378 0.7409 0.0397  0.0071  -0.2242 305 CYS B N   
4739 C CA  . CYS B 279 ? 0.6924 1.1640 0.7558 0.0399  0.0080  -0.2388 305 CYS B CA  
4740 C C   . CYS B 279 ? 0.6316 1.0879 0.6998 0.0495  0.0032  -0.2404 305 CYS B C   
4741 O O   . CYS B 279 ? 0.6128 1.0773 0.6886 0.0534  0.0026  -0.2537 305 CYS B O   
4742 C CB  . CYS B 279 ? 0.7398 1.2275 0.8006 0.0327  0.0113  -0.2381 305 CYS B CB  
4743 S SG  . CYS B 279 ? 1.2733 1.7832 1.3280 0.0206  0.0171  -0.2374 305 CYS B SG  
4744 N N   . GLN B 280 ? 0.6413 1.0755 0.7047 0.0533  -0.0001 -0.2269 306 GLN B N   
4745 C CA  . GLN B 280 ? 0.6136 1.0325 0.6799 0.0621  -0.0050 -0.2267 306 GLN B CA  
4746 C C   . GLN B 280 ? 0.6342 1.0469 0.7055 0.0688  -0.0076 -0.2344 306 GLN B C   
4747 O O   . GLN B 280 ? 0.7596 1.1737 0.8367 0.0747  -0.0100 -0.2431 306 GLN B O   
4748 C CB  . GLN B 280 ? 0.5483 0.9417 0.6074 0.0648  -0.0082 -0.2096 306 GLN B CB  
4749 C CG  . GLN B 280 ? 0.6566 1.0537 0.7111 0.0587  -0.0056 -0.2019 306 GLN B CG  
4750 C CD  . GLN B 280 ? 0.5963 1.0124 0.6557 0.0570  -0.0041 -0.2119 306 GLN B CD  
4751 O OE1 . GLN B 280 ? 0.5599 0.9716 0.6229 0.0630  -0.0074 -0.2153 306 GLN B OE1 
4752 N NE2 . GLN B 280 ? 0.4984 0.9361 0.5575 0.0486  0.0009  -0.2167 306 GLN B NE2 
4753 N N   . PHE B 281 ? 0.4543 0.8600 0.5232 0.0679  -0.0071 -0.2313 307 PHE B N   
4754 C CA  . PHE B 281 ? 0.5178 0.9162 0.5909 0.0735  -0.0090 -0.2381 307 PHE B CA  
4755 C C   . PHE B 281 ? 0.6145 1.0368 0.6958 0.0713  -0.0054 -0.2563 307 PHE B C   
4756 O O   . PHE B 281 ? 0.8380 1.2607 0.9260 0.0771  -0.0070 -0.2668 307 PHE B O   
4757 C CB  . PHE B 281 ? 0.6293 1.0112 0.6968 0.0732  -0.0096 -0.2281 307 PHE B CB  
4758 C CG  . PHE B 281 ? 0.6304 0.9849 0.6911 0.0778  -0.0141 -0.2120 307 PHE B CG  
4759 C CD1 . PHE B 281 ? 0.7413 1.0894 0.7950 0.0742  -0.0137 -0.1986 307 PHE B CD1 
4760 C CD2 . PHE B 281 ? 0.5141 0.8490 0.5748 0.0854  -0.0186 -0.2103 307 PHE B CD2 
4761 C CE1 . PHE B 281 ? 0.8195 1.1425 0.8668 0.0782  -0.0177 -0.1841 307 PHE B CE1 
4762 C CE2 . PHE B 281 ? 0.5472 0.8578 0.6009 0.0890  -0.0227 -0.1955 307 PHE B CE2 
4763 C CZ  . PHE B 281 ? 0.7362 1.0409 0.7833 0.0854  -0.0222 -0.1826 307 PHE B CZ  
4764 N N   . GLU B 282 ? 0.5225 0.9648 0.6030 0.0627  -0.0005 -0.2601 308 GLU B N   
4765 C CA  . GLU B 282 ? 0.6653 1.1319 0.7529 0.0593  0.0034  -0.2774 308 GLU B CA  
4766 C C   . GLU B 282 ? 0.7234 1.2043 0.8182 0.0616  0.0034  -0.2895 308 GLU B C   
4767 O O   . GLU B 282 ? 0.6512 1.1442 0.7540 0.0633  0.0048  -0.3047 308 GLU B O   
4768 C CB  . GLU B 282 ? 0.7507 1.2377 0.8347 0.0488  0.0085  -0.2780 308 GLU B CB  
4769 C CG  . GLU B 282 ? 0.8480 1.3253 0.9260 0.0461  0.0091  -0.2691 308 GLU B CG  
4770 C CD  . GLU B 282 ? 0.8130 1.3137 0.8878 0.0357  0.0143  -0.2721 308 GLU B CD  
4771 O OE1 . GLU B 282 ? 0.8075 1.3316 0.8844 0.0303  0.0175  -0.2807 308 GLU B OE1 
4772 O OE2 . GLU B 282 ? 0.7961 1.2925 0.8661 0.0328  0.0152  -0.2659 308 GLU B OE2 
4773 N N   . ASP B 283 ? 0.8514 1.3309 0.9436 0.0617  0.0021  -0.2830 309 ASP B N   
4774 C CA  . ASP B 283 ? 0.8813 1.3748 0.9798 0.0636  0.0020  -0.2935 309 ASP B CA  
4775 C C   . ASP B 283 ? 0.8194 1.2992 0.9232 0.0742  -0.0026 -0.2979 309 ASP B C   
4776 O O   . ASP B 283 ? 0.9177 1.4102 1.0287 0.0771  -0.0025 -0.3104 309 ASP B O   
4777 C CB  . ASP B 283 ? 0.9701 1.4657 1.0640 0.0602  0.0022  -0.2849 309 ASP B CB  
4778 C CG  . ASP B 283 ? 1.0842 1.5959 1.1729 0.0493  0.0071  -0.2819 309 ASP B CG  
4779 O OD1 . ASP B 283 ? 0.9584 1.4820 1.0473 0.0444  0.0104  -0.2874 309 ASP B OD1 
4780 O OD2 . ASP B 283 ? 1.1937 1.7063 1.2778 0.0456  0.0079  -0.2741 309 ASP B OD2 
4781 N N   . LEU B 284 ? 0.7246 1.1785 0.8245 0.0799  -0.0066 -0.2875 310 LEU B N   
4782 C CA  . LEU B 284 ? 0.7064 1.1453 0.8099 0.0899  -0.0110 -0.2902 310 LEU B CA  
4783 C C   . LEU B 284 ? 0.7481 1.1978 0.8606 0.0923  -0.0091 -0.3070 310 LEU B C   
4784 O O   . LEU B 284 ? 0.8815 1.3303 0.9999 0.0994  -0.0112 -0.3154 310 LEU B O   
4785 C CB  . LEU B 284 ? 0.7318 1.1416 0.8284 0.0942  -0.0151 -0.2757 310 LEU B CB  
4786 C CG  . LEU B 284 ? 0.8034 1.1993 0.8910 0.0925  -0.0172 -0.2583 310 LEU B CG  
4787 C CD1 . LEU B 284 ? 0.8938 1.2616 0.9749 0.0969  -0.0212 -0.2454 310 LEU B CD1 
4788 C CD2 . LEU B 284 ? 0.7889 1.1878 0.8772 0.0950  -0.0193 -0.2582 310 LEU B CD2 
4789 N N   . ASN B 285 ? 0.6990 1.1590 0.8125 0.0863  -0.0049 -0.3122 311 ASN B N   
4790 C CA  . ASN B 285 ? 0.8971 1.3693 1.0194 0.0873  -0.0021 -0.3290 311 ASN B CA  
4791 C C   . ASN B 285 ? 0.9794 1.4771 1.1092 0.0858  0.0006  -0.3440 311 ASN B C   
4792 O O   . ASN B 285 ? 0.9699 1.4889 1.0989 0.0774  0.0045  -0.3474 311 ASN B O   
4793 C CB  . ASN B 285 ? 0.9107 1.3901 1.0315 0.0799  0.0022  -0.3307 311 ASN B CB  
4794 C CG  . ASN B 285 ? 0.8256 1.3163 0.9555 0.0805  0.0055  -0.3483 311 ASN B CG  
4795 O OD1 . ASN B 285 ? 0.8978 1.3896 1.0353 0.0869  0.0046  -0.3590 311 ASN B OD1 
4796 N ND2 . ASN B 285 ? 0.7101 1.2093 0.8391 0.0738  0.0095  -0.3515 311 ASN B ND2 
4797 N N   . LYS B 286 ? 1.0249 1.5204 1.1617 0.0939  -0.0015 -0.3530 312 LYS B N   
4798 C CA  . LYS B 286 ? 1.1223 1.6409 1.2667 0.0938  0.0005  -0.3674 312 LYS B CA  
4799 C C   . LYS B 286 ? 1.2474 1.7889 1.3988 0.0883  0.0062  -0.3840 312 LYS B C   
4800 O O   . LYS B 286 ? 1.2927 1.8580 1.4446 0.0803  0.0101  -0.3897 312 LYS B O   
4801 C CB  . LYS B 286 ? 1.1984 1.7074 1.3481 0.1047  -0.0035 -0.3721 312 LYS B CB  
4802 C CG  . LYS B 286 ? 1.2421 1.7278 1.3847 0.1105  -0.0093 -0.3563 312 LYS B CG  
4803 C CD  . LYS B 286 ? 1.2193 1.7108 1.3552 0.1045  -0.0095 -0.3461 312 LYS B CD  
4804 C CE  . LYS B 286 ? 1.1492 1.6169 1.2777 0.1096  -0.0150 -0.3303 312 LYS B CE  
4805 N NZ  . LYS B 286 ? 1.0619 1.5339 1.1842 0.1036  -0.0147 -0.3202 312 LYS B NZ  
4806 N N   . ARG B 287 ? 1.3348 1.8689 1.4914 0.0923  0.0070  -0.3917 313 ARG B N   
4807 C CA  . ARG B 287 ? 1.3958 1.9501 1.5593 0.0872  0.0127  -0.4079 313 ARG B CA  
4808 C C   . ARG B 287 ? 1.2835 1.8399 1.4410 0.0783  0.0157  -0.4024 313 ARG B C   
4809 O O   . ARG B 287 ? 1.2280 1.7710 1.3855 0.0798  0.0160  -0.4016 313 ARG B O   
4810 C CB  . ARG B 287 ? 1.5902 2.1362 1.7629 0.0953  0.0128  -0.4197 313 ARG B CB  
4811 C CG  . ARG B 287 ? 1.7687 2.3165 1.9486 0.1039  0.0107  -0.4279 313 ARG B CG  
4812 C CD  . ARG B 287 ? 1.9100 2.4468 2.0986 0.1124  0.0110  -0.4382 313 ARG B CD  
4813 N NE  . ARG B 287 ? 2.0166 2.5237 2.2002 0.1178  0.0073  -0.4258 313 ARG B NE  
4814 C CZ  . ARG B 287 ? 2.0511 2.5428 2.2404 0.1255  0.0070  -0.4309 313 ARG B CZ  
4815 N NH1 . ARG B 287 ? 2.0316 2.5345 2.2322 0.1291  0.0103  -0.4484 313 ARG B NH1 
4816 N NH2 . ARG B 287 ? 2.0764 2.5417 2.2602 0.1296  0.0037  -0.4186 313 ARG B NH2 
4817 N N   . LYS B 288 ? 1.3013 1.8747 1.4533 0.0691  0.0181  -0.3986 314 LYS B N   
4818 C CA  . LYS B 288 ? 1.4103 1.9872 1.5554 0.0604  0.0209  -0.3921 314 LYS B CA  
4819 C C   . LYS B 288 ? 1.4683 2.0611 1.6190 0.0556  0.0261  -0.4073 314 LYS B C   
4820 O O   . LYS B 288 ? 1.5126 2.0991 1.6598 0.0524  0.0273  -0.4035 314 LYS B O   
4821 C CB  . LYS B 288 ? 1.4388 2.0318 1.5769 0.0515  0.0226  -0.3852 314 LYS B CB  
4822 C CG  . LYS B 288 ? 1.5175 2.1165 1.6480 0.0422  0.0256  -0.3787 314 LYS B CG  
4823 C CD  . LYS B 288 ? 1.4673 2.0823 1.5908 0.0335  0.0276  -0.3720 314 LYS B CD  
4824 C CE  . LYS B 288 ? 1.3506 1.9719 1.4661 0.0245  0.0305  -0.3650 314 LYS B CE  
4825 N NZ  . LYS B 288 ? 1.2255 1.8194 1.3348 0.0283  0.0271  -0.3497 314 LYS B NZ  
4826 N N   . ASP B 289 ? 1.3928 2.0066 1.5522 0.0548  0.0293  -0.4248 315 ASP B N   
4827 C CA  . ASP B 289 ? 1.2736 1.9056 1.4389 0.0495  0.0348  -0.4409 315 ASP B CA  
4828 C C   . ASP B 289 ? 1.1233 1.7399 1.2966 0.0573  0.0346  -0.4495 315 ASP B C   
4829 O O   . ASP B 289 ? 0.8012 1.4306 0.9843 0.0584  0.0380  -0.4670 315 ASP B O   
4830 C CB  . ASP B 289 ? 1.2624 1.9250 1.4336 0.0446  0.0388  -0.4565 315 ASP B CB  
4831 C CG  . ASP B 289 ? 1.2359 1.9148 1.3992 0.0361  0.0396  -0.4487 315 ASP B CG  
4832 O OD1 . ASP B 289 ? 1.2454 1.9520 1.4117 0.0294  0.0437  -0.4605 315 ASP B OD1 
4833 O OD2 . ASP B 289 ? 1.1546 1.8187 1.3089 0.0361  0.0363  -0.4309 315 ASP B OD2 
4834 N N   . THR B 290 ? 1.3354 1.9244 1.5046 0.0627  0.0310  -0.4370 316 THR B N   
4835 C CA  . THR B 290 ? 1.4034 1.9749 1.5793 0.0701  0.0306  -0.4431 316 THR B CA  
4836 C C   . THR B 290 ? 1.4175 1.9662 1.5864 0.0704  0.0288  -0.4298 316 THR B C   
