data_3QIR
# 
_entry.id   3QIR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QIR         
RCSB  RCSB063696   
WWPDB D_1000063696 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QIR 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, A.'                             1  
'Xu, C.'                               2  
'Bian, C.'                             3  
'Wernimont, A.K.'                      4  
'Kania, J.'                            5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bountra, C.'                          8  
'Weigelt, J.'                          9  
'Min, J.'                              10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of PIWIL2 PAZ domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, C.'           1  
primary 'Dong, A.'         2  
primary 'Bian, C.'         3  
primary 'Wernimont, A.K.'  4  
primary 'Kania, J.'        5  
primary 'Arrowsmith, C.H.' 6  
primary 'Edwards, A.M.'    7  
primary 'Bountra, C.'      8  
primary 'Weigelt, J.'      9  
primary 'Min, J.'          10 
# 
_cell.entry_id           3QIR 
_cell.length_a           41.548 
_cell.length_b           139.291 
_cell.length_c           224.934 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QIR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Piwi-like protein 2' 
_entity.formula_weight             17425.859 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PAZ domain, rsidues 386-533' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cancer/testis antigen 80, CT80' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVK
EEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVK
EEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   ASN n 
1 3   ASP n 
1 4   CYS n 
1 5   VAL n 
1 6   LEU n 
1 7   ASP n 
1 8   VAL n 
1 9   MET n 
1 10  HIS n 
1 11  ALA n 
1 12  ILE n 
1 13  TYR n 
1 14  GLN n 
1 15  GLN n 
1 16  ASN n 
1 17  LYS n 
1 18  GLU n 
1 19  HIS n 
1 20  PHE n 
1 21  GLN n 
1 22  ASP n 
1 23  GLU n 
1 24  CYS n 
1 25  THR n 
1 26  LYS n 
1 27  LEU n 
1 28  LEU n 
1 29  VAL n 
1 30  GLY n 
1 31  ASN n 
1 32  ILE n 
1 33  VAL n 
1 34  ILE n 
1 35  THR n 
1 36  ARG n 
1 37  TYR n 
1 38  ASN n 
1 39  ASN n 
1 40  ARG n 
1 41  THR n 
1 42  TYR n 
1 43  ARG n 
1 44  ILE n 
1 45  ASP n 
1 46  ASP n 
1 47  VAL n 
1 48  ASP n 
1 49  TRP n 
1 50  ASN n 
1 51  LYS n 
1 52  THR n 
1 53  PRO n 
1 54  LYS n 
1 55  ASP n 
1 56  SER n 
1 57  PHE n 
1 58  THR n 
1 59  MET n 
1 60  SER n 
1 61  ASP n 
1 62  GLY n 
1 63  LYS n 
1 64  GLU n 
1 65  ILE n 
1 66  THR n 
1 67  PHE n 
1 68  LEU n 
1 69  GLU n 
1 70  TYR n 
1 71  TYR n 
1 72  SER n 
1 73  LYS n 
1 74  ASN n 
1 75  TYR n 
1 76  GLY n 
1 77  ILE n 
1 78  THR n 
1 79  VAL n 
1 80  LYS n 
1 81  GLU n 
1 82  GLU n 
1 83  ASP n 
1 84  GLN n 
1 85  PRO n 
1 86  LEU n 
1 87  LEU n 
1 88  ILE n 
1 89  HIS n 
1 90  ARG n 
1 91  PRO n 
1 92  SER n 
1 93  GLU n 
1 94  ARG n 
1 95  GLN n 
1 96  ASP n 
1 97  ASN n 
1 98  HIS n 
1 99  GLY n 
1 100 MET n 
1 101 LEU n 
1 102 LEU n 
1 103 LYS n 
1 104 GLY n 
1 105 GLU n 
1 106 ILE n 
1 107 LEU n 
1 108 LEU n 
1 109 LEU n 
1 110 PRO n 
1 111 GLU n 
1 112 LEU n 
1 113 SER n 
1 114 PHE n 
1 115 MET n 
1 116 THR n 
1 117 GLY n 
1 118 ILE n 
1 119 PRO n 
1 120 GLU n 
1 121 LYS n 
1 122 MET n 
1 123 LYS n 
1 124 LYS n 
1 125 ASP n 
1 126 PHE n 
1 127 ARG n 
1 128 ALA n 
1 129 MET n 
1 130 LYS n 
1 131 ASP n 
1 132 LEU n 
1 133 ALA n 
1 134 GLN n 
1 135 GLN n 
1 136 ILE n 
1 137 ASN n 
1 138 LEU n 
1 139 SER n 
1 140 PRO n 
1 141 LYS n 
1 142 GLN n 
1 143 HIS n 
1 144 HIS n 
1 145 SER n 
1 146 ALA n 
1 147 LEU n 
1 148 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PIWIL2, HILI' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Codon plus RIL (Stratagene)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PIWL2_HUMAN 
_struct_ref.pdbx_db_accession          Q8TC59 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVK
EEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALE
;
_struct_ref.pdbx_align_begin           386 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QIR A 1 ? 148 ? Q8TC59 386 ? 533 ? 1 148 
2 1 3QIR B 1 ? 148 ? Q8TC59 386 ? 533 ? 1 148 
3 1 3QIR C 1 ? 148 ? Q8TC59 386 ? 533 ? 1 148 
4 1 3QIR D 1 ? 148 ? Q8TC59 386 ? 533 ? 1 148 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3QIR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    '0.2 M NaI, 20% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 297K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-12-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.28286 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.28286 
# 
_reflns.entry_id                     3QIR 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   24387 
_reflns.number_all                   24387 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        38.6 
_reflns.B_iso_Wilson_estimate        72.91 
_reflns.pdbx_redundancy              7.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   93.1 
_reflns_shell.Rmerge_I_obs           0.854 
_reflns_shell.pdbx_Rsym_value        0.854 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        5.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1112 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3QIR 
_refine.ls_number_reflns_obs                     24246 
_refine.ls_number_reflns_all                     24387 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.75 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2428 
_refine.ls_R_factor_all                          0.2428 
_refine.ls_R_factor_R_work                       0.2416 
_refine.ls_R_factor_R_free                       0.2722 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.15 
_refine.ls_number_reflns_R_free                  1006 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9181 
_refine.correlation_coeff_Fo_to_Fc_free          0.8984 
_refine.B_iso_mean                               83.44 
_refine.aniso_B[1][1]                            -16.9174 
_refine.aniso_B[2][2]                            -4.3153 
_refine.aniso_B[3][3]                            21.2326 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             3O7X 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3QIR 
_refine_analyze.Luzzati_coordinate_error_obs    0.573 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3290 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3290 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        43.75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  3359 'X-RAY DIFFRACTION' ? 
t_angle_deg               1.08  ? 2.00  4579 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d        ?     ? 2.00  1072 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes           ?     ? 2.00  85   'X-RAY DIFFRACTION' ? 
t_gen_planes              ?     ? 5.00  496  'X-RAY DIFFRACTION' ? 
t_it                      ?     ? 20.00 3359 'X-RAY DIFFRACTION' ? 
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_omega_torsion           2.86  ? ?     ?    'X-RAY DIFFRACTION' ? 
t_other_torsion           18.99 ? ?     ?    'X-RAY DIFFRACTION' ? 
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_chiral_improper_torsion ?     ? 5.00  466  'X-RAY DIFFRACTION' ? 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_ideal_dist_contact      ?     ? 4.00  3481 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   12 
_refine_ls_shell.d_res_high                       2.45 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             2607 
_refine_ls_shell.R_factor_R_work                  0.2789 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3007 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.51 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                2730 
_refine_ls_shell.R_factor_all                     0.2798 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QIR 
_struct.title                     'Crystal structure of PIWIL2 PAZ domain' 
_struct.pdbx_descriptor           'Piwi-like protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QIR 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            'Structural Genomics Consortium, SGC, PAZ domain, RNAi, RNA binding, RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 4   ? VAL A 29  ? CYS A 4   VAL A 29  1 ? 26 
HELX_P HELX_P2  2  PHE A 67  ? GLY A 76  ? PHE A 67  GLY A 76  1 ? 10 
HELX_P HELX_P3  3  LEU A 109 ? GLU A 111 ? LEU A 109 GLU A 111 5 ? 3  
HELX_P HELX_P4  4  CYS B 4   ? VAL B 29  ? CYS B 4   VAL B 29  1 ? 26 
HELX_P HELX_P5  5  PHE B 67  ? GLY B 76  ? PHE B 67  GLY B 76  1 ? 10 
HELX_P HELX_P6  6  LEU B 109 ? GLU B 111 ? LEU B 109 GLU B 111 5 ? 3  
HELX_P HELX_P7  7  CYS C 4   ? VAL C 29  ? CYS C 4   VAL C 29  1 ? 26 
HELX_P HELX_P8  8  PHE C 67  ? GLY C 76  ? PHE C 67  GLY C 76  1 ? 10 
HELX_P HELX_P9  9  LEU C 109 ? GLU C 111 ? LEU C 109 GLU C 111 5 ? 3  
HELX_P HELX_P10 10 CYS D 4   ? VAL D 29  ? CYS D 4   VAL D 29  1 ? 26 
HELX_P HELX_P11 11 PHE D 67  ? GLY D 76  ? PHE D 67  GLY D 76  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           117 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            117 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ILE 
_struct_mon_prot_cis.pdbx_label_seq_id_2    118 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ILE 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     118 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 3 ? 
F ? 2 ? 
G ? 3 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 3 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 41  ? ARG A 43  ? THR A 41  ARG A 43  
A 2 ILE A 32  ? THR A 35  ? ILE A 32  THR A 35  
A 3 SER A 113 ? PHE A 114 ? SER A 113 PHE A 114 
B 1 ASP A 46  ? ASP A 48  ? ASP A 46  ASP A 48  
B 2 LEU A 86  ? HIS A 89  ? LEU A 86  HIS A 89  
B 3 ILE A 106 ? LEU A 108 ? ILE A 106 LEU A 108 
C 1 SER A 56  ? THR A 58  ? SER A 56  THR A 58  
C 2 GLU A 64  ? THR A 66  ? GLU A 64  THR A 66  
D 1 ARG B 40  ? ARG B 43  ? ARG B 40  ARG B 43  
D 2 ILE B 32  ? THR B 35  ? ILE B 32  THR B 35  
D 3 SER B 113 ? MET B 115 ? SER B 113 MET B 115 
E 1 ASP B 46  ? ASP B 48  ? ASP B 46  ASP B 48  
E 2 LEU B 86  ? HIS B 89  ? LEU B 86  HIS B 89  
E 3 ILE B 106 ? LEU B 108 ? ILE B 106 LEU B 108 
F 1 SER B 56  ? THR B 58  ? SER B 56  THR B 58  
F 2 GLU B 64  ? THR B 66  ? GLU B 64  THR B 66  
G 1 THR C 41  ? ARG C 43  ? THR C 41  ARG C 43  
G 2 ILE C 32  ? THR C 35  ? ILE C 32  THR C 35  
G 3 SER C 113 ? MET C 115 ? SER C 113 MET C 115 
H 1 ASP C 46  ? ASP C 48  ? ASP C 46  ASP C 48  
H 2 LEU C 86  ? HIS C 89  ? LEU C 86  HIS C 89  
H 3 ILE C 106 ? LEU C 108 ? ILE C 106 LEU C 108 
I 1 SER C 56  ? THR C 58  ? SER C 56  THR C 58  
I 2 GLU C 64  ? THR C 66  ? GLU C 64  THR C 66  
J 1 ARG D 40  ? ARG D 43  ? ARG D 40  ARG D 43  
J 2 ILE D 32  ? THR D 35  ? ILE D 32  THR D 35  
J 3 SER D 113 ? GLY D 117 ? SER D 113 GLY D 117 
K 1 ASP D 46  ? ASP D 48  ? ASP D 46  ASP D 48  
K 2 LEU D 86  ? HIS D 89  ? LEU D 86  HIS D 89  
K 3 ILE D 106 ? LEU D 108 ? ILE D 106 LEU D 108 
L 1 SER D 56  ? THR D 58  ? SER D 56  THR D 58  
L 2 GLU D 64  ? THR D 66  ? GLU D 64  THR D 66  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 42 ? O TYR A 42 N VAL A 33  ? N VAL A 33  
A 2 3 N ILE A 34 ? N ILE A 34 O PHE A 114 ? O PHE A 114 
B 1 2 N ASP A 48 ? N ASP A 48 O LEU A 86  ? O LEU A 86  
B 2 3 N LEU A 87 ? N LEU A 87 O LEU A 108 ? O LEU A 108 
C 1 2 N PHE A 57 ? N PHE A 57 O ILE A 65  ? O ILE A 65  
D 1 2 O TYR B 42 ? O TYR B 42 N VAL B 33  ? N VAL B 33  
D 2 3 N ILE B 34 ? N ILE B 34 O PHE B 114 ? O PHE B 114 
E 1 2 N ASP B 46 ? N ASP B 46 O ILE B 88  ? O ILE B 88  
E 2 3 N LEU B 87 ? N LEU B 87 O LEU B 108 ? O LEU B 108 
F 1 2 N PHE B 57 ? N PHE B 57 O ILE B 65  ? O ILE B 65  
G 1 2 O TYR C 42 ? O TYR C 42 N VAL C 33  ? N VAL C 33  
G 2 3 N ILE C 34 ? N ILE C 34 O PHE C 114 ? O PHE C 114 
H 1 2 N ASP C 48 ? N ASP C 48 O LEU C 86  ? O LEU C 86  
H 2 3 N LEU C 87 ? N LEU C 87 O LEU C 108 ? O LEU C 108 
I 1 2 N PHE C 57 ? N PHE C 57 O ILE C 65  ? O ILE C 65  
J 1 2 O TYR D 42 ? O TYR D 42 N VAL D 33  ? N VAL D 33  
J 2 3 N ILE D 32 ? N ILE D 32 O GLY D 117 ? O GLY D 117 
K 1 2 N ASP D 46 ? N ASP D 46 O ILE D 88  ? O ILE D 88  
K 2 3 N HIS D 89 ? N HIS D 89 O ILE D 106 ? O ILE D 106 
L 1 2 N PHE D 57 ? N PHE D 57 O ILE D 65  ? O ILE D 65  
# 
_database_PDB_matrix.entry_id          3QIR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QIR 
_atom_sites.fract_transf_matrix[1][1]   0.024069 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007179 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004446 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASN A 1 2   ? 18.499  -44.291 73.072  1.00 143.81 ? 2   ASN A N   1 
ATOM 2    C CA  . ASN A 1 2   ? 19.495  -43.324 72.617  1.00 145.42 ? 2   ASN A CA  1 
ATOM 3    C C   . ASN A 1 2   ? 18.956  -42.311 71.587  1.00 147.65 ? 2   ASN A C   1 
ATOM 4    O O   . ASN A 1 2   ? 19.451  -41.185 71.550  1.00 149.25 ? 2   ASN A O   1 
ATOM 5    C CB  . ASN A 1 2   ? 20.713  -44.046 72.030  1.00 146.03 ? 2   ASN A CB  1 
ATOM 6    C CG  . ASN A 1 2   ? 21.851  -43.128 71.645  1.00 161.72 ? 2   ASN A CG  1 
ATOM 7    O OD1 . ASN A 1 2   ? 21.919  -42.626 70.519  1.00 156.12 ? 2   ASN A OD1 1 
ATOM 8    N ND2 . ASN A 1 2   ? 22.744  -42.857 72.583  1.00 156.73 ? 2   ASN A ND2 1 
ATOM 9    N N   . ASP A 1 3   ? 17.994  -42.712 70.732  1.00 141.18 ? 3   ASP A N   1 
ATOM 10   C CA  . ASP A 1 3   ? 17.450  -41.854 69.670  1.00 135.89 ? 3   ASP A CA  1 
ATOM 11   C C   . ASP A 1 3   ? 16.391  -40.845 70.124  1.00 135.24 ? 3   ASP A C   1 
ATOM 12   O O   . ASP A 1 3   ? 15.792  -40.987 71.193  1.00 133.27 ? 3   ASP A O   1 
ATOM 13   C CB  . ASP A 1 3   ? 16.849  -42.703 68.548  1.00 135.09 ? 3   ASP A CB  1 
ATOM 14   C CG  . ASP A 1 3   ? 17.794  -43.722 67.983  1.00 153.11 ? 3   ASP A CG  1 
ATOM 15   O OD1 . ASP A 1 3   ? 18.766  -43.319 67.310  1.00 155.46 ? 3   ASP A OD1 1 
ATOM 16   O OD2 . ASP A 1 3   ? 17.559  -44.924 68.200  1.00 158.87 ? 3   ASP A OD2 1 
ATOM 17   N N   . CYS A 1 4   ? 16.145  -39.837 69.260  1.00 128.00 ? 4   CYS A N   1 
ATOM 18   C CA  . CYS A 1 4   ? 15.127  -38.815 69.458  1.00 123.37 ? 4   CYS A CA  1 
ATOM 19   C C   . CYS A 1 4   ? 13.786  -39.383 68.953  1.00 121.71 ? 4   CYS A C   1 
ATOM 20   O O   . CYS A 1 4   ? 13.713  -39.940 67.854  1.00 121.81 ? 4   CYS A O   1 
ATOM 21   C CB  . CYS A 1 4   ? 15.507  -37.513 68.756  1.00 122.77 ? 4   CYS A CB  1 
ATOM 22   N N   . VAL A 1 5   ? 12.744  -39.290 69.796  1.00 113.59 ? 5   VAL A N   1 
ATOM 23   C CA  . VAL A 1 5   ? 11.376  -39.786 69.558  1.00 108.30 ? 5   VAL A CA  1 
ATOM 24   C C   . VAL A 1 5   ? 10.840  -39.307 68.197  1.00 106.25 ? 5   VAL A C   1 
ATOM 25   O O   . VAL A 1 5   ? 10.264  -40.098 67.446  1.00 102.70 ? 5   VAL A O   1 
ATOM 26   C CB  . VAL A 1 5   ? 10.447  -39.346 70.742  1.00 109.90 ? 5   VAL A CB  1 
ATOM 27   C CG1 . VAL A 1 5   ? 8.989   -39.735 70.509  1.00 106.10 ? 5   VAL A CG1 1 
ATOM 28   C CG2 . VAL A 1 5   ? 10.948  -39.896 72.075  1.00 113.09 ? 5   VAL A CG2 1 
ATOM 29   N N   . LEU A 1 6   ? 11.039  -38.009 67.884  1.00 102.00 ? 6   LEU A N   1 
ATOM 30   C CA  . LEU A 1 6   ? 10.573  -37.425 66.635  1.00 98.66  ? 6   LEU A CA  1 
ATOM 31   C C   . LEU A 1 6   ? 11.239  -38.102 65.440  1.00 105.46 ? 6   LEU A C   1 
ATOM 32   O O   . LEU A 1 6   ? 10.543  -38.393 64.467  1.00 104.82 ? 6   LEU A O   1 
ATOM 33   C CB  . LEU A 1 6   ? 10.753  -35.889 66.602  1.00 97.30  ? 6   LEU A CB  1 
ATOM 34   C CG  . LEU A 1 6   ? 10.006  -35.139 65.496  1.00 97.61  ? 6   LEU A CG  1 
ATOM 35   C CD1 . LEU A 1 6   ? 8.505   -35.463 65.481  1.00 94.32  ? 6   LEU A CD1 1 
ATOM 36   C CD2 . LEU A 1 6   ? 10.264  -33.659 65.570  1.00 99.73  ? 6   LEU A CD2 1 
ATOM 37   N N   . ASP A 1 7   ? 12.551  -38.404 65.519  1.00 105.38 ? 7   ASP A N   1 
ATOM 38   C CA  . ASP A 1 7   ? 13.279  -39.097 64.433  1.00 107.01 ? 7   ASP A CA  1 
ATOM 39   C C   . ASP A 1 7   ? 12.711  -40.498 64.189  1.00 108.87 ? 7   ASP A C   1 
ATOM 40   O O   . ASP A 1 7   ? 12.480  -40.869 63.032  1.00 107.69 ? 7   ASP A O   1 
ATOM 41   C CB  . ASP A 1 7   ? 14.794  -39.165 64.721  1.00 113.32 ? 7   ASP A CB  1 
ATOM 42   C CG  . ASP A 1 7   ? 15.509  -37.838 64.576  1.00 125.55 ? 7   ASP A CG  1 
ATOM 43   O OD1 . ASP A 1 7   ? 15.613  -37.121 65.572  1.00 126.15 ? 7   ASP A OD1 1 
ATOM 44   O OD2 . ASP A 1 7   ? 15.968  -37.518 63.439  1.00 134.63 ? 7   ASP A OD2 1 
ATOM 45   N N   . VAL A 1 8   ? 12.439  -41.238 65.288  1.00 104.93 ? 8   VAL A N   1 
ATOM 46   C CA  . VAL A 1 8   ? 11.848  -42.572 65.262  1.00 105.21 ? 8   VAL A CA  1 
ATOM 47   C C   . VAL A 1 8   ? 10.475  -42.503 64.590  1.00 108.02 ? 8   VAL A C   1 
ATOM 48   O O   . VAL A 1 8   ? 10.195  -43.276 63.661  1.00 108.81 ? 8   VAL A O   1 
ATOM 49   C CB  . VAL A 1 8   ? 11.790  -43.183 66.685  1.00 111.06 ? 8   VAL A CB  1 
ATOM 50   N N   . MET A 1 9   ? 9.674   -41.498 64.994  1.00 103.36 ? 9   MET A N   1 
ATOM 51   C CA  . MET A 1 9   ? 8.346   -41.213 64.462  1.00 100.41 ? 9   MET A CA  1 
ATOM 52   C C   . MET A 1 9   ? 8.389   -40.871 62.987  1.00 105.35 ? 9   MET A C   1 
ATOM 53   O O   . MET A 1 9   ? 7.528   -41.357 62.248  1.00 103.80 ? 9   MET A O   1 
ATOM 54   C CB  . MET A 1 9   ? 7.682   -40.079 65.245  1.00 100.39 ? 9   MET A CB  1 
ATOM 55   N N   . HIS A 1 10  ? 9.386   -40.050 62.551  1.00 104.90 ? 10  HIS A N   1 
ATOM 56   C CA  . HIS A 1 10  ? 9.563   -39.653 61.138  1.00 104.16 ? 10  HIS A CA  1 
ATOM 57   C C   . HIS A 1 10  ? 9.784   -40.855 60.263  1.00 108.16 ? 10  HIS A C   1 
ATOM 58   O O   . HIS A 1 10  ? 9.211   -40.914 59.175  1.00 108.01 ? 10  HIS A O   1 
ATOM 59   C CB  . HIS A 1 10  ? 10.726  -38.654 60.947  1.00 106.76 ? 10  HIS A CB  1 
ATOM 60   C CG  . HIS A 1 10  ? 10.443  -37.242 61.378  1.00 109.24 ? 10  HIS A CG  1 
ATOM 61   N ND1 . HIS A 1 10  ? 9.147   -36.719 61.401  1.00 108.12 ? 10  HIS A ND1 1 
ATOM 62   C CD2 . HIS A 1 10  ? 11.311  -36.270 61.752  1.00 112.41 ? 10  HIS A CD2 1 
ATOM 63   C CE1 . HIS A 1 10  ? 9.278   -35.461 61.794  1.00 106.79 ? 10  HIS A CE1 1 
ATOM 64   N NE2 . HIS A 1 10  ? 10.559  -35.145 62.013  1.00 109.68 ? 10  HIS A NE2 1 
ATOM 65   N N   . ALA A 1 11  ? 10.606  -41.820 60.744  1.00 105.94 ? 11  ALA A N   1 
ATOM 66   C CA  . ALA A 1 11  ? 10.922  -43.055 60.018  1.00 106.67 ? 11  ALA A CA  1 
ATOM 67   C C   . ALA A 1 11  ? 9.672   -43.924 59.834  1.00 109.06 ? 11  ALA A C   1 
ATOM 68   O O   . ALA A 1 11  ? 9.437   -44.418 58.733  1.00 110.58 ? 11  ALA A O   1 
ATOM 69   C CB  . ALA A 1 11  ? 12.027  -43.819 60.736  1.00 111.00 ? 11  ALA A CB  1 
ATOM 70   N N   . ILE A 1 12  ? 8.836   -44.041 60.887  1.00 103.62 ? 12  ILE A N   1 
ATOM 71   C CA  . ILE A 1 12  ? 7.582   -44.806 60.819  1.00 101.19 ? 12  ILE A CA  1 
ATOM 72   C C   . ILE A 1 12  ? 6.592   -44.100 59.865  1.00 103.09 ? 12  ILE A C   1 
ATOM 73   O O   . ILE A 1 12  ? 5.891   -44.766 59.094  1.00 102.93 ? 12  ILE A O   1 
ATOM 74   C CB  . ILE A 1 12  ? 6.972   -45.055 62.234  1.00 102.71 ? 12  ILE A CB  1 
ATOM 75   C CG1 . ILE A 1 12  ? 7.984   -45.725 63.170  1.00 105.69 ? 12  ILE A CG1 1 
ATOM 76   C CG2 . ILE A 1 12  ? 5.698   -45.906 62.126  1.00 102.22 ? 12  ILE A CG2 1 
ATOM 77   C CD1 . ILE A 1 12  ? 7.771   -45.441 64.651  1.00 118.35 ? 12  ILE A CD1 1 
ATOM 78   N N   . TYR A 1 13  ? 6.555   -42.752 59.924  1.00 98.24  ? 13  TYR A N   1 
ATOM 79   C CA  . TYR A 1 13  ? 5.694   -41.928 59.082  1.00 96.32  ? 13  TYR A CA  1 
ATOM 80   C C   . TYR A 1 13  ? 6.002   -42.144 57.620  1.00 101.65 ? 13  TYR A C   1 
ATOM 81   O O   . TYR A 1 13  ? 5.079   -42.339 56.829  1.00 100.73 ? 13  TYR A O   1 
ATOM 82   C CB  . TYR A 1 13  ? 5.840   -40.435 59.430  1.00 96.38  ? 13  TYR A CB  1 
ATOM 83   C CG  . TYR A 1 13  ? 5.018   -39.538 58.532  1.00 95.82  ? 13  TYR A CG  1 
ATOM 84   C CD1 . TYR A 1 13  ? 3.665   -39.319 58.783  1.00 96.74  ? 13  TYR A CD1 1 
ATOM 85   C CD2 . TYR A 1 13  ? 5.591   -38.903 57.436  1.00 95.35  ? 13  TYR A CD2 1 
ATOM 86   C CE1 . TYR A 1 13  ? 2.897   -38.512 57.948  1.00 94.95  ? 13  TYR A CE1 1 
ATOM 87   C CE2 . TYR A 1 13  ? 4.836   -38.077 56.606  1.00 94.11  ? 13  TYR A CE2 1 
ATOM 88   C CZ  . TYR A 1 13  ? 3.489   -37.883 56.870  1.00 98.07  ? 13  TYR A CZ  1 
ATOM 89   O OH  . TYR A 1 13  ? 2.716   -37.083 56.068  1.00 95.44  ? 13  TYR A OH  1 
ATOM 90   N N   . GLN A 1 14  ? 7.307   -42.104 57.278  1.00 100.13 ? 14  GLN A N   1 
ATOM 91   C CA  . GLN A 1 14  ? 7.845   -42.266 55.941  1.00 100.62 ? 14  GLN A CA  1 
ATOM 92   C C   . GLN A 1 14  ? 7.474   -43.617 55.340  1.00 107.63 ? 14  GLN A C   1 
ATOM 93   O O   . GLN A 1 14  ? 7.097   -43.668 54.167  1.00 106.76 ? 14  GLN A O   1 
ATOM 94   C CB  . GLN A 1 14  ? 9.368   -42.048 55.950  1.00 103.82 ? 14  GLN A CB  1 
ATOM 95   C CG  . GLN A 1 14  ? 9.896   -41.017 54.933  1.00 114.97 ? 14  GLN A CG  1 
ATOM 96   C CD  . GLN A 1 14  ? 8.867   -40.075 54.337  1.00 115.30 ? 14  GLN A CD  1 
ATOM 97   O OE1 . GLN A 1 14  ? 8.548   -39.010 54.895  1.00 98.40  ? 14  GLN A OE1 1 
ATOM 98   N NE2 . GLN A 1 14  ? 8.323   -40.457 53.187  1.00 104.76 ? 14  GLN A NE2 1 
ATOM 99   N N   . GLN A 1 15  ? 7.538   -44.699 56.147  1.00 107.31 ? 15  GLN A N   1 
ATOM 100  C CA  . GLN A 1 15  ? 7.179   -46.036 55.682  1.00 109.08 ? 15  GLN A CA  1 
ATOM 101  C C   . GLN A 1 15  ? 5.668   -46.115 55.372  1.00 111.77 ? 15  GLN A C   1 
ATOM 102  O O   . GLN A 1 15  ? 5.268   -46.680 54.353  1.00 113.20 ? 15  GLN A O   1 
ATOM 103  C CB  . GLN A 1 15  ? 7.624   -47.097 56.700  1.00 113.15 ? 15  GLN A CB  1 
ATOM 104  N N   . ASN A 1 16  ? 4.856   -45.481 56.212  1.00 105.84 ? 16  ASN A N   1 
ATOM 105  C CA  . ASN A 1 16  ? 3.401   -45.450 56.059  1.00 104.14 ? 16  ASN A CA  1 
ATOM 106  C C   . ASN A 1 16  ? 2.920   -44.565 54.896  1.00 103.11 ? 16  ASN A C   1 
ATOM 107  O O   . ASN A 1 16  ? 1.888   -44.884 54.294  1.00 101.96 ? 16  ASN A O   1 
ATOM 108  C CB  . ASN A 1 16  ? 2.746   -45.007 57.363  1.00 105.30 ? 16  ASN A CB  1 
ATOM 109  C CG  . ASN A 1 16  ? 2.571   -46.142 58.332  1.00 126.24 ? 16  ASN A CG  1 
ATOM 110  O OD1 . ASN A 1 16  ? 1.536   -46.820 58.354  1.00 120.29 ? 16  ASN A OD1 1 
ATOM 111  N ND2 . ASN A 1 16  ? 3.600   -46.410 59.110  1.00 119.76 ? 16  ASN A ND2 1 
ATOM 112  N N   . LYS A 1 17  ? 3.632   -43.439 54.616  1.00 97.36  ? 17  LYS A N   1 
ATOM 113  C CA  . LYS A 1 17  ? 3.304   -42.491 53.534  1.00 95.66  ? 17  LYS A CA  1 
ATOM 114  C C   . LYS A 1 17  ? 3.485   -43.209 52.196  1.00 101.37 ? 17  LYS A C   1 
ATOM 115  O O   . LYS A 1 17  ? 2.583   -43.165 51.348  1.00 99.64  ? 17  LYS A O   1 
ATOM 116  C CB  . LYS A 1 17  ? 4.187   -41.217 53.595  1.00 96.69  ? 17  LYS A CB  1 
ATOM 117  C CG  . LYS A 1 17  ? 3.868   -40.147 52.530  1.00 99.51  ? 17  LYS A CG  1 
ATOM 118  N N   . GLU A 1 18  ? 4.632   -43.931 52.063  1.00 100.15 ? 18  GLU A N   1 
ATOM 119  C CA  . GLU A 1 18  ? 5.001   -44.707 50.889  1.00 101.88 ? 18  GLU A CA  1 
ATOM 120  C C   . GLU A 1 18  ? 3.943   -45.762 50.613  1.00 106.84 ? 18  GLU A C   1 
ATOM 121  O O   . GLU A 1 18  ? 3.484   -45.872 49.475  1.00 106.47 ? 18  GLU A O   1 
ATOM 122  C CB  . GLU A 1 18  ? 6.400   -45.343 51.071  1.00 105.95 ? 18  GLU A CB  1 
ATOM 123  C CG  . GLU A 1 18  ? 7.535   -44.384 50.736  1.00 119.35 ? 18  GLU A CG  1 
ATOM 124  C CD  . GLU A 1 18  ? 8.861   -44.590 51.446  1.00 149.09 ? 18  GLU A CD  1 
ATOM 125  O OE1 . GLU A 1 18  ? 9.108   -45.704 51.966  1.00 144.92 ? 18  GLU A OE1 1 
ATOM 126  O OE2 . GLU A 1 18  ? 9.665   -43.631 51.463  1.00 148.11 ? 18  GLU A OE2 1 
ATOM 127  N N   . HIS A 1 19  ? 3.510   -46.486 51.669  1.00 104.00 ? 19  HIS A N   1 
ATOM 128  C CA  . HIS A 1 19  ? 2.483   -47.527 51.584  1.00 104.95 ? 19  HIS A CA  1 
ATOM 129  C C   . HIS A 1 19  ? 1.181   -46.958 51.029  1.00 105.49 ? 19  HIS A C   1 
ATOM 130  O O   . HIS A 1 19  ? 0.563   -47.575 50.158  1.00 106.75 ? 19  HIS A O   1 
ATOM 131  C CB  . HIS A 1 19  ? 2.244   -48.170 52.964  1.00 107.32 ? 19  HIS A CB  1 
ATOM 132  C CG  . HIS A 1 19  ? 1.319   -49.347 52.918  1.00 113.20 ? 19  HIS A CG  1 
ATOM 133  N ND1 . HIS A 1 19  ? 1.796   -50.620 52.669  1.00 118.47 ? 19  HIS A ND1 1 
ATOM 134  C CD2 . HIS A 1 19  ? -0.022  -49.415 53.103  1.00 114.46 ? 19  HIS A CD2 1 
ATOM 135  C CE1 . HIS A 1 19  ? 0.738   -51.413 52.695  1.00 119.64 ? 19  HIS A CE1 1 
ATOM 136  N NE2 . HIS A 1 19  ? -0.377  -50.736 52.966  1.00 117.82 ? 19  HIS A NE2 1 
ATOM 137  N N   . PHE A 1 20  ? 0.775   -45.786 51.539  1.00 98.23  ? 20  PHE A N   1 
ATOM 138  C CA  . PHE A 1 20  ? -0.451  -45.110 51.131  1.00 95.66  ? 20  PHE A CA  1 
ATOM 139  C C   . PHE A 1 20  ? -0.416  -44.700 49.658  1.00 98.12  ? 20  PHE A C   1 
ATOM 140  O O   . PHE A 1 20  ? -1.387  -44.923 48.927  1.00 97.83  ? 20  PHE A O   1 
ATOM 141  C CB  . PHE A 1 20  ? -0.716  -43.890 52.031  1.00 93.98  ? 20  PHE A CB  1 
ATOM 142  C CG  . PHE A 1 20  ? -1.547  -42.804 51.395  1.00 92.21  ? 20  PHE A CG  1 
ATOM 143  C CD1 . PHE A 1 20  ? -2.896  -43.002 51.120  1.00 94.70  ? 20  PHE A CD1 1 
ATOM 144  C CD2 . PHE A 1 20  ? -0.990  -41.575 51.099  1.00 91.25  ? 20  PHE A CD2 1 
ATOM 145  C CE1 . PHE A 1 20  ? -3.661  -41.991 50.545  1.00 93.22  ? 20  PHE A CE1 1 
ATOM 146  C CE2 . PHE A 1 20  ? -1.759  -40.562 50.537  1.00 91.80  ? 20  PHE A CE2 1 
ATOM 147  C CZ  . PHE A 1 20  ? -3.090  -40.775 50.270  1.00 90.04  ? 20  PHE A CZ  1 
ATOM 148  N N   . GLN A 1 21  ? 0.693   -44.076 49.248  1.00 93.35  ? 21  GLN A N   1 
ATOM 149  C CA  . GLN A 1 21  ? 0.898   -43.556 47.895  1.00 91.14  ? 21  GLN A CA  1 
ATOM 150  C C   . GLN A 1 21  ? 0.934   -44.689 46.881  1.00 101.12 ? 21  GLN A C   1 
ATOM 151  O O   . GLN A 1 21  ? 0.254   -44.590 45.863  1.00 102.68 ? 21  GLN A O   1 
ATOM 152  C CB  . GLN A 1 21  ? 2.147   -42.679 47.844  1.00 89.63  ? 21  GLN A CB  1 
ATOM 153  C CG  . GLN A 1 21  ? 1.954   -41.389 48.644  1.00 83.99  ? 21  GLN A CG  1 
ATOM 154  C CD  . GLN A 1 21  ? 3.139   -40.470 48.645  1.00 94.45  ? 21  GLN A CD  1 
ATOM 155  O OE1 . GLN A 1 21  ? 4.220   -40.812 48.156  1.00 86.77  ? 21  GLN A OE1 1 
ATOM 156  N NE2 . GLN A 1 21  ? 2.964   -39.281 49.229  1.00 93.48  ? 21  GLN A NE2 1 
ATOM 157  N N   . ASP A 1 22  ? 1.650   -45.806 47.202  1.00 100.14 ? 22  ASP A N   1 
ATOM 158  C CA  . ASP A 1 22  ? 1.757   -47.054 46.422  1.00 101.74 ? 22  ASP A CA  1 
ATOM 159  C C   . ASP A 1 22  ? 0.414   -47.838 46.387  1.00 107.98 ? 22  ASP A C   1 
ATOM 160  O O   . ASP A 1 22  ? 0.218   -48.662 45.505  1.00 111.56 ? 22  ASP A O   1 
ATOM 161  C CB  . ASP A 1 22  ? 2.879   -47.958 46.982  1.00 104.51 ? 22  ASP A CB  1 
ATOM 162  N N   . GLU A 1 23  ? -0.486  -47.599 47.343  1.00 102.96 ? 23  GLU A N   1 
ATOM 163  C CA  . GLU A 1 23  ? -1.814  -48.221 47.403  1.00 104.31 ? 23  GLU A CA  1 
ATOM 164  C C   . GLU A 1 23  ? -2.799  -47.466 46.506  1.00 106.51 ? 23  GLU A C   1 
ATOM 165  O O   . GLU A 1 23  ? -3.632  -48.094 45.849  1.00 107.66 ? 23  GLU A O   1 
ATOM 166  C CB  . GLU A 1 23  ? -2.336  -48.268 48.852  1.00 105.17 ? 23  GLU A CB  1 
ATOM 167  N N   . CYS A 1 24  ? -2.704  -46.115 46.495  1.00 100.73 ? 24  CYS A N   1 
ATOM 168  C CA  . CYS A 1 24  ? -3.523  -45.213 45.678  1.00 99.86  ? 24  CYS A CA  1 
ATOM 169  C C   . CYS A 1 24  ? -3.231  -45.415 44.211  1.00 104.64 ? 24  CYS A C   1 
ATOM 170  O O   . CYS A 1 24  ? -4.167  -45.535 43.410  1.00 103.72 ? 24  CYS A O   1 
ATOM 171  C CB  . CYS A 1 24  ? -3.286  -43.763 46.072  1.00 97.15  ? 24  CYS A CB  1 
ATOM 172  S SG  . CYS A 1 24  ? -4.370  -43.171 47.385  1.00 100.46 ? 24  CYS A SG  1 
ATOM 173  N N   . THR A 1 25  ? -1.925  -45.436 43.860  1.00 102.51 ? 25  THR A N   1 
ATOM 174  C CA  . THR A 1 25  ? -1.478  -45.608 42.483  1.00 103.96 ? 25  THR A CA  1 
ATOM 175  C C   . THR A 1 25  ? -1.960  -46.959 41.956  1.00 112.60 ? 25  THR A C   1 
ATOM 176  O O   . THR A 1 25  ? -2.590  -46.995 40.890  1.00 112.51 ? 25  THR A O   1 
ATOM 177  C CB  . THR A 1 25  ? 0.044   -45.393 42.331  1.00 111.85 ? 25  THR A CB  1 
ATOM 178  O OG1 . THR A 1 25  ? 0.751   -46.375 43.096  1.00 107.92 ? 25  THR A OG1 1 
ATOM 179  C CG2 . THR A 1 25  ? 0.488   -43.968 42.719  1.00 111.26 ? 25  THR A CG2 1 
ATOM 180  N N   . LYS A 1 26  ? -1.746  -48.054 42.738  1.00 112.02 ? 26  LYS A N   1 
ATOM 181  C CA  . LYS A 1 26  ? -2.191  -49.397 42.336  1.00 115.45 ? 26  LYS A CA  1 
ATOM 182  C C   . LYS A 1 26  ? -3.689  -49.381 41.971  1.00 121.28 ? 26  LYS A C   1 
ATOM 183  O O   . LYS A 1 26  ? -4.057  -49.753 40.843  1.00 124.32 ? 26  LYS A O   1 
ATOM 184  C CB  . LYS A 1 26  ? -1.878  -50.439 43.417  1.00 118.79 ? 26  LYS A CB  1 
ATOM 185  N N   . LEU A 1 27  ? -4.514  -48.817 42.874  1.00 114.52 ? 27  LEU A N   1 
ATOM 186  C CA  . LEU A 1 27  ? -5.955  -48.684 42.713  1.00 115.74 ? 27  LEU A CA  1 
ATOM 187  C C   . LEU A 1 27  ? -6.417  -47.781 41.539  1.00 120.99 ? 27  LEU A C   1 
ATOM 188  O O   . LEU A 1 27  ? -7.407  -48.118 40.887  1.00 124.39 ? 27  LEU A O   1 
ATOM 189  C CB  . LEU A 1 27  ? -6.548  -48.155 44.010  1.00 114.24 ? 27  LEU A CB  1 
ATOM 190  N N   . LEU A 1 28  ? -5.730  -46.646 41.275  1.00 113.23 ? 28  LEU A N   1 
ATOM 191  C CA  . LEU A 1 28  ? -6.169  -45.658 40.286  1.00 110.45 ? 28  LEU A CA  1 
ATOM 192  C C   . LEU A 1 28  ? -5.591  -45.773 38.881  1.00 111.34 ? 28  LEU A C   1 
ATOM 193  O O   . LEU A 1 28  ? -6.318  -45.483 37.926  1.00 110.13 ? 28  LEU A O   1 
ATOM 194  C CB  . LEU A 1 28  ? -5.887  -44.254 40.820  1.00 106.81 ? 28  LEU A CB  1 
ATOM 195  N N   . VAL A 1 29  ? -4.287  -46.101 38.748  1.00 106.54 ? 29  VAL A N   1 
ATOM 196  C CA  . VAL A 1 29  ? -3.603  -46.169 37.460  1.00 105.92 ? 29  VAL A CA  1 
ATOM 197  C C   . VAL A 1 29  ? -4.330  -47.153 36.540  1.00 115.61 ? 29  VAL A C   1 
ATOM 198  O O   . VAL A 1 29  ? -4.626  -48.279 36.954  1.00 120.14 ? 29  VAL A O   1 
ATOM 199  C CB  . VAL A 1 29  ? -2.098  -46.482 37.596  1.00 108.22 ? 29  VAL A CB  1 
ATOM 200  N N   . GLY A 1 30  ? -4.698  -46.675 35.346  1.00 110.09 ? 30  GLY A N   1 
ATOM 201  C CA  . GLY A 1 30  ? -5.437  -47.459 34.368  1.00 112.92 ? 30  GLY A CA  1 
ATOM 202  C C   . GLY A 1 30  ? -6.865  -47.011 34.124  1.00 117.31 ? 30  GLY A C   1 
ATOM 203  O O   . GLY A 1 30  ? -7.357  -47.160 33.010  1.00 120.55 ? 30  GLY A O   1 
ATOM 204  N N   . ASN A 1 31  ? -7.553  -46.493 35.145  1.00 112.22 ? 31  ASN A N   1 
ATOM 205  C CA  . ASN A 1 31  ? -8.950  -46.047 35.062  1.00 112.84 ? 31  ASN A CA  1 
ATOM 206  C C   . ASN A 1 31  ? -9.110  -44.759 34.244  1.00 112.24 ? 31  ASN A C   1 
ATOM 207  O O   . ASN A 1 31  ? -8.153  -44.008 34.093  1.00 106.76 ? 31  ASN A O   1 
ATOM 208  C CB  . ASN A 1 31  ? -9.524  -45.863 36.471  1.00 112.11 ? 31  ASN A CB  1 
ATOM 209  N N   . ILE A 1 32  ? -10.324 -44.515 33.717  1.00 112.23 ? 32  ILE A N   1 
ATOM 210  C CA  . ILE A 1 32  ? -10.668 -43.333 32.904  1.00 111.15 ? 32  ILE A CA  1 
ATOM 211  C C   . ILE A 1 32  ? -11.603 -42.416 33.711  1.00 113.94 ? 32  ILE A C   1 
ATOM 212  O O   . ILE A 1 32  ? -12.519 -42.926 34.355  1.00 116.29 ? 32  ILE A O   1 
ATOM 213  C CB  . ILE A 1 32  ? -11.260 -43.726 31.507  1.00 117.54 ? 32  ILE A CB  1 
ATOM 214  N N   . VAL A 1 33  ? -11.378 -41.084 33.697  1.00 106.07 ? 33  VAL A N   1 
ATOM 215  C CA  . VAL A 1 33  ? -12.208 -40.164 34.494  1.00 105.38 ? 33  VAL A CA  1 
ATOM 216  C C   . VAL A 1 33  ? -12.919 -39.120 33.640  1.00 111.30 ? 33  VAL A C   1 
ATOM 217  O O   . VAL A 1 33  ? -12.401 -38.730 32.609  1.00 109.83 ? 33  VAL A O   1 
ATOM 218  C CB  . VAL A 1 33  ? -11.449 -39.492 35.680  1.00 104.76 ? 33  VAL A CB  1 
ATOM 219  C CG1 . VAL A 1 33  ? -11.211 -40.477 36.821  1.00 104.46 ? 33  VAL A CG1 1 
ATOM 220  C CG2 . VAL A 1 33  ? -10.137 -38.837 35.239  1.00 100.63 ? 33  VAL A CG2 1 
ATOM 221  N N   . ILE A 1 34  ? -14.089 -38.649 34.094  1.00 112.25 ? 34  ILE A N   1 
ATOM 222  C CA  . ILE A 1 34  ? -14.883 -37.627 33.410  1.00 114.92 ? 34  ILE A CA  1 
ATOM 223  C C   . ILE A 1 34  ? -14.923 -36.331 34.222  1.00 118.05 ? 34  ILE A C   1 
ATOM 224  O O   . ILE A 1 34  ? -15.163 -36.357 35.438  1.00 116.58 ? 34  ILE A O   1 
ATOM 225  C CB  . ILE A 1 34  ? -16.307 -38.141 33.096  1.00 123.83 ? 34  ILE A CB  1 
ATOM 226  N N   . THR A 1 35  ? -14.672 -35.198 33.548  1.00 114.82 ? 35  THR A N   1 
ATOM 227  C CA  . THR A 1 35  ? -14.711 -33.872 34.165  1.00 113.26 ? 35  THR A CA  1 
ATOM 228  C C   . THR A 1 35  ? -16.164 -33.391 34.116  1.00 122.39 ? 35  THR A C   1 
ATOM 229  O O   . THR A 1 35  ? -16.775 -33.445 33.053  1.00 124.98 ? 35  THR A O   1 
ATOM 230  C CB  . THR A 1 35  ? -13.716 -32.936 33.470  1.00 117.74 ? 35  THR A CB  1 
ATOM 231  N N   . ARG A 1 36  ? -16.739 -32.989 35.272  1.00 120.28 ? 36  ARG A N   1 
ATOM 232  C CA  . ARG A 1 36  ? -18.142 -32.541 35.380  1.00 124.70 ? 36  ARG A CA  1 
ATOM 233  C C   . ARG A 1 36  ? -18.427 -31.266 34.561  1.00 130.08 ? 36  ARG A C   1 
ATOM 234  O O   . ARG A 1 36  ? -19.535 -31.093 34.042  1.00 134.83 ? 36  ARG A O   1 
ATOM 235  C CB  . ARG A 1 36  ? -18.532 -32.331 36.849  1.00 124.56 ? 36  ARG A CB  1 
ATOM 236  N N   . TYR A 1 37  ? -17.403 -30.408 34.426  1.00 122.12 ? 37  TYR A N   1 
ATOM 237  C CA  . TYR A 1 37  ? -17.401 -29.139 33.693  1.00 121.77 ? 37  TYR A CA  1 
ATOM 238  C C   . TYR A 1 37  ? -17.091 -29.302 32.183  1.00 124.46 ? 37  TYR A C   1 
ATOM 239  O O   . TYR A 1 37  ? -17.622 -28.532 31.386  1.00 126.79 ? 37  TYR A O   1 
ATOM 240  C CB  . TYR A 1 37  ? -16.378 -28.167 34.349  1.00 118.33 ? 37  TYR A CB  1 
ATOM 241  C CG  . TYR A 1 37  ? -14.945 -28.671 34.339  1.00 115.15 ? 37  TYR A CG  1 
ATOM 242  C CD1 . TYR A 1 37  ? -14.064 -28.308 33.325  1.00 115.33 ? 37  TYR A CD1 1 
ATOM 243  C CD2 . TYR A 1 37  ? -14.476 -29.526 35.334  1.00 113.42 ? 37  TYR A CD2 1 
ATOM 244  C CE1 . TYR A 1 37  ? -12.765 -28.809 33.280  1.00 112.42 ? 37  TYR A CE1 1 
ATOM 245  C CE2 . TYR A 1 37  ? -13.170 -30.015 35.312  1.00 110.57 ? 37  TYR A CE2 1 
ATOM 246  C CZ  . TYR A 1 37  ? -12.319 -29.656 34.279  1.00 115.94 ? 37  TYR A CZ  1 
ATOM 247  O OH  . TYR A 1 37  ? -11.036 -30.141 34.219  1.00 112.98 ? 37  TYR A OH  1 
ATOM 248  N N   . ASN A 1 38  ? -16.199 -30.258 31.803  1.00 118.03 ? 38  ASN A N   1 
ATOM 249  C CA  . ASN A 1 38  ? -15.725 -30.466 30.426  1.00 118.13 ? 38  ASN A CA  1 
ATOM 250  C C   . ASN A 1 38  ? -16.280 -31.728 29.741  1.00 126.72 ? 38  ASN A C   1 
ATOM 251  O O   . ASN A 1 38  ? -16.207 -31.815 28.514  1.00 127.79 ? 38  ASN A O   1 
ATOM 252  C CB  . ASN A 1 38  ? -14.195 -30.498 30.384  1.00 109.78 ? 38  ASN A CB  1 
ATOM 253  N N   . ASN A 1 39  ? -16.796 -32.710 30.529  1.00 124.93 ? 39  ASN A N   1 
ATOM 254  C CA  . ASN A 1 39  ? -17.364 -33.999 30.096  1.00 128.44 ? 39  ASN A CA  1 
ATOM 255  C C   . ASN A 1 39  ? -16.415 -34.790 29.162  1.00 131.67 ? 39  ASN A C   1 
ATOM 256  O O   . ASN A 1 39  ? -16.875 -35.620 28.377  1.00 136.03 ? 39  ASN A O   1 
ATOM 257  C CB  . ASN A 1 39  ? -18.712 -33.781 29.408  1.00 20.00  ? 39  ASN A CB  1 
ATOM 258  N N   . ARG A 1 40  ? -15.100 -34.526 29.259  1.00 122.09 ? 40  ARG A N   1 
ATOM 259  C CA  . ARG A 1 40  ? -14.061 -35.202 28.485  1.00 119.61 ? 40  ARG A CA  1 
ATOM 260  C C   . ARG A 1 40  ? -13.481 -36.340 29.339  1.00 118.93 ? 40  ARG A C   1 
ATOM 261  O O   . ARG A 1 40  ? -13.494 -36.243 30.563  1.00 117.58 ? 40  ARG A O   1 
ATOM 262  C CB  . ARG A 1 40  ? -12.955 -34.204 28.074  1.00 117.09 ? 40  ARG A CB  1 
ATOM 263  N N   . THR A 1 41  ? -12.995 -37.412 28.702  1.00 113.59 ? 41  THR A N   1 
ATOM 264  C CA  . THR A 1 41  ? -12.425 -38.574 29.385  1.00 111.39 ? 41  THR A CA  1 
ATOM 265  C C   . THR A 1 41  ? -10.900 -38.672 29.238  1.00 109.58 ? 41  THR A C   1 
ATOM 266  O O   . THR A 1 41  ? -10.350 -38.137 28.281  1.00 108.33 ? 41  THR A O   1 
ATOM 267  C CB  . THR A 1 41  ? -13.093 -39.825 28.861  1.00 123.03 ? 41  THR A CB  1 
ATOM 268  N N   . TYR A 1 42  ? -10.217 -39.344 30.198  1.00 103.92 ? 42  TYR A N   1 
ATOM 269  C CA  . TYR A 1 42  ? -8.744  -39.542 30.236  1.00 101.20 ? 42  TYR A CA  1 
ATOM 270  C C   . TYR A 1 42  ? -8.358  -40.752 31.095  1.00 102.70 ? 42  TYR A C   1 
ATOM 271  O O   . TYR A 1 42  ? -8.992  -41.001 32.130  1.00 99.90  ? 42  TYR A O   1 
ATOM 272  C CB  . TYR A 1 42  ? -7.951  -38.315 30.833  1.00 99.20  ? 42  TYR A CB  1 
ATOM 273  C CG  . TYR A 1 42  ? -8.525  -36.926 30.609  1.00 101.47 ? 42  TYR A CG  1 
ATOM 274  C CD1 . TYR A 1 42  ? -8.023  -36.095 29.614  1.00 102.10 ? 42  TYR A CD1 1 
ATOM 275  C CD2 . TYR A 1 42  ? -9.570  -36.444 31.400  1.00 103.55 ? 42  TYR A CD2 1 
ATOM 276  C CE1 . TYR A 1 42  ? -8.568  -34.828 29.388  1.00 103.96 ? 42  TYR A CE1 1 
ATOM 277  C CE2 . TYR A 1 42  ? -10.136 -35.193 31.169  1.00 104.60 ? 42  TYR A CE2 1 
ATOM 278  C CZ  . TYR A 1 42  ? -9.606  -34.371 30.191  1.00 111.26 ? 42  TYR A CZ  1 
ATOM 279  O OH  . TYR A 1 42  ? -10.172 -33.136 29.990  1.00 113.24 ? 42  TYR A OH  1 
ATOM 280  N N   . ARG A 1 43  ? -7.251  -41.429 30.721  1.00 99.07  ? 43  ARG A N   1 
ATOM 281  C CA  . ARG A 1 43  ? -6.680  -42.532 31.496  1.00 99.50  ? 43  ARG A CA  1 
ATOM 282  C C   . ARG A 1 43  ? -5.758  -41.923 32.562  1.00 103.33 ? 43  ARG A C   1 
ATOM 283  O O   . ARG A 1 43  ? -5.093  -40.921 32.279  1.00 101.69 ? 43  ARG A O   1 
ATOM 284  C CB  . ARG A 1 43  ? -5.862  -43.466 30.587  1.00 99.07  ? 43  ARG A CB  1 
ATOM 285  C CG  . ARG A 1 43  ? -5.200  -44.622 31.320  1.00 108.05 ? 43  ARG A CG  1 
ATOM 286  C CD  . ARG A 1 43  ? -4.263  -45.423 30.443  1.00 118.57 ? 43  ARG A CD  1 
ATOM 287  N NE  . ARG A 1 43  ? -3.272  -46.125 31.255  1.00 131.80 ? 43  ARG A NE  1 
ATOM 288  N N   . ILE A 1 44  ? -5.719  -42.526 33.775  1.00 100.06 ? 44  ILE A N   1 
ATOM 289  C CA  . ILE A 1 44  ? -4.822  -42.151 34.866  1.00 96.50  ? 44  ILE A CA  1 
ATOM 290  C C   . ILE A 1 44  ? -3.572  -43.016 34.680  1.00 100.46 ? 44  ILE A C   1 
ATOM 291  O O   . ILE A 1 44  ? -3.650  -44.241 34.714  1.00 102.35 ? 44  ILE A O   1 
ATOM 292  C CB  . ILE A 1 44  ? -5.458  -42.333 36.263  1.00 100.15 ? 44  ILE A CB  1 
ATOM 293  C CG1 . ILE A 1 44  ? -6.740  -41.469 36.418  1.00 101.34 ? 44  ILE A CG1 1 
ATOM 294  C CG2 . ILE A 1 44  ? -4.436  -42.016 37.365  1.00 98.31  ? 44  ILE A CG2 1 
ATOM 295  C CD1 . ILE A 1 44  ? -7.707  -41.905 37.592  1.00 107.40 ? 44  ILE A CD1 1 
ATOM 296  N N   . ASP A 1 45  ? -2.437  -42.368 34.439  1.00 95.81  ? 45  ASP A N   1 
ATOM 297  C CA  . ASP A 1 45  ? -1.153  -43.007 34.173  1.00 95.78  ? 45  ASP A CA  1 
ATOM 298  C C   . ASP A 1 45  ? -0.218  -42.953 35.360  1.00 98.78  ? 45  ASP A C   1 
ATOM 299  O O   . ASP A 1 45  ? 0.743   -43.728 35.410  1.00 97.87  ? 45  ASP A O   1 
ATOM 300  C CB  . ASP A 1 45  ? -0.509  -42.350 32.933  1.00 96.65  ? 45  ASP A CB  1 
ATOM 301  C CG  . ASP A 1 45  ? -1.316  -42.540 31.652  1.00 106.83 ? 45  ASP A CG  1 
ATOM 302  O OD1 . ASP A 1 45  ? -2.275  -43.340 31.664  1.00 110.46 ? 45  ASP A OD1 1 
ATOM 303  O OD2 . ASP A 1 45  ? -0.991  -41.893 30.650  1.00 112.70 ? 45  ASP A OD2 1 
ATOM 304  N N   . ASP A 1 46  ? -0.515  -42.029 36.324  1.00 95.85  ? 46  ASP A N   1 
ATOM 305  C CA  . ASP A 1 46  ? 0.229   -41.767 37.567  1.00 93.45  ? 46  ASP A CA  1 
ATOM 306  C C   . ASP A 1 46  ? -0.435  -40.673 38.416  1.00 92.03  ? 46  ASP A C   1 
ATOM 307  O O   . ASP A 1 46  ? -1.405  -40.032 38.007  1.00 89.50  ? 46  ASP A O   1 
ATOM 308  C CB  . ASP A 1 46  ? 1.672   -41.319 37.238  1.00 95.08  ? 46  ASP A CB  1 
ATOM 309  C CG  . ASP A 1 46  ? 2.766   -41.994 38.051  1.00 110.19 ? 46  ASP A CG  1 
ATOM 310  O OD1 . ASP A 1 46  ? 2.488   -42.410 39.200  1.00 109.32 ? 46  ASP A OD1 1 
ATOM 311  O OD2 . ASP A 1 46  ? 3.907   -42.107 37.536  1.00 119.57 ? 46  ASP A OD2 1 
ATOM 312  N N   . VAL A 1 47  ? 0.118   -40.465 39.607  1.00 89.51  ? 47  VAL A N   1 
ATOM 313  C CA  . VAL A 1 47  ? -0.301  -39.441 40.553  1.00 87.80  ? 47  VAL A CA  1 
ATOM 314  C C   . VAL A 1 47  ? 0.952   -38.607 40.905  1.00 88.65  ? 47  VAL A C   1 
ATOM 315  O O   . VAL A 1 47  ? 2.007   -39.180 41.211  1.00 88.71  ? 47  VAL A O   1 
ATOM 316  C CB  . VAL A 1 47  ? -0.976  -40.056 41.806  1.00 91.78  ? 47  VAL A CB  1 
ATOM 317  N N   . ASP A 1 48  ? 0.860   -37.276 40.791  1.00 82.35  ? 48  ASP A N   1 
ATOM 318  C CA  . ASP A 1 48  ? 1.968   -36.418 41.209  1.00 81.13  ? 48  ASP A CA  1 
ATOM 319  C C   . ASP A 1 48  ? 1.676   -36.021 42.646  1.00 80.80  ? 48  ASP A C   1 
ATOM 320  O O   . ASP A 1 48  ? 0.786   -35.210 42.925  1.00 78.64  ? 48  ASP A O   1 
ATOM 321  C CB  . ASP A 1 48  ? 2.206   -35.178 40.315  1.00 82.53  ? 48  ASP A CB  1 
ATOM 322  C CG  . ASP A 1 48  ? 3.556   -34.475 40.533  1.00 98.51  ? 48  ASP A CG  1 
ATOM 323  O OD1 . ASP A 1 48  ? 4.228   -34.754 41.564  1.00 98.48  ? 48  ASP A OD1 1 
ATOM 324  O OD2 . ASP A 1 48  ? 3.947   -33.661 39.669  1.00 110.82 ? 48  ASP A OD2 1 
ATOM 325  N N   . TRP A 1 49  ? 2.411   -36.648 43.550  1.00 76.54  ? 49  TRP A N   1 
ATOM 326  C CA  . TRP A 1 49  ? 2.279   -36.445 44.981  1.00 76.10  ? 49  TRP A CA  1 
ATOM 327  C C   . TRP A 1 49  ? 2.957   -35.131 45.430  1.00 80.94  ? 49  TRP A C   1 
ATOM 328  O O   . TRP A 1 49  ? 2.606   -34.593 46.475  1.00 78.58  ? 49  TRP A O   1 
ATOM 329  C CB  . TRP A 1 49  ? 2.854   -37.675 45.718  1.00 75.43  ? 49  TRP A CB  1 
ATOM 330  C CG  . TRP A 1 49  ? 2.088   -38.942 45.461  1.00 77.41  ? 49  TRP A CG  1 
ATOM 331  C CD1 . TRP A 1 49  ? 2.445   -39.994 44.656  1.00 81.67  ? 49  TRP A CD1 1 
ATOM 332  C CD2 . TRP A 1 49  ? 0.806   -39.258 45.984  1.00 77.51  ? 49  TRP A CD2 1 
ATOM 333  N NE1 . TRP A 1 49  ? 1.472   -40.973 44.696  1.00 82.36  ? 49  TRP A NE1 1 
ATOM 334  C CE2 . TRP A 1 49  ? 0.442   -40.533 45.485  1.00 83.49  ? 49  TRP A CE2 1 
ATOM 335  C CE3 . TRP A 1 49  ? -0.089  -38.574 46.802  1.00 77.95  ? 49  TRP A CE3 1 
ATOM 336  C CZ2 . TRP A 1 49  ? -0.787  -41.119 45.778  1.00 84.61  ? 49  TRP A CZ2 1 
ATOM 337  C CZ3 . TRP A 1 49  ? -1.289  -39.165 47.111  1.00 80.71  ? 49  TRP A CZ3 1 
ATOM 338  C CH2 . TRP A 1 49  ? -1.615  -40.435 46.636  1.00 83.53  ? 49  TRP A CH2 1 
ATOM 339  N N   . ASN A 1 50  ? 3.871   -34.596 44.597  1.00 80.68  ? 50  ASN A N   1 
ATOM 340  C CA  . ASN A 1 50  ? 4.653   -33.384 44.851  1.00 80.89  ? 50  ASN A CA  1 
ATOM 341  C C   . ASN A 1 50  ? 4.006   -32.095 44.309  1.00 83.43  ? 50  ASN A C   1 
ATOM 342  O O   . ASN A 1 50  ? 4.555   -31.013 44.519  1.00 83.19  ? 50  ASN A O   1 
ATOM 343  C CB  . ASN A 1 50  ? 6.073   -33.546 44.268  1.00 84.00  ? 50  ASN A CB  1 
ATOM 344  C CG  . ASN A 1 50  ? 6.830   -34.736 44.794  1.00 113.27 ? 50  ASN A CG  1 
ATOM 345  O OD1 . ASN A 1 50  ? 6.775   -35.080 45.992  1.00 105.53 ? 50  ASN A OD1 1 
ATOM 346  N ND2 . ASN A 1 50  ? 7.559   -35.385 43.898  1.00 106.73 ? 50  ASN A ND2 1 
ATOM 347  N N   . LYS A 1 51  ? 2.866   -32.203 43.609  1.00 78.25  ? 51  LYS A N   1 
ATOM 348  C CA  . LYS A 1 51  ? 2.163   -31.047 43.063  1.00 75.99  ? 51  LYS A CA  1 
ATOM 349  C C   . LYS A 1 51  ? 0.796   -30.909 43.720  1.00 77.56  ? 51  LYS A C   1 
ATOM 350  O O   . LYS A 1 51  ? 0.238   -31.892 44.209  1.00 78.79  ? 51  LYS A O   1 
ATOM 351  C CB  . LYS A 1 51  ? 2.064   -31.112 41.532  1.00 78.26  ? 51  LYS A CB  1 
ATOM 352  C CG  . LYS A 1 51  ? 3.259   -30.514 40.809  1.00 91.10  ? 51  LYS A CG  1 
ATOM 353  N N   . THR A 1 52  ? 0.273   -29.676 43.736  1.00 72.26  ? 52  THR A N   1 
ATOM 354  C CA  . THR A 1 52  ? -0.981  -29.290 44.380  1.00 71.91  ? 52  THR A CA  1 
ATOM 355  C C   . THR A 1 52  ? -1.703  -28.186 43.527  1.00 74.78  ? 52  THR A C   1 
ATOM 356  O O   . THR A 1 52  ? -1.018  -27.493 42.766  1.00 73.03  ? 52  THR A O   1 
ATOM 357  C CB  . THR A 1 52  ? -0.631  -28.853 45.840  1.00 79.58  ? 52  THR A CB  1 
ATOM 358  O OG1 . THR A 1 52  ? -1.795  -28.803 46.643  1.00 87.04  ? 52  THR A OG1 1 
ATOM 359  C CG2 . THR A 1 52  ? 0.092   -27.520 45.928  1.00 73.42  ? 52  THR A CG2 1 
ATOM 360  N N   . PRO A 1 53  ? -3.049  -27.967 43.637  1.00 70.77  ? 53  PRO A N   1 
ATOM 361  C CA  . PRO A 1 53  ? -3.679  -26.874 42.870  1.00 70.66  ? 53  PRO A CA  1 
ATOM 362  C C   . PRO A 1 53  ? -3.106  -25.479 43.160  1.00 73.44  ? 53  PRO A C   1 
ATOM 363  O O   . PRO A 1 53  ? -3.311  -24.563 42.368  1.00 74.57  ? 53  PRO A O   1 
ATOM 364  C CB  . PRO A 1 53  ? -5.151  -26.962 43.274  1.00 73.69  ? 53  PRO A CB  1 
ATOM 365  C CG  . PRO A 1 53  ? -5.336  -28.371 43.732  1.00 78.05  ? 53  PRO A CG  1 
ATOM 366  C CD  . PRO A 1 53  ? -4.062  -28.699 44.429  1.00 72.79  ? 53  PRO A CD  1 
ATOM 367  N N   . LYS A 1 54  ? -2.365  -25.331 44.270  1.00 70.35  ? 54  LYS A N   1 
ATOM 368  C CA  . LYS A 1 54  ? -1.679  -24.097 44.686  1.00 69.94  ? 54  LYS A CA  1 
ATOM 369  C C   . LYS A 1 54  ? -0.516  -23.827 43.733  1.00 74.75  ? 54  LYS A C   1 
ATOM 370  O O   . LYS A 1 54  ? -0.125  -22.679 43.561  1.00 75.48  ? 54  LYS A O   1 
ATOM 371  C CB  . LYS A 1 54  ? -1.139  -24.214 46.133  1.00 70.83  ? 54  LYS A CB  1 
ATOM 372  C CG  . LYS A 1 54  ? -2.183  -24.300 47.256  1.00 84.53  ? 54  LYS A CG  1 
ATOM 373  C CD  . LYS A 1 54  ? -1.543  -24.751 48.592  1.00 85.05  ? 54  LYS A CD  1 
ATOM 374  N N   . ASP A 1 55  ? 0.024   -24.889 43.109  1.00 73.02  ? 55  ASP A N   1 
ATOM 375  C CA  . ASP A 1 55  ? 1.151   -24.808 42.198  1.00 74.44  ? 55  ASP A CA  1 
ATOM 376  C C   . ASP A 1 55  ? 0.777   -24.199 40.863  1.00 83.58  ? 55  ASP A C   1 
ATOM 377  O O   . ASP A 1 55  ? -0.404  -24.078 40.516  1.00 83.64  ? 55  ASP A O   1 
ATOM 378  C CB  . ASP A 1 55  ? 1.819   -26.175 42.005  1.00 76.47  ? 55  ASP A CB  1 
ATOM 379  C CG  . ASP A 1 55  ? 2.630   -26.648 43.198  1.00 93.75  ? 55  ASP A CG  1 
ATOM 380  O OD1 . ASP A 1 55  ? 3.667   -27.299 42.984  1.00 97.13  ? 55  ASP A OD1 1 
ATOM 381  O OD2 . ASP A 1 55  ? 2.291   -26.267 44.339  1.00 100.09 ? 55  ASP A OD2 1 