4837 O O   . THR B 290 ? 1.4453 1.9960 1.6052 0.0637  0.0288  -0.4186 316 THR B O   
4838 C CB  . THR B 290 ? 1.3917 1.9477 1.5726 0.0819  0.0263  -0.4434 316 THR B CB  
4839 O OG1 . THR B 290 ? 1.3255 1.9032 1.5136 0.0820  0.0282  -0.4568 316 THR B OG1 
4840 C CG2 . THR B 290 ? 1.3303 1.8675 1.5179 0.0895  0.0263  -0.4491 316 THR B CG2 
4841 N N   . GLU B 292 ? 0.3904 0.9355 0.5259 0.0545  0.0237  -0.3799 318 GLU B N   
4842 C CA  . GLU B 292 ? 0.7320 1.2804 0.8589 0.0464  0.0255  -0.3705 318 GLU B CA  
4843 C C   . GLU B 292 ? 0.8748 1.3940 0.9943 0.0508  0.0211  -0.3526 318 GLU B C   
4844 O O   . GLU B 292 ? 0.7716 1.2727 0.8937 0.0563  0.0196  -0.3531 318 GLU B O   
4845 C CB  . GLU B 292 ? 0.9003 1.4656 1.0306 0.0398  0.0309  -0.3838 318 GLU B CB  
4846 C CG  . GLU B 292 ? 1.2013 1.7694 1.3228 0.0320  0.0325  -0.3745 318 GLU B CG  
4847 C CD  . GLU B 292 ? 1.4482 2.0334 1.5618 0.0238  0.0337  -0.3668 318 GLU B CD  
4848 O OE1 . GLU B 292 ? 1.5375 2.1446 1.6482 0.0143  0.0380  -0.3714 318 GLU B OE1 
4849 O OE2 . GLU B 292 ? 1.5218 2.0990 1.6319 0.0267  0.0306  -0.3563 318 GLU B OE2 
4850 N N   . ILE B 293 ? 0.9422 1.4568 1.0527 0.0481  0.0193  -0.3370 319 ILE B N   
4851 C CA  . ILE B 293 ? 0.8388 1.3266 0.9419 0.0518  0.0152  -0.3192 319 ILE B CA  
4852 C C   . ILE B 293 ? 0.7847 1.2771 0.8790 0.0439  0.0172  -0.3091 319 ILE B C   
4853 O O   . ILE B 293 ? 0.7882 1.2962 0.8781 0.0373  0.0191  -0.3057 319 ILE B O   
4854 C CB  . ILE B 293 ? 0.7423 1.2143 0.8422 0.0577  0.0104  -0.3075 319 ILE B CB  
4855 C CG1 . ILE B 293 ? 0.7041 1.1704 0.8121 0.0662  0.0079  -0.3165 319 ILE B CG1 
4856 C CG2 . ILE B 293 ? 0.7371 1.1821 0.8289 0.0609  0.0065  -0.2891 319 ILE B CG2 
4857 C CD1 . ILE B 293 ? 0.6808 1.1329 0.7858 0.0719  0.0031  -0.3061 319 ILE B CD1 
4858 N N   . TYR B 294 ? 0.7253 1.2042 0.8170 0.0445  0.0168  -0.3042 320 TYR B N   
4859 C CA  . TYR B 294 ? 0.6662 1.1488 0.7498 0.0376  0.0185  -0.2948 320 TYR B CA  
4860 C C   . TYR B 294 ? 0.5899 1.0481 0.6652 0.0411  0.0142  -0.2746 320 TYR B C   
4861 O O   . TYR B 294 ? 0.5210 0.9548 0.5957 0.0476  0.0107  -0.2679 320 TYR B O   
4862 C CB  . TYR B 294 ? 0.6409 1.1245 0.7264 0.0355  0.0209  -0.3017 320 TYR B CB  
4863 C CG  . TYR B 294 ? 0.7316 1.2342 0.8266 0.0337  0.0248  -0.3225 320 TYR B CG  
4864 C CD1 . TYR B 294 ? 0.7999 1.3329 0.8954 0.0243  0.0299  -0.3331 320 TYR B CD1 
4865 C CD2 . TYR B 294 ? 0.6604 1.1506 0.7636 0.0412  0.0236  -0.3314 320 TYR B CD2 
4866 C CE1 . TYR B 294 ? 0.8155 1.3660 0.9199 0.0224  0.0338  -0.3526 320 TYR B CE1 
4867 C CE2 . TYR B 294 ? 0.5919 1.0986 0.7043 0.0398  0.0276  -0.3508 320 TYR B CE2 
4868 C CZ  . TYR B 294 ? 0.7969 1.3339 0.9100 0.0303  0.0327  -0.3616 320 TYR B CZ  
4869 O OH  . TYR B 294 ? 0.9180 1.4717 1.0405 0.0287  0.0369  -0.3813 320 TYR B OH  
4870 N N   . THR B 295 ? 0.6058 1.0708 0.6748 0.0365  0.0147  -0.2651 321 THR B N   
4871 C CA  . THR B 295 ? 0.4601 0.9030 0.5216 0.0396  0.0111  -0.2465 321 THR B CA  
4872 C C   . THR B 295 ? 0.4624 0.9051 0.5157 0.0341  0.0125  -0.2353 321 THR B C   
4873 O O   . THR B 295 ? 0.4062 0.8718 0.4576 0.0258  0.0165  -0.2399 321 THR B O   
4874 C CB  . THR B 295 ? 0.5802 1.0269 0.6402 0.0393  0.0104  -0.2422 321 THR B CB  
4875 O OG1 . THR B 295 ? 0.6780 1.1257 0.7457 0.0446  0.0089  -0.2526 321 THR B OG1 
4876 C CG2 . THR B 295 ? 0.5552 0.9778 0.6081 0.0427  0.0068  -0.2236 321 THR B CG2 
4877 N N   . HIS B 296 ? 0.5331 0.9504 0.5814 0.0386  0.0090  -0.2207 322 HIS B N   
4878 C CA  . HIS B 296 ? 0.3872 0.8012 0.4277 0.0346  0.0097  -0.2086 322 HIS B CA  
4879 C C   . HIS B 296 ? 0.4975 0.8877 0.5318 0.0386  0.0062  -0.1907 322 HIS B C   
4880 O O   . HIS B 296 ? 0.6172 0.9853 0.6526 0.0461  0.0022  -0.1862 322 HIS B O   
4881 C CB  . HIS B 296 ? 0.3211 0.7284 0.3623 0.0354  0.0098  -0.2109 322 HIS B CB  
4882 C CG  . HIS B 296 ? 0.5275 0.9590 0.5738 0.0301  0.0140  -0.2278 322 HIS B CG  
4883 N ND1 . HIS B 296 ? 0.5912 1.0447 0.6340 0.0213  0.0179  -0.2299 322 HIS B ND1 
4884 C CD2 . HIS B 296 ? 0.6549 1.0924 0.7097 0.0321  0.0150  -0.2436 322 HIS B CD2 
4885 C CE1 . HIS B 296 ? 0.6763 1.1485 0.7249 0.0178  0.0212  -0.2465 322 HIS B CE1 
4886 N NE2 . HIS B 296 ? 0.6135 1.0760 0.6697 0.0244  0.0196  -0.2553 322 HIS B NE2 
4887 N N   . PHE B 297 ? 0.5955 0.9907 0.6231 0.0334  0.0078  -0.1805 323 PHE B N   
4888 C CA  . PHE B 297 ? 0.6399 1.0126 0.6614 0.0366  0.0052  -0.1632 323 PHE B CA  
4889 C C   . PHE B 297 ? 0.6143 0.9745 0.6316 0.0372  0.0044  -0.1544 323 PHE B C   
4890 O O   . PHE B 297 ? 0.8631 1.2378 0.8771 0.0310  0.0073  -0.1535 323 PHE B O   
4891 C CB  . PHE B 297 ? 0.5551 0.9388 0.5718 0.0308  0.0075  -0.1567 323 PHE B CB  
4892 C CG  . PHE B 297 ? 0.3573 0.7488 0.3773 0.0309  0.0078  -0.1625 323 PHE B CG  
4893 C CD1 . PHE B 297 ? 0.3267 0.7444 0.3513 0.0262  0.0108  -0.1774 323 PHE B CD1 
4894 C CD2 . PHE B 297 ? 0.3608 0.7341 0.3793 0.0352  0.0052  -0.1534 323 PHE B CD2 
4895 C CE1 . PHE B 297 ? 0.3671 0.7926 0.3948 0.0262  0.0111  -0.1831 323 PHE B CE1 
4896 C CE2 . PHE B 297 ? 0.4443 0.8256 0.4658 0.0350  0.0056  -0.1591 323 PHE B CE2 
4897 C CZ  . PHE B 297 ? 0.5335 0.9410 0.5598 0.0306  0.0085  -0.1739 323 PHE B CZ  
4898 N N   . THR B 298 ? 0.4177 0.7518 0.4349 0.0445  0.0004  -0.1479 324 THR B N   
4899 C CA  . THR B 298 ? 0.4040 0.7259 0.4182 0.0456  -0.0004 -0.1414 324 THR B CA  
4900 C C   . THR B 298 ? 0.4623 0.7569 0.4711 0.0504  -0.0038 -0.1243 324 THR B C   
4901 O O   . THR B 298 ? 0.4752 0.7566 0.4830 0.0541  -0.0061 -0.1181 324 THR B O   
4902 C CB  . THR B 298 ? 0.5114 0.8277 0.5305 0.0493  -0.0017 -0.1511 324 THR B CB  
4903 O OG1 . THR B 298 ? 0.5598 0.8532 0.5799 0.0571  -0.0062 -0.1474 324 THR B OG1 
4904 C CG2 . THR B 298 ? 0.7032 1.0447 0.7290 0.0455  0.0016  -0.1693 324 THR B CG2 
4905 N N   . CYS B 299 ? 0.4318 0.7186 0.4371 0.0501  -0.0038 -0.1170 325 CYS B N   
4906 C CA  . CYS B 299 ? 0.3071 0.5668 0.3078 0.0551  -0.0071 -0.1019 325 CYS B CA  
4907 C C   . CYS B 299 ? 0.5032 0.7503 0.5044 0.0583  -0.0090 -0.1028 325 CYS B C   
4908 O O   . CYS B 299 ? 0.4983 0.7489 0.4977 0.0557  -0.0075 -0.1008 325 CYS B O   
4909 C CB  . CYS B 299 ? 0.1900 0.4519 0.1859 0.0515  -0.0051 -0.0906 325 CYS B CB  
4910 S SG  . CYS B 299 ? 0.5500 0.7788 0.5412 0.0577  -0.0085 -0.0720 325 CYS B SG  
4911 N N   . ALA B 300 ? 0.5437 0.7768 0.5469 0.0637  -0.0123 -0.1059 326 ALA B N   
4912 C CA  . ALA B 300 ? 0.5077 0.7305 0.5118 0.0664  -0.0139 -0.1093 326 ALA B CA  
4913 C C   . ALA B 300 ? 0.5960 0.8036 0.5951 0.0672  -0.0149 -0.0978 326 ALA B C   
4914 O O   . ALA B 300 ? 0.7263 0.9318 0.7263 0.0672  -0.0147 -0.1018 326 ALA B O   
4915 C CB  . ALA B 300 ? 0.4818 0.6883 0.4868 0.0725  -0.0181 -0.1105 326 ALA B CB  
4916 N N   . THR B 301 ? 0.4952 0.6924 0.4895 0.0679  -0.0157 -0.0840 327 THR B N   
4917 C CA  . THR B 301 ? 0.5025 0.6844 0.4924 0.0692  -0.0167 -0.0725 327 THR B CA  
4918 C C   . THR B 301 ? 0.5224 0.7224 0.5126 0.0636  -0.0126 -0.0730 327 THR B C   
4919 O O   . THR B 301 ? 0.5022 0.6937 0.4899 0.0641  -0.0127 -0.0654 327 THR B O   
4920 C CB  . THR B 301 ? 0.3975 0.5564 0.3824 0.0734  -0.0197 -0.0569 327 THR B CB  
4921 O OG1 . THR B 301 ? 0.4619 0.6307 0.4475 0.0711  -0.0175 -0.0546 327 THR B OG1 
4922 C CG2 . THR B 301 ? 0.4509 0.5914 0.4331 0.0782  -0.0244 -0.0551 327 THR B CG2 
4923 N N   . ASP B 302 ? 0.5659 0.7916 0.5584 0.0580  -0.0090 -0.0817 328 ASP B N   
4924 C CA  . ASP B 302 ? 0.6770 0.9240 0.6684 0.0514  -0.0052 -0.0827 328 ASP B CA  
4925 C C   . ASP B 302 ? 0.8214 1.0858 0.8157 0.0474  -0.0030 -0.0963 328 ASP B C   
4926 O O   . ASP B 302 ? 0.8561 1.1404 0.8539 0.0437  -0.0008 -0.1092 328 ASP B O   
4927 C CB  . ASP B 302 ? 0.7753 1.0420 0.7662 0.0464  -0.0025 -0.0834 328 ASP B CB  
4928 C CG  . ASP B 302 ? 0.9785 1.2672 0.9666 0.0393  0.0009  -0.0820 328 ASP B CG  
4929 O OD1 . ASP B 302 ? 1.0531 1.3387 1.0397 0.0391  0.0009  -0.0778 328 ASP B OD1 
4930 O OD2 . ASP B 302 ? 1.0721 1.3820 1.0593 0.0337  0.0035  -0.0847 328 ASP B OD2 
4931 N N   . THR B 303 ? 0.8031 1.0603 0.7962 0.0479  -0.0033 -0.0937 329 THR B N   
4932 C CA  . THR B 303 ? 0.7224 0.9935 0.7181 0.0442  -0.0012 -0.1064 329 THR B CA  
4933 C C   . THR B 303 ? 0.8099 1.1149 0.8065 0.0356  0.0032  -0.1168 329 THR B C   
4934 O O   . THR B 303 ? 0.7243 1.0442 0.7252 0.0326  0.0053  -0.1317 329 THR B O   