ATOM 382  N N   . SER A 1 56  ? 1.809   -23.770 40.127  1.00 83.22  ? 56  SER A N   1 
ATOM 383  C CA  . SER A 1 56  ? 1.652   -23.123 38.836  1.00 83.94  ? 56  SER A CA  1 
ATOM 384  C C   . SER A 1 56  ? 2.090   -24.008 37.679  1.00 89.13  ? 56  SER A C   1 
ATOM 385  O O   . SER A 1 56  ? 2.872   -24.953 37.839  1.00 88.56  ? 56  SER A O   1 
ATOM 386  C CB  . SER A 1 56  ? 2.432   -21.811 38.801  1.00 86.67  ? 56  SER A CB  1 
ATOM 387  O OG  . SER A 1 56  ? 1.901   -20.877 39.722  1.00 96.98  ? 56  SER A OG  1 
ATOM 388  N N   . PHE A 1 57  ? 1.566   -23.689 36.506  1.00 86.47  ? 57  PHE A N   1 
ATOM 389  C CA  . PHE A 1 57  ? 1.975   -24.295 35.260  1.00 86.54  ? 57  PHE A CA  1 
ATOM 390  C C   . PHE A 1 57  ? 2.218   -23.161 34.260  1.00 88.63  ? 57  PHE A C   1 
ATOM 391  O O   . PHE A 1 57  ? 1.617   -22.085 34.374  1.00 88.83  ? 57  PHE A O   1 
ATOM 392  C CB  . PHE A 1 57  ? 0.988   -25.356 34.758  1.00 89.40  ? 57  PHE A CB  1 
ATOM 393  C CG  . PHE A 1 57  ? -0.374  -24.864 34.357  1.00 93.12  ? 57  PHE A CG  1 
ATOM 394  C CD1 . PHE A 1 57  ? -0.653  -24.548 33.037  1.00 97.17  ? 57  PHE A CD1 1 
ATOM 395  C CD2 . PHE A 1 57  ? -1.396  -24.758 35.296  1.00 96.78  ? 57  PHE A CD2 1 
ATOM 396  C CE1 . PHE A 1 57  ? -1.918  -24.118 32.661  1.00 100.23 ? 57  PHE A CE1 1 
ATOM 397  C CE2 . PHE A 1 57  ? -2.664  -24.334 34.920  1.00 101.23 ? 57  PHE A CE2 1 
ATOM 398  C CZ  . PHE A 1 57  ? -2.916  -24.022 33.600  1.00 100.57 ? 57  PHE A CZ  1 
ATOM 399  N N   . THR A 1 58  ? 3.145   -23.383 33.327  1.00 82.79  ? 58  THR A N   1 
ATOM 400  C CA  . THR A 1 58  ? 3.497   -22.404 32.308  1.00 80.98  ? 58  THR A CA  1 
ATOM 401  C C   . THR A 1 58  ? 2.606   -22.579 31.091  1.00 82.24  ? 58  THR A C   1 
ATOM 402  O O   . THR A 1 58  ? 2.411   -23.706 30.626  1.00 80.41  ? 58  THR A O   1 
ATOM 403  C CB  . THR A 1 58  ? 4.983   -22.512 31.974  1.00 83.51  ? 58  THR A CB  1 
ATOM 404  N N   . MET A 1 59  ? 2.051   -21.461 30.580  1.00 79.63  ? 59  MET A N   1 
ATOM 405  C CA  . MET A 1 59  ? 1.228   -21.445 29.358  1.00 79.56  ? 59  MET A CA  1 
ATOM 406  C C   . MET A 1 59  ? 2.128   -21.305 28.128  1.00 76.09  ? 59  MET A C   1 
ATOM 407  O O   . MET A 1 59  ? 3.355   -21.300 28.282  1.00 73.22  ? 59  MET A O   1 
ATOM 408  C CB  . MET A 1 59  ? 0.113   -20.405 29.436  1.00 84.71  ? 59  MET A CB  1 
ATOM 409  C CG  . MET A 1 59  ? -0.768  -20.660 30.649  1.00 90.25  ? 59  MET A CG  1 
ATOM 410  S SD  . MET A 1 59  ? -2.450  -20.015 30.551  1.00 98.58  ? 59  MET A SD  1 
ATOM 411  C CE  . MET A 1 59  ? -2.215  -18.425 31.336  1.00 95.73  ? 59  MET A CE  1 
ATOM 412  N N   . SER A 1 60  ? 1.543   -21.277 26.899  1.00 70.63  ? 60  SER A N   1 
ATOM 413  C CA  . SER A 1 60  ? 2.311   -21.312 25.658  1.00 67.85  ? 60  SER A CA  1 
ATOM 414  C C   . SER A 1 60  ? 3.387   -20.237 25.560  1.00 73.77  ? 60  SER A C   1 
ATOM 415  O O   . SER A 1 60  ? 4.509   -20.564 25.173  1.00 74.66  ? 60  SER A O   1 
ATOM 416  C CB  . SER A 1 60  ? 1.398   -21.293 24.442  1.00 70.33  ? 60  SER A CB  1 
ATOM 417  O OG  . SER A 1 60  ? 0.836   -20.020 24.191  1.00 82.21  ? 60  SER A OG  1 
ATOM 418  N N   . ASP A 1 61  ? 3.080   -18.982 25.942  1.00 70.97  ? 61  ASP A N   1 
ATOM 419  C CA  . ASP A 1 61  ? 4.050   -17.886 25.834  1.00 71.81  ? 61  ASP A CA  1 
ATOM 420  C C   . ASP A 1 61  ? 4.888   -17.713 27.113  1.00 77.67  ? 61  ASP A C   1 
ATOM 421  O O   . ASP A 1 61  ? 5.671   -16.771 27.212  1.00 78.68  ? 61  ASP A O   1 
ATOM 422  C CB  . ASP A 1 61  ? 3.350   -16.571 25.453  1.00 74.85  ? 61  ASP A CB  1 
ATOM 423  C CG  . ASP A 1 61  ? 2.464   -15.982 26.538  1.00 78.23  ? 61  ASP A CG  1 
ATOM 424  O OD1 . ASP A 1 61  ? 1.990   -16.753 27.413  1.00 74.53  ? 61  ASP A OD1 1 
ATOM 425  O OD2 . ASP A 1 61  ? 2.236   -14.760 26.512  1.00 84.37  ? 61  ASP A OD2 1 
ATOM 426  N N   . GLY A 1 62  ? 4.705   -18.618 28.071  1.00 73.66  ? 62  GLY A N   1 
ATOM 427  C CA  . GLY A 1 62  ? 5.463   -18.599 29.311  1.00 72.63  ? 62  GLY A CA  1 
ATOM 428  C C   . GLY A 1 62  ? 4.742   -18.027 30.512  1.00 75.74  ? 62  GLY A C   1 
ATOM 429  O O   . GLY A 1 62  ? 5.295   -18.059 31.617  1.00 74.75  ? 62  GLY A O   1 
ATOM 430  N N   . LYS A 1 63  ? 3.527   -17.465 30.310  1.00 71.96  ? 63  LYS A N   1 
ATOM 431  C CA  . LYS A 1 63  ? 2.726   -16.907 31.393  1.00 71.75  ? 63  LYS A CA  1 
ATOM 432  C C   . LYS A 1 63  ? 2.382   -18.030 32.383  1.00 77.35  ? 63  LYS A C   1 
ATOM 433  O O   . LYS A 1 63  ? 1.978   -19.130 31.979  1.00 75.59  ? 63  LYS A O   1 
ATOM 434  C CB  . LYS A 1 63  ? 1.453   -16.235 30.853  1.00 74.73  ? 63  LYS A CB  1 
ATOM 435  C CG  . LYS A 1 63  ? 0.596   -15.536 31.909  1.00 87.60  ? 63  LYS A CG  1 
ATOM 436  C CD  . LYS A 1 63  ? -0.742  -15.111 31.325  1.00 99.50  ? 63  LYS A CD  1 
ATOM 437  C CE  . LYS A 1 63  ? -1.478  -14.112 32.178  1.00 109.77 ? 63  LYS A CE  1 
ATOM 438  N NZ  . LYS A 1 63  ? -2.451  -13.315 31.376  1.00 115.12 ? 63  LYS A NZ  1 
ATOM 439  N N   . GLU A 1 64  ? 2.602   -17.755 33.672  1.00 76.41  ? 64  GLU A N   1 
ATOM 440  C CA  . GLU A 1 64  ? 2.326   -18.696 34.752  1.00 76.51  ? 64  GLU A CA  1 
ATOM 441  C C   . GLU A 1 64  ? 0.978   -18.399 35.375  1.00 81.03  ? 64  GLU A C   1 
ATOM 442  O O   . GLU A 1 64  ? 0.604   -17.228 35.562  1.00 80.35  ? 64  GLU A O   1 
ATOM 443  C CB  . GLU A 1 64  ? 3.428   -18.668 35.819  1.00 77.97  ? 64  GLU A CB  1 
ATOM 444  C CG  . GLU A 1 64  ? 4.708   -19.351 35.377  1.00 93.19  ? 64  GLU A CG  1 
ATOM 445  C CD  . GLU A 1 64  ? 5.708   -19.683 36.467  1.00 131.27 ? 64  GLU A CD  1 
ATOM 446  O OE1 . GLU A 1 64  ? 5.436   -19.421 37.664  1.00 134.80 ? 64  GLU A OE1 1 
ATOM 447  O OE2 . GLU A 1 64  ? 6.786   -20.205 36.107  1.00 134.52 ? 64  GLU A OE2 1 
ATOM 448  N N   . ILE A 1 65  ? 0.247   -19.476 35.692  1.00 78.09  ? 65  ILE A N   1 
ATOM 449  C CA  . ILE A 1 65  ? -1.077  -19.417 36.300  1.00 78.71  ? 65  ILE A CA  1 
ATOM 450  C C   . ILE A 1 65  ? -1.181  -20.577 37.294  1.00 83.31  ? 65  ILE A C   1 
ATOM 451  O O   . ILE A 1 65  ? -0.684  -21.668 37.001  1.00 82.46  ? 65  ILE A O   1 
ATOM 452  C CB  . ILE A 1 65  ? -2.186  -19.418 35.185  1.00 82.83  ? 65  ILE A CB  1 
ATOM 453  C CG1 . ILE A 1 65  ? -3.556  -18.993 35.724  1.00 85.16  ? 65  ILE A CG1 1 
ATOM 454  C CG2 . ILE A 1 65  ? -2.286  -20.737 34.438  1.00 81.48  ? 65  ILE A CG2 1 
ATOM 455  N N   . THR A 1 66  ? -1.786  -20.350 38.481  1.00 79.75  ? 66  THR A N   1 
ATOM 456  C CA  . THR A 1 66  ? -2.003  -21.448 39.430  1.00 77.33  ? 66  THR A CA  1 
ATOM 457  C C   . THR A 1 66  ? -3.220  -22.223 38.922  1.00 80.18  ? 66  THR A C   1 
ATOM 458  O O   . THR A 1 66  ? -4.032  -21.651 38.196  1.00 80.65  ? 66  THR A O   1 
ATOM 459  C CB  . THR A 1 66  ? -2.251  -20.947 40.867  1.00 83.92  ? 66  THR A CB  1 
ATOM 460  O OG1 . THR A 1 66  ? -3.508  -20.273 40.923  1.00 87.48  ? 66  THR A OG1 1 
ATOM 461  C CG2 . THR A 1 66  ? -1.133  -20.043 41.401  1.00 80.28  ? 66  THR A CG2 1 
ATOM 462  N N   . PHE A 1 67  ? -3.369  -23.500 39.289  1.00 77.06  ? 67  PHE A N   1 
ATOM 463  C CA  . PHE A 1 67  ? -4.556  -24.268 38.894  1.00 78.51  ? 67  PHE A CA  1 
ATOM 464  C C   . PHE A 1 67  ? -5.810  -23.639 39.544  1.00 85.68  ? 67  PHE A C   1 
ATOM 465  O O   . PHE A 1 67  ? -6.870  -23.606 38.911  1.00 88.09  ? 67  PHE A O   1 
ATOM 466  C CB  . PHE A 1 67  ? -4.424  -25.747 39.271  1.00 79.14  ? 67  PHE A CB  1 
ATOM 467  C CG  . PHE A 1 67  ? -3.207  -26.434 38.700  1.00 79.06  ? 67  PHE A CG  1 
ATOM 468  C CD1 . PHE A 1 67  ? -2.019  -26.494 39.422  1.00 79.42  ? 67  PHE A CD1 1 
ATOM 469  C CD2 . PHE A 1 67  ? -3.256  -27.053 37.456  1.00 81.36  ? 67  PHE A CD2 1 
ATOM 470  C CE1 . PHE A 1 67  ? -0.900  -27.153 38.908  1.00 78.83  ? 67  PHE A CE1 1 
ATOM 471  C CE2 . PHE A 1 67  ? -2.137  -27.718 36.944  1.00 82.97  ? 67  PHE A CE2 1 
ATOM 472  C CZ  . PHE A 1 67  ? -0.961  -27.740 37.664  1.00 79.50  ? 67  PHE A CZ  1 
ATOM 473  N N   . LEU A 1 68  ? -5.662  -23.062 40.769  1.00 81.07  ? 68  LEU A N   1 
ATOM 474  C CA  . LEU A 1 68  ? -6.759  -22.362 41.440  1.00 82.33  ? 68  LEU A CA  1 
ATOM 475  C C   . LEU A 1 68  ? -7.290  -21.248 40.529  1.00 89.89  ? 68  LEU A C   1 
ATOM 476  O O   . LEU A 1 68  ? -8.479  -21.236 40.244  1.00 92.52  ? 68  LEU A O   1 
ATOM 477  C CB  . LEU A 1 68  ? -6.350  -21.785 42.809  1.00 81.04  ? 68  LEU A CB  1 
ATOM 478  C CG  . LEU A 1 68  ? -5.870  -22.764 43.898  1.00 83.81  ? 68  LEU A CG  1 
ATOM 479  C CD1 . LEU A 1 68  ? -5.384  -22.002 45.107  1.00 82.77  ? 68  LEU A CD1 1 
ATOM 480  C CD2 . LEU A 1 68  ? -6.950  -23.767 44.325  1.00 85.51  ? 68  LEU A CD2 1 
ATOM 481  N N   . GLU A 1 69  ? -6.401  -20.362 40.025  1.00 86.40  ? 69  GLU A N   1 
ATOM 482  C CA  . GLU A 1 69  ? -6.729  -19.255 39.116  1.00 88.36  ? 69  GLU A CA  1 
ATOM 483  C C   . GLU A 1 69  ? -7.223  -19.764 37.757  1.00 92.07  ? 69  GLU A C   1 
ATOM 484  O O   . GLU A 1 69  ? -8.116  -19.156 37.172  1.00 93.05  ? 69  GLU A O   1 
ATOM 485  C CB  . GLU A 1 69  ? -5.519  -18.329 38.929  1.00 89.21  ? 69  GLU A CB  1 
ATOM 486  N N   . TYR A 1 70  ? -6.667  -20.896 37.282  1.00 87.25  ? 70  TYR A N   1 
ATOM 487  C CA  . TYR A 1 70  ? -7.052  -21.532 36.024  1.00 88.29  ? 70  TYR A CA  1 
ATOM 488  C C   . TYR A 1 70  ? -8.502  -21.978 36.032  1.00 94.44  ? 70  TYR A C   1 
ATOM 489  O O   . TYR A 1 70  ? -9.235  -21.642 35.113  1.00 97.99  ? 70  TYR A O   1 
ATOM 490  C CB  . TYR A 1 70  ? -6.129  -22.729 35.700  1.00 87.24  ? 70  TYR A CB  1 
ATOM 491  C CG  . TYR A 1 70  ? -6.493  -23.452 34.415  1.00 89.27  ? 70  TYR A CG  1 
ATOM 492  C CD1 . TYR A 1 70  ? -6.168  -22.917 33.172  1.00 91.55  ? 70  TYR A CD1 1 
ATOM 493  C CD2 . TYR A 1 70  ? -7.166  -24.671 34.444  1.00 90.17  ? 70  TYR A CD2 1 
ATOM 494  C CE1 . TYR A 1 70  ? -6.481  -23.589 31.990  1.00 93.36  ? 70  TYR A CE1 1 
ATOM 495  C CE2 . TYR A 1 70  ? -7.500  -25.344 33.270  1.00 92.27  ? 70  TYR A CE2 1 
ATOM 496  C CZ  . TYR A 1 70  ? -7.164  -24.793 32.045  1.00 99.35  ? 70  TYR A CZ  1 
ATOM 497  O OH  . TYR A 1 70  ? -7.474  -25.459 30.889  1.00 98.24  ? 70  TYR A OH  1 
ATOM 498  N N   . TYR A 1 71  ? -8.916  -22.738 37.049  1.00 89.61  ? 71  TYR A N   1 
ATOM 499  C CA  . TYR A 1 71  ? -10.276 -23.259 37.112  1.00 90.84  ? 71  TYR A CA  1 
ATOM 500  C C   . TYR A 1 71  ? -11.316 -22.169 37.396  1.00 98.65  ? 71  TYR A C   1 
ATOM 501  O O   . TYR A 1 71  ? -12.405 -22.231 36.828  1.00 101.43 ? 71  TYR A O   1 
ATOM 502  C CB  . TYR A 1 71  ? -10.370 -24.456 38.072  1.00 89.09  ? 71  TYR A CB  1 
ATOM 503  C CG  . TYR A 1 71  ? -9.705  -25.694 37.498  1.00 86.50  ? 71  TYR A CG  1 
ATOM 504  C CD1 . TYR A 1 71  ? -8.390  -26.018 37.820  1.00 84.47  ? 71  TYR A CD1 1 
ATOM 505  C CD2 . TYR A 1 71  ? -10.361 -26.494 36.569  1.00 88.57  ? 71  TYR A CD2 1 
ATOM 506  C CE1 . TYR A 1 71  ? -7.750  -27.119 37.246  1.00 81.36  ? 71  TYR A CE1 1 
ATOM 507  C CE2 . TYR A 1 71  ? -9.741  -27.612 36.009  1.00 88.08  ? 71  TYR A CE2 1 
ATOM 508  C CZ  . TYR A 1 71  ? -8.438  -27.930 36.361  1.00 86.65  ? 71  TYR A CZ  1 
ATOM 509  O OH  . TYR A 1 71  ? -7.823  -29.046 35.834  1.00 84.38  ? 71  TYR A OH  1 
ATOM 510  N N   . SER A 1 72  ? -10.962 -21.138 38.177  1.00 96.26  ? 72  SER A N   1 
ATOM 511  C CA  . SER A 1 72  ? -11.867 -20.022 38.475  1.00 99.51  ? 72  SER A CA  1 
ATOM 512  C C   . SER A 1 72  ? -12.078 -19.133 37.240  1.00 107.09 ? 72  SER A C   1 
ATOM 513  O O   . SER A 1 72  ? -13.226 -18.835 36.903  1.00 110.40 ? 72  SER A O   1 
ATOM 514  C CB  . SER A 1 72  ? -11.376 -19.211 39.674  1.00 100.93 ? 72  SER A CB  1 
ATOM 515  O OG  . SER A 1 72  ? -11.851 -17.875 39.652  1.00 108.92 ? 72  SER A OG  1 
ATOM 516  N N   . LYS A 1 73  ? -10.985 -18.740 36.556  1.00 102.71 ? 73  LYS A N   1 
ATOM 517  C CA  . LYS A 1 73  ? -11.052 -17.875 35.372  1.00 104.66 ? 73  LYS A CA  1 
ATOM 518  C C   . LYS A 1 73  ? -11.647 -18.571 34.154  1.00 111.79 ? 73  LYS A C   1 
ATOM 519  O O   . LYS A 1 73  ? -12.340 -17.916 33.375  1.00 115.82 ? 73  LYS A O   1 
ATOM 520  C CB  . LYS A 1 73  ? -9.672  -17.304 35.016  1.00 104.67 ? 73  LYS A CB  1 
ATOM 521  N N   . ASN A 1 74  ? -11.370 -19.874 33.975  1.00 106.31 ? 74  ASN A N   1 
ATOM 522  C CA  . ASN A 1 74  ? -11.839 -20.632 32.819  1.00 107.67 ? 74  ASN A CA  1 
ATOM 523  C C   . ASN A 1 74  ? -13.229 -21.249 32.959  1.00 114.46 ? 74  ASN A C   1 
ATOM 524  O O   . ASN A 1 74  ? -13.959 -21.283 31.969  1.00 117.22 ? 74  ASN A O   1 
ATOM 525  C CB  . ASN A 1 74  ? -10.847 -21.735 32.464  1.00 106.26 ? 74  ASN A CB  1 
ATOM 526  C CG  . ASN A 1 74  ? -10.007 -21.472 31.238  1.00 133.34 ? 74  ASN A CG  1 
ATOM 527  O OD1 . ASN A 1 74  ? -10.261 -20.569 30.429  1.00 135.54 ? 74  ASN A OD1 1 
ATOM 528  N ND2 . ASN A 1 74  ? -9.018  -22.309 31.035  1.00 119.38 ? 74  ASN A ND2 1 
ATOM 529  N N   . TYR A 1 75  ? -13.594 -21.769 34.147  1.00 110.62 ? 75  TYR A N   1 
ATOM 530  C CA  . TYR A 1 75  ? -14.861 -22.491 34.309  1.00 112.85 ? 75  TYR A CA  1 
ATOM 531  C C   . TYR A 1 75  ? -15.803 -21.951 35.382  1.00 119.41 ? 75  TYR A C   1 
ATOM 532  O O   . TYR A 1 75  ? -16.939 -22.428 35.486  1.00 122.08 ? 75  TYR A O   1 
ATOM 533  C CB  . TYR A 1 75  ? -14.572 -23.974 34.596  1.00 110.94 ? 75  TYR A CB  1 
ATOM 534  C CG  . TYR A 1 75  ? -13.662 -24.639 33.587  1.00 109.81 ? 75  TYR A CG  1 
ATOM 535  C CD1 . TYR A 1 75  ? -12.358 -24.988 33.920  1.00 107.63 ? 75  TYR A CD1 1 
ATOM 536  C CD2 . TYR A 1 75  ? -14.100 -24.903 32.289  1.00 112.66 ? 75  TYR A CD2 1 
ATOM 537  C CE1 . TYR A 1 75  ? -11.517 -25.603 32.995  1.00 107.53 ? 75  TYR A CE1 1 
ATOM 538  C CE2 . TYR A 1 75  ? -13.268 -25.515 31.356  1.00 111.85 ? 75  TYR A CE2 1 
ATOM 539  C CZ  . TYR A 1 75  ? -11.983 -25.875 31.719  1.00 116.35 ? 75  TYR A CZ  1 
ATOM 540  O OH  . TYR A 1 75  ? -11.184 -26.519 30.815  1.00 117.62 ? 75  TYR A OH  1 
ATOM 541  N N   . GLY A 1 76  ? -15.335 -20.987 36.171  1.00 114.83 ? 76  GLY A N   1 
ATOM 542  C CA  . GLY A 1 76  ? -16.117 -20.430 37.270  1.00 116.32 ? 76  GLY A CA  1 
ATOM 543  C C   . GLY A 1 76  ? -16.181 -21.390 38.443  1.00 119.60 ? 76  GLY A C   1 
ATOM 544  O O   . GLY A 1 76  ? -17.090 -21.302 39.275  1.00 122.25 ? 76  GLY A O   1 
ATOM 545  N N   . ILE A 1 77  ? -15.201 -22.319 38.509  1.00 111.92 ? 77  ILE A N   1 
ATOM 546  C CA  . ILE A 1 77  ? -15.072 -23.347 39.538  1.00 109.44 ? 77  ILE A CA  1 
ATOM 547  C C   . ILE A 1 77  ? -14.088 -22.900 40.627  1.00 110.79 ? 77  ILE A C   1 
ATOM 548  O O   . ILE A 1 77  ? -12.946 -22.525 40.336  1.00 107.62 ? 77  ILE A O   1 
ATOM 549  C CB  . ILE A 1 77  ? -14.678 -24.734 38.927  1.00 110.93 ? 77  ILE A CB  1 
ATOM 550  C CG1 . ILE A 1 77  ? -15.750 -25.247 37.944  1.00 114.63 ? 77  ILE A CG1 1 
ATOM 551  C CG2 . ILE A 1 77  ? -14.407 -25.789 40.011  1.00 109.24 ? 77  ILE A CG2 1 
ATOM 552  N N   . THR A 1 78  ? -14.547 -22.969 41.885  1.00 108.19 ? 78  THR A N   1 
ATOM 553  C CA  . THR A 1 78  ? -13.752 -22.681 43.065  1.00 105.54 ? 78  THR A CA  1 
ATOM 554  C C   . THR A 1 78  ? -13.315 -24.035 43.645  1.00 108.13 ? 78  THR A C   1 
ATOM 555  O O   . THR A 1 78  ? -14.153 -24.832 44.074  1.00 109.27 ? 78  THR A O   1 
ATOM 556  C CB  . THR A 1 78  ? -14.526 -21.780 44.047  1.00 115.49 ? 78  THR A CB  1 
ATOM 557  O OG1 . THR A 1 78  ? -14.863 -20.563 43.382  1.00 119.99 ? 78  THR A OG1 1 
ATOM 558  C CG2 . THR A 1 78  ? -13.724 -21.456 45.308  1.00 109.92 ? 78  THR A CG2 1 
ATOM 559  N N   . VAL A 1 79  ? -12.002 -24.303 43.600  1.00 102.69 ? 79  VAL A N   1 
ATOM 560  C CA  . VAL A 1 79  ? -11.387 -25.532 44.107  1.00 101.37 ? 79  VAL A CA  1 
ATOM 561  C C   . VAL A 1 79  ? -11.382 -25.440 45.644  1.00 106.07 ? 79  VAL A C   1 
ATOM 562  O O   . VAL A 1 79  ? -10.782 -24.522 46.207  1.00 105.37 ? 79  VAL A O   1 
ATOM 563  C CB  . VAL A 1 79  ? -9.976  -25.755 43.489  1.00 102.90 ? 79  VAL A CB  1 
ATOM 564  C CG1 . VAL A 1 79  ? -9.328  -27.043 43.999  1.00 101.17 ? 79  VAL A CG1 1 
ATOM 565  C CG2 . VAL A 1 79  ? -10.035 -25.752 41.960  1.00 103.83 ? 79  VAL A CG2 1 
ATOM 566  N N   . LYS A 1 80  ? -12.107 -26.353 46.304  1.00 103.36 ? 80  LYS A N   1 
ATOM 567  C CA  . LYS A 1 80  ? -12.252 -26.383 47.764  1.00 102.59 ? 80  LYS A CA  1 
ATOM 568  C C   . LYS A 1 80  ? -11.016 -26.962 48.483  1.00 102.87 ? 80  LYS A C   1 
ATOM 569  O O   . LYS A 1 80  ? -10.545 -26.346 49.445  1.00 101.93 ? 80  LYS A O   1 
ATOM 570  C CB  . LYS A 1 80  ? -13.524 -27.146 48.166  1.00 107.18 ? 80  LYS A CB  1 
ATOM 571  N N   . GLU A 1 81  ? -10.496 -28.130 48.025  1.00 96.45  ? 81  GLU A N   1 
ATOM 572  C CA  . GLU A 1 81  ? -9.322  -28.792 48.609  1.00 92.53  ? 81  GLU A CA  1 
ATOM 573  C C   . GLU A 1 81  ? -8.027  -28.368 47.887  1.00 92.55  ? 81  GLU A C   1 
ATOM 574  O O   . GLU A 1 81  ? -7.688  -28.916 46.845  1.00 92.76  ? 81  GLU A O   1 
ATOM 575  C CB  . GLU A 1 81  ? -9.502  -30.312 48.608  1.00 94.18  ? 81  GLU A CB  1 
ATOM 576  N N   . GLU A 1 82  ? -7.319  -27.381 48.442  1.00 86.18  ? 82  GLU A N   1 
ATOM 577  C CA  . GLU A 1 82  ? -6.093  -26.825 47.872  1.00 84.68  ? 82  GLU A CA  1 
ATOM 578  C C   . GLU A 1 82  ? -4.835  -27.681 48.149  1.00 86.53  ? 82  GLU A C   1 
ATOM 579  O O   . GLU A 1 82  ? -3.754  -27.303 47.707  1.00 86.70  ? 82  GLU A O   1 
ATOM 580  C CB  . GLU A 1 82  ? -5.871  -25.390 48.391  1.00 86.00  ? 82  GLU A CB  1 
ATOM 581  C CG  . GLU A 1 82  ? -7.025  -24.428 48.155  1.00 98.87  ? 82  GLU A CG  1 
ATOM 582  C CD  . GLU A 1 82  ? -6.821  -22.983 48.581  1.00 129.63 ? 82  GLU A CD  1 
ATOM 583  O OE1 . GLU A 1 82  ? -5.836  -22.686 49.296  1.00 129.50 ? 82  GLU A OE1 1 
ATOM 584  O OE2 . GLU A 1 82  ? -7.671  -22.142 48.205  1.00 129.22 ? 82  GLU A OE2 1 
ATOM 585  N N   . ASP A 1 83  ? -4.966  -28.816 48.860  1.00 81.29  ? 83  ASP A N   1 
ATOM 586  C CA  . ASP A 1 83  ? -3.829  -29.670 49.240  1.00 79.84  ? 83  ASP A CA  1 
ATOM 587  C C   . ASP A 1 83  ? -3.808  -31.043 48.537  1.00 82.48  ? 83  ASP A C   1 
ATOM 588  O O   . ASP A 1 83  ? -2.903  -31.851 48.800  1.00 81.81  ? 83  ASP A O   1 
ATOM 589  C CB  . ASP A 1 83  ? -3.799  -29.856 50.774  1.00 81.28  ? 83  ASP A CB  1 
ATOM 590  N N   . GLN A 1 84  ? -4.784  -31.294 47.634  1.00 78.20  ? 84  GLN A N   1 
ATOM 591  C CA  . GLN A 1 84  ? -4.915  -32.559 46.901  1.00 77.87  ? 84  GLN A CA  1 
ATOM 592  C C   . GLN A 1 84  ? -3.758  -32.785 45.894  1.00 79.27  ? 84  GLN A C   1 
ATOM 593  O O   . GLN A 1 84  ? -3.221  -31.801 45.367  1.00 77.46  ? 84  GLN A O   1 
ATOM 594  C CB  . GLN A 1 84  ? -6.280  -32.620 46.188  1.00 80.68  ? 84  GLN A CB  1 
ATOM 595  C CG  . GLN A 1 84  ? -6.424  -31.648 45.012  1.00 80.83  ? 84  GLN A CG  1 
ATOM 596  C CD  . GLN A 1 84  ? -7.824  -31.556 44.493  1.00 89.59  ? 84  GLN A CD  1 
ATOM 597  O OE1 . GLN A 1 84  ? -8.298  -32.420 43.762  1.00 90.91  ? 84  GLN A OE1 1 
ATOM 598  N NE2 . GLN A 1 84  ? -8.501  -30.472 44.816  1.00 72.71  ? 84  GLN A NE2 1 
ATOM 599  N N   . PRO A 1 85  ? -3.380  -34.059 45.578  1.00 74.71  ? 85  PRO A N   1 
ATOM 600  C CA  . PRO A 1 85  ? -2.336  -34.274 44.549  1.00 74.02  ? 85  PRO A CA  1 
ATOM 601  C C   . PRO A 1 85  ? -2.947  -34.107 43.147  1.00 79.29  ? 85  PRO A C   1 
ATOM 602  O O   . PRO A 1 85  ? -4.127  -33.756 43.015  1.00 79.41  ? 85  PRO A O   1 
ATOM 603  C CB  . PRO A 1 85  ? -1.854  -35.713 44.808  1.00 75.94  ? 85  PRO A CB  1 
ATOM 604  C CG  . PRO A 1 85  ? -3.016  -36.376 45.387  1.00 80.97  ? 85  PRO A CG  1 
ATOM 605  C CD  . PRO A 1 85  ? -3.917  -35.348 46.064  1.00 75.65  ? 85  PRO A CD  1 
ATOM 606  N N   . LEU A 1 86  ? -2.145  -34.329 42.101  1.00 75.55  ? 86  LEU A N   1 
ATOM 607  C CA  . LEU A 1 86  ? -2.630  -34.201 40.735  1.00 75.31  ? 86  LEU A CA  1 
ATOM 608  C C   . LEU A 1 86  ? -2.610  -35.542 40.026  1.00 79.97  ? 86  LEU A C   1 
ATOM 609  O O   . LEU A 1 86  ? -1.703  -36.353 40.238  1.00 78.32  ? 86  LEU A O   1 
ATOM 610  C CB  . LEU A 1 86  ? -1.823  -33.157 39.946  1.00 74.08  ? 86  LEU A CB  1 
ATOM 611  C CG  . LEU A 1 86  ? -1.725  -31.732 40.512  1.00 77.20  ? 86  LEU A CG  1 
ATOM 612  C CD1 . LEU A 1 86  ? -1.054  -30.824 39.529  1.00 76.31  ? 86  LEU A CD1 1 
ATOM 613  C CD2 . LEU A 1 86  ? -3.077  -31.154 40.864  1.00 80.25  ? 86  LEU A CD2 1 
ATOM 614  N N   . LEU A 1 87  ? -3.609  -35.766 39.166  1.00 78.39  ? 87  LEU A N   1 
ATOM 615  C CA  . LEU A 1 87  ? -3.682  -36.985 38.378  1.00 79.11  ? 87  LEU A CA  1 
ATOM 616  C C   . LEU A 1 87  ? -2.966  -36.707 37.053  1.00 83.20  ? 87  LEU A C   1 
ATOM 617  O O   . LEU A 1 87  ? -3.217  -35.677 36.407  1.00 81.58  ? 87  LEU A O   1 
ATOM 618  C CB  . LEU A 1 87  ? -5.158  -37.418 38.142  1.00 80.65  ? 87  LEU A CB  1 
ATOM 619  C CG  . LEU A 1 87  ? -6.093  -37.544 39.348  1.00 83.68  ? 87  LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 87  ? -7.519  -37.811 38.908  1.00 85.38  ? 87  LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 87  ? -5.598  -38.633 40.314  1.00 87.24  ? 87  LEU A CD2 1 
ATOM 622  N N   . ILE A 1 88  ? -2.059  -37.628 36.666  1.00 81.20  ? 88  ILE A N   1 
ATOM 623  C CA  . ILE A 1 88  ? -1.280  -37.546 35.433  1.00 81.30  ? 88  ILE A CA  1 
ATOM 624  C C   . ILE A 1 88  ? -1.820  -38.468 34.352  1.00 90.52  ? 88  ILE A C   1 
ATOM 625  O O   . ILE A 1 88  ? -2.058  -39.658 34.591  1.00 92.79  ? 88  ILE A O   1 
ATOM 626  C CB  . ILE A 1 88  ? 0.223   -37.856 35.688  1.00 82.70  ? 88  ILE A CB  1 
ATOM 627  C CG1 . ILE A 1 88  ? 0.810   -36.958 36.794  1.00 80.05  ? 88  ILE A CG1 1 
ATOM 628  C CG2 . ILE A 1 88  ? 1.059   -37.745 34.416  1.00 83.14  ? 88  ILE A CG2 1 
ATOM 629  N N   . HIS A 1 89  ? -1.890  -37.925 33.141  1.00 88.52  ? 89  HIS A N   1 
ATOM 630  C CA  . HIS A 1 89  ? -2.236  -38.623 31.920  1.00 91.29  ? 89  HIS A CA  1 
ATOM 631  C C   . HIS A 1 89  ? -1.106  -38.309 30.919  1.00 94.68  ? 89  HIS A C   1 
ATOM 632  O O   . HIS A 1 89  ? -0.968  -37.157 30.497  1.00 93.66  ? 89  HIS A O   1 
ATOM 633  C CB  . HIS A 1 89  ? -3.625  -38.199 31.399  1.00 93.83  ? 89  HIS A CB  1 
ATOM 634  C CG  . HIS A 1 89  ? -3.899  -38.680 30.007  1.00 99.64  ? 89  HIS A CG  1 
ATOM 635  N ND1 . HIS A 1 89  ? -3.911  -40.026 29.699  1.00 103.66 ? 89  HIS A ND1 1 
ATOM 636  C CD2 . HIS A 1 89  ? -4.111  -37.969 28.874  1.00 101.22 ? 89  HIS A CD2 1 
ATOM 637  C CE1 . HIS A 1 89  ? -4.123  -40.088 28.396  1.00 104.28 ? 89  HIS A CE1 1 
ATOM 638  N NE2 . HIS A 1 89  ? -4.265  -38.874 27.863  1.00 103.26 ? 89  HIS A NE2 1 
ATOM 639  N N   . ARG A 1 90  ? -0.258  -39.323 30.623  1.00 90.39  ? 90  ARG A N   1 
ATOM 640  C CA  . ARG A 1 90  ? 0.901   -39.251 29.730  1.00 88.57  ? 90  ARG A CA  1 
ATOM 641  C C   . ARG A 1 90  ? 0.520   -39.647 28.276  1.00 95.91  ? 90  ARG A C   1 
ATOM 642  O O   . ARG A 1 90  ? -0.070  -40.716 28.055  1.00 97.03  ? 90  ARG A O   1 
ATOM 643  C CB  . ARG A 1 90  ? 2.074   -40.109 30.261  1.00 83.89  ? 90  ARG A CB  1 
ATOM 644  C CG  . ARG A 1 90  ? 2.638   -39.661 31.612  1.00 81.22  ? 90  ARG A CG  1 
ATOM 645  N N   . PRO A 1 91  ? 0.856   -38.792 27.274  1.00 93.12  ? 91  PRO A N   1 
ATOM 646  C CA  . PRO A 1 91  ? 0.474   -39.101 25.882  1.00 95.19  ? 91  PRO A CA  1 
ATOM 647  C C   . PRO A 1 91  ? 1.428   -40.058 25.171  1.00 102.45 ? 91  PRO A C   1 
ATOM 648  O O   . PRO A 1 91  ? 2.587   -40.205 25.571  1.00 100.67 ? 91  PRO A O   1 
ATOM 649  C CB  . PRO A 1 91  ? 0.416   -37.735 25.223  1.00 95.47  ? 91  PRO A CB  1 
ATOM 650  C CG  . PRO A 1 91  ? 1.416   -36.919 25.984  1.00 97.27  ? 91  PRO A CG  1 
ATOM 651  C CD  . PRO A 1 91  ? 1.533   -37.482 27.370  1.00 91.86  ? 91  PRO A CD  1 
ATOM 652  N N   . SER A 1 92  ? 0.902   -40.708 24.107  1.00 104.01 ? 92  SER A N   1 
ATOM 653  C CA  . SER A 1 92  ? 1.493   -41.780 23.287  1.00 107.02 ? 92  SER A CA  1 
ATOM 654  C C   . SER A 1 92  ? 2.515   -41.370 22.180  1.00 112.98 ? 92  SER A C   1 
ATOM 655  O O   . SER A 1 92  ? 2.865   -42.247 21.369  1.00 117.11 ? 92  SER A O   1 
ATOM 656  C CB  . SER A 1 92  ? 0.386   -42.613 22.644  1.00 112.78 ? 92  SER A CB  1 
ATOM 657  N N   . GLU A 1 93  ? 2.998   -40.094 22.145  1.00 103.76 ? 93  GLU A N   1 
ATOM 658  C CA  . GLU A 1 93  ? 4.040   -39.611 21.213  1.00 102.47 ? 93  GLU A CA  1 
ATOM 659  C C   . GLU A 1 93  ? 4.718   -38.362 21.827  1.00 102.72 ? 93  GLU A C   1 
ATOM 660  O O   . GLU A 1 93  ? 4.783   -37.299 21.215  1.00 100.39 ? 93  GLU A O   1 
ATOM 661  C CB  . GLU A 1 93  ? 3.489   -39.357 19.789  1.00 105.15 ? 93  GLU A CB  1 
ATOM 662  N N   . ARG A 1 94  ? 5.227   -38.537 23.050  1.00 98.96  ? 94  ARG A N   1 
ATOM 663  C CA  . ARG A 1 94  ? 5.775   -37.519 23.948  1.00 96.55  ? 94  ARG A CA  1 
ATOM 664  C C   . ARG A 1 94  ? 7.293   -37.291 23.887  1.00 99.52  ? 94  ARG A C   1 
ATOM 665  O O   . ARG A 1 94  ? 7.740   -36.280 24.435  1.00 97.65  ? 94  ARG A O   1 
ATOM 666  C CB  . ARG A 1 94  ? 5.366   -37.836 25.406  1.00 93.13  ? 94  ARG A CB  1 
ATOM 667  N N   . GLN A 1 95  ? 8.093   -38.217 23.307  1.00 96.62  ? 95  GLN A N   1 
ATOM 668  C CA  . GLN A 1 95  ? 9.553   -38.025 23.247  1.00 96.32  ? 95  GLN A CA  1 
ATOM 669  C C   . GLN A 1 95  ? 10.211  -38.734 22.050  1.00 105.06 ? 95  GLN A C   1 
ATOM 670  O O   . GLN A 1 95  ? 9.546   -39.474 21.314  1.00 106.44 ? 95  GLN A O   1 
ATOM 671  C CB  . GLN A 1 95  ? 10.267  -38.382 24.571  1.00 96.59  ? 95  GLN A CB  1 
ATOM 672  C CG  . GLN A 1 95  ? 10.142  -39.826 25.025  1.00 103.03 ? 95  GLN A CG  1 
ATOM 673  C CD  . GLN A 1 95  ? 11.177  -40.205 26.054  1.00 106.14 ? 95  GLN A CD  1 
ATOM 674  O OE1 . GLN A 1 95  ? 12.343  -39.795 25.989  1.00 96.30  ? 95  GLN A OE1 1 
ATOM 675  N NE2 . GLN A 1 95  ? 10.794  -41.078 26.975  1.00 92.30  ? 95  GLN A NE2 1 
ATOM 676  N N   . ASP A 1 96  ? 11.515  -38.445 21.832  1.00 102.39 ? 96  ASP A N   1 
ATOM 677  C CA  . ASP A 1 96  ? 12.311  -38.991 20.729  1.00 103.78 ? 96  ASP A CA  1 
ATOM 678  C C   . ASP A 1 96  ? 13.796  -39.126 21.103  1.00 107.79 ? 96  ASP A C   1 
ATOM 679  O O   . ASP A 1 96  ? 14.225  -38.574 22.117  1.00 108.76 ? 96  ASP A O   1 
ATOM 680  C CB  . ASP A 1 96  ? 12.157  -38.091 19.482  1.00 105.00 ? 96  ASP A CB  1 
ATOM 681  N N   . ASN A 1 97  ? 14.569  -39.867 20.278  1.00 103.10 ? 97  ASN A N   1 
ATOM 682  C CA  . ASN A 1 97  ? 16.024  -40.047 20.379  1.00 102.83 ? 97  ASN A CA  1 
ATOM 683  C C   . ASN A 1 97  ? 16.577  -40.710 19.101  1.00 105.22 ? 97  ASN A C   1 
ATOM 684  O O   . ASN A 1 97  ? 17.007  -40.016 18.172  1.00 101.32 ? 97  ASN A O   1 
ATOM 685  C CB  . ASN A 1 97  ? 16.442  -40.805 21.631  1.00 100.93 ? 97  ASN A CB  1 
ATOM 686  N N   . LEU A 1 101 ? 11.525  -34.135 24.605  1.00 89.72  ? 101 LEU A N   1 
ATOM 687  C CA  . LEU A 1 101 ? 10.126  -33.931 25.003  1.00 88.73  ? 101 LEU A CA  1 
ATOM 688  C C   . LEU A 1 101 ? 9.361   -33.338 23.834  1.00 92.23  ? 101 LEU A C   1 
ATOM 689  O O   . LEU A 1 101 ? 9.711   -32.258 23.369  1.00 92.33  ? 101 LEU A O   1 
ATOM 690  C CB  . LEU A 1 101 ? 10.008  -33.039 26.255  1.00 87.46  ? 101 LEU A CB  1 
ATOM 691  N N   . LEU A 1 102 ? 8.368   -34.069 23.320  1.00 89.13  ? 102 LEU A N   1 
ATOM 692  C CA  . LEU A 1 102 ? 7.564   -33.708 22.147  1.00 89.26  ? 102 LEU A CA  1 
ATOM 693  C C   . LEU A 1 102 ? 6.130   -33.312 22.498  1.00 95.71  ? 102 LEU A C   1 
ATOM 694  O O   . LEU A 1 102 ? 5.431   -32.710 21.676  1.00 96.56  ? 102 LEU A O   1 
ATOM 695  C CB  . LEU A 1 102 ? 7.547   -34.882 21.156  1.00 90.27  ? 102 LEU A CB  1 
ATOM 696  C CG  . LEU A 1 102 ? 8.889   -35.331 20.580  1.00 94.48  ? 102 LEU A CG  1 
ATOM 697  C CD1 . LEU A 1 102 ? 8.699   -36.555 19.736  1.00 95.66  ? 102 LEU A CD1 1 
ATOM 698  C CD2 . LEU A 1 102 ? 9.579   -34.191 19.756  1.00 92.87  ? 102 LEU A CD2 1 
ATOM 699  N N   . LYS A 1 103 ? 5.688   -33.701 23.699  1.00 92.73  ? 103 LYS A N   1 
ATOM 700  C CA  . LYS A 1 103 ? 4.369   -33.435 24.265  1.00 92.72  ? 103 LYS A CA  1 
ATOM 701  C C   . LYS A 1 103 ? 4.490   -33.409 25.785  1.00 94.27  ? 103 LYS A C   1 
ATOM 702  O O   . LYS A 1 103 ? 5.288   -34.151 26.365  1.00 93.54  ? 103 LYS A O   1 
ATOM 703  C CB  . LYS A 1 103 ? 3.348   -34.522 23.854  1.00 97.29  ? 103 LYS A CB  1 
ATOM 704  C CG  . LYS A 1 103 ? 2.766   -34.390 22.457  1.00 105.58 ? 103 LYS A CG  1 
ATOM 705  N N   . GLY A 1 104 ? 3.699   -32.543 26.401  1.00 89.81  ? 104 GLY A N   1 
ATOM 706  C CA  . GLY A 1 104 ? 3.622   -32.426 27.849  1.00 88.57  ? 104 GLY A CA  1 
ATOM 707  C C   . GLY A 1 104 ? 2.602   -33.398 28.410  1.00 93.23  ? 104 GLY A C   1 
ATOM 708  O O   . GLY A 1 104 ? 1.826   -33.994 27.655  1.00 94.99  ? 104 GLY A O   1 
ATOM 709  N N   . GLU A 1 105 ? 2.596   -33.551 29.737  1.00 88.00  ? 105 GLU A N   1 
ATOM 710  C CA  . GLU A 1 105 ? 1.683   -34.412 30.490  1.00 88.06  ? 105 GLU A CA  1 
ATOM 711  C C   . GLU A 1 105 ? 0.383   -33.668 30.793  1.00 89.24  ? 105 GLU A C   1 
ATOM 712  O O   . GLU A 1 105 ? 0.402   -32.470 31.081  1.00 86.69  ? 105 GLU A O   1 
ATOM 713  C CB  . GLU A 1 105 ? 2.316   -34.832 31.837  1.00 88.90  ? 105 GLU A CB  1 
ATOM 714  C CG  . GLU A 1 105 ? 3.665   -35.532 31.742  1.00 101.84 ? 105 GLU A CG  1 
ATOM 715  C CD  . GLU A 1 105 ? 4.292   -35.956 33.059  1.00 129.34 ? 105 GLU A CD  1 
ATOM 716  O OE1 . GLU A 1 105 ? 4.991   -36.996 33.062  1.00 130.41 ? 105 GLU A OE1 1 
ATOM 717  O OE2 . GLU A 1 105 ? 4.111   -35.246 34.078  1.00 119.33 ? 105 GLU A OE2 1 
ATOM 718  N N   . ILE A 1 106 ? -0.738  -34.396 30.794  1.00 86.81  ? 106 ILE A N   1 
ATOM 719  C CA  . ILE A 1 106 ? -2.055  -33.843 31.137  1.00 86.26  ? 106 ILE A CA  1 
ATOM 720  C C   . ILE A 1 106 ? -2.204  -33.954 32.661  1.00 85.64  ? 106 ILE A C   1 
ATOM 721  O O   . ILE A 1 106 ? -1.664  -34.892 33.250  1.00 83.92  ? 106 ILE A O   1 
ATOM 722  C CB  . ILE A 1 106 ? -3.195  -34.522 30.313  1.00 91.63  ? 106 ILE A CB  1 
ATOM 723  C CG1 . ILE A 1 106 ? -3.108  -34.120 28.819  1.00 91.87  ? 106 ILE A CG1 1 
ATOM 724  C CG2 . ILE A 1 106 ? -4.591  -34.223 30.865  1.00 92.74  ? 106 ILE A CG2 1 
ATOM 725  C CD1 . ILE A 1 106 ? -2.232  -35.043 27.961  1.00 91.93  ? 106 ILE A CD1 1 
ATOM 726  N N   . LEU A 1 107 ? -2.842  -32.944 33.294  1.00 80.14  ? 107 LEU A N   1 
ATOM 727  C CA  . LEU A 1 107 ? -3.001  -32.865 34.748  1.00 77.87  ? 107 LEU A CA  1 
ATOM 728  C C   . LEU A 1 107 ? -4.407  -32.492 35.163  1.00 80.92  ? 107 LEU A C   1 
ATOM 729  O O   . LEU A 1 107 ? -4.890  -31.387 34.902  1.00 79.81  ? 107 LEU A O   1 
ATOM 730  C CB  . LEU A 1 107 ? -1.994  -31.873 35.354  1.00 75.69  ? 107 LEU A CB  1 
ATOM 731  C CG  . LEU A 1 107 ? -0.518  -32.240 35.287  1.00 78.18  ? 107 LEU A CG  1 
ATOM 732  C CD1 . LEU A 1 107 ? 0.309   -31.086 35.761  1.00 76.70  ? 107 LEU A CD1 1 
ATOM 733  C CD2 . LEU A 1 107 ? -0.223  -33.486 36.116  1.00 79.81  ? 107 LEU A CD2 1 
ATOM 734  N N   . LEU A 1 108 ? -5.036  -33.423 35.872  1.00 79.21  ? 108 LEU A N   1 
ATOM 735  C CA  . LEU A 1 108 ? -6.412  -33.346 36.365  1.00 80.12  ? 108 LEU A CA  1 
ATOM 736  C C   . LEU A 1 108 ? -6.480  -33.341 37.879  1.00 83.94  ? 108 LEU A C   1 
ATOM 737  O O   . LEU A 1 108 ? -5.638  -33.952 38.551  1.00 81.23  ? 108 LEU A O   1 
ATOM 738  C CB  . LEU A 1 108 ? -7.220  -34.531 35.821  1.00 82.55  ? 108 LEU A CB  1 
ATOM 739  C CG  . LEU A 1 108 ? -7.044  -34.832 34.326  1.00 88.05  ? 108 LEU A CG  1 
ATOM 740  C CD1 . LEU A 1 108 ? -7.302  -36.294 34.029  1.00 91.12  ? 108 LEU A CD1 1 
ATOM 741  C CD2 . LEU A 1 108 ? -7.854  -33.869 33.465  1.00 89.98  ? 108 LEU A CD2 1 
ATOM 742  N N   . LEU A 1 109 ? -7.516  -32.673 38.412  1.00 83.19  ? 109 LEU A N   1 
ATOM 743  C CA  . LEU A 1 109 ? -7.764  -32.588 39.842  1.00 83.20  ? 109 LEU A CA  1 
ATOM 744  C C   . LEU A 1 109 ? -8.677  -33.717 40.293  1.00 88.86  ? 109 LEU A C   1 
ATOM 745  O O   . LEU A 1 109 ? -9.774  -33.866 39.731  1.00 90.48  ? 109 LEU A O   1 
ATOM 746  C CB  . LEU A 1 109 ? -8.409  -31.241 40.233  1.00 84.00  ? 109 LEU A CB  1 
ATOM 747  C CG  . LEU A 1 109 ? -7.714  -29.938 39.816  1.00 88.60  ? 109 LEU A CG  1 
ATOM 748  C CD1 . LEU A 1 109 ? -8.368  -28.745 40.500  1.00 89.57  ? 109 LEU A CD1 1 
ATOM 749  C CD2 . LEU A 1 109 ? -6.256  -29.950 40.181  1.00 90.35  ? 109 LEU A CD2 1 
ATOM 750  N N   . PRO A 1 110 ? -8.285  -34.465 41.361  1.00 83.54  ? 110 PRO A N   1 
ATOM 751  C CA  . PRO A 1 110 ? -9.156  -35.549 41.855  1.00 84.96  ? 110 PRO A CA  1 
ATOM 752  C C   . PRO A 1 110 ? -10.576 -35.077 42.227  1.00 87.59  ? 110 PRO A C   1 
ATOM 753  O O   . PRO A 1 110 ? -11.528 -35.799 42.010  1.00 88.24  ? 110 PRO A O   1 
ATOM 754  C CB  . PRO A 1 110 ? -8.389  -36.078 43.070  1.00 85.58  ? 110 PRO A CB  1 
ATOM 755  C CG  . PRO A 1 110 ? -6.952  -35.676 42.855  1.00 87.27  ? 110 PRO A CG  1 
ATOM 756  C CD  . PRO A 1 110 ? -7.008  -34.399 42.112  1.00 82.18  ? 110 PRO A CD  1 
ATOM 757  N N   . GLU A 1 111 ? -10.704 -33.845 42.730  1.00 84.42  ? 111 GLU A N   1 
ATOM 758  C CA  . GLU A 1 111 ? -11.941 -33.165 43.126  1.00 86.18  ? 111 GLU A CA  1 
ATOM 759  C C   . GLU A 1 111 ? -12.917 -32.991 41.936  1.00 93.07  ? 111 GLU A C   1 
ATOM 760  O O   . GLU A 1 111 ? -14.130 -32.962 42.158  1.00 95.81  ? 111 GLU A O   1 
ATOM 761  C CB  . GLU A 1 111 ? -11.580 -31.780 43.719  1.00 85.95  ? 111 GLU A CB  1 
ATOM 762  C CG  . GLU A 1 111 ? -12.743 -30.953 44.258  1.00 103.70 ? 111 GLU A CG  1 
ATOM 763  C CD  . GLU A 1 111 ? -12.410 -29.569 44.796  1.00 131.54 ? 111 GLU A CD  1 
ATOM 764  O OE1 . GLU A 1 111 ? -11.335 -29.422 45.420  1.00 132.12 ? 111 GLU A OE1 1 
ATOM 765  O OE2 . GLU A 1 111 ? -13.250 -28.649 44.651  1.00 128.56 ? 111 GLU A OE2 1 
ATOM 766  N N   . LEU A 1 112 ? -12.395 -32.840 40.694  1.00 88.30  ? 112 LEU A N   1 
ATOM 767  C CA  . LEU A 1 112 ? -13.227 -32.632 39.508  1.00 90.89  ? 112 LEU A CA  1 
ATOM 768  C C   . LEU A 1 112 ? -13.342 -33.883 38.625  1.00 95.73  ? 112 LEU A C   1 
ATOM 769  O O   . LEU A 1 112 ? -14.028 -33.840 37.586  1.00 97.63  ? 112 LEU A O   1 
ATOM 770  C CB  . LEU A 1 112 ? -12.683 -31.448 38.684  1.00 90.10  ? 112 LEU A CB  1 
ATOM 771  C CG  . LEU A 1 112 ? -12.366 -30.155 39.451  1.00 93.30  ? 112 LEU A CG  1 
ATOM 772  C CD2 . LEU A 1 112 ? -13.626 -29.521 40.049  1.00 97.58  ? 112 LEU A CD2 1 
ATOM 773  N N   . SER A 1 113 ? -12.684 -34.994 39.045  1.00 90.41  ? 113 SER A N   1 
ATOM 774  C CA  . SER A 1 113 ? -12.638 -36.267 38.322  1.00 92.01  ? 113 SER A CA  1 
ATOM 775  C C   . SER A 1 113 ? -13.530 -37.329 38.968  1.00 98.53  ? 113 SER A C   1 
ATOM 776  O O   . SER A 1 113 ? -13.606 -37.432 40.196  1.00 98.47  ? 113 SER A O   1 
ATOM 777  C CB  . SER A 1 113 ? -11.205 -36.773 38.204  1.00 92.83  ? 113 SER A CB  1 
ATOM 778  O OG  . SER A 1 113 ? -10.317 -35.760 37.755  1.00 98.99  ? 113 SER A OG  1 
ATOM 779  N N   . PHE A 1 114 ? -14.221 -38.105 38.119  1.00 96.87  ? 114 PHE A N   1 
ATOM 780  C CA  . PHE A 1 114 ? -15.153 -39.144 38.539  1.00 99.12  ? 114 PHE A CA  1 
ATOM 781  C C   . PHE A 1 114 ? -14.759 -40.461 37.926  1.00 101.17 ? 114 PHE A C   1 
ATOM 782  O O   . PHE A 1 114 ? -14.565 -40.518 36.727  1.00 101.09 ? 114 PHE A O   1 
ATOM 783  C CB  . PHE A 1 114 ? -16.602 -38.738 38.180  1.00 105.26 ? 114 PHE A CB  1 
ATOM 784  C CG  . PHE A 1 114 ? -17.040 -37.505 38.941  1.00 106.56 ? 114 PHE A CG  1 
ATOM 785  C CD1 . PHE A 1 114 ? -16.689 -36.229 38.496  1.00 107.65 ? 114 PHE A CD1 1 
ATOM 786  C CD2 . PHE A 1 114 ? -17.748 -37.617 40.136  1.00 110.69 ? 114 PHE A CD2 1 
ATOM 787  C CE1 . PHE A 1 114 ? -17.025 -35.091 39.238  1.00 107.63 ? 114 PHE A CE1 1 
ATOM 788  C CE2 . PHE A 1 114 ? -18.103 -36.477 40.868  1.00 112.81 ? 114 PHE A CE2 1 
ATOM 789  C CZ  . PHE A 1 114 ? -17.737 -35.221 40.411  1.00 108.91 ? 114 PHE A CZ  1 
ATOM 790  N N   . MET A 1 115 ? -14.578 -41.504 38.756  1.00 97.86  ? 115 MET A N   1 
ATOM 791  C CA  . MET A 1 115 ? -14.216 -42.882 38.362  1.00 99.82  ? 115 MET A CA  1 
ATOM 792  C C   . MET A 1 115 ? -15.195 -43.512 37.320  1.00 104.97 ? 115 MET A C   1 
ATOM 793  O O   . MET A 1 115 ? -16.374 -43.121 37.259  1.00 105.30 ? 115 MET A O   1 
ATOM 794  C CB  . MET A 1 115 ? -14.178 -43.804 39.613  1.00 102.98 ? 115 MET A CB  1 
ATOM 795  C CG  . MET A 1 115 ? -13.022 -43.537 40.570  1.00 102.11 ? 115 MET A CG  1 
ATOM 796  N N   . THR A 1 116 ? -14.665 -44.491 36.509  1.00 102.33 ? 116 THR A N   1 
ATOM 797  C CA  . THR A 1 116 ? -15.299 -45.345 35.486  1.00 128.90 ? 116 THR A CA  1 
ATOM 798  C C   . THR A 1 116 ? -14.244 -45.802 34.429  1.00 161.96 ? 116 THR A C   1 
ATOM 799  O O   . THR A 1 116 ? -14.171 -45.330 33.282  1.00 112.82 ? 116 THR A O   1 
ATOM 800  C CB  . THR A 1 116 ? -16.564 -44.722 34.877  1.00 142.51 ? 116 THR A CB  1 
ATOM 801  N N   . ASP B 1 3   ? 6.289   -30.824 -19.656 1.00 96.90  ? 3   ASP B N   1 
ATOM 802  C CA  . ASP B 1 3   ? 5.519   -30.477 -18.448 1.00 94.16  ? 3   ASP B CA  1 
ATOM 803  C C   . ASP B 1 3   ? 4.750   -29.161 -18.556 1.00 94.21  ? 3   ASP B C   1 
ATOM 804  O O   . ASP B 1 3   ? 5.140   -28.233 -19.283 1.00 94.27  ? 3   ASP B O   1 
ATOM 805  C CB  . ASP B 1 3   ? 6.401   -30.442 -17.192 1.00 96.96  ? 3   ASP B CB  1 
ATOM 806  N N   . CYS B 1 4   ? 3.648   -29.095 -17.798 1.00 87.01  ? 4   CYS B N   1 
ATOM 807  C CA  . CYS B 1 4   ? 2.719   -27.981 -17.698 1.00 82.17  ? 4   CYS B CA  1 
ATOM 808  C C   . CYS B 1 4   ? 3.431   -26.814 -17.007 1.00 79.90  ? 4   CYS B C   1 
ATOM 809  O O   . CYS B 1 4   ? 4.010   -27.002 -15.937 1.00 79.08  ? 4   CYS B O   1 
ATOM 810  C CB  . CYS B 1 4   ? 1.486   -28.450 -16.928 1.00 82.33  ? 4   CYS B CB  1 
ATOM 811  S SG  . CYS B 1 4   ? 0.320   -27.143 -16.471 1.00 83.58  ? 4   CYS B SG  1 
ATOM 812  N N   . VAL B 1 5   ? 3.415   -25.620 -17.639 1.00 73.47  ? 5   VAL B N   1 
ATOM 813  C CA  . VAL B 1 5   ? 4.074   -24.387 -17.144 1.00 70.29  ? 5   VAL B CA  1 
ATOM 814  C C   . VAL B 1 5   ? 3.691   -24.059 -15.694 1.00 70.79  ? 5   VAL B C   1 
ATOM 815  O O   . VAL B 1 5   ? 4.569   -23.726 -14.894 1.00 70.09  ? 5   VAL B O   1 
ATOM 816  C CB  . VAL B 1 5   ? 3.853   -23.181 -18.095 1.00 71.33  ? 5   VAL B CB  1 
ATOM 817  C CG1 . VAL B 1 5   ? 4.475   -21.896 -17.536 1.00 69.48  ? 5   VAL B CG1 1 
ATOM 818  C CG2 . VAL B 1 5   ? 4.419   -23.487 -19.486 1.00 72.38  ? 5   VAL B CG2 1 
ATOM 819  N N   . LEU B 1 6   ? 2.408   -24.190 -15.342 1.00 68.75  ? 6   LEU B N   1 
ATOM 820  C CA  . LEU B 1 6   ? 1.969   -23.905 -13.963 1.00 68.67  ? 6   LEU B CA  1 
ATOM 821  C C   . LEU B 1 6   ? 2.618   -24.869 -12.965 1.00 73.19  ? 6   LEU B C   1 
ATOM 822  O O   . LEU B 1 6   ? 3.046   -24.421 -11.913 1.00 74.43  ? 6   LEU B O   1 
ATOM 823  C CB  . LEU B 1 6   ? 0.427   -23.895 -13.841 1.00 68.18  ? 6   LEU B CB  1 
ATOM 824  C CG  . LEU B 1 6   ? -0.173  -23.349 -12.545 1.00 72.47  ? 6   LEU B CG  1 
ATOM 825  C CD1 . LEU B 1 6   ? 0.278   -21.914 -12.269 1.00 72.32  ? 6   LEU B CD1 1 
ATOM 826  C CD2 . LEU B 1 6   ? -1.677  -23.465 -12.552 1.00 73.82  ? 6   LEU B CD2 1 
ATOM 827  N N   . ASP B 1 7   ? 2.756   -26.162 -13.319 1.00 70.87  ? 7   ASP B N   1 
ATOM 828  C CA  . ASP B 1 7   ? 3.416   -27.159 -12.459 1.00 71.87  ? 7   ASP B CA  1 
ATOM 829  C C   . ASP B 1 7   ? 4.893   -26.822 -12.253 1.00 76.20  ? 7   ASP B C   1 
ATOM 830  O O   . ASP B 1 7   ? 5.379   -26.911 -11.131 1.00 75.48  ? 7   ASP B O   1 
ATOM 831  C CB  . ASP B 1 7   ? 3.261   -28.580 -13.011 1.00 75.49  ? 7   ASP B CB  1 
ATOM 832  C CG  . ASP B 1 7   ? 1.859   -29.150 -12.955 1.00 86.85  ? 7   ASP B CG  1 
ATOM 833  O OD1 . ASP B 1 7   ? 1.066   -28.704 -12.091 1.00 88.84  ? 7   ASP B OD1 1 
ATOM 834  O OD2 . ASP B 1 7   ? 1.554   -30.047 -13.770 1.00 92.89  ? 7   ASP B OD2 1 
ATOM 835  N N   . VAL B 1 8   ? 5.580   -26.387 -13.329 1.00 74.07  ? 8   VAL B N   1 
ATOM 836  C CA  . VAL B 1 8   ? 6.986   -25.965 -13.330 1.00 75.07  ? 8   VAL B CA  1 
ATOM 837  C C   . VAL B 1 8   ? 7.103   -24.763 -12.392 1.00 77.09  ? 8   VAL B C   1 
ATOM 838  O O   . VAL B 1 8   ? 7.978   -24.769 -11.540 1.00 77.00  ? 8   VAL B O   1 
ATOM 839  C CB  . VAL B 1 8   ? 7.503   -25.649 -14.764 1.00 80.41  ? 8   VAL B CB  1 
ATOM 840  C CG1 . VAL B 1 8   ? 8.919   -25.084 -14.745 1.00 82.08  ? 8   VAL B CG1 1 
ATOM 841  C CG2 . VAL B 1 8   ? 7.435   -26.884 -15.662 1.00 82.22  ? 8   VAL B CG2 1 
ATOM 842  N N   . MET B 1 9   ? 6.177   -23.784 -12.509 1.00 71.81  ? 9   MET B N   1 
ATOM 843  C CA  . MET B 1 9   ? 6.096   -22.590 -11.667 1.00 69.89  ? 9   MET B CA  1 
ATOM 844  C C   . MET B 1 9   ? 5.866   -22.947 -10.196 1.00 72.72  ? 9   MET B C   1 
ATOM 845  O O   . MET B 1 9   ? 6.504   -22.347 -9.332  1.00 71.99  ? 9   MET B O   1 
ATOM 846  C CB  . MET B 1 9   ? 4.978   -21.667 -12.152 1.00 70.70  ? 9   MET B CB  1 
ATOM 847  C CG  . MET B 1 9   ? 5.320   -20.893 -13.407 1.00 76.39  ? 9   MET B CG  1 
ATOM 848  S SD  . MET B 1 9   ? 3.968   -19.738 -13.800 1.00 79.02  ? 9   MET B SD  1 
ATOM 849  C CE  . MET B 1 9   ? 4.646   -18.894 -15.073 1.00 77.59  ? 9   MET B CE  1 
ATOM 850  N N   . HIS B 1 10  ? 4.969   -23.918 -9.906  1.00 70.30  ? 10  HIS B N   1 
ATOM 851  C CA  . HIS B 1 10  ? 4.683   -24.387 -8.534  1.00 70.96  ? 10  HIS B CA  1 
ATOM 852  C C   . HIS B 1 10  ? 5.941   -24.959 -7.856  1.00 72.84  ? 10  HIS B C   1 
ATOM 853  O O   . HIS B 1 10  ? 6.196   -24.676 -6.685  1.00 70.78  ? 10  HIS B O   1 
ATOM 854  C CB  . HIS B 1 10  ? 3.540   -25.435 -8.512  1.00 73.67  ? 10  HIS B CB  1 
ATOM 855  C CG  . HIS B 1 10  ? 2.151   -24.890 -8.751  1.00 76.93  ? 10  HIS B CG  1 
ATOM 856  N ND1 . HIS B 1 10  ? 1.812   -23.569 -8.461  1.00 77.08  ? 10  HIS B ND1 1 
ATOM 857  C CD2 . HIS B 1 10  ? 1.046   -25.527 -9.211  1.00 80.42  ? 10  HIS B CD2 1 
ATOM 858  C CE1 . HIS B 1 10  ? 0.531   -23.446 -8.776  1.00 76.41  ? 10  HIS B CE1 1 
ATOM 859  N NE2 . HIS B 1 10  ? 0.022   -24.596 -9.225  1.00 78.43  ? 10  HIS B NE2 1 
ATOM 860  N N   . ALA B 1 11  ? 6.738   -25.738 -8.621  1.00 70.98  ? 11  ALA B N   1 
ATOM 861  C CA  . ALA B 1 11  ? 7.992   -26.334 -8.169  1.00 72.37  ? 11  ALA B CA  1 
ATOM 862  C C   . ALA B 1 11  ? 9.034   -25.261 -7.873  1.00 75.53  ? 11  ALA B C   1 
ATOM 863  O O   . ALA B 1 11  ? 9.706   -25.374 -6.864  1.00 76.95  ? 11  ALA B O   1 
ATOM 864  C CB  . ALA B 1 11  ? 8.518   -27.318 -9.199  1.00 76.08  ? 11  ALA B CB  1 
ATOM 865  N N   . ILE B 1 12  ? 9.141   -24.206 -8.711  1.00 71.37  ? 12  ILE B N   1 
ATOM 866  C CA  . ILE B 1 12  ? 10.048  -23.072 -8.487  1.00 70.87  ? 12  ILE B CA  1 
ATOM 867  C C   . ILE B 1 12  ? 9.569   -22.287 -7.243  1.00 73.65  ? 12  ILE B C   1 
ATOM 868  O O   . ILE B 1 12  ? 10.404  -21.845 -6.455  1.00 72.77  ? 12  ILE B O   1 
ATOM 869  C CB  . ILE B 1 12  ? 10.218  -22.160 -9.733  1.00 73.41  ? 12  ILE B CB  1 
ATOM 870  C CG1 . ILE B 1 12  ? 10.704  -22.952 -10.955 1.00 76.17  ? 12  ILE B CG1 1 
ATOM 871  C CG2 . ILE B 1 12  ? 11.161  -20.984 -9.462  1.00 73.62  ? 12  ILE B CG2 1 
ATOM 872  N N   . TYR B 1 13  ? 8.239   -22.133 -7.068  1.00 69.79  ? 13  TYR B N   1 
ATOM 873  C CA  . TYR B 1 13  ? 7.651   -21.444 -5.925  1.00 69.12  ? 13  TYR B CA  1 
ATOM 874  C C   . TYR B 1 13  ? 8.060   -22.121 -4.619  1.00 73.07  ? 13  TYR B C   1 
ATOM 875  O O   . TYR B 1 13  ? 8.494   -21.442 -3.676  1.00 72.10  ? 13  TYR B O   1 
ATOM 876  C CB  . TYR B 1 13  ? 6.107   -21.386 -6.038  1.00 70.36  ? 13  TYR B CB  1 
ATOM 877  C CG  . TYR B 1 13  ? 5.463   -20.732 -4.831  1.00 74.07  ? 13  TYR B CG  1 
ATOM 878  C CD1 . TYR B 1 13  ? 5.379   -19.343 -4.725  1.00 76.65  ? 13  TYR B CD1 1 
ATOM 879  C CD2 . TYR B 1 13  ? 4.983   -21.498 -3.767  1.00 74.82  ? 13  TYR B CD2 1 
ATOM 880  C CE1 . TYR B 1 13  ? 4.821   -18.732 -3.598  1.00 78.30  ? 13  TYR B CE1 1 
ATOM 881  C CE2 . TYR B 1 13  ? 4.431   -20.899 -2.633  1.00 75.12  ? 13  TYR B CE2 1 
ATOM 882  C CZ  . TYR B 1 13  ? 4.354   -19.513 -2.552  1.00 85.14  ? 13  TYR B CZ  1 
ATOM 883  O OH  . TYR B 1 13  ? 3.828   -18.905 -1.434  1.00 88.30  ? 13  TYR B OH  1 
ATOM 884  N N   . GLN B 1 14  ? 7.905   -23.462 -4.586  1.00 69.97  ? 14  GLN B N   1 
ATOM 885  C CA  . GLN B 1 14  ? 8.225   -24.325 -3.465  1.00 70.96  ? 14  GLN B CA  1 
ATOM 886  C C   . GLN B 1 14  ? 9.707   -24.231 -3.081  1.00 77.38  ? 14  GLN B C   1 
ATOM 887  O O   . GLN B 1 14  ? 10.011  -24.180 -1.892  1.00 77.62  ? 14  GLN B O   1 
ATOM 888  C CB  . GLN B 1 14  ? 7.823   -25.770 -3.783  1.00 74.39  ? 14  GLN B CB  1 
ATOM 889  C CG  . GLN B 1 14  ? 6.908   -26.402 -2.734  1.00 99.73  ? 14  GLN B CG  1 
ATOM 890  N N   . GLN B 1 15  ? 10.622  -24.184 -4.071  1.00 75.66  ? 15  GLN B N   1 
ATOM 891  C CA  . GLN B 1 15  ? 12.065  -24.059 -3.824  1.00 77.50  ? 15  GLN B CA  1 
ATOM 892  C C   . GLN B 1 15  ? 12.386  -22.690 -3.227  1.00 81.27  ? 15  GLN B C   1 
ATOM 893  O O   . GLN B 1 15  ? 13.219  -22.610 -2.329  1.00 82.97  ? 15  GLN B O   1 
ATOM 894  C CB  . GLN B 1 15  ? 12.885  -24.300 -5.093  1.00 80.92  ? 15  GLN B CB  1 
ATOM 895  C CG  . GLN B 1 15  ? 14.184  -25.025 -4.819  1.00 96.70  ? 15  GLN B CG  1 
ATOM 896  N N   . ASN B 1 16  ? 11.692  -21.628 -3.685  1.00 75.06  ? 16  ASN B N   1 
ATOM 897  C CA  . ASN B 1 16  ? 11.881  -20.266 -3.197  1.00 73.94  ? 16  ASN B CA  1 
ATOM 898  C C   . ASN B 1 16  ? 11.314  -20.080 -1.801  1.00 75.56  ? 16  ASN B C   1 
ATOM 899  O O   . ASN B 1 16  ? 11.855  -19.286 -1.038  1.00 74.81  ? 16  ASN B O   1 
ATOM 900  C CB  . ASN B 1 16  ? 11.281  -19.255 -4.167  1.00 72.75  ? 16  ASN B CB  1 
ATOM 901  C CG  . ASN B 1 16  ? 12.244  -18.902 -5.264  1.00 92.97  ? 16  ASN B CG  1 
ATOM 902  O OD1 . ASN B 1 16  ? 13.008  -17.935 -5.183  1.00 93.57  ? 16  ASN B OD1 1 
ATOM 903  N ND2 . ASN B 1 16  ? 12.274  -19.713 -6.287  1.00 82.02  ? 16  ASN B ND2 1 
ATOM 904  N N   . LYS B 1 17  ? 10.203  -20.788 -1.490  1.00 70.03  ? 17  LYS B N   1 
ATOM 905  C CA  . LYS B 1 17  ? 9.519   -20.768 -0.200  1.00 66.52  ? 17  LYS B CA  1 
ATOM 906  C C   . LYS B 1 17  ? 10.445  -21.377 0.880   1.00 67.80  ? 17  LYS B C   1 