4935 C CB  . THR B 303 ? 0.6305 0.8922 0.6236 0.0446  -0.0016 -0.1003 329 THR B CB  
4936 O OG1 . THR B 303 ? 0.7355 0.9659 0.7269 0.0521  -0.0057 -0.0896 329 THR B OG1 
4937 C CG2 . THR B 303 ? 0.4473 0.7211 0.4435 0.0409  0.0007  -0.1141 329 THR B CG2 
4938 N N   . LYS B 304 ? 0.8829 1.2001 0.8753 0.0314  0.0046  -0.1088 330 LYS B N   
4939 C CA  . LYS B 304 ? 0.7479 1.0983 0.7395 0.0225  0.0083  -0.1164 330 LYS B CA  
4940 C C   . LYS B 304 ? 0.6304 0.9939 0.6258 0.0210  0.0096  -0.1281 330 LYS B C   
4941 O O   . LYS B 304 ? 0.5486 0.9346 0.5469 0.0156  0.0125  -0.1423 330 LYS B O   
4942 C CB  . LYS B 304 ? 0.8875 1.2455 0.8735 0.0193  0.0089  -0.1033 330 LYS B CB  
4943 C CG  . LYS B 304 ? 0.9931 1.3862 0.9764 0.0094  0.0124  -0.1085 330 LYS B CG  
4944 C CD  . LYS B 304 ? 1.0738 1.4720 1.0514 0.0068  0.0124  -0.0937 330 LYS B CD  
4945 C CE  . LYS B 304 ? 1.0238 1.4580 0.9979 -0.0034 0.0154  -0.0975 330 LYS B CE  
4946 N NZ  . LYS B 304 ? 0.8022 1.2419 0.7709 -0.0057 0.0152  -0.0822 330 LYS B NZ  
4947 N N   . ASN B 305 ? 0.7756 1.1253 0.7715 0.0256  0.0076  -0.1226 331 ASN B N   
4948 C CA  . ASN B 305 ? 0.8156 1.1768 0.8152 0.0246  0.0086  -0.1327 331 ASN B CA  
4949 C C   . ASN B 305 ? 0.7774 1.1355 0.7838 0.0277  0.0083  -0.1468 331 ASN B C   
4950 O O   . ASN B 305 ? 0.6907 1.0698 0.7012 0.0237  0.0109  -0.1609 331 ASN B O   
4951 C CB  . ASN B 305 ? 0.8494 1.1951 0.8477 0.0290  0.0064  -0.1227 331 ASN B CB  
4952 C CG  . ASN B 305 ? 0.7799 1.1381 0.7821 0.0278  0.0074  -0.1329 331 ASN B CG  
4953 O OD1 . ASN B 305 ? 0.5783 0.9212 0.5818 0.0330  0.0051  -0.1297 331 ASN B OD1 
4954 N ND2 . ASN B 305 ? 0.8264 1.2133 0.8303 0.0208  0.0110  -0.1453 331 ASN B ND2 
4955 N N   . VAL B 306 ? 0.7159 1.0477 0.7235 0.0349  0.0050  -0.1428 332 VAL B N   
4956 C CA  . VAL B 306 ? 0.6750 1.0010 0.6889 0.0385  0.0043  -0.1547 332 VAL B CA  
4957 C C   . VAL B 306 ? 0.6977 1.0453 0.7150 0.0326  0.0082  -0.1696 332 VAL B C   
4958 O O   . VAL B 306 ? 0.5594 0.9172 0.5830 0.0321  0.0099  -0.1843 332 VAL B O   
4959 C CB  . VAL B 306 ? 0.6728 0.9676 0.6857 0.0461  0.0001  -0.1464 332 VAL B CB  
4960 C CG1 . VAL B 306 ? 0.6512 0.9415 0.6704 0.0492  -0.0002 -0.1590 332 VAL B CG1 
4961 C CG2 . VAL B 306 ? 0.7171 0.9908 0.7268 0.0519  -0.0038 -0.1331 332 VAL B CG2 
4962 N N   . GLN B 307 ? 0.7872 1.1421 0.8005 0.0280  0.0098  -0.1660 333 GLN B N   
4963 C CA  . GLN B 307 ? 0.7529 1.1295 0.7685 0.0214  0.0138  -0.1795 333 GLN B CA  
4964 C C   . GLN B 307 ? 0.6192 1.0270 0.6369 0.0143  0.0175  -0.1915 333 GLN B C   
4965 O O   . GLN B 307 ? 0.7746 1.1970 0.7978 0.0112  0.0204  -0.2077 333 GLN B O   
4966 C CB  . GLN B 307 ? 0.8262 1.2071 0.8360 0.0173  0.0146  -0.1717 333 GLN B CB  
4967 C CG  . GLN B 307 ? 0.8663 1.2700 0.8778 0.0099  0.0186  -0.1852 333 GLN B CG  
4968 C CD  . GLN B 307 ? 0.8500 1.2574 0.8557 0.0061  0.0190  -0.1771 333 GLN B CD  
4969 O OE1 . GLN B 307 ? 1.0020 1.4254 1.0083 0.0003  0.0219  -0.1865 333 GLN B OE1 
4970 N NE2 . GLN B 307 ? 0.7011 1.0942 0.7014 0.0093  0.0161  -0.1597 333 GLN B NE2 
4971 N N   . PHE B 308 ? 0.4012 0.8188 0.4145 0.0115  0.0176  -0.1838 334 PHE B N   
4972 C CA  . PHE B 308 ? 0.5442 0.9918 0.5584 0.0043  0.0210  -0.1935 334 PHE B CA  
4973 C C   . PHE B 308 ? 0.6025 1.0496 0.6237 0.0077  0.0209  -0.2044 334 PHE B C   
4974 O O   . PHE B 308 ? 0.6566 1.1263 0.6823 0.0029  0.0242  -0.2197 334 PHE B O   
4975 C CB  . PHE B 308 ? 0.8901 1.3471 0.8971 0.0003  0.0210  -0.1809 334 PHE B CB  
4976 C CG  . PHE B 308 ? 1.2308 1.7187 1.2376 -0.0076 0.0244  -0.1896 334 PHE B CG  
4977 C CD1 . PHE B 308 ? 1.4236 1.9409 1.4280 -0.0169 0.0278  -0.1964 334 PHE B CD1 
4978 C CD2 . PHE B 308 ? 1.2668 1.7554 1.2757 -0.0060 0.0240  -0.1910 334 PHE B CD2 
4979 C CE1 . PHE B 308 ? 1.4867 2.0331 1.4905 -0.0246 0.0309  -0.2043 334 PHE B CE1 
4980 C CE2 . PHE B 308 ? 1.4016 1.9189 1.4102 -0.0135 0.0272  -0.1990 334 PHE B CE2 
4981 C CZ  . PHE B 308 ? 1.4809 2.0270 1.4868 -0.0228 0.0306  -0.2056 334 PHE B CZ  
4982 N N   . VAL B 309 ? 0.6574 1.0796 0.6797 0.0159  0.0171  -0.1966 335 VAL B N   
4983 C CA  . VAL B 309 ? 0.6985 1.1190 0.7273 0.0199  0.0165  -0.2056 335 VAL B CA  
4984 C C   . VAL B 309 ? 0.6907 1.1100 0.7273 0.0222  0.0174  -0.2209 335 VAL B C   
4985 O O   . VAL B 309 ? 0.7115 1.1477 0.7543 0.0202  0.0198  -0.2356 335 VAL B O   
4986 C CB  . VAL B 309 ? 0.6766 1.0699 0.7041 0.0281  0.0118  -0.1932 335 VAL B CB  
4987 C CG1 . VAL B 309 ? 0.5133 0.9051 0.5479 0.0326  0.0109  -0.2032 335 VAL B CG1 
4988 C CG2 . VAL B 309 ? 0.6084 1.0036 0.6292 0.0256  0.0115  -0.1797 335 VAL B CG2 
4989 N N   . PHE B 310 ? 0.7220 1.1214 0.7587 0.0264  0.0156  -0.2174 336 PHE B N   
4990 C CA  . PHE B 310 ? 0.7703 1.1662 0.8143 0.0287  0.0166  -0.2310 336 PHE B CA  
4991 C C   . PHE B 310 ? 0.8526 1.2770 0.8996 0.0201  0.0221  -0.2466 336 PHE B C   
4992 O O   . PHE B 310 ? 0.9008 1.3320 0.9555 0.0202  0.0244  -0.2624 336 PHE B O   
4993 C CB  . PHE B 310 ? 0.8664 1.2355 0.9087 0.0340  0.0138  -0.2228 336 PHE B CB  
4994 C CG  . PHE B 310 ? 1.0343 1.3964 1.0841 0.0370  0.0147  -0.2355 336 PHE B CG  
4995 C CD1 . PHE B 310 ? 1.0469 1.3915 1.1013 0.0448  0.0118  -0.2370 336 PHE B CD1 
4996 C CD2 . PHE B 310 ? 1.0901 1.4634 1.1421 0.0319  0.0187  -0.2460 336 PHE B CD2 
4997 C CE1 . PHE B 310 ? 1.0307 1.3683 1.0921 0.0477  0.0128  -0.2484 336 PHE B CE1 
4998 C CE2 . PHE B 310 ? 1.1271 1.4932 1.1864 0.0345  0.0200  -0.2579 336 PHE B CE2 
4999 C CZ  . PHE B 310 ? 1.0875 1.4354 1.1517 0.0426  0.0171  -0.2590 336 PHE B CZ  
5000 N N   . ASP B 311 ? 0.8178 1.2589 0.8584 0.0127  0.0241  -0.2420 337 ASP B N   
5001 C CA  . ASP B 311 ? 0.9297 1.4008 0.9715 0.0033  0.0292  -0.2557 337 ASP B CA  
5002 C C   . ASP B 311 ? 0.8814 1.3751 0.9278 -0.0001 0.0318  -0.2685 337 ASP B C   
5003 O O   . ASP B 311 ? 0.7237 1.2334 0.7766 -0.0035 0.0355  -0.2858 337 ASP B O   
5004 C CB  . ASP B 311 ? 1.0606 1.5460 1.0934 -0.0039 0.0301  -0.2459 337 ASP B CB  
5005 C CG  . ASP B 311 ? 1.1039 1.6194 1.1371 -0.0138 0.0350  -0.2591 337 ASP B CG  
5006 O OD1 . ASP B 311 ? 1.0059 1.5372 1.0457 -0.0166 0.0383  -0.2763 337 ASP B OD1 
5007 O OD2 . ASP B 311 ? 1.1089 1.6327 1.1356 -0.0190 0.0356  -0.2525 337 ASP B OD2 
5008 N N   . ALA B 312 ? 0.8986 1.3934 0.9420 0.0008  0.0301  -0.2602 338 ALA B N   
5009 C CA  . ALA B 312 ? 0.7967 1.3115 0.8442 -0.0020 0.0322  -0.2710 338 ALA B CA  
5010 C C   . ALA B 312 ? 0.7207 1.2240 0.7780 0.0053  0.0313  -0.2822 338 ALA B C   
5011 O O   . ALA B 312 ? 0.6831 1.2050 0.7467 0.0026  0.0343  -0.2976 338 ALA B O   
5012 C CB  . ALA B 312 ? 0.7728 1.2885 0.8145 -0.0023 0.0303  -0.2583 338 ALA B CB  
5013 N N   . VAL B 313 ? 0.8203 1.2932 0.8786 0.0143  0.0272  -0.2742 339 VAL B N   
5014 C CA  . VAL B 313 ? 0.8489 1.3083 0.9158 0.0219  0.0258  -0.2830 339 VAL B CA  
5015 C C   . VAL B 313 ? 0.7265 1.1943 0.8008 0.0198  0.0297  -0.3005 339 VAL B C   
5016 O O   . VAL B 313 ? 0.6624 1.1385 0.7450 0.0210  0.0315  -0.3152 339 VAL B O   
5017 C CB  . VAL B 313 ? 0.9686 1.3936 1.0336 0.0314  0.0204  -0.2695 339 VAL B CB  
5018 C CG1 . VAL B 313 ? 0.8736 1.2854 0.9473 0.0386  0.0193  -0.2793 339 VAL B CG1 
5019 C CG2 . VAL B 313 ? 1.0567 1.4724 1.1160 0.0342  0.0167  -0.2544 339 VAL B CG2 
5020 N N   . THR B 314 ? 0.7183 1.1840 0.7897 0.0167  0.0310  -0.2990 340 THR B N   
5021 C CA  . THR B 314 ? 0.7415 1.2148 0.8195 0.0139  0.0352  -0.3152 340 THR B CA  
5022 C C   . THR B 314 ? 0.7588 1.2650 0.8412 0.0060  0.0404  -0.3326 340 THR B C   
5023 O O   . THR B 314 ? 0.7252 1.2361 0.8168 0.0070  0.0432  -0.3489 340 THR B O   
5024 C CB  . THR B 314 ? 0.9100 1.3812 0.9827 0.0097  0.0363  -0.3103 340 THR B CB  
5025 O OG1 . THR B 314 ? 0.8650 1.3049 0.9342 0.0172  0.0316  -0.2952 340 THR B OG1 
5026 C CG2 . THR B 314 ? 1.0806 1.5614 1.1602 0.0059  0.0412  -0.3282 340 THR B CG2 
5027 N N   . ASP B 315 ? 0.7427 1.2717 0.8186 -0.0019 0.0418  -0.3289 341 ASP B N   
5028 C CA  . ASP B 315 ? 0.6718 1.2341 0.7505 -0.0103 0.0467  -0.3440 341 ASP B CA  
5029 C C   . ASP B 315 ? 0.5430 1.1076 0.6298 -0.0060 0.0467  -0.3541 341 ASP B C   
5030 O O   . ASP B 315 ? 0.6013 1.1862 0.6949 -0.0101 0.0510  -0.3719 341 ASP B O   
5031 C CB  . ASP B 315 ? 0.8635 1.4471 0.9326 -0.0186 0.0473  -0.3350 341 ASP B CB  
5032 C CG  . ASP B 315 ? 1.1684 1.7585 1.2302 -0.0249 0.0484  -0.3292 341 ASP B CG  
5033 O OD1 . ASP B 315 ? 1.2894 1.8693 1.3539 -0.0237 0.0493  -0.3337 341 ASP B OD1 
5034 O OD2 . ASP B 315 ? 1.2166 1.8222 1.2699 -0.0313 0.0485  -0.3199 341 ASP B OD2 
5035 N N   . VAL B 316 ? 0.6857 1.2300 0.7718 0.0021  0.0420  -0.3430 342 VAL B N   
5036 C CA  . VAL B 316 ? 0.8072 1.3522 0.9007 0.0070  0.0413  -0.3510 342 VAL B CA  
5037 C C   . VAL B 316 ? 0.9336 1.4678 1.0377 0.0129  0.0423  -0.3648 342 VAL B C   
5038 O O   . VAL B 316 ? 1.0652 1.6135 1.1775 0.0125  0.0451  -0.3806 342 VAL B O   
5039 C CB  . VAL B 316 ? 0.6838 1.2085 0.7735 0.0144  0.0358  -0.3350 342 VAL B CB  
5040 C CG1 . VAL B 316 ? 0.5999 1.1230 0.6978 0.0204  0.0348  -0.3438 342 VAL B CG1 
5041 C CG2 . VAL B 316 ? 0.6756 1.2128 0.7560 0.0084  0.0355  -0.3231 342 VAL B CG2 
5042 N N   . ILE B 317 ? 0.8673 1.3763 0.9712 0.0183  0.0402  -0.3588 343 ILE B N   
5043 C CA  . ILE B 317 ? 0.9541 1.4504 1.0675 0.0240  0.0412  -0.3706 343 ILE B CA  
5044 C C   . ILE B 317 ? 1.0405 1.5592 1.1602 0.0166  0.0478  -0.3902 343 ILE B C   
5045 O O   . ILE B 317 ? 0.9702 1.4918 1.0999 0.0190  0.0504  -0.4059 343 ILE B O   
5046 C CB  . ILE B 317 ? 0.9664 1.4318 1.0773 0.0302  0.0378  -0.3592 343 ILE B CB  
5047 C CG1 . ILE B 317 ? 0.9977 1.4421 1.1013 0.0365  0.0313  -0.3390 343 ILE B CG1 
5048 C CG2 . ILE B 317 ? 0.9656 1.4164 1.0864 0.0368  0.0386  -0.3704 343 ILE B CG2 
5049 C CD1 . ILE B 317 ? 0.9967 1.4112 1.0966 0.0422  0.0277  -0.3265 343 ILE B CD1 
5050 N N   . ILE B 318 ? 1.1273 1.6623 1.2409 0.0074  0.0507  -0.3895 344 ILE B N   
5051 C CA  . ILE B 318 ? 1.1113 1.6691 1.2295 -0.0010 0.0571  -0.4075 344 ILE B CA  
5052 C C   . ILE B 318 ? 1.0927 1.6748 1.2185 -0.0041 0.0610  -0.4252 344 ILE B C   
5053 O O   . ILE B 318 ? 1.1424 1.7288 1.2779 -0.0041 0.0651  -0.4426 344 ILE B O   
5054 C CB  . ILE B 318 ? 1.1207 1.6976 1.2295 -0.0114 0.0591  -0.4025 344 ILE B CB  
5055 C CG1 . ILE B 318 ? 1.0273 1.5815 1.1299 -0.0089 0.0563  -0.3882 344 ILE B CG1 
5056 C CG2 . ILE B 318 ? 1.1834 1.7885 1.2965 -0.0211 0.0660  -0.4223 344 ILE B CG2 
5057 C CD1 . ILE B 318 ? 0.9474 1.5192 1.0406 -0.0185 0.0579  -0.3826 344 ILE B CD1 
5058 N N   . LYS B 319 ? 1.0464 1.6442 1.1681 -0.0068 0.0598  -0.4207 345 LYS B N   
5059 C CA  . LYS B 319 ? 1.1414 1.7643 1.2694 -0.0105 0.0634  -0.4364 345 LYS B CA  
5060 C C   . LYS B 319 ? 1.2561 1.8650 1.3944 -0.0006 0.0620  -0.4437 345 LYS B C   
5061 O O   . LYS B 319 ? 1.3601 1.9849 1.5028 -0.0012 0.0632  -0.4524 345 LYS B O   
5062 C CB  . LYS B 319 ? 1.1777 1.8204 1.2978 -0.0162 0.0625  -0.4283 345 LYS B CB  
5063 C CG  . LYS B 319 ? 1.2428 1.8649 1.3578 -0.0087 0.0563  -0.4098 345 LYS B CG  
5064 C CD  . LYS B 319 ? 1.2290 1.8714 1.3367 -0.0150 0.0562  -0.4028 345 LYS B CD  
5065 C CE  . LYS B 319 ? 1.1051 1.7266 1.2083 -0.0078 0.0505  -0.3852 345 LYS B CE  
5066 N NZ  . LYS B 319 ? 0.9544 1.5943 1.0506 -0.0139 0.0507  -0.3783 345 LYS B NZ  
5067 N N   . ASN B 320 ? 1.2461 1.8255 1.3879 0.0084  0.0594  -0.4399 346 ASN B N   
5068 C CA  . ASN B 320 ? 1.2285 1.7924 1.3795 0.0185  0.0576  -0.4456 346 ASN B CA  
5069 C C   . ASN B 320 ? 1.2023 1.7484 1.3614 0.0232  0.0596  -0.4545 346 ASN B C   
5070 O O   . ASN B 320 ? 1.0707 1.5932 1.2344 0.0333  0.0564  -0.4517 346 ASN B O   
5071 C CB  . ASN B 320 ? 1.1738 1.7153 1.3199 0.0271  0.0505  -0.4273 346 ASN B CB  
5072 C CG  . ASN B 320 ? 1.0523 1.6102 1.1921 0.0233  0.0489  -0.4201 346 ASN B CG  
5073 O OD1 . ASN B 320 ? 0.8893 1.4732 1.0324 0.0179  0.0524  -0.4321 346 ASN B OD1 
5074 N ND2 . ASN B 320 ? 1.0958 1.6383 1.2266 0.0260  0.0439  -0.4005 346 ASN B ND2 
5075 N N   . ASN B 321 ? 1.2849 1.8429 1.4455 0.0157  0.0650  -0.4651 347 ASN B N   
5076 C CA  . ASN B 321 ? 1.3293 1.8725 1.4979 0.0189  0.0679  -0.4750 347 ASN B CA  
5077 C C   . ASN B 321 ? 1.2955 1.8571 1.4762 0.0161  0.0746  -0.4990 347 ASN B C   
5078 O O   . ASN B 321 ? 1.3033 1.8551 1.4920 0.0181  0.0783  -0.5101 347 ASN B O   
5079 C CB  . ASN B 321 ? 1.2979 1.8381 1.4604 0.0129  0.0695  -0.4702 347 ASN B CB  
5080 C CG  . ASN B 321 ? 1.2888 1.8061 1.4576 0.0177  0.0712  -0.4750 347 ASN B CG  
5081 O OD1 . ASN B 321 ? 1.2373 1.7563 1.4046 0.0120  0.0746  -0.4781 347 ASN B OD1 
5082 N ND2 . ASN B 321 ? 1.3216 1.8176 1.4975 0.0282  0.0690  -0.4755 347 ASN B ND2 
5083 N N   . LEU B 322 ? 1.2231 1.8112 1.4049 0.0113  0.0764  -0.5071 348 LEU B N   
5084 C CA  . LEU B 322 ? 1.2616 1.8696 1.4545 0.0080  0.0829  -0.5302 348 LEU B CA  
5085 C C   . LEU B 322 ? 1.1629 1.7827 1.3583 -0.0008 0.0896  -0.5436 348 LEU B C   
5086 O O   . LEU B 322 ? 1.0419 1.6918 1.2382 -0.0108 0.0948  -0.5570 348 LEU B O   
5087 C CB  . LEU B 322 ? 1.3282 1.9173 1.5326 0.0194  0.0823  -0.5373 348 LEU B CB  
5088 C CG  . LEU B 322 ? 1.2741 1.8499 1.4767 0.0289  0.0755  -0.5248 348 LEU B CG  
5089 C CD1 . LEU B 322 ? 1.2549 1.8116 1.4687 0.0402  0.0751  -0.5319 348 LEU B CD1 
5090 C CD2 . LEU B 322 ? 1.2075 1.8107 1.4078 0.0238  0.0755  -0.5273 348 LEU B CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   27  ?   ?   ?   A . n 
A 1 2   ASN 2   28  ?   ?   ?   A . n 
A 1 3   ALA 3   29  ?   ?   ?   A . n 
A 1 4   GLY 4   30  30  GLY GLY A . n 
A 1 5   ALA 5   31  31  ALA ALA A . n 
A 1 6   ARG 6   32  32  ARG ARG A . n 
A 1 7   GLU 7   33  33  GLU GLU A . n 
A 1 8   VAL 8   34  34  VAL VAL A . n 
A 1 9   LYS 9   35  35  LYS LYS A . n 
A 1 10  LEU 10  36  36  LEU LEU A . n 
A 1 11  LEU 11  37  37  LEU LEU A . n 
A 1 12  LEU 12  38  38  LEU LEU A . n 
A 1 13  LEU 13  39  39  LEU LEU A . n 
A 1 14  GLY 14  40  40  GLY GLY A . n 
A 1 15  ALA 15  41  41  ALA ALA A . n 
A 1 16  ARG 16  42  42  ARG ARG A . n 
A 1 17  GLU 17  43  43  GLU GLU A . n 
A 1 18  SER 18  44  44  SER SER A . n 
A 1 19  GLY 19  45  45  GLY GLY A . n 
A 1 20  LYS 20  46  46  LYS LYS A . n 
A 1 21  SER 21  47  47  SER SER A . n 
A 1 22  THR 22  48  48  THR THR A . n 
A 1 23  ILE 23  49  49  ILE ILE A . n 
A 1 24  VAL 24  50  50  VAL VAL A . n 
A 1 25  LYS 25  51  51  LYS LYS A . n 
A 1 26  GLN 26  52  52  GLN GLN A . n 
A 1 27  MET 27  53  53  MET MET A . n 
A 1 28  LYS 28  54  54  LYS LYS A . n 
A 1 29  ILE 29  55  55  ILE ILE A . n 
A 1 30  ILE 30  56  56  ILE ILE A . n 
A 1 31  HIS 31  57  57  HIS HIS A . n 
A 1 32  GLU 32  58  58  GLU GLU A . n 
A 1 33  ALA 33  59  59  ALA ALA A . n 
A 1 34  GLY 34  60  60  GLY GLY A . n 
A 1 35  TYR 35  61  61  TYR TYR A . n 
A 1 36  SER 36  62  62  SER SER A . n 
A 1 37  GLU 37  63  63  GLU GLU A . n 
A 1 38  GLU 38  64  64  GLU GLU A . n 
A 1 39  GLU 39  65  65  GLU GLU A . n 
A 1 40  CYS 40  66  66  CYS CYS A . n 
A 1 41  LYS 41  67  67  LYS LYS A . n 
A 1 42  GLN 42  68  68  GLN GLN A . n 
A 1 43  TYR 43  69  69  TYR TYR A . n 
A 1 44  LYS 44  70  70  LYS LYS A . n 
A 1 45  ALA 45  71  71  ALA ALA A . n 
A 1 46  VAL 46  72  72  VAL VAL A . n 
A 1 47  VAL 47  73  73  VAL VAL A . n 
A 1 48  TYR 48  74  74  TYR TYR A . n 
A 1 49  SER 49  75  75  SER SER A . n 
A 1 50  ASN 50  76  76  ASN ASN A . n 
A 1 51  THR 51  77  77  THR THR A . n 
A 1 52  ILE 52  78  78  ILE ILE A . n 
A 1 53  GLN 53  79  79  GLN GLN A . n 
A 1 54  SER 54  80  80  SER SER A . n 
A 1 55  ILE 55  81  81  ILE ILE A . n 
A 1 56  ILE 56  82  82  ILE ILE A . n 
A 1 57  ALA 57  83  83  ALA ALA A . n 
A 1 58  ILE 58  84  84  ILE ILE A . n 
A 1 59  ILE 59  85  85  ILE ILE A . n 
A 1 60  ARG 60  86  86  ARG ARG A . n 
A 1 61  ALA 61  87  87  ALA ALA A . n 
A 1 62  MET 62  88  88  MET MET A . n 
A 1 63  GLY 63  89  89  GLY GLY A . n 
A 1 64  ARG 64  90  90  ARG ARG A . n 
A 1 65  LEU 65  91  91  LEU LEU A . n 
A 1 66  LYS 66  92  92  LYS LYS A . n 
A 1 67  ILE 67  93  93  ILE ILE A . n 
A 1 68  ASP 68  94  94  ASP ASP A . n 
A 1 69  PHE 69  95  95  PHE PHE A . n 
A 1 70  GLY 70  96  96  GLY GLY A . n 
A 1 71  ASP 71  97  97  ASP ASP A . n 
A 1 72  SER 72  98  98  SER SER A . n 
A 1 73  ALA 73  99  99  ALA ALA A . n 
A 1 74  ARG 74  100 100 ARG ARG A . n 
A 1 75  ALA 75  101 101 ALA ALA A . n 
A 1 76  ASP 76  102 102 ASP ASP A . n 
A 1 77  ASP 77  103 103 ASP ASP A . n 
A 1 78  ALA 78  104 104 ALA ALA A . n 
A 1 79  ARG 79  105 105 ARG ARG A . n 
A 1 80  GLN 80  106 106 GLN GLN A . n 
A 1 81  LEU 81  107 107 LEU LEU A . n 
A 1 82  PHE 82  108 108 PHE PHE A . n 
A 1 83  VAL 83  109 109 VAL VAL A . n 
A 1 84  LEU 84  110 110 LEU LEU A . n 
A 1 85  ALA 85  111 111 ALA ALA A . n 
A 1 86  GLY 86  112 112 GLY GLY A . n 
A 1 87  ALA 87  113 113 ALA ALA A . n 
A 1 88  ALA 88  114 114 ALA ALA A . n 