ATOM 907  O O   . LYS B 1 17  ? 10.600  -20.781 1.946   1.00 65.32  ? 17  LYS B O   1 
ATOM 908  C CB  . LYS B 1 17  ? 8.171   -21.515 -0.304  1.00 67.81  ? 17  LYS B CB  1 
ATOM 909  C CG  . LYS B 1 17  ? 7.352   -21.501 0.984   1.00 75.85  ? 17  LYS B CG  1 
ATOM 910  C CD  . LYS B 1 17  ? 6.070   -22.300 0.841   1.00 82.94  ? 17  LYS B CD  1 
ATOM 911  C CE  . LYS B 1 17  ? 5.435   -22.556 2.179   1.00 80.36  ? 17  LYS B CE  1 
ATOM 912  N NZ  . LYS B 1 17  ? 4.021   -22.965 2.027   1.00 84.54  ? 17  LYS B NZ  1 
ATOM 913  N N   . GLU B 1 18  ? 11.079  -22.531 0.571   1.00 64.77  ? 18  GLU B N   1 
ATOM 914  C CA  . GLU B 1 18  ? 12.044  -23.239 1.417   1.00 66.17  ? 18  GLU B CA  1 
ATOM 915  C C   . GLU B 1 18  ? 13.259  -22.345 1.667   1.00 73.80  ? 18  GLU B C   1 
ATOM 916  O O   . GLU B 1 18  ? 13.701  -22.230 2.805   1.00 74.81  ? 18  GLU B O   1 
ATOM 917  C CB  . GLU B 1 18  ? 12.450  -24.569 0.779   1.00 70.24  ? 18  GLU B CB  1 
ATOM 918  N N   . HIS B 1 19  ? 13.742  -21.643 0.630   1.00 72.70  ? 19  HIS B N   1 
ATOM 919  C CA  . HIS B 1 19  ? 14.860  -20.718 0.754   1.00 74.15  ? 19  HIS B CA  1 
ATOM 920  C C   . HIS B 1 19  ? 14.532  -19.587 1.721   1.00 73.21  ? 19  HIS B C   1 
ATOM 921  O O   . HIS B 1 19  ? 15.378  -19.227 2.537   1.00 74.28  ? 19  HIS B O   1 
ATOM 922  C CB  . HIS B 1 19  ? 15.277  -20.154 -0.616  1.00 77.28  ? 19  HIS B CB  1 
ATOM 923  C CG  . HIS B 1 19  ? 16.483  -19.265 -0.532  1.00 83.85  ? 19  HIS B CG  1 
ATOM 924  N ND1 . HIS B 1 19  ? 16.363  -17.926 -0.179  1.00 84.96  ? 19  HIS B ND1 1 
ATOM 925  C CD2 . HIS B 1 19  ? 17.799  -19.570 -0.644  1.00 89.62  ? 19  HIS B CD2 1 
ATOM 926  C CE1 . HIS B 1 19  ? 17.600  -17.455 -0.119  1.00 87.77  ? 19  HIS B CE1 1 
ATOM 927  N NE2 . HIS B 1 19  ? 18.499  -18.410 -0.372  1.00 91.01  ? 19  HIS B NE2 1 
ATOM 928  N N   . PHE B 1 20  ? 13.309  -19.034 1.623   1.00 65.23  ? 20  PHE B N   1 
ATOM 929  C CA  . PHE B 1 20  ? 12.801  -17.957 2.476   1.00 62.91  ? 20  PHE B CA  1 
ATOM 930  C C   . PHE B 1 20  ? 12.772  -18.397 3.949   1.00 67.01  ? 20  PHE B C   1 
ATOM 931  O O   . PHE B 1 20  ? 13.223  -17.660 4.823   1.00 66.75  ? 20  PHE B O   1 
ATOM 932  C CB  . PHE B 1 20  ? 11.397  -17.503 2.007   1.00 61.70  ? 20  PHE B CB  1 
ATOM 933  C CG  . PHE B 1 20  ? 10.502  -16.919 3.085   1.00 60.78  ? 20  PHE B CG  1 
ATOM 934  C CD1 . PHE B 1 20  ? 10.807  -15.703 3.689   1.00 62.68  ? 20  PHE B CD1 1 
ATOM 935  C CD2 . PHE B 1 20  ? 9.371   -17.603 3.521   1.00 61.03  ? 20  PHE B CD2 1 
ATOM 936  C CE1 . PHE B 1 20  ? 9.982   -15.180 4.697   1.00 61.08  ? 20  PHE B CE1 1 
ATOM 937  C CE2 . PHE B 1 20  ? 8.556   -17.082 4.534   1.00 60.48  ? 20  PHE B CE2 1 
ATOM 938  C CZ  . PHE B 1 20  ? 8.856   -15.868 5.097   1.00 58.36  ? 20  PHE B CZ  1 
ATOM 939  N N   . GLN B 1 21  ? 12.213  -19.580 4.202   1.00 62.90  ? 21  GLN B N   1 
ATOM 940  C CA  . GLN B 1 21  ? 12.092  -20.151 5.517   1.00 62.76  ? 21  GLN B CA  1 
ATOM 941  C C   . GLN B 1 21  ? 13.448  -20.434 6.136   1.00 73.92  ? 21  GLN B C   1 
ATOM 942  O O   . GLN B 1 21  ? 13.653  -20.084 7.299   1.00 75.77  ? 21  GLN B O   1 
ATOM 943  C CB  . GLN B 1 21  ? 11.222  -21.409 5.476   1.00 63.21  ? 21  GLN B CB  1 
ATOM 944  C CG  . GLN B 1 21  ? 9.762   -21.086 5.168   1.00 56.57  ? 21  GLN B CG  1 
ATOM 945  C CD  . GLN B 1 21  ? 8.858   -22.296 5.148   1.00 67.35  ? 21  GLN B CD  1 
ATOM 946  O OE1 . GLN B 1 21  ? 9.282   -23.451 5.241   1.00 62.41  ? 21  GLN B OE1 1 
ATOM 947  N NE2 . GLN B 1 21  ? 7.569   -22.048 5.015   1.00 54.57  ? 21  GLN B NE2 1 
ATOM 948  N N   . ASP B 1 22  ? 14.386  -20.990 5.359   1.00 73.84  ? 22  ASP B N   1 
ATOM 949  C CA  . ASP B 1 22  ? 15.739  -21.263 5.833   1.00 77.54  ? 22  ASP B CA  1 
ATOM 950  C C   . ASP B 1 22  ? 16.482  -19.967 6.122   1.00 82.79  ? 22  ASP B C   1 
ATOM 951  O O   . ASP B 1 22  ? 17.224  -19.904 7.099   1.00 85.01  ? 22  ASP B O   1 
ATOM 952  C CB  . ASP B 1 22  ? 16.515  -22.124 4.827   1.00 83.85  ? 22  ASP B CB  1 
ATOM 953  C CG  . ASP B 1 22  ? 15.999  -23.549 4.633   1.00 104.79 ? 22  ASP B CG  1 
ATOM 954  O OD1 . ASP B 1 22  ? 15.104  -23.973 5.406   1.00 103.36 ? 22  ASP B OD1 1 
ATOM 955  O OD2 . ASP B 1 22  ? 16.495  -24.245 3.704   1.00 119.96 ? 22  ASP B OD2 1 
ATOM 956  N N   . GLU B 1 23  ? 16.242  -18.924 5.315   1.00 78.56  ? 23  GLU B N   1 
ATOM 957  C CA  . GLU B 1 23  ? 16.860  -17.604 5.479   1.00 79.06  ? 23  GLU B CA  1 
ATOM 958  C C   . GLU B 1 23  ? 16.419  -16.953 6.797   1.00 81.89  ? 23  GLU B C   1 
ATOM 959  O O   . GLU B 1 23  ? 17.246  -16.354 7.478   1.00 84.43  ? 23  GLU B O   1 
ATOM 960  C CB  . GLU B 1 23  ? 16.524  -16.700 4.274   1.00 79.93  ? 23  GLU B CB  1 
ATOM 961  C CG  . GLU B 1 23  ? 17.561  -15.647 3.964   1.00 89.80  ? 23  GLU B CG  1 
ATOM 962  C CD  . GLU B 1 23  ? 17.239  -14.799 2.749   1.00 102.80 ? 23  GLU B CD  1 
ATOM 963  N N   . CYS B 1 24  ? 15.138  -17.097 7.173   1.00 74.97  ? 24  CYS B N   1 
ATOM 964  C CA  . CYS B 1 24  ? 14.563  -16.522 8.396   1.00 73.05  ? 24  CYS B CA  1 
ATOM 965  C C   . CYS B 1 24  ? 15.025  -17.263 9.635   1.00 79.02  ? 24  CYS B C   1 
ATOM 966  O O   . CYS B 1 24  ? 15.303  -16.649 10.665  1.00 77.51  ? 24  CYS B O   1 
ATOM 967  C CB  . CYS B 1 24  ? 13.040  -16.505 8.312   1.00 70.16  ? 24  CYS B CB  1 
ATOM 968  S SG  . CYS B 1 24  ? 12.382  -15.338 7.105   1.00 72.99  ? 24  CYS B SG  1 
ATOM 969  N N   . THR B 1 25  ? 15.039  -18.598 9.543   1.00 79.27  ? 25  THR B N   1 
ATOM 970  C CA  . THR B 1 25  ? 15.460  -19.503 10.618  1.00 80.52  ? 25  THR B CA  1 
ATOM 971  C C   . THR B 1 25  ? 16.959  -19.254 10.898  1.00 87.58  ? 25  THR B C   1 
ATOM 972  O O   . THR B 1 25  ? 17.307  -19.027 12.059  1.00 87.88  ? 25  THR B O   1 
ATOM 973  C CB  . THR B 1 25  ? 15.056  -20.947 10.264  1.00 81.69  ? 25  THR B CB  1 
ATOM 974  O OG1 . THR B 1 25  ? 13.689  -20.912 9.840   1.00 74.73  ? 25  THR B OG1 1 
ATOM 975  C CG2 . THR B 1 25  ? 15.174  -21.887 11.434  1.00 77.57  ? 25  THR B CG2 1 
ATOM 976  N N   . LYS B 1 26  ? 17.805  -19.154 9.838   1.00 85.95  ? 26  LYS B N   1 
ATOM 977  C CA  . LYS B 1 26  ? 19.235  -18.845 9.976   1.00 89.78  ? 26  LYS B CA  1 
ATOM 978  C C   . LYS B 1 26  ? 19.432  -17.508 10.723  1.00 92.92  ? 26  LYS B C   1 
ATOM 979  O O   . LYS B 1 26  ? 20.206  -17.445 11.687  1.00 95.54  ? 26  LYS B O   1 
ATOM 980  C CB  . LYS B 1 26  ? 19.943  -18.820 8.605   1.00 96.03  ? 26  LYS B CB  1 
ATOM 981  C CG  . LYS B 1 26  ? 21.398  -19.263 8.667   1.00 114.70 ? 26  LYS B CG  1 
ATOM 982  N N   . LEU B 1 27  ? 18.647  -16.489 10.340  1.00 84.96  ? 27  LEU B N   1 
ATOM 983  C CA  . LEU B 1 27  ? 18.668  -15.146 10.907  1.00 83.73  ? 27  LEU B CA  1 
ATOM 984  C C   . LEU B 1 27  ? 18.254  -15.062 12.377  1.00 85.01  ? 27  LEU B C   1 
ATOM 985  O O   . LEU B 1 27  ? 18.845  -14.267 13.108  1.00 86.77  ? 27  LEU B O   1 
ATOM 986  C CB  . LEU B 1 27  ? 17.725  -14.266 10.080  1.00 82.17  ? 27  LEU B CB  1 
ATOM 987  C CG  . LEU B 1 27  ? 17.684  -12.786 10.412  1.00 86.60  ? 27  LEU B CG  1 
ATOM 988  C CD1 . LEU B 1 27  ? 18.434  -12.012 9.377   1.00 89.70  ? 27  LEU B CD1 1 
ATOM 989  C CD2 . LEU B 1 27  ? 16.255  -12.295 10.541  1.00 83.94  ? 27  LEU B CD2 1 
ATOM 990  N N   . LEU B 1 28  ? 17.226  -15.841 12.803  1.00 77.14  ? 28  LEU B N   1 
ATOM 991  C CA  . LEU B 1 28  ? 16.610  -15.766 14.132  1.00 73.37  ? 28  LEU B CA  1 
ATOM 992  C C   . LEU B 1 28  ? 17.127  -16.711 15.217  1.00 74.80  ? 28  LEU B C   1 
ATOM 993  O O   . LEU B 1 28  ? 17.122  -16.330 16.387  1.00 73.38  ? 28  LEU B O   1 
ATOM 994  C CB  . LEU B 1 28  ? 15.113  -15.983 13.978  1.00 71.12  ? 28  LEU B CB  1 
ATOM 995  C CG  . LEU B 1 28  ? 14.291  -14.714 13.762  1.00 75.32  ? 28  LEU B CG  1 
ATOM 996  C CD1 . LEU B 1 28  ? 13.172  -14.948 12.753  1.00 73.46  ? 28  LEU B CD1 1 
ATOM 997  C CD2 . LEU B 1 28  ? 13.751  -14.188 15.094  1.00 77.14  ? 28  LEU B CD2 1 
ATOM 998  N N   . VAL B 1 29  ? 17.495  -17.947 14.857  1.00 71.19  ? 29  VAL B N   1 
ATOM 999  C CA  . VAL B 1 29  ? 17.985  -18.956 15.794  1.00 71.03  ? 29  VAL B CA  1 
ATOM 1000 C C   . VAL B 1 29  ? 19.257  -18.452 16.475  1.00 78.79  ? 29  VAL B C   1 
ATOM 1001 O O   . VAL B 1 29  ? 20.182  -18.011 15.797  1.00 80.25  ? 29  VAL B O   1 
ATOM 1002 C CB  . VAL B 1 29  ? 18.155  -20.334 15.101  1.00 74.98  ? 29  VAL B CB  1 
ATOM 1003 C CG1 . VAL B 1 29  ? 18.878  -21.340 15.985  1.00 76.64  ? 29  VAL B CG1 1 
ATOM 1004 C CG2 . VAL B 1 29  ? 16.807  -20.881 14.664  1.00 72.05  ? 29  VAL B CG2 1 
ATOM 1005 N N   . GLY B 1 30  ? 19.233  -18.449 17.813  1.00 76.71  ? 30  GLY B N   1 
ATOM 1006 C CA  . GLY B 1 30  ? 20.327  -17.984 18.664  1.00 78.27  ? 30  GLY B CA  1 
ATOM 1007 C C   . GLY B 1 30  ? 20.211  -16.537 19.091  1.00 79.81  ? 30  GLY B C   1 
ATOM 1008 O O   . GLY B 1 30  ? 21.007  -16.062 19.909  1.00 79.18  ? 30  GLY B O   1 
ATOM 1009 N N   . ASN B 1 31  ? 19.227  -15.818 18.517  1.00 75.48  ? 31  ASN B N   1 
ATOM 1010 C CA  . ASN B 1 31  ? 18.965  -14.408 18.832  1.00 73.72  ? 31  ASN B CA  1 
ATOM 1011 C C   . ASN B 1 31  ? 18.003  -14.320 19.979  1.00 72.82  ? 31  ASN B C   1 
ATOM 1012 O O   . ASN B 1 31  ? 17.217  -15.252 20.211  1.00 70.45  ? 31  ASN B O   1 
ATOM 1013 C CB  . ASN B 1 31  ? 18.420  -13.643 17.626  1.00 73.20  ? 31  ASN B CB  1 
ATOM 1014 C CG  . ASN B 1 31  ? 19.451  -13.465 16.543  1.00 101.39 ? 31  ASN B CG  1 
ATOM 1015 O OD1 . ASN B 1 31  ? 20.249  -12.518 16.569  1.00 99.43  ? 31  ASN B OD1 1 
ATOM 1016 N ND2 . ASN B 1 31  ? 19.495  -14.405 15.603  1.00 88.03  ? 31  ASN B ND2 1 
ATOM 1017 N N   . ILE B 1 32  ? 18.069  -13.186 20.694  1.00 67.54  ? 32  ILE B N   1 
ATOM 1018 C CA  . ILE B 1 32  ? 17.241  -12.890 21.854  1.00 64.27  ? 32  ILE B CA  1 
ATOM 1019 C C   . ILE B 1 32  ? 16.205  -11.843 21.455  1.00 63.85  ? 32  ILE B C   1 
ATOM 1020 O O   . ILE B 1 32  ? 16.544  -10.801 20.899  1.00 62.80  ? 32  ILE B O   1 
ATOM 1021 C CB  . ILE B 1 32  ? 18.138  -12.503 23.076  1.00 68.49  ? 32  ILE B CB  1 
ATOM 1022 C CG1 . ILE B 1 32  ? 19.016  -13.740 23.476  1.00 70.26  ? 32  ILE B CG1 1 
ATOM 1023 C CG2 . ILE B 1 32  ? 17.314  -11.957 24.254  1.00 65.30  ? 32  ILE B CG2 1 
ATOM 1024 C CD1 . ILE B 1 32  ? 20.122  -13.558 24.498  1.00 79.22  ? 32  ILE B CD1 1 
ATOM 1025 N N   . VAL B 1 33  ? 14.934  -12.170 21.675  1.00 57.76  ? 33  VAL B N   1 
ATOM 1026 C CA  . VAL B 1 33  ? 13.822  -11.290 21.321  1.00 55.62  ? 33  VAL B CA  1 
ATOM 1027 C C   . VAL B 1 33  ? 13.161  -10.811 22.588  1.00 58.83  ? 33  VAL B C   1 
ATOM 1028 O O   . VAL B 1 33  ? 13.313  -11.435 23.640  1.00 57.92  ? 33  VAL B O   1 
ATOM 1029 C CB  . VAL B 1 33  ? 12.768  -11.970 20.363  1.00 56.87  ? 33  VAL B CB  1 
ATOM 1030 C CG1 . VAL B 1 33  ? 13.333  -12.212 18.965  1.00 56.18  ? 33  VAL B CG1 1 
ATOM 1031 C CG2 . VAL B 1 33  ? 12.170  -13.248 20.972  1.00 55.05  ? 33  VAL B CG2 1 
ATOM 1032 N N   . ILE B 1 34  ? 12.378  -9.739  22.469  1.00 55.20  ? 34  ILE B N   1 
ATOM 1033 C CA  . ILE B 1 34  ? 11.595  -9.165  23.548  1.00 54.02  ? 34  ILE B CA  1 
ATOM 1034 C C   . ILE B 1 34  ? 10.137  -9.164  23.092  1.00 57.35  ? 34  ILE B C   1 
ATOM 1035 O O   . ILE B 1 34  ? 9.856   -8.785  21.959  1.00 56.84  ? 34  ILE B O   1 
ATOM 1036 C CB  . ILE B 1 34  ? 12.086  -7.727  23.889  1.00 57.47  ? 34  ILE B CB  1 
ATOM 1037 C CG2 . ILE B 1 34  ? 11.648  -7.302  25.364  1.00 57.85  ? 34  ILE B CG2 1 
ATOM 1038 N N   . THR B 1 35  ? 9.226   -9.644  23.932  1.00 53.53  ? 35  THR B N   1 
ATOM 1039 C CA  . THR B 1 35  ? 7.783   -9.547  23.676  1.00 52.64  ? 35  THR B CA  1 
ATOM 1040 C C   . THR B 1 35  ? 7.417   -8.359  24.521  1.00 58.22  ? 35  THR B C   1 
ATOM 1041 O O   . THR B 1 35  ? 7.477   -8.450  25.751  1.00 58.08  ? 35  THR B O   1 
ATOM 1042 C CB  . THR B 1 35  ? 7.004   -10.807 24.077  1.00 54.66  ? 35  THR B CB  1 
ATOM 1043 O OG1 . THR B 1 35  ? 7.355   -11.187 25.413  1.00 54.42  ? 35  THR B OG1 1 
ATOM 1044 C CG2 . THR B 1 35  ? 7.218   -11.962 23.108  1.00 47.26  ? 35  THR B CG2 1 
ATOM 1045 N N   . ARG B 1 36  ? 7.165   -7.214  23.881  1.00 57.49  ? 36  ARG B N   1 
ATOM 1046 C CA  . ARG B 1 36  ? 6.940   -5.945  24.596  1.00 59.57  ? 36  ARG B CA  1 
ATOM 1047 C C   . ARG B 1 36  ? 5.605   -5.864  25.318  1.00 65.43  ? 36  ARG B C   1 
ATOM 1048 O O   . ARG B 1 36  ? 5.481   -5.020  26.191  1.00 68.46  ? 36  ARG B O   1 
ATOM 1049 C CB  . ARG B 1 36  ? 7.163   -4.708  23.705  1.00 59.18  ? 36  ARG B CB  1 
ATOM 1050 C CG  . ARG B 1 36  ? 8.428   -4.790  22.861  1.00 68.30  ? 36  ARG B CG  1 
ATOM 1051 C CD  . ARG B 1 36  ? 9.039   -3.453  22.490  1.00 78.59  ? 36  ARG B CD  1 
ATOM 1052 N NE  . ARG B 1 36  ? 10.139  -3.138  23.404  1.00 95.12  ? 36  ARG B NE  1 
ATOM 1053 C CZ  . ARG B 1 36  ? 11.421  -3.073  23.053  1.00 99.58  ? 36  ARG B CZ  1 
ATOM 1054 N NH1 . ARG B 1 36  ? 11.780  -3.239  21.784  1.00 74.79  ? 36  ARG B NH1 1 
ATOM 1055 N NH2 . ARG B 1 36  ? 12.350  -2.804  23.964  1.00 83.91  ? 36  ARG B NH2 1 
ATOM 1056 N N   . TYR B 1 37  ? 4.657   -6.785  25.074  1.00 61.13  ? 37  TYR B N   1 
ATOM 1057 C CA  . TYR B 1 37  ? 3.388   -6.754  25.816  1.00 60.79  ? 37  TYR B CA  1 
ATOM 1058 C C   . TYR B 1 37  ? 3.583   -7.080  27.309  1.00 66.58  ? 37  TYR B C   1 
ATOM 1059 O O   . TYR B 1 37  ? 2.839   -6.560  28.136  1.00 68.70  ? 37  TYR B O   1 
ATOM 1060 C CB  . TYR B 1 37  ? 2.290   -7.625  25.166  1.00 59.25  ? 37  TYR B CB  1 
ATOM 1061 C CG  . TYR B 1 37  ? 2.614   -9.097  25.055  1.00 57.13  ? 37  TYR B CG  1 
ATOM 1062 C CD1 . TYR B 1 37  ? 2.212   -9.995  26.037  1.00 58.77  ? 37  TYR B CD1 1 
ATOM 1063 C CD2 . TYR B 1 37  ? 3.253   -9.607  23.932  1.00 55.45  ? 37  TYR B CD2 1 
ATOM 1064 C CE1 . TYR B 1 37  ? 2.502   -11.356 25.937  1.00 56.39  ? 37  TYR B CE1 1 
ATOM 1065 C CE2 . TYR B 1 37  ? 3.492   -10.970 23.793  1.00 55.01  ? 37  TYR B CE2 1 
ATOM 1066 C CZ  . TYR B 1 37  ? 3.143   -11.841 24.814  1.00 63.27  ? 37  TYR B CZ  1 
ATOM 1067 O OH  . TYR B 1 37  ? 3.455   -13.183 24.752  1.00 64.63  ? 37  TYR B OH  1 
ATOM 1068 N N   . ASN B 1 38  ? 4.598   -7.887  27.654  1.00 62.48  ? 38  ASN B N   1 
ATOM 1069 C CA  . ASN B 1 38  ? 4.898   -8.276  29.038  1.00 61.66  ? 38  ASN B CA  1 
ATOM 1070 C C   . ASN B 1 38  ? 6.382   -8.029  29.395  1.00 63.66  ? 38  ASN B C   1 
ATOM 1071 O O   . ASN B 1 38  ? 6.793   -8.331  30.494  1.00 63.75  ? 38  ASN B O   1 
ATOM 1072 C CB  . ASN B 1 38  ? 4.507   -9.755  29.266  1.00 59.44  ? 38  ASN B CB  1 
ATOM 1073 C CG  . ASN B 1 38  ? 5.181   -10.754 28.331  1.00 70.31  ? 38  ASN B CG  1 
ATOM 1074 O OD1 . ASN B 1 38  ? 6.120   -10.442 27.597  1.00 63.22  ? 38  ASN B OD1 1 
ATOM 1075 N ND2 . ASN B 1 38  ? 4.751   -11.998 28.367  1.00 61.83  ? 38  ASN B ND2 1 
ATOM 1076 N N   . ASN B 1 39  ? 7.170   -7.512  28.457  1.00 61.68  ? 39  ASN B N   1 
ATOM 1077 C CA  . ASN B 1 39  ? 8.614   -7.204  28.555  1.00 61.61  ? 39  ASN B CA  1 
ATOM 1078 C C   . ASN B 1 39  ? 9.437   -8.414  29.004  1.00 62.42  ? 39  ASN B C   1 
ATOM 1079 O O   . ASN B 1 39  ? 10.207  -8.341  29.940  1.00 62.05  ? 39  ASN B O   1 
ATOM 1080 C CB  . ASN B 1 39  ? 8.886   -5.965  29.414  1.00 61.84  ? 39  ASN B CB  1 
ATOM 1081 C CG  . ASN B 1 39  ? 8.884   -4.650  28.670  1.00 75.85  ? 39  ASN B CG  1 
ATOM 1082 O OD1 . ASN B 1 39  ? 8.833   -4.566  27.433  1.00 70.03  ? 39  ASN B OD1 1 
ATOM 1083 N ND2 . ASN B 1 39  ? 8.907   -3.588  29.429  1.00 71.15  ? 39  ASN B ND2 1 
ATOM 1084 N N   . ARG B 1 40  ? 9.297   -9.522  28.278  1.00 57.66  ? 40  ARG B N   1 
ATOM 1085 C CA  . ARG B 1 40  ? 9.981   -10.770 28.584  1.00 55.27  ? 40  ARG B CA  1 
ATOM 1086 C C   . ARG B 1 40  ? 10.941  -11.074 27.488  1.00 57.11  ? 40  ARG B C   1 
ATOM 1087 O O   . ARG B 1 40  ? 10.572  -10.949 26.323  1.00 57.95  ? 40  ARG B O   1 
ATOM 1088 C CB  . ARG B 1 40  ? 8.950   -11.916 28.738  1.00 51.97  ? 40  ARG B CB  1 
ATOM 1089 C CG  . ARG B 1 40  ? 8.088   -11.843 30.007  1.00 58.79  ? 40  ARG B CG  1 
ATOM 1090 C CD  . ARG B 1 40  ? 8.859   -12.046 31.315  1.00 72.03  ? 40  ARG B CD  1 
ATOM 1091 N NE  . ARG B 1 40  ? 8.904   -13.452 31.736  1.00 88.53  ? 40  ARG B NE  1 
ATOM 1092 C CZ  . ARG B 1 40  ? 9.856   -14.325 31.401  1.00 102.37 ? 40  ARG B CZ  1 
ATOM 1093 N NH1 . ARG B 1 40  ? 9.795   -15.579 31.833  1.00 84.64  ? 40  ARG B NH1 1 
ATOM 1094 N NH2 . ARG B 1 40  ? 10.875  -13.951 30.630  1.00 86.56  ? 40  ARG B NH2 1 
ATOM 1095 N N   . THR B 1 41  ? 12.159  -11.481 27.843  1.00 52.25  ? 41  THR B N   1 
ATOM 1096 C CA  . THR B 1 41  ? 13.210  -11.802 26.889  1.00 53.20  ? 41  THR B CA  1 
ATOM 1097 C C   . THR B 1 41  ? 13.367  -13.304 26.698  1.00 57.12  ? 41  THR B C   1 
ATOM 1098 O O   . THR B 1 41  ? 13.330  -14.044 27.676  1.00 57.31  ? 41  THR B O   1 
ATOM 1099 C CB  . THR B 1 41  ? 14.576  -11.140 27.240  1.00 64.33  ? 41  THR B CB  1 
ATOM 1100 O OG1 . THR B 1 41  ? 14.861  -11.253 28.633  1.00 64.48  ? 41  THR B OG1 1 
ATOM 1101 C CG2 . THR B 1 41  ? 14.656  -9.716  26.812  1.00 64.19  ? 41  THR B CG2 1 
ATOM 1102 N N   . TYR B 1 42  ? 13.541  -13.757 25.441  1.00 54.45  ? 42  TYR B N   1 
ATOM 1103 C CA  . TYR B 1 42  ? 13.725  -15.181 25.130  1.00 55.85  ? 42  TYR B CA  1 
ATOM 1104 C C   . TYR B 1 42  ? 14.701  -15.380 23.989  1.00 62.03  ? 42  TYR B C   1 
ATOM 1105 O O   . TYR B 1 42  ? 14.606  -14.690 22.977  1.00 62.56  ? 42  TYR B O   1 
ATOM 1106 C CB  . TYR B 1 42  ? 12.396  -15.876 24.746  1.00 56.04  ? 42  TYR B CB  1 
ATOM 1107 C CG  . TYR B 1 42  ? 11.265  -15.745 25.733  1.00 59.61  ? 42  TYR B CG  1 
ATOM 1108 C CD1 . TYR B 1 42  ? 10.324  -14.725 25.613  1.00 62.15  ? 42  TYR B CD1 1 
ATOM 1109 C CD2 . TYR B 1 42  ? 11.121  -16.644 26.788  1.00 62.33  ? 42  TYR B CD2 1 
ATOM 1110 C CE1 . TYR B 1 42  ? 9.251   -14.614 26.509  1.00 63.99  ? 42  TYR B CE1 1 
ATOM 1111 C CE2 . TYR B 1 42  ? 10.065  -16.531 27.703  1.00 63.14  ? 42  TYR B CE2 1 
ATOM 1112 C CZ  . TYR B 1 42  ? 9.122   -15.522 27.546  1.00 72.46  ? 42  TYR B CZ  1 
ATOM 1113 O OH  . TYR B 1 42  ? 8.060   -15.411 28.416  1.00 79.16  ? 42  TYR B OH  1 
ATOM 1114 N N   . ARG B 1 43  ? 15.612  -16.341 24.132  1.00 61.47  ? 43  ARG B N   1 
ATOM 1115 C CA  . ARG B 1 43  ? 16.521  -16.715 23.045  1.00 64.62  ? 43  ARG B CA  1 
ATOM 1116 C C   . ARG B 1 43  ? 15.710  -17.651 22.149  1.00 68.68  ? 43  ARG B C   1 
ATOM 1117 O O   . ARG B 1 43  ? 15.063  -18.574 22.657  1.00 68.87  ? 43  ARG B O   1 
ATOM 1118 C CB  . ARG B 1 43  ? 17.790  -17.419 23.573  1.00 68.30  ? 43  ARG B CB  1 
ATOM 1119 C CG  . ARG B 1 43  ? 18.647  -18.125 22.507  1.00 68.98  ? 43  ARG B CG  1 
ATOM 1120 C CD  . ARG B 1 43  ? 19.395  -19.333 23.067  1.00 81.60  ? 43  ARG B CD  1 
ATOM 1121 N NE  . ARG B 1 43  ? 18.486  -20.293 23.707  1.00 97.66  ? 43  ARG B NE  1 
ATOM 1122 C CZ  . ARG B 1 43  ? 18.539  -20.657 24.988  1.00 110.90 ? 43  ARG B CZ  1 
ATOM 1123 N NH1 . ARG B 1 43  ? 19.490  -20.179 25.783  1.00 101.03 ? 43  ARG B NH1 1 
ATOM 1124 N NH2 . ARG B 1 43  ? 17.652  -21.513 25.479  1.00 90.74  ? 43  ARG B NH2 1 
ATOM 1125 N N   . ILE B 1 44  ? 15.701  -17.383 20.836  1.00 64.23  ? 44  ILE B N   1 
ATOM 1126 C CA  . ILE B 1 44  ? 14.944  -18.183 19.873  1.00 62.99  ? 44  ILE B CA  1 
ATOM 1127 C C   . ILE B 1 44  ? 15.752  -19.444 19.507  1.00 69.50  ? 44  ILE B C   1 
ATOM 1128 O O   . ILE B 1 44  ? 16.927  -19.350 19.143  1.00 70.83  ? 44  ILE B O   1 
ATOM 1129 C CB  . ILE B 1 44  ? 14.520  -17.303 18.660  1.00 64.12  ? 44  ILE B CB  1 
ATOM 1130 C CG1 . ILE B 1 44  ? 13.402  -16.317 19.098  1.00 60.47  ? 44  ILE B CG1 1 
ATOM 1131 C CG2 . ILE B 1 44  ? 14.094  -18.157 17.434  1.00 63.24  ? 44  ILE B CG2 1 
ATOM 1132 N N   . ASP B 1 45  ? 15.123  -20.620 19.647  1.00 66.88  ? 45  ASP B N   1 
ATOM 1133 C CA  . ASP B 1 45  ? 15.793  -21.894 19.416  1.00 70.61  ? 45  ASP B CA  1 
ATOM 1134 C C   . ASP B 1 45  ? 15.375  -22.604 18.122  1.00 77.05  ? 45  ASP B C   1 
ATOM 1135 O O   . ASP B 1 45  ? 16.065  -23.532 17.686  1.00 79.99  ? 45  ASP B O   1 
ATOM 1136 C CB  . ASP B 1 45  ? 15.638  -22.804 20.642  1.00 73.57  ? 45  ASP B CB  1 
ATOM 1137 C CG  . ASP B 1 45  ? 16.385  -22.238 21.827  1.00 82.81  ? 45  ASP B CG  1 
ATOM 1138 O OD1 . ASP B 1 45  ? 15.784  -22.152 22.924  1.00 81.63  ? 45  ASP B OD1 1 
ATOM 1139 O OD2 . ASP B 1 45  ? 17.538  -21.790 21.639  1.00 92.45  ? 45  ASP B OD2 1 
ATOM 1140 N N   . ASP B 1 46  ? 14.295  -22.126 17.484  1.00 71.42  ? 46  ASP B N   1 
ATOM 1141 C CA  . ASP B 1 46  ? 13.747  -22.628 16.227  1.00 71.26  ? 46  ASP B CA  1 
ATOM 1142 C C   . ASP B 1 46  ? 12.533  -21.834 15.790  1.00 71.56  ? 46  ASP B C   1 
ATOM 1143 O O   . ASP B 1 46  ? 12.004  -21.031 16.552  1.00 69.15  ? 46  ASP B O   1 
ATOM 1144 C CB  . ASP B 1 46  ? 13.352  -24.114 16.350  1.00 75.47  ? 46  ASP B CB  1 
ATOM 1145 C CG  . ASP B 1 46  ? 13.817  -24.982 15.198  1.00 92.73  ? 46  ASP B CG  1 
ATOM 1146 O OD1 . ASP B 1 46  ? 14.037  -24.435 14.087  1.00 92.01  ? 46  ASP B OD1 1 
ATOM 1147 O OD2 . ASP B 1 46  ? 13.971  -26.209 15.406  1.00 107.58 ? 46  ASP B OD2 1 
ATOM 1148 N N   . VAL B 1 47  ? 12.083  -22.079 14.547  1.00 67.56  ? 47  VAL B N   1 
ATOM 1149 C CA  . VAL B 1 47  ? 10.876  -21.507 13.966  1.00 64.58  ? 47  VAL B CA  1 
ATOM 1150 C C   . VAL B 1 47  ? 10.007  -22.682 13.496  1.00 67.22  ? 47  VAL B C   1 
ATOM 1151 O O   . VAL B 1 47  ? 10.500  -23.510 12.744  1.00 66.91  ? 47  VAL B O   1 
ATOM 1152 C CB  . VAL B 1 47  ? 11.144  -20.519 12.798  1.00 68.05  ? 47  VAL B CB  1 
ATOM 1153 C CG1 . VAL B 1 47  ? 9.848   -19.825 12.380  1.00 65.99  ? 47  VAL B CG1 1 
ATOM 1154 C CG2 . VAL B 1 47  ? 12.193  -19.472 13.171  1.00 68.31  ? 47  VAL B CG2 1 
ATOM 1155 N N   . ASP B 1 48  ? 8.754   -22.785 13.977  1.00 64.05  ? 48  ASP B N   1 
ATOM 1156 C CA  . ASP B 1 48  ? 7.859   -23.834 13.507  1.00 65.93  ? 48  ASP B CA  1 
ATOM 1157 C C   . ASP B 1 48  ? 7.080   -23.258 12.334  1.00 69.54  ? 48  ASP B C   1 
ATOM 1158 O O   . ASP B 1 48  ? 6.194   -22.417 12.508  1.00 67.21  ? 48  ASP B O   1 
ATOM 1159 C CB  . ASP B 1 48  ? 6.902   -24.369 14.598  1.00 68.89  ? 48  ASP B CB  1 
ATOM 1160 C CG  . ASP B 1 48  ? 6.188   -25.692 14.241  1.00 84.09  ? 48  ASP B CG  1 
ATOM 1161 O OD1 . ASP B 1 48  ? 6.217   -26.094 13.043  1.00 86.17  ? 48  ASP B OD1 1 
ATOM 1162 O OD2 . ASP B 1 48  ? 5.599   -26.321 15.159  1.00 89.53  ? 48  ASP B OD2 1 
ATOM 1163 N N   . TRP B 1 49  ? 7.445   -23.685 11.130  1.00 67.98  ? 49  TRP B N   1 
ATOM 1164 C CA  . TRP B 1 49  ? 6.788   -23.224 9.916   1.00 66.15  ? 49  TRP B CA  1 
ATOM 1165 C C   . TRP B 1 49  ? 5.489   -23.975 9.621   1.00 72.17  ? 49  TRP B C   1 
ATOM 1166 O O   . TRP B 1 49  ? 4.669   -23.500 8.825   1.00 69.92  ? 49  TRP B O   1 
ATOM 1167 C CB  . TRP B 1 49  ? 7.728   -23.337 8.751   1.00 64.34  ? 49  TRP B CB  1 
ATOM 1168 C CG  . TRP B 1 49  ? 8.863   -22.371 8.852   1.00 63.73  ? 49  TRP B CG  1 
ATOM 1169 C CD1 . TRP B 1 49  ? 10.146  -22.667 9.199   1.00 67.94  ? 49  TRP B CD1 1 
ATOM 1170 C CD2 . TRP B 1 49  ? 8.820   -20.944 8.624   1.00 61.08  ? 49  TRP B CD2 1 
ATOM 1171 N NE1 . TRP B 1 49  ? 10.911  -21.528 9.178   1.00 66.20  ? 49  TRP B NE1 1 
ATOM 1172 C CE2 . TRP B 1 49  ? 10.127  -20.458 8.828   1.00 64.97  ? 49  TRP B CE2 1 
ATOM 1173 C CE3 . TRP B 1 49  ? 7.836   -20.050 8.144   1.00 60.68  ? 49  TRP B CE3 1 
ATOM 1174 C CZ2 . TRP B 1 49  ? 10.474  -19.118 8.608   1.00 63.74  ? 49  TRP B CZ2 1 
ATOM 1175 C CZ3 . TRP B 1 49  ? 8.178   -18.709 7.932   1.00 61.74  ? 49  TRP B CZ3 1 
ATOM 1176 C CH2 . TRP B 1 49  ? 9.486   -18.256 8.171   1.00 63.31  ? 49  TRP B CH2 1 
ATOM 1177 N N   . ASN B 1 50  ? 5.270   -25.088 10.323  1.00 72.53  ? 50  ASN B N   1 
ATOM 1178 C CA  . ASN B 1 50  ? 4.074   -25.919 10.182  1.00 75.48  ? 50  ASN B CA  1 
ATOM 1179 C C   . ASN B 1 50  ? 2.947   -25.530 11.159  1.00 80.90  ? 50  ASN B C   1 
ATOM 1180 O O   . ASN B 1 50  ? 1.863   -26.126 11.105  1.00 82.77  ? 50  ASN B O   1 
ATOM 1181 C CB  . ASN B 1 50  ? 4.442   -27.409 10.334  1.00 81.13  ? 50  ASN B CB  1 
ATOM 1182 C CG  . ASN B 1 50  ? 5.502   -27.875 9.355   1.00 90.51  ? 50  ASN B CG  1 
ATOM 1183 O OD1 . ASN B 1 50  ? 5.507   -27.507 8.162   1.00 75.75  ? 50  ASN B OD1 1 
ATOM 1184 N ND2 . ASN B 1 50  ? 6.432   -28.681 9.852   1.00 82.72  ? 50  ASN B ND2 1 
ATOM 1185 N N   . LYS B 1 51  ? 3.197   -24.528 12.029  1.00 75.66  ? 51  LYS B N   1 
ATOM 1186 C CA  . LYS B 1 51  ? 2.211   -24.014 12.977  1.00 74.08  ? 51  LYS B CA  1 
ATOM 1187 C C   . LYS B 1 51  ? 1.911   -22.545 12.661  1.00 70.10  ? 51  LYS B C   1 
ATOM 1188 O O   . LYS B 1 51  ? 2.730   -21.849 12.090  1.00 66.28  ? 51  LYS B O   1 
ATOM 1189 C CB  . LYS B 1 51  ? 2.639   -24.232 14.442  1.00 77.11  ? 51  LYS B CB  1 
ATOM 1190 C CG  . LYS B 1 51  ? 2.277   -25.597 14.979  1.00 80.69  ? 51  LYS B CG  1 
ATOM 1191 N N   . THR B 1 52  ? 0.717   -22.101 13.003  1.00 66.47  ? 52  THR B N   1 
ATOM 1192 C CA  . THR B 1 52  ? 0.203   -20.758 12.730  1.00 63.82  ? 52  THR B CA  1 
ATOM 1193 C C   . THR B 1 52  ? -0.646  -20.270 13.944  1.00 65.81  ? 52  THR B C   1 
ATOM 1194 O O   . THR B 1 52  ? -1.144  -21.118 14.679  1.00 66.79  ? 52  THR B O   1 
ATOM 1195 C CB  . THR B 1 52  ? -0.574  -20.835 11.368  1.00 76.11  ? 52  THR B CB  1 
ATOM 1196 O OG1 . THR B 1 52  ? -0.842  -19.551 10.854  1.00 87.77  ? 52  THR B OG1 1 
ATOM 1197 C CG2 . THR B 1 52  ? -1.871  -21.607 11.450  1.00 75.75  ? 52  THR B CG2 1 
ATOM 1198 N N   . PRO B 1 53  ? -0.890  -18.956 14.170  1.00 61.42  ? 53  PRO B N   1 
ATOM 1199 C CA  . PRO B 1 53  ? -1.755  -18.556 15.299  1.00 62.12  ? 53  PRO B CA  1 
ATOM 1200 C C   . PRO B 1 53  ? -3.172  -19.140 15.244  1.00 67.28  ? 53  PRO B C   1 
ATOM 1201 O O   . PRO B 1 53  ? -3.855  -19.147 16.272  1.00 67.60  ? 53  PRO B O   1 
ATOM 1202 C CB  . PRO B 1 53  ? -1.767  -17.016 15.208  1.00 62.08  ? 53  PRO B CB  1 
ATOM 1203 C CG  . PRO B 1 53  ? -0.537  -16.674 14.478  1.00 63.51  ? 53  PRO B CG  1 
ATOM 1204 C CD  . PRO B 1 53  ? -0.383  -17.758 13.465  1.00 59.88  ? 53  PRO B CD  1 
ATOM 1205 N N   . LYS B 1 54  ? -3.597  -19.640 14.062  1.00 65.94  ? 54  LYS B N   1 
ATOM 1206 C CA  . LYS B 1 54  ? -4.896  -20.307 13.818  1.00 67.80  ? 54  LYS B CA  1 
ATOM 1207 C C   . LYS B 1 54  ? -4.901  -21.652 14.535  1.00 74.98  ? 54  LYS B C   1 
ATOM 1208 O O   . LYS B 1 54  ? -5.971  -22.182 14.842  1.00 79.45  ? 54  LYS B O   1 
ATOM 1209 C CB  . LYS B 1 54  ? -5.157  -20.552 12.309  1.00 67.89  ? 54  LYS B CB  1 
ATOM 1210 C CG  . LYS B 1 54  ? -5.332  -19.318 11.420  1.00 74.23  ? 54  LYS B CG  1 
ATOM 1211 C CD  . LYS B 1 54  ? -5.210  -19.725 9.916   1.00 72.04  ? 54  LYS B CD  1 
ATOM 1212 C CE  . LYS B 1 54  ? -5.229  -18.594 8.909   1.00 92.68  ? 54  LYS B CE  1 
ATOM 1213 N NZ  . LYS B 1 54  ? -6.573  -17.955 8.758   1.00 106.74 ? 54  LYS B NZ  1 
ATOM 1214 N N   . ASP B 1 55  ? -3.708  -22.226 14.767  1.00 70.25  ? 55  ASP B N   1 
ATOM 1215 C CA  . ASP B 1 55  ? -3.571  -23.516 15.433  1.00 72.22  ? 55  ASP B CA  1 
ATOM 1216 C C   . ASP B 1 55  ? -3.836  -23.441 16.923  1.00 77.86  ? 55  ASP B C   1 
ATOM 1217 O O   . ASP B 1 55  ? -3.891  -22.361 17.518  1.00 73.90  ? 55  ASP B O   1 
ATOM 1218 C CB  . ASP B 1 55  ? -2.203  -24.146 15.166  1.00 73.45  ? 55  ASP B CB  1 
ATOM 1219 C CG  . ASP B 1 55  ? -2.016  -24.654 13.751  1.00 89.25  ? 55  ASP B CG  1 
ATOM 1220 O OD1 . ASP B 1 55  ? -2.993  -25.177 13.167  1.00 93.63  ? 55  ASP B OD1 1 
ATOM 1221 O OD2 . ASP B 1 55  ? -0.895  -24.531 13.225  1.00 94.00  ? 55  ASP B OD2 1 
ATOM 1222 N N   . SER B 1 56  ? -4.057  -24.619 17.514  1.00 81.03  ? 56  SER B N   1 
ATOM 1223 C CA  . SER B 1 56  ? -4.378  -24.752 18.916  1.00 83.50  ? 56  SER B CA  1 
ATOM 1224 C C   . SER B 1 56  ? -3.256  -25.377 19.717  1.00 91.66  ? 56  SER B C   1 
ATOM 1225 O O   . SER B 1 56  ? -2.414  -26.089 19.165  1.00 93.58  ? 56  SER B O   1 
ATOM 1226 C CB  . SER B 1 56  ? -5.645  -25.575 19.069  1.00 88.99  ? 56  SER B CB  1 
ATOM 1227 N N   . PHE B 1 57  ? -3.222  -25.069 21.014  1.00 87.77  ? 57  PHE B N   1 
ATOM 1228 C CA  . PHE B 1 57  ? -2.319  -25.682 21.965  1.00 88.11  ? 57  PHE B CA  1 
ATOM 1229 C C   . PHE B 1 57  ? -3.145  -26.207 23.119  1.00 95.07  ? 57  PHE B C   1 
ATOM 1230 O O   . PHE B 1 57  ? -4.223  -25.667 23.406  1.00 95.73  ? 57  PHE B O   1 
ATOM 1231 C CB  . PHE B 1 57  ? -1.199  -24.754 22.419  1.00 86.69  ? 57  PHE B CB  1 
ATOM 1232 C CG  . PHE B 1 57  ? -1.610  -23.549 23.225  1.00 87.06  ? 57  PHE B CG  1 
ATOM 1233 C CD1 . PHE B 1 57  ? -1.585  -23.581 24.616  1.00 91.11  ? 57  PHE B CD1 1 
ATOM 1234 C CD2 . PHE B 1 57  ? -1.946  -22.357 22.595  1.00 86.97  ? 57  PHE B CD2 1 
ATOM 1235 C CE1 . PHE B 1 57  ? -1.933  -22.446 25.364  1.00 91.16  ? 57  PHE B CE1 1 
ATOM 1236 C CE2 . PHE B 1 57  ? -2.273  -21.216 23.340  1.00 89.13  ? 57  PHE B CE2 1 
ATOM 1237 C CZ  . PHE B 1 57  ? -2.265  -21.268 24.721  1.00 88.38  ? 57  PHE B CZ  1 
ATOM 1238 N N   . THR B 1 58  ? -2.666  -27.291 23.744  1.00 92.99  ? 58  THR B N   1 
ATOM 1239 C CA  . THR B 1 58  ? -3.371  -27.951 24.835  1.00 95.49  ? 58  THR B CA  1 
ATOM 1240 C C   . THR B 1 58  ? -2.944  -27.360 26.161  1.00 95.89  ? 58  THR B C   1 
ATOM 1241 O O   . THR B 1 58  ? -1.752  -27.208 26.398  1.00 93.81  ? 58  THR B O   1 
ATOM 1242 C CB  . THR B 1 58  ? -3.137  -29.459 24.730  1.00 101.42 ? 58  THR B CB  1 
ATOM 1243 O OG1 . THR B 1 58  ? -3.418  -29.872 23.386  1.00 98.54  ? 58  THR B OG1 1 
ATOM 1244 C CG2 . THR B 1 58  ? -3.983  -30.253 25.694  1.00 100.56 ? 58  THR B CG2 1 
ATOM 1245 N N   . MET B 1 59  ? -3.917  -27.032 27.026  1.00 93.33  ? 59  MET B N   1 
ATOM 1246 C CA  . MET B 1 59  ? -3.670  -26.515 28.375  1.00 91.38  ? 59  MET B CA  1 
ATOM 1247 C C   . MET B 1 59  ? -3.520  -27.696 29.356  1.00 93.59  ? 59  MET B C   1 
ATOM 1248 O O   . MET B 1 59  ? -3.473  -28.840 28.898  1.00 93.43  ? 59  MET B O   1 
ATOM 1249 C CB  . MET B 1 59  ? -4.728  -25.481 28.773  1.00 94.92  ? 59  MET B CB  1 
ATOM 1250 C CG  . MET B 1 59  ? -4.755  -24.320 27.778  1.00 96.99  ? 59  MET B CG  1 
ATOM 1251 S SD  . MET B 1 59  ? -5.352  -22.716 28.354  1.00 101.94 ? 59  MET B SD  1 
ATOM 1252 C CE  . MET B 1 59  ? -7.089  -22.885 27.913  1.00 102.58 ? 59  MET B CE  1 
ATOM 1253 N N   . SER B 1 60  ? -3.354  -27.429 30.684  1.00 89.59  ? 60  SER B N   1 
ATOM 1254 C CA  . SER B 1 60  ? -3.045  -28.442 31.691  1.00 92.53  ? 60  SER B CA  1 
ATOM 1255 C C   . SER B 1 60  ? -4.017  -29.622 31.741  1.00 103.23 ? 60  SER B C   1 
ATOM 1256 O O   . SER B 1 60  ? -3.566  -30.775 31.746  1.00 105.22 ? 60  SER B O   1 
ATOM 1257 C CB  . SER B 1 60  ? -2.907  -27.813 33.075  1.00 97.00  ? 60  SER B CB  1 
ATOM 1258 O OG  . SER B 1 60  ? -4.161  -27.477 33.648  1.00 111.25 ? 60  SER B OG  1 
ATOM 1259 N N   . ASP B 1 61  ? -5.336  -29.350 31.849  1.00 102.93 ? 61  ASP B N   1 
ATOM 1260 C CA  . ASP B 1 61  ? -6.346  -30.414 31.941  1.00 108.59 ? 61  ASP B CA  1 
ATOM 1261 C C   . ASP B 1 61  ? -6.612  -31.062 30.581  1.00 111.98 ? 61  ASP B C   1 
ATOM 1262 O O   . ASP B 1 61  ? -7.045  -32.209 30.535  1.00 117.57 ? 61  ASP B O   1 
ATOM 1263 C CB  . ASP B 1 61  ? -7.657  -29.902 32.579  1.00 113.25 ? 61  ASP B CB  1 
ATOM 1264 C CG  . ASP B 1 61  ? -8.360  -28.770 31.840  1.00 118.34 ? 61  ASP B CG  1 
ATOM 1265 O OD1 . ASP B 1 61  ? -7.681  -28.049 31.065  1.00 112.23 ? 61  ASP B OD1 1 
ATOM 1266 O OD2 . ASP B 1 61  ? -9.573  -28.559 32.091  1.00 124.73 ? 61  ASP B OD2 1 
ATOM 1267 N N   . GLY B 1 62  ? -6.307  -30.355 29.503  1.00 101.67 ? 62  GLY B N   1 
ATOM 1268 C CA  . GLY B 1 62  ? -6.515  -30.861 28.152  1.00 101.87 ? 62  GLY B CA  1 
ATOM 1269 C C   . GLY B 1 62  ? -7.242  -29.892 27.235  1.00 103.81 ? 62  GLY B C   1 
ATOM 1270 O O   . GLY B 1 62  ? -7.309  -30.117 26.023  1.00 102.06 ? 62  GLY B O   1 
ATOM 1271 N N   . LYS B 1 63  ? -7.774  -28.794 27.805  1.00 100.69 ? 63  LYS B N   1 
ATOM 1272 C CA  . LYS B 1 63  ? -8.533  -27.776 27.082  1.00 99.74  ? 63  LYS B CA  1 
ATOM 1273 C C   . LYS B 1 63  ? -7.674  -27.161 25.996  1.00 101.67 ? 63  LYS B C   1 
ATOM 1274 O O   . LYS B 1 63  ? -6.523  -26.789 26.235  1.00 98.19  ? 63  LYS B O   1 
ATOM 1275 C CB  . LYS B 1 63  ? -9.076  -26.689 28.041  1.00 101.94 ? 63  LYS B CB  1 
ATOM 1276 C CG  . LYS B 1 63  ? -10.030 -25.681 27.383  1.00 113.06 ? 63  LYS B CG  1 
ATOM 1277 C CD  . LYS B 1 63  ? -10.314 -24.488 28.291  1.00 121.01 ? 63  LYS B CD  1 
ATOM 1278 C CE  . LYS B 1 63  ? -11.435 -23.614 27.787  1.00 131.61 ? 63  LYS B CE  1 
ATOM 1279 N N   . GLU B 1 64  ? -8.230  -27.093 24.793  1.00 100.48 ? 64  GLU B N   1 
ATOM 1280 C CA  . GLU B 1 64  ? -7.558  -26.519 23.632  1.00 95.87  ? 64  GLU B CA  1 
ATOM 1281 C C   . GLU B 1 64  ? -8.023  -25.085 23.411  1.00 97.37  ? 64  GLU B C   1 
ATOM 1282 O O   . GLU B 1 64  ? -9.204  -24.771 23.563  1.00 98.99  ? 64  GLU B O   1 
ATOM 1283 C CB  . GLU B 1 64  ? -7.807  -27.372 22.377  1.00 98.73  ? 64  GLU B CB  1 
ATOM 1284 C CG  . GLU B 1 64  ? -7.018  -28.672 22.346  1.00 114.18 ? 64  GLU B CG  1 
ATOM 1285 C CD  . GLU B 1 64  ? -6.925  -29.348 20.992  1.00 140.51 ? 64  GLU B CD  1 
ATOM 1286 O OE1 . GLU B 1 64  ? -7.636  -30.358 20.788  1.00 147.52 ? 64  GLU B OE1 1 
ATOM 1287 O OE2 . GLU B 1 64  ? -6.125  -28.887 20.144  1.00 132.50 ? 64  GLU B OE2 1 
ATOM 1288 N N   . ILE B 1 65  ? -7.087  -24.220 23.044  1.00 90.28  ? 65  ILE B N   1 
ATOM 1289 C CA  . ILE B 1 65  ? -7.342  -22.811 22.756  1.00 88.35  ? 65  ILE B CA  1 
ATOM 1290 C C   . ILE B 1 65  ? -6.470  -22.418 21.548  1.00 89.15  ? 65  ILE B C   1 
ATOM 1291 O O   . ILE B 1 65  ? -5.322  -22.875 21.465  1.00 90.09  ? 65  ILE B O   1 
ATOM 1292 C CB  . ILE B 1 65  ? -7.083  -21.930 24.045  1.00 91.32  ? 65  ILE B CB  1 
ATOM 1293 C CG1 . ILE B 1 65  ? -7.614  -20.479 23.879  1.00 91.16  ? 65  ILE B CG1 1 
ATOM 1294 C CG2 . ILE B 1 65  ? -5.617  -21.910 24.475  1.00 88.40  ? 65  ILE B CG2 1 
ATOM 1295 C CD1 . ILE B 1 65  ? -7.560  -19.556 25.176  1.00 93.02  ? 65  ILE B CD1 1 
ATOM 1296 N N   . THR B 1 66  ? -6.997  -21.603 20.603  1.00 80.35  ? 66  THR B N   1 
ATOM 1297 C CA  . THR B 1 66  ? -6.156  -21.131 19.503  1.00 75.64  ? 66  THR B CA  1 
ATOM 1298 C C   . THR B 1 66  ? -5.260  -20.009 20.045  1.00 75.06  ? 66  THR B C   1 
ATOM 1299 O O   . THR B 1 66  ? -5.609  -19.367 21.052  1.00 75.07  ? 66  THR B O   1 
ATOM 1300 C CB  . THR B 1 66  ? -6.966  -20.614 18.287  1.00 79.44  ? 66  THR B CB  1 
ATOM 1301 O OG1 . THR B 1 66  ? -7.559  -19.360 18.622  1.00 78.48  ? 66  THR B OG1 1 
ATOM 1302 C CG2 . THR B 1 66  ? -8.012  -21.615 17.773  1.00 75.45  ? 66  THR B CG2 1 
ATOM 1303 N N   . PHE B 1 67  ? -4.130  -19.760 19.370  1.00 67.85  ? 67  PHE B N   1 
ATOM 1304 C CA  . PHE B 1 67  ? -3.244  -18.677 19.791  1.00 66.37  ? 67  PHE B CA  1 
ATOM 1305 C C   . PHE B 1 67  ? -3.960  -17.332 19.654  1.00 71.27  ? 67  PHE B C   1 
ATOM 1306 O O   . PHE B 1 67  ? -3.778  -16.467 20.504  1.00 69.63  ? 67  PHE B O   1 
ATOM 1307 C CB  . PHE B 1 67  ? -1.934  -18.683 19.013  1.00 66.12  ? 67  PHE B CB  1 
ATOM 1308 C CG  . PHE B 1 67  ? -1.111  -19.925 19.234  1.00 67.78  ? 67  PHE B CG  1 
ATOM 1309 C CD1 . PHE B 1 67  ? -1.217  -21.013 18.366  1.00 71.43  ? 67  PHE B CD1 1 
ATOM 1310 C CD2 . PHE B 1 67  ? -0.176  -19.987 20.270  1.00 66.81  ? 67  PHE B CD2 1 
ATOM 1311 C CE1 . PHE B 1 67  ? -0.430  -22.151 18.557  1.00 72.27  ? 67  PHE B CE1 1 
ATOM 1312 C CE2 . PHE B 1 67  ? 0.610   -21.123 20.460  1.00 69.73  ? 67  PHE B CE2 1 
ATOM 1313 C CZ  . PHE B 1 67  ? 0.468   -22.202 19.616  1.00 69.92  ? 67  PHE B CZ  1 
ATOM 1314 N N   . LEU B 1 68  ? -4.861  -17.210 18.641  1.00 70.27  ? 68  LEU B N   1 
ATOM 1315 C CA  . LEU B 1 68  ? -5.691  -16.023 18.393  1.00 70.58  ? 68  LEU B CA  1 
ATOM 1316 C C   . LEU B 1 68  ? -6.541  -15.711 19.614  1.00 75.62  ? 68  LEU B C   1 
ATOM 1317 O O   . LEU B 1 68  ? -6.484  -14.580 20.107  1.00 76.16  ? 68  LEU B O   1 
ATOM 1318 C CB  . LEU B 1 68  ? -6.600  -16.197 17.148  1.00 71.60  ? 68  LEU B CB  1 
ATOM 1319 C CG  . LEU B 1 68  ? -5.939  -16.415 15.781  1.00 75.28  ? 68  LEU B CG  1 
ATOM 1320 C CD1 . LEU B 1 68  ? -6.980  -16.669 14.721  1.00 76.72  ? 68  LEU B CD1 1 
ATOM 1321 C CD2 . LEU B 1 68  ? -5.090  -15.204 15.347  1.00 77.37  ? 68  LEU B CD2 1 
ATOM 1322 N N   . GLU B 1 69  ? -7.286  -16.731 20.129  1.00 73.62  ? 69  GLU B N   1 
ATOM 1323 C CA  . GLU B 1 69  ? -8.158  -16.621 21.306  1.00 76.20  ? 69  GLU B CA  1 
ATOM 1324 C C   . GLU B 1 69  ? -7.341  -16.323 22.569  1.00 76.70  ? 69  GLU B C   1 
ATOM 1325 O O   . GLU B 1 69  ? -7.784  -15.554 23.425  1.00 77.59  ? 69  GLU B O   1 
ATOM 1326 C CB  . GLU B 1 69  ? -8.965  -17.919 21.516  1.00 81.40  ? 69  GLU B CB  1 
ATOM 1327 C CG  . GLU B 1 69  ? -9.919  -18.302 20.392  1.00 96.54  ? 69  GLU B CG  1 
ATOM 1328 C CD  . GLU B 1 69  ? -10.676 -19.617 20.545  1.00 118.60 ? 69  GLU B CD  1 
ATOM 1329 O OE1 . GLU B 1 69  ? -10.490 -20.321 21.567  1.00 96.00  ? 69  GLU B OE1 1 
ATOM 1330 O OE2 . GLU B 1 69  ? -11.472 -19.933 19.631  1.00 120.84 ? 69  GLU B OE2 1 
ATOM 1331 N N   . TYR B 1 70  ? -6.157  -16.954 22.685  1.00 69.22  ? 70  TYR B N   1 
ATOM 1332 C CA  . TYR B 1 70  ? -5.254  -16.796 23.815  1.00 67.52  ? 70  TYR B CA  1 
ATOM 1333 C C   . TYR B 1 70  ? -4.806  -15.337 23.987  1.00 69.63  ? 70  TYR B C   1 
ATOM 1334 O O   . TYR B 1 70  ? -4.919  -14.804 25.080  1.00 68.21  ? 70  TYR B O   1 
ATOM 1335 C CB  . TYR B 1 70  ? -4.033  -17.728 23.669  1.00 66.88  ? 70  TYR B CB  1 
ATOM 1336 C CG  . TYR B 1 70  ? -3.050  -17.595 24.809  1.00 68.00  ? 70  TYR B CG  1 
ATOM 1337 C CD1 . TYR B 1 70  ? -3.298  -18.191 26.045  1.00 71.53  ? 70  TYR B CD1 1 
ATOM 1338 C CD2 . TYR B 1 70  ? -1.867  -16.870 24.656  1.00 66.34  ? 70  TYR B CD2 1 
ATOM 1339 C CE1 . TYR B 1 70  ? -2.403  -18.059 27.107  1.00 69.91  ? 70  TYR B CE1 1 
ATOM 1340 C CE2 . TYR B 1 70  ? -0.958  -16.742 25.708  1.00 66.54  ? 70  TYR B CE2 1 
ATOM 1341 C CZ  . TYR B 1 70  ? -1.239  -17.327 26.939  1.00 72.84  ? 70  TYR B CZ  1 
ATOM 1342 O OH  . TYR B 1 70  ? -0.369  -17.192 27.996  1.00 68.36  ? 70  TYR B OH  1 
ATOM 1343 N N   . TYR B 1 71  ? -4.302  -14.696 22.916  1.00 66.11  ? 71  TYR B N   1 
ATOM 1344 C CA  . TYR B 1 71  ? -3.805  -13.324 23.026  1.00 65.48  ? 71  TYR B CA  1 
ATOM 1345 C C   . TYR B 1 71  ? -4.915  -12.282 23.201  1.00 72.05  ? 71  TYR B C   1 
ATOM 1346 O O   . TYR B 1 71  ? -4.717  -11.316 23.942  1.00 71.23  ? 71  TYR B O   1 
ATOM 1347 C CB  . TYR B 1 71  ? -2.861  -12.986 21.872  1.00 65.03  ? 71  TYR B CB  1 
ATOM 1348 C CG  . TYR B 1 71  ? -1.533  -13.710 22.015  1.00 66.85  ? 71  TYR B CG  1 
ATOM 1349 C CD1 . TYR B 1 71  ? -1.302  -14.919 21.367  1.00 68.77  ? 71  TYR B CD1 1 
ATOM 1350 C CD2 . TYR B 1 71  ? -0.542  -13.234 22.871  1.00 66.59  ? 71  TYR B CD2 1 
ATOM 1351 C CE1 . TYR B 1 71  ? -0.108  -15.618 21.535  1.00 68.06  ? 71  TYR B CE1 1 
ATOM 1352 C CE2 . TYR B 1 71  ? 0.659   -13.925 23.040  1.00 66.28  ? 71  TYR B CE2 1 
ATOM 1353 C CZ  . TYR B 1 71  ? 0.878   -15.104 22.353  1.00 73.27  ? 71  TYR B CZ  1 
ATOM 1354 O OH  . TYR B 1 71  ? 2.056   -15.788 22.487  1.00 75.81  ? 71  TYR B OH  1 
ATOM 1355 N N   . SER B 1 72  ? -6.089  -12.510 22.597  1.00 71.81  ? 72  SER B N   1 
ATOM 1356 C CA  . SER B 1 72  ? -7.231  -11.610 22.752  1.00 74.42  ? 72  SER B CA  1 
ATOM 1357 C C   . SER B 1 72  ? -7.804  -11.687 24.179  1.00 80.83  ? 72  SER B C   1 
ATOM 1358 O O   . SER B 1 72  ? -7.998  -10.644 24.804  1.00 81.48  ? 72  SER B O   1 
ATOM 1359 C CB  . SER B 1 72  ? -8.302  -11.898 21.699  1.00 76.89  ? 72  SER B CB  1 
ATOM 1360 N N   . LYS B 1 73  ? -8.034  -12.916 24.704  1.00 79.83  ? 73  LYS B N   1 
ATOM 1361 C CA  . LYS B 1 73  ? -8.602  -13.115 26.051  1.00 82.85  ? 73  LYS B CA  1 
ATOM 1362 C C   . LYS B 1 73  ? -7.646  -12.736 27.180  1.00 86.73  ? 73  LYS B C   1 
ATOM 1363 O O   . LYS B 1 73  ? -8.111  -12.234 28.212  1.00 90.58  ? 73  LYS B O   1 
ATOM 1364 C CB  . LYS B 1 73  ? -9.085  -14.558 26.253  1.00 86.78  ? 73  LYS B CB  1 
ATOM 1365 N N   . ASN B 1 74  ? -6.329  -12.987 27.016  1.00 78.99  ? 74  ASN B N   1 
ATOM 1366 C CA  . ASN B 1 74  ? -5.353  -12.722 28.077  1.00 77.94  ? 74  ASN B CA  1 
ATOM 1367 C C   . ASN B 1 74  ? -4.722  -11.335 28.067  1.00 79.61  ? 74  ASN B C   1 
ATOM 1368 O O   . ASN B 1 74  ? -4.365  -10.849 29.143  1.00 80.20  ? 74  ASN B O   1 
ATOM 1369 C CB  . ASN B 1 74  ? -4.237  -13.753 28.064  1.00 80.99  ? 74  ASN B CB  1 
ATOM 1370 C CG  . ASN B 1 74  ? -4.663  -15.083 28.623  1.00 109.14 ? 74  ASN B CG  1 
ATOM 1371 O OD1 . ASN B 1 74  ? -5.243  -15.939 27.940  1.00 96.25  ? 74  ASN B OD1 1 
ATOM 1372 N ND2 . ASN B 1 74  ? -4.388  -15.276 29.901  1.00 109.00 ? 74  ASN B ND2 1 
ATOM 1373 N N   . TYR B 1 75  ? -4.539  -10.711 26.889  1.00 72.25  ? 75  TYR B N   1 
ATOM 1374 C CA  . TYR B 1 75  ? -3.853  -9.413  26.834  1.00 70.11  ? 75  TYR B CA  1 
ATOM 1375 C C   . TYR B 1 75  ? -4.632  -8.296  26.138  1.00 74.17  ? 75  TYR B C   1 
ATOM 1376 O O   . TYR B 1 75  ? -4.184  -7.145  26.172  1.00 74.15  ? 75  TYR B O   1 
ATOM 1377 C CB  . TYR B 1 75  ? -2.483  -9.578  26.140  1.00 67.80  ? 75  TYR B CB  1 
ATOM 1378 C CG  . TYR B 1 75  ? -1.597  -10.635 26.758  1.00 66.06  ? 75  TYR B CG  1 
ATOM 1379 C CD1 . TYR B 1 75  ? -1.402  -11.863 26.131  1.00 66.36  ? 75  TYR B CD1 1 
ATOM 1380 C CD2 . TYR B 1 75  ? -0.974  -10.421 27.988  1.00 65.98  ? 75  TYR B CD2 1 
ATOM 1381 C CE1 . TYR B 1 75  ? -0.605  -12.855 26.712  1.00 66.56  ? 75  TYR B CE1 1 
ATOM 1382 C CE2 . TYR B 1 75  ? -0.165  -11.399 28.570  1.00 65.51  ? 75  TYR B CE2 1 
ATOM 1383 C CZ  . TYR B 1 75  ? 0.015   -12.616 27.930  1.00 72.57  ? 75  TYR B CZ  1 
ATOM 1384 O OH  . TYR B 1 75  ? 0.825   -13.576 28.488  1.00 73.97  ? 75  TYR B OH  1 
ATOM 1385 N N   . GLY B 1 76  ? -5.758  -8.633  25.508  1.00 69.24  ? 76  GLY B N   1 
ATOM 1386 C CA  . GLY B 1 76  ? -6.541  -7.667  24.756  1.00 70.26  ? 76  GLY B CA  1 
ATOM 1387 C C   . GLY B 1 76  ? -5.882  -7.315  23.435  1.00 72.96  ? 76  GLY B C   1 
ATOM 1388 O O   . GLY B 1 76  ? -6.179  -6.261  22.861  1.00 73.78  ? 76  GLY B O   1 
ATOM 1389 N N   . ILE B 1 77  ? -4.992  -8.216  22.942  1.00 66.62  ? 77  ILE B N   1 
ATOM 1390 C CA  . ILE B 1 77  ? -4.247  -8.093  21.691  1.00 64.54  ? 77  ILE B CA  1 
ATOM 1391 C C   . ILE B 1 77  ? -4.948  -8.859  20.562  1.00 70.38  ? 77  ILE B C   1 
ATOM 1392 O O   . ILE B 1 77  ? -5.226  -10.057 20.697  1.00 69.86  ? 77  ILE B O   1 
ATOM 1393 C CB  . ILE B 1 77  ? -2.768  -8.565  21.860  1.00 64.80  ? 77  ILE B CB  1 
ATOM 1394 C CG1 . ILE B 1 77  ? -2.019  -7.705  22.905  1.00 65.38  ? 77  ILE B CG1 1 
ATOM 1395 C CG2 . ILE B 1 77  ? -2.014  -8.562  20.490  1.00 63.19  ? 77  ILE B CG2 1 
ATOM 1396 C CD1 . ILE B 1 77  ? -0.655  -8.271  23.312  1.00 69.89  ? 77  ILE B CD1 1 
ATOM 1397 N N   . THR B 1 78  ? -5.204  -8.165  19.446  1.00 68.06  ? 78  THR B N   1 
ATOM 1398 C CA  . THR B 1 78  ? -5.796  -8.770  18.257  1.00 68.78  ? 78  THR B CA  1 
ATOM 1399 C C   . THR B 1 78  ? -4.647  -9.058  17.282  1.00 71.03  ? 78  THR B C   1 
ATOM 1400 O O   . THR B 1 78  ? -3.973  -8.131  16.839  1.00 69.90  ? 78  THR B O   1 
ATOM 1401 C CB  . THR B 1 78  ? -6.907  -7.860  17.678  1.00 77.65  ? 78  THR B CB  1 
ATOM 1402 O OG1 . THR B 1 78  ? -7.916  -7.688  18.668  1.00 81.23  ? 78  THR B OG1 1 
ATOM 1403 C CG2 . THR B 1 78  ? -7.531  -8.411  16.409  1.00 71.62  ? 78  THR B CG2 1 
ATOM 1404 N N   . VAL B 1 79  ? -4.395  -10.343 17.008  1.00 68.18  ? 79  VAL B N   1 
ATOM 1405 C CA  . VAL B 1 79  ? -3.344  -10.808 16.095  1.00 67.08  ? 79  VAL B CA  1 
ATOM 1406 C C   . VAL B 1 79  ? -3.846  -10.569 14.673  1.00 73.94  ? 79  VAL B C   1 
ATOM 1407 O O   . VAL B 1 79  ? -4.866  -11.149 14.269  1.00 75.65  ? 79  VAL B O   1 
ATOM 1408 C CB  . VAL B 1 79  ? -2.966  -12.297 16.361  1.00 70.09  ? 79  VAL B CB  1 
ATOM 1409 C CG1 . VAL B 1 79  ? -1.876  -12.788 15.409  1.00 67.68  ? 79  VAL B CG1 1 
ATOM 1410 C CG2 . VAL B 1 79  ? -2.557  -12.509 17.821  1.00 69.81  ? 79  VAL B CG2 1 
ATOM 1411 N N   . LYS B 1 80  ? -3.157  -9.664  13.947  1.00 71.35  ? 80  LYS B N   1 
ATOM 1412 C CA  . LYS B 1 80  ? -3.502  -9.243  12.587  1.00 72.06  ? 80  LYS B CA  1 
ATOM 1413 C C   . LYS B 1 80  ? -3.127  -10.284 11.533  1.00 76.00  ? 80  LYS B C   1 
ATOM 1414 O O   . LYS B 1 80  ? -3.974  -10.594 10.687  1.00 77.22  ? 80  LYS B O   1 
ATOM 1415 C CB  . LYS B 1 80  ? -2.865  -7.883  12.267  1.00 75.15  ? 80  LYS B CB  1 
ATOM 1416 N N   . GLU B 1 81  ? -1.872  -10.829 11.579  1.00 70.15  ? 81  GLU B N   1 
ATOM 1417 C CA  . GLU B 1 81  ? -1.372  -11.810 10.610  1.00 67.48  ? 81  GLU B CA  1 
ATOM 1418 C C   . GLU B 1 81  ? -1.597  -13.239 11.123  1.00 73.25  ? 81  GLU B C   1 
ATOM 1419 O O   . GLU B 1 81  ? -0.833  -13.755 11.945  1.00 73.76  ? 81  GLU B O   1 
ATOM 1420 C CB  . GLU B 1 81  ? 0.106   -11.538 10.280  1.00 67.53  ? 81  GLU B CB  1 
ATOM 1421 N N   . GLU B 1 82  ? -2.668  -13.875 10.638  1.00 69.31  ? 82  GLU B N   1 
ATOM 1422 C CA  . GLU B 1 82  ? -3.068  -15.227 11.043  1.00 67.95  ? 82  GLU B CA  1 
ATOM 1423 C C   . GLU B 1 82  ? -2.290  -16.342 10.311  1.00 70.67  ? 82  GLU B C   1 
ATOM 1424 O O   . GLU B 1 82  ? -2.544  -17.514 10.574  1.00 71.91  ? 82  GLU B O   1 
ATOM 1425 C CB  . GLU B 1 82  ? -4.588  -15.431 10.842  1.00 70.07  ? 82  GLU B CB  1 
ATOM 1426 C CG  . GLU B 1 82  ? -5.482  -14.407 11.527  1.00 78.48  ? 82  GLU B CG  1 
ATOM 1427 C CD  . GLU B 1 82  ? -6.977  -14.676 11.409  1.00 99.93  ? 82  GLU B CD  1 
ATOM 1428 O OE1 . GLU B 1 82  ? -7.764  -13.705 11.491  1.00 87.45  ? 82  GLU B OE1 1 
ATOM 1429 O OE2 . GLU B 1 82  ? -7.366  -15.855 11.220  1.00 90.97  ? 82  GLU B OE2 1 
ATOM 1430 N N   . ASP B 1 83  ? -1.348  -15.989 9.430   1.00 66.19  ? 83  ASP B N   1 
ATOM 1431 C CA  . ASP B 1 83  ? -0.581  -16.960 8.632   1.00 66.48  ? 83  ASP B CA  1 