A 1 89  GLU 89  115 115 GLU GLU A . n 
A 1 90  GLU 90  116 116 GLU GLU A . n 
A 1 91  GLY 91  117 117 GLY GLY A . n 
A 1 92  PHE 92  118 118 PHE PHE A . n 
A 1 93  MET 93  119 119 MET MET A . n 
A 1 94  THR 94  120 120 THR THR A . n 
A 1 95  ALA 95  121 121 ALA ALA A . n 
A 1 96  GLU 96  122 122 GLU GLU A . n 
A 1 97  LEU 97  123 123 LEU LEU A . n 
A 1 98  ALA 98  124 124 ALA ALA A . n 
A 1 99  GLY 99  125 125 GLY GLY A . n 
A 1 100 VAL 100 126 126 VAL VAL A . n 
A 1 101 ILE 101 127 127 ILE ILE A . n 
A 1 102 LYS 102 128 128 LYS LYS A . n 
A 1 103 ARG 103 129 129 ARG ARG A . n 
A 1 104 LEU 104 130 130 LEU LEU A . n 
A 1 105 TRP 105 131 131 TRP TRP A . n 
A 1 106 LYS 106 132 132 LYS LYS A . n 
A 1 107 ASP 107 133 133 ASP ASP A . n 
A 1 108 SER 108 134 134 SER SER A . n 
A 1 109 GLY 109 135 135 GLY GLY A . n 
A 1 110 VAL 110 136 136 VAL VAL A . n 
A 1 111 GLN 111 137 137 GLN GLN A . n 
A 1 112 ALA 112 138 138 ALA ALA A . n 
A 1 113 CYS 113 139 139 CYS CYS A . n 
A 1 114 PHE 114 140 140 PHE PHE A . n 
A 1 115 ASN 115 141 141 ASN ASN A . n 
A 1 116 ARG 116 142 142 ARG ARG A . n 
A 1 117 SER 117 143 143 SER SER A . n 
A 1 118 ARG 118 144 144 ARG ARG A . n 
A 1 119 GLU 119 145 145 GLU GLU A . n 
A 1 120 TYR 120 146 146 TYR TYR A . n 
A 1 121 GLN 121 147 147 GLN GLN A . n 
A 1 122 LEU 122 148 148 LEU LEU A . n 
A 1 123 ASN 123 149 149 ASN ASN A . n 
A 1 124 ASP 124 150 150 ASP ASP A . n 
A 1 125 SER 125 151 151 SER SER A . n 
A 1 126 ALA 126 152 152 ALA ALA A . n 
A 1 127 ALA 127 153 153 ALA ALA A . n 
A 1 128 TYR 128 154 154 TYR TYR A . n 
A 1 129 TYR 129 155 155 TYR TYR A . n 
A 1 130 LEU 130 156 156 LEU LEU A . n 
A 1 131 ASN 131 157 157 ASN ASN A . n 
A 1 132 ASP 132 158 158 ASP ASP A . n 
A 1 133 LEU 133 159 159 LEU LEU A . n 
A 1 134 ASP 134 160 160 ASP ASP A . n 
A 1 135 ARG 135 161 161 ARG ARG A . n 
A 1 136 ILE 136 162 162 ILE ILE A . n 
A 1 137 ALA 137 163 163 ALA ALA A . n 
A 1 138 GLN 138 164 164 GLN GLN A . n 
A 1 139 PRO 139 165 165 PRO PRO A . n 
A 1 140 ASN 140 166 166 ASN ASN A . n 
A 1 141 TYR 141 167 167 TYR TYR A . n 
A 1 142 ILE 142 168 168 ILE ILE A . n 
A 1 143 PRO 143 169 169 PRO PRO A . n 
A 1 144 THR 144 170 170 THR THR A . n 
A 1 145 GLN 145 171 171 GLN GLN A . n 
A 1 146 GLN 146 172 172 GLN GLN A . n 
A 1 147 ASP 147 173 173 ASP ASP A . n 
A 1 148 VAL 148 174 174 VAL VAL A . n 
A 1 149 LEU 149 175 175 LEU LEU A . n 
A 1 150 ARG 150 176 176 ARG ARG A . n 
A 1 151 THR 151 177 177 THR THR A . n 
A 1 152 ARG 152 178 178 ARG ARG A . n 
A 1 153 VAL 153 179 179 VAL VAL A . n 
A 1 154 LYS 154 180 180 LYS LYS A . n 
A 1 155 THR 155 181 181 THR THR A . n 
A 1 156 THR 156 182 182 THR THR A . n 
A 1 157 GLY 157 183 183 GLY GLY A . n 
A 1 158 ILE 158 184 184 ILE ILE A . n 
A 1 159 VAL 159 185 185 VAL VAL A . n 
A 1 160 GLU 160 186 186 GLU GLU A . n 
A 1 161 THR 161 187 187 THR THR A . n 
A 1 162 HIS 162 188 188 HIS HIS A . n 
A 1 163 PHE 163 189 189 PHE PHE A . n 
A 1 164 THR 164 190 190 THR THR A . n 
A 1 165 PHE 165 191 191 PHE PHE A . n 
A 1 166 LYS 166 192 192 LYS LYS A . n 
A 1 167 ASP 167 193 193 ASP ASP A . n 
A 1 168 LEU 168 194 194 LEU LEU A . n 
A 1 169 HIS 169 195 195 HIS HIS A . n 
A 1 170 PHE 170 196 196 PHE PHE A . n 
A 1 171 LYS 171 197 197 LYS LYS A . n 
A 1 172 MET 172 198 198 MET MET A . n 
A 1 173 PHE 173 199 199 PHE PHE A . n 
A 1 174 ASP 174 200 200 ASP ASP A . n 
A 1 175 VAL 175 201 201 VAL VAL A . n 
A 1 176 GLY 176 202 202 GLY GLY A . n 
A 1 177 GLY 177 203 203 GLY GLY A . n 
A 1 178 GLN 178 204 204 GLN GLN A . n 
A 1 179 ARG 179 205 205 ARG ARG A . n 
A 1 180 SER 180 206 206 SER SER A . n 
A 1 181 GLU 181 207 207 GLU GLU A . n 
A 1 182 ARG 182 208 208 ARG ARG A . n 
A 1 183 LYS 183 209 209 LYS LYS A . n 
A 1 184 LYS 184 210 210 LYS LYS A . n 
A 1 185 TRP 185 211 211 TRP TRP A . n 
A 1 186 ILE 186 212 212 ILE ILE A . n 
A 1 187 HIS 187 213 213 HIS HIS A . n 
A 1 188 CYS 188 214 214 CYS CYS A . n 
A 1 189 PHE 189 215 215 PHE PHE A . n 
A 1 190 GLU 190 216 216 GLU GLU A . n 
A 1 191 GLY 191 217 217 GLY GLY A . n 
A 1 192 VAL 192 218 218 VAL VAL A . n 
A 1 193 THR 193 219 219 THR THR A . n 
A 1 194 ALA 194 220 220 ALA ALA A . n 
A 1 195 ILE 195 221 221 ILE ILE A . n 
A 1 196 ILE 196 222 222 ILE ILE A . n 
A 1 197 PHE 197 223 223 PHE PHE A . n 
A 1 198 CYS 198 224 224 CYS CYS A . n 
A 1 199 VAL 199 225 225 VAL VAL A . n 
A 1 200 ALA 200 226 226 ALA ALA A . n 
A 1 201 LEU 201 227 227 LEU LEU A . n 
A 1 202 SER 202 228 228 SER SER A . n 
A 1 203 ASP 203 229 229 ASP ASP A . n 
A 1 204 TYR 204 230 230 TYR TYR A . n 
A 1 205 ASP 205 231 231 ASP ASP A . n 
A 1 206 LEU 206 232 232 LEU LEU A . n 
A 1 207 VAL 207 233 233 VAL VAL A . n 
A 1 208 LEU 208 234 234 LEU LEU A . n 
A 1 209 ALA 209 235 235 ALA ALA A . n 
A 1 210 GLU 210 236 236 GLU GLU A . n 
A 1 211 ASP 211 237 237 ASP ASP A . n 
A 1 212 GLU 212 238 238 GLU GLU A . n 
A 1 213 GLU 213 239 239 GLU GLU A . n 
A 1 214 MET 214 240 240 MET MET A . n 
A 1 215 ASN 215 241 241 ASN ASN A . n 
A 1 216 ARG 216 242 242 ARG ARG A . n 
A 1 217 MET 217 243 243 MET MET A . n 
A 1 218 HIS 218 244 244 HIS HIS A . n 
A 1 219 GLU 219 245 245 GLU GLU A . n 
A 1 220 SER 220 246 246 SER SER A . n 
A 1 221 MET 221 247 247 MET MET A . n 
A 1 222 LYS 222 248 248 LYS LYS A . n 
A 1 223 LEU 223 249 249 LEU LEU A . n 
A 1 224 PHE 224 250 250 PHE PHE A . n 
A 1 225 ASP 225 251 251 ASP ASP A . n 
A 1 226 SER 226 252 252 SER SER A . n 
A 1 227 ILE 227 253 253 ILE ILE A . n 
A 1 228 CYS 228 254 254 CYS CYS A . n 
A 1 229 ASN 229 255 255 ASN ASN A . n 
A 1 230 ASN 230 256 256 ASN ASN A . n 
A 1 231 LYS 231 257 257 LYS LYS A . n 
A 1 232 TRP 232 258 258 TRP TRP A . n 
A 1 233 PHE 233 259 259 PHE PHE A . n 
A 1 234 THR 234 260 260 THR THR A . n 
A 1 235 ASP 235 261 261 ASP ASP A . n 
A 1 236 THR 236 262 262 THR THR A . n 
A 1 237 SER 237 263 263 SER SER A . n 
A 1 238 ILE 238 264 264 ILE ILE A . n 
A 1 239 ILE 239 265 265 ILE ILE A . n 
A 1 240 LEU 240 266 266 LEU LEU A . n 
A 1 241 PHE 241 267 267 PHE PHE A . n 
A 1 242 LEU 242 268 268 LEU LEU A . n 
A 1 243 ASN 243 269 269 ASN ASN A . n 
A 1 244 LYS 244 270 270 LYS LYS A . n 
A 1 245 LYS 245 271 271 LYS LYS A . n 
A 1 246 ASP 246 272 272 ASP ASP A . n 
A 1 247 LEU 247 273 273 LEU LEU A . n 
A 1 248 PHE 248 274 274 PHE PHE A . n 
A 1 249 GLU 249 275 275 GLU GLU A . n 
A 1 250 GLU 250 276 276 GLU GLU A . n 
A 1 251 LYS 251 277 277 LYS LYS A . n 
A 1 252 ILE 252 278 278 ILE ILE A . n 
A 1 253 LYS 253 279 279 LYS LYS A . n 
A 1 254 LYS 254 280 280 LYS LYS A . n 
A 1 255 SER 255 281 281 SER SER A . n 
A 1 256 PRO 256 282 282 PRO PRO A . n 
A 1 257 LEU 257 283 283 LEU LEU A . n 
A 1 258 THR 258 284 284 THR THR A . n 
A 1 259 ILE 259 285 285 ILE ILE A . n 
A 1 260 CYS 260 286 286 CYS CYS A . n 
A 1 261 TYR 261 287 287 TYR TYR A . n 
A 1 262 PRO 262 288 288 PRO PRO A . n 
A 1 263 GLU 263 289 289 GLU GLU A . n 
A 1 264 TYR 264 290 290 TYR TYR A . n 
A 1 265 ALA 265 291 291 ALA ALA A . n 
A 1 266 GLY 266 292 292 GLY GLY A . n 
A 1 267 SER 267 293 293 SER SER A . n 
A 1 268 ASN 268 294 294 ASN ASN A . n 
A 1 269 THR 269 295 295 THR THR A . n 
A 1 270 TYR 270 296 296 TYR TYR A . n 
A 1 271 GLU 271 297 297 GLU GLU A . n 
A 1 272 GLU 272 298 298 GLU GLU A . n 
A 1 273 ALA 273 299 299 ALA ALA A . n 
A 1 274 ALA 274 300 300 ALA ALA A . n 
A 1 275 ALA 275 301 301 ALA ALA A . n 
A 1 276 TYR 276 302 302 TYR TYR A . n 
A 1 277 ILE 277 303 303 ILE ILE A . n 
A 1 278 GLN 278 304 304 GLN GLN A . n 
A 1 279 CYS 279 305 305 CYS CYS A . n 
A 1 280 GLN 280 306 306 GLN GLN A . n 
A 1 281 PHE 281 307 307 PHE PHE A . n 
A 1 282 GLU 282 308 308 GLU GLU A . n 
A 1 283 ASP 283 309 309 ASP ASP A . n 
A 1 284 LEU 284 310 310 LEU LEU A . n 
A 1 285 ASN 285 311 311 ASN ASN A . n 
A 1 286 LYS 286 312 312 LYS LYS A . n 
A 1 287 ARG 287 313 313 ARG ARG A . n 
A 1 288 LYS 288 314 314 LYS LYS A . n 
A 1 289 ASP 289 315 315 ASP ASP A . n 
A 1 290 THR 290 316 316 THR THR A . n 
A 1 291 LYS 291 317 317 LYS LYS A . n 
A 1 292 GLU 292 318 318 GLU GLU A . n 
A 1 293 ILE 293 319 319 ILE ILE A . n 
A 1 294 TYR 294 320 320 TYR TYR A . n 
A 1 295 THR 295 321 321 THR THR A . n 
A 1 296 HIS 296 322 322 HIS HIS A . n 
A 1 297 PHE 297 323 323 PHE PHE A . n 
A 1 298 THR 298 324 324 THR THR A . n 
A 1 299 CYS 299 325 325 CYS CYS A . n 
A 1 300 ALA 300 326 326 ALA ALA A . n 
A 1 301 THR 301 327 327 THR THR A . n 
A 1 302 ASP 302 328 328 ASP ASP A . n 
A 1 303 THR 303 329 329 THR THR A . n 