ATOM 1432 C C   . ASP B 1 83  ? 0.918   -17.022 8.972   1.00 70.35  ? 83  ASP B C   1 
ATOM 1433 O O   . ASP B 1 83  ? 1.657   -17.797 8.339   1.00 73.95  ? 83  ASP B O   1 
ATOM 1434 C CB  . ASP B 1 83  ? -0.750  -16.686 7.124   1.00 67.33  ? 83  ASP B CB  1 
ATOM 1435 N N   . GLN B 1 84  ? 1.355   -16.249 9.975   1.00 60.68  ? 84  GLN B N   1 
ATOM 1436 C CA  . GLN B 1 84  ? 2.746   -16.200 10.433  1.00 57.07  ? 84  GLN B CA  1 
ATOM 1437 C C   . GLN B 1 84  ? 3.197   -17.526 11.112  1.00 55.61  ? 84  GLN B C   1 
ATOM 1438 O O   . GLN B 1 84  ? 2.367   -18.241 11.656  1.00 55.64  ? 84  GLN B O   1 
ATOM 1439 C CB  . GLN B 1 84  ? 2.954   -14.989 11.380  1.00 57.42  ? 84  GLN B CB  1 
ATOM 1440 C CG  . GLN B 1 84  ? 2.301   -15.142 12.756  1.00 60.25  ? 84  GLN B CG  1 
ATOM 1441 C CD  . GLN B 1 84  ? 2.337   -13.888 13.562  1.00 62.11  ? 84  GLN B CD  1 
ATOM 1442 O OE1 . GLN B 1 84  ? 3.346   -13.517 14.153  1.00 59.10  ? 84  GLN B OE1 1 
ATOM 1443 N NE2 . GLN B 1 84  ? 1.223   -13.217 13.623  1.00 55.24  ? 84  GLN B NE2 1 
ATOM 1444 N N   . PRO B 1 85  ? 4.486   -17.875 11.119  1.00 49.68  ? 85  PRO B N   1 
ATOM 1445 C CA  . PRO B 1 85  ? 4.902   -19.083 11.842  1.00 51.09  ? 85  PRO B CA  1 
ATOM 1446 C C   . PRO B 1 85  ? 5.050   -18.807 13.363  1.00 60.93  ? 85  PRO B C   1 
ATOM 1447 O O   . PRO B 1 85  ? 4.738   -17.712 13.831  1.00 61.13  ? 85  PRO B O   1 
ATOM 1448 C CB  . PRO B 1 85  ? 6.249   -19.375 11.219  1.00 53.64  ? 85  PRO B CB  1 
ATOM 1449 C CG  . PRO B 1 85  ? 6.813   -18.014 10.913  1.00 58.01  ? 85  PRO B CG  1 
ATOM 1450 C CD  . PRO B 1 85  ? 5.638   -17.156 10.540  1.00 52.07  ? 85  PRO B CD  1 
ATOM 1451 N N   . LEU B 1 86  ? 5.546   -19.783 14.128  1.00 58.78  ? 86  LEU B N   1 
ATOM 1452 C CA  . LEU B 1 86  ? 5.750   -19.610 15.563  1.00 59.63  ? 86  LEU B CA  1 
ATOM 1453 C C   . LEU B 1 86  ? 7.211   -19.700 15.925  1.00 63.04  ? 86  LEU B C   1 
ATOM 1454 O O   . LEU B 1 86  ? 7.926   -20.527 15.366  1.00 65.60  ? 86  LEU B O   1 
ATOM 1455 C CB  . LEU B 1 86  ? 4.943   -20.653 16.378  1.00 61.83  ? 86  LEU B CB  1 
ATOM 1456 C CG  . LEU B 1 86  ? 3.432   -20.714 16.121  1.00 67.42  ? 86  LEU B CG  1 
ATOM 1457 C CD1 . LEU B 1 86  ? 2.807   -21.614 17.083  1.00 69.98  ? 86  LEU B CD1 1 
ATOM 1458 C CD2 . LEU B 1 86  ? 2.779   -19.327 16.188  1.00 69.71  ? 86  LEU B CD2 1 
ATOM 1459 N N   . LEU B 1 87  ? 7.656   -18.864 16.865  1.00 56.56  ? 87  LEU B N   1 
ATOM 1460 C CA  . LEU B 1 87  ? 9.037   -18.870 17.334  1.00 54.82  ? 87  LEU B CA  1 
ATOM 1461 C C   . LEU B 1 87  ? 9.101   -19.789 18.535  1.00 58.99  ? 87  LEU B C   1 
ATOM 1462 O O   . LEU B 1 87  ? 8.258   -19.703 19.437  1.00 56.49  ? 87  LEU B O   1 
ATOM 1463 C CB  . LEU B 1 87  ? 9.522   -17.450 17.709  1.00 53.91  ? 87  LEU B CB  1 
ATOM 1464 C CG  . LEU B 1 87  ? 9.358   -16.302 16.697  1.00 54.97  ? 87  LEU B CG  1 
ATOM 1465 C CD1 . LEU B 1 87  ? 9.777   -14.998 17.305  1.00 52.25  ? 87  LEU B CD1 1 
ATOM 1466 C CD2 . LEU B 1 87  ? 10.136  -16.566 15.403  1.00 55.82  ? 87  LEU B CD2 1 
ATOM 1467 N N   . ILE B 1 88  ? 10.087  -20.697 18.539  1.00 58.31  ? 88  ILE B N   1 
ATOM 1468 C CA  . ILE B 1 88  ? 10.283  -21.681 19.601  1.00 57.70  ? 88  ILE B CA  1 
ATOM 1469 C C   . ILE B 1 88  ? 11.465  -21.300 20.511  1.00 61.41  ? 88  ILE B C   1 
ATOM 1470 O O   . ILE B 1 88  ? 12.575  -21.046 20.039  1.00 61.10  ? 88  ILE B O   1 
ATOM 1471 C CB  . ILE B 1 88  ? 10.481  -23.107 19.000  1.00 63.22  ? 88  ILE B CB  1 
ATOM 1472 C CG1 . ILE B 1 88  ? 9.327   -23.535 18.029  1.00 63.85  ? 88  ILE B CG1 1 
ATOM 1473 C CG2 . ILE B 1 88  ? 10.682  -24.142 20.107  1.00 64.16  ? 88  ILE B CG2 1 
ATOM 1474 N N   . HIS B 1 89  ? 11.235  -21.322 21.829  1.00 58.28  ? 89  HIS B N   1 
ATOM 1475 C CA  . HIS B 1 89  ? 12.259  -21.135 22.847  1.00 58.62  ? 89  HIS B CA  1 
ATOM 1476 C C   . HIS B 1 89  ? 12.250  -22.409 23.688  1.00 66.46  ? 89  HIS B C   1 
ATOM 1477 O O   . HIS B 1 89  ? 11.195  -22.818 24.172  1.00 65.92  ? 89  HIS B O   1 
ATOM 1478 C CB  . HIS B 1 89  ? 12.007  -19.884 23.715  1.00 57.23  ? 89  HIS B CB  1 
ATOM 1479 C CG  . HIS B 1 89  ? 12.806  -19.857 24.983  1.00 61.28  ? 89  HIS B CG  1 
ATOM 1480 N ND1 . HIS B 1 89  ? 14.181  -19.674 24.970  1.00 64.00  ? 89  HIS B ND1 1 
ATOM 1481 C CD2 . HIS B 1 89  ? 12.398  -19.999 26.269  1.00 62.79  ? 89  HIS B CD2 1 
ATOM 1482 C CE1 . HIS B 1 89  ? 14.556  -19.686 26.243  1.00 63.33  ? 89  HIS B CE1 1 
ATOM 1483 N NE2 . HIS B 1 89  ? 13.517  -19.870 27.060  1.00 62.91  ? 89  HIS B NE2 1 
ATOM 1484 N N   . ARG B 1 90  ? 13.395  -23.087 23.763  1.00 67.51  ? 90  ARG B N   1 
ATOM 1485 C CA  . ARG B 1 90  ? 13.525  -24.296 24.558  1.00 71.35  ? 90  ARG B CA  1 
ATOM 1486 C C   . ARG B 1 90  ? 14.253  -23.955 25.866  1.00 79.31  ? 90  ARG B C   1 
ATOM 1487 O O   . ARG B 1 90  ? 15.450  -23.637 25.841  1.00 80.97  ? 90  ARG B O   1 
ATOM 1488 C CB  . ARG B 1 90  ? 14.194  -25.448 23.784  1.00 72.96  ? 90  ARG B CB  1 
ATOM 1489 C CG  . ARG B 1 90  ? 13.380  -25.865 22.561  1.00 80.89  ? 90  ARG B CG  1 
ATOM 1490 C CD  . ARG B 1 90  ? 13.805  -27.185 21.937  1.00 83.18  ? 90  ARG B CD  1 
ATOM 1491 N NE  . ARG B 1 90  ? 13.197  -27.337 20.610  1.00 85.33  ? 90  ARG B NE  1 
ATOM 1492 C CZ  . ARG B 1 90  ? 13.789  -26.999 19.468  1.00 97.39  ? 90  ARG B CZ  1 
ATOM 1493 N NH1 . ARG B 1 90  ? 15.022  -26.511 19.470  1.00 94.67  ? 90  ARG B NH1 1 
ATOM 1494 N NH2 . ARG B 1 90  ? 13.155  -27.156 18.313  1.00 81.30  ? 90  ARG B NH2 1 
ATOM 1495 N N   . PRO B 1 91  ? 13.529  -23.918 27.006  1.00 76.22  ? 91  PRO B N   1 
ATOM 1496 C CA  . PRO B 1 91  ? 14.199  -23.617 28.286  1.00 76.86  ? 91  PRO B CA  1 
ATOM 1497 C C   . PRO B 1 91  ? 14.947  -24.836 28.819  1.00 82.62  ? 91  PRO B C   1 
ATOM 1498 O O   . PRO B 1 91  ? 16.144  -24.977 28.574  1.00 83.55  ? 91  PRO B O   1 
ATOM 1499 C CB  . PRO B 1 91  ? 13.051  -23.191 29.214  1.00 77.33  ? 91  PRO B CB  1 
ATOM 1500 C CG  . PRO B 1 91  ? 11.767  -23.477 28.456  1.00 80.68  ? 91  PRO B CG  1 
ATOM 1501 C CD  . PRO B 1 91  ? 12.103  -24.232 27.208  1.00 77.34  ? 91  PRO B CD  1 
ATOM 1502 N N   . GLY B 1 104 ? 9.545   -27.710 29.003  1.00 85.38  ? 104 GLY B N   1 
ATOM 1503 C CA  . GLY B 1 104 ? 8.670   -27.657 27.833  1.00 84.12  ? 104 GLY B CA  1 
ATOM 1504 C C   . GLY B 1 104 ? 8.784   -26.364 27.048  1.00 83.23  ? 104 GLY B C   1 
ATOM 1505 O O   . GLY B 1 104 ? 9.085   -25.319 27.623  1.00 79.97  ? 104 GLY B O   1 
ATOM 1506 N N   . GLU B 1 105 ? 8.537   -26.440 25.726  1.00 79.35  ? 105 GLU B N   1 
ATOM 1507 C CA  . GLU B 1 105 ? 8.625   -25.362 24.727  1.00 75.69  ? 105 GLU B CA  1 
ATOM 1508 C C   . GLU B 1 105 ? 7.815   -24.091 25.030  1.00 77.54  ? 105 GLU B C   1 
ATOM 1509 O O   . GLU B 1 105 ? 6.626   -24.183 25.348  1.00 77.09  ? 105 GLU B O   1 
ATOM 1510 C CB  . GLU B 1 105 ? 8.129   -25.882 23.369  1.00 77.10  ? 105 GLU B CB  1 
ATOM 1511 C CG  . GLU B 1 105 ? 9.138   -26.603 22.496  1.00 86.85  ? 105 GLU B CG  1 
ATOM 1512 C CD  . GLU B 1 105 ? 8.596   -27.000 21.131  1.00 112.81 ? 105 GLU B CD  1 
ATOM 1513 O OE1 . GLU B 1 105 ? 7.353   -27.059 20.970  1.00 107.17 ? 105 GLU B OE1 1 
ATOM 1514 O OE2 . GLU B 1 105 ? 9.416   -27.267 20.222  1.00 112.28 ? 105 GLU B OE2 1 
ATOM 1515 N N   . ILE B 1 106 ? 8.448   -22.898 24.857  1.00 71.67  ? 106 ILE B N   1 
ATOM 1516 C CA  . ILE B 1 106 ? 7.762   -21.598 24.935  1.00 67.93  ? 106 ILE B CA  1 
ATOM 1517 C C   . ILE B 1 106 ? 7.507   -21.153 23.480  1.00 67.64  ? 106 ILE B C   1 
ATOM 1518 O O   . ILE B 1 106 ? 8.426   -21.199 22.668  1.00 65.92  ? 106 ILE B O   1 
ATOM 1519 C CB  . ILE B 1 106 ? 8.502   -20.553 25.790  1.00 69.52  ? 106 ILE B CB  1 
ATOM 1520 C CG1 . ILE B 1 106 ? 8.425   -20.922 27.307  1.00 70.70  ? 106 ILE B CG1 1 
ATOM 1521 C CG2 . ILE B 1 106 ? 7.966   -19.135 25.538  1.00 67.04  ? 106 ILE B CG2 1 
ATOM 1522 N N   . LEU B 1 107 ? 6.260   -20.798 23.143  1.00 62.36  ? 107 LEU B N   1 
ATOM 1523 C CA  . LEU B 1 107 ? 5.902   -20.407 21.788  1.00 60.80  ? 107 LEU B CA  1 
ATOM 1524 C C   . LEU B 1 107 ? 5.507   -18.949 21.718  1.00 61.85  ? 107 LEU B C   1 
ATOM 1525 O O   . LEU B 1 107 ? 4.641   -18.501 22.466  1.00 62.80  ? 107 LEU B O   1 
ATOM 1526 C CB  . LEU B 1 107 ? 4.809   -21.316 21.236  1.00 62.18  ? 107 LEU B CB  1 
ATOM 1527 C CG  . LEU B 1 107 ? 5.187   -22.809 21.108  1.00 67.95  ? 107 LEU B CG  1 
ATOM 1528 C CD1 . LEU B 1 107 ? 3.979   -23.622 20.829  1.00 67.85  ? 107 LEU B CD1 1 
ATOM 1529 C CD2 . LEU B 1 107 ? 6.192   -23.031 19.963  1.00 72.52  ? 107 LEU B CD2 1 
ATOM 1530 N N   . LEU B 1 108 ? 6.207   -18.199 20.846  1.00 55.91  ? 108 LEU B N   1 
ATOM 1531 C CA  . LEU B 1 108 ? 6.044   -16.755 20.637  1.00 53.87  ? 108 LEU B CA  1 
ATOM 1532 C C   . LEU B 1 108 ? 5.655   -16.414 19.221  1.00 57.40  ? 108 LEU B C   1 
ATOM 1533 O O   . LEU B 1 108 ? 6.059   -17.098 18.281  1.00 57.16  ? 108 LEU B O   1 
ATOM 1534 C CB  . LEU B 1 108 ? 7.326   -15.968 21.029  1.00 52.73  ? 108 LEU B CB  1 
ATOM 1535 C CG  . LEU B 1 108 ? 8.003   -16.371 22.335  1.00 56.36  ? 108 LEU B CG  1 
ATOM 1536 C CD1 . LEU B 1 108 ? 9.459   -16.001 22.294  1.00 56.19  ? 108 LEU B CD1 1 
ATOM 1537 C CD2 . LEU B 1 108 ? 7.238   -15.859 23.582  1.00 54.51  ? 108 LEU B CD2 1 
ATOM 1538 N N   . LEU B 1 109 ? 4.899   -15.314 19.066  1.00 54.40  ? 109 LEU B N   1 
ATOM 1539 C CA  . LEU B 1 109 ? 4.464   -14.811 17.771  1.00 53.20  ? 109 LEU B CA  1 
ATOM 1540 C C   . LEU B 1 109 ? 5.441   -13.796 17.254  1.00 56.13  ? 109 LEU B C   1 
ATOM 1541 O O   . LEU B 1 109 ? 5.731   -12.840 17.970  1.00 56.40  ? 109 LEU B O   1 
ATOM 1542 C CB  . LEU B 1 109 ? 3.059   -14.186 17.832  1.00 53.66  ? 109 LEU B CB  1 
ATOM 1543 C CG  . LEU B 1 109 ? 1.909   -15.026 18.381  1.00 59.86  ? 109 LEU B CG  1 
ATOM 1544 C CD1 . LEU B 1 109 ? 0.608   -14.332 18.158  1.00 60.92  ? 109 LEU B CD1 1 
ATOM 1545 C CD2 . LEU B 1 109 ? 1.823   -16.362 17.712  1.00 62.72  ? 109 LEU B CD2 1 
ATOM 1546 N N   . PRO B 1 110 ? 5.903   -13.937 15.987  1.00 52.46  ? 110 PRO B N   1 
ATOM 1547 C CA  . PRO B 1 110 ? 6.830   -12.934 15.409  1.00 51.73  ? 110 PRO B CA  1 
ATOM 1548 C C   . PRO B 1 110 ? 6.289   -11.495 15.457  1.00 55.73  ? 110 PRO B C   1 
ATOM 1549 O O   . PRO B 1 110 ? 7.060   -10.556 15.606  1.00 56.58  ? 110 PRO B O   1 
ATOM 1550 C CB  . PRO B 1 110 ? 7.009   -13.415 13.955  1.00 53.40  ? 110 PRO B CB  1 
ATOM 1551 C CG  . PRO B 1 110 ? 6.691   -14.871 13.981  1.00 57.65  ? 110 PRO B CG  1 
ATOM 1552 C CD  . PRO B 1 110 ? 5.642   -15.046 15.040  1.00 53.69  ? 110 PRO B CD  1 
ATOM 1553 N N   . GLU B 1 111 ? 4.964   -11.334 15.327  1.00 51.99  ? 111 GLU B N   1 
ATOM 1554 C CA  . GLU B 1 111 ? 4.230   -10.070 15.349  1.00 52.70  ? 111 GLU B CA  1 
ATOM 1555 C C   . GLU B 1 111 ? 4.383   -9.352  16.704  1.00 59.20  ? 111 GLU B C   1 
ATOM 1556 O O   . GLU B 1 111 ? 4.327   -8.131  16.752  1.00 59.39  ? 111 GLU B O   1 
ATOM 1557 C CB  . GLU B 1 111 ? 2.732   -10.380 15.086  1.00 54.33  ? 111 GLU B CB  1 
ATOM 1558 C CG  . GLU B 1 111 ? 1.815   -9.175  14.968  1.00 64.36  ? 111 GLU B CG  1 
ATOM 1559 C CD  . GLU B 1 111 ? 0.358   -9.448  14.651  1.00 88.55  ? 111 GLU B CD  1 
ATOM 1560 O OE1 . GLU B 1 111 ? 0.069   -10.385 13.868  1.00 82.62  ? 111 GLU B OE1 1 
ATOM 1561 O OE2 . GLU B 1 111 ? -0.495  -8.666  15.128  1.00 92.15  ? 111 GLU B OE2 1 
ATOM 1562 N N   . LEU B 1 112 ? 4.546   -10.111 17.812  1.00 56.84  ? 112 LEU B N   1 
ATOM 1563 C CA  . LEU B 1 112 ? 4.671   -9.536  19.161  1.00 56.29  ? 112 LEU B CA  1 
ATOM 1564 C C   . LEU B 1 112 ? 6.116   -9.575  19.684  1.00 57.01  ? 112 LEU B C   1 
ATOM 1565 O O   . LEU B 1 112 ? 6.364   -9.164  20.814  1.00 56.69  ? 112 LEU B O   1 
ATOM 1566 C CB  . LEU B 1 112 ? 3.713   -10.267 20.136  1.00 56.34  ? 112 LEU B CB  1 
ATOM 1567 C CG  . LEU B 1 112 ? 2.274   -10.510 19.643  1.00 60.76  ? 112 LEU B CG  1 
ATOM 1568 C CD1 . LEU B 1 112 ? 1.529   -11.391 20.572  1.00 60.33  ? 112 LEU B CD1 1 
ATOM 1569 C CD2 . LEU B 1 112 ? 1.533   -9.223  19.473  1.00 63.77  ? 112 LEU B CD2 1 
ATOM 1570 N N   . SER B 1 113 ? 7.069   -9.971  18.823  1.00 52.73  ? 113 SER B N   1 
ATOM 1571 C CA  . SER B 1 113 ? 8.482   -10.164 19.141  1.00 52.55  ? 113 SER B CA  1 
ATOM 1572 C C   . SER B 1 113 ? 9.384   -9.161  18.445  1.00 59.01  ? 113 SER B C   1 
ATOM 1573 O O   . SER B 1 113 ? 9.198   -8.843  17.265  1.00 59.89  ? 113 SER B O   1 
ATOM 1574 C CB  . SER B 1 113 ? 8.904   -11.605 18.829  1.00 55.40  ? 113 SER B CB  1 
ATOM 1575 O OG  . SER B 1 113 ? 8.047   -12.550 19.464  1.00 58.62  ? 113 SER B OG  1 
ATOM 1576 N N   . PHE B 1 114 ? 10.375  -8.661  19.194  1.00 56.35  ? 114 PHE B N   1 
ATOM 1577 C CA  . PHE B 1 114 ? 11.304  -7.624  18.743  1.00 57.72  ? 114 PHE B CA  1 
ATOM 1578 C C   . PHE B 1 114 ? 12.721  -8.019  19.018  1.00 66.62  ? 114 PHE B C   1 
ATOM 1579 O O   . PHE B 1 114 ? 13.039  -8.531  20.084  1.00 66.89  ? 114 PHE B O   1 
ATOM 1580 C CB  . PHE B 1 114 ? 11.001  -6.286  19.462  1.00 59.34  ? 114 PHE B CB  1 
ATOM 1581 C CG  . PHE B 1 114 ? 9.612   -5.766  19.163  1.00 58.66  ? 114 PHE B CG  1 
ATOM 1582 C CD1 . PHE B 1 114 ? 8.499   -6.284  19.818  1.00 55.06  ? 114 PHE B CD1 1 
ATOM 1583 C CD2 . PHE B 1 114 ? 9.412   -4.788  18.195  1.00 60.91  ? 114 PHE B CD2 1 
ATOM 1584 C CE1 . PHE B 1 114 ? 7.220   -5.845  19.511  1.00 54.81  ? 114 PHE B CE1 1 
ATOM 1585 C CE2 . PHE B 1 114 ? 8.120   -4.362  17.876  1.00 61.79  ? 114 PHE B CE2 1 
ATOM 1586 C CZ  . PHE B 1 114 ? 7.032   -4.890  18.544  1.00 56.43  ? 114 PHE B CZ  1 
ATOM 1587 N N   . MET B 1 115 ? 13.580  -7.720  18.074  1.00 68.51  ? 115 MET B N   1 
ATOM 1588 C CA  . MET B 1 115 ? 15.008  -7.986  18.176  1.00 72.18  ? 115 MET B CA  1 
ATOM 1589 C C   . MET B 1 115 ? 15.678  -7.068  19.186  1.00 79.70  ? 115 MET B C   1 
ATOM 1590 O O   . MET B 1 115 ? 15.258  -5.918  19.361  1.00 80.26  ? 115 MET B O   1 
ATOM 1591 C CB  . MET B 1 115 ? 15.658  -7.857  16.796  1.00 77.18  ? 115 MET B CB  1 
ATOM 1592 C CG  . MET B 1 115 ? 14.885  -8.608  15.736  1.00 80.04  ? 115 MET B CG  1 
ATOM 1593 S SD  . MET B 1 115 ? 15.618  -10.173 15.229  1.00 85.62  ? 115 MET B SD  1 
ATOM 1594 C CE  . MET B 1 115 ? 15.871  -11.010 16.759  1.00 81.28  ? 115 MET B CE  1 
ATOM 1595 N N   . THR B 1 116 ? 16.700  -7.597  19.878  1.00 78.96  ? 116 THR B N   1 
ATOM 1596 C CA  . THR B 1 116 ? 17.460  -6.859  20.891  1.00 81.34  ? 116 THR B CA  1 
ATOM 1597 C C   . THR B 1 116 ? 18.931  -6.773  20.440  1.00 94.50  ? 116 THR B C   1 
ATOM 1598 O O   . THR B 1 116 ? 19.320  -5.814  19.772  1.00 96.81  ? 116 THR B O   1 
ATOM 1599 C CB  . THR B 1 116 ? 17.318  -7.513  22.298  1.00 73.03  ? 116 THR B CB  1 
ATOM 1600 O OG1 . THR B 1 116 ? 17.847  -8.835  22.256  1.00 75.20  ? 116 THR B OG1 1 
ATOM 1601 C CG2 . THR B 1 116 ? 15.882  -7.531  22.838  1.00 56.77  ? 116 THR B CG2 1 
ATOM 1602 N N   . GLY B 1 117 ? 19.679  -7.837  20.745  1.00 94.87  ? 117 GLY B N   1 
ATOM 1603 C CA  . GLY B 1 117 ? 21.107  -8.033  20.527  1.00 98.58  ? 117 GLY B CA  1 
ATOM 1604 C C   . GLY B 1 117 ? 21.673  -8.638  21.801  1.00 104.98 ? 117 GLY B C   1 
ATOM 1605 O O   . GLY B 1 117 ? 21.406  -8.113  22.893  1.00 105.13 ? 117 GLY B O   1 
ATOM 1606 N N   . ILE B 1 118 ? 22.373  -9.800  21.689  1.00 102.52 ? 118 ILE B N   1 
ATOM 1607 C CA  . ILE B 1 118 ? 23.029  -10.550 22.781  1.00 128.51 ? 118 ILE B CA  1 
ATOM 1608 C C   . ILE B 1 118 ? 23.394  -11.967 22.320  1.00 146.62 ? 118 ILE B C   1 
ATOM 1609 O O   . ILE B 1 118 ? 23.786  -12.813 23.129  1.00 103.89 ? 118 ILE B O   1 
ATOM 1610 C CB  . ILE B 1 118 ? 22.213  -10.577 24.105  1.00 128.64 ? 118 ILE B CB  1 
ATOM 1611 N N   . ARG C 1 1   ? 19.255  -3.533  14.337  1.00 131.65 ? 1   ARG C N   1 
ATOM 1612 C CA  . ARG C 1 1   ? 17.932  -4.145  14.497  1.00 127.07 ? 1   ARG C CA  1 
ATOM 1613 C C   . ARG C 1 1   ? 17.385  -4.058  15.954  1.00 129.83 ? 1   ARG C C   1 
ATOM 1614 O O   . ARG C 1 1   ? 18.068  -4.417  16.926  1.00 128.60 ? 1   ARG C O   1 
ATOM 1615 C CB  . ARG C 1 1   ? 17.978  -5.609  14.055  1.00 20.00  ? 1   ARG C CB  1 
ATOM 1616 N N   . ASN C 1 2   ? 16.132  -3.552  16.058  1.00 125.11 ? 2   ASN C N   1 
ATOM 1617 C CA  . ASN C 1 2   ? 15.299  -3.330  17.252  1.00 123.10 ? 2   ASN C CA  1 
ATOM 1618 C C   . ASN C 1 2   ? 13.804  -3.471  16.832  1.00 119.51 ? 2   ASN C C   1 
ATOM 1619 O O   . ASN C 1 2   ? 12.894  -3.314  17.661  1.00 119.84 ? 2   ASN C O   1 
ATOM 1620 C CB  . ASN C 1 2   ? 15.567  -1.926  17.817  1.00 129.36 ? 2   ASN C CB  1 
ATOM 1621 N N   . ASP C 1 3   ? 13.592  -3.797  15.524  1.00 108.07 ? 3   ASP C N   1 
ATOM 1622 C CA  . ASP C 1 3   ? 12.327  -3.952  14.808  1.00 102.93 ? 3   ASP C CA  1 
ATOM 1623 C C   . ASP C 1 3   ? 11.581  -5.261  15.122  1.00 93.19  ? 3   ASP C C   1 
ATOM 1624 O O   . ASP C 1 3   ? 12.142  -6.220  15.689  1.00 89.01  ? 3   ASP C O   1 
ATOM 1625 C CB  . ASP C 1 3   ? 12.570  -3.836  13.283  1.00 105.22 ? 3   ASP C CB  1 
ATOM 1626 N N   . CYS C 1 4   ? 10.297  -5.275  14.711  1.00 82.07  ? 4   CYS C N   1 
ATOM 1627 C CA  . CYS C 1 4   ? 9.350   -6.366  14.882  1.00 75.34  ? 4   CYS C CA  1 
ATOM 1628 C C   . CYS C 1 4   ? 9.771   -7.520  13.955  1.00 74.08  ? 4   CYS C C   1 
ATOM 1629 O O   . CYS C 1 4   ? 10.007  -7.289  12.765  1.00 73.89  ? 4   CYS C O   1 
ATOM 1630 C CB  . CYS C 1 4   ? 7.941   -5.851  14.584  1.00 75.31  ? 4   CYS C CB  1 
ATOM 1631 S SG  . CYS C 1 4   ? 6.663   -7.127  14.439  1.00 74.22  ? 4   CYS C SG  1 
ATOM 1632 N N   . VAL C 1 5   ? 9.907   -8.742  14.518  1.00 65.50  ? 5   VAL C N   1 
ATOM 1633 C CA  . VAL C 1 5   ? 10.338  -9.965  13.824  1.00 60.78  ? 5   VAL C CA  1 
ATOM 1634 C C   . VAL C 1 5   ? 9.494   -10.221 12.561  1.00 64.56  ? 5   VAL C C   1 
ATOM 1635 O O   . VAL C 1 5   ? 10.068  -10.544 11.516  1.00 67.06  ? 5   VAL C O   1 
ATOM 1636 C CB  . VAL C 1 5   ? 10.328  -11.180 14.808  1.00 60.93  ? 5   VAL C CB  1 
ATOM 1637 C CG1 . VAL C 1 5   ? 10.589  -12.508 14.082  1.00 58.37  ? 5   VAL C CG1 1 
ATOM 1638 C CG2 . VAL C 1 5   ? 11.342  -10.980 15.926  1.00 60.25  ? 5   VAL C CG2 1 
ATOM 1639 N N   . LEU C 1 6   ? 8.150   -10.056 12.640  1.00 57.89  ? 6   LEU C N   1 
ATOM 1640 C CA  . LEU C 1 6   ? 7.274   -10.258 11.481  1.00 55.13  ? 6   LEU C CA  1 
ATOM 1641 C C   . LEU C 1 6   ? 7.616   -9.273  10.358  1.00 60.12  ? 6   LEU C C   1 
ATOM 1642 O O   . LEU C 1 6   ? 7.664   -9.689  9.205   1.00 58.08  ? 6   LEU C O   1 
ATOM 1643 C CB  . LEU C 1 6   ? 5.772   -10.180 11.854  1.00 54.84  ? 6   LEU C CB  1 
ATOM 1644 C CG  . LEU C 1 6   ? 4.762   -10.756 10.830  1.00 55.33  ? 6   LEU C CG  1 
ATOM 1645 N N   . ASP C 1 7   ? 7.907   -8.000  10.685  1.00 60.81  ? 7   ASP C N   1 
ATOM 1646 C CA  . ASP C 1 7   ? 8.285   -6.987  9.686   1.00 63.15  ? 7   ASP C CA  1 
ATOM 1647 C C   . ASP C 1 7   ? 9.601   -7.358  8.988   1.00 66.55  ? 7   ASP C C   1 
ATOM 1648 O O   . ASP C 1 7   ? 9.696   -7.249  7.764   1.00 66.60  ? 7   ASP C O   1 
ATOM 1649 C CB  . ASP C 1 7   ? 8.373   -5.586  10.316  1.00 69.60  ? 7   ASP C CB  1 
ATOM 1650 C CG  . ASP C 1 7   ? 7.051   -4.975  10.748  1.00 86.59  ? 7   ASP C CG  1 
ATOM 1651 O OD1 . ASP C 1 7   ? 5.999   -5.370  10.199  1.00 86.42  ? 7   ASP C OD1 1 
ATOM 1652 O OD2 . ASP C 1 7   ? 7.069   -4.094  11.632  1.00 98.48  ? 7   ASP C OD2 1 
ATOM 1653 N N   . VAL C 1 8   ? 10.583  -7.843  9.759   1.00 64.89  ? 8   VAL C N   1 
ATOM 1654 C CA  . VAL C 1 8   ? 11.890  -8.304  9.275   1.00 66.95  ? 8   VAL C CA  1 
ATOM 1655 C C   . VAL C 1 8   ? 11.653  -9.488  8.313   1.00 71.20  ? 8   VAL C C   1 
ATOM 1656 O O   . VAL C 1 8   ? 12.182  -9.496  7.205   1.00 72.51  ? 8   VAL C O   1 
ATOM 1657 C CB  . VAL C 1 8   ? 12.839  -8.676  10.458  1.00 71.47  ? 8   VAL C CB  1 
ATOM 1658 C CG1 . VAL C 1 8   ? 14.153  -9.258  9.962   1.00 71.60  ? 8   VAL C CG1 1 
ATOM 1659 C CG2 . VAL C 1 8   ? 13.097  -7.473  11.365  1.00 74.82  ? 8   VAL C CG2 1 
ATOM 1660 N N   . MET C 1 9   ? 10.790  -10.426 8.720   1.00 65.81  ? 9   MET C N   1 
ATOM 1661 C CA  . MET C 1 9   ? 10.370  -11.577 7.929   1.00 63.23  ? 9   MET C CA  1 
ATOM 1662 C C   . MET C 1 9   ? 9.653   -11.167 6.643   1.00 65.37  ? 9   MET C C   1 
ATOM 1663 O O   . MET C 1 9   ? 9.912   -11.778 5.615   1.00 62.61  ? 9   MET C O   1 
ATOM 1664 C CB  . MET C 1 9   ? 9.465   -12.498 8.750   1.00 63.50  ? 9   MET C CB  1 
ATOM 1665 C CG  . MET C 1 9   ? 10.200  -13.316 9.775   1.00 66.63  ? 9   MET C CG  1 
ATOM 1666 S SD  . MET C 1 9   ? 9.059   -14.434 10.626  1.00 69.57  ? 9   MET C SD  1 
ATOM 1667 C CE  . MET C 1 9   ? 8.184   -15.145 9.155   1.00 66.86  ? 9   MET C CE  1 
ATOM 1668 N N   . HIS C 1 10  ? 8.767   -10.133 6.688   1.00 64.91  ? 10  HIS C N   1 
ATOM 1669 C CA  . HIS C 1 10  ? 8.036   -9.625  5.513   1.00 65.84  ? 10  HIS C CA  1 
ATOM 1670 C C   . HIS C 1 10  ? 9.003   -9.088  4.454   1.00 71.93  ? 10  HIS C C   1 
ATOM 1671 O O   . HIS C 1 10  ? 8.801   -9.324  3.258   1.00 70.41  ? 10  HIS C O   1 
ATOM 1672 C CB  . HIS C 1 10  ? 7.013   -8.539  5.895   1.00 69.16  ? 10  HIS C CB  1 
ATOM 1673 C CG  . HIS C 1 10  ? 5.752   -9.027  6.559   1.00 71.96  ? 10  HIS C CG  1 
ATOM 1674 N ND1 . HIS C 1 10  ? 5.267   -10.317 6.364   1.00 71.88  ? 10  HIS C ND1 1 
ATOM 1675 C CD2 . HIS C 1 10  ? 4.894   -8.358  7.366   1.00 75.92  ? 10  HIS C CD2 1 
ATOM 1676 C CE1 . HIS C 1 10  ? 4.151   -10.395 7.077   1.00 71.77  ? 10  HIS C CE1 1 
ATOM 1677 N NE2 . HIS C 1 10  ? 3.880   -9.237  7.696   1.00 74.32  ? 10  HIS C NE2 1 
ATOM 1678 N N   . ALA C 1 11  ? 10.072  -8.388  4.900   1.00 70.71  ? 11  ALA C N   1 
ATOM 1679 C CA  . ALA C 1 11  ? 11.112  -7.839  4.035   1.00 71.20  ? 11  ALA C CA  1 
ATOM 1680 C C   . ALA C 1 11  ? 11.897  -8.972  3.357   1.00 74.63  ? 11  ALA C C   1 
ATOM 1681 O O   . ALA C 1 11  ? 12.156  -8.880  2.159   1.00 74.80  ? 11  ALA C O   1 
ATOM 1682 C CB  . ALA C 1 11  ? 12.044  -6.945  4.834   1.00 74.54  ? 11  ALA C CB  1 
ATOM 1683 N N   . ILE C 1 12  ? 12.239  -10.050 4.103   1.00 71.14  ? 12  ILE C N   1 
ATOM 1684 C CA  . ILE C 1 12  ? 12.921  -11.232 3.547   1.00 71.44  ? 12  ILE C CA  1 
ATOM 1685 C C   . ILE C 1 12  ? 11.975  -11.970 2.564   1.00 73.97  ? 12  ILE C C   1 
ATOM 1686 O O   . ILE C 1 12  ? 12.429  -12.420 1.515   1.00 73.88  ? 12  ILE C O   1 
ATOM 1687 C CB  . ILE C 1 12  ? 13.471  -12.176 4.650   1.00 73.43  ? 12  ILE C CB  1 
ATOM 1688 N N   . TYR C 1 13  ? 10.665  -12.047 2.886   1.00 69.23  ? 13  TYR C N   1 
ATOM 1689 C CA  . TYR C 1 13  ? 9.647   -12.654 2.031   1.00 68.59  ? 13  TYR C CA  1 
ATOM 1690 C C   . TYR C 1 13  ? 9.579   -11.943 0.684   1.00 73.20  ? 13  TYR C C   1 
ATOM 1691 O O   . TYR C 1 13  ? 9.577   -12.607 -0.355  1.00 73.04  ? 13  TYR C O   1 
ATOM 1692 C CB  . TYR C 1 13  ? 8.265   -12.640 2.705   1.00 70.16  ? 13  TYR C CB  1 
ATOM 1693 C CG  . TYR C 1 13  ? 7.159   -13.183 1.817   1.00 74.62  ? 13  TYR C CG  1 
ATOM 1694 C CD1 . TYR C 1 13  ? 6.896   -14.546 1.754   1.00 75.43  ? 13  TYR C CD1 1 
ATOM 1695 C CD2 . TYR C 1 13  ? 6.387   -12.332 1.023   1.00 77.44  ? 13  TYR C CD2 1 
ATOM 1696 C CE1 . TYR C 1 13  ? 5.889   -15.049 0.932   1.00 77.88  ? 13  TYR C CE1 1 
ATOM 1697 C CE2 . TYR C 1 13  ? 5.395   -12.827 0.176   1.00 77.98  ? 13  TYR C CE2 1 
ATOM 1698 C CZ  . TYR C 1 13  ? 5.152   -14.186 0.131   1.00 88.83  ? 13  TYR C CZ  1 
ATOM 1699 O OH  . TYR C 1 13  ? 4.159   -14.656 -0.697  1.00 94.43  ? 13  TYR C OH  1 
ATOM 1700 N N   . GLN C 1 14  ? 9.533   -10.596 0.714   1.00 69.66  ? 14  GLN C N   1 
ATOM 1701 C CA  . GLN C 1 14  ? 9.462   -9.731  -0.450  1.00 70.11  ? 14  GLN C CA  1 
ATOM 1702 C C   . GLN C 1 14  ? 10.662  -9.912  -1.376  1.00 75.75  ? 14  GLN C C   1 
ATOM 1703 O O   . GLN C 1 14  ? 10.484  -9.958  -2.599  1.00 75.72  ? 14  GLN C O   1 
ATOM 1704 C CB  . GLN C 1 14  ? 9.313   -8.272  -0.007  1.00 73.78  ? 14  GLN C CB  1 
ATOM 1705 C CG  . GLN C 1 14  ? 8.122   -7.506  -0.614  1.00 94.19  ? 14  GLN C CG  1 
ATOM 1706 C CD  . GLN C 1 14  ? 7.047   -8.338  -1.294  1.00 107.32 ? 14  GLN C CD  1 
ATOM 1707 O OE1 . GLN C 1 14  ? 7.013   -8.470  -2.522  1.00 105.78 ? 14  GLN C OE1 1 
ATOM 1708 N NE2 . GLN C 1 14  ? 6.127   -8.890  -0.519  1.00 89.98  ? 14  GLN C NE2 1 
ATOM 1709 N N   . GLN C 1 15  ? 11.874  -10.042 -0.803  1.00 73.51  ? 15  GLN C N   1 
ATOM 1710 C CA  . GLN C 1 15  ? 13.102  -10.260 -1.578  1.00 75.30  ? 15  GLN C CA  1 
ATOM 1711 C C   . GLN C 1 15  ? 13.068  -11.635 -2.252  1.00 79.96  ? 15  GLN C C   1 
ATOM 1712 O O   . GLN C 1 15  ? 13.465  -11.750 -3.408  1.00 82.63  ? 15  GLN C O   1 
ATOM 1713 C CB  . GLN C 1 15  ? 14.361  -10.101 -0.712  1.00 78.25  ? 15  GLN C CB  1 
ATOM 1714 C CG  . GLN C 1 15  ? 15.070  -8.765  -0.899  1.00 98.30  ? 15  GLN C CG  1 
ATOM 1715 N N   . ASN C 1 16  ? 12.541  -12.658 -1.553  1.00 74.10  ? 16  ASN C N   1 
ATOM 1716 C CA  . ASN C 1 16  ? 12.401  -14.025 -2.058  1.00 71.63  ? 16  ASN C CA  1 
ATOM 1717 C C   . ASN C 1 16  ? 11.319  -14.139 -3.127  1.00 72.83  ? 16  ASN C C   1 
ATOM 1718 O O   . ASN C 1 16  ? 11.466  -14.955 -4.030  1.00 71.10  ? 16  ASN C O   1 
ATOM 1719 C CB  . ASN C 1 16  ? 12.136  -15.000 -0.919  1.00 67.47  ? 16  ASN C CB  1 
ATOM 1720 C CG  . ASN C 1 16  ? 13.406  -15.465 -0.270  1.00 87.31  ? 16  ASN C CG  1 
ATOM 1721 O OD1 . ASN C 1 16  ? 13.927  -16.526 -0.597  1.00 78.90  ? 16  ASN C OD1 1 
ATOM 1722 N ND2 . ASN C 1 16  ? 13.945  -14.669 0.647   1.00 81.57  ? 16  ASN C ND2 1 
ATOM 1723 N N   . LYS C 1 17  ? 10.234  -13.338 -3.007  1.00 69.42  ? 17  LYS C N   1 
ATOM 1724 C CA  . LYS C 1 17  ? 9.104   -13.283 -3.951  1.00 68.48  ? 17  LYS C CA  1 
ATOM 1725 C C   . LYS C 1 17  ? 9.597   -12.753 -5.324  1.00 75.85  ? 17  LYS C C   1 
ATOM 1726 O O   . LYS C 1 17  ? 9.305   -13.359 -6.361  1.00 75.41  ? 17  LYS C O   1 
ATOM 1727 C CB  . LYS C 1 17  ? 7.969   -12.409 -3.374  1.00 69.02  ? 17  LYS C CB  1 
ATOM 1728 C CG  . LYS C 1 17  ? 6.748   -12.299 -4.282  1.00 73.46  ? 17  LYS C CG  1 
ATOM 1729 C CD  . LYS C 1 17  ? 5.641   -11.461 -3.672  1.00 73.88  ? 17  LYS C CD  1 
ATOM 1730 C CE  . LYS C 1 17  ? 4.588   -11.144 -4.708  1.00 86.28  ? 17  LYS C CE  1 
ATOM 1731 N NZ  . LYS C 1 17  ? 3.284   -10.799 -4.092  1.00 97.77  ? 17  LYS C NZ  1 
ATOM 1732 N N   . GLU C 1 18  ? 10.370  -11.642 -5.299  1.00 74.75  ? 18  GLU C N   1 
ATOM 1733 C CA  . GLU C 1 18  ? 10.991  -11.003 -6.449  1.00 77.02  ? 18  GLU C CA  1 
ATOM 1734 C C   . GLU C 1 18  ? 11.947  -11.989 -7.122  1.00 84.16  ? 18  GLU C C   1 
ATOM 1735 O O   . GLU C 1 18  ? 11.901  -12.139 -8.344  1.00 85.70  ? 18  GLU C O   1 
ATOM 1736 C CB  . GLU C 1 18  ? 11.727  -9.725  -6.017  1.00 80.87  ? 18  GLU C CB  1 
ATOM 1737 N N   . HIS C 1 19  ? 12.760  -12.711 -6.325  1.00 81.64  ? 19  HIS C N   1 
ATOM 1738 C CA  . HIS C 1 19  ? 13.687  -13.726 -6.833  1.00 83.45  ? 19  HIS C CA  1 
ATOM 1739 C C   . HIS C 1 19  ? 12.931  -14.840 -7.558  1.00 82.78  ? 19  HIS C C   1 
ATOM 1740 O O   . HIS C 1 19  ? 13.386  -15.268 -8.608  1.00 85.13  ? 19  HIS C O   1 
ATOM 1741 C CB  . HIS C 1 19  ? 14.548  -14.313 -5.711  1.00 85.89  ? 19  HIS C CB  1 
ATOM 1742 C CG  . HIS C 1 19  ? 15.548  -15.325 -6.198  1.00 92.74  ? 19  HIS C CG  1 
ATOM 1743 N ND1 . HIS C 1 19  ? 15.191  -16.654 -6.380  1.00 93.96  ? 19  HIS C ND1 1 
ATOM 1744 C CD2 . HIS C 1 19  ? 16.831  -15.164 -6.596  1.00 98.88  ? 19  HIS C CD2 1 
ATOM 1745 C CE1 . HIS C 1 19  ? 16.272  -17.258 -6.844  1.00 96.32  ? 19  HIS C CE1 1 
ATOM 1746 N NE2 . HIS C 1 19  ? 17.278  -16.403 -7.002  1.00 99.77  ? 19  HIS C NE2 1 
ATOM 1747 N N   . PHE C 1 20  ? 11.790  -15.299 -7.001  1.00 72.85  ? 20  PHE C N   1 
ATOM 1748 C CA  . PHE C 1 20  ? 10.929  -16.320 -7.587  1.00 69.85  ? 20  PHE C CA  1 
ATOM 1749 C C   . PHE C 1 20  ? 10.390  -15.876 -8.957  1.00 76.09  ? 20  PHE C C   1 
ATOM 1750 O O   . PHE C 1 20  ? 10.454  -16.650 -9.916  1.00 77.82  ? 20  PHE C O   1 
ATOM 1751 C CB  . PHE C 1 20  ? 9.768   -16.675 -6.627  1.00 66.89  ? 20  PHE C CB  1 
ATOM 1752 C CG  . PHE C 1 20  ? 8.520   -17.209 -7.294  1.00 65.23  ? 20  PHE C CG  1 
ATOM 1753 C CD1 . PHE C 1 20  ? 8.524   -18.448 -7.928  1.00 67.30  ? 20  PHE C CD1 1 
ATOM 1754 C CD2 . PHE C 1 20  ? 7.343   -16.461 -7.310  1.00 65.10  ? 20  PHE C CD2 1 
ATOM 1755 C CE1 . PHE C 1 20  ? 7.376   -18.934 -8.564  1.00 66.93  ? 20  PHE C CE1 1 
ATOM 1756 C CE2 . PHE C 1 20  ? 6.190   -16.951 -7.952  1.00 65.90  ? 20  PHE C CE2 1 
ATOM 1757 C CZ  . PHE C 1 20  ? 6.217   -18.183 -8.571  1.00 64.24  ? 20  PHE C CZ  1 
ATOM 1758 N N   . GLN C 1 21  ? 9.847   -14.651 -9.029  1.00 72.43  ? 21  GLN C N   1 
ATOM 1759 C CA  . GLN C 1 21  ? 9.253   -14.090 -10.237 1.00 73.59  ? 21  GLN C CA  1 
ATOM 1760 C C   . GLN C 1 21  ? 10.306  -13.916 -11.317 1.00 82.02  ? 21  GLN C C   1 
ATOM 1761 O O   . GLN C 1 21  ? 10.063  -14.307 -12.452 1.00 81.13  ? 21  GLN C O   1 
ATOM 1762 C CB  . GLN C 1 21  ? 8.507   -12.793 -9.929  1.00 74.23  ? 21  GLN C CB  1 
ATOM 1763 C CG  . GLN C 1 21  ? 7.258   -13.040 -9.069  1.00 68.14  ? 21  GLN C CG  1 
ATOM 1764 C CD  . GLN C 1 21  ? 6.459   -11.792 -8.781  1.00 71.68  ? 21  GLN C CD  1 
ATOM 1765 O OE1 . GLN C 1 21  ? 6.890   -10.672 -9.071  1.00 66.42  ? 21  GLN C OE1 1 
ATOM 1766 N NE2 . GLN C 1 21  ? 5.279   -11.954 -8.198  1.00 61.86  ? 21  GLN C NE2 1 
ATOM 1767 N N   . ASP C 1 22  ? 11.506  -13.437 -10.942 1.00 83.01  ? 22  ASP C N   1 
ATOM 1768 C CA  . ASP C 1 22  ? 12.644  -13.280 -11.855 1.00 86.29  ? 22  ASP C CA  1 
ATOM 1769 C C   . ASP C 1 22  ? 13.163  -14.637 -12.339 1.00 89.74  ? 22  ASP C C   1 
ATOM 1770 O O   . ASP C 1 22  ? 13.559  -14.751 -13.499 1.00 93.32  ? 22  ASP C O   1 
ATOM 1771 C CB  . ASP C 1 22  ? 13.785  -12.476 -11.199 1.00 91.03  ? 22  ASP C CB  1 
ATOM 1772 C CG  . ASP C 1 22  ? 13.480  -11.012 -10.916 1.00 109.90 ? 22  ASP C CG  1 
ATOM 1773 O OD1 . ASP C 1 22  ? 12.399  -10.526 -11.348 1.00 111.29 ? 22  ASP C OD1 1 
ATOM 1774 O OD2 . ASP C 1 22  ? 14.320  -10.348 -10.263 1.00 119.03 ? 22  ASP C OD2 1 
ATOM 1775 N N   . GLU C 1 23  ? 13.151  -15.656 -11.467 1.00 82.38  ? 23  GLU C N   1 
ATOM 1776 C CA  . GLU C 1 23  ? 13.599  -17.016 -11.785 1.00 82.33  ? 23  GLU C CA  1 
ATOM 1777 C C   . GLU C 1 23  ? 12.685  -17.661 -12.813 1.00 84.09  ? 23  GLU C C   1 
ATOM 1778 O O   . GLU C 1 23  ? 13.176  -18.351 -13.706 1.00 86.95  ? 23  GLU C O   1 
ATOM 1779 C CB  . GLU C 1 23  ? 13.648  -17.885 -10.522 1.00 82.12  ? 23  GLU C CB  1 
ATOM 1780 C CG  . GLU C 1 23  ? 14.665  -19.010 -10.572 1.00 93.26  ? 23  GLU C CG  1 
ATOM 1781 C CD  . GLU C 1 23  ? 14.671  -19.930 -9.371  1.00 118.47 ? 23  GLU C CD  1 
ATOM 1782 O OE1 . GLU C 1 23  ? 14.888  -21.148 -9.562  1.00 117.75 ? 23  GLU C OE1 1 
ATOM 1783 O OE2 . GLU C 1 23  ? 14.442  -19.441 -8.242  1.00 118.77 ? 23  GLU C OE2 1 
ATOM 1784 N N   . CYS C 1 24  ? 11.360  -17.433 -12.682 1.00 76.84  ? 24  CYS C N   1 
ATOM 1785 C CA  . CYS C 1 24  ? 10.330  -17.930 -13.597 1.00 75.24  ? 24  CYS C CA  1 
ATOM 1786 C C   . CYS C 1 24  ? 10.477  -17.275 -14.950 1.00 81.37  ? 24  CYS C C   1 
ATOM 1787 O O   . CYS C 1 24  ? 10.503  -17.978 -15.965 1.00 83.04  ? 24  CYS C O   1 
ATOM 1788 C CB  . CYS C 1 24  ? 8.937   -17.701 -13.017 1.00 71.68  ? 24  CYS C CB  1 
ATOM 1789 S SG  . CYS C 1 24  ? 8.409   -18.974 -11.855 1.00 72.85  ? 24  CYS C SG  1 
ATOM 1790 N N   . THR C 1 25  ? 10.597  -15.925 -14.961 1.00 79.35  ? 25  THR C N   1 
ATOM 1791 C CA  . THR C 1 25  ? 10.763  -15.150 -16.193 1.00 82.39  ? 25  THR C CA  1 
ATOM 1792 C C   . THR C 1 25  ? 12.061  -15.565 -16.905 1.00 91.24  ? 25  THR C C   1 
ATOM 1793 O O   . THR C 1 25  ? 12.006  -15.876 -18.087 1.00 93.75  ? 25  THR C O   1 
ATOM 1794 C CB  . THR C 1 25  ? 10.675  -13.640 -15.955 1.00 91.90  ? 25  THR C CB  1 
ATOM 1795 O OG1 . THR C 1 25  ? 11.763  -13.228 -15.137 1.00 96.06  ? 25  THR C OG1 1 
ATOM 1796 C CG2 . THR C 1 25  ? 9.352   -13.212 -15.346 1.00 88.73  ? 25  THR C CG2 1 
ATOM 1797 N N   . LYS C 1 26  ? 13.197  -15.642 -16.188 1.00 89.07  ? 26  LYS C N   1 
ATOM 1798 C CA  . LYS C 1 26  ? 14.468  -16.069 -16.788 1.00 94.00  ? 26  LYS C CA  1 
ATOM 1799 C C   . LYS C 1 26  ? 14.302  -17.406 -17.522 1.00 101.07 ? 26  LYS C C   1 
ATOM 1800 O O   . LYS C 1 26  ? 14.659  -17.496 -18.692 1.00 106.21 ? 26  LYS C O   1 
ATOM 1801 C CB  . LYS C 1 26  ? 15.595  -16.157 -15.738 1.00 97.75  ? 26  LYS C CB  1 
ATOM 1802 N N   . LEU C 1 27  ? 13.671  -18.395 -16.870 1.00 94.68  ? 27  LEU C N   1 
ATOM 1803 C CA  . LEU C 1 27  ? 13.414  -19.731 -17.393 1.00 94.81  ? 27  LEU C CA  1 
ATOM 1804 C C   . LEU C 1 27  ? 12.419  -19.759 -18.546 1.00 98.77  ? 27  LEU C C   1 
ATOM 1805 O O   . LEU C 1 27  ? 12.603  -20.538 -19.481 1.00 102.60 ? 27  LEU C O   1 
ATOM 1806 C CB  . LEU C 1 27  ? 12.907  -20.615 -16.253 1.00 92.76  ? 27  LEU C CB  1 
ATOM 1807 C CG  . LEU C 1 27  ? 12.568  -22.057 -16.613 1.00 99.32  ? 27  LEU C CG  1 
ATOM 1808 C CD1 . LEU C 1 27  ? 13.779  -22.994 -16.429 1.00 102.94 ? 27  LEU C CD1 1 
ATOM 1809 C CD2 . LEU C 1 27  ? 11.333  -22.519 -15.868 1.00 98.27  ? 27  LEU C CD2 1 
ATOM 1810 N N   . LEU C 1 28  ? 11.380  -18.915 -18.485 1.00 92.76  ? 28  LEU C N   1 
ATOM 1811 C CA  . LEU C 1 28  ? 10.303  -18.889 -19.472 1.00 92.27  ? 28  LEU C CA  1 
ATOM 1812 C C   . LEU C 1 28  ? 10.443  -17.877 -20.611 1.00 95.91  ? 28  LEU C C   1 
ATOM 1813 O O   . LEU C 1 28  ? 10.202  -18.254 -21.749 1.00 96.38  ? 28  LEU C O   1 
ATOM 1814 C CB  . LEU C 1 28  ? 8.970   -18.649 -18.751 1.00 89.10  ? 28  LEU C CB  1 
ATOM 1815 C CG  . LEU C 1 28  ? 8.260   -19.891 -18.274 1.00 93.56  ? 28  LEU C CG  1 
ATOM 1816 C CD1 . LEU C 1 28  ? 7.632   -19.661 -16.938 1.00 90.67  ? 28  LEU C CD1 1 
ATOM 1817 C CD2 . LEU C 1 28  ? 7.204   -20.300 -19.271 1.00 97.97  ? 28  LEU C CD2 1 
ATOM 1818 N N   . VAL C 1 29  ? 10.732  -16.592 -20.304 1.00 92.92  ? 29  VAL C N   1 
ATOM 1819 C CA  . VAL C 1 29  ? 10.834  -15.493 -21.266 1.00 94.60  ? 29  VAL C CA  1 
ATOM 1820 C C   . VAL C 1 29  ? 11.947  -15.800 -22.245 1.00 105.83 ? 29  VAL C C   1 
ATOM 1821 O O   . VAL C 1 29  ? 13.133  -15.767 -21.894 1.00 110.01 ? 29  VAL C O   1 
ATOM 1822 C CB  . VAL C 1 29  ? 10.985  -14.112 -20.588 1.00 97.64  ? 29  VAL C CB  1 
ATOM 1823 N N   . GLY C 1 30  ? 11.528  -16.222 -23.430 1.00 102.95 ? 30  GLY C N   1 
ATOM 1824 C CA  . GLY C 1 30  ? 12.400  -16.687 -24.502 1.00 106.55 ? 30  GLY C CA  1 
ATOM 1825 C C   . GLY C 1 30  ? 12.091  -18.119 -24.908 1.00 109.36 ? 30  GLY C C   1 
ATOM 1826 O O   . GLY C 1 30  ? 12.180  -18.451 -26.086 1.00 112.14 ? 30  GLY C O   1 
ATOM 1827 N N   . ASN C 1 31  ? 11.706  -18.987 -23.940 1.00 102.29 ? 31  ASN C N   1 
ATOM 1828 C CA  . ASN C 1 31  ? 11.349  -20.387 -24.222 1.00 101.55 ? 31  ASN C CA  1 
ATOM 1829 C C   . ASN C 1 31  ? 10.048  -20.471 -25.040 1.00 97.48  ? 31  ASN C C   1 
ATOM 1830 O O   . ASN C 1 31  ? 9.309   -19.481 -25.113 1.00 93.91  ? 31  ASN C O   1 
ATOM 1831 C CB  . ASN C 1 31  ? 11.260  -21.216 -22.918 1.00 102.88 ? 31  ASN C CB  1 
ATOM 1832 C CG  . ASN C 1 31  ? 11.838  -22.611 -23.055 1.00 136.78 ? 31  ASN C CG  1 
ATOM 1833 O OD1 . ASN C 1 31  ? 11.115  -23.615 -23.116 1.00 133.42 ? 31  ASN C OD1 1 
ATOM 1834 N ND2 . ASN C 1 31  ? 13.160  -22.704 -23.162 1.00 131.86 ? 31  ASN C ND2 1 
ATOM 1835 N N   . ILE C 1 32  ? 9.780   -21.628 -25.672 1.00 92.43  ? 32  ILE C N   1 
ATOM 1836 C CA  . ILE C 1 32  ? 8.588   -21.797 -26.514 1.00 90.82  ? 32  ILE C CA  1 
ATOM 1837 C C   . ILE C 1 32  ? 7.564   -22.737 -25.873 1.00 91.50  ? 32  ILE C C   1 
ATOM 1838 O O   . ILE C 1 32  ? 7.831   -23.906 -25.654 1.00 91.23  ? 32  ILE C O   1 
ATOM 1839 C CB  . ILE C 1 32  ? 8.914   -22.198 -28.011 1.00 97.56  ? 32  ILE C CB  1 
ATOM 1840 N N   . VAL C 1 33  ? 6.379   -22.214 -25.601 1.00 88.06  ? 33  VAL C N   1 
ATOM 1841 C CA  . VAL C 1 33  ? 5.279   -22.983 -25.026 1.00 88.20  ? 33  VAL C CA  1 
ATOM 1842 C C   . VAL C 1 33  ? 4.399   -23.614 -26.125 1.00 95.54  ? 33  VAL C C   1 
ATOM 1843 O O   . VAL C 1 33  ? 4.303   -23.075 -27.221 1.00 96.72  ? 33  VAL C O   1 
ATOM 1844 C CB  . VAL C 1 33  ? 4.439   -22.091 -24.078 1.00 88.01  ? 33  VAL C CB  1 
ATOM 1845 N N   . ILE C 1 34  ? 3.737   -24.727 -25.816 1.00 92.90  ? 34  ILE C N   1 
ATOM 1846 C CA  . ILE C 1 34  ? 2.776   -25.365 -26.708 1.00 94.93  ? 34  ILE C CA  1 
ATOM 1847 C C   . ILE C 1 34  ? 1.424   -25.417 -25.977 1.00 97.26  ? 34  ILE C C   1 
ATOM 1848 O O   . ILE C 1 34  ? 1.361   -25.813 -24.815 1.00 95.87  ? 34  ILE C O   1 
ATOM 1849 C CB  . ILE C 1 34  ? 3.225   -26.765 -27.205 1.00 102.82 ? 34  ILE C CB  1 
ATOM 1850 N N   . THR C 1 35  ? 0.363   -24.985 -26.658 1.00 94.68  ? 35  THR C N   1 
ATOM 1851 C CA  . THR C 1 35  ? -1.014  -24.992 -26.160 1.00 93.17  ? 35  THR C CA  1 
ATOM 1852 C C   . THR C 1 35  ? -1.616  -26.310 -26.667 1.00 100.68 ? 35  THR C C   1 
ATOM 1853 O O   . THR C 1 35  ? -1.812  -26.464 -27.869 1.00 101.30 ? 35  THR C O   1 
ATOM 1854 C CB  . THR C 1 35  ? -1.766  -23.708 -26.624 1.00 88.98  ? 35  THR C CB  1 
ATOM 1855 N N   . ARG C 1 36  ? -1.851  -27.274 -25.759 1.00 99.96  ? 36  ARG C N   1 
ATOM 1856 C CA  . ARG C 1 36  ? -2.351  -28.624 -26.092 1.00 104.20 ? 36  ARG C CA  1 
ATOM 1857 C C   . ARG C 1 36  ? -3.675  -28.615 -26.889 1.00 109.04 ? 36  ARG C C   1 
ATOM 1858 O O   . ARG C 1 36  ? -3.812  -29.427 -27.798 1.00 114.20 ? 36  ARG C O   1 
ATOM 1859 C CB  . ARG C 1 36  ? -2.495  -29.494 -24.814 1.00 103.74 ? 36  ARG C CB  1 
ATOM 1860 C CG  . ARG C 1 36  ? -2.580  -31.009 -25.046 1.00 113.92 ? 36  ARG C CG  1 
ATOM 1861 C CD  . ARG C 1 36  ? -2.959  -31.777 -23.789 1.00 123.08 ? 36  ARG C CD  1 
ATOM 1862 N NE  . ARG C 1 36  ? -1.786  -32.318 -23.090 1.00 134.70 ? 36  ARG C NE  1 
ATOM 1863 C CZ  . ARG C 1 36  ? -1.805  -32.856 -21.870 1.00 142.94 ? 36  ARG C CZ  1 
ATOM 1864 N NH1 . ARG C 1 36  ? -2.935  -32.906 -21.175 1.00 137.37 ? 36  ARG C NH1 1 
ATOM 1865 N NH2 . ARG C 1 36  ? -0.691  -33.333 -21.331 1.00 115.73 ? 36  ARG C NH2 1 
ATOM 1866 N N   . TYR C 1 37  ? -4.626  -27.715 -26.561 1.00 99.77  ? 37  TYR C N   1 
ATOM 1867 C CA  . TYR C 1 37  ? -5.951  -27.662 -27.192 1.00 100.11 ? 37  TYR C CA  1 
ATOM 1868 C C   . TYR C 1 37  ? -5.961  -27.305 -28.678 1.00 105.19 ? 37  TYR C C   1 
ATOM 1869 O O   . TYR C 1 37  ? -6.969  -27.547 -29.351 1.00 107.79 ? 37  TYR C O   1 
ATOM 1870 C CB  . TYR C 1 37  ? -6.889  -26.701 -26.442 1.00 97.34  ? 37  TYR C CB  1 
ATOM 1871 C CG  . TYR C 1 37  ? -6.368  -25.290 -26.284 1.00 94.17  ? 37  TYR C CG  1 
ATOM 1872 C CD1 . TYR C 1 37  ? -6.677  -24.304 -27.218 1.00 94.69  ? 37  TYR C CD1 1 
ATOM 1873 C CD2 . TYR C 1 37  ? -5.637  -24.918 -25.158 1.00 92.48  ? 37  TYR C CD2 1 
ATOM 1874 C CE1 . TYR C 1 37  ? -6.222  -22.997 -27.066 1.00 91.58  ? 37  TYR C CE1 1 
ATOM 1875 C CE2 . TYR C 1 37  ? -5.171  -23.615 -24.995 1.00 90.54  ? 37  TYR C CE2 1 
ATOM 1876 C CZ  . TYR C 1 37  ? -5.482  -22.652 -25.944 1.00 100.29 ? 37  TYR C CZ  1 
ATOM 1877 O OH  . TYR C 1 37  ? -5.026  -21.362 -25.793 1.00 101.97 ? 37  TYR C OH  1 
ATOM 1878 N N   . ASN C 1 38  ? -4.895  -26.685 -29.180 1.00 99.17  ? 38  ASN C N   1 
ATOM 1879 C CA  . ASN C 1 38  ? -4.876  -26.298 -30.579 1.00 99.82  ? 38  ASN C CA  1 
ATOM 1880 C C   . ASN C 1 38  ? -3.550  -26.653 -31.239 1.00 107.02 ? 38  ASN C C   1 
ATOM 1881 O O   . ASN C 1 38  ? -3.402  -26.472 -32.447 1.00 108.06 ? 38  ASN C O   1 
ATOM 1882 C CB  . ASN C 1 38  ? -5.217  -24.808 -30.732 1.00 91.12  ? 38  ASN C CB  1 
ATOM 1883 C CG  . ASN C 1 38  ? -4.120  -23.851 -30.334 1.00 109.79 ? 38  ASN C CG  1 
ATOM 1884 O OD1 . ASN C 1 38  ? -3.211  -24.178 -29.569 1.00 109.52 ? 38  ASN C OD1 1 
ATOM 1885 N ND2 . ASN C 1 38  ? -4.183  -22.636 -30.853 1.00 99.97  ? 38  ASN C ND2 1 
ATOM 1886 N N   . ASN C 1 39  ? -2.599  -27.169 -30.445 1.00 105.23 ? 39  ASN C N   1 
ATOM 1887 C CA  . ASN C 1 39  ? -1.253  -27.566 -30.883 1.00 108.69 ? 39  ASN C CA  1 
ATOM 1888 C C   . ASN C 1 39  ? -0.482  -26.366 -31.472 1.00 111.96 ? 39  ASN C C   1 
ATOM 1889 O O   . ASN C 1 39  ? 0.209   -26.516 -32.483 1.00 115.35 ? 39  ASN C O   1 
ATOM 1890 C CB  . ASN C 1 39  ? -1.290  -28.769 -31.867 1.00 117.26 ? 39  ASN C CB  1 
ATOM 1891 C CG  . ASN C 1 39  ? -1.302  -30.132 -31.223 1.00 142.77 ? 39  ASN C CG  1 
ATOM 1892 O OD1 . ASN C 1 39  ? -1.830  -30.347 -30.131 1.00 130.13 ? 39  ASN C OD1 1 
ATOM 1893 N ND2 . ASN C 1 39  ? -0.765  -31.109 -31.923 1.00 145.48 ? 39  ASN C ND2 1 
ATOM 1894 N N   . ARG C 1 40  ? -0.631  -25.166 -30.855 1.00 103.86 ? 40  ARG C N   1 
ATOM 1895 C CA  . ARG C 1 40  ? 0.055   -23.954 -31.316 1.00 101.43 ? 40  ARG C CA  1 
ATOM 1896 C C   . ARG C 1 40  ? 1.258   -23.655 -30.448 1.00 101.17 ? 40  ARG C C   1 
ATOM 1897 O O   . ARG C 1 40  ? 1.243   -23.952 -29.256 1.00 99.07  ? 40  ARG C O   1 
ATOM 1898 C CB  . ARG C 1 40  ? -0.883  -22.745 -31.393 1.00 98.42  ? 40  ARG C CB  1 
ATOM 1899 N N   . THR C 1 41  ? 2.300   -23.080 -31.048 1.00 97.46  ? 41  THR C N   1 
ATOM 1900 C CA  . THR C 1 41  ? 3.536   -22.755 -30.351 1.00 97.21  ? 41  THR C CA  1 
ATOM 1901 C C   . THR C 1 41  ? 3.731   -21.256 -30.274 1.00 98.55  ? 41  THR C C   1 
ATOM 1902 O O   . THR C 1 41  ? 3.424   -20.544 -31.237 1.00 98.24  ? 41  THR C O   1 
ATOM 1903 C CB  . THR C 1 41  ? 4.747   -23.444 -30.984 1.00 113.35 ? 41  THR C CB  1 
ATOM 1904 O OG1 . THR C 1 41  ? 4.311   -24.460 -31.875 1.00 118.95 ? 41  THR C OG1 1 
ATOM 1905 C CG2 . THR C 1 41  ? 5.688   -24.050 -29.938 1.00 114.02 ? 41  THR C CG2 1 
ATOM 1906 N N   . TYR C 1 42  ? 4.214   -20.763 -29.105 1.00 92.84  ? 42  TYR C N   1 
ATOM 1907 C CA  . TYR C 1 42  ? 4.462   -19.330 -28.905 1.00 89.84  ? 42  TYR C CA  1 
ATOM 1908 C C   . TYR C 1 42  ? 5.725   -19.085 -28.078 1.00 88.92  ? 42  TYR C C   1 
ATOM 1909 O O   . TYR C 1 42  ? 5.897   -19.733 -27.057 1.00 86.57  ? 42  TYR C O   1 
ATOM 1910 C CB  . TYR C 1 42  ? 3.266   -18.642 -28.214 1.00 88.12  ? 42  TYR C CB  1 
ATOM 1911 C CG  . TYR C 1 42  ? 1.915   -18.826 -28.870 1.00 90.26  ? 42  TYR C CG  1 
ATOM 1912 C CD1 . TYR C 1 42  ? 1.056   -19.850 -28.468 1.00 91.81  ? 42  TYR C CD1 1 
ATOM 1913 C CD2 . TYR C 1 42  ? 1.457   -17.927 -29.834 1.00 91.62  ? 42  TYR C CD2 1 
ATOM 1914 C CE1 . TYR C 1 42  ? -0.215  -19.987 -29.025 1.00 93.00  ? 42  TYR C CE1 1 
ATOM 1915 C CE2 . TYR C 1 42  ? 0.191   -18.056 -30.402 1.00 92.31  ? 42  TYR C CE2 1 
ATOM 1916 C CZ  . TYR C 1 42  ? -0.641  -19.091 -29.997 1.00 103.09 ? 42  TYR C CZ  1 
ATOM 1917 O OH  . TYR C 1 42  ? -1.888  -19.234 -30.563 1.00 109.19 ? 42  TYR C OH  1 
ATOM 1918 N N   . ARG C 1 43  ? 6.588   -18.133 -28.508 1.00 85.16  ? 43  ARG C N   1 
ATOM 1919 C CA  . ARG C 1 43  ? 7.775   -17.699 -27.767 1.00 84.90  ? 43  ARG C CA  1 
ATOM 1920 C C   . ARG C 1 43  ? 7.245   -16.769 -26.681 1.00 87.03  ? 43  ARG C C   1 
ATOM 1921 O O   . ARG C 1 43  ? 6.704   -15.687 -26.978 1.00 84.13  ? 43  ARG C O   1 
ATOM 1922 C CB  . ARG C 1 43  ? 8.756   -16.924 -28.662 1.00 84.64  ? 43  ARG C CB  1 
ATOM 1923 N N   . ILE C 1 44  ? 7.322   -17.234 -25.424 1.00 83.79  ? 44  ILE C N   1 
ATOM 1924 C CA  . ILE C 1 44  ? 6.865   -16.460 -24.281 1.00 80.40  ? 44  ILE C CA  1 
ATOM 1925 C C   . ILE C 1 44  ? 7.803   -15.263 -24.148 1.00 88.48  ? 44  ILE C C   1 
ATOM 1926 O O   . ILE C 1 44  ? 9.027   -15.428 -24.146 1.00 90.55  ? 44  ILE C O   1 
ATOM 1927 C CB  . ILE C 1 44  ? 6.752   -17.321 -23.010 1.00 81.29  ? 44  ILE C CB  1 
ATOM 1928 C CG1 . ILE C 1 44  ? 5.531   -18.244 -23.109 1.00 79.67  ? 44  ILE C CG1 1 
ATOM 1929 N N   . ASP C 1 45  ? 7.224   -14.056 -24.191 1.00 85.70  ? 45  ASP C N   1 
ATOM 1930 C CA  . ASP C 1 45  ? 7.975   -12.808 -24.143 1.00 87.59  ? 45  ASP C CA  1 
ATOM 1931 C C   . ASP C 1 45  ? 8.103   -12.272 -22.730 1.00 91.31  ? 45  ASP C C   1 
ATOM 1932 O O   . ASP C 1 45  ? 9.128   -11.669 -22.401 1.00 92.65  ? 45  ASP C O   1 
ATOM 1933 C CB  . ASP C 1 45  ? 7.346   -11.759 -25.075 1.00 89.24  ? 45  ASP C CB  1 
ATOM 1934 C CG  . ASP C 1 45  ? 7.813   -11.885 -26.521 1.00 104.86 ? 45  ASP C CG  1 
ATOM 1935 O OD1 . ASP C 1 45  ? 8.885   -11.333 -26.847 1.00 108.75 ? 45  ASP C OD1 1 
ATOM 1936 O OD2 . ASP C 1 45  ? 7.113   -12.561 -27.322 1.00 109.41 ? 45  ASP C OD2 1 
ATOM 1937 N N   . ASP C 1 46  ? 7.066   -12.502 -21.900 1.00 85.68  ? 46  ASP C N   1 
ATOM 1938 C CA  . ASP C 1 46  ? 6.969   -12.032 -20.524 1.00 84.19  ? 46  ASP C CA  1 
ATOM 1939 C C   . ASP C 1 46  ? 5.885   -12.795 -19.754 1.00 85.25  ? 46  ASP C C   1 
ATOM 1940 O O   . ASP C 1 46  ? 5.141   -13.588 -20.329 1.00 84.04  ? 46  ASP C O   1 
ATOM 1941 C CB  . ASP C 1 46  ? 6.613   -10.532 -20.527 1.00 86.78  ? 46  ASP C CB  1 
ATOM 1942 C CG  . ASP C 1 46  ? 7.385   -9.668  -19.541 1.00 106.52 ? 46  ASP C CG  1 
ATOM 1943 O OD1 . ASP C 1 46  ? 7.874   -10.211 -18.524 1.00 107.36 ? 46  ASP C OD1 1 
ATOM 1944 O OD2 . ASP C 1 46  ? 7.475   -8.439  -19.770 1.00 118.82 ? 46  ASP C OD2 1 
ATOM 1945 N N   . VAL C 1 47  ? 5.802   -12.531 -18.444 1.00 81.36  ? 47  VAL C N   1 
ATOM 1946 C CA  . VAL C 1 47  ? 4.798   -13.071 -17.524 1.00 78.98  ? 47  VAL C CA  1 
ATOM 1947 C C   . VAL C 1 47  ? 4.124   -11.890 -16.845 1.00 81.04  ? 47  VAL C C   1 
ATOM 1948 O O   . VAL C 1 47  ? 4.819   -11.009 -16.325 1.00 81.46  ? 47  VAL C O   1 
ATOM 1949 C CB  . VAL C 1 47  ? 5.392   -14.058 -16.476 1.00 81.98  ? 47  VAL C CB  1 
ATOM 1950 N N   . ASP C 1 48  ? 2.784   -11.821 -16.908 1.00 76.09  ? 48  ASP C N   1 
ATOM 1951 C CA  . ASP C 1 48  ? 2.055   -10.755 -16.206 1.00 74.60  ? 48  ASP C CA  1 
ATOM 1952 C C   . ASP C 1 48  ? 1.674   -11.329 -14.859 1.00 72.13  ? 48  ASP C C   1 
ATOM 1953 O O   . ASP C 1 48  ? 0.769   -12.164 -14.762 1.00 67.44  ? 48  ASP C O   1 
ATOM 1954 C CB  . ASP C 1 48  ? 0.818   -10.222 -16.973 1.00 76.25  ? 48  ASP C CB  1 
ATOM 1955 C CG  . ASP C 1 48  ? 0.254   -8.907  -16.434 1.00 85.97  ? 48  ASP C CG  1 
ATOM 1956 O OD1 . ASP C 1 48  ? 0.631   -8.506  -15.301 1.00 86.03  ? 48  ASP C OD1 1 