A 1 304 LYS 304 330 330 LYS LYS A . n 
A 1 305 ASN 305 331 331 ASN ASN A . n 
A 1 306 VAL 306 332 332 VAL VAL A . n 
A 1 307 GLN 307 333 333 GLN GLN A . n 
A 1 308 PHE 308 334 334 PHE PHE A . n 
A 1 309 VAL 309 335 335 VAL VAL A . n 
A 1 310 PHE 310 336 336 PHE PHE A . n 
A 1 311 ASP 311 337 337 ASP ASP A . n 
A 1 312 ALA 312 338 338 ALA ALA A . n 
A 1 313 VAL 313 339 339 VAL VAL A . n 
A 1 314 THR 314 340 340 THR THR A . n 
A 1 315 ASP 315 341 341 ASP ASP A . n 
A 1 316 VAL 316 342 342 VAL VAL A . n 
A 1 317 ILE 317 343 343 ILE ILE A . n 
A 1 318 ILE 318 344 344 ILE ILE A . n 
A 1 319 LYS 319 345 345 LYS LYS A . n 
A 1 320 ASN 320 346 346 ASN ASN A . n 
A 1 321 ASN 321 347 347 ASN ASN A . n 
A 1 322 LEU 322 348 ?   ?   ?   A . n 
A 1 323 LYS 323 349 ?   ?   ?   A . n 
A 1 324 ASP 324 350 ?   ?   ?   A . n 
A 1 325 CYS 325 351 ?   ?   ?   A . n 
A 1 326 GLY 326 352 ?   ?   ?   A . n 
A 1 327 LEU 327 353 ?   ?   ?   A . n 
A 1 328 PHE 328 354 ?   ?   ?   A . n 
B 1 1   SER 1   27  ?   ?   ?   B . n 
B 1 2   ASN 2   28  ?   ?   ?   B . n 
B 1 3   ALA 3   29  ?   ?   ?   B . n 
B 1 4   GLY 4   30  ?   ?   ?   B . n 
B 1 5   ALA 5   31  ?   ?   ?   B . n 
B 1 6   ARG 6   32  ?   ?   ?   B . n 
B 1 7   GLU 7   33  ?   ?   ?   B . n 
B 1 8   VAL 8   34  34  VAL VAL B . n 
B 1 9   LYS 9   35  35  LYS LYS B . n 
B 1 10  LEU 10  36  36  LEU LEU B . n 
B 1 11  LEU 11  37  37  LEU LEU B . n 
B 1 12  LEU 12  38  38  LEU LEU B . n 
B 1 13  LEU 13  39  39  LEU LEU B . n 
B 1 14  GLY 14  40  40  GLY GLY B . n 
B 1 15  ALA 15  41  41  ALA ALA B . n 
B 1 16  ARG 16  42  42  ARG ARG B . n 
B 1 17  GLU 17  43  43  GLU GLU B . n 
B 1 18  SER 18  44  44  SER SER B . n 
B 1 19  GLY 19  45  45  GLY GLY B . n 
B 1 20  LYS 20  46  46  LYS LYS B . n 
B 1 21  SER 21  47  47  SER SER B . n 
B 1 22  THR 22  48  48  THR THR B . n 
B 1 23  ILE 23  49  49  ILE ILE B . n 
B 1 24  VAL 24  50  50  VAL VAL B . n 
B 1 25  LYS 25  51  51  LYS LYS B . n 
B 1 26  GLN 26  52  52  GLN GLN B . n 
B 1 27  MET 27  53  53  MET MET B . n 
B 1 28  LYS 28  54  54  LYS LYS B . n 
B 1 29  ILE 29  55  55  ILE ILE B . n 
B 1 30  ILE 30  56  56  ILE ILE B . n 
B 1 31  HIS 31  57  57  HIS HIS B . n 
B 1 32  GLU 32  58  58  GLU GLU B . n 
B 1 33  ALA 33  59  59  ALA ALA B . n 
B 1 34  GLY 34  60  60  GLY GLY B . n 
B 1 35  TYR 35  61  61  TYR TYR B . n 
B 1 36  SER 36  62  62  SER SER B . n 
B 1 37  GLU 37  63  63  GLU GLU B . n 
B 1 38  GLU 38  64  64  GLU GLU B . n 
B 1 39  GLU 39  65  65  GLU GLU B . n 
B 1 40  CYS 40  66  66  CYS CYS B . n 
B 1 41  LYS 41  67  67  LYS LYS B . n 
B 1 42  GLN 42  68  68  GLN GLN B . n 
B 1 43  TYR 43  69  69  TYR TYR B . n 
B 1 44  LYS 44  70  70  LYS LYS B . n 
B 1 45  ALA 45  71  71  ALA ALA B . n 
B 1 46  VAL 46  72  72  VAL VAL B . n 
B 1 47  VAL 47  73  73  VAL VAL B . n 
B 1 48  TYR 48  74  74  TYR TYR B . n 
B 1 49  SER 49  75  75  SER SER B . n 
B 1 50  ASN 50  76  76  ASN ASN B . n 
B 1 51  THR 51  77  77  THR THR B . n 
B 1 52  ILE 52  78  78  ILE ILE B . n 
B 1 53  GLN 53  79  79  GLN GLN B . n 
B 1 54  SER 54  80  80  SER SER B . n 
B 1 55  ILE 55  81  81  ILE ILE B . n 
B 1 56  ILE 56  82  82  ILE ILE B . n 
B 1 57  ALA 57  83  83  ALA ALA B . n 
B 1 58  ILE 58  84  84  ILE ILE B . n 
B 1 59  ILE 59  85  85  ILE ILE B . n 
B 1 60  ARG 60  86  86  ARG ARG B . n 
B 1 61  ALA 61  87  87  ALA ALA B . n 
B 1 62  MET 62  88  88  MET MET B . n 
B 1 63  GLY 63  89  89  GLY GLY B . n 
B 1 64  ARG 64  90  90  ARG ARG B . n 
B 1 65  LEU 65  91  91  LEU LEU B . n 
B 1 66  LYS 66  92  92  LYS LYS B . n 
B 1 67  ILE 67  93  93  ILE ILE B . n 
B 1 68  ASP 68  94  94  ASP ASP B . n 
B 1 69  PHE 69  95  95  PHE PHE B . n 
B 1 70  GLY 70  96  96  GLY GLY B . n 
B 1 71  ASP 71  97  97  ASP ASP B . n 
B 1 72  SER 72  98  98  SER SER B . n 
B 1 73  ALA 73  99  99  ALA ALA B . n 
B 1 74  ARG 74  100 100 ARG ARG B . n 
B 1 75  ALA 75  101 101 ALA ALA B . n 
B 1 76  ASP 76  102 102 ASP ASP B . n 
B 1 77  ASP 77  103 103 ASP ASP B . n 
B 1 78  ALA 78  104 104 ALA ALA B . n 
B 1 79  ARG 79  105 105 ARG ARG B . n 
B 1 80  GLN 80  106 106 GLN GLN B . n 
B 1 81  LEU 81  107 107 LEU LEU B . n 
B 1 82  PHE 82  108 108 PHE PHE B . n 
B 1 83  VAL 83  109 109 VAL VAL B . n 
B 1 84  LEU 84  110 110 LEU LEU B . n 
B 1 85  ALA 85  111 111 ALA ALA B . n 
B 1 86  GLY 86  112 112 GLY GLY B . n 
B 1 87  ALA 87  113 113 ALA ALA B . n 
B 1 88  ALA 88  114 114 ALA ALA B . n 
B 1 89  GLU 89  115 115 GLU GLU B . n 
B 1 90  GLU 90  116 116 GLU GLU B . n 
B 1 91  GLY 91  117 117 GLY GLY B . n 
B 1 92  PHE 92  118 118 PHE PHE B . n 
B 1 93  MET 93  119 119 MET MET B . n 
B 1 94  THR 94  120 120 THR THR B . n 
B 1 95  ALA 95  121 121 ALA ALA B . n 
B 1 96  GLU 96  122 122 GLU GLU B . n 
B 1 97  LEU 97  123 123 LEU LEU B . n 
B 1 98  ALA 98  124 124 ALA ALA B . n 
B 1 99  GLY 99  125 125 GLY GLY B . n 
B 1 100 VAL 100 126 126 VAL VAL B . n 
B 1 101 ILE 101 127 127 ILE ILE B . n 
B 1 102 LYS 102 128 128 LYS LYS B . n 
B 1 103 ARG 103 129 129 ARG ARG B . n 
B 1 104 LEU 104 130 130 LEU LEU B . n 
B 1 105 TRP 105 131 131 TRP TRP B . n 
B 1 106 LYS 106 132 132 LYS LYS B . n 
B 1 107 ASP 107 133 133 ASP ASP B . n 
B 1 108 SER 108 134 134 SER SER B . n 
B 1 109 GLY 109 135 135 GLY GLY B . n 
B 1 110 VAL 110 136 136 VAL VAL B . n 
B 1 111 GLN 111 137 137 GLN GLN B . n 
B 1 112 ALA 112 138 138 ALA ALA B . n 
B 1 113 CYS 113 139 139 CYS CYS B . n 
B 1 114 PHE 114 140 140 PHE PHE B . n 
B 1 115 ASN 115 141 141 ASN ASN B . n 
B 1 116 ARG 116 142 142 ARG ARG B . n 
B 1 117 SER 117 143 143 SER SER B . n 
B 1 118 ARG 118 144 144 ARG ARG B . n 
B 1 119 GLU 119 145 145 GLU GLU B . n 
B 1 120 TYR 120 146 146 TYR TYR B . n 
B 1 121 GLN 121 147 147 GLN GLN B . n 
B 1 122 LEU 122 148 148 LEU LEU B . n 
B 1 123 ASN 123 149 149 ASN ASN B . n 
B 1 124 ASP 124 150 150 ASP ASP B . n 
B 1 125 SER 125 151 151 SER SER B . n 
B 1 126 ALA 126 152 152 ALA ALA B . n 
B 1 127 ALA 127 153 153 ALA ALA B . n 
B 1 128 TYR 128 154 154 TYR TYR B . n 
B 1 129 TYR 129 155 155 TYR TYR B . n 
B 1 130 LEU 130 156 156 LEU LEU B . n 
B 1 131 ASN 131 157 157 ASN ASN B . n 
B 1 132 ASP 132 158 158 ASP ASP B . n 
B 1 133 LEU 133 159 159 LEU LEU B . n 
B 1 134 ASP 134 160 160 ASP ASP B . n 
B 1 135 ARG 135 161 161 ARG ARG B . n 
B 1 136 ILE 136 162 162 ILE ILE B . n 
B 1 137 ALA 137 163 163 ALA ALA B . n 
B 1 138 GLN 138 164 164 GLN GLN B . n 
B 1 139 PRO 139 165 165 PRO PRO B . n 
B 1 140 ASN 140 166 166 ASN ASN B . n 
B 1 141 TYR 141 167 167 TYR TYR B . n 
B 1 142 ILE 142 168 168 ILE ILE B . n 
B 1 143 PRO 143 169 169 PRO PRO B . n 
B 1 144 THR 144 170 170 THR THR B . n 
B 1 145 GLN 145 171 171 GLN GLN B . n 
B 1 146 GLN 146 172 172 GLN GLN B . n 
B 1 147 ASP 147 173 173 ASP ASP B . n 
B 1 148 VAL 148 174 174 VAL VAL B . n 
B 1 149 LEU 149 175 175 LEU LEU B . n 
B 1 150 ARG 150 176 176 ARG ARG B . n 
B 1 151 THR 151 177 177 THR THR B . n 
B 1 152 ARG 152 178 178 ARG ARG B . n 
B 1 153 VAL 153 179 179 VAL VAL B . n 
B 1 154 LYS 154 180 180 LYS LYS B . n 
B 1 155 THR 155 181 181 THR THR B . n 
B 1 156 THR 156 182 182 THR THR B . n 
B 1 157 GLY 157 183 183 GLY GLY B . n 
B 1 158 ILE 158 184 184 ILE ILE B . n 
B 1 159 VAL 159 185 185 VAL VAL B . n 
B 1 160 GLU 160 186 186 GLU GLU B . n 
B 1 161 THR 161 187 187 THR THR B . n 
B 1 162 HIS 162 188 188 HIS HIS B . n 
B 1 163 PHE 163 189 189 PHE PHE B . n 
B 1 164 THR 164 190 190 THR THR B . n 
B 1 165 PHE 165 191 191 PHE PHE B . n 
B 1 166 LYS 166 192 192 LYS LYS B . n 
B 1 167 ASP 167 193 193 ASP ASP B . n 
B 1 168 LEU 168 194 194 LEU LEU B . n 
B 1 169 HIS 169 195 195 HIS HIS B . n 
B 1 170 PHE 170 196 196 PHE PHE B . n 
B 1 171 LYS 171 197 197 LYS LYS B . n 
B 1 172 MET 172 198 198 MET MET B . n 
B 1 173 PHE 173 199 199 PHE PHE B . n 
B 1 174 ASP 174 200 200 ASP ASP B . n 
B 1 175 VAL 175 201 201 VAL VAL B . n 
B 1 176 GLY 176 202 202 GLY GLY B . n 
B 1 177 GLY 177 203 203 GLY GLY B . n 
B 1 178 GLN 178 204 204 GLN GLN B . n 
B 1 179 ARG 179 205 205 ARG ARG B . n 
B 1 180 SER 180 206 206 SER SER B . n 
B 1 181 GLU 181 207 207 GLU GLU B . n 
B 1 182 ARG 182 208 208 ARG ARG B . n 
B 1 183 LYS 183 209 209 LYS LYS B . n 
B 1 184 LYS 184 210 210 LYS LYS B . n 
B 1 185 TRP 185 211 211 TRP TRP B . n 
B 1 186 ILE 186 212 212 ILE ILE B . n 
B 1 187 HIS 187 213 213 HIS HIS B . n 
B 1 188 CYS 188 214 214 CYS CYS B . n 
B 1 189 PHE 189 215 215 PHE PHE B . n 