ATOM 1957 O OD2 . ASP C 1 48  ? -0.551  -8.267  -17.152 1.00 91.20  ? 48  ASP C OD2 1 
ATOM 1958 N N   . TRP C 1 49  ? 2.408   -10.896 -13.834 1.00 70.05  ? 49  TRP C N   1 
ATOM 1959 C CA  . TRP C 1 49  ? 2.214   -11.321 -12.457 1.00 69.63  ? 49  TRP C CA  1 
ATOM 1960 C C   . TRP C 1 49  ? 0.989   -10.643 -11.841 1.00 76.16  ? 49  TRP C C   1 
ATOM 1961 O O   . TRP C 1 49  ? 0.445   -11.164 -10.876 1.00 77.50  ? 49  TRP C O   1 
ATOM 1962 C CB  . TRP C 1 49  ? 3.502   -11.080 -11.644 1.00 69.17  ? 49  TRP C CB  1 
ATOM 1963 C CG  . TRP C 1 49  ? 4.664   -11.923 -12.109 1.00 70.98  ? 49  TRP C CG  1 
ATOM 1964 C CD1 . TRP C 1 49  ? 5.727   -11.527 -12.868 1.00 75.65  ? 49  TRP C CD1 1 
ATOM 1965 C CD2 . TRP C 1 49  ? 4.840   -13.319 -11.873 1.00 70.04  ? 49  TRP C CD2 1 
ATOM 1966 N NE1 . TRP C 1 49  ? 6.585   -12.585 -13.073 1.00 75.81  ? 49  TRP C NE1 1 
ATOM 1967 C CE2 . TRP C 1 49  ? 6.059   -13.702 -12.482 1.00 75.16  ? 49  TRP C CE2 1 
ATOM 1968 C CE3 . TRP C 1 49  ? 4.103   -14.280 -11.167 1.00 69.75  ? 49  TRP C CE3 1 
ATOM 1969 C CZ2 . TRP C 1 49  ? 6.537   -15.015 -12.437 1.00 74.44  ? 49  TRP C CZ2 1 
ATOM 1970 C CZ3 . TRP C 1 49  ? 4.591   -15.571 -11.099 1.00 71.08  ? 49  TRP C CZ3 1 
ATOM 1971 C CH2 . TRP C 1 49  ? 5.795   -15.928 -11.727 1.00 73.33  ? 49  TRP C CH2 1 
ATOM 1972 N N   . ASN C 1 50  ? 0.521   -9.533  -12.433 1.00 75.20  ? 50  ASN C N   1 
ATOM 1973 C CA  . ASN C 1 50  ? -0.606  -8.722  -11.945 1.00 76.64  ? 50  ASN C CA  1 
ATOM 1974 C C   . ASN C 1 50  ? -1.966  -9.093  -12.575 1.00 80.61  ? 50  ASN C C   1 
ATOM 1975 O O   . ASN C 1 50  ? -2.976  -8.476  -12.228 1.00 82.85  ? 50  ASN C O   1 
ATOM 1976 C CB  . ASN C 1 50  ? -0.317  -7.226  -12.173 1.00 80.95  ? 50  ASN C CB  1 
ATOM 1977 C CG  . ASN C 1 50  ? 0.974   -6.727  -11.558 1.00 107.26 ? 50  ASN C CG  1 
ATOM 1978 O OD1 . ASN C 1 50  ? 1.345   -7.089  -10.429 1.00 92.41  ? 50  ASN C OD1 1 
ATOM 1979 N ND2 . ASN C 1 50  ? 1.690   -5.885  -12.301 1.00 104.51 ? 50  ASN C ND2 1 
ATOM 1980 N N   . LYS C 1 51  ? -2.007  -10.075 -13.488 1.00 74.27  ? 51  LYS C N   1 
ATOM 1981 C CA  . LYS C 1 51  ? -3.266  -10.481 -14.137 1.00 72.99  ? 51  LYS C CA  1 
ATOM 1982 C C   . LYS C 1 51  ? -3.586  -11.907 -13.793 1.00 75.30  ? 51  LYS C C   1 
ATOM 1983 O O   . LYS C 1 51  ? -2.667  -12.645 -13.450 1.00 74.41  ? 51  LYS C O   1 
ATOM 1984 C CB  . LYS C 1 51  ? -3.241  -10.257 -15.663 1.00 74.94  ? 51  LYS C CB  1 
ATOM 1985 N N   . THR C 1 52  ? -4.892  -12.304 -13.876 1.00 72.24  ? 52  THR C N   1 
ATOM 1986 C CA  . THR C 1 52  ? -5.395  -13.639 -13.496 1.00 71.37  ? 52  THR C CA  1 
ATOM 1987 C C   . THR C 1 52  ? -6.554  -14.103 -14.446 1.00 73.39  ? 52  THR C C   1 
ATOM 1988 O O   . THR C 1 52  ? -7.205  -13.229 -15.027 1.00 73.49  ? 52  THR C O   1 
ATOM 1989 C CB  . THR C 1 52  ? -5.811  -13.545 -11.993 1.00 80.54  ? 52  THR C CB  1 
ATOM 1990 O OG1 . THR C 1 52  ? -5.945  -14.824 -11.425 1.00 75.73  ? 52  THR C OG1 1 
ATOM 1991 C CG2 . THR C 1 52  ? -7.092  -12.753 -11.753 1.00 84.56  ? 52  THR C CG2 1 
ATOM 1992 N N   . PRO C 1 53  ? -6.867  -15.436 -14.602 1.00 67.89  ? 53  PRO C N   1 
ATOM 1993 C CA  . PRO C 1 53  ? -8.003  -15.841 -15.465 1.00 67.92  ? 53  PRO C CA  1 
ATOM 1994 C C   . PRO C 1 53  ? -9.358  -15.272 -15.041 1.00 75.17  ? 53  PRO C C   1 
ATOM 1995 O O   . PRO C 1 53  ? -10.303 -15.280 -15.837 1.00 77.83  ? 53  PRO C O   1 
ATOM 1996 C CB  . PRO C 1 53  ? -8.003  -17.367 -15.356 1.00 69.93  ? 53  PRO C CB  1 
ATOM 1997 C CG  . PRO C 1 53  ? -6.620  -17.716 -14.967 1.00 72.65  ? 53  PRO C CG  1 
ATOM 1998 C CD  . PRO C 1 53  ? -6.204  -16.630 -14.037 1.00 67.51  ? 53  PRO C CD  1 
ATOM 1999 N N   . LYS C 1 54  ? -9.445  -14.759 -13.791 1.00 71.66  ? 54  LYS C N   1 
ATOM 2000 C CA  . LYS C 1 54  ? -10.633 -14.111 -13.225 1.00 72.30  ? 54  LYS C CA  1 
ATOM 2001 C C   . LYS C 1 54  ? -10.870 -12.767 -13.926 1.00 76.00  ? 54  LYS C C   1 
ATOM 2002 O O   . LYS C 1 54  ? -12.017 -12.312 -13.966 1.00 78.21  ? 54  LYS C O   1 
ATOM 2003 C CB  . LYS C 1 54  ? -10.477 -13.848 -11.709 1.00 73.33  ? 54  LYS C CB  1 
ATOM 2004 C CG  . LYS C 1 54  ? -10.459 -15.081 -10.806 1.00 77.51  ? 54  LYS C CG  1 
ATOM 2005 C CD  . LYS C 1 54  ? -9.970  -14.711 -9.390  1.00 70.35  ? 54  LYS C CD  1 
ATOM 2006 N N   . ASP C 1 55  ? -9.788  -12.107 -14.423 1.00 69.36  ? 55  ASP C N   1 
ATOM 2007 C CA  . ASP C 1 55  ? -9.829  -10.823 -15.129 1.00 68.96  ? 55  ASP C CA  1 
ATOM 2008 C C   . ASP C 1 55  ? -10.555 -10.943 -16.497 1.00 76.29  ? 55  ASP C C   1 
ATOM 2009 O O   . ASP C 1 55  ? -10.672 -12.031 -17.071 1.00 74.11  ? 55  ASP C O   1 
ATOM 2010 C CB  . ASP C 1 55  ? -8.409  -10.245 -15.304 1.00 68.47  ? 55  ASP C CB  1 
ATOM 2011 C CG  . ASP C 1 55  ? -7.693  -9.915  -14.006 1.00 71.22  ? 55  ASP C CG  1 
ATOM 2012 N N   . SER C 1 56  ? -11.059 -9.818  -16.997 1.00 78.57  ? 56  SER C N   1 
ATOM 2013 C CA  . SER C 1 56  ? -11.790 -9.762  -18.261 1.00 80.87  ? 56  SER C CA  1 
ATOM 2014 C C   . SER C 1 56  ? -11.006 -9.088  -19.367 1.00 89.06  ? 56  SER C C   1 
ATOM 2015 O O   . SER C 1 56  ? -10.098 -8.296  -19.114 1.00 90.44  ? 56  SER C O   1 
ATOM 2016 C CB  . SER C 1 56  ? -13.122 -9.043  -18.072 1.00 85.57  ? 56  SER C CB  1 
ATOM 2017 O OG  . SER C 1 56  ? -13.982 -9.797  -17.235 1.00 92.86  ? 56  SER C OG  1 
ATOM 2018 N N   . PHE C 1 57  ? -11.361 -9.418  -20.598 1.00 86.56  ? 57  PHE C N   1 
ATOM 2019 C CA  . PHE C 1 57  ? -10.828 -8.772  -21.782 1.00 86.17  ? 57  PHE C CA  1 
ATOM 2020 C C   . PHE C 1 57  ? -12.019 -8.354  -22.670 1.00 89.72  ? 57  PHE C C   1 
ATOM 2021 O O   . PHE C 1 57  ? -13.090 -8.972  -22.613 1.00 90.26  ? 57  PHE C O   1 
ATOM 2022 C CB  . PHE C 1 57  ? -9.803  -9.641  -22.509 1.00 87.09  ? 57  PHE C CB  1 
ATOM 2023 C CG  . PHE C 1 57  ? -10.326 -10.900 -23.143 1.00 89.10  ? 57  PHE C CG  1 
ATOM 2024 C CD1 . PHE C 1 57  ? -10.717 -10.912 -24.481 1.00 92.24  ? 57  PHE C CD1 1 
ATOM 2025 C CD2 . PHE C 1 57  ? -10.367 -12.090 -22.428 1.00 91.62  ? 57  PHE C CD2 1 
ATOM 2026 C CE1 . PHE C 1 57  ? -11.173 -12.080 -25.084 1.00 93.80  ? 57  PHE C CE1 1 
ATOM 2027 C CE2 . PHE C 1 57  ? -10.814 -13.267 -23.037 1.00 95.33  ? 57  PHE C CE2 1 
ATOM 2028 C CZ  . PHE C 1 57  ? -11.212 -13.250 -24.363 1.00 94.01  ? 57  PHE C CZ  1 
ATOM 2029 N N   . THR C 1 58  ? -11.844 -7.274  -23.432 1.00 83.03  ? 58  THR C N   1 
ATOM 2030 C CA  . THR C 1 58  ? -12.883 -6.734  -24.290 1.00 81.30  ? 58  THR C CA  1 
ATOM 2031 C C   . THR C 1 58  ? -12.803 -7.366  -25.679 1.00 78.11  ? 58  THR C C   1 
ATOM 2032 O O   . THR C 1 58  ? -11.720 -7.471  -26.255 1.00 74.87  ? 58  THR C O   1 
ATOM 2033 C CB  . THR C 1 58  ? -12.770 -5.209  -24.304 1.00 88.45  ? 58  THR C CB  1 
ATOM 2034 O OG1 . THR C 1 58  ? -12.764 -4.749  -22.949 1.00 89.74  ? 58  THR C OG1 1 
ATOM 2035 C CG2 . THR C 1 58  ? -13.888 -4.535  -25.068 1.00 84.88  ? 58  THR C CG2 1 
ATOM 2036 N N   . MET C 1 59  ? -13.961 -7.790  -26.205 1.00 72.79  ? 59  MET C N   1 
ATOM 2037 C CA  . MET C 1 59  ? -14.086 -8.339  -27.556 1.00 71.03  ? 59  MET C CA  1 
ATOM 2038 C C   . MET C 1 59  ? -14.312 -7.199  -28.574 1.00 70.18  ? 59  MET C C   1 
ATOM 2039 O O   . MET C 1 59  ? -14.313 -6.014  -28.183 1.00 68.25  ? 59  MET C O   1 
ATOM 2040 C CB  . MET C 1 59  ? -15.145 -9.438  -27.605 1.00 75.04  ? 59  MET C CB  1 
ATOM 2041 C CG  . MET C 1 59  ? -14.797 -10.553 -26.623 1.00 79.91  ? 59  MET C CG  1 
ATOM 2042 S SD  . MET C 1 59  ? -15.504 -12.179 -26.895 1.00 86.28  ? 59  MET C SD  1 
ATOM 2043 C CE  . MET C 1 59  ? -14.609 -12.679 -28.284 1.00 82.82  ? 59  MET C CE  1 
ATOM 2044 N N   . SER C 1 60  ? -14.428 -7.542  -29.878 1.00 65.78  ? 60  SER C N   1 
ATOM 2045 C CA  . SER C 1 60  ? -14.501 -6.569  -30.975 1.00 64.59  ? 60  SER C CA  1 
ATOM 2046 C C   . SER C 1 60  ? -15.561 -5.475  -30.797 1.00 66.16  ? 60  SER C C   1 
ATOM 2047 O O   . SER C 1 60  ? -15.255 -4.320  -31.065 1.00 66.96  ? 60  SER C O   1 
ATOM 2048 C CB  . SER C 1 60  ? -14.659 -7.263  -32.325 1.00 68.73  ? 60  SER C CB  1 
ATOM 2049 O OG  . SER C 1 60  ? -15.942 -7.834  -32.510 1.00 81.31  ? 60  SER C OG  1 
ATOM 2050 N N   . ASP C 1 61  ? -16.768 -5.807  -30.321 1.00 60.66  ? 61  ASP C N   1 
ATOM 2051 C CA  . ASP C 1 61  ? -17.818 -4.800  -30.170 1.00 61.95  ? 61  ASP C CA  1 
ATOM 2052 C C   . ASP C 1 61  ? -17.932 -4.240  -28.744 1.00 68.50  ? 61  ASP C C   1 
ATOM 2053 O O   . ASP C 1 61  ? -18.894 -3.534  -28.467 1.00 72.70  ? 61  ASP C O   1 
ATOM 2054 C CB  . ASP C 1 61  ? -19.187 -5.374  -30.616 1.00 65.37  ? 61  ASP C CB  1 
ATOM 2055 C CG  . ASP C 1 61  ? -19.736 -6.465  -29.676 1.00 72.43  ? 61  ASP C CG  1 
ATOM 2056 O OD1 . ASP C 1 61  ? -18.919 -7.173  -29.038 1.00 68.39  ? 61  ASP C OD1 1 
ATOM 2057 O OD2 . ASP C 1 61  ? -20.979 -6.615  -29.598 1.00 81.23  ? 61  ASP C OD2 1 
ATOM 2058 N N   . GLY C 1 62  ? -16.990 -4.525  -27.861 1.00 63.61  ? 62  GLY C N   1 
ATOM 2059 C CA  . GLY C 1 62  ? -17.063 -4.028  -26.488 1.00 64.30  ? 62  GLY C CA  1 
ATOM 2060 C C   . GLY C 1 62  ? -17.534 -5.036  -25.450 1.00 69.28  ? 62  GLY C C   1 
ATOM 2061 O O   . GLY C 1 62  ? -17.540 -4.724  -24.255 1.00 69.79  ? 62  GLY C O   1 
ATOM 2062 N N   . LYS C 1 63  ? -17.955 -6.248  -25.880 1.00 64.96  ? 63  LYS C N   1 
ATOM 2063 C CA  . LYS C 1 63  ? -18.437 -7.259  -24.946 1.00 65.56  ? 63  LYS C CA  1 
ATOM 2064 C C   . LYS C 1 63  ? -17.260 -7.798  -24.129 1.00 68.46  ? 63  LYS C C   1 
ATOM 2065 O O   . LYS C 1 63  ? -16.208 -8.130  -24.688 1.00 66.16  ? 63  LYS C O   1 
ATOM 2066 C CB  . LYS C 1 63  ? -19.176 -8.391  -25.685 1.00 68.25  ? 63  LYS C CB  1 
ATOM 2067 C CG  . LYS C 1 63  ? -19.816 -9.445  -24.772 1.00 81.97  ? 63  LYS C CG  1 
ATOM 2068 C CD  . LYS C 1 63  ? -20.268 -10.661 -25.578 1.00 95.55  ? 63  LYS C CD  1 
ATOM 2069 C CE  . LYS C 1 63  ? -21.057 -11.670 -24.784 1.00 103.21 ? 63  LYS C CE  1 
ATOM 2070 N NZ  . LYS C 1 63  ? -21.889 -12.521 -25.674 1.00 113.05 ? 63  LYS C NZ  1 
ATOM 2071 N N   . GLU C 1 64  ? -17.438 -7.860  -22.819 1.00 66.65  ? 64  GLU C N   1 
ATOM 2072 C CA  . GLU C 1 64  ? -16.429 -8.361  -21.893 1.00 65.89  ? 64  GLU C CA  1 
ATOM 2073 C C   . GLU C 1 64  ? -16.687 -9.822  -21.543 1.00 71.95  ? 64  GLU C C   1 
ATOM 2074 O O   . GLU C 1 64  ? -17.832 -10.241 -21.355 1.00 73.56  ? 64  GLU C O   1 
ATOM 2075 C CB  . GLU C 1 64  ? -16.373 -7.500  -20.618 1.00 67.88  ? 64  GLU C CB  1 
ATOM 2076 C CG  . GLU C 1 64  ? -15.702 -6.151  -20.831 1.00 80.85  ? 64  GLU C CG  1 
ATOM 2077 C CD  . GLU C 1 64  ? -15.270 -5.447  -19.556 1.00 114.66 ? 64  GLU C CD  1 
ATOM 2078 O OE1 . GLU C 1 64  ? -15.988 -4.518  -19.121 1.00 117.28 ? 64  GLU C OE1 1 
ATOM 2079 O OE2 . GLU C 1 64  ? -14.218 -5.827  -18.989 1.00 111.47 ? 64  GLU C OE2 1 
ATOM 2080 N N   . ILE C 1 65  ? -15.605 -10.591 -21.441 1.00 68.05  ? 65  ILE C N   1 
ATOM 2081 C CA  . ILE C 1 65  ? -15.638 -11.999 -21.074 1.00 68.28  ? 65  ILE C CA  1 
ATOM 2082 C C   . ILE C 1 65  ? -14.430 -12.285 -20.185 1.00 73.82  ? 65  ILE C C   1 
ATOM 2083 O O   . ILE C 1 65  ? -13.351 -11.728 -20.422 1.00 73.17  ? 65  ILE C O   1 
ATOM 2084 C CB  . ILE C 1 65  ? -15.659 -12.886 -22.346 1.00 70.42  ? 65  ILE C CB  1 
ATOM 2085 N N   . THR C 1 66  ? -14.590 -13.152 -19.166 1.00 71.66  ? 66  THR C N   1 
ATOM 2086 C CA  . THR C 1 66  ? -13.442 -13.529 -18.325 1.00 69.30  ? 66  THR C CA  1 
ATOM 2087 C C   . THR C 1 66  ? -12.680 -14.577 -19.085 1.00 73.53  ? 66  THR C C   1 
ATOM 2088 O O   . THR C 1 66  ? -13.242 -15.239 -19.979 1.00 74.57  ? 66  THR C O   1 
ATOM 2089 C CB  . THR C 1 66  ? -13.845 -14.007 -16.899 1.00 75.94  ? 66  THR C CB  1 
ATOM 2090 O OG1 . THR C 1 66  ? -14.611 -15.215 -16.978 1.00 85.34  ? 66  THR C OG1 1 
ATOM 2091 C CG2 . THR C 1 66  ? -14.608 -12.941 -16.094 1.00 66.06  ? 66  THR C CG2 1 
ATOM 2092 N N   . PHE C 1 67  ? -11.402 -14.747 -18.756 1.00 68.65  ? 67  PHE C N   1 
ATOM 2093 C CA  . PHE C 1 67  ? -10.627 -15.794 -19.415 1.00 67.65  ? 67  PHE C CA  1 
ATOM 2094 C C   . PHE C 1 67  ? -11.274 -17.155 -19.116 1.00 74.37  ? 67  PHE C C   1 
ATOM 2095 O O   . PHE C 1 67  ? -11.330 -18.005 -19.999 1.00 75.86  ? 67  PHE C O   1 
ATOM 2096 C CB  . PHE C 1 67  ? -9.159  -15.733 -18.986 1.00 67.22  ? 67  PHE C CB  1 
ATOM 2097 C CG  . PHE C 1 67  ? -8.457  -14.463 -19.418 1.00 66.27  ? 67  PHE C CG  1 
ATOM 2098 C CD1 . PHE C 1 67  ? -8.369  -13.371 -18.563 1.00 66.88  ? 67  PHE C CD1 1 
ATOM 2099 C CD2 . PHE C 1 67  ? -7.848  -14.376 -20.668 1.00 67.75  ? 67  PHE C CD2 1 
ATOM 2100 C CE1 . PHE C 1 67  ? -7.716  -12.199 -18.961 1.00 67.78  ? 67  PHE C CE1 1 
ATOM 2101 C CE2 . PHE C 1 67  ? -7.189  -13.206 -21.066 1.00 69.91  ? 67  PHE C CE2 1 
ATOM 2102 C CZ  . PHE C 1 67  ? -7.152  -12.114 -20.219 1.00 67.81  ? 67  PHE C CZ  1 
ATOM 2103 N N   . LEU C 1 68  ? -11.870 -17.301 -17.916 1.00 71.65  ? 68  LEU C N   1 
ATOM 2104 C CA  . LEU C 1 68  ? -12.600 -18.495 -17.476 1.00 73.92  ? 68  LEU C CA  1 
ATOM 2105 C C   . LEU C 1 68  ? -13.743 -18.858 -18.452 1.00 78.77  ? 68  LEU C C   1 
ATOM 2106 O O   . LEU C 1 68  ? -13.803 -19.989 -18.946 1.00 79.05  ? 68  LEU C O   1 
ATOM 2107 C CB  . LEU C 1 68  ? -13.164 -18.299 -16.042 1.00 75.21  ? 68  LEU C CB  1 
ATOM 2108 C CG  . LEU C 1 68  ? -12.173 -18.036 -14.878 1.00 78.46  ? 68  LEU C CG  1 
ATOM 2109 C CD1 . LEU C 1 68  ? -12.917 -17.735 -13.593 1.00 79.88  ? 68  LEU C CD1 1 
ATOM 2110 C CD2 . LEU C 1 68  ? -11.247 -19.217 -14.660 1.00 78.90  ? 68  LEU C CD2 1 
ATOM 2111 N N   . GLU C 1 69  ? -14.612 -17.869 -18.767 1.00 75.90  ? 69  GLU C N   1 
ATOM 2112 C CA  . GLU C 1 69  ? -15.750 -18.057 -19.672 1.00 77.68  ? 69  GLU C CA  1 
ATOM 2113 C C   . GLU C 1 69  ? -15.289 -18.282 -21.123 1.00 81.37  ? 69  GLU C C   1 
ATOM 2114 O O   . GLU C 1 69  ? -15.927 -19.034 -21.871 1.00 82.20  ? 69  GLU C O   1 
ATOM 2115 C CB  . GLU C 1 69  ? -16.721 -16.886 -19.574 1.00 79.45  ? 69  GLU C CB  1 
ATOM 2116 N N   . TYR C 1 70  ? -14.163 -17.651 -21.502 1.00 75.33  ? 70  TYR C N   1 
ATOM 2117 C CA  . TYR C 1 70  ? -13.571 -17.777 -22.825 1.00 73.95  ? 70  TYR C CA  1 
ATOM 2118 C C   . TYR C 1 70  ? -13.149 -19.208 -23.123 1.00 81.23  ? 70  TYR C C   1 
ATOM 2119 O O   . TYR C 1 70  ? -13.500 -19.734 -24.177 1.00 84.02  ? 70  TYR C O   1 
ATOM 2120 C CB  . TYR C 1 70  ? -12.373 -16.818 -22.980 1.00 71.84  ? 70  TYR C CB  1 
ATOM 2121 C CG  . TYR C 1 70  ? -11.683 -16.924 -24.322 1.00 73.61  ? 70  TYR C CG  1 
ATOM 2122 C CD1 . TYR C 1 70  ? -12.235 -16.344 -25.461 1.00 76.77  ? 70  TYR C CD1 1 
ATOM 2123 C CD2 . TYR C 1 70  ? -10.482 -17.613 -24.459 1.00 73.13  ? 70  TYR C CD2 1 
ATOM 2124 C CE1 . TYR C 1 70  ? -11.618 -16.463 -26.707 1.00 77.80  ? 70  TYR C CE1 1 
ATOM 2125 C CE2 . TYR C 1 70  ? -9.853  -17.734 -25.697 1.00 73.71  ? 70  TYR C CE2 1 
ATOM 2126 C CZ  . TYR C 1 70  ? -10.428 -17.161 -26.819 1.00 79.96  ? 70  TYR C CZ  1 
ATOM 2127 O OH  . TYR C 1 70  ? -9.817  -17.274 -28.042 1.00 78.53  ? 70  TYR C OH  1 
ATOM 2128 N N   . TYR C 1 71  ? -12.397 -19.837 -22.211 1.00 77.35  ? 71  TYR C N   1 
ATOM 2129 C CA  . TYR C 1 71  ? -11.907 -21.198 -22.438 1.00 78.33  ? 71  TYR C CA  1 
ATOM 2130 C C   . TYR C 1 71  ? -13.014 -22.256 -22.368 1.00 83.83  ? 71  TYR C C   1 
ATOM 2131 O O   . TYR C 1 71  ? -12.978 -23.212 -23.150 1.00 84.67  ? 71  TYR C O   1 
ATOM 2132 C CB  . TYR C 1 71  ? -10.711 -21.517 -21.523 1.00 76.93  ? 71  TYR C CB  1 
ATOM 2133 C CG  . TYR C 1 71  ? -9.471  -20.777 -21.981 1.00 75.72  ? 71  TYR C CG  1 
ATOM 2134 C CD1 . TYR C 1 71  ? -9.104  -19.569 -21.400 1.00 75.23  ? 71  TYR C CD1 1 
ATOM 2135 C CD2 . TYR C 1 71  ? -8.716  -21.238 -23.059 1.00 77.52  ? 71  TYR C CD2 1 
ATOM 2136 C CE1 . TYR C 1 71  ? -8.009  -18.843 -21.865 1.00 75.28  ? 71  TYR C CE1 1 
ATOM 2137 C CE2 . TYR C 1 71  ? -7.602  -20.532 -23.515 1.00 77.31  ? 71  TYR C CE2 1 
ATOM 2138 C CZ  . TYR C 1 71  ? -7.249  -19.341 -22.906 1.00 84.12  ? 71  TYR C CZ  1 
ATOM 2139 O OH  . TYR C 1 71  ? -6.162  -18.642 -23.338 1.00 88.94  ? 71  TYR C OH  1 
ATOM 2140 N N   . SER C 1 72  ? -14.028 -22.041 -21.511 1.00 81.09  ? 72  SER C N   1 
ATOM 2141 C CA  . SER C 1 72  ? -15.155 -22.962 -21.394 1.00 85.68  ? 72  SER C CA  1 
ATOM 2142 C C   . SER C 1 72  ? -16.046 -22.900 -22.641 1.00 95.35  ? 72  SER C C   1 
ATOM 2143 O O   . SER C 1 72  ? -16.359 -23.949 -23.204 1.00 98.46  ? 72  SER C O   1 
ATOM 2144 C CB  . SER C 1 72  ? -15.951 -22.726 -20.109 1.00 89.67  ? 72  SER C CB  1 
ATOM 2145 O OG  . SER C 1 72  ? -16.025 -21.362 -19.729 1.00 101.20 ? 72  SER C OG  1 
ATOM 2146 N N   . LYS C 1 73  ? -16.411 -21.677 -23.095 1.00 92.23  ? 73  LYS C N   1 
ATOM 2147 C CA  . LYS C 1 73  ? -17.271 -21.482 -24.263 1.00 94.49  ? 73  LYS C CA  1 
ATOM 2148 C C   . LYS C 1 73  ? -16.598 -21.863 -25.591 1.00 100.57 ? 73  LYS C C   1 
ATOM 2149 O O   . LYS C 1 73  ? -17.283 -22.383 -26.485 1.00 104.18 ? 73  LYS C O   1 
ATOM 2150 C CB  . LYS C 1 73  ? -17.792 -20.033 -24.344 1.00 95.12  ? 73  LYS C CB  1 
ATOM 2151 N N   . ASN C 1 74  ? -15.282 -21.598 -25.739 1.00 93.52  ? 74  ASN C N   1 
ATOM 2152 C CA  . ASN C 1 74  ? -14.575 -21.860 -27.003 1.00 92.69  ? 74  ASN C CA  1 
ATOM 2153 C C   . ASN C 1 74  ? -13.941 -23.232 -27.143 1.00 97.58  ? 74  ASN C C   1 
ATOM 2154 O O   . ASN C 1 74  ? -13.842 -23.715 -28.279 1.00 99.25  ? 74  ASN C O   1 
ATOM 2155 C CB  . ASN C 1 74  ? -13.500 -20.812 -27.255 1.00 88.87  ? 74  ASN C CB  1 
ATOM 2156 C CG  . ASN C 1 74  ? -14.071 -19.488 -27.648 1.00 101.86 ? 74  ASN C CG  1 
ATOM 2157 O OD1 . ASN C 1 74  ? -14.379 -19.255 -28.817 1.00 91.92  ? 74  ASN C OD1 1 
ATOM 2158 N ND2 . ASN C 1 74  ? -14.277 -18.623 -26.657 1.00 87.35  ? 74  ASN C ND2 1 
ATOM 2159 N N   . TYR C 1 75  ? -13.463 -23.840 -26.037 1.00 92.15  ? 75  TYR C N   1 
ATOM 2160 C CA  . TYR C 1 75  ? -12.758 -25.118 -26.127 1.00 93.12  ? 75  TYR C CA  1 
ATOM 2161 C C   . TYR C 1 75  ? -13.331 -26.243 -25.265 1.00 101.70 ? 75  TYR C C   1 
ATOM 2162 O O   . TYR C 1 75  ? -12.885 -27.386 -25.396 1.00 104.39 ? 75  TYR C O   1 
ATOM 2163 C CB  . TYR C 1 75  ? -11.270 -24.923 -25.780 1.00 90.42  ? 75  TYR C CB  1 
ATOM 2164 C CG  . TYR C 1 75  ? -10.575 -23.854 -26.592 1.00 88.64  ? 75  TYR C CG  1 
ATOM 2165 C CD1 . TYR C 1 75  ? -10.268 -22.614 -26.035 1.00 86.51  ? 75  TYR C CD1 1 
ATOM 2166 C CD2 . TYR C 1 75  ? -10.247 -24.068 -27.929 1.00 91.47  ? 75  TYR C CD2 1 
ATOM 2167 C CE1 . TYR C 1 75  ? -9.647  -21.613 -26.785 1.00 82.98  ? 75  TYR C CE1 1 
ATOM 2168 C CE2 . TYR C 1 75  ? -9.643  -23.069 -28.696 1.00 90.58  ? 75  TYR C CE2 1 
ATOM 2169 C CZ  . TYR C 1 75  ? -9.334  -21.848 -28.114 1.00 90.28  ? 75  TYR C CZ  1 
ATOM 2170 O OH  . TYR C 1 75  ? -8.688  -20.895 -28.854 1.00 82.47  ? 75  TYR C OH  1 
ATOM 2171 N N   . GLY C 1 76  ? -14.278 -25.924 -24.389 1.00 99.00  ? 76  GLY C N   1 
ATOM 2172 C CA  . GLY C 1 76  ? -14.851 -26.898 -23.466 1.00 101.89 ? 76  GLY C CA  1 
ATOM 2173 C C   . GLY C 1 76  ? -13.887 -27.226 -22.340 1.00 104.31 ? 76  GLY C C   1 
ATOM 2174 O O   . GLY C 1 76  ? -13.971 -28.298 -21.740 1.00 106.99 ? 76  GLY C O   1 
ATOM 2175 N N   . ILE C 1 77  ? -12.951 -26.296 -22.063 1.00 96.64  ? 77  ILE C N   1 
ATOM 2176 C CA  . ILE C 1 77  ? -11.931 -26.406 -21.024 1.00 94.30  ? 77  ILE C CA  1 
ATOM 2177 C C   . ILE C 1 77  ? -12.350 -25.642 -19.763 1.00 97.18  ? 77  ILE C C   1 
ATOM 2178 O O   . ILE C 1 77  ? -12.693 -24.458 -19.837 1.00 95.24  ? 77  ILE C O   1 
ATOM 2179 C CB  . ILE C 1 77  ? -10.540 -25.927 -21.536 1.00 94.30  ? 77  ILE C CB  1 
ATOM 2180 C CG1 . ILE C 1 77  ? -10.038 -26.780 -22.740 1.00 96.57  ? 77  ILE C CG1 1 
ATOM 2181 C CG2 . ILE C 1 77  ? -9.508  -25.941 -20.383 1.00 91.73  ? 77  ILE C CG2 1 
ATOM 2182 C CD1 . ILE C 1 77  ? -8.812  -26.205 -23.472 1.00 92.63  ? 77  ILE C CD1 1 
ATOM 2183 N N   . THR C 1 78  ? -12.280 -26.314 -18.609 1.00 93.33  ? 78  THR C N   1 
ATOM 2184 C CA  . THR C 1 78  ? -12.586 -25.729 -17.315 1.00 91.61  ? 78  THR C CA  1 
ATOM 2185 C C   . THR C 1 78  ? -11.246 -25.425 -16.640 1.00 95.78  ? 78  THR C C   1 
ATOM 2186 O O   . THR C 1 78  ? -10.484 -26.352 -16.330 1.00 97.96  ? 78  THR C O   1 
ATOM 2187 C CB  . THR C 1 78  ? -13.492 -26.670 -16.485 1.00 101.22 ? 78  THR C CB  1 
ATOM 2188 O OG1 . THR C 1 78  ? -14.664 -27.006 -17.233 1.00 109.29 ? 78  THR C OG1 1 
ATOM 2189 C CG2 . THR C 1 78  ? -13.888 -26.065 -15.136 1.00 95.81  ? 78  THR C CG2 1 
ATOM 2190 N N   . VAL C 1 79  ? -10.950 -24.134 -16.440 1.00 89.06  ? 79  VAL C N   1 
ATOM 2191 C CA  . VAL C 1 79  ? -9.726  -23.648 -15.790 1.00 85.54  ? 79  VAL C CA  1 
ATOM 2192 C C   . VAL C 1 79  ? -9.872  -23.883 -14.280 1.00 89.99  ? 79  VAL C C   1 
ATOM 2193 O O   . VAL C 1 79  ? -10.763 -23.313 -13.645 1.00 90.76  ? 79  VAL C O   1 
ATOM 2194 C CB  . VAL C 1 79  ? -9.443  -22.155 -16.141 1.00 86.58  ? 79  VAL C CB  1 
ATOM 2195 C CG1 . VAL C 1 79  ? -8.154  -21.640 -15.496 1.00 83.76  ? 79  VAL C CG1 1 
ATOM 2196 C CG2 . VAL C 1 79  ? -9.420  -21.947 -17.649 1.00 86.60  ? 79  VAL C CG2 1 
ATOM 2197 N N   . LYS C 1 80  ? -9.017  -24.750 -13.728 1.00 86.01  ? 80  LYS C N   1 
ATOM 2198 C CA  . LYS C 1 80  ? -9.025  -25.135 -12.321 1.00 85.48  ? 80  LYS C CA  1 
ATOM 2199 C C   . LYS C 1 80  ? -8.372  -24.086 -11.408 1.00 87.08  ? 80  LYS C C   1 
ATOM 2200 O O   . LYS C 1 80  ? -8.939  -23.776 -10.370 1.00 87.31  ? 80  LYS C O   1 
ATOM 2201 C CB  . LYS C 1 80  ? -8.358  -26.518 -12.142 1.00 88.65  ? 80  LYS C CB  1 
ATOM 2202 C CG  . LYS C 1 80  ? -9.317  -27.706 -12.316 1.00 89.68  ? 80  LYS C CG  1 
ATOM 2203 C CD  . LYS C 1 80  ? -9.455  -28.182 -13.760 1.00 102.82 ? 80  LYS C CD  1 
ATOM 2204 N N   . GLU C 1 81  ? -7.187  -23.557 -11.774 1.00 82.02  ? 81  GLU C N   1 
ATOM 2205 C CA  . GLU C 1 81  ? -6.446  -22.571 -10.977 1.00 79.37  ? 81  GLU C CA  1 
ATOM 2206 C C   . GLU C 1 81  ? -6.773  -21.149 -11.430 1.00 82.92  ? 81  GLU C C   1 
ATOM 2207 O O   . GLU C 1 81  ? -6.216  -20.652 -12.406 1.00 82.45  ? 81  GLU C O   1 
ATOM 2208 C CB  . GLU C 1 81  ? -4.933  -22.844 -11.024 1.00 79.50  ? 81  GLU C CB  1 
ATOM 2209 N N   . GLU C 1 82  ? -7.687  -20.499 -10.709 1.00 78.39  ? 82  GLU C N   1 
ATOM 2210 C CA  . GLU C 1 82  ? -8.177  -19.155 -11.012 1.00 76.60  ? 82  GLU C CA  1 
ATOM 2211 C C   . GLU C 1 82  ? -7.251  -18.032 -10.515 1.00 77.91  ? 82  GLU C C   1 
ATOM 2212 O O   . GLU C 1 82  ? -7.573  -16.869 -10.731 1.00 77.68  ? 82  GLU C O   1 
ATOM 2213 C CB  . GLU C 1 82  ? -9.602  -18.962 -10.445 1.00 79.27  ? 82  GLU C CB  1 
ATOM 2214 C CG  . GLU C 1 82  ? -10.626 -19.990 -10.922 1.00 85.98  ? 82  GLU C CG  1 
ATOM 2215 C CD  . GLU C 1 82  ? -12.052 -19.815 -10.434 1.00 109.15 ? 82  GLU C CD  1 
ATOM 2216 O OE1 . GLU C 1 82  ? -12.301 -18.965 -9.546  1.00 102.31 ? 82  GLU C OE1 1 
ATOM 2217 O OE2 . GLU C 1 82  ? -12.928 -20.550 -10.943 1.00 111.26 ? 82  GLU C OE2 1 
ATOM 2218 N N   . ASP C 1 83  ? -6.113  -18.359 -9.874  1.00 72.75  ? 83  ASP C N   1 
ATOM 2219 C CA  . ASP C 1 83  ? -5.180  -17.356 -9.321  1.00 70.31  ? 83  ASP C CA  1 
ATOM 2220 C C   . ASP C 1 83  ? -3.810  -17.309 -10.040 1.00 71.94  ? 83  ASP C C   1 
ATOM 2221 O O   . ASP C 1 83  ? -2.924  -16.553 -9.621  1.00 71.94  ? 83  ASP C O   1 
ATOM 2222 C CB  . ASP C 1 83  ? -4.978  -17.603 -7.818  1.00 71.56  ? 83  ASP C CB  1 
ATOM 2223 N N   . GLN C 1 84  ? -3.635  -18.120 -11.103 1.00 66.31  ? 84  GLN C N   1 
ATOM 2224 C CA  . GLN C 1 84  ? -2.396  -18.207 -11.890 1.00 63.97  ? 84  GLN C CA  1 
ATOM 2225 C C   . GLN C 1 84  ? -2.096  -16.904 -12.676 1.00 64.71  ? 84  GLN C C   1 
ATOM 2226 O O   . GLN C 1 84  ? -3.041  -16.197 -13.036 1.00 62.15  ? 84  GLN C O   1 
ATOM 2227 C CB  . GLN C 1 84  ? -2.450  -19.409 -12.849 1.00 65.22  ? 84  GLN C CB  1 
ATOM 2228 C CG  . GLN C 1 84  ? -3.425  -19.247 -14.010 1.00 68.35  ? 84  GLN C CG  1 
ATOM 2229 C CD  . GLN C 1 84  ? -3.617  -20.499 -14.800 1.00 80.66  ? 84  GLN C CD  1 
ATOM 2230 O OE1 . GLN C 1 84  ? -2.789  -20.881 -15.610 1.00 82.82  ? 84  GLN C OE1 1 
ATOM 2231 N NE2 . GLN C 1 84  ? -4.727  -21.165 -14.590 1.00 75.07  ? 84  GLN C NE2 1 
ATOM 2232 N N   . PRO C 1 85  ? -0.801  -16.583 -12.969 1.00 60.98  ? 85  PRO C N   1 
ATOM 2233 C CA  . PRO C 1 85  ? -0.507  -15.380 -13.774 1.00 60.29  ? 85  PRO C CA  1 
ATOM 2234 C C   . PRO C 1 85  ? -0.770  -15.665 -15.268 1.00 68.87  ? 85  PRO C C   1 
ATOM 2235 O O   . PRO C 1 85  ? -1.225  -16.749 -15.622 1.00 69.20  ? 85  PRO C O   1 
ATOM 2236 C CB  . PRO C 1 85  ? 0.984   -15.119 -13.488 1.00 61.68  ? 85  PRO C CB  1 
ATOM 2237 C CG  . PRO C 1 85  ? 1.549   -16.436 -13.198 1.00 67.28  ? 85  PRO C CG  1 
ATOM 2238 C CD  . PRO C 1 85  ? 0.443   -17.310 -12.623 1.00 62.38  ? 85  PRO C CD  1 
ATOM 2239 N N   . LEU C 1 86  ? -0.486  -14.701 -16.147 1.00 67.04  ? 86  LEU C N   1 
ATOM 2240 C CA  . LEU C 1 86  ? -0.685  -14.886 -17.575 1.00 68.02  ? 86  LEU C CA  1 
ATOM 2241 C C   . LEU C 1 86  ? 0.638   -14.824 -18.323 1.00 74.70  ? 86  LEU C C   1 
ATOM 2242 O O   . LEU C 1 86  ? 1.533   -14.056 -17.958 1.00 76.35  ? 86  LEU C O   1 
ATOM 2243 C CB  . LEU C 1 86  ? -1.674  -13.842 -18.141 1.00 67.87  ? 86  LEU C CB  1 
ATOM 2244 C CG  . LEU C 1 86  ? -3.101  -13.767 -17.518 1.00 71.29  ? 86  LEU C CG  1 
ATOM 2245 C CD1 . LEU C 1 86  ? -4.004  -12.851 -18.305 1.00 70.68  ? 86  LEU C CD1 1 
ATOM 2246 C CD2 . LEU C 1 86  ? -3.772  -15.126 -17.441 1.00 71.35  ? 86  LEU C CD2 1 
ATOM 2247 N N   . LEU C 1 87  ? 0.761   -15.624 -19.376 1.00 70.41  ? 87  LEU C N   1 
ATOM 2248 C CA  . LEU C 1 87  ? 1.959   -15.631 -20.210 1.00 70.83  ? 87  LEU C CA  1 
ATOM 2249 C C   . LEU C 1 87  ? 1.687   -14.680 -21.366 1.00 76.34  ? 87  LEU C C   1 
ATOM 2250 O O   . LEU C 1 87  ? 0.616   -14.735 -21.965 1.00 73.53  ? 87  LEU C O   1 
ATOM 2251 C CB  . LEU C 1 87  ? 2.327   -17.062 -20.719 1.00 70.78  ? 87  LEU C CB  1 
ATOM 2252 C CG  . LEU C 1 87  ? 2.414   -18.202 -19.692 1.00 71.19  ? 87  LEU C CG  1 
ATOM 2253 C CD1 . LEU C 1 87  ? 2.624   -19.509 -20.364 1.00 70.67  ? 87  LEU C CD1 1 
ATOM 2254 C CD2 . LEU C 1 87  ? 3.514   -17.974 -18.671 1.00 72.26  ? 87  LEU C CD2 1 
ATOM 2255 N N   . ILE C 1 88  ? 2.644   -13.787 -21.644 1.00 77.98  ? 88  ILE C N   1 
ATOM 2256 C CA  . ILE C 1 88  ? 2.540   -12.769 -22.682 1.00 79.98  ? 88  ILE C CA  1 
ATOM 2257 C C   . ILE C 1 88  ? 3.357   -13.133 -23.899 1.00 88.89  ? 88  ILE C C   1 
ATOM 2258 O O   . ILE C 1 88  ? 4.559   -13.385 -23.790 1.00 91.48  ? 88  ILE C O   1 
ATOM 2259 C CB  . ILE C 1 88  ? 2.944   -11.374 -22.137 1.00 83.67  ? 88  ILE C CB  1 
ATOM 2260 N N   . HIS C 1 89  ? 2.694   -13.176 -25.063 1.00 85.95  ? 89  HIS C N   1 
ATOM 2261 C CA  . HIS C 1 89  ? 3.320   -13.405 -26.356 1.00 88.18  ? 89  HIS C CA  1 
ATOM 2262 C C   . HIS C 1 89  ? 3.083   -12.152 -27.189 1.00 93.49  ? 89  HIS C C   1 
ATOM 2263 O O   . HIS C 1 89  ? 1.938   -11.830 -27.526 1.00 90.78  ? 89  HIS C O   1 
ATOM 2264 C CB  . HIS C 1 89  ? 2.778   -14.669 -27.055 1.00 89.27  ? 89  HIS C CB  1 
ATOM 2265 C CG  . HIS C 1 89  ? 3.221   -14.790 -28.476 1.00 95.34  ? 89  HIS C CG  1 
ATOM 2266 N ND1 . HIS C 1 89  ? 2.314   -14.723 -29.523 1.00 97.22  ? 89  HIS C ND1 1 
ATOM 2267 C CD2 . HIS C 1 89  ? 4.470   -14.898 -28.987 1.00 100.10 ? 89  HIS C CD2 1 
ATOM 2268 C CE1 . HIS C 1 89  ? 3.033   -14.835 -30.629 1.00 99.07  ? 89  HIS C CE1 1 
ATOM 2269 N NE2 . HIS C 1 89  ? 4.336   -14.934 -30.357 1.00 101.49 ? 89  HIS C NE2 1 
ATOM 2270 N N   . ARG C 1 90  ? 4.174   -11.435 -27.490 1.00 94.40  ? 90  ARG C N   1 
ATOM 2271 C CA  . ARG C 1 90  ? 4.159   -10.186 -28.260 1.00 95.75  ? 90  ARG C CA  1 
ATOM 2272 C C   . ARG C 1 90  ? 4.564   -10.438 -29.732 1.00 103.41 ? 90  ARG C C   1 
ATOM 2273 O O   . ARG C 1 90  ? 5.758   -10.584 -30.024 1.00 106.18 ? 90  ARG C O   1 
ATOM 2274 C CB  . ARG C 1 90  ? 5.071   -9.132  -27.585 1.00 96.54  ? 90  ARG C CB  1 
ATOM 2275 C CG  . ARG C 1 90  ? 4.694   -8.784  -26.139 1.00 92.98  ? 90  ARG C CG  1 
ATOM 2276 C CD  . ARG C 1 90  ? 5.889   -8.257  -25.369 1.00 104.86 ? 90  ARG C CD  1 
ATOM 2277 N NE  . ARG C 1 90  ? 5.525   -7.748  -24.042 1.00 111.16 ? 90  ARG C NE  1 
ATOM 2278 C CZ  . ARG C 1 90  ? 6.398   -7.468  -23.077 1.00 125.76 ? 90  ARG C CZ  1 
ATOM 2279 N NH1 . ARG C 1 90  ? 7.697   -7.665  -23.269 1.00 110.33 ? 90  ARG C NH1 1 
ATOM 2280 N NH2 . ARG C 1 90  ? 5.976   -7.008  -21.908 1.00 118.62 ? 90  ARG C NH2 1 
ATOM 2281 N N   . PRO C 1 91  ? 3.594   -10.532 -30.678 1.00 100.32 ? 91  PRO C N   1 
ATOM 2282 C CA  . PRO C 1 91  ? 3.966   -10.783 -32.081 1.00 102.19 ? 91  PRO C CA  1 
ATOM 2283 C C   . PRO C 1 91  ? 4.387   -9.518  -32.813 1.00 105.10 ? 91  PRO C C   1 
ATOM 2284 O O   . PRO C 1 91  ? 5.413   -9.532  -33.484 1.00 106.92 ? 91  PRO C O   1 
ATOM 2285 C CB  . PRO C 1 91  ? 2.699   -11.397 -32.691 1.00 102.66 ? 91  PRO C CB  1 
ATOM 2286 C CG  . PRO C 1 91  ? 1.606   -11.247 -31.636 1.00 104.12 ? 91  PRO C CG  1 
ATOM 2287 C CD  . PRO C 1 91  ? 2.133   -10.389 -30.538 1.00 99.41  ? 91  PRO C CD  1 
ATOM 2288 N N   . GLU C 1 105 ? -0.641  -8.650  -26.259 1.00 75.46  ? 105 GLU C N   1 
ATOM 2289 C CA  . GLU C 1 105 ? -1.382  -9.040  -27.463 1.00 75.11  ? 105 GLU C CA  1 
ATOM 2290 C C   . GLU C 1 105 ? -1.929  -10.475 -27.340 1.00 77.76  ? 105 GLU C C   1 
ATOM 2291 O O   . GLU C 1 105 ? -3.142  -10.620 -27.186 1.00 76.58  ? 105 GLU C O   1 
ATOM 2292 C CB  . GLU C 1 105 ? -0.551  -8.843  -28.731 1.00 78.05  ? 105 GLU C CB  1 
ATOM 2293 N N   . ILE C 1 106 ? -1.068  -11.524 -27.359 1.00 74.22  ? 106 ILE C N   1 
ATOM 2294 C CA  . ILE C 1 106 ? -1.535  -12.904 -27.153 1.00 73.05  ? 106 ILE C CA  1 
ATOM 2295 C C   . ILE C 1 106 ? -1.300  -13.281 -25.669 1.00 78.50  ? 106 ILE C C   1 
ATOM 2296 O O   . ILE C 1 106 ? -0.177  -13.184 -25.154 1.00 78.74  ? 106 ILE C O   1 
ATOM 2297 C CB  . ILE C 1 106 ? -0.958  -13.947 -28.162 1.00 76.91  ? 106 ILE C CB  1 
ATOM 2298 C CG1 . ILE C 1 106 ? -1.440  -13.665 -29.607 1.00 77.60  ? 106 ILE C CG1 1 
ATOM 2299 C CG2 . ILE C 1 106 ? -1.305  -15.389 -27.766 1.00 75.90  ? 106 ILE C CG2 1 
ATOM 2300 N N   . LEU C 1 107 ? -2.383  -13.664 -24.985 1.00 74.32  ? 107 LEU C N   1 
ATOM 2301 C CA  . LEU C 1 107 ? -2.314  -14.053 -23.585 1.00 74.25  ? 107 LEU C CA  1 
ATOM 2302 C C   . LEU C 1 107 ? -2.666  -15.525 -23.428 1.00 77.17  ? 107 LEU C C   1 
ATOM 2303 O O   . LEU C 1 107 ? -3.728  -15.970 -23.899 1.00 76.41  ? 107 LEU C O   1 
ATOM 2304 C CB  . LEU C 1 107 ? -3.194  -13.159 -22.696 1.00 73.56  ? 107 LEU C CB  1 
ATOM 2305 C CG  . LEU C 1 107 ? -2.787  -11.697 -22.654 1.00 78.70  ? 107 LEU C CG  1 
ATOM 2306 C CD1 . LEU C 1 107 ? -3.896  -10.855 -22.100 1.00 78.32  ? 107 LEU C CD1 1 
ATOM 2307 C CD2 . LEU C 1 107 ? -1.502  -11.496 -21.850 1.00 80.43  ? 107 LEU C CD2 1 
ATOM 2308 N N   . LEU C 1 108 ? -1.725  -16.286 -22.816 1.00 71.74  ? 108 LEU C N   1 
ATOM 2309 C CA  . LEU C 1 108 ? -1.847  -17.722 -22.588 1.00 71.02  ? 108 LEU C CA  1 
ATOM 2310 C C   . LEU C 1 108 ? -1.837  -18.059 -21.098 1.00 70.85  ? 108 LEU C C   1 
ATOM 2311 O O   . LEU C 1 108 ? -1.188  -17.383 -20.302 1.00 67.51  ? 108 LEU C O   1 
ATOM 2312 C CB  . LEU C 1 108 ? -0.716  -18.480 -23.295 1.00 73.28  ? 108 LEU C CB  1 
ATOM 2313 C CG  . LEU C 1 108 ? -0.407  -18.063 -24.738 1.00 78.64  ? 108 LEU C CG  1 
ATOM 2314 C CD1 . LEU C 1 108 ? 1.023   -18.410 -25.098 1.00 79.68  ? 108 LEU C CD1 1 
ATOM 2315 C CD2 . LEU C 1 108 ? -1.434  -18.620 -25.728 1.00 79.80  ? 108 LEU C CD2 1 
ATOM 2316 N N   . LEU C 1 109 ? -2.533  -19.132 -20.742 1.00 68.94  ? 109 LEU C N   1 
ATOM 2317 C CA  . LEU C 1 109 ? -2.608  -19.622 -19.374 1.00 68.37  ? 109 LEU C CA  1 
ATOM 2318 C C   . LEU C 1 109 ? -1.524  -20.649 -19.120 1.00 73.37  ? 109 LEU C C   1 
ATOM 2319 O O   . LEU C 1 109 ? -1.438  -21.618 -19.864 1.00 74.39  ? 109 LEU C O   1 
ATOM 2320 C CB  . LEU C 1 109 ? -3.984  -20.241 -19.059 1.00 69.38  ? 109 LEU C CB  1 
ATOM 2321 C CG  . LEU C 1 109 ? -5.246  -19.411 -19.336 1.00 75.36  ? 109 LEU C CG  1 
ATOM 2322 C CD1 . LEU C 1 109 ? -6.456  -20.097 -18.776 1.00 76.12  ? 109 LEU C CD1 1 
ATOM 2323 C CD2 . LEU C 1 109 ? -5.167  -18.043 -18.698 1.00 79.29  ? 109 LEU C CD2 1 
ATOM 2324 N N   . PRO C 1 110 ? -0.749  -20.513 -18.015 1.00 70.55  ? 110 PRO C N   1 
ATOM 2325 C CA  . PRO C 1 110 ? 0.288   -21.509 -17.701 1.00 71.19  ? 110 PRO C CA  1 
ATOM 2326 C C   . PRO C 1 110 ? -0.258  -22.936 -17.565 1.00 77.73  ? 110 PRO C C   1 
ATOM 2327 O O   . PRO C 1 110 ? 0.440   -23.893 -17.907 1.00 80.76  ? 110 PRO C O   1 
ATOM 2328 C CB  . PRO C 1 110 ? 0.863   -21.005 -16.377 1.00 71.01  ? 110 PRO C CB  1 
ATOM 2329 C CG  . PRO C 1 110 ? 0.560   -19.580 -16.339 1.00 73.00  ? 110 PRO C CG  1 
ATOM 2330 C CD  . PRO C 1 110 ? -0.734  -19.402 -17.044 1.00 69.35  ? 110 PRO C CD  1 
ATOM 2331 N N   . GLU C 1 111 ? -1.517  -23.072 -17.106 1.00 72.16  ? 111 GLU C N   1 
ATOM 2332 C CA  . GLU C 1 111 ? -2.227  -24.341 -16.920 1.00 73.35  ? 111 GLU C CA  1 
ATOM 2333 C C   . GLU C 1 111 ? -2.467  -25.065 -18.268 1.00 78.59  ? 111 GLU C C   1 
ATOM 2334 O O   . GLU C 1 111 ? -2.596  -26.272 -18.286 1.00 82.30  ? 111 GLU C O   1 
ATOM 2335 C CB  . GLU C 1 111 ? -3.569  -24.057 -16.221 1.00 73.80  ? 111 GLU C CB  1 
ATOM 2336 C CG  . GLU C 1 111 ? -4.406  -25.276 -15.852 1.00 81.33  ? 111 GLU C CG  1 
ATOM 2337 C CD  . GLU C 1 111 ? -5.766  -24.993 -15.234 1.00 104.73 ? 111 GLU C CD  1 
ATOM 2338 O OE1 . GLU C 1 111 ? -5.869  -24.026 -14.445 1.00 103.56 ? 111 GLU C OE1 1 
ATOM 2339 O OE2 . GLU C 1 111 ? -6.713  -25.777 -15.484 1.00 99.86  ? 111 GLU C OE2 1 
ATOM 2340 N N   . LEU C 1 112 ? -2.552  -24.336 -19.372 1.00 73.54  ? 112 LEU C N   1 
ATOM 2341 C CA  . LEU C 1 112 ? -2.827  -24.908 -20.696 1.00 75.18  ? 112 LEU C CA  1 
ATOM 2342 C C   . LEU C 1 112 ? -1.606  -24.900 -21.619 1.00 81.93  ? 112 LEU C C   1 
ATOM 2343 O O   . LEU C 1 112 ? -1.689  -25.362 -22.771 1.00 83.12  ? 112 LEU C O   1 
ATOM 2344 C CB  . LEU C 1 112 ? -3.991  -24.169 -21.372 1.00 73.50  ? 112 LEU C CB  1 
ATOM 2345 C CG  . LEU C 1 112 ? -5.241  -23.938 -20.540 1.00 75.72  ? 112 LEU C CG  1 
ATOM 2346 C CD1 . LEU C 1 112 ? -6.199  -23.072 -21.288 1.00 75.24  ? 112 LEU C CD1 1 
ATOM 2347 C CD2 . LEU C 1 112 ? -5.905  -25.248 -20.158 1.00 79.49  ? 112 LEU C CD2 1 
ATOM 2348 N N   . SER C 1 113 ? -0.467  -24.412 -21.091 1.00 78.85  ? 113 SER C N   1 
ATOM 2349 C CA  . SER C 1 113 ? 0.809   -24.308 -21.800 1.00 79.67  ? 113 SER C CA  1 
ATOM 2350 C C   . SER C 1 113 ? 1.799   -25.347 -21.304 1.00 84.98  ? 113 SER C C   1 
ATOM 2351 O O   . SER C 1 113 ? 1.883   -25.632 -20.108 1.00 83.61  ? 113 SER C O   1 
ATOM 2352 C CB  . SER C 1 113 ? 1.395   -22.901 -21.673 1.00 80.56  ? 113 SER C CB  1 
ATOM 2353 O OG  . SER C 1 113 ? 0.431   -21.893 -21.930 1.00 82.80  ? 113 SER C OG  1 
ATOM 2354 N N   . PHE C 1 114 ? 2.541   -25.912 -22.241 1.00 85.88  ? 114 PHE C N   1 
ATOM 2355 C CA  . PHE C 1 114 ? 3.521   -26.952 -21.999 1.00 89.28  ? 114 PHE C CA  1 
ATOM 2356 C C   . PHE C 1 114 ? 4.830   -26.562 -22.599 1.00 97.64  ? 114 PHE C C   1 
ATOM 2357 O O   . PHE C 1 114 ? 4.880   -26.020 -23.705 1.00 98.35  ? 114 PHE C O   1 
ATOM 2358 C CB  . PHE C 1 114 ? 3.039   -28.288 -22.599 1.00 94.47  ? 114 PHE C CB  1 
ATOM 2359 C CG  . PHE C 1 114 ? 1.777   -28.781 -21.931 1.00 94.65  ? 114 PHE C CG  1 
ATOM 2360 C CD1 . PHE C 1 114 ? 0.531   -28.284 -22.306 1.00 94.70  ? 114 PHE C CD1 1 
ATOM 2361 C CD2 . PHE C 1 114 ? 1.838   -29.688 -20.871 1.00 96.95  ? 114 PHE C CD2 1 
ATOM 2362 C CE1 . PHE C 1 114 ? -0.628  -28.686 -21.641 1.00 95.00  ? 114 PHE C CE1 1 
ATOM 2363 C CE2 . PHE C 1 114 ? 0.672   -30.108 -20.219 1.00 98.95  ? 114 PHE C CE2 1 
ATOM 2364 C CZ  . PHE C 1 114 ? -0.553  -29.604 -20.610 1.00 95.78  ? 114 PHE C CZ  1 
ATOM 2365 N N   . MET C 1 115 ? 5.899   -26.881 -21.892 1.00 96.24  ? 115 MET C N   1 
ATOM 2366 C CA  . MET C 1 115 ? 7.247   -26.599 -22.355 1.00 98.23  ? 115 MET C CA  1 
ATOM 2367 C C   . MET C 1 115 ? 7.560   -27.536 -23.494 1.00 105.26 ? 115 MET C C   1 
ATOM 2368 O O   . MET C 1 115 ? 6.987   -28.626 -23.565 1.00 106.10 ? 115 MET C O   1 
ATOM 2369 C CB  . MET C 1 115 ? 8.229   -26.756 -21.198 1.00 100.76 ? 115 MET C CB  1 
ATOM 2370 C CG  . MET C 1 115 ? 7.837   -25.921 -19.986 1.00 100.02 ? 115 MET C CG  1 
ATOM 2371 S SD  . MET C 1 115 ? 8.969   -24.554 -19.714 1.00 104.00 ? 115 MET C SD  1 
ATOM 2372 C CE  . MET C 1 115 ? 8.421   -23.374 -20.965 1.00 100.60 ? 115 MET C CE  1 
ATOM 2373 N N   . THR C 1 116 ? 8.388   -27.082 -24.439 1.00 104.36 ? 116 THR C N   1 
ATOM 2374 C CA  . THR C 1 116 ? 8.729   -27.885 -25.614 1.00 109.35 ? 116 THR C CA  1 
ATOM 2375 C C   . THR C 1 116 ? 9.909   -28.813 -25.279 1.00 118.35 ? 116 THR C C   1 
ATOM 2376 O O   . THR C 1 116 ? 10.226  -29.725 -26.041 1.00 124.10 ? 116 THR C O   1 
ATOM 2377 C CB  . THR C 1 116 ? 8.888   -27.004 -26.865 1.00 111.82 ? 116 THR C CB  1 
ATOM 2378 O OG1 . THR C 1 116 ? 9.742   -25.885 -26.615 1.00 106.40 ? 116 THR C OG1 1 
ATOM 2379 C CG2 . THR C 1 116 ? 7.553   -26.497 -27.353 1.00 107.69 ? 116 THR C CG2 1 
ATOM 2380 N N   . GLY C 1 117 ? 10.487  -28.578 -24.112 1.00 112.63 ? 117 GLY C N   1 
ATOM 2381 C CA  . GLY C 1 117 ? 11.549  -29.333 -23.468 1.00 115.63 ? 117 GLY C CA  1 
ATOM 2382 C C   . GLY C 1 117 ? 11.311  -29.268 -21.964 1.00 117.60 ? 117 GLY C C   1 
ATOM 2383 O O   . GLY C 1 117 ? 10.174  -29.489 -21.526 1.00 114.71 ? 117 GLY C O   1 
ATOM 2384 N N   . ILE C 1 118 ? 12.330  -28.909 -21.132 1.00 114.49 ? 118 ILE C N   1 
ATOM 2385 C CA  . ILE C 1 118 ? 13.728  -28.622 -21.490 1.00 128.38 ? 118 ILE C CA  1 
ATOM 2386 C C   . ILE C 1 118 ? 14.541  -29.929 -21.339 1.00 168.67 ? 118 ILE C C   1 
ATOM 2387 O O   . ILE C 1 118 ? 14.316  -30.902 -22.069 1.00 144.74 ? 118 ILE C O   1 
ATOM 2388 C CB  . ILE C 1 118 ? 14.318  -27.431 -20.644 1.00 128.01 ? 118 ILE C CB  1 
ATOM 2389 C CG1 . ILE C 1 118 ? 13.418  -26.167 -20.722 1.00 122.79 ? 118 ILE C CG1 1 
ATOM 2390 C CG2 . ILE C 1 118 ? 15.746  -27.090 -21.093 1.00 133.62 ? 118 ILE C CG2 1 
ATOM 2391 C CD1 . ILE C 1 118 ? 13.718  -25.040 -19.705 1.00 119.47 ? 118 ILE C CD1 1 
ATOM 2392 N N   . ASP D 1 3   ? -9.819  7.208   -73.454 1.00 102.83 ? 3   ASP D N   1 
ATOM 2393 C CA  . ASP D 1 3   ? -9.422  5.909   -74.010 1.00 102.34 ? 3   ASP D CA  1 
ATOM 2394 C C   . ASP D 1 3   ? -10.654 4.940   -74.122 1.00 95.26  ? 3   ASP D C   1 
ATOM 2395 O O   . ASP D 1 3   ? -11.654 5.305   -74.756 1.00 90.11  ? 3   ASP D O   1 
ATOM 2396 C CB  . ASP D 1 3   ? -8.273  5.314   -73.144 1.00 106.85 ? 3   ASP D CB  1 
ATOM 2397 C CG  . ASP D 1 3   ? -7.350  4.339   -73.869 1.00 120.47 ? 3   ASP D CG  1 
ATOM 2398 O OD1 . ASP D 1 3   ? -6.855  3.395   -73.211 1.00 119.88 ? 3   ASP D OD1 1 
ATOM 2399 O OD2 . ASP D 1 3   ? -7.123  4.522   -75.106 1.00 127.33 ? 3   ASP D OD2 1 
ATOM 2400 N N   . CYS D 1 4   ? -10.559 3.719   -73.524 1.00 87.95  ? 4   CYS D N   1 
ATOM 2401 C CA  . CYS D 1 4   ? -11.613 2.700   -73.467 1.00 82.93  ? 4   CYS D CA  1 
ATOM 2402 C C   . CYS D 1 4   ? -12.724 3.246   -72.549 1.00 79.76  ? 4   CYS D C   1 
ATOM 2403 O O   . CYS D 1 4   ? -12.433 3.682   -71.439 1.00 80.64  ? 4   CYS D O   1 
ATOM 2404 C CB  . CYS D 1 4   ? -11.030 1.381   -72.955 1.00 84.41  ? 4   CYS D CB  1 
ATOM 2405 S SG  . CYS D 1 4   ? -12.249 0.129   -72.466 1.00 84.05  ? 4   CYS D SG  1 
ATOM 2406 N N   . VAL D 1 5   ? -13.979 3.267   -73.035 1.00 69.14  ? 5   VAL D N   1 
ATOM 2407 C CA  . VAL D 1 5   ? -15.157 3.791   -72.331 1.00 63.52  ? 5   VAL D CA  1 
ATOM 2408 C C   . VAL D 1 5   ? -15.288 3.210   -70.912 1.00 65.72  ? 5   VAL D C   1 
ATOM 2409 O O   . VAL D 1 5   ? -15.529 3.975   -69.969 1.00 65.81  ? 5   VAL D O   1 
ATOM 2410 C CB  . VAL D 1 5   ? -16.461 3.584   -73.150 1.00 63.22  ? 5   VAL D CB  1 
ATOM 2411 C CG1 . VAL D 1 5   ? -17.666 4.149   -72.414 1.00 59.09  ? 5   VAL D CG1 1 
ATOM 2412 C CG2 . VAL D 1 5   ? -16.353 4.180   -74.557 1.00 64.75  ? 5   VAL D CG2 1 
ATOM 2413 N N   . LEU D 1 6   ? -15.091 1.881   -70.745 1.00 61.21  ? 6   LEU D N   1 
ATOM 2414 C CA  . LEU D 1 6   ? -15.186 1.271   -69.407 1.00 59.41  ? 6   LEU D CA  1 
ATOM 2415 C C   . LEU D 1 6   ? -14.135 1.840   -68.434 1.00 63.90  ? 6   LEU D C   1 
ATOM 2416 O O   . LEU D 1 6   ? -14.471 2.122   -67.284 1.00 61.69  ? 6   LEU D O   1 
ATOM 2417 C CB  . LEU D 1 6   ? -15.143 -0.270  -69.456 1.00 58.56  ? 6   LEU D CB  1 
ATOM 2418 C CG  . LEU D 1 6   ? -15.552 -1.016  -68.140 1.00 59.56  ? 6   LEU D CG  1 
ATOM 2419 C CD1 . LEU D 1 6   ? -16.928 -0.588  -67.618 1.00 54.57  ? 6   LEU D CD1 1 
ATOM 2420 C CD2 . LEU D 1 6   ? -15.511 -2.481  -68.308 1.00 59.47  ? 6   LEU D CD2 1 
ATOM 2421 N N   . ASP D 1 7   ? -12.905 2.076   -68.913 1.00 67.35  ? 7   ASP D N   1 
ATOM 2422 C CA  . ASP D 1 7   ? -11.819 2.658   -68.103 1.00 70.80  ? 7   ASP D CA  1 
ATOM 2423 C C   . ASP D 1 7   ? -12.163 4.082   -67.674 1.00 73.73  ? 7   ASP D C   1 
ATOM 2424 O O   . ASP D 1 7   ? -11.983 4.418   -66.511 1.00 71.99  ? 7   ASP D O   1 
ATOM 2425 C CB  . ASP D 1 7   ? -10.478 2.620   -68.858 1.00 78.50  ? 7   ASP D CB  1 
ATOM 2426 C CG  . ASP D 1 7   ? -9.893  1.227   -69.059 1.00 96.82  ? 7   ASP D CG  1 
ATOM 2427 O OD1 . ASP D 1 7   ? -10.224 0.310   -68.252 1.00 95.71  ? 7   ASP D OD1 1 
ATOM 2428 O OD2 . ASP D 1 7   ? -9.106  1.049   -70.017 1.00 108.22 ? 7   ASP D OD2 1 
ATOM 2429 N N   . VAL D 1 8   ? -12.723 4.888   -68.607 1.00 71.90  ? 8   VAL D N   1 
ATOM 2430 C CA  . VAL D 1 8   ? -13.185 6.260   -68.377 1.00 71.68  ? 8   VAL D CA  1 
ATOM 2431 C C   . VAL D 1 8   ? -14.271 6.237   -67.312 1.00 72.56  ? 8   VAL D C   1 
ATOM 2432 O O   . VAL D 1 8   ? -14.187 6.994   -66.355 1.00 74.06  ? 8   VAL D O   1 
ATOM 2433 C CB  . VAL D 1 8   ? -13.641 6.948   -69.687 1.00 75.96  ? 8   VAL D CB  1 
ATOM 2434 C CG1 . VAL D 1 8   ? -14.185 8.346   -69.423 1.00 75.77  ? 8   VAL D CG1 1 
ATOM 2435 C CG2 . VAL D 1 8   ? -12.499 7.018   -70.686 1.00 79.93  ? 8   VAL D CG2 1 
ATOM 2436 N N   . MET D 1 9   ? -15.234 5.315   -67.448 1.00 66.50  ? 9   MET D N   1 
ATOM 2437 C CA  . MET D 1 9   ? -16.316 5.074   -66.487 1.00 63.15  ? 9   MET D CA  1 
ATOM 2438 C C   . MET D 1 9   ? -15.791 4.683   -65.105 1.00 67.44  ? 9   MET D C   1 
ATOM 2439 O O   . MET D 1 9   ? -16.307 5.194   -64.111 1.00 65.50  ? 9   MET D O   1 
ATOM 2440 C CB  . MET D 1 9   ? -17.265 3.987   -66.999 1.00 62.43  ? 9   MET D CB  1 
ATOM 2441 C CG  . MET D 1 9   ? -18.180 4.447   -68.080 1.00 65.05  ? 9   MET D CG  1 
ATOM 2442 S SD  . MET D 1 9   ? -19.299 3.100   -68.516 1.00 66.31  ? 9   MET D SD  1 
ATOM 2443 C CE  . MET D 1 9   ? -20.370 3.958   -69.674 1.00 62.05  ? 9   MET D CE  1 
ATOM 2444 N N   . HIS D 1 10  ? -14.765 3.794   -65.038 1.00 67.37  ? 10  HIS D N   1 
ATOM 2445 C CA  . HIS D 1 10  ? -14.155 3.348   -63.770 1.00 68.08  ? 10  HIS D CA  1 
ATOM 2446 C C   . HIS D 1 10  ? -13.546 4.539   -63.019 1.00 74.56  ? 10  HIS D C   1 
ATOM 2447 O O   . HIS D 1 10  ? -13.701 4.630   -61.802 1.00 73.27  ? 10  HIS D O   1 
ATOM 2448 C CB  . HIS D 1 10  ? -13.074 2.258   -63.994 1.00 71.63  ? 10  HIS D CB  1 
ATOM 2449 C CG  . HIS D 1 10  ? -13.589 0.883   -64.340 1.00 74.66  ? 10  HIS D CG  1 
ATOM 2450 N ND1 . HIS D 1 10  ? -14.857 0.446   -63.942 1.00 73.63  ? 10  HIS D ND1 1 
ATOM 2451 C CD2 . HIS D 1 10  ? -12.973 -0.130  -65.004 1.00 78.43  ? 10  HIS D CD2 1 
ATOM 2452 C CE1 . HIS D 1 10  ? -14.971 -0.796  -64.397 1.00 72.30  ? 10  HIS D CE1 1 
ATOM 2453 N NE2 . HIS D 1 10  ? -13.867 -1.188  -65.042 1.00 75.65  ? 10  HIS D NE2 1 
ATOM 2454 N N   . ALA D 1 11  ? -12.873 5.463   -63.752 1.00 73.64  ? 11  ALA D N   1 
ATOM 2455 C CA  . ALA D 1 11  ? -12.260 6.668   -63.192 1.00 74.99  ? 11  ALA D CA  1 
ATOM 2456 C C   . ALA D 1 11  ? -13.313 7.615   -62.623 1.00 79.47  ? 11  ALA D C   1 
ATOM 2457 O O   . ALA D 1 11  ? -13.121 8.131   -61.524 1.00 80.24  ? 11  ALA D O   1 
ATOM 2458 C CB  . ALA D 1 11  ? -11.412 7.368   -64.232 1.00 79.37  ? 11  ALA D CB  1 
ATOM 2459 N N   . ILE D 1 12  ? -14.449 7.798   -63.329 1.00 76.02  ? 12  ILE D N   1 
ATOM 2460 C CA  . ILE D 1 12  ? -15.558 8.634   -62.839 1.00 74.69  ? 12  ILE D CA  1 
ATOM 2461 C C   . ILE D 1 12  ? -16.192 7.961   -61.589 1.00 75.07  ? 12  ILE D C   1 
ATOM 2462 O O   . ILE D 1 12  ? -16.546 8.655   -60.630 1.00 71.97  ? 12  ILE D O   1 
ATOM 2463 C CB  . ILE D 1 12  ? -16.617 8.910   -63.947 1.00 76.49  ? 12  ILE D CB  1 
ATOM 2464 C CG1 . ILE D 1 12  ? -15.979 9.567   -65.183 1.00 79.99  ? 12  ILE D CG1 1 
ATOM 2465 C CG2 . ILE D 1 12  ? -17.790 9.762   -63.421 1.00 75.41  ? 12  ILE D CG2 1 
ATOM 2466 C CD1 . ILE D 1 12  ? -16.735 9.292   -66.486 1.00 80.70  ? 12  ILE D CD1 1 
ATOM 2467 N N   . TYR D 1 13  ? -16.320 6.615   -61.622 1.00 71.24  ? 13  TYR D N   1 
ATOM 2468 C CA  . TYR D 1 13  ? -16.877 5.832   -60.519 1.00 69.88  ? 13  TYR D CA  1 
ATOM 2469 C C   . TYR D 1 13  ? -16.050 6.019   -59.255 1.00 75.28  ? 13  TYR D C   1 
ATOM 2470 O O   . TYR D 1 13  ? -16.605 6.267   -58.188 1.00 73.35  ? 13  TYR D O   1 
ATOM 2471 C CB  . TYR D 1 13  ? -16.971 4.342   -60.887 1.00 70.51  ? 13  TYR D CB  1 
ATOM 2472 C CG  . TYR D 1 13  ? -17.493 3.498   -59.753 1.00 72.53  ? 13  TYR D CG  1 
ATOM 2473 C CD1 . TYR D 1 13  ? -18.862 3.397   -59.503 1.00 73.37  ? 13  TYR D CD1 1 
ATOM 2474 C CD2 . TYR D 1 13  ? -16.619 2.833   -58.893 1.00 73.98  ? 13  TYR D CD2 1 
ATOM 2475 C CE1 . TYR D 1 13  ? -19.349 2.653   -58.428 1.00 74.43  ? 13  TYR D CE1 1 
ATOM 2476 C CE2 . TYR D 1 13  ? -17.096 2.076   -57.822 1.00 72.92  ? 13  TYR D CE2 1 
ATOM 2477 C CZ  . TYR D 1 13  ? -18.463 1.994   -57.590 1.00 81.27  ? 13  TYR D CZ  1 
ATOM 2478 O OH  . TYR D 1 13  ? -18.948 1.262   -56.535 1.00 86.75  ? 13  TYR D OH  1 
ATOM 2479 N N   . GLN D 1 14  ? -14.720 5.906   -59.393 1.00 74.38  ? 14  GLN D N   1 
ATOM 2480 C CA  . GLN D 1 14  ? -13.746 6.055   -58.326 1.00 74.77  ? 14  GLN D CA  1 
ATOM 2481 C C   . GLN D 1 14  ? -13.812 7.430   -57.670 1.00 77.53  ? 14  GLN D C   1 
ATOM 2482 O O   . GLN D 1 14  ? -13.720 7.512   -56.446 1.00 75.59  ? 14  GLN D O   1 
ATOM 2483 C CB  . GLN D 1 14  ? -12.335 5.766   -58.858 1.00 79.48  ? 14  GLN D CB  1 
ATOM 2484 C CG  . GLN D 1 14  ? -11.534 4.698   -58.093 1.00 97.68  ? 14  GLN D CG  1 
ATOM 2485 C CD  . GLN D 1 14  ? -12.324 3.800   -57.170 1.00 103.89 ? 14  GLN D CD  1 
ATOM 2486 O OE1 . GLN D 1 14  ? -12.342 4.009   -55.958 1.00 93.94  ? 14  GLN D OE1 1 
ATOM 2487 N NE2 . GLN D 1 14  ? -12.950 2.761   -57.715 1.00 94.99  ? 14  GLN D NE2 1 
ATOM 2488 N N   . GLN D 1 15  ? -13.997 8.504   -58.461 1.00 76.04  ? 15  GLN D N   1 
ATOM 2489 C CA  . GLN D 1 15  ? -14.123 9.869   -57.931 1.00 77.32  ? 15  GLN D CA  1 
ATOM 2490 C C   . GLN D 1 15  ? -15.426 10.023  -57.130 1.00 79.43  ? 15  GLN D C   1 
ATOM 2491 O O   . GLN D 1 15  ? -15.433 10.638  -56.058 1.00 79.81  ? 15  GLN D O   1 
ATOM 2492 C CB  . GLN D 1 15  ? -14.028 10.907  -59.055 1.00 81.57  ? 15  GLN D CB  1 
ATOM 2493 C CG  . GLN D 1 15  ? -12.694 11.665  -59.099 1.00 103.84 ? 15  GLN D CG  1 
ATOM 2494 C CD  . GLN D 1 15  ? -11.491 10.782  -59.364 1.00 120.80 ? 15  GLN D CD  1 
ATOM 2495 O OE1 . GLN D 1 15  ? -11.348 10.191  -60.450 1.00 114.05 ? 15  GLN D OE1 1 
ATOM 2496 N NE2 . GLN D 1 15  ? -10.593 10.690  -58.377 1.00 107.80 ? 15  GLN D NE2 1 
ATOM 2497 N N   . ASN D 1 16  ? -16.510 9.394   -57.617 1.00 73.65  ? 16  ASN D N   1 
ATOM 2498 C CA  . ASN D 1 16  ? -17.814 9.411   -56.954 1.00 71.45  ? 16  ASN D CA  1 
ATOM 2499 C C   . ASN D 1 16  ? -17.837 8.552   -55.683 1.00 73.88  ? 16  ASN D C   1 
ATOM 2500 O O   . ASN D 1 16  ? -18.569 8.879   -54.757 1.00 71.73  ? 16  ASN D O   1 
ATOM 2501 C CB  . ASN D 1 16  ? -18.902 8.967   -57.918 1.00 69.74  ? 16  ASN D CB  1 
ATOM 2502 C CG  . ASN D 1 16  ? -19.396 10.094  -58.788 1.00 95.58  ? 16  ASN D CG  1 
ATOM 2503 O OD1 . ASN D 1 16  ? -20.386 10.750  -58.464 1.00 89.20  ? 16  ASN D OD1 1 
ATOM 2504 N ND2 . ASN D 1 16  ? -18.702 10.359  -59.893 1.00 88.98  ? 16  ASN D ND2 1 
ATOM 2505 N N   . LYS D 1 17  ? -17.056 7.442   -55.670 1.00 70.69  ? 17  LYS D N   1 
ATOM 2506 C CA  . LYS D 1 17  ? -16.912 6.511   -54.555 1.00 69.44  ? 17  LYS D CA  1 
ATOM 2507 C C   . LYS D 1 17  ? -16.234 7.218   -53.376 1.00 76.41  ? 17  LYS D C   1 
ATOM 2508 O O   . LYS D 1 17  ? -16.722 7.122   -52.254 1.00 75.80  ? 17  LYS D O   1 
ATOM 2509 C CB  . LYS D 1 17  ? -16.130 5.258   -54.984 1.00 70.96  ? 17  LYS D CB  1 
ATOM 2510 C CG  . LYS D 1 17  ? -15.983 4.201   -53.886 1.00 70.90  ? 17  LYS D CG  1 
ATOM 2511 C CD  . LYS D 1 17  ? -15.209 2.982   -54.347 1.00 68.94  ? 17  LYS D CD  1 
ATOM 2512 C CE  . LYS D 1 17  ? -14.907 2.054   -53.200 1.00 68.02  ? 17  LYS D CE  1 
ATOM 2513 N NZ  . LYS D 1 17  ? -14.680 0.654   -53.650 1.00 77.75  ? 17  LYS D NZ  1 
ATOM 2514 N N   . GLU D 1 18  ? -15.137 7.948   -53.649 1.00 75.99  ? 18  GLU D N   1 
ATOM 2515 C CA  . GLU D 1 18  ? -14.375 8.750   -52.699 1.00 77.53  ? 18  GLU D CA  1 
ATOM 2516 C C   . GLU D 1 18  ? -15.282 9.824   -52.091 1.00 84.51  ? 18  GLU D C   1 
ATOM 2517 O O   . GLU D 1 18  ? -15.299 9.996   -50.871 1.00 85.03  ? 18  GLU D O   1 
ATOM 2518 C CB  . GLU D 1 18  ? -13.142 9.379   -53.377 1.00 81.71  ? 18  GLU D CB  1 
ATOM 2519 N N   . HIS D 1 19  ? -16.082 10.490  -52.927 1.00 82.72  ? 19  HIS D N   1 
ATOM 2520 C CA  . HIS D 1 19  ? -17.032 11.508  -52.475 1.00 83.54  ? 19  HIS D CA  1 
ATOM 2521 C C   . HIS D 1 19  ? -18.059 10.916  -51.502 1.00 81.04  ? 19  HIS D C   1 
ATOM 2522 O O   . HIS D 1 19  ? -18.368 11.534  -50.492 1.00 82.27  ? 19  HIS D O   1 
ATOM 2523 C CB  . HIS D 1 19  ? -17.750 12.154  -53.672 1.00 86.29  ? 19  HIS D CB  1 
ATOM 2524 C CG  . HIS D 1 19  ? -18.580 13.336  -53.284 1.00 92.03  ? 19  HIS D CG  1 
ATOM 2525 N ND1 . HIS D 1 19  ? -18.003 14.578  -53.040 1.00 97.62  ? 19  HIS D ND1 1 
ATOM 2526 C CD2 . HIS D 1 19  ? -19.919 13.438  -53.125 1.00 93.41  ? 19  HIS D CD2 1 
ATOM 2527 C CE1 . HIS D 1 19  ? -19.006 15.387  -52.740 1.00 98.23  ? 19  HIS D CE1 1 
ATOM 2528 N NE2 . HIS D 1 19  ? -20.179 14.755  -52.800 1.00 96.15  ? 19  HIS D NE2 1 
ATOM 2529 N N   . PHE D 1 20  ? -18.576 9.720   -51.813 1.00 71.82  ? 20  PHE D N   1 
ATOM 2530 C CA  . PHE D 1 20  ? -19.546 8.992   -50.995 1.00 67.67  ? 20  PHE D CA  1 
ATOM 2531 C C   . PHE D 1 20  ? -18.961 8.657   -49.617 1.00 71.01  ? 20  PHE D C   1 
ATOM 2532 O O   . PHE D 1 20  ? -19.627 8.877   -48.607 1.00 72.01  ? 20  PHE D O   1 
ATOM 2533 C CB  . PHE D 1 20  ? -20.001 7.704   -51.723 1.00 65.50  ? 20  PHE D CB  1 
ATOM 2534 C CG  . PHE D 1 20  ? -20.460 6.581   -50.829 1.00 62.86  ? 20  PHE D CG  1 
ATOM 2535 C CD1 . PHE D 1 20  ? -21.637 6.690   -50.097 1.00 63.79  ? 20  PHE D CD1 1 
ATOM 2536 C CD2 . PHE D 1 20  ? -19.705 5.416   -50.705 1.00 61.18  ? 20  PHE D CD2 1 
ATOM 2537 C CE1 . PHE D 1 20  ? -22.050 5.648   -49.261 1.00 62.39  ? 20  PHE D CE1 1 
ATOM 2538 C CE2 . PHE D 1 20  ? -20.114 4.381   -49.860 1.00 60.56  ? 20  PHE D CE2 1 
ATOM 2539 C CZ  . PHE D 1 20  ? -21.282 4.502   -49.146 1.00 57.97  ? 20  PHE D CZ  1 
ATOM 2540 N N   . GLN D 1 21  ? -17.734 8.117   -49.596 1.00 65.85  ? 21  GLN D N   1 
ATOM 2541 C CA  . GLN D 1 21  ? -17.037 7.718   -48.388 1.00 65.29  ? 21  GLN D CA  1 
ATOM 2542 C C   . GLN D 1 21  ? -16.741 8.901   -47.512 1.00 75.85  ? 21  GLN D C   1 
ATOM 2543 O O   . GLN D 1 21  ? -16.988 8.821   -46.311 1.00 76.46  ? 21  GLN D O   1 
ATOM 2544 C CB  . GLN D 1 21  ? -15.778 6.924   -48.715 1.00 65.67  ? 21  GLN D CB  1 
ATOM 2545 C CG  . GLN D 1 21  ? -16.110 5.556   -49.313 1.00 47.56  ? 21  GLN D CG  1 
ATOM 2546 C CD  . GLN D 1 21  ? -14.886 4.733   -49.621 1.00 67.81  ? 21  GLN D CD  1 
ATOM 2547 O OE1 . GLN D 1 21  ? -13.744 5.188   -49.520 1.00 71.33  ? 21  GLN D OE1 1 
ATOM 2548 N NE2 . GLN D 1 21  ? -15.097 3.485   -49.997 1.00 60.64  ? 21  GLN D NE2 1 
ATOM 2549 N N   . ASP D 1 22  ? -16.291 10.019  -48.107 1.00 77.23  ? 22  ASP D N   1 
ATOM 2550 C CA  . ASP D 1 22  ? -16.018 11.254  -47.372 1.00 79.54  ? 22  ASP D CA  1 
ATOM 2551 C C   . ASP D 1 22  ? -17.303 11.854  -46.802 1.00 83.29  ? 22  ASP D C   1 
ATOM 2552 O O   . ASP D 1 22  ? -17.286 12.385  -45.695 1.00 84.79  ? 22  ASP D O   1 
ATOM 2553 C CB  . ASP D 1 22  ? -15.298 12.281  -48.266 1.00 85.16  ? 22  ASP D CB  1 
ATOM 2554 C CG  . ASP D 1 22  ? -13.882 11.912  -48.686 1.00 105.44 ? 22  ASP D CG  1 
ATOM 2555 O OD1 . ASP D 1 22  ? -13.356 10.884  -48.188 1.00 105.19 ? 22  ASP D OD1 1 
ATOM 2556 O OD2 . ASP D 1 22  ? -13.299 12.649  -49.517 1.00 119.42 ? 22  ASP D OD2 1 
ATOM 2557 N N   . GLU D 1 23  ? -18.412 11.741  -47.542 1.00 79.53  ? 23  GLU D N   1 
ATOM 2558 C CA  . GLU D 1 23  ? -19.724 12.259  -47.139 1.00 80.18  ? 23  GLU D CA  1 
ATOM 2559 C C   . GLU D 1 23  ? -20.253 11.517  -45.917 1.00 83.35  ? 23  GLU D C   1 
ATOM 2560 O O   . GLU D 1 23  ? -20.827 12.145  -45.027 1.00 84.56  ? 23  GLU D O   1 
ATOM 2561 C CB  . GLU D 1 23  ? -20.723 12.161  -48.301 1.00 81.13  ? 23  GLU D CB  1 
ATOM 2562 C CG  . GLU D 1 23  ? -21.775 13.254  -48.287 1.00 90.63  ? 23  GLU D CG  1 
ATOM 2563 C CD  . GLU D 1 23  ? -22.791 13.209  -49.414 1.00 116.56 ? 23  GLU D CD  1 
ATOM 2564 O OE1 . GLU D 1 23  ? -23.926 13.682  -49.179 1.00 124.49 ? 23  GLU D OE1 1 
ATOM 2565 O OE2 . GLU D 1 23  ? -22.466 12.725  -50.526 1.00 102.79 ? 23  GLU D OE2 1 
ATOM 2566 N N   . CYS D 1 24  ? -20.051 10.184  -45.884 1.00 77.63  ? 24  CYS D N   1 
ATOM 2567 C CA  . CYS D 1 24  ? -20.457 9.296   -44.794 1.00 75.65  ? 24  CYS D CA  1 
ATOM 2568 C C   . CYS D 1 24  ? -19.633 9.596   -43.546 1.00 80.96  ? 24  CYS D C   1 
ATOM 2569 O O   . CYS D 1 24  ? -20.208 9.737   -42.454 1.00 81.37  ? 24  CYS D O   1 
ATOM 2570 C CB  . CYS D 1 24  ? -20.310 7.837   -45.211 1.00 74.12  ? 24  CYS D CB  1 
ATOM 2571 S SG  . CYS D 1 24  ? -21.697 7.188   -46.175 1.00 77.32  ? 24  CYS D SG  1 
ATOM 2572 N N   . THR D 1 25  ? -18.286 9.698   -43.707 1.00 77.02  ? 25  THR D N   1 
ATOM 2573 C CA  . THR D 1 25  ? -17.370 9.989   -42.602 1.00 77.40  ? 25  THR D CA  1 
ATOM 2574 C C   . THR D 1 25  ? -17.704 11.337  -42.000 1.00 83.56  ? 25  THR D C   1 
ATOM 2575 O O   . THR D 1 25  ? -17.873 11.404  -40.782 1.00 82.35  ? 25  THR D O   1 
ATOM 2576 C CB  . THR D 1 25  ? -15.892 9.880   -42.994 1.00 85.49  ? 25  THR D CB  1 
ATOM 2577 O OG1 . THR D 1 25  ? -15.586 10.844  -43.993 1.00 101.22 ? 25  THR D OG1 1 
ATOM 2578 C CG2 . THR D 1 25  ? -15.516 8.508   -43.464 1.00 78.00  ? 25  THR D CG2 1 
ATOM 2579 N N   . LYS D 1 26  ? -17.866 12.396  -42.847 1.00 82.73  ? 26  LYS D N   1 
ATOM 2580 C CA  . LYS D 1 26  ? -18.216 13.744  -42.379 1.00 85.41  ? 26  LYS D CA  1 
ATOM 2581 C C   . LYS D 1 26  ? -19.454 13.685  -41.476 1.00 89.98  ? 26  LYS D C   1 
ATOM 2582 O O   . LYS D 1 26  ? -19.407 14.155  -40.337 1.00 92.08  ? 26  LYS D O   1 
ATOM 2583 C CB  . LYS D 1 26  ? -18.422 14.724  -43.554 1.00 90.24  ? 26  LYS D CB  1 
ATOM 2584 N N   . LEU D 1 27  ? -20.500 12.995  -41.942 1.00 84.22  ? 27  LEU D N   1 
ATOM 2585 C CA  . LEU D 1 27  ? -21.769 12.818  -41.243 1.00 83.69  ? 27  LEU D CA  1 
ATOM 2586 C C   . LEU D 1 27  ? -21.679 11.998  -39.935 1.00 86.83  ? 27  LEU D C   1 
ATOM 2587 O O   . LEU D 1 27  ? -22.387 12.319  -38.980 1.00 88.99  ? 27  LEU D O   1 
ATOM 2588 C CB  . LEU D 1 27  ? -22.766 12.150  -42.209 1.00 82.44  ? 27  LEU D CB  1 
ATOM 2589 C CG  . LEU D 1 27  ? -24.191 12.024  -41.740 1.00 87.09  ? 27  LEU D CG  1 
ATOM 2590 C CD1 . LEU D 1 27  ? -25.025 13.209  -42.190 1.00 89.52  ? 27  LEU D CD1 1 
ATOM 2591 C CD2 . LEU D 1 27  ? -24.775 10.753  -42.216 1.00 87.65  ? 27  LEU D CD2 1 
ATOM 2592 N N   . LEU D 1 28  ? -20.834 10.954  -39.887 1.00 78.90  ? 28  LEU D N   1 
ATOM 2593 C CA  . LEU D 1 28  ? -20.767 10.044  -38.749 1.00 75.13  ? 28  LEU D CA  1 
ATOM 2594 C C   . LEU D 1 28  ? -19.711 10.314  -37.692 1.00 74.11  ? 28  LEU D C   1 
ATOM 2595 O O   . LEU D 1 28  ? -19.973 10.019  -36.530 1.00 72.78  ? 28  LEU D O   1 
ATOM 2596 C CB  . LEU D 1 28  ? -20.586 8.621   -39.260 1.00 73.50  ? 28  LEU D CB  1 
ATOM 2597 C CG  . LEU D 1 28  ? -21.875 7.952   -39.686 1.00 79.30  ? 28  LEU D CG  1 
ATOM 2598 C CD1 . LEU D 1 28  ? -21.687 7.158   -40.976 1.00 79.38  ? 28  LEU D CD1 1 
ATOM 2599 C CD2 . LEU D 1 28  ? -22.437 7.105   -38.568 1.00 79.90  ? 28  LEU D CD2 1 
ATOM 2600 N N   . VAL D 1 29  ? -18.504 10.762  -38.071 1.00 68.11  ? 29  VAL D N   1 
ATOM 2601 C CA  . VAL D 1 29  ? -17.424 10.999  -37.116 1.00 67.64  ? 29  VAL D CA  1 
ATOM 2602 C C   . VAL D 1 29  ? -17.865 12.083  -36.104 1.00 75.92  ? 29  VAL D C   1 
ATOM 2603 O O   . VAL D 1 29  ? -18.267 13.177  -36.519 1.00 78.47  ? 29  VAL D O   1 
ATOM 2604 C CB  . VAL D 1 29  ? -16.071 11.319  -37.807 1.00 71.44  ? 29  VAL D CB  1 
ATOM 2605 C CG1 . VAL D 1 29  ? -15.024 11.787  -36.790 1.00 71.29  ? 29  VAL D CG1 1 
ATOM 2606 C CG2 . VAL D 1 29  ? -15.544 10.121  -38.601 1.00 69.53  ? 29  VAL D CG2 1 
ATOM 2607 N N   . GLY D 1 30  ? -17.857 11.725  -34.811 1.00 72.46  ? 30  GLY D N   1 
ATOM 2608 C CA  . GLY D 1 30  ? -18.279 12.593  -33.711 1.00 73.72  ? 30  GLY D CA  1 
ATOM 2609 C C   . GLY D 1 30  ? -19.659 12.262  -33.162 1.00 77.59  ? 30  GLY D C   1 
ATOM 2610 O O   . GLY D 1 30  ? -20.003 12.674  -32.051 1.00 79.42  ? 30  GLY D O   1 
ATOM 2611 N N   . ASN D 1 31  ? -20.460 11.518  -33.953 1.00 71.10  ? 31  ASN D N   1 
ATOM 2612 C CA  . ASN D 1 31  ? -21.815 11.076  -33.637 1.00 70.36  ? 31  ASN D CA  1 
ATOM 2613 C C   . ASN D 1 31  ? -21.764 9.859   -32.723 1.00 70.07  ? 31  ASN D C   1 
ATOM 2614 O O   . ASN D 1 31  ? -20.841 9.034   -32.789 1.00 66.48  ? 31  ASN D O   1 
ATOM 2615 C CB  . ASN D 1 31  ? -22.575 10.712  -34.945 1.00 76.55  ? 31  ASN D CB  1 
ATOM 2616 C CG  . ASN D 1 31  ? -24.098 10.753  -34.891 1.00 109.36 ? 31  ASN D CG  1 
ATOM 2617 O OD1 . ASN D 1 31  ? -24.765 9.771   -34.546 1.00 105.02 ? 31  ASN D OD1 1 
ATOM 2618 N ND2 . ASN D 1 31  ? -24.689 11.865  -35.316 1.00 102.80 ? 31  ASN D ND2 1 
ATOM 2619 N N   . ILE D 1 32  ? -22.791 9.749   -31.882 1.00 65.53  ? 32  ILE D N   1 
ATOM 2620 C CA  . ILE D 1 32  ? -22.985 8.662   -30.932 1.00 62.11  ? 32  ILE D CA  1 
ATOM 2621 C C   . ILE D 1 32  ? -24.004 7.726   -31.570 1.00 63.16  ? 32  ILE D C   1 
ATOM 2622 O O   . ILE D 1 32  ? -25.072 8.168   -32.001 1.00 66.17  ? 32  ILE D O   1 
ATOM 2623 C CB  . ILE D 1 32  ? -23.485 9.240   -29.558 1.00 65.95  ? 32  ILE D CB  1 
ATOM 2624 C CG1 . ILE D 1 32  ? -22.454 10.195  -28.922 1.00 66.95  ? 32  ILE D CG1 1 
ATOM 2625 C CG2 . ILE D 1 32  ? -23.882 8.144   -28.579 1.00 64.44  ? 32  ILE D CG2 1 
ATOM 2626 N N   . VAL D 1 33  ? -23.694 6.456   -31.599 1.00 56.59  ? 33  VAL D N   1 
ATOM 2627 C CA  . VAL D 1 33  ? -24.581 5.417   -32.113 1.00 56.93  ? 33  VAL D CA  1 
ATOM 2628 C C   . VAL D 1 33  ? -25.001 4.494   -30.977 1.00 61.83  ? 33  VAL D C   1 
ATOM 2629 O O   . VAL D 1 33  ? -24.275 4.358   -30.001 1.00 61.48  ? 33  VAL D O   1 
ATOM 2630 C CB  . VAL D 1 33  ? -23.978 4.582   -33.292 1.00 59.09  ? 33  VAL D CB  1 
ATOM 2631 C CG1 . VAL D 1 33  ? -23.829 5.412   -34.557 1.00 58.67  ? 33  VAL D CG1 1 
ATOM 2632 C CG2 . VAL D 1 33  ? -22.659 3.922   -32.903 1.00 57.18  ? 33  VAL D CG2 1 
ATOM 2633 N N   . ILE D 1 34  ? -26.136 3.822   -31.150 1.00 60.50  ? 34  ILE D N   1 
ATOM 2634 C CA  . ILE D 1 34  ? -26.685 2.840   -30.229 1.00 60.99  ? 34  ILE D CA  1 
ATOM 2635 C C   . ILE D 1 34  ? -26.749 1.518   -30.990 1.00 67.98  ? 34  ILE D C   1 
ATOM 2636 O O   . ILE D 1 34  ? -27.193 1.483   -32.150 1.00 67.18  ? 34  ILE D O   1 
ATOM 2637 C CB  . ILE D 1 34  ? -28.081 3.242   -29.712 1.00 65.73  ? 34  ILE D CB  1 
ATOM 2638 C CG2 . ILE D 1 34  ? -28.417 2.526   -28.379 1.00 65.85  ? 34  ILE D CG2 1 
ATOM 2639 N N   . THR D 1 35  ? -26.251 0.448   -30.368 1.00 64.62  ? 35  THR D N   1 
ATOM 2640 C CA  . THR D 1 35  ? -26.350 -0.889  -30.921 1.00 64.64  ? 35  THR D CA  1 
ATOM 2641 C C   . THR D 1 35  ? -27.506 -1.463  -30.140 1.00 73.12  ? 35  THR D C   1 
ATOM 2642 O O   . THR D 1 35  ? -27.385 -1.680  -28.941 1.00 74.72  ? 35  THR D O   1 
ATOM 2643 C CB  . THR D 1 35  ? -25.033 -1.673  -30.798 1.00 65.87  ? 35  THR D CB  1 
ATOM 2644 O OG1 . THR D 1 35  ? -24.577 -1.613  -29.452 1.00 67.36  ? 35  THR D OG1 1 
ATOM 2645 C CG2 . THR D 1 35  ? -23.941 -1.170  -31.765 1.00 57.41  ? 35  THR D CG2 1 
ATOM 2646 N N   . ARG D 1 36  ? -28.662 -1.583  -30.781 1.00 72.78  ? 36  ARG D N   1 
ATOM 2647 C CA  . ARG D 1 36  ? -29.899 -2.010  -30.128 1.00 75.81  ? 36  ARG D CA  1 
ATOM 2648 C C   . ARG D 1 36  ? -29.863 -3.440  -29.557 1.00 82.39  ? 36  ARG D C   1 
ATOM 2649 O O   . ARG D 1 36  ? -30.627 -3.707  -28.622 1.00 86.86  ? 36  ARG D O   1 
ATOM 2650 C CB  . ARG D 1 36  ? -31.105 -1.842  -31.065 1.00 77.26  ? 36  ARG D CB  1 
ATOM 2651 C CG  . ARG D 1 36  ? -31.499 -0.401  -31.293 1.00 88.63  ? 36  ARG D CG  1 
ATOM 2652 C CD  . ARG D 1 36  ? -32.719 -0.301  -32.181 1.00 100.00 ? 36  ARG D CD  1 
ATOM 2653 N NE  . ARG D 1 36  ? -33.897 0.096   -31.419 1.00 113.61 ? 36  ARG D NE  1 
ATOM 2654 C CZ  . ARG D 1 36  ? -35.096 -0.464  -31.543 1.00 136.76 ? 36  ARG D CZ  1 
ATOM 2655 N NH1 . ARG D 1 36  ? -35.289 -1.452  -32.410 1.00 126.18 ? 36  ARG D NH1 1 
ATOM 2656 N NH2 . ARG D 1 36  ? -36.113 -0.039  -30.805 1.00 128.04 ? 36  ARG D NH2 1 
ATOM 2657 N N   . TYR D 1 37  ? -28.989 -4.347  -30.071 1.00 75.11  ? 37  TYR D N   1 
ATOM 2658 C CA  . TYR D 1 37  ? -28.924 -5.735  -29.573 1.00 74.84  ? 37  TYR D CA  1 
ATOM 2659 C C   . TYR D 1 37  ? -28.453 -5.841  -28.096 1.00 79.43  ? 37  TYR D C   1 
ATOM 2660 O O   . TYR D 1 37  ? -28.797 -6.802  -27.402 1.00 81.86  ? 37  TYR D O   1 
ATOM 2661 C CB  . TYR D 1 37  ? -28.084 -6.639  -30.505 1.00 73.38  ? 37  TYR D CB  1 
ATOM 2662 C CG  . TYR D 1 37  ? -26.629 -6.257  -30.667 1.00 70.16  ? 37  TYR D CG  1 
ATOM 2663 C CD1 . TYR D 1 37  ? -25.648 -6.809  -29.852 1.00 70.85  ? 37  TYR D CD1 1 
ATOM 2664 C CD2 . TYR D 1 37  ? -26.221 -5.396  -31.684 1.00 68.60  ? 37  TYR D CD2 1 
ATOM 2665 C CE1 . TYR D 1 37  ? -24.307 -6.468  -30.002 1.00 68.82  ? 37  TYR D CE1 1 
ATOM 2666 C CE2 . TYR D 1 37  ? -24.877 -5.057  -31.854 1.00 66.36  ? 37  TYR D CE2 1 
ATOM 2667 C CZ  . TYR D 1 37  ? -23.926 -5.587  -31.004 1.00 70.77  ? 37  TYR D CZ  1 
ATOM 2668 O OH  . TYR D 1 37  ? -22.614 -5.212  -31.141 1.00 65.37  ? 37  TYR D OH  1 
ATOM 2669 N N   . ASN D 1 38  ? -27.694 -4.849  -27.617 1.00 74.38  ? 38  ASN D N   1 
ATOM 2670 C CA  . ASN D 1 38  ? -27.173 -4.819  -26.246 1.00 73.91  ? 38  ASN D CA  1 
ATOM 2671 C C   . ASN D 1 38  ? -27.418 -3.465  -25.587 1.00 79.87  ? 38  ASN D C   1 
ATOM 2672 O O   . ASN D 1 38  ? -26.986 -3.264  -24.454 1.00 81.71  ? 38  ASN D O   1 
ATOM 2673 C CB  . ASN D 1 38  ? -25.663 -5.184  -26.215 1.00 67.90  ? 38  ASN D CB  1 
ATOM 2674 C CG  . ASN D 1 38  ? -24.756 -4.327  -27.090 1.00 76.61  ? 38  ASN D CG  1 
ATOM 2675 O OD1 . ASN D 1 38  ? -25.133 -3.256  -27.573 1.00 69.85  ? 38  ASN D OD1 1 
ATOM 2676 N ND2 . ASN D 1 38  ? -23.523 -4.760  -27.299 1.00 58.03  ? 38  ASN D ND2 1 
ATOM 2677 N N   . ASN D 1 39  ? -28.091 -2.534  -26.295 1.00 76.11  ? 39  ASN D N   1 
ATOM 2678 C CA  . ASN D 1 39  ? -28.407 -1.180  -25.824 1.00 76.66  ? 39  ASN D CA  1 
ATOM 2679 C C   . ASN D 1 39  ? -27.172 -0.430  -25.285 1.00 77.66  ? 39  ASN D C   1 
ATOM 2680 O O   . ASN D 1 39  ? -27.213 0.193   -24.218 1.00 79.48  ? 39  ASN D O   1 
ATOM 2681 C CB  . ASN D 1 39  ? -29.568 -1.180  -24.805 1.00 80.77  ? 39  ASN D CB  1 
ATOM 2682 C CG  . ASN D 1 39  ? -30.866 -0.670  -25.394 1.00 108.59 ? 39  ASN D CG  1 
ATOM 2683 O OD1 . ASN D 1 39  ? -31.271 -1.018  -26.516 1.00 100.45 ? 39  ASN D OD1 1 
ATOM 2684 N ND2 . ASN D 1 39  ? -31.509 0.243   -24.680 1.00 103.46 ? 39  ASN D ND2 1 
ATOM 2685 N N   . ARG D 1 40  ? -26.080 -0.503  -26.037 1.00 69.07  ? 40  ARG D N   1 
ATOM 2686 C CA  . ARG D 1 40  ? -24.838 0.178   -25.709 1.00 64.82  ? 40  ARG D CA  1 
ATOM 2687 C C   . ARG D 1 40  ? -24.664 1.361   -26.625 1.00 61.67  ? 40  ARG D C   1 
ATOM 2688 O O   . ARG D 1 40  ? -25.063 1.337   -27.792 1.00 59.97  ? 40  ARG D O   1 
ATOM 2689 C CB  . ARG D 1 40  ? -23.632 -0.782  -25.759 1.00 61.38  ? 40  ARG D CB  1 
ATOM 2690 C CG  . ARG D 1 40  ? -23.361 -1.422  -24.411 1.00 66.78  ? 40  ARG D CG  1 
ATOM 2691 C CD  . ARG D 1 40  ? -22.097 -0.850  -23.796 1.00 83.88  ? 40  ARG D CD  1 
ATOM 2692 N NE  . ARG D 1 40  ? -21.418 -1.781  -22.883 1.00 97.37  ? 40  ARG D NE  1 
ATOM 2693 C CZ  . ARG D 1 40  ? -20.747 -2.872  -23.254 1.00 120.37 ? 40  ARG D CZ  1 
ATOM 2694 N NH1 . ARG D 1 40  ? -20.686 -3.222  -24.538 1.00 100.06 ? 40  ARG D NH1 1 
ATOM 2695 N NH2 . ARG D 1 40  ? -20.160 -3.638  -22.345 1.00 121.93 ? 40  ARG D NH2 1 
ATOM 2696 N N   . THR D 1 41  ? -24.033 2.381   -26.100 1.00 56.69  ? 41  THR D N   1 
ATOM 2697 C CA  . THR D 1 41  ? -23.829 3.631   -26.805 1.00 56.89  ? 41  THR D CA  1 
ATOM 2698 C C   . THR D 1 41  ? -22.338 3.871   -27.023 1.00 59.33  ? 41  THR D C   1 
ATOM 2699 O O   . THR D 1 41  ? -21.563 3.630   -26.117 1.00 56.86  ? 41  THR D O   1 
ATOM 2700 C CB  . THR D 1 41  ? -24.561 4.731   -25.996 1.00 62.68  ? 41  THR D CB  1 
ATOM 2701 O OG1 . THR D 1 41  ? -25.397 5.509   -26.857 1.00 61.73  ? 41  THR D OG1 1 
ATOM 2702 C CG2 . THR D 1 41  ? -23.641 5.593   -25.187 1.00 56.19  ? 41  THR D CG2 1 
ATOM 2703 N N   . TYR D 1 42  ? -21.938 4.350   -28.222 1.00 57.98  ? 42  TYR D N   1 
ATOM 2704 C CA  . TYR D 1 42  ? -20.528 4.640   -28.533 1.00 57.44  ? 42  TYR D CA  1 
ATOM 2705 C C   . TYR D 1 42  ? -20.424 5.819   -29.467 1.00 62.18  ? 42  TYR D C   1 
ATOM 2706 O O   . TYR D 1 42  ? -21.191 5.908   -30.431 1.00 62.25  ? 42  TYR D O   1 
ATOM 2707 C CB  . TYR D 1 42  ? -19.842 3.446   -29.241 1.00 58.43  ? 42  TYR D CB  1 
ATOM 2708 C CG  . TYR D 1 42  ? -19.915 2.113   -28.529 1.00 61.94  ? 42  TYR D CG  1 
ATOM 2709 C CD1 . TYR D 1 42  ? -20.928 1.202   -28.814 1.00 64.53  ? 42  TYR D CD1 1 
ATOM 2710 C CD2 . TYR D 1 42  ? -18.943 1.740   -27.607 1.00 63.23  ? 42  TYR D CD2 1 
ATOM 2711 C CE1 . TYR D 1 42  ? -20.977 -0.038  -28.186 1.00 66.04  ? 42  TYR D CE1 1 
ATOM 2712 C CE2 . TYR D 1 42  ? -18.987 0.505   -26.972 1.00 64.36  ? 42  TYR D CE2 1 
ATOM 2713 C CZ  . TYR D 1 42  ? -20.002 -0.383  -27.268 1.00 75.18  ? 42  TYR D CZ  1 
ATOM 2714 O OH  . TYR D 1 42  ? -20.044 -1.592  -26.617 1.00 85.64  ? 42  TYR D OH  1 
ATOM 2715 N N   . ARG D 1 43  ? -19.385 6.635   -29.291 1.00 59.99  ? 43  ARG D N   1 
ATOM 2716 C CA  . ARG D 1 43  ? -19.115 7.739   -30.211 1.00 61.14  ? 43  ARG D CA  1 
ATOM 2717 C C   . ARG D 1 43  ? -18.213 7.218   -31.323 1.00 66.22  ? 43  ARG D C   1 
ATOM 2718 O O   . ARG D 1 43  ? -17.257 6.500   -31.036 1.00 66.16  ? 43  ARG D O   1 
ATOM 2719 C CB  . ARG D 1 43  ? -18.470 8.943   -29.497 1.00 60.82  ? 43  ARG D CB  1 
ATOM 2720 C CG  . ARG D 1 43  ? -18.406 10.171  -30.402 1.00 69.92  ? 43  ARG D CG  1 
ATOM 2721 C CD  . ARG D 1 43  ? -17.549 11.278  -29.856 1.00 83.66  ? 43  ARG D CD  1 
ATOM 2722 N NE  . ARG D 1 43  ? -18.038 11.788  -28.567 1.00 97.32  ? 43  ARG D NE  1 
ATOM 2723 C CZ  . ARG D 1 43  ? -18.981 12.714  -28.426 1.00 99.58  ? 43  ARG D CZ  1 
ATOM 2724 N NH1 . ARG D 1 43  ? -19.574 13.238  -29.492 1.00 78.55  ? 43  ARG D NH1 1 
ATOM 2725 N NH2 . ARG D 1 43  ? -19.343 13.118  -27.217 1.00 81.44  ? 43  ARG D NH2 1 
ATOM 2726 N N   . ILE D 1 44  ? -18.518 7.562   -32.590 1.00 63.70  ? 44  ILE D N   1 
ATOM 2727 C CA  . ILE D 1 44  ? -17.733 7.113   -33.763 1.00 61.79  ? 44  ILE D CA  1 
ATOM 2728 C C   . ILE D 1 44  ? -16.572 8.054   -33.991 1.00 62.87  ? 44  ILE D C   1 
ATOM 2729 O O   . ILE D 1 44  ? -16.747 9.267   -34.036 1.00 63.70  ? 44  ILE D O   1 
ATOM 2730 C CB  . ILE D 1 44  ? -18.623 6.936   -35.019 1.00 64.98  ? 44  ILE D CB  1 
ATOM 2731 C CG1 . ILE D 1 44  ? -19.761 5.958   -34.718 1.00 64.93  ? 44  ILE D CG1 1 
ATOM 2732 C CG2 . ILE D 1 44  ? -17.844 6.524   -36.288 1.00 64.52  ? 44  ILE D CG2 1 
ATOM 2733 C CD1 . ILE D 1 44  ? -21.020 6.567   -35.158 1.00 81.09  ? 44  ILE D CD1 1 
ATOM 2734 N N   . ASP D 1 45  ? -15.383 7.472   -34.082 1.00 58.56  ? 45  ASP D N   1 
ATOM 2735 C CA  . ASP D 1 45  ? -14.117 8.157   -34.276 1.00 59.48  ? 45  ASP D CA  1 
ATOM 2736 C C   . ASP D 1 45  ? -13.673 8.066   -35.713 1.00 65.29  ? 45  ASP D C   1 
ATOM 2737 O O   . ASP D 1 45  ? -12.981 8.967   -36.173 1.00 68.27  ? 45  ASP D O   1 
ATOM 2738 C CB  . ASP D 1 45  ? -13.031 7.588   -33.323 1.00 60.47  ? 45  ASP D CB  1 
ATOM 2739 C CG  . ASP D 1 45  ? -13.294 7.856   -31.838 1.00 78.36  ? 45  ASP D CG  1 
ATOM 2740 O OD1 . ASP D 1 45  ? -13.533 9.034   -31.476 1.00 82.76  ? 45  ASP D OD1 1 
ATOM 2741 O OD2 . ASP D 1 45  ? -13.265 6.880   -31.031 1.00 81.89  ? 45  ASP D OD2 1 
ATOM 2742 N N   . ASP D 1 46  ? -14.076 6.995   -36.432 1.00 61.13  ? 46  ASP D N   1 
ATOM 2743 C CA  . ASP D 1 46  ? -13.690 6.738   -37.816 1.00 61.34  ? 46  ASP D CA  1 
ATOM 2744 C C   . ASP D 1 46  ? -14.536 5.627   -38.432 1.00 62.91  ? 46  ASP D C   1 
ATOM 2745 O O   . ASP D 1 46  ? -15.281 4.943   -37.728 1.00 60.62  ? 46  ASP D O   1 
ATOM 2746 C CB  . ASP D 1 46  ? -12.203 6.309   -37.855 1.00 64.61  ? 46  ASP D CB  1 
ATOM 2747 C CG  . ASP D 1 46  ? -11.352 6.900   -38.953 1.00 82.30  ? 46  ASP D CG  1 
ATOM 2748 O OD1 . ASP D 1 46  ? -11.925 7.371   -39.968 1.00 84.51  ? 46  ASP D OD1 1 
ATOM 2749 O OD2 . ASP D 1 46  ? -10.112 6.839   -38.828 1.00 94.69  ? 46  ASP D OD2 1 
ATOM 2750 N N   . VAL D 1 47  ? -14.405 5.457   -39.772 1.00 59.67  ? 47  VAL D N   1 
ATOM 2751 C CA  . VAL D 1 47  ? -15.036 4.403   -40.568 1.00 58.03  ? 47  VAL D CA  1 
ATOM 2752 C C   . VAL D 1 47  ? -13.924 3.670   -41.305 1.00 62.80  ? 47  VAL D C   1 
ATOM 2753 O O   . VAL D 1 47  ? -13.127 4.322   -41.984 1.00 63.47  ? 47  VAL D O   1 
ATOM 2754 C CB  . VAL D 1 47  ? -16.103 4.912   -41.561 1.00 61.83  ? 47  VAL D CB  1 
ATOM 2755 C CG1 . VAL D 1 47  ? -16.840 3.751   -42.221 1.00 60.06  ? 47  VAL D CG1 1 
ATOM 2756 C CG2 . VAL D 1 47  ? -17.091 5.849   -40.877 1.00 62.14  ? 47  VAL D CG2 1 
ATOM 2757 N N   . ASP D 1 48  ? -13.821 2.336   -41.125 1.00 58.37  ? 48  ASP D N   1 
ATOM 2758 C CA  . ASP D 1 48  ? -12.823 1.564   -41.864 1.00 59.68  ? 48  ASP D CA  1 
ATOM 2759 C C   . ASP D 1 48  ? -13.496 1.068   -43.125 1.00 62.74  ? 48  ASP D C   1 
ATOM 2760 O O   . ASP D 1 48  ? -14.322 0.144   -43.087 1.00 60.67  ? 48  ASP D O   1 
ATOM 2761 C CB  . ASP D 1 48  ? -12.222 0.387   -41.064 1.00 62.01  ? 48  ASP D CB  1 
ATOM 2762 C CG  . ASP D 1 48  ? -10.928 -0.184  -41.663 1.00 81.42  ? 48  ASP D CG  1 
ATOM 2763 O OD1 . ASP D 1 48  ? -10.632 0.104   -42.846 1.00 85.35  ? 48  ASP D OD1 1 
ATOM 2764 O OD2 . ASP D 1 48  ? -10.200 -0.893  -40.941 1.00 89.64  ? 48  ASP D OD2 1 
ATOM 2765 N N   . TRP D 1 49  ? -13.171 1.714   -44.237 1.00 60.35  ? 49  TRP D N   1 
ATOM 2766 C CA  . TRP D 1 49  ? -13.726 1.361   -45.534 1.00 59.08  ? 49  TRP D CA  1 
ATOM 2767 C C   . TRP D 1 49  ? -13.047 0.129   -46.146 1.00 67.14  ? 49  TRP D C   1 
ATOM 2768 O O   . TRP D 1 49  ? -13.630 -0.514  -47.020 1.00 67.76  ? 49  TRP D O   1 
ATOM 2769 C CB  . TRP D 1 49  ? -13.632 2.559   -46.462 1.00 57.47  ? 49  TRP D CB  1 
ATOM 2770 C CG  . TRP D 1 49  ? -14.536 3.671   -46.049 1.00 56.21  ? 49  TRP D CG  1 
ATOM 2771 C CD1 . TRP D 1 49  ? -14.164 4.833   -45.457 1.00 59.82  ? 49  TRP D CD1 1 
ATOM 2772 C CD2 . TRP D 1 49  ? -15.980 3.715   -46.164 1.00 53.64  ? 49  TRP D CD2 1 
ATOM 2773 N NE1 . TRP D 1 49  ? -15.265 5.622   -45.235 1.00 58.61  ? 49  TRP D NE1 1 
ATOM 2774 C CE2 . TRP D 1 49  ? -16.391 4.967   -45.671 1.00 57.63  ? 49  TRP D CE2 1 
ATOM 2775 C CE3 . TRP D 1 49  ? -16.952 2.857   -46.733 1.00 52.62  ? 49  TRP D CE3 1 
ATOM 2776 C CZ2 . TRP D 1 49  ? -17.724 5.381   -45.695 1.00 55.63  ? 49  TRP D CZ2 1 
ATOM 2777 C CZ3 . TRP D 1 49  ? -18.281 3.272   -46.766 1.00 52.80  ? 49  TRP D CZ3 1 
ATOM 2778 C CH2 . TRP D 1 49  ? -18.655 4.519   -46.244 1.00 54.36  ? 49  TRP D CH2 1 
ATOM 2779 N N   . ASN D 1 50  ? -11.862 -0.242  -45.626 1.00 66.86  ? 50  ASN D N   1 
ATOM 2780 C CA  . ASN D 1 50  ? -11.061 -1.373  -46.086 1.00 68.89  ? 50  ASN D CA  1 
ATOM 2781 C C   . ASN D 1 50  ? -11.373 -2.692  -45.342 1.00 74.69  ? 50  ASN D C   1 
ATOM 2782 O O   . ASN D 1 50  ? -10.813 -3.732  -45.689 1.00 78.60  ? 50  ASN D O   1 
ATOM 2783 C CB  . ASN D 1 50  ? -9.573  -1.030  -45.981 1.00 71.05  ? 50  ASN D CB  1 
ATOM 2784 C CG  . ASN D 1 50  ? -9.158  0.242   -46.706 1.00 85.16  ? 50  ASN D CG  1 
ATOM 2785 O OD1 . ASN D 1 50  ? -9.629  0.584   -47.804 1.00 73.66  ? 50  ASN D OD1 1 
ATOM 2786 N ND2 . ASN D 1 50  ? -8.256  0.974   -46.092 1.00 79.06  ? 50  ASN D ND2 1 
ATOM 2787 N N   . LYS D 1 51  ? -12.265 -2.654  -44.341 1.00 67.31  ? 51  LYS D N   1 
ATOM 2788 C CA  . LYS D 1 51  ? -12.678 -3.830  -43.570 1.00 64.83  ? 51  LYS D CA  1 
ATOM 2789 C C   . LYS D 1 51  ? -14.155 -4.108  -43.795 1.00 64.49  ? 51  LYS D C   1 
ATOM 2790 O O   . LYS D 1 51  ? -14.921 -3.207  -44.125 1.00 62.94  ? 51  LYS D O   1 
ATOM 2791 C CB  . LYS D 1 51  ? -12.343 -3.701  -42.075 1.00 65.52  ? 51  LYS D CB  1 
ATOM 2792 C CG  . LYS D 1 51  ? -10.926 -4.126  -41.720 1.00 81.96  ? 51  LYS D CG  1 
ATOM 2793 C CD  . LYS D 1 51  ? -10.710 -4.100  -40.203 1.00 85.96  ? 51  LYS D CD  1 
ATOM 2794 C CE  . LYS D 1 51  ? -9.260  -4.005  -39.835 1.00 92.18  ? 51  LYS D CE  1 
ATOM 2795 N N   . THR D 1 52  ? -14.542 -5.360  -43.630 1.00 60.95  ? 52  THR D N   1 
ATOM 2796 C CA  . THR D 1 52  ? -15.887 -5.854  -43.909 1.00 60.70  ? 52  THR D CA  1 
ATOM 2797 C C   . THR D 1 52  ? -16.253 -6.976  -42.878 1.00 63.64  ? 52  THR D C   1 
ATOM 2798 O O   . THR D 1 52  ? -15.330 -7.591  -42.336 1.00 63.12  ? 52  THR D O   1 
ATOM 2799 C CB  . THR D 1 52  ? -15.901 -6.329  -45.416 1.00 70.66  ? 52  THR D CB  1 
ATOM 2800 O OG1 . THR D 1 52  ? -17.223 -6.508  -45.877 1.00 75.16  ? 52  THR D OG1 1 
ATOM 2801 C CG2 . THR D 1 52  ? -15.105 -7.607  -45.669 1.00 70.47  ? 52  THR D CG2 1 
ATOM 2802 N N   . PRO D 1 53  ? -17.552 -7.295  -42.611 1.00 57.82  ? 53  PRO D N   1 
ATOM 2803 C CA  . PRO D 1 53  ? -17.851 -8.383  -41.664 1.00 58.21  ? 53  PRO D CA  1 
ATOM 2804 C C   . PRO D 1 53  ? -17.251 -9.746  -42.062 1.00 66.40  ? 53  PRO D C   1 
ATOM 2805 O O   . PRO D 1 53  ? -17.140 -10.643 -41.220 1.00 67.55  ? 53  PRO D O   1 
ATOM 2806 C CB  . PRO D 1 53  ? -19.378 -8.412  -41.639 1.00 59.24  ? 53  PRO D CB  1 
ATOM 2807 C CG  . PRO D 1 53  ? -19.799 -7.034  -42.065 1.00 61.64  ? 53  PRO D CG  1 
ATOM 2808 C CD  . PRO D 1 53  ? -18.796 -6.661  -43.100 1.00 57.63  ? 53  PRO D CD  1 
ATOM 2809 N N   . LYS D 1 54  ? -16.840 -9.888  -43.334 1.00 66.11  ? 54  LYS D N   1 
ATOM 2810 C CA  . LYS D 1 54  ? -16.194 -11.086 -43.894 1.00 68.58  ? 54  LYS D CA  1 
ATOM 2811 C C   . LYS D 1 54  ? -14.785 -11.220 -43.281 1.00 73.94  ? 54  LYS D C   1 
ATOM 2812 O O   . LYS D 1 54  ? -14.251 -12.327 -43.226 1.00 76.84  ? 54  LYS D O   1 
ATOM 2813 C CB  . LYS D 1 54  ? -16.072 -11.018 -45.451 1.00 69.65  ? 54  LYS D CB  1 
ATOM 2814 C CG  . LYS D 1 54  ? -17.375 -11.065 -46.234 1.00 80.11  ? 54  LYS D CG  1 
ATOM 2815 N N   . ASP D 1 55  ? -14.190 -10.098 -42.845 1.00 69.02  ? 55  ASP D N   1 
ATOM 2816 C CA  . ASP D 1 55  ? -12.859 -10.069 -42.253 1.00 71.04  ? 55  ASP D CA  1 
ATOM 2817 C C   . ASP D 1 55  ? -12.824 -10.699 -40.855 1.00 80.43  ? 55  ASP D C   1 
ATOM 2818 O O   . ASP D 1 55  ? -13.856 -10.889 -40.213 1.00 79.32  ? 55  ASP D O   1 
ATOM 2819 C CB  . ASP D 1 55  ? -12.289 -8.643  -42.237 1.00 71.77  ? 55  ASP D CB  1 
ATOM 2820 C CG  . ASP D 1 55  ? -11.887 -8.130  -43.609 1.00 91.37  ? 55  ASP D CG  1 
ATOM 2821 O OD1 . ASP D 1 55  ? -11.385 -8.932  -44.425 1.00 98.55  ? 55  ASP D OD1 1 
ATOM 2822 O OD2 . ASP D 1 55  ? -12.035 -6.927  -43.854 1.00 97.40  ? 55  ASP D OD2 1 
ATOM 2823 N N   . SER D 1 56  ? -11.627 -11.056 -40.412 1.00 82.87  ? 56  SER D N   1 
ATOM 2824 C CA  . SER D 1 56  ? -11.407 -11.699 -39.125 1.00 85.30  ? 56  SER D CA  1 
ATOM 2825 C C   . SER D 1 56  ? -10.691 -10.794 -38.136 1.00 91.33  ? 56  SER D C   1 
ATOM 2826 O O   . SER D 1 56  ? -10.001 -9.852  -38.531 1.00 92.60  ? 56  SER D O   1 
ATOM 2827 C CB  . SER D 1 56  ? -10.619 -12.998 -39.305 1.00 92.92  ? 56  SER D CB  1 
ATOM 2828 O OG  . SER D 1 56  ? -9.544  -12.864 -40.224 1.00 105.42 ? 56  SER D OG  1 
ATOM 2829 N N   . PHE D 1 57  ? -10.871 -11.083 -36.847 1.00 86.72  ? 57  PHE D N   1 
ATOM 2830 C CA  . PHE D 1 57  ? -10.171 -10.423 -35.762 1.00 85.52  ? 57  PHE D CA  1 
ATOM 2831 C C   . PHE D 1 57  ? -9.607  -11.504 -34.844 1.00 91.79  ? 57  PHE D C   1 
ATOM 2832 O O   . PHE D 1 57  ? -10.160 -12.612 -34.776 1.00 92.46  ? 57  PHE D O   1 
ATOM 2833 C CB  . PHE D 1 57  ? -11.051 -9.412  -35.032 1.00 84.36  ? 57  PHE D CB  1 
ATOM 2834 C CG  . PHE D 1 57  ? -12.222 -9.961  -34.263 1.00 84.79  ? 57  PHE D CG  1 
ATOM 2835 C CD1 . PHE D 1 57  ? -12.111 -10.240 -32.905 1.00 87.93  ? 57  PHE D CD1 1 
ATOM 2836 C CD2 . PHE D 1 57  ? -13.461 -10.126 -34.876 1.00 86.20  ? 57  PHE D CD2 1 
ATOM 2837 C CE1 . PHE D 1 57  ? -13.206 -10.715 -32.179 1.00 88.84  ? 57  PHE D CE1 1 
ATOM 2838 C CE2 . PHE D 1 57  ? -14.562 -10.590 -34.148 1.00 89.28  ? 57  PHE D CE2 1 
ATOM 2839 C CZ  . PHE D 1 57  ? -14.428 -10.875 -32.803 1.00 87.87  ? 57  PHE D CZ  1 
ATOM 2840 N N   . THR D 1 58  ? -8.470  -11.209 -34.194 1.00 87.83  ? 58  THR D N   1 
ATOM 2841 C CA  . THR D 1 58  ? -7.791  -12.156 -33.314 1.00 88.09  ? 58  THR D CA  1 
ATOM 2842 C C   . THR D 1 58  ? -8.299  -12.010 -31.894 1.00 88.76  ? 58  THR D C   1 
ATOM 2843 O O   . THR D 1 58  ? -8.420  -10.890 -31.397 1.00 86.20  ? 58  THR D O   1 
ATOM 2844 C CB  . THR D 1 58  ? -6.274  -11.980 -33.412 1.00 93.75  ? 58  THR D CB  1 
ATOM 2845 N N   . MET D 1 59  ? -8.609  -13.138 -31.242 1.00 85.33  ? 59  MET D N   1 
ATOM 2846 C CA  . MET D 1 59  ? -9.053  -13.153 -29.842 1.00 83.06  ? 59  MET D CA  1 
ATOM 2847 C C   . MET D 1 59  ? -7.828  -13.252 -28.903 1.00 83.26  ? 59  MET D C   1 
ATOM 2848 O O   . MET D 1 59  ? -6.694  -13.238 -29.387 1.00 83.17  ? 59  MET D O   1 
ATOM 2849 C CB  . MET D 1 59  ? -10.112 -14.235 -29.603 1.00 87.00  ? 59  MET D CB  1 
ATOM 2850 C CG  . MET D 1 59  ? -11.303 -14.053 -30.519 1.00 90.35  ? 59  MET D CG  1 
ATOM 2851 S SD  . MET D 1 59  ? -12.831 -14.780 -29.933 1.00 95.31  ? 59  MET D SD  1 
ATOM 2852 C CE  . MET D 1 59  ? -12.779 -16.330 -30.791 1.00 94.43  ? 59  MET D CE  1 
ATOM 2853 N N   . SER D 1 60  ? -8.046  -13.267 -27.570 1.00 77.01  ? 60  SER D N   1 
ATOM 2854 C CA  . SER D 1 60  ? -6.982  -13.228 -26.562 1.00 75.76  ? 60  SER D CA  1 
ATOM 2855 C C   . SER D 1 60  ? -5.894  -14.269 -26.741 1.00 79.57  ? 60  SER D C   1 
ATOM 2856 O O   . SER D 1 60  ? -4.718  -13.927 -26.589 1.00 79.33  ? 60  SER D O   1 
ATOM 2857 C CB  . SER D 1 60  ? -7.544  -13.297 -25.144 1.00 79.51  ? 60  SER D CB  1 
ATOM 2858 O OG  . SER D 1 60  ? -8.095  -14.566 -24.831 1.00 94.48  ? 60  SER D OG  1 
ATOM 2859 N N   . ASP D 1 61  ? -6.254  -15.520 -27.072 1.00 76.82  ? 61  ASP D N   1 
ATOM 2860 C CA  . ASP D 1 61  ? -5.252  -16.577 -27.218 1.00 79.56  ? 61  ASP D CA  1 
ATOM 2861 C C   . ASP D 1 61  ? -4.775  -16.719 -28.674 1.00 88.84  ? 61  ASP D C   1 
ATOM 2862 O O   . ASP D 1 61  ? -3.958  -17.592 -28.980 1.00 94.01  ? 61  ASP D O   1 
ATOM 2863 C CB  . ASP D 1 61  ? -5.786  -17.902 -26.643 1.00 82.19  ? 61  ASP D CB  1 
ATOM 2864 C CG  . ASP D 1 61  ? -6.860  -18.560 -27.483 1.00 90.23  ? 61  ASP D CG  1 
ATOM 2865 O OD1 . ASP D 1 61  ? -7.588  -17.827 -28.198 1.00 84.59  ? 61  ASP D OD1 1 
ATOM 2866 O OD2 . ASP D 1 61  ? -6.918  -19.827 -27.496 1.00 99.46  ? 61  ASP D OD2 1 
ATOM 2867 N N   . GLY D 1 62  ? -5.271  -15.850 -29.546 1.00 83.58  ? 62  GLY D N   1 
ATOM 2868 C CA  . GLY D 1 62  ? -4.891  -15.851 -30.952 1.00 84.92  ? 62  GLY D CA  1 
ATOM 2869 C C   . GLY D 1 62  ? -5.886  -16.477 -31.907 1.00 88.73  ? 62  GLY D C   1 
ATOM 2870 O O   . GLY D 1 62  ? -5.657  -16.451 -33.120 1.00 89.15  ? 62  GLY D O   1 
ATOM 2871 N N   . LYS D 1 63  ? -6.975  -17.075 -31.381 1.00 84.70  ? 63  LYS D N   1 
ATOM 2872 C CA  . LYS D 1 63  ? -8.018  -17.678 -32.212 1.00 84.88  ? 63  LYS D CA  1 
ATOM 2873 C C   . LYS D 1 63  ? -8.667  -16.579 -33.058 1.00 86.17  ? 63  LYS D C   1 
ATOM 2874 O O   . LYS D 1 63  ? -8.989  -15.508 -32.543 1.00 84.32  ? 63  LYS D O   1 
ATOM 2875 C CB  . LYS D 1 63  ? -9.080  -18.385 -31.349 1.00 86.98  ? 63  LYS D CB  1 
ATOM 2876 C CG  . LYS D 1 63  ? -10.161 -19.123 -32.149 1.00 88.97  ? 63  LYS D CG  1 
ATOM 2877 C CD  . LYS D 1 63  ? -11.311 -19.596 -31.278 1.00 97.56  ? 63  LYS D CD  1 
ATOM 2878 C CE  . LYS D 1 63  ? -12.176 -20.635 -31.947 1.00 101.72 ? 63  LYS D CE  1 
ATOM 2879 N N   . GLU D 1 64  ? -8.785  -16.839 -34.356 1.00 83.51  ? 64  GLU D N   1 
ATOM 2880 C CA  . GLU D 1 64  ? -9.397  -15.938 -35.327 1.00 80.95  ? 64  GLU D CA  1 
ATOM 2881 C C   . GLU D 1 64  ? -10.857 -16.324 -35.562 1.00 84.67  ? 64  GLU D C   1 
ATOM 2882 O O   . GLU D 1 64  ? -11.194 -17.509 -35.687 1.00 86.56  ? 64  GLU D O   1 
ATOM 2883 C CB  . GLU D 1 64  ? -8.626  -15.942 -36.658 1.00 83.38  ? 64  GLU D CB  1 
ATOM 2884 C CG  . GLU D 1 64  ? -7.311  -15.191 -36.593 1.00 93.28  ? 64  GLU D CG  1 
ATOM 2885 N N   . ILE D 1 65  ? -11.711 -15.312 -35.636 1.00 78.79  ? 65  ILE D N   1 
ATOM 2886 C CA  . ILE D 1 65  ? -13.149 -15.456 -35.858 1.00 77.31  ? 65  ILE D CA  1 
ATOM 2887 C C   . ILE D 1 65  ? -13.573 -14.333 -36.807 1.00 78.78  ? 65  ILE D C   1 
ATOM 2888 O O   . ILE D 1 65  ? -13.072 -13.213 -36.682 1.00 77.82  ? 65  ILE D O   1 
ATOM 2889 C CB  . ILE D 1 65  ? -13.909 -15.476 -34.462 1.00 78.98  ? 65  ILE D CB  1 
ATOM 2890 C CG1 . ILE D 1 65  ? -15.360 -15.959 -34.583 1.00 79.23  ? 65  ILE D CG1 1 
ATOM 2891 C CG2 . ILE D 1 65  ? -13.870 -14.139 -33.731 1.00 75.64  ? 65  ILE D CG2 1 
ATOM 2892 N N   . THR D 1 66  ? -14.443 -14.621 -37.782 1.00 74.72  ? 66  THR D N   1 
ATOM 2893 C CA  . THR D 1 66  ? -14.924 -13.542 -38.654 1.00 71.15  ? 66  THR D CA  1 
ATOM 2894 C C   . THR D 1 66  ? -15.981 -12.779 -37.868 1.00 72.93  ? 66  THR D C   1 
ATOM 2895 O O   . THR D 1 66  ? -16.484 -13.288 -36.865 1.00 74.35  ? 66  THR D O   1 
ATOM 2896 C CB  . THR D 1 66  ? -15.502 -14.078 -39.960 1.00 74.56  ? 66  THR D CB  1 
ATOM 2897 O OG1 . THR D 1 66  ? -16.591 -14.946 -39.655 1.00 76.70  ? 66  THR D OG1 1 
ATOM 2898 C CG2 . THR D 1 66  ? -14.464 -14.772 -40.823 1.00 71.27  ? 66  THR D CG2 1 
ATOM 2899 N N   . PHE D 1 67  ? -16.320 -11.563 -38.295 1.00 67.60  ? 67  PHE D N   1 
ATOM 2900 C CA  . PHE D 1 67  ? -17.359 -10.800 -37.619 1.00 64.43  ? 67  PHE D CA  1 
ATOM 2901 C C   . PHE D 1 67  ? -18.700 -11.513 -37.797 1.00 71.27  ? 67  PHE D C   1 
ATOM 2902 O O   . PHE D 1 67  ? -19.489 -11.541 -36.857 1.00 73.18  ? 67  PHE D O   1 
ATOM 2903 C CB  . PHE D 1 67  ? -17.403 -9.356  -38.113 1.00 62.84  ? 67  PHE D CB  1 
ATOM 2904 C CG  . PHE D 1 67  ? -16.151 -8.572  -37.810 1.00 62.22  ? 67  PHE D CG  1 
ATOM 2905 C CD1 . PHE D 1 67  ? -15.120 -8.498  -38.736 1.00 63.84  ? 67  PHE D CD1 1 
ATOM 2906 C CD2 . PHE D 1 67  ? -16.030 -7.852  -36.622 1.00 62.83  ? 67  PHE D CD2 1 
ATOM 2907 C CE1 . PHE D 1 67  ? -13.968 -7.750  -38.467 1.00 64.25  ? 67  PHE D CE1 1 
ATOM 2908 C CE2 . PHE D 1 67  ? -14.869 -7.116  -36.344 1.00 64.85  ? 67  PHE D CE2 1 
ATOM 2909 C CZ  . PHE D 1 67  ? -13.843 -7.080  -37.266 1.00 63.54  ? 67  PHE D CZ  1 
ATOM 2910 N N   . LEU D 1 68  ? -18.905 -12.174 -38.956 1.00 68.40  ? 68  LEU D N   1 
ATOM 2911 C CA  . LEU D 1 68  ? -20.122 -12.942 -39.280 1.00 69.30  ? 68  LEU D CA  1 
ATOM 2912 C C   . LEU D 1 68  ? -20.376 -14.031 -38.248 1.00 75.90  ? 68  LEU D C   1 
ATOM 2913 O O   . LEU D 1 68  ? -21.466 -14.087 -37.681 1.00 76.65  ? 68  LEU D O   1 
ATOM 2914 C CB  . LEU D 1 68  ? -20.049 -13.555 -40.697 1.00 69.92  ? 68  LEU D CB  1 
ATOM 2915 C CG  . LEU D 1 68  ? -19.914 -12.613 -41.909 1.00 72.69  ? 68  LEU D CG  1 
ATOM 2916 C CD1 . LEU D 1 68  ? -19.715 -13.422 -43.193 1.00 74.12  ? 68  LEU D CD1 1 
ATOM 2917 C CD2 . LEU D 1 68  ? -21.149 -11.697 -42.080 1.00 71.00  ? 68  LEU D CD2 1 
ATOM 2918 N N   . GLU D 1 69  ? -19.359 -14.861 -37.967 1.00 75.30  ? 69  GLU D N   1 
ATOM 2919 C CA  . GLU D 1 69  ? -19.442 -15.958 -37.001 1.00 77.96  ? 69  GLU D CA  1 
ATOM 2920 C C   . GLU D 1 69  ? -19.556 -15.428 -35.563 1.00 80.89  ? 69  GLU D C   1 
ATOM 2921 O O   . GLU D 1 69  ? -20.288 -16.018 -34.761 1.00 81.27  ? 69  GLU D O   1 
ATOM 2922 C CB  . GLU D 1 69  ? -18.244 -16.907 -37.170 1.00 81.86  ? 69  GLU D CB  1 
ATOM 2923 N N   . TYR D 1 70  ? -18.892 -14.270 -35.263 1.00 76.11  ? 70  TYR D N   1 
ATOM 2924 C CA  . TYR D 1 70  ? -18.952 -13.595 -33.961 1.00 74.74  ? 70  TYR D CA  1 
ATOM 2925 C C   . TYR D 1 70  ? -20.383 -13.207 -33.595 1.00 78.64  ? 70  TYR D C   1 
ATOM 2926 O O   . TYR D 1 70  ? -20.831 -13.538 -32.501 1.00 79.97  ? 70  TYR D O   1 
ATOM 2927 C CB  . TYR D 1 70  ? -18.033 -12.357 -33.918 1.00 73.70  ? 70  TYR D CB  1 
ATOM 2928 C CG  . TYR D 1 70  ? -18.092 -11.607 -32.601 1.00 74.49  ? 70  TYR D CG  1 
ATOM 2929 C CD1 . TYR D 1 70  ? -17.413 -12.075 -31.477 1.00 76.93  ? 70  TYR D CD1 1 
ATOM 2930 C CD2 . TYR D 1 70  ? -18.830 -10.428 -32.476 1.00 73.63  ? 70  TYR D CD2 1 
ATOM 2931 C CE1 . TYR D 1 70  ? -17.482 -11.405 -30.257 1.00 74.90  ? 70  TYR D CE1 1 
ATOM 2932 C CE2 . TYR D 1 70  ? -18.896 -9.741  -31.261 1.00 73.49  ? 70  TYR D CE2 1 
ATOM 2933 C CZ  . TYR D 1 70  ? -18.229 -10.241 -30.150 1.00 80.40  ? 70  TYR D CZ  1 
ATOM 2934 O OH  . TYR D 1 70  ? -18.301 -9.588  -28.938 1.00 77.17  ? 70  TYR D OH  1 
ATOM 2935 N N   . TYR D 1 71  ? -21.100 -12.523 -34.496 1.00 74.17  ? 71  TYR D N   1 
ATOM 2936 C CA  . TYR D 1 71  ? -22.463 -12.076 -34.213 1.00 74.09  ? 71  TYR D CA  1 
ATOM 2937 C C   . TYR D 1 71  ? -23.473 -13.226 -34.195 1.00 80.77  ? 71  TYR D C   1 
ATOM 2938 O O   . TYR D 1 71  ? -24.377 -13.201 -33.354 1.00 81.88  ? 71  TYR D O   1 
ATOM 2939 C CB  . TYR D 1 71  ? -22.889 -10.925 -35.144 1.00 72.22  ? 71  TYR D CB  1 
ATOM 2940 C CG  . TYR D 1 71  ? -22.173 -9.637  -34.787 1.00 69.10  ? 71  TYR D CG  1 
ATOM 2941 C CD1 . TYR D 1 71  ? -21.010 -9.260  -35.446 1.00 69.46  ? 71  TYR D CD1 1 
ATOM 2942 C CD2 . TYR D 1 71  ? -22.615 -8.836  -33.733 1.00 68.44  ? 71  TYR D CD2 1 
ATOM 2943 C CE1 . TYR D 1 71  ? -20.309 -8.109  -35.081 1.00 68.12  ? 71  TYR D CE1 1 
ATOM 2944 C CE2 . TYR D 1 71  ? -21.926 -7.676  -33.365 1.00 66.41  ? 71  TYR D CE2 1 
ATOM 2945 C CZ  . TYR D 1 71  ? -20.782 -7.307  -34.056 1.00 65.42  ? 71  TYR D CZ  1 
ATOM 2946 O OH  . TYR D 1 71  ? -20.085 -6.168  -33.729 1.00 59.22  ? 71  TYR D OH  1 
ATOM 2947 N N   . SER D 1 72  ? -23.286 -14.248 -35.063 1.00 78.64  ? 72  SER D N   1 
ATOM 2948 C CA  . SER D 1 72  ? -24.129 -15.453 -35.075 1.00 81.75  ? 72  SER D CA  1 
ATOM 2949 C C   . SER D 1 72  ? -23.935 -16.285 -33.791 1.00 86.59  ? 72  SER D C   1 
ATOM 2950 O O   . SER D 1 72  ? -24.934 -16.609 -33.157 1.00 88.52  ? 72  SER D O   1 
ATOM 2951 C CB  . SER D 1 72  ? -23.891 -16.304 -36.326 1.00 86.41  ? 72  SER D CB  1 
ATOM 2952 N N   . LYS D 1 73  ? -22.678 -16.571 -33.373 1.00 82.74  ? 73  LYS D N   1 
ATOM 2953 C CA  . LYS D 1 73  ? -22.388 -17.371 -32.163 1.00 85.60  ? 73  LYS D CA  1 
ATOM 2954 C C   . LYS D 1 73  ? -22.710 -16.660 -30.847 1.00 89.48  ? 73  LYS D C   1 
ATOM 2955 O O   . LYS D 1 73  ? -23.131 -17.325 -29.904 1.00 91.66  ? 73  LYS D O   1 
ATOM 2956 C CB  . LYS D 1 73  ? -20.919 -17.841 -32.126 1.00 88.17  ? 73  LYS D CB  1 
ATOM 2957 N N   . ASN D 1 74  ? -22.489 -15.333 -30.762 1.00 83.67  ? 74  ASN D N   1 
ATOM 2958 C CA  . ASN D 1 74  ? -22.710 -14.584 -29.515 1.00 83.15  ? 74  ASN D CA  1 
ATOM 2959 C C   . ASN D 1 74  ? -24.105 -13.997 -29.327 1.00 88.07  ? 74  ASN D C   1 
ATOM 2960 O O   . ASN D 1 74  ? -24.524 -13.859 -28.180 1.00 89.71  ? 74  ASN D O   1 
ATOM 2961 C CB  . ASN D 1 74  ? -21.698 -13.461 -29.368 1.00 81.49  ? 74  ASN D CB  1 
ATOM 2962 C CG  . ASN D 1 74  ? -20.327 -13.960 -29.027 1.00 107.50 ? 74  ASN D CG  1 
ATOM 2963 O OD1 . ASN D 1 74  ? -19.998 -14.200 -27.866 1.00 102.41 ? 74  ASN D OD1 1 
ATOM 2964 N ND2 . ASN D 1 74  ? -19.514 -14.175 -30.042 1.00 100.05 ? 74  ASN D ND2 1 
ATOM 2965 N N   . TYR D 1 75  ? -24.804 -13.606 -30.412 1.00 83.44  ? 75  TYR D N   1 
ATOM 2966 C CA  . TYR D 1 75  ? -26.108 -12.944 -30.272 1.00 83.12  ? 75  TYR D CA  1 
ATOM 2967 C C   . TYR D 1 75  ? -27.251 -13.583 -31.056 1.00 88.91  ? 75  TYR D C   1 
ATOM 2968 O O   . TYR D 1 75  ? -28.400 -13.163 -30.895 1.00 90.06  ? 75  TYR D O   1 
ATOM 2969 C CB  . TYR D 1 75  ? -25.993 -11.455 -30.683 1.00 80.33  ? 75  TYR D CB  1 
ATOM 2970 C CG  . TYR D 1 75  ? -24.910 -10.689 -29.961 1.00 78.07  ? 75  TYR D CG  1 
ATOM 2971 C CD1 . TYR D 1 75  ? -23.725 -10.345 -30.604 1.00 77.85  ? 75  TYR D CD1 1 
ATOM 2972 C CD2 . TYR D 1 75  ? -25.062 -10.314 -28.630 1.00 78.65  ? 75  TYR D CD2 1 
ATOM 2973 C CE1 . TYR D 1 75  ? -22.714 -9.656  -29.939 1.00 76.20  ? 75  TYR D CE1 1 
ATOM 2974 C CE2 . TYR D 1 75  ? -24.059 -9.626  -27.953 1.00 77.60  ? 75  TYR D CE2 1 
ATOM 2975 C CZ  . TYR D 1 75  ? -22.885 -9.301  -28.611 1.00 82.47  ? 75  TYR D CZ  1 
ATOM 2976 O OH  . TYR D 1 75  ? -21.908 -8.609  -27.944 1.00 83.71  ? 75  TYR D OH  1 
ATOM 2977 N N   . GLY D 1 76  ? -26.939 -14.555 -31.906 1.00 85.81  ? 76  GLY D N   1 
ATOM 2978 C CA  . GLY D 1 76  ? -27.938 -15.211 -32.743 1.00 88.15  ? 76  GLY D CA  1 
ATOM 2979 C C   . GLY D 1 76  ? -28.377 -14.321 -33.892 1.00 91.59  ? 76  GLY D C   1 
ATOM 2980 O O   . GLY D 1 76  ? -29.458 -14.514 -34.457 1.00 92.96  ? 76  GLY D O   1 
ATOM 2981 N N   . ILE D 1 77  ? -27.522 -13.329 -34.240 1.00 85.06  ? 77  ILE D N   1 
ATOM 2982 C CA  . ILE D 1 77  ? -27.738 -12.352 -35.296 1.00 82.33  ? 77  ILE D CA  1 
ATOM 2983 C C   . ILE D 1 77  ? -27.050 -12.809 -36.591 1.00 87.66  ? 77  ILE D C   1 
ATOM 2984 O O   . ILE D 1 77  ? -25.849 -13.121 -36.600 1.00 88.01  ? 77  ILE D O   1 
ATOM 2985 C CB  . ILE D 1 77  ? -27.284 -10.923 -34.864 1.00 82.09  ? 77  ILE D CB  1 
ATOM 2986 C CG1 . ILE D 1 77  ? -28.089 -10.420 -33.645 1.00 83.17  ? 77  ILE D CG1 1 
ATOM 2987 C CG2 . ILE D 1 77  ? -27.390 -9.920  -36.029 1.00 80.32  ? 77  ILE D CG2 1 
ATOM 2988 C CD1 . ILE D 1 77  ? -27.538 -9.131  -32.974 1.00 80.79  ? 77  ILE D CD1 1 
ATOM 2989 N N   . THR D 1 78  ? -27.825 -12.824 -37.684 1.00 83.11  ? 78  THR D N   1 
ATOM 2990 C CA  . THR D 1 78  ? -27.330 -13.152 -39.002 1.00 82.35  ? 78  THR D CA  1 
ATOM 2991 C C   . THR D 1 78  ? -27.136 -11.805 -39.722 1.00 85.45  ? 78  THR D C   1 
ATOM 2992 O O   . THR D 1 78  ? -28.111 -11.067 -39.947 1.00 86.75  ? 78  THR D O   1 
ATOM 2993 C CB  . THR D 1 78  ? -28.290 -14.132 -39.716 1.00 86.97  ? 78  THR D CB  1 
ATOM 2994 O OG1 . THR D 1 78  ? -28.367 -15.340 -38.952 1.00 89.76  ? 78  THR D OG1 1 
ATOM 2995 C CG2 . THR D 1 78  ? -27.854 -14.456 -41.134 1.00 81.37  ? 78  THR D CG2 1 
ATOM 2996 N N   . VAL D 1 79  ? -25.868 -11.480 -40.042 1.00 77.54  ? 79  VAL D N   1 
ATOM 2997 C CA  . VAL D 1 79  ? -25.498 -10.251 -40.734 1.00 74.05  ? 79  VAL D CA  1 
ATOM 2998 C C   . VAL D 1 79  ? -25.887 -10.415 -42.209 1.00 78.73  ? 79  VAL D C   1 
ATOM 2999 O O   . VAL D 1 79  ? -25.378 -11.314 -42.875 1.00 80.74  ? 79  VAL D O   1 
ATOM 3000 C CB  . VAL D 1 79  ? -23.998 -9.903  -40.502 1.00 74.66  ? 79  VAL D CB  1 
ATOM 3001 C CG1 . VAL D 1 79  ? -23.599 -8.619  -41.226 1.00 72.01  ? 79  VAL D CG1 1 
ATOM 3002 C CG2 . VAL D 1 79  ? -23.678 -9.798  -39.008 1.00 73.81  ? 79  VAL D CG2 1 
ATOM 3003 N N   . LYS D 1 80  ? -26.833 -9.590  -42.689 1.00 73.96  ? 80  LYS D N   1 
ATOM 3004 C CA  . LYS D 1 80  ? -27.348 -9.657  -44.060 1.00 74.00  ? 80  LYS D CA  1 
ATOM 3005 C C   . LYS D 1 80  ? -26.392 -9.028  -45.084 1.00 78.89  ? 80  LYS D C   1 
ATOM 3006 O O   . LYS D 1 80  ? -26.127 -9.648  -46.113 1.00 80.61  ? 80  LYS D O   1 
ATOM 3007 C CB  . LYS D 1 80  ? -28.739 -9.017  -44.151 1.00 76.28  ? 80  LYS D CB  1 