B 1 190 GLU 190 216 216 GLU GLU B . n 
B 1 191 GLY 191 217 217 GLY GLY B . n 
B 1 192 VAL 192 218 218 VAL VAL B . n 
B 1 193 THR 193 219 219 THR THR B . n 
B 1 194 ALA 194 220 220 ALA ALA B . n 
B 1 195 ILE 195 221 221 ILE ILE B . n 
B 1 196 ILE 196 222 222 ILE ILE B . n 
B 1 197 PHE 197 223 223 PHE PHE B . n 
B 1 198 CYS 198 224 224 CYS CYS B . n 
B 1 199 VAL 199 225 225 VAL VAL B . n 
B 1 200 ALA 200 226 226 ALA ALA B . n 
B 1 201 LEU 201 227 227 LEU LEU B . n 
B 1 202 SER 202 228 228 SER SER B . n 
B 1 203 ASP 203 229 229 ASP ASP B . n 
B 1 204 TYR 204 230 230 TYR TYR B . n 
B 1 205 ASP 205 231 231 ASP ASP B . n 
B 1 206 LEU 206 232 232 LEU LEU B . n 
B 1 207 VAL 207 233 233 VAL VAL B . n 
B 1 208 LEU 208 234 234 LEU LEU B . n 
B 1 209 ALA 209 235 235 ALA ALA B . n 
B 1 210 GLU 210 236 236 GLU GLU B . n 
B 1 211 ASP 211 237 237 ASP ASP B . n 
B 1 212 GLU 212 238 238 GLU GLU B . n 
B 1 213 GLU 213 239 239 GLU GLU B . n 
B 1 214 MET 214 240 240 MET MET B . n 
B 1 215 ASN 215 241 241 ASN ASN B . n 
B 1 216 ARG 216 242 242 ARG ARG B . n 
B 1 217 MET 217 243 243 MET MET B . n 
B 1 218 HIS 218 244 244 HIS HIS B . n 
B 1 219 GLU 219 245 245 GLU GLU B . n 
B 1 220 SER 220 246 246 SER SER B . n 
B 1 221 MET 221 247 247 MET MET B . n 
B 1 222 LYS 222 248 248 LYS LYS B . n 
B 1 223 LEU 223 249 249 LEU LEU B . n 
B 1 224 PHE 224 250 250 PHE PHE B . n 
B 1 225 ASP 225 251 251 ASP ASP B . n 
B 1 226 SER 226 252 252 SER SER B . n 
B 1 227 ILE 227 253 253 ILE ILE B . n 
B 1 228 CYS 228 254 254 CYS CYS B . n 
B 1 229 ASN 229 255 255 ASN ASN B . n 
B 1 230 ASN 230 256 256 ASN ASN B . n 
B 1 231 LYS 231 257 257 LYS LYS B . n 
B 1 232 TRP 232 258 258 TRP TRP B . n 
B 1 233 PHE 233 259 259 PHE PHE B . n 
B 1 234 THR 234 260 260 THR THR B . n 
B 1 235 ASP 235 261 261 ASP ASP B . n 
B 1 236 THR 236 262 262 THR THR B . n 
B 1 237 SER 237 263 263 SER SER B . n 
B 1 238 ILE 238 264 264 ILE ILE B . n 
B 1 239 ILE 239 265 265 ILE ILE B . n 
B 1 240 LEU 240 266 266 LEU LEU B . n 
B 1 241 PHE 241 267 267 PHE PHE B . n 
B 1 242 LEU 242 268 268 LEU LEU B . n 
B 1 243 ASN 243 269 269 ASN ASN B . n 
B 1 244 LYS 244 270 270 LYS LYS B . n 
B 1 245 LYS 245 271 271 LYS LYS B . n 
B 1 246 ASP 246 272 272 ASP ASP B . n 
B 1 247 LEU 247 273 273 LEU LEU B . n 
B 1 248 PHE 248 274 274 PHE PHE B . n 
B 1 249 GLU 249 275 275 GLU GLU B . n 
B 1 250 GLU 250 276 276 GLU GLU B . n 
B 1 251 LYS 251 277 277 LYS LYS B . n 
B 1 252 ILE 252 278 278 ILE ILE B . n 
B 1 253 LYS 253 279 279 LYS LYS B . n 
B 1 254 LYS 254 280 280 LYS LYS B . n 
B 1 255 SER 255 281 281 SER SER B . n 
B 1 256 PRO 256 282 282 PRO PRO B . n 
B 1 257 LEU 257 283 283 LEU LEU B . n 
B 1 258 THR 258 284 284 THR THR B . n 
B 1 259 ILE 259 285 285 ILE ILE B . n 
B 1 260 CYS 260 286 286 CYS CYS B . n 
B 1 261 TYR 261 287 287 TYR TYR B . n 
B 1 262 PRO 262 288 288 PRO PRO B . n 
B 1 263 GLU 263 289 289 GLU GLU B . n 
B 1 264 TYR 264 290 290 TYR TYR B . n 
B 1 265 ALA 265 291 291 ALA ALA B . n 
B 1 266 GLY 266 292 292 GLY GLY B . n 
B 1 267 SER 267 293 293 SER SER B . n 
B 1 268 ASN 268 294 294 ASN ASN B . n 
B 1 269 THR 269 295 295 THR THR B . n 
B 1 270 TYR 270 296 296 TYR TYR B . n 
B 1 271 GLU 271 297 297 GLU GLU B . n 
B 1 272 GLU 272 298 298 GLU GLU B . n 
B 1 273 ALA 273 299 299 ALA ALA B . n 
B 1 274 ALA 274 300 300 ALA ALA B . n 
B 1 275 ALA 275 301 301 ALA ALA B . n 
B 1 276 TYR 276 302 302 TYR TYR B . n 
B 1 277 ILE 277 303 303 ILE ILE B . n 
B 1 278 GLN 278 304 304 GLN GLN B . n 
B 1 279 CYS 279 305 305 CYS CYS B . n 
B 1 280 GLN 280 306 306 GLN GLN B . n 
B 1 281 PHE 281 307 307 PHE PHE B . n 
B 1 282 GLU 282 308 308 GLU GLU B . n 
B 1 283 ASP 283 309 309 ASP ASP B . n 
B 1 284 LEU 284 310 310 LEU LEU B . n 
B 1 285 ASN 285 311 311 ASN ASN B . n 
B 1 286 LYS 286 312 312 LYS LYS B . n 
B 1 287 ARG 287 313 313 ARG ARG B . n 
B 1 288 LYS 288 314 314 LYS LYS B . n 
B 1 289 ASP 289 315 315 ASP ASP B . n 
B 1 290 THR 290 316 316 THR THR B . n 
B 1 291 LYS 291 317 ?   ?   ?   B . n 
B 1 292 GLU 292 318 318 GLU GLU B . n 
B 1 293 ILE 293 319 319 ILE ILE B . n 
B 1 294 TYR 294 320 320 TYR TYR B . n 
B 1 295 THR 295 321 321 THR THR B . n 
B 1 296 HIS 296 322 322 HIS HIS B . n 
B 1 297 PHE 297 323 323 PHE PHE B . n 
B 1 298 THR 298 324 324 THR THR B . n 
B 1 299 CYS 299 325 325 CYS CYS B . n 
B 1 300 ALA 300 326 326 ALA ALA B . n 
B 1 301 THR 301 327 327 THR THR B . n 
B 1 302 ASP 302 328 328 ASP ASP B . n 
B 1 303 THR 303 329 329 THR THR B . n 
B 1 304 LYS 304 330 330 LYS LYS B . n 
B 1 305 ASN 305 331 331 ASN ASN B . n 
B 1 306 VAL 306 332 332 VAL VAL B . n 
B 1 307 GLN 307 333 333 GLN GLN B . n 
B 1 308 PHE 308 334 334 PHE PHE B . n 
B 1 309 VAL 309 335 335 VAL VAL B . n 
B 1 310 PHE 310 336 336 PHE PHE B . n 
B 1 311 ASP 311 337 337 ASP ASP B . n 
B 1 312 ALA 312 338 338 ALA ALA B . n 
B 1 313 VAL 313 339 339 VAL VAL B . n 
B 1 314 THR 314 340 340 THR THR B . n 
B 1 315 ASP 315 341 341 ASP ASP B . n 
B 1 316 VAL 316 342 342 VAL VAL B . n 
B 1 317 ILE 317 343 343 ILE ILE B . n 
B 1 318 ILE 318 344 344 ILE ILE B . n 
B 1 319 LYS 319 345 345 LYS LYS B . n 
B 1 320 ASN 320 346 346 ASN ASN B . n 
B 1 321 ASN 321 347 347 ASN ASN B . n 
B 1 322 LEU 322 348 348 LEU LEU B . n 
B 1 323 LYS 323 349 ?   ?   ?   B . n 
B 1 324 ASP 324 350 ?   ?   ?   B . n 
B 1 325 CYS 325 351 ?   ?   ?   B . n 
B 1 326 GLY 326 352 ?   ?   ?   B . n 
B 1 327 LEU 327 353 ?   ?   ?   B . n 
B 1 328 PHE 328 354 ?   ?   ?   B . n 
C 2 1   ASP 1   496 496 ASP ASP C . n 
C 2 2   ILE 2   497 497 ILE ILE C . n 
C 2 3   GLU 3   498 498 GLU GLU C . n 
C 2 4   GLY 4   499 499 GLY GLY C . n 
C 2 5   LEU 5   500 500 LEU LEU C . n 
C 2 6   VAL 6   501 501 VAL VAL C . n 
C 2 7   GLU 7   502 502 GLU GLU C . n 
C 2 8   LEU 8   503 503 LEU LEU C . n 
C 2 9   LEU 9   504 504 LEU LEU C . n 
C 2 10  ASN 10  505 505 ASN ASN C . n 
C 2 11  ARG 11  506 506 ARG ARG C . n 
C 2 12  VAL 12  507 507 VAL VAL C . n 
C 2 13  GLN 13  508 508 GLN GLN C . n 
C 2 14  SER 14  509 509 SER SER C . n 
C 2 15  SER 15  510 510 SER SER C . n 
C 2 16  GLY 16  511 ?   ?   ?   C . n 
C 2 17  ALA 17  512 ?   ?   ?   C . n 
C 2 18  HIS 18  513 513 HIS HIS C . n 
C 2 19  ASP 19  514 514 ASP ASP C . n 
C 2 20  GLN 20  515 515 GLN GLN C . n 
C 2 21  ARG 21  516 516 ARG ARG C . n 
C 2 22  GLY 22  517 517 GLY GLY C . n 
C 2 23  LEU 23  518 518 LEU LEU C . n 
C 2 24  LEU 24  519 519 LEU LEU C . n 
C 2 25  ARG 25  520 520 ARG ARG C . n 
C 2 26  LYS 26  521 521 LYS LYS C . n 
C 2 27  GLU 27  522 522 GLU GLU C . n 
C 2 28  ASP 28  523 523 ASP ASP C . n 
C 2 29  LEU 29  524 524 LEU LEU C . n 
C 2 30  VAL 30  525 525 VAL VAL C . n 
C 2 31  LEU 31  526 526 LEU LEU C . n 
C 2 32  PRO 32  527 527 PRO PRO C . n 
C 2 33  GLU 33  528 528 GLU GLU C . n 
C 2 34  PHE 34  529 529 PHE PHE C . n 
C 2 35  LEU 35  530 530 LEU LEU C . n 
C 2 36  GLN 36  531 ?   ?   ?   C . n 
D 2 1   ASP 1   496 ?   ?   ?   D . n 
D 2 2   ILE 2   497 ?   ?   ?   D . n 
D 2 3   GLU 3   498 498 GLU GLU D . n 
D 2 4   GLY 4   499 499 GLY GLY D . n 
D 2 5   LEU 5   500 500 LEU LEU D . n 
D 2 6   VAL 6   501 501 VAL VAL D . n 
D 2 7   GLU 7   502 502 GLU GLU D . n 
D 2 8   LEU 8   503 503 LEU LEU D . n 
D 2 9   LEU 9   504 504 LEU LEU D . n 
D 2 10  ASN 10  505 505 ASN ASN D . n 
D 2 11  ARG 11  506 506 ARG ARG D . n 
D 2 12  VAL 12  507 507 VAL VAL D . n 
D 2 13  GLN 13  508 508 GLN GLN D . n 
D 2 14  SER 14  509 509 SER SER D . n 
D 2 15  SER 15  510 ?   ?   ?   D . n 
D 2 16  GLY 16  511 ?   ?   ?   D . n 
D 2 17  ALA 17  512 ?   ?   ?   D . n 
D 2 18  HIS 18  513 ?   ?   ?   D . n 
D 2 19  ASP 19  514 514 ASP ASP D . n 
D 2 20  GLN 20  515 515 GLN GLN D . n 
D 2 21  ARG 21  516 516 ARG ARG D . n 
D 2 22  GLY 22  517 517 GLY GLY D . n 
D 2 23  LEU 23  518 518 LEU LEU D . n 
D 2 24  LEU 24  519 519 LEU LEU D . n 
D 2 25  ARG 25  520 520 ARG ARG D . n 
D 2 26  LYS 26  521 521 LYS LYS D . n 
D 2 27  GLU 27  522 522 GLU GLU D . n 
D 2 28  ASP 28  523 523 ASP ASP D . n 
D 2 29  LEU 29  524 524 LEU LEU D . n 
D 2 30  VAL 30  525 525 VAL VAL D . n 
D 2 31  LEU 31  526 526 LEU LEU D . n 
D 2 32  PRO 32  527 527 PRO PRO D . n 
D 2 33  GLU 33  528 528 GLU GLU D . n 
D 2 34  PHE 34  529 529 PHE PHE D . n 
D 2 35  LEU 35  530 530 LEU LEU D . n 
D 2 36  GLN 36  531 531 GLN GLN D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,J,L 
2 1 B,D,H,I,K,M   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4620  ? 