ATOM 3008 N N   . GLU D 1 81  ? -25.868 -7.818  -44.814 1.00 74.42  ? 81  GLU D N   1 
ATOM 3009 C CA  . GLU D 1 81  ? -24.949 -7.118  -45.719 1.00 72.90  ? 81  GLU D CA  1 
ATOM 3010 C C   . GLU D 1 81  ? -23.492 -7.406  -45.359 1.00 76.41  ? 81  GLU D C   1 
ATOM 3011 O O   . GLU D 1 81  ? -22.938 -6.789  -44.454 1.00 76.49  ? 81  GLU D O   1 
ATOM 3012 C CB  . GLU D 1 81  ? -25.241 -5.614  -45.730 1.00 73.79  ? 81  GLU D CB  1 
ATOM 3013 C CG  . GLU D 1 81  ? -26.553 -5.241  -46.415 1.00 91.88  ? 81  GLU D CG  1 
ATOM 3014 C CD  . GLU D 1 81  ? -26.568 -5.243  -47.931 1.00 126.49 ? 81  GLU D CD  1 
ATOM 3015 O OE1 . GLU D 1 81  ? -27.561 -5.749  -48.503 1.00 135.05 ? 81  GLU D OE1 1 
ATOM 3016 O OE2 . GLU D 1 81  ? -25.609 -4.724  -48.548 1.00 123.01 ? 81  GLU D OE2 1 
ATOM 3017 N N   . GLU D 1 82  ? -22.877 -8.358  -46.066 1.00 73.74  ? 82  GLU D N   1 
ATOM 3018 C CA  . GLU D 1 82  ? -21.497 -8.806  -45.836 1.00 74.30  ? 82  GLU D CA  1 
ATOM 3019 C C   . GLU D 1 82  ? -20.440 -7.883  -46.467 1.00 77.87  ? 82  GLU D C   1 
ATOM 3020 O O   . GLU D 1 82  ? -19.251 -8.171  -46.338 1.00 79.25  ? 82  GLU D O   1 
ATOM 3021 C CB  . GLU D 1 82  ? -21.306 -10.240 -46.363 1.00 77.44  ? 82  GLU D CB  1 
ATOM 3022 C CG  . GLU D 1 82  ? -22.268 -11.271 -45.784 1.00 91.52  ? 82  GLU D CG  1 
ATOM 3023 C CD  . GLU D 1 82  ? -22.055 -12.721 -46.192 1.00 115.15 ? 82  GLU D CD  1 
ATOM 3024 O OE1 . GLU D 1 82  ? -21.258 -12.989 -47.122 1.00 116.67 ? 82  GLU D OE1 1 
ATOM 3025 O OE2 . GLU D 1 82  ? -22.695 -13.596 -45.567 1.00 106.88 ? 82  GLU D OE2 1 
ATOM 3026 N N   . ASP D 1 83  ? -20.860 -6.788  -47.141 1.00 72.58  ? 83  ASP D N   1 
ATOM 3027 C CA  . ASP D 1 83  ? -19.952 -5.856  -47.826 1.00 71.86  ? 83  ASP D CA  1 
ATOM 3028 C C   . ASP D 1 83  ? -19.853 -4.462  -47.169 1.00 73.16  ? 83  ASP D C   1 
ATOM 3029 O O   . ASP D 1 83  ? -19.120 -3.603  -47.683 1.00 74.78  ? 83  ASP D O   1 
ATOM 3030 C CB  . ASP D 1 83  ? -20.374 -5.702  -49.293 1.00 72.95  ? 83  ASP D CB  1 
ATOM 3031 N N   . GLN D 1 84  ? -20.574 -4.246  -46.046 1.00 64.64  ? 84  GLN D N   1 
ATOM 3032 C CA  . GLN D 1 84  ? -20.596 -2.975  -45.306 1.00 62.10  ? 84  GLN D CA  1 
ATOM 3033 C C   . GLN D 1 84  ? -19.248 -2.631  -44.650 1.00 62.80  ? 84  GLN D C   1 
ATOM 3034 O O   . GLN D 1 84  ? -18.512 -3.545  -44.274 1.00 62.96  ? 84  GLN D O   1 
ATOM 3035 C CB  . GLN D 1 84  ? -21.715 -2.996  -44.248 1.00 62.61  ? 84  GLN D CB  1 
ATOM 3036 C CG  . GLN D 1 84  ? -21.451 -3.935  -43.071 1.00 65.15  ? 84  GLN D CG  1 
ATOM 3037 C CD  . GLN D 1 84  ? -22.646 -4.094  -42.184 1.00 67.82  ? 84  GLN D CD  1 
ATOM 3038 O OE1 . GLN D 1 84  ? -22.980 -3.228  -41.380 1.00 60.04  ? 84  GLN D OE1 1 
ATOM 3039 N NE2 . GLN D 1 84  ? -23.303 -5.219  -42.301 1.00 52.47  ? 84  GLN D NE2 1 
ATOM 3040 N N   . PRO D 1 85  ? -18.919 -1.329  -44.449 1.00 57.57  ? 85  PRO D N   1 
ATOM 3041 C CA  . PRO D 1 85  ? -17.680 -1.002  -43.721 1.00 57.00  ? 85  PRO D CA  1 
ATOM 3042 C C   . PRO D 1 85  ? -17.854 -1.181  -42.202 1.00 60.55  ? 85  PRO D C   1 
ATOM 3043 O O   . PRO D 1 85  ? -18.917 -1.586  -41.742 1.00 58.23  ? 85  PRO D O   1 
ATOM 3044 C CB  . PRO D 1 85  ? -17.476 0.477   -44.059 1.00 58.01  ? 85  PRO D CB  1 
ATOM 3045 C CG  . PRO D 1 85  ? -18.858 1.005   -44.189 1.00 60.30  ? 85  PRO D CG  1 
ATOM 3046 C CD  . PRO D 1 85  ? -19.672 -0.095  -44.791 1.00 55.98  ? 85  PRO D CD  1 
ATOM 3047 N N   . LEU D 1 86  ? -16.807 -0.877  -41.428 1.00 57.40  ? 86  LEU D N   1 
ATOM 3048 C CA  . LEU D 1 86  ? -16.855 -0.994  -39.974 1.00 55.46  ? 86  LEU D CA  1 
ATOM 3049 C C   . LEU D 1 86  ? -16.728 0.368   -39.322 1.00 57.99  ? 86  LEU D C   1 
ATOM 3050 O O   . LEU D 1 86  ? -15.960 1.207   -39.792 1.00 58.04  ? 86  LEU D O   1 
ATOM 3051 C CB  . LEU D 1 86  ? -15.761 -1.946  -39.443 1.00 55.50  ? 86  LEU D CB  1 
ATOM 3052 C CG  . LEU D 1 86  ? -15.734 -3.371  -39.989 1.00 60.57  ? 86  LEU D CG  1 
ATOM 3053 C CD1 . LEU D 1 86  ? -14.738 -4.202  -39.259 1.00 61.65  ? 86  LEU D CD1 1 
ATOM 3054 C CD2 . LEU D 1 86  ? -17.094 -4.045  -39.945 1.00 61.43  ? 86  LEU D CD2 1 
ATOM 3055 N N   . LEU D 1 87  ? -17.479 0.587   -38.243 1.00 53.80  ? 87  LEU D N   1 
ATOM 3056 C CA  . LEU D 1 87  ? -17.428 1.838   -37.494 1.00 53.52  ? 87  LEU D CA  1 
ATOM 3057 C C   . LEU D 1 87  ? -16.390 1.641   -36.384 1.00 55.90  ? 87  LEU D C   1 
ATOM 3058 O O   . LEU D 1 87  ? -16.392 0.612   -35.708 1.00 52.99  ? 87  LEU D O   1 
ATOM 3059 C CB  . LEU D 1 87  ? -18.806 2.203   -36.905 1.00 53.19  ? 87  LEU D CB  1 
ATOM 3060 C CG  . LEU D 1 87  ? -20.025 2.220   -37.852 1.00 57.06  ? 87  LEU D CG  1 
ATOM 3061 C CD1 . LEU D 1 87  ? -21.288 2.463   -37.072 1.00 56.79  ? 87  LEU D CD1 1 
ATOM 3062 C CD2 . LEU D 1 87  ? -19.894 3.267   -38.948 1.00 57.65  ? 87  LEU D CD2 1 
ATOM 3063 N N   . ILE D 1 88  ? -15.486 2.610   -36.238 1.00 53.46  ? 88  ILE D N   1 
ATOM 3064 C CA  . ILE D 1 88  ? -14.414 2.559   -35.256 1.00 53.21  ? 88  ILE D CA  1 
ATOM 3065 C C   . ILE D 1 88  ? -14.671 3.488   -34.072 1.00 58.09  ? 88  ILE D C   1 
ATOM 3066 O O   . ILE D 1 88  ? -14.937 4.677   -34.250 1.00 57.01  ? 88  ILE D O   1 
ATOM 3067 C CB  . ILE D 1 88  ? -13.028 2.892   -35.896 1.00 57.18  ? 88  ILE D CB  1 
ATOM 3068 C CG1 . ILE D 1 88  ? -12.694 1.971   -37.124 1.00 56.82  ? 88  ILE D CG1 1 
ATOM 3069 C CG2 . ILE D 1 88  ? -11.901 2.853   -34.823 1.00 55.82  ? 88  ILE D CG2 1 
ATOM 3070 C CD1 . ILE D 1 88  ? -11.629 2.597   -38.063 1.00 54.29  ? 88  ILE D CD1 1 
ATOM 3071 N N   . HIS D 1 89  ? -14.551 2.926   -32.861 1.00 55.03  ? 89  HIS D N   1 
ATOM 3072 C CA  . HIS D 1 89  ? -14.565 3.652   -31.609 1.00 54.79  ? 89  HIS D CA  1 
ATOM 3073 C C   . HIS D 1 89  ? -13.252 3.348   -30.909 1.00 59.26  ? 89  HIS D C   1 
ATOM 3074 O O   . HIS D 1 89  ? -12.893 2.174   -30.712 1.00 56.30  ? 89  HIS D O   1 
ATOM 3075 C CB  . HIS D 1 89  ? -15.758 3.259   -30.732 1.00 55.26  ? 89  HIS D CB  1 
ATOM 3076 C CG  . HIS D 1 89  ? -15.703 3.833   -29.350 1.00 59.05  ? 89  HIS D CG  1 
ATOM 3077 N ND1 . HIS D 1 89  ? -15.523 3.020   -28.236 1.00 60.59  ? 89  HIS D ND1 1 
ATOM 3078 C CD2 . HIS D 1 89  ? -15.779 5.121   -28.943 1.00 61.54  ? 89  HIS D CD2 1 
ATOM 3079 C CE1 . HIS D 1 89  ? -15.540 3.836   -27.197 1.00 60.37  ? 89  HIS D CE1 1 
ATOM 3080 N NE2 . HIS D 1 89  ? -15.683 5.109   -27.571 1.00 61.40  ? 89  HIS D NE2 1 
ATOM 3081 N N   . ARG D 1 90  ? -12.509 4.408   -30.575 1.00 60.30  ? 90  ARG D N   1 
ATOM 3082 C CA  . ARG D 1 90  ? -11.238 4.286   -29.836 1.00 61.78  ? 90  ARG D CA  1 
ATOM 3083 C C   . ARG D 1 90  ? -11.514 4.554   -28.337 1.00 62.89  ? 90  ARG D C   1 
ATOM 3084 O O   . ARG D 1 90  ? -11.802 5.686   -27.984 1.00 61.70  ? 90  ARG D O   1 
ATOM 3085 C CB  . ARG D 1 90  ? -10.166 5.209   -30.454 1.00 65.02  ? 90  ARG D CB  1 
ATOM 3086 C CG  . ARG D 1 90  ? -9.895  4.823   -31.897 1.00 69.68  ? 90  ARG D CG  1 
ATOM 3087 C CD  . ARG D 1 90  ? -8.667  5.456   -32.507 1.00 80.92  ? 90  ARG D CD  1 
ATOM 3088 N NE  . ARG D 1 90  ? -8.652  5.219   -33.951 1.00 85.62  ? 90  ARG D NE  1 
ATOM 3089 C CZ  . ARG D 1 90  ? -9.118  6.072   -34.855 1.00 97.30  ? 90  ARG D CZ  1 
ATOM 3090 N NH1 . ARG D 1 90  ? -9.594  7.255   -34.480 1.00 78.28  ? 90  ARG D NH1 1 
ATOM 3091 N NH2 . ARG D 1 90  ? -9.083  5.764   -36.145 1.00 89.60  ? 90  ARG D NH2 1 
ATOM 3092 N N   . PRO D 1 91  ? -11.559 3.526   -27.460 1.00 61.58  ? 91  PRO D N   1 
ATOM 3093 C CA  . PRO D 1 91  ? -11.946 3.774   -26.036 1.00 61.73  ? 91  PRO D CA  1 
ATOM 3094 C C   . PRO D 1 91  ? -10.888 4.418   -25.125 1.00 66.37  ? 91  PRO D C   1 
ATOM 3095 O O   . PRO D 1 91  ? -10.101 5.273   -25.530 1.00 67.30  ? 91  PRO D O   1 
ATOM 3096 C CB  . PRO D 1 91  ? -12.287 2.374   -25.515 1.00 62.70  ? 91  PRO D CB  1 
ATOM 3097 C CG  . PRO D 1 91  ? -11.496 1.438   -26.355 1.00 66.56  ? 91  PRO D CG  1 
ATOM 3098 C CD  . PRO D 1 91  ? -11.295 2.090   -27.709 1.00 62.97  ? 91  PRO D CD  1 
ATOM 3099 N N   . GLU D 1 93  ? -9.777  4.724   -22.127 1.00 75.74  ? 93  GLU D N   1 
ATOM 3100 C CA  . GLU D 1 93  ? -8.528  4.544   -21.382 1.00 76.98  ? 93  GLU D CA  1 
ATOM 3101 C C   . GLU D 1 93  ? -7.770  3.350   -21.988 1.00 82.97  ? 93  GLU D C   1 
ATOM 3102 O O   . GLU D 1 93  ? -7.548  2.317   -21.333 1.00 84.49  ? 93  GLU D O   1 
ATOM 3103 C CB  . GLU D 1 93  ? -8.786  4.384   -19.860 1.00 77.52  ? 93  GLU D CB  1 
ATOM 3104 N N   . ARG D 1 94  ? -7.351  3.531   -23.255 1.00 77.70  ? 94  ARG D N   1 
ATOM 3105 C CA  . ARG D 1 94  ? -6.717  2.526   -24.111 1.00 76.05  ? 94  ARG D CA  1 
ATOM 3106 C C   . ARG D 1 94  ? -5.184  2.360   -24.014 1.00 77.55  ? 94  ARG D C   1 
ATOM 3107 O O   . ARG D 1 94  ? -4.659  1.367   -24.519 1.00 77.52  ? 94  ARG D O   1 
ATOM 3108 C CB  . ARG D 1 94  ? -7.106  2.782   -25.581 1.00 74.89  ? 94  ARG D CB  1 
ATOM 3109 C CG  . ARG D 1 94  ? -6.596  4.062   -26.206 1.00 77.78  ? 94  ARG D CG  1 
ATOM 3110 C CD  . ARG D 1 94  ? -7.149  4.163   -27.608 1.00 72.89  ? 94  ARG D CD  1 
ATOM 3111 N NE  . ARG D 1 94  ? -6.819  5.431   -28.266 1.00 69.61  ? 94  ARG D NE  1 
ATOM 3112 C CZ  . ARG D 1 94  ? -7.573  6.520   -28.208 1.00 78.31  ? 94  ARG D CZ  1 
ATOM 3113 N NH1 . ARG D 1 94  ? -7.222  7.614   -28.872 1.00 74.63  ? 94  ARG D NH1 1 
ATOM 3114 N NH2 . ARG D 1 94  ? -8.690  6.522   -27.494 1.00 59.25  ? 94  ARG D NH2 1 
ATOM 3115 N N   . GLN D 1 95  ? -4.478  3.320   -23.413 1.00 71.89  ? 95  GLN D N   1 
ATOM 3116 C CA  . GLN D 1 95  ? -3.024  3.283   -23.321 1.00 70.78  ? 95  GLN D CA  1 
ATOM 3117 C C   . GLN D 1 95  ? -2.560  3.679   -21.915 1.00 70.83  ? 95  GLN D C   1 
ATOM 3118 O O   . GLN D 1 95  ? -3.113  4.604   -21.306 1.00 68.00  ? 95  GLN D O   1 
ATOM 3119 C CB  . GLN D 1 95  ? -2.443  4.229   -24.375 1.00 73.28  ? 95  GLN D CB  1 
ATOM 3120 C CG  . GLN D 1 95  ? -1.015  3.919   -24.761 1.00 84.16  ? 95  GLN D CG  1 
ATOM 3121 C CD  . GLN D 1 95  ? -0.536  4.772   -25.905 1.00 89.26  ? 95  GLN D CD  1 
ATOM 3122 O OE1 . GLN D 1 95  ? -1.172  5.758   -26.304 1.00 79.19  ? 95  GLN D OE1 1 
ATOM 3123 N NE2 . GLN D 1 95  ? 0.611   4.408   -26.459 1.00 79.28  ? 95  GLN D NE2 1 
ATOM 3124 N N   . ASP D 1 96  ? -1.555  2.960   -21.402 1.00 67.15  ? 96  ASP D N   1 
ATOM 3125 C CA  . ASP D 1 96  ? -0.975  3.253   -20.095 1.00 66.71  ? 96  ASP D CA  1 
ATOM 3126 C C   . ASP D 1 96  ? 0.247   4.156   -20.307 1.00 71.82  ? 96  ASP D C   1 
ATOM 3127 O O   . ASP D 1 96  ? 0.560   4.484   -21.454 1.00 73.95  ? 96  ASP D O   1 
ATOM 3128 C CB  . ASP D 1 96  ? -0.663  1.952   -19.310 1.00 68.69  ? 96  ASP D CB  1 
ATOM 3129 C CG  . ASP D 1 96  ? 0.581   1.150   -19.706 1.00 85.71  ? 96  ASP D CG  1 
ATOM 3130 O OD1 . ASP D 1 96  ? 1.000   1.233   -20.886 1.00 88.37  ? 96  ASP D OD1 1 
ATOM 3131 O OD2 . ASP D 1 96  ? 1.103   0.404   -18.847 1.00 92.69  ? 96  ASP D OD2 1 
ATOM 3132 N N   . ASN D 1 97  ? 0.928   4.562   -19.236 1.00 68.58  ? 97  ASN D N   1 
ATOM 3133 C CA  . ASN D 1 97  ? 2.101   5.449   -19.338 1.00 71.72  ? 97  ASN D CA  1 
ATOM 3134 C C   . ASN D 1 97  ? 3.343   4.796   -20.019 1.00 79.37  ? 97  ASN D C   1 
ATOM 3135 O O   . ASN D 1 97  ? 4.212   5.517   -20.529 1.00 81.72  ? 97  ASN D O   1 
ATOM 3136 C CB  . ASN D 1 97  ? 2.470   6.005   -17.965 1.00 68.78  ? 97  ASN D CB  1 
ATOM 3137 C CG  . ASN D 1 97  ? 2.775   4.996   -16.895 1.00 84.08  ? 97  ASN D CG  1 
ATOM 3138 O OD1 . ASN D 1 97  ? 2.512   3.795   -17.008 1.00 84.49  ? 97  ASN D OD1 1 
ATOM 3139 N ND2 . ASN D 1 97  ? 3.337   5.479   -15.815 1.00 75.36  ? 97  ASN D ND2 1 
ATOM 3140 N N   . HIS D 1 98  ? 3.388   3.437   -20.075 1.00 74.82  ? 98  HIS D N   1 
ATOM 3141 C CA  . HIS D 1 98  ? 4.468   2.671   -20.710 1.00 76.44  ? 98  HIS D CA  1 
ATOM 3142 C C   . HIS D 1 98  ? 4.251   2.534   -22.220 1.00 81.40  ? 98  HIS D C   1 
ATOM 3143 O O   . HIS D 1 98  ? 5.074   1.934   -22.919 1.00 84.34  ? 98  HIS D O   1 
ATOM 3144 C CB  . HIS D 1 98  ? 4.620   1.301   -20.034 1.00 75.86  ? 98  HIS D CB  1 
ATOM 3145 C CG  . HIS D 1 98  ? 5.137   1.405   -18.636 1.00 78.87  ? 98  HIS D CG  1 
ATOM 3146 N ND1 . HIS D 1 98  ? 4.290   1.687   -17.569 1.00 77.48  ? 98  HIS D ND1 1 
ATOM 3147 C CD2 . HIS D 1 98  ? 6.406   1.304   -18.174 1.00 83.04  ? 98  HIS D CD2 1 
ATOM 3148 C CE1 . HIS D 1 98  ? 5.066   1.738   -16.498 1.00 77.51  ? 98  HIS D CE1 1 
ATOM 3149 N NE2 . HIS D 1 98  ? 6.348   1.517   -16.810 1.00 81.26  ? 98  HIS D NE2 1 
ATOM 3150 N N   . GLY D 1 99  ? 3.157   3.121   -22.700 1.00 75.51  ? 99  GLY D N   1 
ATOM 3151 C CA  . GLY D 1 99  ? 2.766   3.126   -24.097 1.00 76.11  ? 99  GLY D CA  1 
ATOM 3152 C C   . GLY D 1 99  ? 2.052   1.856   -24.511 1.00 80.10  ? 99  GLY D C   1 
ATOM 3153 O O   . GLY D 1 99  ? 1.697   1.701   -25.680 1.00 79.71  ? 99  GLY D O   1 
ATOM 3154 N N   . MET D 1 100 ? 1.838   0.932   -23.556 1.00 76.05  ? 100 MET D N   1 
ATOM 3155 C CA  . MET D 1 100 ? 1.170   -0.333  -23.829 1.00 74.34  ? 100 MET D CA  1 
ATOM 3156 C C   . MET D 1 100 ? -0.330  -0.129  -24.034 1.00 75.91  ? 100 MET D C   1 
ATOM 3157 O O   . MET D 1 100 ? -0.988  0.626   -23.300 1.00 72.91  ? 100 MET D O   1 
ATOM 3158 C CB  . MET D 1 100 ? 1.458   -1.359  -22.713 1.00 76.07  ? 100 MET D CB  1 
ATOM 3159 N N   . LEU D 1 101 ? -0.851  -0.802  -25.055 1.00 74.25  ? 101 LEU D N   1 
ATOM 3160 C CA  . LEU D 1 101 ? -2.260  -0.824  -25.401 1.00 72.96  ? 101 LEU D CA  1 
ATOM 3161 C C   . LEU D 1 101 ? -2.983  -1.600  -24.299 1.00 78.35  ? 101 LEU D C   1 
ATOM 3162 O O   . LEU D 1 101 ? -2.653  -2.756  -24.050 1.00 79.90  ? 101 LEU D O   1 
ATOM 3163 C CB  . LEU D 1 101 ? -2.449  -1.509  -26.768 1.00 73.65  ? 101 LEU D CB  1 
ATOM 3164 N N   . LEU D 1 102 ? -3.890  -0.940  -23.581 1.00 75.73  ? 102 LEU D N   1 
ATOM 3165 C CA  . LEU D 1 102 ? -4.666  -1.549  -22.490 1.00 75.58  ? 102 LEU D CA  1 
ATOM 3166 C C   . LEU D 1 102 ? -5.997  -2.091  -23.032 1.00 80.00  ? 102 LEU D C   1 
ATOM 3167 O O   . LEU D 1 102 ? -6.428  -3.185  -22.649 1.00 81.15  ? 102 LEU D O   1 
ATOM 3168 C CB  . LEU D 1 102 ? -4.977  -0.529  -21.388 1.00 74.58  ? 102 LEU D CB  1 
ATOM 3169 C CG  . LEU D 1 102 ? -3.827  0.109   -20.636 1.00 80.21  ? 102 LEU D CG  1 
ATOM 3170 C CD1 . LEU D 1 102 ? -4.354  1.213   -19.743 1.00 79.36  ? 102 LEU D CD1 1 
ATOM 3171 C CD2 . LEU D 1 102 ? -3.058  -0.926  -19.812 1.00 80.79  ? 102 LEU D CD2 1 
ATOM 3172 N N   . LYS D 1 103 ? -6.650  -1.297  -23.893 1.00 73.05  ? 103 LYS D N   1 
ATOM 3173 C CA  . LYS D 1 103 ? -7.916  -1.633  -24.531 1.00 71.56  ? 103 LYS D CA  1 
ATOM 3174 C C   . LYS D 1 103 ? -7.705  -1.557  -26.047 1.00 75.52  ? 103 LYS D C   1 
ATOM 3175 O O   . LYS D 1 103 ? -7.040  -0.635  -26.538 1.00 76.89  ? 103 LYS D O   1 
ATOM 3176 C CB  . LYS D 1 103 ? -9.000  -0.604  -24.141 1.00 72.48  ? 103 LYS D CB  1 
ATOM 3177 C CG  . LYS D 1 103 ? -9.536  -0.717  -22.723 1.00 83.27  ? 103 LYS D CG  1 
ATOM 3178 C CD  . LYS D 1 103 ? -10.248 0.577   -22.336 1.00 85.43  ? 103 LYS D CD  1 
ATOM 3179 C CE  . LYS D 1 103 ? -10.796 0.554   -20.936 1.00 91.83  ? 103 LYS D CE  1 
ATOM 3180 N NZ  . LYS D 1 103 ? -11.576 1.785   -20.633 1.00 102.64 ? 103 LYS D NZ  1 
ATOM 3181 N N   . GLY D 1 104 ? -8.289  -2.481  -26.791 1.00 69.14  ? 104 GLY D N   1 
ATOM 3182 C CA  . GLY D 1 104 ? -8.208  -2.402  -28.249 1.00 68.34  ? 104 GLY D CA  1 
ATOM 3183 C C   . GLY D 1 104 ? -9.286  -1.471  -28.780 1.00 68.28  ? 104 GLY D C   1 
ATOM 3184 O O   . GLY D 1 104 ? -10.131 -1.004  -28.008 1.00 66.35  ? 104 GLY D O   1 
ATOM 3185 N N   . GLU D 1 105 ? -9.308  -1.199  -30.089 1.00 63.68  ? 105 GLU D N   1 
ATOM 3186 C CA  . GLU D 1 105 ? -10.399 -0.369  -30.590 1.00 61.20  ? 105 GLU D CA  1 
ATOM 3187 C C   . GLU D 1 105 ? -11.699 -1.220  -30.686 1.00 62.42  ? 105 GLU D C   1 
ATOM 3188 O O   . GLU D 1 105 ? -11.649 -2.463  -30.684 1.00 61.19  ? 105 GLU D O   1 
ATOM 3189 C CB  . GLU D 1 105 ? -10.050 0.394   -31.882 1.00 62.93  ? 105 GLU D CB  1 
ATOM 3190 C CG  . GLU D 1 105 ? -10.022 -0.379  -33.182 1.00 70.98  ? 105 GLU D CG  1 
ATOM 3191 C CD  . GLU D 1 105 ? -9.253  0.325   -34.293 1.00 104.52 ? 105 GLU D CD  1 
ATOM 3192 O OE1 . GLU D 1 105 ? -9.044  -0.305  -35.357 1.00 102.76 ? 105 GLU D OE1 1 
ATOM 3193 O OE2 . GLU D 1 105 ? -8.838  1.493   -34.097 1.00 99.04  ? 105 GLU D OE2 1 
ATOM 3194 N N   . ILE D 1 106 ? -12.847 -0.537  -30.572 1.00 56.65  ? 106 ILE D N   1 
ATOM 3195 C CA  . ILE D 1 106 ? -14.156 -1.162  -30.617 1.00 54.16  ? 106 ILE D CA  1 
ATOM 3196 C C   . ILE D 1 106 ? -14.677 -1.037  -32.040 1.00 56.60  ? 106 ILE D C   1 
ATOM 3197 O O   . ILE D 1 106 ? -14.689 0.056   -32.606 1.00 54.35  ? 106 ILE D O   1 
ATOM 3198 C CB  . ILE D 1 106 ? -15.109 -0.596  -29.542 1.00 56.74  ? 106 ILE D CB  1 
ATOM 3199 C CG1 . ILE D 1 106 ? -14.676 -1.090  -28.125 1.00 56.64  ? 106 ILE D CG1 1 
ATOM 3200 C CG2 . ILE D 1 106 ? -16.597 -0.955  -29.850 1.00 54.94  ? 106 ILE D CG2 1 
ATOM 3201 C CD1 . ILE D 1 106 ? -15.480 -0.458  -27.013 1.00 60.56  ? 106 ILE D CD1 1 
ATOM 3202 N N   . LEU D 1 107 ? -15.058 -2.178  -32.627 1.00 54.60  ? 107 LEU D N   1 
ATOM 3203 C CA  . LEU D 1 107 ? -15.565 -2.225  -33.974 1.00 55.23  ? 107 LEU D CA  1 
ATOM 3204 C C   . LEU D 1 107 ? -17.052 -2.591  -33.994 1.00 56.93  ? 107 LEU D C   1 
ATOM 3205 O O   . LEU D 1 107 ? -17.464 -3.594  -33.404 1.00 58.15  ? 107 LEU D O   1 
ATOM 3206 C CB  . LEU D 1 107 ? -14.712 -3.162  -34.831 1.00 56.51  ? 107 LEU D CB  1 
ATOM 3207 C CG  . LEU D 1 107 ? -13.241 -2.722  -34.993 1.00 62.34  ? 107 LEU D CG  1 
ATOM 3208 C CD1 . LEU D 1 107 ? -12.429 -3.801  -35.564 1.00 63.49  ? 107 LEU D CD1 1 
ATOM 3209 C CD2 . LEU D 1 107 ? -13.122 -1.522  -35.910 1.00 66.54  ? 107 LEU D CD2 1 
ATOM 3210 N N   . LEU D 1 108 ? -17.848 -1.722  -34.636 1.00 49.41  ? 108 LEU D N   1 
ATOM 3211 C CA  . LEU D 1 108 ? -19.304 -1.836  -34.750 1.00 49.00  ? 108 LEU D CA  1 
ATOM 3212 C C   . LEU D 1 108 ? -19.763 -1.933  -36.186 1.00 53.32  ? 108 LEU D C   1 
ATOM 3213 O O   . LEU D 1 108 ? -19.149 -1.349  -37.068 1.00 55.35  ? 108 LEU D O   1 
ATOM 3214 C CB  . LEU D 1 108 ? -20.005 -0.631  -34.065 1.00 47.96  ? 108 LEU D CB  1 
ATOM 3215 C CG  . LEU D 1 108 ? -19.499 -0.288  -32.654 1.00 49.58  ? 108 LEU D CG  1 
ATOM 3216 C CD1 . LEU D 1 108 ? -19.772 1.165   -32.322 1.00 50.65  ? 108 LEU D CD1 1 
ATOM 3217 C CD2 . LEU D 1 108 ? -20.035 -1.270  -31.604 1.00 42.65  ? 108 LEU D CD2 1 
ATOM 3218 N N   . LEU D 1 109 ? -20.866 -2.637  -36.406 1.00 50.09  ? 109 LEU D N   1 
ATOM 3219 C CA  . LEU D 1 109 ? -21.445 -2.802  -37.735 1.00 51.12  ? 109 LEU D CA  1 
ATOM 3220 C C   . LEU D 1 109 ? -22.508 -1.746  -37.989 1.00 53.73  ? 109 LEU D C   1 
ATOM 3221 O O   . LEU D 1 109 ? -23.446 -1.647  -37.205 1.00 55.16  ? 109 LEU D O   1 
ATOM 3222 C CB  . LEU D 1 109 ? -22.069 -4.210  -37.921 1.00 52.73  ? 109 LEU D CB  1 
ATOM 3223 C CG  . LEU D 1 109 ? -21.195 -5.448  -37.663 1.00 60.12  ? 109 LEU D CG  1 
ATOM 3224 C CD1 . LEU D 1 109 ? -21.918 -6.705  -38.117 1.00 62.78  ? 109 LEU D CD1 1 
ATOM 3225 C CD2 . LEU D 1 109 ? -19.875 -5.382  -38.406 1.00 60.73  ? 109 LEU D CD2 1 
ATOM 3226 N N   . PRO D 1 110 ? -22.416 -0.985  -39.104 1.00 48.74  ? 110 PRO D N   1 
ATOM 3227 C CA  . PRO D 1 110 ? -23.485 -0.023  -39.455 1.00 47.87  ? 110 PRO D CA  1 
ATOM 3228 C C   . PRO D 1 110 ? -24.912 -0.585  -39.440 1.00 53.43  ? 110 PRO D C   1 
ATOM 3229 O O   . PRO D 1 110 ? -25.836 0.172   -39.160 1.00 53.53  ? 110 PRO D O   1 
ATOM 3230 C CB  . PRO D 1 110 ? -23.113 0.400   -40.880 1.00 49.00  ? 110 PRO D CB  1 
ATOM 3231 C CG  . PRO D 1 110 ? -21.671 0.141   -41.033 1.00 52.37  ? 110 PRO D CG  1 
ATOM 3232 C CD  . PRO D 1 110 ? -21.351 -1.006  -40.138 1.00 49.81  ? 110 PRO D CD  1 
ATOM 3233 N N   . GLU D 1 111 ? -25.091 -1.889  -39.794 1.00 52.47  ? 111 GLU D N   1 
ATOM 3234 C CA  . GLU D 1 111 ? -26.351 -2.643  -39.846 1.00 54.95  ? 111 GLU D CA  1 
ATOM 3235 C C   . GLU D 1 111 ? -26.984 -2.770  -38.449 1.00 64.23  ? 111 GLU D C   1 
ATOM 3236 O O   . GLU D 1 111 ? -28.210 -2.832  -38.343 1.00 67.46  ? 111 GLU D O   1 
ATOM 3237 C CB  . GLU D 1 111 ? -26.063 -4.041  -40.430 1.00 56.90  ? 111 GLU D CB  1 
ATOM 3238 C CG  . GLU D 1 111 ? -27.263 -4.959  -40.628 1.00 73.55  ? 111 GLU D CG  1 
ATOM 3239 C CD  . GLU D 1 111 ? -27.000 -6.327  -41.238 1.00 88.42  ? 111 GLU D CD  1 
ATOM 3240 O OE1 . GLU D 1 111 ? -26.138 -6.428  -42.142 1.00 68.51  ? 111 GLU D OE1 1 
ATOM 3241 O OE2 . GLU D 1 111 ? -27.721 -7.283  -40.872 1.00 86.67  ? 111 GLU D OE2 1 
ATOM 3242 N N   . LEU D 1 112 ? -26.156 -2.807  -37.376 1.00 60.02  ? 112 LEU D N   1 
ATOM 3243 C CA  . LEU D 1 112 ? -26.633 -2.968  -35.998 1.00 59.00  ? 112 LEU D CA  1 
ATOM 3244 C C   . LEU D 1 112 ? -26.597 -1.670  -35.194 1.00 59.43  ? 112 LEU D C   1 
ATOM 3245 O O   . LEU D 1 112 ? -27.015 -1.666  -34.024 1.00 60.05  ? 112 LEU D O   1 
ATOM 3246 C CB  . LEU D 1 112 ? -25.816 -4.083  -35.285 1.00 58.80  ? 112 LEU D CB  1 
ATOM 3247 C CG  . LEU D 1 112 ? -25.627 -5.413  -36.065 1.00 64.82  ? 112 LEU D CG  1 
ATOM 3248 C CD1 . LEU D 1 112 ? -24.659 -6.327  -35.375 1.00 66.15  ? 112 LEU D CD1 1 
ATOM 3249 C CD2 . LEU D 1 112 ? -26.952 -6.133  -36.312 1.00 66.08  ? 112 LEU D CD2 1 
ATOM 3250 N N   . SER D 1 113 ? -26.129 -0.569  -35.830 1.00 52.64  ? 113 SER D N   1 
ATOM 3251 C CA  . SER D 1 113 ? -25.959 0.750   -35.209 1.00 51.70  ? 113 SER D CA  1 
ATOM 3252 C C   . SER D 1 113 ? -26.997 1.756   -35.670 1.00 57.23  ? 113 SER D C   1 
ATOM 3253 O O   . SER D 1 113 ? -27.373 1.795   -36.839 1.00 56.82  ? 113 SER D O   1 
ATOM 3254 C CB  . SER D 1 113 ? -24.555 1.302   -35.457 1.00 51.78  ? 113 SER D CB  1 
ATOM 3255 O OG  . SER D 1 113 ? -23.537 0.345   -35.215 1.00 55.38  ? 113 SER D OG  1 
ATOM 3256 N N   . PHE D 1 114 ? -27.448 2.581   -34.723 1.00 57.54  ? 114 PHE D N   1 
ATOM 3257 C CA  . PHE D 1 114 ? -28.473 3.598   -34.913 1.00 59.90  ? 114 PHE D CA  1 
ATOM 3258 C C   . PHE D 1 114 ? -27.956 4.914   -34.382 1.00 67.20  ? 114 PHE D C   1 
ATOM 3259 O O   . PHE D 1 114 ? -27.466 4.971   -33.263 1.00 66.22  ? 114 PHE D O   1 
ATOM 3260 C CB  . PHE D 1 114 ? -29.787 3.182   -34.203 1.00 63.15  ? 114 PHE D CB  1 
ATOM 3261 C CG  . PHE D 1 114 ? -30.373 1.909   -34.753 1.00 64.20  ? 114 PHE D CG  1 
ATOM 3262 C CD1 . PHE D 1 114 ? -29.877 0.665   -34.363 1.00 66.14  ? 114 PHE D CD1 1 
ATOM 3263 C CD2 . PHE D 1 114 ? -31.389 1.946   -35.694 1.00 66.90  ? 114 PHE D CD2 1 
ATOM 3264 C CE1 . PHE D 1 114 ? -30.351 -0.513  -34.944 1.00 66.61  ? 114 PHE D CE1 1 
ATOM 3265 C CE2 . PHE D 1 114 ? -31.893 0.762   -36.243 1.00 69.63  ? 114 PHE D CE2 1 
ATOM 3266 C CZ  . PHE D 1 114 ? -31.371 -0.457  -35.857 1.00 66.93  ? 114 PHE D CZ  1 
ATOM 3267 N N   . MET D 1 115 ? -28.008 5.962   -35.203 1.00 68.16  ? 115 MET D N   1 
ATOM 3268 C CA  . MET D 1 115 ? -27.552 7.301   -34.819 1.00 70.29  ? 115 MET D CA  1 
ATOM 3269 C C   . MET D 1 115 ? -28.491 7.934   -33.807 1.00 73.80  ? 115 MET D C   1 
ATOM 3270 O O   . MET D 1 115 ? -29.705 7.806   -33.944 1.00 73.82  ? 115 MET D O   1 
ATOM 3271 C CB  . MET D 1 115 ? -27.421 8.192   -36.049 1.00 73.96  ? 115 MET D CB  1 
ATOM 3272 C CG  . MET D 1 115 ? -26.231 7.831   -36.876 1.00 77.01  ? 115 MET D CG  1 
ATOM 3273 S SD  . MET D 1 115 ? -26.375 8.589   -38.485 1.00 83.82  ? 115 MET D SD  1 
ATOM 3274 C CE  . MET D 1 115 ? -25.442 10.140  -38.194 1.00 82.57  ? 115 MET D CE  1 
ATOM 3275 N N   . THR D 1 116 ? -27.912 8.556   -32.760 1.00 69.97  ? 116 THR D N   1 
ATOM 3276 C CA  . THR D 1 116 ? -28.615 9.214   -31.661 1.00 72.00  ? 116 THR D CA  1 
ATOM 3277 C C   . THR D 1 116 ? -28.355 10.732  -31.709 1.00 80.21  ? 116 THR D C   1 
ATOM 3278 O O   . THR D 1 116 ? -29.016 11.508  -31.008 1.00 80.89  ? 116 THR D O   1 
ATOM 3279 C CB  . THR D 1 116 ? -28.166 8.618   -30.305 1.00 68.53  ? 116 THR D CB  1 
ATOM 3280 O OG1 . THR D 1 116 ? -26.810 8.938   -30.087 1.00 68.20  ? 116 THR D OG1 1 
ATOM 3281 C CG2 . THR D 1 116 ? -28.373 7.115   -30.202 1.00 59.51  ? 116 THR D CG2 1 
ATOM 3282 N N   . GLY D 1 117 ? -27.386 11.113  -32.543 1.00 79.08  ? 117 GLY D N   1 
ATOM 3283 C CA  . GLY D 1 117 ? -26.915 12.480  -32.733 1.00 81.73  ? 117 GLY D CA  1 
ATOM 3284 C C   . GLY D 1 117 ? -25.560 12.702  -32.077 1.00 87.31  ? 117 GLY D C   1 
ATOM 3285 O O   . GLY D 1 117 ? -24.889 11.742  -31.667 1.00 84.55  ? 117 GLY D O   1 
ATOM 3286 N N   . ILE D 1 118 ? -25.156 13.979  -31.961 1.00 87.65  ? 118 ILE D N   1 
ATOM 3287 C CA  . ILE D 1 118 ? -23.911 14.393  -31.316 1.00 114.42 ? 118 ILE D CA  1 
ATOM 3288 C C   . ILE D 1 118 ? -24.189 14.806  -29.864 1.00 138.04 ? 118 ILE D C   1 
ATOM 3289 O O   . ILE D 1 118 ? -24.534 13.967  -29.028 1.00 93.17  ? 118 ILE D O   1 
ATOM 3290 C CB  . ILE D 1 118 ? -23.234 15.523  -32.123 1.00 118.92 ? 118 ILE D CB  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 2   ? 2.3803 2.3838 0.7001 1.2848  0.0722  -0.1480 2   ASN A N   
2    C CA  . ASN A 2   ? 2.3055 2.4992 0.7206 1.2489  0.0256  -0.1546 2   ASN A CA  
3    C C   . ASN A 2   ? 2.3179 2.5334 0.7587 1.2219  0.0052  -0.1647 2   ASN A C   
4    O O   . ASN A 2   ? 2.2675 2.6205 0.7829 1.1824  -0.0382 -0.1805 2   ASN A O   
5    C CB  . ASN A 2   ? 2.2611 2.5467 0.7407 1.2208  0.0343  -0.1371 2   ASN A CB  
6    C CG  . ASN A 2   ? 2.3474 2.7736 1.0235 1.0570  -0.0040 -0.1339 2   ASN A CG  
7    O OD1 . ASN A 2   ? 2.2526 2.7565 0.9227 1.0872  -0.0174 -0.1390 2   ASN A OD1 
8    N ND2 . ASN A 2   ? 2.2462 2.7691 0.9395 1.0661  -0.0309 -0.1365 2   ASN A ND2 
9    N N   . ASP A 3   ? 2.2973 2.3796 0.6872 1.2273  0.0374  -0.1559 3   ASP A N   
10   C CA  . ASP A 3   ? 2.1989 2.2798 0.6846 1.1223  0.0263  -0.1584 3   ASP A CA  
11   C C   . ASP A 3   ? 2.1960 2.2105 0.7322 1.0426  0.0108  -0.1704 3   ASP A C   
12   O O   . ASP A 3   ? 2.2181 2.1428 0.7029 1.0662  0.0186  -0.1744 3   ASP A O   
13   C CB  . ASP A 3   ? 2.2434 2.2021 0.6875 1.1178  0.0685  -0.1415 3   ASP A CB  
14   C CG  . ASP A 3   ? 2.4742 2.4742 0.8689 1.1836  0.0912  -0.1261 3   ASP A CG  
15   O OD1 . ASP A 3   ? 2.4273 2.5789 0.9006 1.1605  0.0678  -0.1256 3   ASP A OD1 
16   O OD2 . ASP A 3   ? 2.5893 2.4728 0.9741 1.1497  0.1347  -0.1149 3   ASP A OD2 
17   N N   . CYS A 4   ? 2.0596 2.1119 0.6917 0.9506  -0.0077 -0.1744 4   CYS A N   
18   C CA  . CYS A 4   ? 2.0046 1.9947 0.6881 0.8712  -0.0185 -0.1816 4   CYS A CA  
19   C C   . CYS A 4   ? 2.0501 1.8732 0.7011 0.8518  0.0193  -0.1679 4   CYS A C   
20   O O   . CYS A 4   ? 2.0602 1.8608 0.7072 0.8455  0.0387  -0.1567 4   CYS A O   
21   C CB  . CYS A 4   ? 1.9237 2.0284 0.7126 0.7884  -0.0512 -0.1911 4   CYS A CB  
22   N N   . VAL A 5   ? 1.9955 1.7026 0.6179 0.8444  0.0308  -0.1690 5   VAL A N   
23   C CA  . VAL A 5   ? 1.9911 1.5425 0.5812 0.8242  0.0662  -0.1582 5   VAL A CA  
24   C C   . VAL A 5   ? 1.9396 1.4954 0.6021 0.7467  0.0652  -0.1508 5   VAL A C   
25   O O   . VAL A 5   ? 1.9318 1.4083 0.5620 0.7428  0.0949  -0.1400 5   VAL A O   
26   C CB  . VAL A 5   ? 2.0460 1.5083 0.6214 0.8151  0.0686  -0.1625 5   VAL A CB  
27   C CG1 . VAL A 5   ? 2.0528 1.3709 0.6074 0.7856  0.1033  -0.1517 5   VAL A CG1 
28   C CG2 . VAL A 5   ? 2.1186 1.5655 0.6128 0.8960  0.0720  -0.1693 5   VAL A CG2 
29   N N   . LEU A 6   ? 1.8256 1.4710 0.5790 0.6847  0.0325  -0.1571 6   LEU A N   
30   C CA  . LEU A 6   ? 1.7566 1.4129 0.5792 0.6135  0.0292  -0.1504 6   LEU A CA  
31   C C   . LEU A 6   ? 1.8286 1.5305 0.6479 0.6253  0.0369  -0.1442 6   LEU A C   
32   O O   . LEU A 6   ? 1.8375 1.4826 0.6625 0.5929  0.0544  -0.1335 6   LEU A O   
33   C CB  . LEU A 6   ? 1.6842 1.4221 0.5906 0.5509  -0.0036 -0.1595 6   LEU A CB  
34   C CG  . LEU A 6   ? 1.6705 1.3962 0.6421 0.4775  -0.0041 -0.1511 6   LEU A CG  
35   C CD1 . LEU A 6   ? 1.6771 1.2762 0.6305 0.4617  0.0220  -0.1372 6   LEU A CD1 
36   C CD2 . LEU A 6   ? 1.6530 1.4483 0.6880 0.4236  -0.0311 -0.1610 6   LEU A CD2 
37   N N   . ASP A 7   ? 1.7987 1.6011 0.6041 0.6739  0.0257  -0.1495 7   ASP A N   
38   C CA  . ASP A 7   ? 1.8080 1.6553 0.6026 0.6949  0.0357  -0.1415 7   ASP A CA  
39   C C   . ASP A 7   ? 1.9060 1.6235 0.6071 0.7358  0.0790  -0.1282 7   ASP A C   
40   O O   . ASP A 7   ? 1.9014 1.5881 0.6023 0.7113  0.0947  -0.1184 7   ASP A O   
41   C CB  . ASP A 7   ? 1.8413 1.8289 0.6354 0.7475  0.0169  -0.1483 7   ASP A CB  
42   C CG  . ASP A 7   ? 1.9168 2.0477 0.8058 0.6942  -0.0226 -0.1622 7   ASP A CG  
43   O OD1 . ASP A 7   ? 1.9057 2.0759 0.8115 0.6860  -0.0449 -0.1758 7   ASP A OD1 
44   O OD2 . ASP A 7   ? 1.9917 2.1901 0.9335 0.6581  -0.0290 -0.1601 7   ASP A OD2 
45   N N   . VAL A 8   ? 1.9122 1.5456 0.5292 0.7935  0.0996  -0.1287 8   VAL A N   
46   C CA  . VAL A 8   ? 1.9983 1.4898 0.5095 0.8326  0.1460  -0.1188 8   VAL A CA  
47   C C   . VAL A 8   ? 2.0614 1.4514 0.5915 0.7606  0.1622  -0.1134 8   VAL A C   
48   O O   . VAL A 8   ? 2.1061 1.4328 0.5953 0.7516  0.1897  -0.1044 8   VAL A O   
49   C CB  . VAL A 8   ? 2.1251 1.5471 0.5476 0.9034  0.1630  -0.1228 8   VAL A CB  
50   N N   . MET A 9   ? 1.9815 1.3682 0.5776 0.7066  0.1432  -0.1184 9   MET A N   
51   C CA  . MET A 9   ? 1.9564 1.2722 0.5866 0.6370  0.1524  -0.1126 9   MET A CA  
52   C C   . MET A 9   ? 1.9814 1.3488 0.6724 0.5821  0.1426  -0.1062 9   MET A C   
53   O O   . MET A 9   ? 1.9929 1.2856 0.6656 0.5486  0.1649  -0.0984 9   MET A O   
54   C CB  . MET A 9   ? 1.9333 1.2563 0.6245 0.6006  0.1314  -0.1171 9   MET A CB  
55   N N   . HIS A 10  ? 1.9104 1.4049 0.6703 0.5709  0.1102  -0.1105 10  HIS A N   
56   C CA  . HIS A 10  ? 1.8628 1.4133 0.6814 0.5219  0.0996  -0.1053 10  HIS A CA  
57   C C   . HIS A 10  ? 1.9511 1.4556 0.7030 0.5460  0.1282  -0.0964 10  HIS A C   
58   O O   . HIS A 10  ? 1.9538 1.4283 0.7217 0.4985  0.1357  -0.0889 10  HIS A O   
59   C CB  . HIS A 10  ? 1.8238 1.5171 0.7155 0.5123  0.0643  -0.1139 10  HIS A CB  
60   C CG  . HIS A 10  ? 1.8157 1.5523 0.7827 0.4631  0.0367  -0.1218 10  HIS A CG  
61   N ND1 . HIS A 10  ? 1.8166 1.4828 0.8086 0.4155  0.0409  -0.1160 10  HIS A ND1 
62   C CD2 . HIS A 10  ? 1.8042 1.6465 0.8204 0.4539  0.0075  -0.1343 10  HIS A CD2 
63   C CE1 . HIS A 10  ? 1.7626 1.4837 0.8113 0.3838  0.0166  -0.1237 10  HIS A CE1 
64   N NE2 . HIS A 10  ? 1.7599 1.5840 0.8234 0.4013  -0.0039 -0.1363 10  HIS A NE2 
65   N N   . ALA A 11  ? 1.9531 1.4484 0.6235 0.6218  0.1458  -0.0963 11  ALA A N   
66   C CA  . ALA A 11  ? 2.0097 1.4484 0.5950 0.6570  0.1795  -0.0864 11  ALA A CA  
67   C C   . ALA A 11  ? 2.1155 1.4007 0.6275 0.6355  0.2179  -0.0810 11  ALA A C   
68   O O   . ALA A 11  ? 2.1580 1.3990 0.6447 0.6089  0.2361  -0.0733 11  ALA A O   
69   C CB  . ALA A 11  ? 2.0823 1.5439 0.5912 0.7505  0.1916  -0.0859 11  ALA A CB  
70   N N   . ILE A 12  ? 2.0827 1.2900 0.5645 0.6402  0.2294  -0.0859 12  ILE A N   
71   C CA  . ILE A 12  ? 2.1203 1.1878 0.5368 0.6129  0.2662  -0.0833 12  ILE A CA  
72   C C   . ILE A 12  ? 2.1122 1.1926 0.6122 0.5222  0.2517  -0.0797 12  ILE A C   
73   O O   . ILE A 12  ? 2.1503 1.1533 0.6072 0.4873  0.2775  -0.0750 12  ILE A O   
74   C CB  . ILE A 12  ? 2.1826 1.1700 0.5500 0.6419  0.2824  -0.0897 12  ILE A CB  
75   C CG1 . ILE A 12  ? 2.2502 1.2317 0.5338 0.7367  0.2949  -0.0926 12  ILE A CG1 
76   C CG2 . ILE A 12  ? 2.2485 1.0923 0.5428 0.6102  0.3249  -0.0884 12  ILE A CG2 
77   C CD1 . ILE A 12  ? 2.4176 1.3826 0.6965 0.7669  0.2884  -0.1008 12  ILE A CD1 
78   N N   . TYR A 13  ? 1.9806 1.1584 0.5935 0.4853  0.2116  -0.0818 13  TYR A N   
79   C CA  . TYR A 13  ? 1.9193 1.1239 0.6164 0.4080  0.1948  -0.0767 13  TYR A CA  
80   C C   . TYR A 13  ? 1.9771 1.2044 0.6806 0.3805  0.1954  -0.0703 13  TYR A C   
81   O O   . TYR A 13  ? 1.9805 1.1631 0.6838 0.3293  0.2063  -0.0645 13  TYR A O   
82   C CB  . TYR A 13  ? 1.8527 1.1554 0.6540 0.3856  0.1553  -0.0799 13  TYR A CB  
83   C CG  . TYR A 13  ? 1.8082 1.1412 0.6912 0.3143  0.1395  -0.0724 13  TYR A CG  
84   C CD1 . TYR A 13  ? 1.8306 1.1141 0.7309 0.2777  0.1472  -0.0664 13  TYR A CD1 
85   C CD2 . TYR A 13  ? 1.7560 1.1695 0.6974 0.2863  0.1184  -0.0703 13  TYR A CD2 
86   C CE1 . TYR A 13  ? 1.7730 1.0901 0.7446 0.2190  0.1337  -0.0570 13  TYR A CE1 
87   C CE2 . TYR A 13  ? 1.7094 1.1475 0.7189 0.2264  0.1055  -0.0623 13  TYR A CE2 
88   C CZ  . TYR A 13  ? 1.7701 1.1622 0.7941 0.1949  0.1128  -0.0550 13  TYR A CZ  
89   O OH  . TYR A 13  ? 1.7057 1.1271 0.7933 0.1424  0.1012  -0.0448 13  TYR A OH  
90   N N   . GLN A 14  ? 1.9311 1.2329 0.6405 0.4147  0.1833  -0.0714 14  GLN A N   
91   C CA  . GLN A 14  ? 1.9249 1.2584 0.6397 0.3994  0.1828  -0.0653 14  GLN A CA  
92   C C   . GLN A 14  ? 2.0865 1.3061 0.6967 0.4034  0.2236  -0.0589 14  GLN A C   
93   O O   . GLN A 14  ? 2.0765 1.2831 0.6969 0.3550  0.2259  -0.0529 14  GLN A O   
94   C CB  . GLN A 14  ? 1.9265 1.3613 0.6568 0.4483  0.1668  -0.0680 14  GLN A CB  
95   C CG  . GLN A 14  ? 2.0007 1.5437 0.8240 0.4082  0.1369  -0.0675 14  GLN A CG  
96   C CD  . GLN A 14  ? 1.9772 1.5258 0.8779 0.3317  0.1197  -0.0657 14  GLN A CD  
97   O OE1 . GLN A 14  ? 1.7281 1.3161 0.6945 0.3068  0.0974  -0.0709 14  GLN A OE1 
98   N NE2 . GLN A 14  ? 1.8618 1.3690 0.7497 0.2953  0.1312  -0.0572 14  GLN A NE2 
99   N N   . GLN A 15  ? 2.1479 1.2781 0.6513 0.4587  0.2575  -0.0605 15  GLN A N   
100  C CA  . GLN A 15  ? 2.2531 1.2550 0.6363 0.4637  0.3036  -0.0560 15  GLN A CA  
101  C C   . GLN A 15  ? 2.3112 1.2388 0.6966 0.3891  0.3148  -0.0570 15  GLN A C   
102  O O   . GLN A 15  ? 2.3630 1.2331 0.7049 0.3497  0.3341  -0.0528 15  GLN A O   
103  C CB  . GLN A 15  ? 2.3712 1.2927 0.6352 0.5451  0.3392  -0.0579 15  GLN A CB  
104  N N   . ASN A 16  ? 2.2143 1.1527 0.6546 0.3677  0.3009  -0.0618 16  ASN A N   
105  C CA  . ASN A 16  ? 2.2041 1.0934 0.6594 0.3003  0.3088  -0.0618 16  ASN A CA  
106  C C   . ASN A 16  ? 2.1324 1.0983 0.6870 0.2294  0.2788  -0.0553 16  ASN A C   
107  O O   . ASN A 16  ? 2.1371 1.0587 0.6783 0.1725  0.2920  -0.0530 16  ASN A O   
108  C CB  . ASN A 16  ? 2.2119 1.0936 0.6954 0.3077  0.3045  -0.0666 16  ASN A CB  
109  C CG  . ASN A 16  ? 2.5577 1.3177 0.9212 0.3514  0.3478  -0.0730 16  ASN A CG  
110  O OD1 . ASN A 16  ? 2.5331 1.1986 0.8390 0.3170  0.3800  -0.0754 16  ASN A OD1 
111  N ND2 . ASN A 16  ? 2.4912 1.2510 0.8081 0.4281  0.3518  -0.0762 16  ASN A ND2 
112  N N   . LYS A 17  ? 1.9893 1.0700 0.6400 0.2315  0.2400  -0.0529 17  LYS A N   
113  C CA  . LYS A 17  ? 1.9118 1.0677 0.6552 0.1728  0.2114  -0.0463 17  LYS A CA  
114  C C   . LYS A 17  ? 2.0104 1.1351 0.7060 0.1504  0.2255  -0.0418 17  LYS A C   
115  O O   . LYS A 17  ? 1.9855 1.1015 0.6988 0.0908  0.2244  -0.0369 17  LYS A O   
116  C CB  . LYS A 17  ? 1.8554 1.1262 0.6922 0.1854  0.1737  -0.0472 17  LYS A CB  
117  C CG  . LYS A 17  ? 1.8369 1.1790 0.7651 0.1290  0.1465  -0.0403 17  LYS A CG  
118  N N   . GLU A 18  ? 2.0244 1.1291 0.6516 0.2015  0.2411  -0.0426 18  GLU A N   
119  C CA  . GLU A 18  ? 2.0812 1.1445 0.6454 0.1933  0.2597  -0.0373 18  GLU A CA  
120  C C   . GLU A 18  ? 2.2142 1.1581 0.6871 0.1553  0.2955  -0.0379 18  GLU A C   
121  O O   . GLU A 18  ? 2.2142 1.1457 0.6856 0.1011  0.2959  -0.0338 18  GLU A O   
122  C CB  . GLU A 18  ? 2.1571 1.2149 0.6536 0.2689  0.2758  -0.0361 18  GLU A CB  
123  C CG  . GLU A 18  ? 2.2545 1.4406 0.8395 0.2877  0.2415  -0.0346 18  GLU A CG  
124  C CD  . GLU A 18  ? 2.6268 1.8544 1.1835 0.3684  0.2449  -0.0357 18  GLU A CD  
125  O OE1 . GLU A 18  ? 2.6391 1.7825 1.0847 0.4223  0.2807  -0.0340 18  GLU A OE1 
126  O OE2 . GLU A 18  ? 2.5460 1.8928 1.1888 0.3776  0.2129  -0.0384 18  GLU A OE2 
127  N N   . HIS A 19  ? 2.2318 1.0899 0.6299 0.1792  0.3251  -0.0441 19  HIS A N   
128  C CA  . HIS A 19  ? 2.3165 1.0533 0.6179 0.1413  0.3645  -0.0479 19  HIS A CA  
129  C C   . HIS A 19  ? 2.2863 1.0591 0.6627 0.0564  0.3459  -0.0468 19  HIS A C   
130  O O   . HIS A 19  ? 2.3375 1.0558 0.6628 0.0025  0.3637  -0.0469 19  HIS A O   
131  C CB  . HIS A 19  ? 2.4001 1.0521 0.6256 0.1836  0.3957  -0.0559 19  HIS A CB  
132  C CG  . HIS A 19  ? 2.5601 1.0739 0.6669 0.1482  0.4439  -0.0621 19  HIS A CG  
133  N ND1 . HIS A 19  ? 2.7175 1.1089 0.6750 0.1783  0.4916  -0.0630 19  HIS A ND1 
134  C CD2 . HIS A 19  ? 2.5844 1.0661 0.6983 0.0858  0.4533  -0.0677 19  HIS A CD2 
135  C CE1 . HIS A 19  ? 2.7961 1.0788 0.6710 0.1280  0.5289  -0.0711 19  HIS A CE1 
136  N NE2 . HIS A 19  ? 2.7235 1.0615 0.6916 0.0707  0.5067  -0.0747 19  HIS A NE2 
137  N N   . PHE A 20  ? 2.1248 0.9902 0.6175 0.0461  0.3112  -0.0451 20  PHE A N   
138  C CA  . PHE A 20  ? 2.0479 0.9648 0.6220 -0.0233 0.2914  -0.0407 20  PHE A CA  
139  C C   . PHE A 20  ? 2.0444 1.0192 0.6643 -0.0686 0.2693  -0.0330 20  PHE A C   
140  O O   . PHE A 20  ? 2.0457 1.0102 0.6610 -0.1314 0.2732  -0.0310 20  PHE A O   
141  C CB  . PHE A 20  ? 1.9641 0.9629 0.6439 -0.0110 0.2618  -0.0377 20  PHE A CB  
142  C CG  . PHE A 20  ? 1.8754 0.9651 0.6629 -0.0647 0.2305  -0.0275 20  PHE A CG  
143  C CD1 . PHE A 20  ? 1.9080 0.9890 0.7012 -0.1234 0.2386  -0.0241 20  PHE A CD1 
144  C CD2 . PHE A 20  ? 1.8008 0.9862 0.6801 -0.0558 0.1948  -0.0213 20  PHE A CD2 
145  C CE1 . PHE A 20  ? 1.8265 0.9984 0.7168 -0.1653 0.2103  -0.0120 20  PHE A CE1 
146  C CE2 . PHE A 20  ? 1.7528 1.0139 0.7212 -0.0984 0.1699  -0.0102 20  PHE A CE2 
147  C CZ  . PHE A 20  ? 1.7301 0.9866 0.7043 -0.1492 0.1772  -0.0044 20  PHE A CZ  
148  N N   . GLN A 21  ? 1.9471 0.9872 0.6124 -0.0379 0.2457  -0.0293 21  GLN A N   
149  C CA  . GLN A 21  ? 1.8834 0.9823 0.5972 -0.0716 0.2231  -0.0220 21  GLN A CA  
150  C C   . GLN A 21  ? 2.0704 1.0871 0.6845 -0.0960 0.2503  -0.0222 21  GLN A C   
151  O O   . GLN A 21  ? 2.0797 1.1105 0.7111 -0.1550 0.2418  -0.0179 21  GLN A O   
152  C CB  . GLN A 21  ? 1.8164 0.9965 0.5925 -0.0298 0.1973  -0.0203 21  GLN A CB  
153  C CG  . GLN A 21  ? 1.6833 0.9462 0.5618 -0.0240 0.1681  -0.0196 21  GLN A CG  
154  C CD  . GLN A 21  ? 1.7689 1.1128 0.7069 0.0077  0.1439  -0.0209 21  GLN A CD  
155  O OE1 . GLN A 21  ? 1.6802 1.0285 0.5883 0.0334  0.1480  -0.0222 21  GLN A OE1 
156  N NE2 . GLN A 21  ? 1.7078 1.1163 0.7275 0.0058  0.1203  -0.0207 21  GLN A NE2 
157  N N   . ASP A 22  ? 2.1269 1.0506 0.6274 -0.0507 0.2859  -0.0268 22  ASP A N   
158  C CA  . ASP A 22  ? 2.2250 1.0406 0.6002 -0.0641 0.3228  -0.0272 22  ASP A CA  
159  C C   . ASP A 22  ? 2.3546 1.0856 0.6625 -0.1272 0.3498  -0.0337 22  ASP A C   
160  O O   . ASP A 22  ? 2.4542 1.1094 0.6752 -0.1652 0.3733  -0.0346 22  ASP A O   
161  C CB  . ASP A 22  ? 2.3207 1.0602 0.5899 0.0136  0.3569  -0.0283 22  ASP A CB  
162  N N   . GLU A 23  ? 2.2753 1.0177 0.6188 -0.1398 0.3481  -0.0387 23  GLU A N   
163  C CA  . GLU A 23  ? 2.3280 1.0108 0.6245 -0.2037 0.3713  -0.0458 23  GLU A CA  
164  C C   . GLU A 23  ? 2.2920 1.0699 0.6850 -0.2786 0.3376  -0.0398 23  GLU A C   
165  O O   . GLU A 23  ? 2.3372 1.0746 0.6788 -0.3454 0.3533  -0.0439 23  GLU A O   
166  C CB  . GLU A 23  ? 2.3474 1.0055 0.6430 -0.1810 0.3854  -0.0525 23  GLU A CB  
167  N N   . CYS A 24  ? 2.1323 1.0358 0.6594 -0.2669 0.2930  -0.0301 24  CYS A N   
168  C CA  . CYS A 24  ? 2.0540 1.0600 0.6804 -0.3225 0.2584  -0.0208 24  CYS A CA  
169  C C   . CYS A 24  ? 2.1243 1.1275 0.7240 -0.3556 0.2525  -0.0174 24  CYS A C   
170  O O   . CYS A 24  ? 2.1059 1.1273 0.7078 -0.4222 0.2477  -0.0158 24  CYS A O   
171  C CB  . CYS A 24  ? 1.9401 1.0577 0.6935 -0.2902 0.2199  -0.0113 24  CYS A CB  
172  S SG  . CYS A 24  ? 1.9458 1.1045 0.7669 -0.2899 0.2155  -0.0087 24  CYS A SG  
173  N N   . THR A 25  ? 2.1113 1.0971 0.6868 -0.3089 0.2524  -0.0158 25  THR A N   
174  C CA  . THR A 25  ? 2.1426 1.1185 0.6887 -0.3310 0.2487  -0.0116 25  THR A CA  
175  C C   . THR A 25  ? 2.3329 1.1955 0.7499 -0.3793 0.2857  -0.0188 25  THR A C   
176  O O   . THR A 25  ? 2.3265 1.2048 0.7435 -0.4419 0.2760  -0.0166 25  THR A O   
177  C CB  . THR A 25  ? 2.2428 1.2218 0.7850 -0.2665 0.2462  -0.0082 25  THR A CB  
178  O OG1 . THR A 25  ? 2.2589 1.1425 0.6989 -0.2144 0.2836  -0.0144 25  THR A OG1 
179  C CG2 . THR A 25  ? 2.1535 1.2499 0.8239 -0.2326 0.2082  -0.0031 25  THR A CG2 
180  N N   . LYS A 26  ? 2.4023 1.1489 0.7052 -0.3531 0.3294  -0.0280 26  LYS A N   
181  C CA  . LYS A 26  ? 2.5362 1.1540 0.6963 -0.3997 0.3728  -0.0369 26  LYS A CA  
182  C C   . LYS A 26  ? 2.5895 1.2423 0.7762 -0.4912 0.3641  -0.0416 26  LYS A C   
183  O O   . LYS A 26  ? 2.6509 1.2811 0.7917 -0.5532 0.3667  -0.0428 26  LYS A O   
184  C CB  . LYS A 26  ? 2.6612 1.1519 0.7003 -0.3541 0.4225  -0.0461 26  LYS A CB  
185  N N   . LEU A 27  ? 2.4518 1.1757 0.7237 -0.4975 0.3492  -0.0425 27  LEU A N   
186  C CA  . LEU A 27  ? 2.4334 1.2154 0.7489 -0.5749 0.3389  -0.0448 27  LEU A CA  
187  C C   . LEU A 27  ? 2.4241 1.3318 0.8410 -0.6198 0.2935  -0.0330 27  LEU A C   
188  O O   . LEU A 27  ? 2.4665 1.3917 0.8680 -0.6967 0.2933  -0.0364 27  LEU A O   
189  C CB  . LEU A 27  ? 2.3728 1.2056 0.7624 -0.5533 0.3335  -0.0446 27  LEU A CB  
190  N N   . LEU A 28  ? 2.2635 1.2591 0.7796 -0.5743 0.2565  -0.0199 28  LEU A N   
191  C CA  . LEU A 28  ? 2.1551 1.2706 0.7708 -0.6062 0.2144  -0.0072 28  LEU A CA  
192  C C   . LEU A 28  ? 2.1834 1.2829 0.7641 -0.6242 0.2061  -0.0039 28  LEU A C   
193  O O   . LEU A 28  ? 2.1347 1.3002 0.7497 -0.6785 0.1838  0.0017  28  LEU A O   
194  C CB  . LEU A 28  ? 2.0320 1.2509 0.7752 -0.5521 0.1810  0.0052  28  LEU A CB  
195  N N   . VAL A 29  ? 2.1680 1.1917 0.6881 -0.5751 0.2215  -0.0054 29  VAL A N   
196  C CA  . VAL A 29  ? 2.1779 1.1814 0.6650 -0.5825 0.2158  -0.0007 29  VAL A CA  
197  C C   . VAL A 29  ? 2.3560 1.2932 0.7436 -0.6605 0.2338  -0.0075 29  VAL A C   
198  O O   . VAL A 29  ? 2.4842 1.3175 0.7630 -0.6833 0.2729  -0.0196 29  VAL A O   
199  C CB  . VAL A 29  ? 2.2490 1.1815 0.6814 -0.5125 0.2353  -0.0005 29  VAL A CB  
200  N N   . GLY A 30  ? 2.2532 1.2521 0.6777 -0.7033 0.2056  -0.0003 30  GLY A N   
201  C CA  . GLY A 30  ? 2.3311 1.2869 0.6726 -0.7841 0.2150  -0.0063 30  GLY A CA  
202  C C   . GLY A 30  ? 2.3245 1.3944 0.7384 -0.8520 0.1863  -0.0044 30  GLY A C   
203  O O   . GLY A 30  ? 2.3668 1.4551 0.7584 -0.9113 0.1738  -0.0036 30  GLY A O   
204  N N   . ASN A 31  ? 2.2061 1.3546 0.7032 -0.8432 0.1767  -0.0028 31  ASN A N   
205  C CA  . ASN A 31  ? 2.1477 1.4179 0.7216 -0.8983 0.1520  0.0016  31  ASN A CA  
206  C C   . ASN A 31  ? 2.0560 1.4620 0.7466 -0.8880 0.1047  0.0203  31  ASN A C   
207  O O   . ASN A 31  ? 1.9676 1.3844 0.7045 -0.8274 0.0906  0.0295  31  ASN A O   
208  C CB  . ASN A 31  ? 2.1114 1.4134 0.7348 -0.8791 0.1608  -0.0002 31  ASN A CB  
209  N N   . ILE A 32  ? 2.0060 1.5174 0.7407 -0.9473 0.0819  0.0258  32  ILE A N   
210  C CA  . ILE A 32  ? 1.9137 1.5587 0.7506 -0.9409 0.0389  0.0452  32  ILE A CA  
211  C C   . ILE A 32  ? 1.8685 1.6417 0.8190 -0.9240 0.0212  0.0589  32  ILE A C   
212  O O   . ILE A 32  ? 1.8954 1.6854 0.8379 -0.9617 0.0352  0.0522  32  ILE A O   
213  C CB  . ILE A 32  ? 1.9989 1.6728 0.7943 -1.0150 0.0241  0.0442  32  ILE A CB  
214  N N   . VAL A 33  ? 1.7077 1.5649 0.7574 -0.8681 -0.0058 0.0782  33  VAL A N   
215  C CA  . VAL A 33  ? 1.6276 1.5971 0.7790 -0.8430 -0.0191 0.0945  33  VAL A CA  
216  C C   . VAL A 33  ? 1.6305 1.7376 0.8606 -0.8456 -0.0541 0.1173  33  VAL A C   
217  O O   . VAL A 33  ? 1.6136 1.7211 0.8385 -0.8387 -0.0704 0.1224  33  VAL A O   
218  C CB  . VAL A 33  ? 1.6161 1.5539 0.8102 -0.7656 -0.0107 0.0979  33  VAL A CB  
219  C CG1 . VAL A 33  ? 1.6658 1.5038 0.7996 -0.7634 0.0233  0.0795  33  VAL A CG1 
220  C CG2 . VAL A 33  ? 1.5765 1.4724 0.7746 -0.7140 -0.0188 0.1001  33  VAL A CG2 
221  N N   . ILE A 34  ? 1.5801 1.8032 0.8817 -0.8501 -0.0635 0.1323  34  ILE A N   
222  C CA  . ILE A 34  ? 1.5409 1.9065 0.9189 -0.8439 -0.0940 0.1579  34  ILE A CA  
223  C C   . ILE A 34  ? 1.5339 1.9537 0.9976 -0.7704 -0.0983 0.1801  34  ILE A C   
224  O O   . ILE A 34  ? 1.5125 1.9207 0.9964 -0.7514 -0.0812 0.1792  34  ILE A O   
225  C CB  . ILE A 34  ? 1.6147 2.0897 1.0006 -0.9149 -0.1023 0.1602  34  ILE A CB  
226  N N   . THR A 35  ? 1.4625 1.9318 0.9681 -0.7291 -0.1184 0.1997  35  THR A N   
227  C CA  . THR A 35  ? 1.4047 1.9189 0.9798 -0.6600 -0.1205 0.2228  35  THR A CA  
228  C C   . THR A 35  ? 1.4498 2.1140 1.0864 -0.6657 -0.1334 0.2490  35  THR A C   
229  O O   . THR A 35  ? 1.4534 2.2024 1.0930 -0.6981 -0.1537 0.2577  35  THR A O   
230  C CB  . THR A 35  ? 1.4719 1.9529 1.0487 -0.6148 -0.1298 0.2295  35  THR A CB  
231  N N   . ARG A 36  ? 1.3955 2.0958 1.0789 -0.6352 -0.1212 0.2619  36  ARG A N   
232  C CA  . ARG A 36  ? 1.3814 2.2297 1.1268 -0.6336 -0.1293 0.2898  36  ARG A CA  
233  C C   . ARG A 36  ? 1.4058 2.3452 1.1914 -0.5877 -0.1484 0.3217  36  ARG A C   
234  O O   . ARG A 36  ? 1.4077 2.4860 1.2292 -0.6011 -0.1639 0.3430  36  ARG A O   
235  C CB  . ARG A 36  ? 1.3690 2.2147 1.1492 -0.6008 -0.1079 0.2976  36  ARG A CB  
236  N N   . TYR A 37  ? 1.3354 2.1955 1.1091 -0.5353 -0.1461 0.3238  37  TYR A N   
237  C CA  . TYR A 37  ? 1.3091 2.2149 1.1027 -0.4838 -0.1568 0.3506  37  TYR A CA  
238  C C   . TYR A 37  ? 1.3527 2.2635 1.1129 -0.5113 -0.1779 0.3446  37  TYR A C   
239  O O   . TYR A 37  ? 1.3469 2.3443 1.1261 -0.4867 -0.1922 0.3700  37  TYR A O   
240  C CB  . TYR A 37  ? 1.3015 2.1044 1.0899 -0.4195 -0.1386 0.3519  37  TYR A CB  
241  C CG  . TYR A 37  ? 1.3236 1.9884 1.0632 -0.4328 -0.1316 0.3186  37  TYR A CG  
242  C CD1 . TYR A 37  ? 1.3524 1.9675 1.0620 -0.4255 -0.1389 0.3124  37  TYR A CD1 
243  C CD2 . TYR A 37  ? 1.3339 1.9201 1.0554 -0.4496 -0.1163 0.2945  37  TYR A CD2 
244  C CE1 . TYR A 37  ? 1.3679 1.8683 1.0352 -0.4369 -0.1320 0.2836  37  TYR A CE1 
245  C CE2 . TYR A 37  ? 1.3515 1.8219 1.0277 -0.4564 -0.1095 0.2665  37  TYR A CE2 
246  C CZ  . TYR A 37  ? 1.4406 1.8726 1.0920 -0.4504 -0.1176 0.2616  37  TYR A CZ  
247  O OH  . TYR A 37  ? 1.4516 1.7804 1.0609 -0.4552 -0.1102 0.2361  37  TYR A OH  
248  N N   . ASN A 38  ? 1.3225 2.1342 1.0279 -0.5558 -0.1776 0.3128  38  ASN A N   