1 MORE         -30   ? 
1 'SSA (A^2)'  16760 ? 
2 'ABSA (A^2)' 4270  ? 
2 MORE         -34   ? 
2 'SSA (A^2)'  16980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-02-01 
2 'Structure model' 1 1 2012-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -18.3030 17.6671 34.9945 -0.0003 0.1827 0.0717  -0.0107 0.0543  -0.0456 0.9199 0.7085 1.4834 
0.2079  -1.0711 -0.2208 0.0757  0.0051  0.3464  -0.0219 0.2911  -0.0076 -0.1084 -0.1301 -0.2386 
'X-RAY DIFFRACTION' 2  ? refined -39.7395 32.5574 29.4469 0.2439  0.1515 0.2611  0.0333  0.0240  0.0546  1.5723 0.5706 0.9854 
-0.8584 0.2645  0.1160  0.0370  0.0070  0.0013  -0.1741 -0.0915 -0.0466 -0.3859 -0.0849 -0.0017 
'X-RAY DIFFRACTION' 3  ? refined -14.2291 13.0352 28.7144 0.0344  0.3828 0.2333  -0.0975 0.0259  0.0211  0.0584 0.4682 0.4421 
-0.0188 -0.1254 0.1848  -0.0228 0.0380  -0.1536 -0.0665 0.1149  -0.3440 0.0010  0.0337  -0.0496 
'X-RAY DIFFRACTION' 4  ? refined -34.3747 5.5822  36.9441 0.0216  0.2230 0.1725  -0.0256 0.0279  -0.0295 0.1301 0.5356 1.6405 
-0.1482 0.3258  -0.4148 -0.0738 -0.0587 -0.3545 -0.0585 0.1499  -0.0742 0.0635  -0.5452 -0.0980 
'X-RAY DIFFRACTION' 5  ? refined -19.9133 8.4919  44.2361 0.1247  0.1950 0.1306  -0.0671 -0.0411 -0.0539 0.1420 0.1958 0.6903 
-0.0556 0.1454  0.2526  0.0080  -0.0270 -0.0035 -0.0525 0.1345  0.0054  -0.1404 0.3532  -0.1013 
'X-RAY DIFFRACTION' 6  ? refined -15.8755 43.5692 11.1878 0.4327  0.5387 0.3037  0.2988  -0.0284 -0.2946 0.1325 0.4147 0.1661 
0.0892  0.1007  0.0685  0.0852  0.0128  0.0506  0.0502  0.1400  -0.0807 0.0292  0.0887  -0.1314 
'X-RAY DIFFRACTION' 7  ? refined -31.7092 60.8819 22.8035 0.0136  0.0768 0.0944  0.0015  0.0406  -0.0641 0.4791 0.5816 1.0274 
0.0154  -0.2647 0.6326  -0.1544 -0.1003 -0.0282 -0.0045 -0.1114 0.2415  0.0360  -0.0588 0.1477  
'X-RAY DIFFRACTION' 8  ? refined -16.3947 43.0238 12.7457 0.4089  0.1537 0.2085  0.0783  -0.0155 -0.1806 0.3247 3.1726 2.0283 
0.2887  0.3334  1.9575  -0.1048 0.1744  -0.2713 0.8710  0.0650  -0.0560 0.5188  -0.0241 -0.0836 
'X-RAY DIFFRACTION' 9  ? refined -3.9827  48.2975 13.6724 0.5057  0.4246 0.3765  0.2074  -0.1530 -0.1719 0.3877 0.8745 1.5948 
-0.4483 -0.4394 1.1234  -0.1638 -0.0006 -0.1242 0.1237  -0.0888 0.0843  0.1578  0.0627  0.1103  
'X-RAY DIFFRACTION' 10 ? refined -11.2700 57.0566 4.0906  0.0139  0.3887 -0.1000 0.0867  0.0873  -0.2757 0.6012 0.0933 0.4171 
0.1143  -0.2655 0.0698  -0.1337 0.6287  -0.2358 -0.0717 0.2866  -0.1295 0.0597  0.2486  -0.0276 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 30:59)'   
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 60:181)'  
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain A and resid 182:222)' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain A and resid 223:310)' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain A and resid 311:348)' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain B and resid 30:42)'   
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain B and resid 43:182)'  
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain B and resid 183:236)' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain B and resid 237:263)' 
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain B and resid 264:348)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                          ? 1 
PHASER   phasing           .                          ? 2 
PHENIX   refinement        '(phenix.refine: 1.6_289)' ? 3 
HKL-2000 'data reduction'  .                          ? 4 
HKL-2000 'data scaling'    .                          ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 31  ? ? 57.93   -98.22  
2  1 GLU A 58  ? ? -137.81 -156.49 
3  1 MET A 240 ? ? -147.25 -101.88 
4  1 LEU A 268 ? ? -65.97  95.00   
5  1 LYS A 312 ? ? -82.18  38.55   
6  1 THR A 316 ? ? -63.58  -79.69  
7  1 ASN A 346 ? ? -72.32  33.70   
8  1 ASP B 158 ? ? -83.60  45.71   
9  1 ALA B 163 ? ? -85.50  44.59   
10 1 VAL B 201 ? ? -55.34  -70.70  
11 1 LYS B 345 ? ? -71.74  20.85   
12 1 GLN D 508 ? ? -103.35 58.82   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 27  ? A SER 1   
2  1 Y 1 A ASN 28  ? A ASN 2   
3  1 Y 1 A ALA 29  ? A ALA 3   
4  1 Y 1 A LEU 348 ? A LEU 322 
5  1 Y 1 A LYS 349 ? A LYS 323 
6  1 Y 1 A ASP 350 ? A ASP 324 
7  1 Y 1 A CYS 351 ? A CYS 325 
8  1 Y 1 A GLY 352 ? A GLY 326 
9  1 Y 1 A LEU 353 ? A LEU 327 
10 1 Y 1 A PHE 354 ? A PHE 328 
11 1 Y 1 B SER 27  ? B SER 1   
12 1 Y 1 B ASN 28  ? B ASN 2   
13 1 Y 1 B ALA 29  ? B ALA 3   
14 1 Y 1 B GLY 30  ? B GLY 4   
15 1 Y 1 B ALA 31  ? B ALA 5   
16 1 Y 1 B ARG 32  ? B ARG 6   
17 1 Y 1 B GLU 33  ? B GLU 7   
18 1 Y 1 B LYS 317 ? B LYS 291 
19 1 Y 1 B LYS 349 ? B LYS 323 
20 1 Y 1 B ASP 350 ? B ASP 324 
21 1 Y 1 B CYS 351 ? B CYS 325 
22 1 Y 1 B GLY 352 ? B GLY 326 
23 1 Y 1 B LEU 353 ? B LEU 327 
24 1 Y 1 B PHE 354 ? B PHE 328 
25 1 Y 1 C GLY 511 ? C GLY 16  
26 1 Y 1 C ALA 512 ? C ALA 17  
27 1 Y 1 C GLN 531 ? C GLN 36  
28 1 Y 1 D ASP 496 ? D ASP 1   
29 1 Y 1 D ILE 497 ? D ILE 2   
30 1 Y 1 D SER 510 ? D SER 15  
31 1 Y 1 D GLY 511 ? D GLY 16  
32 1 Y 1 D ALA 512 ? D ALA 17  
33 1 Y 1 D HIS 513 ? D HIS 18  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 'SULFATE ION'              SO4 
5 GLYCEROL                   GOL 
6 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 GDP 1  355 355 GDP GDP A . 
F 4 SO4 1  2   2   SO4 SO4 A . 
G 5 GOL 1  3   3   GOL GOL A . 
H 3 GDP 1  356 356 GDP GDP B . 
I 4 SO4 1  1   1   SO4 SO4 B . 
J 6 HOH 1  4   4   HOH HOH A . 
J 6 HOH 2  6   6   HOH HOH A . 
J 6 HOH 3  7   7   HOH HOH A . 
J 6 HOH 4  8   8   HOH HOH A . 
J 6 HOH 5  12  12  HOH HOH A . 
J 6 HOH 6  14  14  HOH HOH A . 
J 6 HOH 7  15  15  HOH HOH A . 
J 6 HOH 8  17  17  HOH HOH A . 
J 6 HOH 9  19  19  HOH HOH A . 
J 6 HOH 10 20  20  HOH HOH A . 
J 6 HOH 11 25  25  HOH HOH A . 
J 6 HOH 12 356 3   HOH HOH A . 
J 6 HOH 13 357 27  HOH HOH A . 
J 6 HOH 14 358 29  HOH HOH A . 
J 6 HOH 15 359 31  HOH HOH A . 
J 6 HOH 16 360 33  HOH HOH A . 
J 6 HOH 17 361 35  HOH HOH A . 
J 6 HOH 18 362 36  HOH HOH A . 
J 6 HOH 19 363 38  HOH HOH A . 
K 6 HOH 1  2   2   HOH HOH B . 
K 6 HOH 2  5   5   HOH HOH B . 
K 6 HOH 3  10  10  HOH HOH B . 
K 6 HOH 4  11  11  HOH HOH B . 
K 6 HOH 5  13  13  HOH HOH B . 
K 6 HOH 6  16  16  HOH HOH B . 
K 6 HOH 7  18  18  HOH HOH B . 
K 6 HOH 8  21  21  HOH HOH B . 
K 6 HOH 9  26  26  HOH HOH B . 
K 6 HOH 10 355 1   HOH HOH B . 
K 6 HOH 11 357 28  HOH HOH B . 
K 6 HOH 12 358 34  HOH HOH B . 
K 6 HOH 13 359 39  HOH HOH B . 
L 6 HOH 1  22  22  HOH HOH C . 
L 6 HOH 2  32  32  HOH HOH C . 
M 6 HOH 1  9   9   HOH HOH D . 
M 6 HOH 2  30  30  HOH HOH D . 
M 6 HOH 3  37  37  HOH HOH D . 
#