249  C CA  . ASN A 38  ? 1.3448 2.1348 1.0086 -0.5807 -0.1938 0.3045  38  ASN A CA  
250  C C   . ASN A 38  ? 1.4525 2.2796 1.0827 -0.6614 -0.2072 0.2896  38  ASN A C   
251  O O   . ASN A 38  ? 1.4696 2.3134 1.0724 -0.6834 -0.2250 0.2898  38  ASN A O   
252  C CB  . ASN A 38  ? 1.3024 1.9469 0.9219 -0.5650 -0.1813 0.2824  38  ASN A CB  
253  N N   . ASN A 39  ? 1.4309 2.2605 1.0552 -0.7074 -0.1964 0.2752  39  ASN A N   
254  C CA  . ASN A 39  ? 1.4823 2.3333 1.0645 -0.7930 -0.2018 0.2570  39  ASN A CA  
255  C C   . ASN A 39  ? 1.5918 2.3222 1.0889 -0.8311 -0.2003 0.2313  39  ASN A C   
256  O O   . ASN A 39  ? 1.6598 2.4004 1.1084 -0.9033 -0.2064 0.2175  39  ASN A O   
258  N N   . ARG A 40  ? 1.5156 2.1315 0.9916 -0.7842 -0.1901 0.2247  40  ARG A N   
259  C CA  . ARG A 40  ? 1.5508 2.0454 0.9485 -0.8071 -0.1842 0.2033  40  ARG A CA  
260  C C   . ARG A 40  ? 1.6000 1.9785 0.9403 -0.8317 -0.1557 0.1770  40  ARG A C   
261  O O   . ARG A 40  ? 1.5758 1.9461 0.9456 -0.8061 -0.1403 0.1762  40  ARG A O   
262  C CB  . ARG A 40  ? 1.5351 1.9727 0.9412 -0.7440 -0.1849 0.2096  40  ARG A CB  
263  N N   . THR A 41  ? 1.5929 1.8776 0.8451 -0.8784 -0.1468 0.1566  41  THR A N   
264  C CA  . THR A 41  ? 1.6312 1.7927 0.8085 -0.9010 -0.1160 0.1324  41  THR A CA  
265  C C   . THR A 41  ? 1.6684 1.6990 0.7959 -0.8621 -0.1001 0.1218  41  THR A C   
266  O O   . THR A 41  ? 1.6548 1.6794 0.7817 -0.8445 -0.1134 0.1284  41  THR A O   
267  C CB  . THR A 41  ? 1.8081 1.9576 0.9089 -0.9882 -0.1115 0.1176  41  THR A CB  
268  N N   . TYR A 42  ? 1.6440 1.5743 0.7302 -0.8455 -0.0710 0.1064  42  TYR A N   
269  C CA  . TYR A 42  ? 1.6641 1.4778 0.7031 -0.8042 -0.0529 0.0967  42  TYR A CA  
270  C C   . TYR A 42  ? 1.7475 1.4488 0.7057 -0.8115 -0.0175 0.0777  42  TYR A C   
271  O O   . TYR A 42  ? 1.7024 1.4189 0.6745 -0.8175 -0.0065 0.0739  42  TYR A O   
272  C CB  . TYR A 42  ? 1.6056 1.4415 0.7223 -0.7274 -0.0590 0.1064  42  TYR A CB  
273  C CG  . TYR A 42  ? 1.5649 1.5161 0.7744 -0.7040 -0.0861 0.1275  42  TYR A CG  
274  C CD1 . TYR A 42  ? 1.5631 1.5273 0.7887 -0.6833 -0.1012 0.1367  42  TYR A CD1 
275  C CD2 . TYR A 42  ? 1.5393 1.5808 0.8144 -0.6991 -0.0932 0.1395  42  TYR A CD2 
276  C CE1 . TYR A 42  ? 1.5308 1.5905 0.8288 -0.6581 -0.1216 0.1571  42  TYR A CE1 
277  C CE2 . TYR A 42  ? 1.4941 1.6364 0.8437 -0.6728 -0.1141 0.1618  42  TYR A CE2 
278  C CZ  . TYR A 42  ? 1.5741 1.7210 0.9323 -0.6502 -0.1272 0.1704  42  TYR A CZ  
279  O OH  . TYR A 42  ? 1.5486 1.7850 0.9691 -0.6197 -0.1431 0.1933  42  TYR A OH  
280  N N   . ARG A 43  ? 1.7678 1.3541 0.6422 -0.8017 0.0026  0.0675  43  ARG A N   
281  C CA  . ARG A 43  ? 1.8426 1.3090 0.6288 -0.7935 0.0401  0.0518  43  ARG A CA  
282  C C   . ARG A 43  ? 1.8765 1.3368 0.7127 -0.7166 0.0456  0.0531  43  ARG A C   
283  O O   . ARG A 43  ? 1.8222 1.3222 0.7192 -0.6745 0.0279  0.0621  43  ARG A O   
284  C CB  . ARG A 43  ? 1.9138 1.2637 0.5866 -0.8082 0.0604  0.0443  43  ARG A CB  
285  C CG  . ARG A 43  ? 2.1078 1.3237 0.6739 -0.7928 0.1039  0.0306  43  ARG A CG  
286  C CD  . ARG A 43  ? 2.3155 1.4161 0.7734 -0.7906 0.1260  0.0279  43  ARG A CD  
287  N NE  . ARG A 43  ? 2.5446 1.5364 0.9269 -0.7408 0.1646  0.0211  43  ARG A NE  
288  N N   . ILE A 44  ? 1.8622 1.2712 0.6683 -0.7004 0.0710  0.0433  44  ILE A N   
289  C CA  . ILE A 44  ? 1.8120 1.2056 0.6489 -0.6305 0.0790  0.0420  44  ILE A CA  
290  C C   . ILE A 44  ? 1.9320 1.2120 0.6730 -0.6028 0.1065  0.0338  44  ILE A C   
291  O O   . ILE A 44  ? 2.0250 1.2061 0.6579 -0.6268 0.1377  0.0239  44  ILE A O   
292  C CB  . ILE A 44  ? 1.8521 1.2495 0.7038 -0.6229 0.0920  0.0369  44  ILE A CB  
293  C CG1 . ILE A 44  ? 1.7960 1.3120 0.7425 -0.6485 0.0667  0.0483  44  ILE A CG1 
294  C CG2 . ILE A 44  ? 1.8281 1.2051 0.7022 -0.5502 0.0997  0.0345  44  ILE A CG2 
295  C CD1 . ILE A 44  ? 1.8713 1.3895 0.8200 -0.6607 0.0830  0.0432  44  ILE A CD1 
296  N N   . ASP A 45  ? 1.8566 1.1510 0.6329 -0.5537 0.0969  0.0388  45  ASP A N   
297  C CA  . ASP A 45  ? 1.9101 1.1185 0.6107 -0.5188 0.1198  0.0351  45  ASP A CA  
298  C C   . ASP A 45  ? 1.9493 1.1447 0.6593 -0.4518 0.1329  0.0309  45  ASP A C   
299  O O   . ASP A 45  ? 1.9906 1.1069 0.6211 -0.4184 0.1598  0.0275  45  ASP A O   
300  C CB  . ASP A 45  ? 1.9005 1.1401 0.6316 -0.5148 0.1008  0.0435  45  ASP A CB  
301  C CG  . ASP A 45  ? 2.0372 1.2791 0.7426 -0.5785 0.0892  0.0477  45  ASP A CG  
302  O OD1 . ASP A 45  ? 2.1061 1.3258 0.7650 -0.6305 0.0969  0.0429  45  ASP A OD1 
303  O OD2 . ASP A 45  ? 2.0952 1.3621 0.8249 -0.5781 0.0732  0.0548  45  ASP A OD2 
304  N N   . ASP A 46  ? 1.8542 1.1289 0.6586 -0.4305 0.1143  0.0321  46  ASP A N   
305  C CA  . ASP A 46  ? 1.8121 1.0957 0.6430 -0.3706 0.1197  0.0277  46  ASP A CA  
306  C C   . ASP A 46  ? 1.7317 1.1013 0.6637 -0.3659 0.0970  0.0309  46  ASP A C   
307  O O   . ASP A 46  ? 1.6613 1.0908 0.6486 -0.4024 0.0768  0.0388  46  ASP A O   
308  C CB  . ASP A 46  ? 1.8210 1.1214 0.6701 -0.3243 0.1154  0.0292  46  ASP A CB  
309  C CG  . ASP A 46  ? 2.0472 1.2983 0.8410 -0.2665 0.1401  0.0229  46  ASP A CG  
310  O OD1 . ASP A 46  ? 2.0506 1.2779 0.8252 -0.2478 0.1529  0.0171  46  ASP A OD1 
311  O OD2 . ASP A 46  ? 2.1781 1.4173 0.9475 -0.2370 0.1473  0.0248  46  ASP A OD2 
312  N N   . VAL A 47  ? 1.6914 1.0665 0.6430 -0.3176 0.1015  0.0259  47  VAL A N   
313  C CA  . VAL A 47  ? 1.6192 1.0614 0.6555 -0.3036 0.0844  0.0284  47  VAL A CA  
314  C C   . VAL A 47  ? 1.6017 1.0831 0.6834 -0.2550 0.0742  0.0256  47  VAL A C   
315  O O   . VAL A 47  ? 1.6299 1.0753 0.6654 -0.2172 0.0890  0.0183  47  VAL A O   
316  C CB  . VAL A 47  ? 1.6919 1.0961 0.6993 -0.2983 0.1022  0.0228  47  VAL A CB  
317  N N   . ASP A 48  ? 1.4693 1.0244 0.6353 -0.2568 0.0508  0.0318  48  ASP A N   
318  C CA  . ASP A 48  ? 1.4266 1.0210 0.6350 -0.2196 0.0422  0.0266  48  ASP A CA  
319  C C   . ASP A 48  ? 1.4083 1.0164 0.6453 -0.1970 0.0413  0.0235  48  ASP A C   
320  O O   . ASP A 48  ? 1.3530 0.9948 0.6403 -0.2110 0.0307  0.0315  48  ASP A O   
321  C CB  . ASP A 48  ? 1.4049 1.0565 0.6742 -0.2322 0.0230  0.0325  48  ASP A CB  
322  C CG  . ASP A 48  ? 1.5861 1.2723 0.8846 -0.2019 0.0185  0.0236  48  ASP A CG  
323  O OD1 . ASP A 48  ? 1.5901 1.2739 0.8777 -0.1683 0.0250  0.0139  48  ASP A OD1 
324  O OD2 . ASP A 48  ? 1.7214 1.4384 1.0508 -0.2130 0.0093  0.0258  48  ASP A OD2 
325  N N   . TRP A 49  ? 1.3771 0.9556 0.5755 -0.1593 0.0545  0.0131  49  TRP A N   
326  C CA  . TRP A 49  ? 1.3668 0.9469 0.5779 -0.1324 0.0562  0.0082  49  TRP A CA  
327  C C   . TRP A 49  ? 1.3858 1.0284 0.6611 -0.1152 0.0388  0.0045  49  TRP A C   
328  O O   . TRP A 49  ? 1.3443 0.9965 0.6448 -0.1040 0.0354  0.0035  49  TRP A O   
329  C CB  . TRP A 49  ? 1.4035 0.9244 0.5381 -0.0950 0.0785  -0.0013 49  TRP A CB  
330  C CG  . TRP A 49  ? 1.4792 0.9232 0.5387 -0.1153 0.1015  0.0003  49  TRP A CG  
331  C CD1 . TRP A 49  ? 1.5773 0.9649 0.5611 -0.1193 0.1200  -0.0003 49  TRP A CD1 
332  C CD2 . TRP A 49  ? 1.4943 0.9071 0.5434 -0.1391 0.1106  0.0027  49  TRP A CD2 
333  N NE1 . TRP A 49  ? 1.6308 0.9475 0.5510 -0.1467 0.1414  -0.0006 49  TRP A NE1 
334  C CE2 . TRP A 49  ? 1.6241 0.9607 0.5874 -0.1612 0.1352  0.0009  49  TRP A CE2 
335  C CE3 . TRP A 49  ? 1.4729 0.9142 0.5748 -0.1460 0.1022  0.0067  49  TRP A CE3 
336  C CZ2 . TRP A 49  ? 1.6618 0.9576 0.5955 -0.1948 0.1504  0.0010  49  TRP A CZ2 
337  C CZ3 . TRP A 49  ? 1.5287 0.9330 0.6050 -0.1730 0.1170  0.0088  49  TRP A CZ3 
338  C CH2 . TRP A 49  ? 1.6153 0.9493 0.6089 -0.1981 0.1409  0.0046  49  TRP A CH2 
339  N N   . ASN A 50  ? 1.3622 1.0431 0.6603 -0.1179 0.0294  0.0024  50  ASN A N   
340  C CA  . ASN A 50  ? 1.3285 1.0662 0.6786 -0.1097 0.0160  -0.0039 50  ASN A CA  
341  C C   . ASN A 50  ? 1.3332 1.0998 0.7370 -0.1409 0.0041  0.0056  50  ASN A C   
342  O O   . ASN A 50  ? 1.3063 1.1089 0.7456 -0.1401 -0.0033 0.0001  50  ASN A O   
343  C CB  . ASN A 50  ? 1.3620 1.1269 0.7028 -0.0943 0.0165  -0.0128 50  ASN A CB  
344  C CG  . ASN A 50  ? 1.7588 1.5016 1.0433 -0.0540 0.0303  -0.0197 50  ASN A CG  
345  O OD1 . ASN A 50  ? 1.6730 1.3993 0.9373 -0.0269 0.0355  -0.0246 50  ASN A OD1 
346  N ND2 . ASN A 50  ? 1.6873 1.4269 0.9412 -0.0455 0.0382  -0.0192 50  ASN A ND2 
347  N N   . LYS A 51  ? 1.2723 1.0238 0.6770 -0.1681 0.0038  0.0197  51  LYS A N   
348  C CA  . LYS A 51  ? 1.2203 0.9986 0.6683 -0.1907 -0.0053 0.0323  51  LYS A CA  
349  C C   . LYS A 51  ? 1.2376 1.0108 0.6987 -0.1954 -0.0039 0.0452  51  LYS A C   
350  O O   . LYS A 51  ? 1.2719 1.0170 0.7048 -0.1940 0.0040  0.0451  51  LYS A O   
351  C CB  . LYS A 51  ? 1.2491 1.0317 0.6929 -0.2165 -0.0092 0.0401  51  LYS A CB  
352  C CG  . LYS A 51  ? 1.4007 1.2038 0.8568 -0.2159 -0.0123 0.0323  51  LYS A CG  
353  N N   . THR A 52  ? 1.1495 0.9470 0.6489 -0.1996 -0.0086 0.0565  52  THR A N   
354  C CA  . THR A 52  ? 1.1374 0.9391 0.6557 -0.1985 -0.0061 0.0722  52  THR A CA  
355  C C   . THR A 52  ? 1.1533 0.9861 0.7020 -0.2107 -0.0108 0.0921  52  THR A C   
356  O O   . THR A 52  ? 1.1266 0.9674 0.6807 -0.2149 -0.0140 0.0892  52  THR A O   
357  C CB  . THR A 52  ? 1.2389 1.0252 0.7596 -0.1725 -0.0009 0.0638  52  THR A CB  
358  O OG1 . THR A 52  ? 1.3325 1.1125 0.8622 -0.1669 0.0052  0.0776  52  THR A OG1 
359  C CG2 . THR A 52  ? 1.1518 0.9486 0.6894 -0.1673 -0.0027 0.0590  52  THR A CG2 
360  N N   . PRO A 53  ? 1.0898 0.9425 0.6566 -0.2137 -0.0094 0.1131  53  PRO A N   
361  C CA  . PRO A 53  ? 1.0702 0.9545 0.6600 -0.2159 -0.0120 0.1340  53  PRO A CA  
362  C C   . PRO A 53  ? 1.1088 0.9782 0.7035 -0.1981 -0.0052 0.1341  53  PRO A C   
363  O O   . PRO A 53  ? 1.1171 0.9989 0.7175 -0.1980 -0.0040 0.1476  53  PRO A O   
364  C CB  . PRO A 53  ? 1.0931 1.0060 0.7008 -0.2145 -0.0091 0.1558  53  PRO A CB  
365  C CG  . PRO A 53  ? 1.1591 1.0575 0.7489 -0.2277 -0.0076 0.1441  53  PRO A CG  
366  C CD  . PRO A 53  ? 1.1166 0.9673 0.6817 -0.2139 -0.0037 0.1196  53  PRO A CD  
367  N N   . LYS A 54  ? 1.0826 0.9220 0.6683 -0.1845 0.0007  0.1181  54  LYS A N   
368  C CA  . LYS A 54  ? 1.0865 0.9039 0.6668 -0.1749 0.0090  0.1122  54  LYS A CA  
369  C C   . LYS A 54  ? 1.1491 0.9686 0.7226 -0.1897 0.0056  0.0964  54  LYS A C   
370  O O   . LYS A 54  ? 1.1654 0.9705 0.7320 -0.1911 0.0143  0.0952  54  LYS A O   
371  C CB  . LYS A 54  ? 1.1101 0.9015 0.6796 -0.1612 0.0131  0.0959  54  LYS A CB  
372  C CG  . LYS A 54  ? 1.2874 1.0652 0.8593 -0.1436 0.0205  0.1101  54  LYS A CG  
373  C CD  . LYS A 54  ? 1.3080 1.0594 0.8640 -0.1305 0.0215  0.0903  54  LYS A CD  
374  N N   . ASP A 55  ? 1.1241 0.9563 0.6941 -0.2012 -0.0040 0.0845  55  ASP A N   
375  C CA  . ASP A 55  ? 1.1423 0.9794 0.7066 -0.2139 -0.0065 0.0700  55  ASP A CA  
376  C C   . ASP A 55  ? 1.2551 1.0985 0.8218 -0.2256 -0.0062 0.0845  55  ASP A C   
377  O O   . ASP A 55  ? 1.2501 1.1042 0.8235 -0.2239 -0.0074 0.1068  55  ASP A O   
378  C CB  . ASP A 55  ? 1.1707 1.0123 0.7224 -0.2164 -0.0132 0.0558  55  ASP A CB  
379  C CG  . ASP A 55  ? 1.3937 1.2318 0.9366 -0.2001 -0.0121 0.0368  55  ASP A CG  
380  O OD1 . ASP A 55  ? 1.4381 1.2839 0.9684 -0.1973 -0.0138 0.0222  55  ASP A OD1 
381  O OD2 . ASP A 55  ? 1.4759 1.3047 1.0225 -0.1879 -0.0087 0.0371  55  ASP A OD2 
382  N N   . SER A 56  ? 1.2537 1.0941 0.8143 -0.2363 -0.0036 0.0718  56  SER A N   
383  C CA  . SER A 56  ? 1.2650 1.1031 0.8212 -0.2455 -0.0009 0.0829  56  SER A CA  
384  C C   . SER A 56  ? 1.3302 1.1765 0.8797 -0.2594 -0.0093 0.0777  56  SER A C   
385  O O   . SER A 56  ? 1.3235 1.1733 0.8681 -0.2614 -0.0131 0.0618  56  SER A O   
386  C CB  . SER A 56  ? 1.3105 1.1264 0.8563 -0.2494 0.0143  0.0739  56  SER A CB  
387  O OG  . SER A 56  ? 1.4494 1.2453 0.9899 -0.2371 0.0257  0.0810  56  SER A OG  
388  N N   . PHE A 57  ? 1.2978 1.1454 0.8422 -0.2659 -0.0110 0.0930  57  PHE A N   
389  C CA  . PHE A 57  ? 1.3034 1.1498 0.8350 -0.2803 -0.0167 0.0900  57  PHE A CA  
390  C C   . PHE A 57  ? 1.3380 1.1692 0.8603 -0.2835 -0.0075 0.0940  57  PHE A C   
391  O O   . PHE A 57  ? 1.3433 1.1674 0.8645 -0.2728 0.0013  0.1071  57  PHE A O   
392  C CB  . PHE A 57  ? 1.3370 1.1974 0.8623 -0.2894 -0.0297 0.1036  57  PHE A CB  
393  C CG  . PHE A 57  ? 1.3737 1.2575 0.9068 -0.2874 -0.0347 0.1286  57  PHE A CG  
394  C CD1 . PHE A 57  ? 1.4272 1.3158 0.9491 -0.2945 -0.0387 0.1402  57  PHE A CD1 
395  C CD2 . PHE A 57  ? 1.4069 1.3126 0.9575 -0.2763 -0.0353 0.1418  57  PHE A CD2 
396  C CE1 . PHE A 57  ? 1.4523 1.3746 0.9812 -0.2884 -0.0445 0.1650  57  PHE A CE1 
397  C CE2 . PHE A 57  ? 1.4484 1.3891 1.0086 -0.2710 -0.0398 0.1671  57  PHE A CE2 
398  C CZ  . PHE A 57  ? 1.4396 1.3924 0.9893 -0.2763 -0.0451 0.1788  57  PHE A CZ  
399  N N   . THR A 58  ? 1.2717 1.0921 0.7817 -0.2955 -0.0060 0.0828  58  THR A N   
400  C CA  . THR A 58  ? 1.2610 1.0595 0.7566 -0.3001 0.0052  0.0839  58  THR A CA  
401  C C   . THR A 58  ? 1.2812 1.0807 0.7629 -0.3020 -0.0038 0.1040  58  THR A C   
402  O O   . THR A 58  ? 1.2565 1.0659 0.7327 -0.3119 -0.0173 0.1063  58  THR A O   
403  C CB  . THR A 58  ? 1.2973 1.0872 0.7885 -0.3119 0.0134  0.0610  58  THR A CB  
404  N N   . MET A 59  ? 1.2565 1.0432 0.7260 -0.2918 0.0053  0.1189  59  MET A N   
405  C CA  . MET A 59  ? 1.2588 1.0516 0.7124 -0.2897 -0.0028 0.1391  59  MET A CA  
406  C C   . MET A 59  ? 1.2347 0.9930 0.6634 -0.3006 0.0047  0.1294  59  MET A C   
407  O O   . MET A 59  ? 1.2051 0.9429 0.6341 -0.3107 0.0158  0.1075  59  MET A O   
408  C CB  . MET A 59  ? 1.3227 1.1243 0.7717 -0.2652 0.0036  0.1636  59  MET A CB  
409  C CG  . MET A 59  ? 1.3719 1.2100 0.8474 -0.2550 -0.0035 0.1738  59  MET A CG  
410  S SD  . MET A 59  ? 1.4626 1.3428 0.9401 -0.2255 -0.0056 0.2111  59  MET A SD  
411  C CE  . MET A 59  ? 1.4517 1.2788 0.9067 -0.1975 0.0272  0.2141  59  MET A CE  
412  N N   . SER A 60  ? 1.1728 0.9301 0.5806 -0.2996 -0.0024 0.1452  60  SER A N   
413  C CA  . SER A 60  ? 1.1585 0.8802 0.5391 -0.3102 0.0031  0.1377  60  SER A CA  
414  C C   . SER A 60  ? 1.2537 0.9293 0.6201 -0.3089 0.0303  0.1223  60  SER A C   
415  O O   . SER A 60  ? 1.2729 0.9289 0.6350 -0.3242 0.0370  0.1041  60  SER A O   
416  C CB  . SER A 60  ? 1.1955 0.9241 0.5524 -0.3055 -0.0084 0.1590  60  SER A CB  
417  O OG  . SER A 60  ? 1.3540 1.0743 0.6953 -0.2796 0.0043  0.1757  60  SER A OG  
418  N N   . ASP A 61  ? 1.2280 0.8849 0.5836 -0.2919 0.0487  0.1288  61  ASP A N   
419  C CA  . ASP A 61  ? 1.2643 0.8687 0.5955 -0.2963 0.0793  0.1128  61  ASP A CA  
420  C C   . ASP A 61  ? 1.3300 0.9387 0.6823 -0.3094 0.0899  0.0901  61  ASP A C   
421  O O   . ASP A 61  ? 1.3624 0.9324 0.6945 -0.3197 0.1163  0.0741  61  ASP A O   
422  C CB  . ASP A 61  ? 1.3298 0.8944 0.6197 -0.2714 0.1001  0.1313  61  ASP A CB  
423  C CG  . ASP A 61  ? 1.3681 0.9432 0.6611 -0.2492 0.1054  0.1463  61  ASP A CG  
424  O OD1 . ASP A 61  ? 1.2908 0.9175 0.6233 -0.2495 0.0843  0.1500  61  ASP A OD1 
425  O OD2 . ASP A 61  ? 1.4764 1.0026 0.7269 -0.2300 0.1332  0.1553  61  ASP A OD2 
426  N N   . GLY A 62  ? 1.2520 0.9064 0.6403 -0.3106 0.0704  0.0881  62  GLY A N   
427  C CA  . GLY A 62  ? 1.2277 0.8951 0.6369 -0.3207 0.0758  0.0673  62  GLY A CA  
428  C C   . GLY A 62  ? 1.2653 0.9342 0.6783 -0.3067 0.0799  0.0756  62  GLY A C   
429  O O   . GLY A 62  ? 1.2434 0.9245 0.6721 -0.3148 0.0820  0.0588  62  GLY A O   
430  N N   . LYS A 63  ? 1.2268 0.8845 0.6227 -0.2838 0.0822  0.1021  63  LYS A N   
431  C CA  . LYS A 63  ? 1.2251 0.8810 0.6202 -0.2650 0.0886  0.1150  63  LYS A CA  
432  C C   . LYS A 63  ? 1.2652 0.9720 0.7018 -0.2646 0.0648  0.1147  63  LYS A C   
433  O O   . LYS A 63  ? 1.2237 0.9681 0.6802 -0.2666 0.0421  0.1218  63  LYS A O   
434  C CB  . LYS A 63  ? 1.2746 0.9205 0.6443 -0.2344 0.0950  0.1476  63  LYS A CB  
435  C CG  . LYS A 63  ? 1.4439 1.0802 0.8042 -0.2091 0.1079  0.1650  63  LYS A CG  
436  C CD  . LYS A 63  ? 1.5954 1.2458 0.9395 -0.1730 0.1089  0.2015  63  LYS A CD  
437  C CE  . LYS A 63  ? 1.7440 1.3658 1.0608 -0.1412 0.1329  0.2216  63  LYS A CE  
438  N NZ  . LYS A 63  ? 1.8264 1.4418 1.1058 -0.1008 0.1462  0.2554  63  LYS A NZ  
439  N N   . GLU A 64  ? 1.2531 0.9542 0.6958 -0.2646 0.0720  0.1046  64  GLU A N   
440  C CA  . GLU A 64  ? 1.2312 0.9698 0.7061 -0.2614 0.0543  0.1028  64  GLU A CA  
441  C C   . GLU A 64  ? 1.2858 1.0306 0.7625 -0.2363 0.0551  0.1291  64  GLU A C   
442  O O   . GLU A 64  ? 1.2985 1.0072 0.7471 -0.2207 0.0764  0.1414  64  GLU A O   
443  C CB  . GLU A 64  ? 1.2485 0.9841 0.7300 -0.2751 0.0592  0.0752  64  GLU A CB  
444  C CG  . GLU A 64  ? 1.4313 1.1859 0.9234 -0.2955 0.0528  0.0509  64  GLU A CG  
445  C CD  . GLU A 64  ? 1.9015 1.6780 1.4082 -0.3044 0.0506  0.0258  64  GLU A CD  
446  O OE1 . GLU A 64  ? 1.9484 1.7190 1.4545 -0.2981 0.0540  0.0244  64  GLU A OE1 
447  O OE2 . GLU A 64  ? 1.9325 1.7314 1.4473 -0.3176 0.0481  0.0073  64  GLU A OE2 
448  N N   . ILE A 65  ? 1.2248 1.0126 0.7297 -0.2323 0.0346  0.1381  65  ILE A N   
449  C CA  . ILE A 65  ? 1.2222 1.0310 0.7376 -0.2106 0.0328  0.1631  65  ILE A CA  
450  C C   . ILE A 65  ? 1.2628 1.0980 0.8048 -0.2161 0.0180  0.1543  65  ILE A C   
451  O O   . ILE A 65  ? 1.2443 1.0941 0.7945 -0.2336 0.0039  0.1397  65  ILE A O   
452  C CB  . ILE A 65  ? 1.2632 1.1054 0.7786 -0.1998 0.0250  0.1912  65  ILE A CB  
453  C CG1 . ILE A 65  ? 1.2818 1.1496 0.8042 -0.1710 0.0298  0.2216  65  ILE A CG1 
454  C CG2 . ILE A 65  ? 1.2273 1.1094 0.7593 -0.2214 0.0009  0.1875  65  ILE A CG2 
455  N N   . THR A 66  ? 1.2161 1.0495 0.7646 -0.1994 0.0241  0.1633  66  THR A N   
456  C CA  . THR A 66  ? 1.1722 1.0252 0.7408 -0.2018 0.0126  0.1567  66  THR A CA  
457  C C   . THR A 66  ? 1.1866 1.0873 0.7724 -0.2039 -0.0009 0.1771  66  THR A C   
458  O O   . THR A 66  ? 1.1851 1.1081 0.7711 -0.1943 0.0005  0.2005  66  THR A O   
459  C CB  . THR A 66  ? 1.2639 1.0942 0.8305 -0.1841 0.0248  0.1586  66  THR A CB  
460  O OG1 . THR A 66  ? 1.3062 1.1447 0.8729 -0.1612 0.0347  0.1894  66  THR A OG1 
461  C CG2 . THR A 66  ? 1.2404 1.0255 0.7845 -0.1877 0.0389  0.1378  66  THR A CG2 
462  N N   . PHE A 67  ? 1.1384 1.0556 0.7341 -0.2167 -0.0123 0.1688  67  PHE A N   
463  C CA  . PHE A 67  ? 1.1368 1.1008 0.7455 -0.2269 -0.0234 0.1855  67  PHE A CA  
464  C C   . PHE A 67  ? 1.2119 1.2048 0.8387 -0.2043 -0.0161 0.2123  67  PHE A C   
465  O O   . PHE A 67  ? 1.2204 1.2664 0.8603 -0.2046 -0.0224 0.2350  67  PHE A O   
466  C CB  . PHE A 67  ? 1.1481 1.1077 0.7511 -0.2464 -0.0304 0.1690  67  PHE A CB  
467  C CG  . PHE A 67  ? 1.1649 1.0945 0.7446 -0.2619 -0.0341 0.1457  67  PHE A CG  
468  C CD1 . PHE A 67  ? 1.1843 1.0790 0.7543 -0.2520 -0.0278 0.1241  67  PHE A CD1 
469  C CD2 . PHE A 67  ? 1.1955 1.1351 0.7608 -0.2853 -0.0435 0.1464  67  PHE A CD2 
470  C CE1 . PHE A 67  ? 1.1901 1.0655 0.7394 -0.2614 -0.0296 0.1054  67  PHE A CE1 
471  C CE2 . PHE A 67  ? 1.2351 1.1429 0.7745 -0.2958 -0.0439 0.1273  67  PHE A CE2 
472  C CZ  . PHE A 67  ? 1.2029 1.0814 0.7362 -0.2817 -0.0363 0.1079  67  PHE A CZ  
473  N N   . LEU A 68  ? 1.1651 1.1251 0.7902 -0.1828 -0.0020 0.2109  68  LEU A N   
474  C CA  . LEU A 68  ? 1.1720 1.1482 0.8078 -0.1557 0.0097  0.2377  68  LEU A CA  
475  C C   . LEU A 68  ? 1.2632 1.2593 0.8930 -0.1364 0.0164  0.2642  68  LEU A C   
476  O O   . LEU A 68  ? 1.2704 1.3263 0.9187 -0.1260 0.0134  0.2911  68  LEU A O   
477  C CB  . LEU A 68  ? 1.1785 1.0997 0.8010 -0.1364 0.0262  0.2302  68  LEU A CB  
478  C CG  . LEU A 68  ? 1.2210 1.1192 0.8444 -0.1452 0.0226  0.2068  68  LEU A CG  
479  C CD1 . LEU A 68  ? 1.2319 1.0762 0.8369 -0.1266 0.0379  0.1998  68  LEU A CD1 
480  C CD2 . LEU A 68  ? 1.2233 1.1587 0.8672 -0.1495 0.0181  0.2168  68  LEU A CD2 
481  N N   . GLU A 69  ? 1.2438 1.1932 0.8456 -0.1323 0.0261  0.2560  69  GLU A N   
482  C CA  . GLU A 69  ? 1.2751 1.2250 0.8570 -0.1111 0.0372  0.2785  69  GLU A CA  
483  C C   . GLU A 69  ? 1.2973 1.3085 0.8923 -0.1235 0.0182  0.2888  69  GLU A C   
484  O O   . GLU A 69  ? 1.2982 1.3468 0.8907 -0.0992 0.0220  0.3182  69  GLU A O   
485  C CB  . GLU A 69  ? 1.3237 1.1996 0.8663 -0.1124 0.0544  0.2609  69  GLU A CB  
486  N N   . TYR A 70  ? 1.2298 1.2510 0.8343 -0.1594 -0.0013 0.2659  70  TYR A N   
487  C CA  . TYR A 70  ? 1.2243 1.2957 0.8348 -0.1793 -0.0206 0.2713  70  TYR A CA  
488  C C   . TYR A 70  ? 1.2648 1.4199 0.9036 -0.1783 -0.0318 0.2959  70  TYR A C   
489  O O   . TYR A 70  ? 1.2915 1.4995 0.9321 -0.1693 -0.0384 0.3182  70  TYR A O   
490  C CB  . TYR A 70  ? 1.2195 1.2704 0.8248 -0.2173 -0.0343 0.2412  70  TYR A CB  
491  C CG  . TYR A 70  ? 1.2326 1.3243 0.8350 -0.2429 -0.0530 0.2449  70  TYR A CG  
492  C CD1 . TYR A 70  ? 1.2709 1.3542 0.8535 -0.2410 -0.0546 0.2490  70  TYR A CD1 
493  C CD2 . TYR A 70  ? 1.2266 1.3598 0.8395 -0.2714 -0.0674 0.2436  70  TYR A CD2 
494  C CE1 . TYR A 70  ? 1.2851 1.4021 0.8599 -0.2658 -0.0724 0.2519  70  TYR A CE1 
495  C CE2 . TYR A 70  ? 1.2454 1.4124 0.8482 -0.3005 -0.0841 0.2458  70  TYR A CE2 
496  C CZ  . TYR A 70  ? 1.3433 1.5038 0.9280 -0.2967 -0.0878 0.2506  70  TYR A CZ  
497  O OH  . TYR A 70  ? 1.3242 1.5141 0.8942 -0.3264 -0.1047 0.2522  70  TYR A OH  
498  N N   . TYR A 71  ? 1.1916 1.3623 0.8511 -0.1881 -0.0337 0.2916  71  TYR A N   
499  C CA  . TYR A 71  ? 1.1691 1.4248 0.8577 -0.1947 -0.0432 0.3119  71  TYR A CA  
500  C C   . TYR A 71  ? 1.2482 1.5490 0.9510 -0.1502 -0.0305 0.3482  71  TYR A C   
501  O O   . TYR A 71  ? 1.2465 1.6374 0.9699 -0.1486 -0.0407 0.3723  71  TYR A O   
502  C CB  . TYR A 71  ? 1.1451 1.3954 0.8444 -0.2211 -0.0454 0.2944  71  TYR A CB  
503  C CG  . TYR A 71  ? 1.1271 1.3535 0.8062 -0.2654 -0.0583 0.2668  71  TYR A CG  
504  C CD1 . TYR A 71  ? 1.1360 1.2832 0.7902 -0.2701 -0.0530 0.2385  71  TYR A CD1 
505  C CD2 . TYR A 71  ? 1.1341 1.4176 0.8137 -0.3014 -0.0745 0.2700  71  TYR A CD2 
506  C CE1 . TYR A 71  ? 1.1144 1.2345 0.7423 -0.3039 -0.0610 0.2164  71  TYR A CE1 
507  C CE2 . TYR A 71  ? 1.1501 1.3982 0.7986 -0.3412 -0.0823 0.2459  71  TYR A CE2 
508  C CZ  . TYR A 71  ? 1.1693 1.3325 0.7906 -0.3394 -0.0741 0.2203  71  TYR A CZ  
509  O OH  . TYR A 71  ? 1.1665 1.2895 0.7502 -0.3723 -0.0776 0.1993  71  TYR A OH  
510  N N   . SER A 72  ? 1.2438 1.4836 0.9299 -0.1139 -0.0077 0.3533  72  SER A N   
511  C CA  . SER A 72  ? 1.2771 1.5410 0.9627 -0.0648 0.0109  0.3896  72  SER A CA  
512  C C   . SER A 72  ? 1.3726 1.6590 1.0373 -0.0392 0.0131  0.4120  72  SER A C   
513  O O   . SER A 72  ? 1.3819 1.7509 1.0620 -0.0123 0.0124  0.4460  72  SER A O   
514  C CB  . SER A 72  ? 1.3328 1.5088 0.9931 -0.0377 0.0375  0.3862  72  SER A CB  
515  O OG  . SER A 72  ? 1.4473 1.6101 1.0809 0.0125  0.0622  0.4184  72  SER A OG  
516  N N   . LYS A 73  ? 1.3518 1.5698 0.9811 -0.0466 0.0162  0.3935  73  LYS A N   
517  C CA  . LYS A 73  ? 1.3854 1.6064 0.9846 -0.0218 0.0217  0.4114  73  LYS A CA  
518  C C   . LYS A 73  ? 1.4380 1.7513 1.0583 -0.0415 -0.0066 0.4195  73  LYS A C   
519  O O   . LYS A 73  ? 1.4769 1.8376 1.0860 -0.0083 -0.0044 0.4489  73  LYS A O   
520  C CB  . LYS A 73  ? 1.4352 1.5525 0.9893 -0.0295 0.0355  0.3862  73  LYS A CB  
521  N N   . ASN A 74  ? 1.3539 1.6886 0.9970 -0.0938 -0.0313 0.3941  74  ASN A N   
522  C CA  . ASN A 74  ? 1.3416 1.7531 0.9964 -0.1229 -0.0584 0.3967  74  ASN A CA  
523  C C   . ASN A 74  ? 1.3736 1.9053 1.0700 -0.1324 -0.0743 0.4173  74  ASN A C   
524  O O   . ASN A 74  ? 1.3781 1.9951 1.0808 -0.1338 -0.0909 0.4353  74  ASN A O   
525  C CB  . ASN A 74  ? 1.3421 1.7076 0.9876 -0.1762 -0.0731 0.3598  74  ASN A CB  
526  C CG  . ASN A 74  ? 1.7131 2.0301 1.3232 -0.1813 -0.0752 0.3491  74  ASN A CG  
527  O OD1 . ASN A 74  ? 1.7438 2.0715 1.3346 -0.1506 -0.0703 0.3693  74  ASN A OD1 
528  N ND2 . ASN A 74  ? 1.5581 1.8220 1.1556 -0.2191 -0.0817 0.3183  74  ASN A ND2 
529  N N   . TYR A 75  ? 1.3121 1.8547 1.0361 -0.1422 -0.0700 0.4132  75  TYR A N   
530  C CA  . TYR A 75  ? 1.2888 1.9457 1.0534 -0.1617 -0.0839 0.4278  75  TYR A CA  
531  C C   . TYR A 75  ? 1.3478 2.0489 1.1404 -0.1213 -0.0666 0.4559  75  TYR A C   
532  O O   . TYR A 75  ? 1.3327 2.1429 1.1627 -0.1330 -0.0761 0.4722  75  TYR A O   
533  C CB  . TYR A 75  ? 1.2688 1.9088 1.0376 -0.2251 -0.0964 0.3946  75  TYR A CB  
534  C CG  . TYR A 75  ? 1.2818 1.8726 1.0177 -0.2657 -0.1108 0.3674  75  TYR A CG  
535  C CD1 . TYR A 75  ? 1.3004 1.7806 1.0085 -0.2788 -0.1027 0.3359  75  TYR A CD1 
536  C CD2 . TYR A 75  ? 1.2975 1.9551 1.0279 -0.2890 -0.1319 0.3744  75  TYR A CD2 
537  C CE1 . TYR A 75  ? 1.3251 1.7598 1.0008 -0.3120 -0.1131 0.3135  75  TYR A CE1 
538  C CE2 . TYR A 75  ? 1.3168 1.9216 1.0114 -0.3253 -0.1430 0.3507  75  TYR A CE2 
539  C CZ  . TYR A 75  ? 1.4205 1.9126 1.0878 -0.3358 -0.1323 0.3210  75  TYR A CZ  
540  O OH  . TYR A 75  ? 1.4658 1.9071 1.0961 -0.3688 -0.1408 0.3001  75  TYR A OH  
541  N N   . GLY A 76  ? 1.3245 1.9418 1.0966 -0.0772 -0.0402 0.4609  76  GLY A N   
542  C CA  . GLY A 76  ? 1.3312 1.9686 1.1199 -0.0355 -0.0192 0.4873  76  GLY A CA  
543  C C   . GLY A 76  ? 1.3686 1.9939 1.1817 -0.0667 -0.0186 0.4683  76  GLY A C   
544  O O   . GLY A 76  ? 1.3778 2.0501 1.2169 -0.0453 -0.0070 0.4901  76  GLY A O   
545  N N   . ILE A 77  ? 1.2974 1.8569 1.0982 -0.1146 -0.0289 0.4284  77  ILE A N   
546  C CA  . ILE A 77  ? 1.2724 1.8026 1.0831 -0.1464 -0.0275 0.4050  77  ILE A CA  
547  C C   . ILE A 77  ? 1.3368 1.7510 1.1218 -0.1238 -0.0075 0.3890  77  ILE A C   
548  O O   . ILE A 77  ? 1.3328 1.6699 1.0865 -0.1219 -0.0057 0.3708  77  ILE A O   
549  C CB  . ILE A 77  ? 1.2940 1.8235 1.0972 -0.2096 -0.0480 0.3732  77  ILE A CB  
550  C CG1 . ILE A 77  ? 1.2931 1.9428 1.1194 -0.2405 -0.0680 0.3874  77  ILE A CG1 
551  C CG2 . ILE A 77  ? 1.2917 1.7691 1.0899 -0.2373 -0.0414 0.3469  77  ILE A CG2 
552  N N   . THR A 78  ? 1.3021 1.7084 1.1001 -0.1095 0.0072  0.3952  78  THR A N   
553  C CA  . THR A 78  ? 1.3103 1.6150 1.0848 -0.0921 0.0247  0.3797  78  THR A CA  
554  C C   . THR A 78  ? 1.3548 1.6263 1.1274 -0.1325 0.0175  0.3461  78  THR A C   
555  O O   . THR A 78  ? 1.3470 1.6637 1.1413 -0.1501 0.0173  0.3492  78  THR A O   
556  C CB  . THR A 78  ? 1.4343 1.7399 1.2139 -0.0440 0.0486  0.4106  78  THR A CB  
557  O OG1 . THR A 78  ? 1.4866 1.8165 1.2559 -0.0042 0.0577  0.4421  78  THR A OG1 
558  C CG2 . THR A 78  ? 1.4101 1.6071 1.1594 -0.0276 0.0667  0.3944  78  THR A CG2 
559  N N   . VAL A 79  ? 1.3211 1.5162 1.0644 -0.1470 0.0132  0.3145  79  VAL A N   
560  C CA  . VAL A 79  ? 1.3243 1.4745 1.0528 -0.1768 0.0095  0.2823  79  VAL A CA  
561  C C   . VAL A 79  ? 1.4028 1.5015 1.1260 -0.1532 0.0267  0.2794  79  VAL A C   
562  O O   . VAL A 79  ? 1.4171 1.4617 1.1247 -0.1244 0.0372  0.2789  79  VAL A O   
563  C CB  . VAL A 79  ? 1.3714 1.4676 1.0707 -0.1924 0.0003  0.2540  79  VAL A CB  
564  C CG1 . VAL A 79  ? 1.3729 1.4222 1.0491 -0.2153 -0.0006 0.2238  79  VAL A CG1 
565  C CG2 . VAL A 79  ? 1.3673 1.5091 1.0687 -0.2124 -0.0150 0.2597  79  VAL A CG2 
566  N N   . LYS A 80  ? 1.3600 1.4747 1.0926 -0.1671 0.0313  0.2780  80  LYS A N   
567  C CA  . LYS A 80  ? 1.3678 1.4358 1.0944 -0.1456 0.0485  0.2765  80  LYS A CA  
568  C C   . LYS A 80  ? 1.4128 1.3935 1.1025 -0.1476 0.0499  0.2424  80  LYS A C   
569  O O   . LYS A 80  ? 1.4239 1.3497 1.0994 -0.1189 0.0599  0.2393  80  LYS A O   
570  C CB  . LYS A 80  ? 1.4013 1.5205 1.1503 -0.1607 0.0555  0.2880  80  LYS A CB  
571  N N   . GLU A 81  ? 1.3425 1.3103 1.0117 -0.1796 0.0411  0.2180  81  GLU A N   
572  C CA  . GLU A 81  ? 1.3302 1.2246 0.9607 -0.1775 0.0430  0.1875  81  GLU A CA  
573  C C   . GLU A 81  ? 1.3408 1.2171 0.9585 -0.1757 0.0314  0.1732  81  GLU A C   
574  O O   . GLU A 81  ? 1.3426 1.2313 0.9505 -0.2002 0.0213  0.1644  81  GLU A O   
575  C CB  . GLU A 81  ? 1.3652 1.2445 0.9685 -0.2075 0.0467  0.1709  81  GLU A CB  
576  N N   . GLU A 82  ? 1.2713 1.1168 0.8862 -0.1491 0.0345  0.1709  82  GLU A N   
577  C CA  . GLU A 82  ? 1.2603 1.0918 0.8653 -0.1483 0.0266  0.1573  82  GLU A CA  
578  C C   . GLU A 82  ? 1.3060 1.1006 0.8811 -0.1502 0.0228  0.1270  82  GLU A C   
579  O O   . GLU A 82  ? 1.3116 1.1022 0.8805 -0.1513 0.0165  0.1140  82  GLU A O   
580  C CB  . GLU A 82  ? 1.2835 1.0944 0.8898 -0.1245 0.0349  0.1656  82  GLU A CB  
581  C CG  . GLU A 82  ? 1.4300 1.2705 1.0560 -0.1125 0.0430  0.1984  82  GLU A CG  
582  C CD  . GLU A 82  ? 1.8361 1.6413 1.4479 -0.0889 0.0571  0.2085  82  GLU A CD  
583  O OE1 . GLU A 82  ? 1.8586 1.6151 1.4468 -0.0847 0.0605  0.1883  82  GLU A OE1 
584  O OE2 . GLU A 82  ? 1.8213 1.6476 1.4407 -0.0741 0.0663  0.2373  82  GLU A OE2 
585  N N   . ASP A 83  ? 1.2553 1.0242 0.8091 -0.1488 0.0287  0.1165  83  ASP A N   
586  C CA  . ASP A 83  ? 1.2611 0.9935 0.7790 -0.1408 0.0287  0.0909  83  ASP A CA  
587  C C   . ASP A 83  ? 1.3074 1.0310 0.7953 -0.1615 0.0298  0.0823  83  ASP A C   
588  O O   . ASP A 83  ? 1.3228 1.0129 0.7725 -0.1500 0.0334  0.0637  83  ASP A O   
589  C CB  . ASP A 83  ? 1.2993 0.9904 0.7987 -0.1141 0.0392  0.0834  83  ASP A CB  
590  N N   . GLN A 84  ? 1.2393 0.9929 0.7392 -0.1909 0.0278  0.0963  84  GLN A N   
591  C CA  . GLN A 84  ? 1.2514 0.9916 0.7156 -0.2189 0.0310  0.0893  84  GLN A CA  
592  C C   . GLN A 84  ? 1.2789 1.0116 0.7214 -0.2235 0.0235  0.0774  84  GLN A C   
593  O O   . GLN A 84  ? 1.2370 0.9979 0.7083 -0.2180 0.0122  0.0806  84  GLN A O   
594  C CB  . GLN A 84  ? 1.2636 1.0512 0.7505 -0.2534 0.0282  0.1076  84  GLN A CB  
595  C CG  . GLN A 84  ? 1.2335 1.0789 0.7588 -0.2634 0.0120  0.1233  84  GLN A CG  
596  C CD  . GLN A 84  ? 1.3141 1.2217 0.8684 -0.2888 0.0080  0.1443  84  GLN A CD  
597  O OE1 . GLN A 84  ? 1.3326 1.2535 0.8682 -0.3258 0.0063  0.1424  84  GLN A OE1 
598  N NE2 . GLN A 84  ? 1.0717 1.0217 0.6690 -0.2694 0.0071  0.1655  84  GLN A NE2 
599  N N   . PRO A 85  ? 1.2539 0.9440 0.6406 -0.2338 0.0326  0.0646  85  PRO A N   
600  C CA  . PRO A 85  ? 1.2547 0.9381 0.6195 -0.2368 0.0276  0.0565  85  PRO A CA  
601  C C   . PRO A 85  ? 1.3050 1.0230 0.6845 -0.2749 0.0169  0.0687  85  PRO A C   
602  O O   . PRO A 85  ? 1.2832 1.0400 0.6939 -0.2952 0.0119  0.0835  85  PRO A O   
603  C CB  . PRO A 85  ? 1.3265 0.9427 0.6162 -0.2297 0.0463  0.0420  85  PRO A CB  
604  C CG  . PRO A 85  ? 1.4050 0.9971 0.6746 -0.2476 0.0598  0.0447  85  PRO A CG  
605  C CD  . PRO A 85  ? 1.3000 0.9402 0.6342 -0.2446 0.0514  0.0579  85  PRO A CD  
606  N N   . LEU A 86  ? 1.2681 0.9768 0.6256 -0.2822 0.0134  0.0636  86  LEU A N   
607  C CA  . LEU A 86  ? 1.2534 0.9899 0.6181 -0.3166 0.0028  0.0740  86  LEU A CA  
608  C C   . LEU A 86  ? 1.3516 1.0393 0.6476 -0.3444 0.0132  0.0671  86  LEU A C   
609  O O   . LEU A 86  ? 1.3675 0.9984 0.6098 -0.3272 0.0277  0.0543  86  LEU A O   
610  C CB  . LEU A 86  ? 1.2176 0.9828 0.6143 -0.3068 -0.0096 0.0766  86  LEU A CB  
611  C CG  . LEU A 86  ? 1.2266 1.0280 0.6785 -0.2828 -0.0162 0.0823  86  LEU A CG  
612  C CD1 . LEU A 86  ? 1.2026 1.0234 0.6733 -0.2830 -0.0242 0.0843  86  LEU A CD1 
613  C CD2 . LEU A 86  ? 1.2408 1.0797 0.7288 -0.2881 -0.0195 0.1002  86  LEU A CD2 
614  N N   . LEU A 87  ? 1.3251 1.0352 0.6180 -0.3868 0.0069  0.0763  87  LEU A N   
615  C CA  . LEU A 87  ? 1.3749 1.0353 0.5956 -0.4226 0.0172  0.0699  87  LEU A CA  
616  C C   . LEU A 87  ? 1.4282 1.0903 0.6427 -0.4277 0.0070  0.0721  87  LEU A C   
617  O O   . LEU A 87  ? 1.3696 1.0920 0.6380 -0.4311 -0.0120 0.0840  87  LEU A O   
618  C CB  . LEU A 87  ? 1.3858 1.0755 0.6032 -0.4732 0.0153  0.0767  87  LEU A CB  
619  C CG  . LEU A 87  ? 1.4128 1.1175 0.6490 -0.4742 0.0240  0.0779  87  LEU A CG  
620  C CD1 . LEU A 87  ? 1.4137 1.1716 0.6586 -0.5280 0.0185  0.0862  87  LEU A CD1 
621  C CD2 . LEU A 87  ? 1.5117 1.1250 0.6780 -0.4589 0.0520  0.0609  87  LEU A CD2 
622  N N   . ILE A 88  ? 1.4503 1.0412 0.5936 -0.4244 0.0226  0.0618  88  ILE A N   
623  C CA  . ILE A 88  ? 1.4620 1.0401 0.5870 -0.4275 0.0180  0.0630  88  ILE A CA  
624  C C   . ILE A 88  ? 1.6140 1.1531 0.6722 -0.4769 0.0226  0.0638  88  ILE A C   
625  O O   . ILE A 88  ? 1.6901 1.1629 0.6727 -0.4962 0.0437  0.0559  88  ILE A O   
626  C CB  . ILE A 88  ? 1.5058 1.0375 0.5988 -0.3838 0.0331  0.0533  88  ILE A CB  
627  C CG1 . ILE A 88  ? 1.4373 1.0115 0.5927 -0.3395 0.0277  0.0500  88  ILE A CG1 
628  C CG2 . ILE A 88  ? 1.5206 1.0408 0.5974 -0.3854 0.0305  0.0556  88  ILE A CG2 
629  N N   . HIS A 89  ? 1.5725 1.1422 0.6486 -0.4956 0.0058  0.0721  89  HIS A N   
630  C CA  . HIS A 89  ? 1.6392 1.1755 0.6537 -0.5416 0.0063  0.0733  89  HIS A CA  
631  C C   . HIS A 89  ? 1.6931 1.2068 0.6975 -0.5223 0.0049  0.0749  89  HIS A C   
632  O O   . HIS A 89  ? 1.6390 1.2108 0.7088 -0.5076 -0.0134 0.0825  89  HIS A O   
633  C CB  . HIS A 89  ? 1.6329 1.2459 0.6864 -0.5855 -0.0164 0.0841  89  HIS A CB  
634  C CG  . HIS A 89  ? 1.7309 1.3244 0.7307 -0.6323 -0.0220 0.0862  89  HIS A CG  
635  N ND1 . HIS A 89  ? 1.8448 1.3510 0.7427 -0.6696 -0.0010 0.0759  89  HIS A ND1 
636  C CD2 . HIS A 89  ? 1.7247 1.3684 0.7527 -0.6452 -0.0443 0.0971  89  HIS A CD2 
637  C CE1 . HIS A 89  ? 1.8618 1.3693 0.7312 -0.7063 -0.0129 0.0804  89  HIS A CE1 
638  N NE2 . HIS A 89  ? 1.7945 1.3869 0.7422 -0.6921 -0.0401 0.0933  89  HIS A NE2 
639  N N   . ARG A 90  ? 1.6971 1.1216 0.6158 -0.5176 0.0282  0.0679  90  ARG A N   
640  C CA  . ARG A 90  ? 1.6932 1.0838 0.5884 -0.4974 0.0336  0.0692  90  ARG A CA  
641  C C   . ARG A 90  ? 1.8163 1.1726 0.6552 -0.5437 0.0298  0.0741  90  ARG A C   
642  O O   . ARG A 90  ? 1.8757 1.1752 0.6356 -0.5847 0.0420  0.0707  90  ARG A O   
643  C CB  . ARG A 90  ? 1.6792 0.9965 0.5119 -0.4568 0.0636  0.0619  90  ARG A CB  
644  C CG  . ARG A 90  ? 1.6137 0.9705 0.5017 -0.4071 0.0651  0.0566  90  ARG A CG  
645  N N   . PRO A 91  ? 1.7594 1.1457 0.6331 -0.5397 0.0143  0.0812  91  PRO A N   
646  C CA  . PRO A 91  ? 1.8127 1.1697 0.6345 -0.5826 0.0082  0.0863  91  PRO A CA  
647  C C   . PRO A 91  ? 1.9731 1.2243 0.6954 -0.5797 0.0343  0.0840  91  PRO A C   
648  O O   . PRO A 91  ? 1.9651 1.1832 0.6766 -0.5341 0.0539  0.0813  91  PRO A O   
649  C CB  . PRO A 91  ? 1.7657 1.1964 0.6654 -0.5730 -0.0169 0.0953  91  PRO A CB  
650  C CG  . PRO A 91  ? 1.7584 1.2166 0.7207 -0.5193 -0.0122 0.0923  91  PRO A CG  
651  C CD  . PRO A 91  ? 1.6956 1.1416 0.6532 -0.4999 0.0026  0.0840  91  PRO A CD  
652  N N   . SER A 92  ? 2.0344 1.2360 0.6815 -0.6293 0.0347  0.0859  92  SER A N   
653  C CA  . SER A 92  ? 2.1504 1.2358 0.6799 -0.6411 0.0613  0.0853  92  SER A CA  
654  C C   . SER A 92  ? 2.2367 1.2965 0.7597 -0.6176 0.0631  0.0926  92  SER A C   
655  O O   . SER A 92  ? 2.3564 1.3170 0.7762 -0.6322 0.0844  0.0943  92  SER A O   
656  C CB  . SER A 92  ? 2.2637 1.3088 0.7126 -0.7129 0.0600  0.0828  92  SER A CB  
657  N N   . GLU A 93  ? 2.0604 1.1991 0.6831 -0.5831 0.0448  0.0965  93  GLU A N   
658  C CA  . GLU A 93  ? 2.0489 1.1697 0.6749 -0.5579 0.0489  0.1019  93  GLU A CA  
659  C C   . GLU A 93  ? 1.9883 1.1921 0.7224 -0.5118 0.0399  0.1005  93  GLU A C   
660  O O   . GLU A 93  ? 1.9263 1.1740 0.7141 -0.5088 0.0241  0.1043  93  GLU A O   
661  C CB  . GLU A 93  ? 2.0932 1.2059 0.6961 -0.5979 0.0312  0.1087  93  GLU A CB  
662  N N   . ARG A 94  ? 1.9284 1.1469 0.6848 -0.4769 0.0525  0.0942  94  ARG A N   
663  C CA  . ARG A 94  ? 1.8404 1.1371 0.6911 -0.4388 0.0457  0.0896  94  ARG A CA  
664  C C   . ARG A 94  ? 1.8747 1.1698 0.7368 -0.3954 0.0633  0.0874  94  ARG A C   
665  O O   . ARG A 94  ? 1.8014 1.1659 0.7428 -0.3731 0.0556  0.0822  94  ARG A O   
666  C CB  . ARG A 94  ? 1.7821 1.1042 0.6523 -0.4286 0.0467  0.0832  94  ARG A CB  
667  N N   . GLN A 95  ? 1.8894 1.1095 0.6721 -0.3832 0.0883  0.0913  95  GLN A N   
668  C CA  . GLN A 95  ? 1.8779 1.1083 0.6737 -0.3402 0.1062  0.0908  95  GLN A CA  
669  C C   . GLN A 95  ? 2.0452 1.1907 0.7557 -0.3377 0.1291  0.1002  95  GLN A C   
670  O O   . GLN A 95  ? 2.1156 1.1832 0.7456 -0.3703 0.1328  0.1059  95  GLN A O   
671  C CB  . GLN A 95  ? 1.8675 1.1268 0.6756 -0.2961 0.1201  0.0851  95  GLN A CB  
672  C CG  . GLN A 95  ? 2.0083 1.1879 0.7183 -0.2851 0.1442  0.0884  95  GLN A CG  
673  C CD  . GLN A 95  ? 2.0408 1.2427 0.7495 -0.2284 0.1638  0.0862  95  GLN A CD  
674  O OE1 . GLN A 95  ? 1.8873 1.1382 0.6335 -0.1938 0.1702  0.0865  95  GLN A OE1 
675  N NE2 . GLN A 95  ? 1.8960 1.0589 0.5522 -0.2174 0.1765  0.0846  95  GLN A NE2 
676  N N   . ASP A 96  ? 1.9990 1.1631 0.7282 -0.3017 0.1445  0.1015  96  ASP A N   
677  C CA  . ASP A 96  ? 2.0652 1.1561 0.7219 -0.2910 0.1692  0.1119  96  ASP A CA  
678  C C   . ASP A 96  ? 2.1020 1.2239 0.7698 -0.2357 0.1940  0.1138  96  ASP A C   
679  O O   . ASP A 96  ? 2.0579 1.2710 0.8033 -0.2121 0.1868  0.1046  96  ASP A O   
680  C CB  . ASP A 96  ? 2.0728 1.1630 0.7539 -0.3200 0.1552  0.1138  96  ASP A CB  
681  N N   . ASN A 97  ? 2.0936 1.1423 0.6814 -0.2151 0.2238  0.1264  97  ASN A N   
682  C CA  . ASN A 97  ? 2.0795 1.1577 0.6701 -0.1606 0.2506  0.1324  97  ASN A CA  
683  C C   . ASN A 97  ? 2.1726 1.1538 0.6713 -0.1518 0.2801  0.1487  97  ASN A C   
684  O O   . ASN A 97  ? 2.1077 1.1031 0.6387 -0.1596 0.2792  0.1499  97  ASN A O   
685  C CB  . ASN A 97  ? 2.0549 1.1542 0.6258 -0.1133 0.2666  0.1333  97  ASN A CB  
686  N N   . LEU A 101 ? 1.6106 1.1060 0.6925 -0.2908 0.0804  0.0637  101 LEU A N   
687  C CA  . LEU A 101 ? 1.5927 1.0915 0.6870 -0.3157 0.0600  0.0656  101 LEU A CA  
688  C C   . LEU A 101 ? 1.6449 1.1235 0.7360 -0.3474 0.0473  0.0731  101 LEU A C   
689  O O   . LEU A 101 ? 1.6242 1.1283 0.7556 -0.3494 0.0451  0.0704  101 LEU A O   
690  C CB  . LEU A 101 ? 1.5281 1.0993 0.6957 -0.3072 0.0485  0.0559  101 LEU A CB  
691  N N   . LEU A 102 ? 1.6400 1.0701 0.6763 -0.3726 0.0412  0.0819  102 LEU A N   
692  C CA  . LEU A 102 ? 1.6534 1.0640 0.6739 -0.4031 0.0277  0.0906  102 LEU A CA  
693  C C   . LEU A 102 ? 1.7112 1.1631 0.7624 -0.4249 0.0043  0.0949  102 LEU A C   
694  O O   . LEU A 102 ? 1.7162 1.1784 0.7741 -0.4428 -0.0101 0.1026  102 LEU A O   
695  C CB  . LEU A 102 ? 1.7248 1.0524 0.6528 -0.4207 0.0380  0.0975  102 LEU A CB  
696  C CG  . LEU A 102 ? 1.8093 1.0861 0.6943 -0.3981 0.0637  0.0981  102 LEU A CG  
697  C CD1 . LEU A 102 ? 1.8896 1.0734 0.6716 -0.4178 0.0755  0.1060  102 LEU A CD1 
698  C CD2 . LEU A 102 ? 1.7693 1.0651 0.6942 -0.3906 0.0649  0.0974  102 LEU A CD2 
699  N N   . LYS A 103 ? 1.6608 1.1363 0.7264 -0.4212 0.0019  0.0912  103 LYS A N   
700  C CA  . LYS A 103 ? 1.6353 1.1556 0.7323 -0.4378 -0.0167 0.0956  103 LYS A CA  
701  C C   . LYS A 103 ? 1.6310 1.1845 0.7664 -0.4155 -0.0131 0.0878  103 LYS A C   
702  O O   . LYS A 103 ? 1.6389 1.1660 0.7492 -0.3962 0.0032  0.0801  103 LYS A O   
703  C CB  . LYS A 103 ? 1.7245 1.2117 0.7603 -0.4753 -0.0222 0.1010  103 LYS A CB  
704  C CG  . LYS A 103 ? 1.8414 1.3197 0.8506 -0.5053 -0.0355 0.1106  103 LYS A CG  
705  N N   . GLY A 104 ? 1.5370 1.1467 0.7287 -0.4151 -0.0270 0.0911  104 GLY A N   
706  C CA  . GLY A 104 ? 1.4984 1.1398 0.7270 -0.3970 -0.0258 0.0852  104 GLY A CA  
707  C C   . GLY A 104 ? 1.5688 1.2025 0.7711 -0.4158 -0.0287 0.0877  104 GLY A C   
708  O O   . GLY A 104 ? 1.6086 1.2267 0.7738 -0.4481 -0.0351 0.0946  104 GLY A O   
709  N N   . GLU A 105 ? 1.4934 1.1379 0.7121 -0.3980 -0.0233 0.0811  105 GLU A N   
710  C CA  . GLU A 105 ? 1.5047 1.1402 0.7011 -0.4123 -0.0217 0.0811  105 GLU A CA  
711  C C   . GLU A 105 ? 1.4819 1.1786 0.7303 -0.4253 -0.0386 0.0917  105 GLU A C   
712  O O   . GLU A 105 ? 1.4160 1.1566 0.7211 -0.4064 -0.0458 0.0959  105 GLU A O   
713  C CB  . GLU A 105 ? 1.5213 1.1422 0.7141 -0.3806 -0.0073 0.0700  105 GLU A CB  
714  C CG  . GLU A 105 ? 1.7163 1.2905 0.8628 -0.3557 0.0112  0.0616  105 GLU A CG  
715  C CD  . GLU A 105 ? 2.0682 1.6368 1.2093 -0.3183 0.0245  0.0518  105 GLU A CD  
716  O OE1 . GLU A 105 ? 2.1194 1.6373 1.1982 -0.3000 0.0440  0.0481  105 GLU A OE1 
717  O OE2 . GLU A 105 ? 1.9089 1.5217 1.1034 -0.3043 0.0167  0.0487  105 GLU A OE2 
718  N N   . ILE A 106 ? 1.4583 1.1570 0.6830 -0.4575 -0.0422 0.0961  106 ILE A N   
719  C CA  . ILE A 106 ? 1.4133 1.1790 0.6853 -0.4697 -0.0567 0.1081  106 ILE A CA  
720  C C   . ILE A 106 ? 1.3955 1.1678 0.6906 -0.4495 -0.0484 0.1032  106 ILE A C   
721  O O   . ILE A 106 ? 1.4057 1.1247 0.6580 -0.4441 -0.0322 0.0908  106 ILE A O   
722  C CB  . ILE A 106 ? 1.4883 1.2665 0.7266 -0.5195 -0.0658 0.1147  106 ILE A CB  
723  C CG1 . ILE A 106 ? 1.4918 1.2785 0.7202 -0.5335 -0.0787 0.1228  106 ILE A CG1 
724  C CG2 . ILE A 106 ? 1.4634 1.3153 0.7448 -0.5333 -0.0766 0.1258  106 ILE A CG2 
725  C CD1 . ILE A 106 ? 1.5448 1.2500 0.6980 -0.5484 -0.0671 0.1132  106 ILE A CD1 
726  N N   . LEU A 107 ? 1.2855 1.1165 0.6430 -0.4326 -0.0568 0.1136  107 LEU A N   
727  C CA  . LEU A 107 ? 1.2474 1.0829 0.6283 -0.4108 -0.0490 0.1102  107 LEU A CA  
728  C C   . LEU A 107 ? 1.2534 1.1488 0.6723 -0.4205 -0.0563 0.1255  107 LEU A C   
729  O O   . LEU A 107 ? 1.2067 1.1569 0.6688 -0.4115 -0.0669 0.1419  107 LEU A O   
730  C CB  . LEU A 107 ? 1.2097 1.0432 0.6230 -0.3707 -0.0452 0.1048  107 LEU A CB  
731  C CG  . LEU A 107 ? 1.2664 1.0543 0.6498 -0.3557 -0.0360 0.0888  107 LEU A CG  
732  C CD1 . LEU A 107 ? 1.2293 1.0336 0.6512 -0.3272 -0.0355 0.0843  107 LEU A CD1 
733  C CD2 . LEU A 107 ? 1.3180 1.0585 0.6560 -0.3484 -0.0215 0.0757  107 LEU A CD2 
734  N N   . LEU A 108 ? 1.2433 1.1252 0.6409 -0.4369 -0.0477 0.1203  108 LEU A N   
735  C CA  . LEU A 108 ? 1.2259 1.1644 0.6540 -0.4513 -0.0511 0.1330  108 LEU A CA  
736  C C   . LEU A 108 ? 1.2742 1.1979 0.7173 -0.4256 -0.0383 0.1290  108 LEU A C   
737  O O   . LEU A 108 ? 1.2731 1.1322 0.6811 -0.4105 -0.0244 0.1122  108 LEU A O   
738  C CB  . LEU A 108 ? 1.2710 1.2096 0.6558 -0.5049 -0.0504 0.1298  108 LEU A CB  
739  C CG  . LEU A 108 ? 1.3549 1.2869 0.7038 -0.5366 -0.0604 0.1293  108 LEU A CG  
740  C CD1 . LEU A 108 ? 1.4343 1.3181 0.7096 -0.5872 -0.0494 0.1163  108 LEU A CD1 
741  C CD2 . LEU A 108 ? 1.3333 1.3552 0.7305 -0.5414 -0.0824 0.1502  108 LEU A CD2 
742  N N   . LEU A 109 ? 1.2280 1.2129 0.7200 -0.4184 -0.0420 0.1459  109 LEU A N   
743  C CA  . LEU A 109 ? 1.2258 1.2008 0.7345 -0.3947 -0.0299 0.1454  109 LEU A CA  
744  C C   . LEU A 109 ? 1.3065 1.2785 0.7912 -0.4282 -0.0194 0.1409  109 LEU A C   
745  O O   . LEU A 109 ? 1.3015 1.3364 0.8000 -0.4630 -0.0270 0.1525  109 LEU A O   
746  C CB  . LEU A 109 ? 1.1962 1.2310 0.7643 -0.3654 -0.0346 0.1682  109 LEU A CB  
747  C CG  . LEU A 109 ? 1.2463 1.2846 0.8355 -0.3343 -0.0407 0.1754  109 LEU A CG  
748  C CD1 . LEU A 109 ? 1.2329 1.3074 0.8631 -0.3016 -0.0366 0.1972  109 LEU A CD1 
749  C CD2 . LEU A 109 ? 1.2990 1.2696 0.8644 -0.3149 -0.0343 0.1540  109 LEU A CD2 
750  N N   . PRO A 110 ? 1.2737 1.1778 0.7227 -0.4175 -0.0009 0.1245  110 PRO A N   
751  C CA  . PRO A 110 ? 1.3069 1.1964 0.7248 -0.4507 0.0145  0.1184  110 PRO A CA  
752  C C   . PRO A 110 ? 1.2938 1.2669 0.7674 -0.4605 0.0114  0.1380  110 PRO A C   
753  O O   . PRO A 110 ? 1.2968 1.2980 0.7579 -0.5061 0.0158  0.1379  110 PRO A O   
754  C CB  . PRO A 110 ? 1.3571 1.1602 0.7343 -0.4195 0.0349  0.1010  110 PRO A CB  
755  C CG  . PRO A 110 ? 1.3926 1.1616 0.7618 -0.3838 0.0290  0.0931  110 PRO A CG  
756  C CD  . PRO A 110 ? 1.2848 1.1234 0.7145 -0.3762 0.0078  0.1099  110 PRO A CD  
757  N N   . GLU A 111 ? 1.2205 1.2351 0.7522 -0.4191 0.0052  0.1555  111 GLU A N   
758  C CA  . GLU A 111 ? 1.1965 1.2929 0.7850 -0.4130 0.0037  0.1797  111 GLU A CA  
759  C C   . GLU A 111 ? 1.2404 1.4381 0.8579 -0.4470 -0.0133 0.1977  111 GLU A C   
760  O O   . GLU A 111 ? 1.2382 1.5124 0.8897 -0.4610 -0.0119 0.2136  111 GLU A O   
761  C CB  . GLU A 111 ? 1.1799 1.2785 0.8073 -0.3564 0.0024  0.1943  111 GLU A CB  
762  C CG  . GLU A 111 ? 1.3643 1.5325 1.0433 -0.3361 0.0062  0.2222  111 GLU A CG  
763  C CD  . GLU A 111 ? 1.7128 1.8697 1.4155 -0.2824 0.0093  0.2375  111 GLU A CD  
764  O OE1 . GLU A 111 ? 1.7538 1.8334 1.4326 -0.2593 0.0151  0.2207  111 GLU A OE1 
765  O OE2 . GLU A 111 ? 1.6397 1.8645 1.3804 -0.2630 0.0081  0.2665  111 GLU A OE2 
766  N N   . LEU A 112 ? 1.1820 1.3856 0.7874 -0.4581 -0.0293 0.1961  112 LEU A N   
767  C CA  . LEU A 112 ? 1.1755 1.4743 0.8038 -0.4866 -0.0478 0.2128  112 LEU A CA  
768  C C   . LEU A 112 ? 1.2574 1.5450 0.8349 -0.5504 -0.0513 0.1955  112 LEU A C   
769  O O   . LEU A 112 ? 1.2505 1.6186 0.8403 -0.5819 -0.0683 0.2066  112 LEU A O   
770  C CB  . LEU A 112 ? 1.1533 1.4686 0.8016 -0.4521 -0.0622 0.2264  112 LEU A CB  
771  C CG  . LEU A 112 ? 1.1869 1.4906 0.8676 -0.3912 -0.0552 0.2406  112 LEU A CG  
772  C CD2 . LEU A 112 ? 1.1972 1.5835 0.9269 -0.3708 -0.0511 0.2689  112 LEU A CD2 
773  N N   . SER A 113 ? 1.2450 1.4309 0.7592 -0.5681 -0.0338 0.1692  113 SER A N   
774  C CA  . SER A 113 ? 1.3026 1.4459 0.7474 -0.6266 -0.0292 0.1502  113 SER A CA  
775  C C   . SER A 113 ? 1.3962 1.5349 0.8127 -0.6727 -0.0103 0.1398  113 SER A C   
776  O O   . SER A 113 ? 1.4042 1.5111 0.8259 -0.6501 0.0079  0.1363  113 SER A O   
777  C CB  . SER A 113 ? 1.3743 1.3988 0.7541 -0.6110 -0.0183 0.1296  113 SER A CB  
778  O OG  . SER A 113 ? 1.4422 1.4685 0.8505 -0.5675 -0.0322 0.1372  113 SER A OG  
779  N N   . PHE A 114 ? 1.3757 1.5458 0.7591 -0.7404 -0.0139 0.1341  114 PHE A N   
780  C CA  . PHE A 114 ? 1.4146 1.5870 0.7645 -0.7993 0.0048  0.1223  114 PHE A CA  
781  C C   . PHE A 114 ? 1.5092 1.5825 0.7521 -0.8561 0.0206  0.0971  114 PHE A C   
782  O O   . PHE A 114 ? 1.5113 1.5970 0.7326 -0.8827 0.0043  0.0974  114 PHE A O   
783  C CB  . PHE A 114 ? 1.4168 1.7472 0.8354 -0.8336 -0.0137 0.1422  114 PHE A CB  
784  C CG  . PHE A 114 ? 1.3735 1.7892 0.8863 -0.7731 -0.0214 0.1691  114 PHE A CG  
785  C CD1 . PHE A 114 ? 1.3530 1.8171 0.9200 -0.7180 -0.0434 0.1915  114 PHE A CD1 
786  C CD2 . PHE A 114 ? 1.4112 1.8453 0.9494 -0.7690 -0.0026 0.1720  114 PHE A CD2 
787  C CE1 . PHE A 114 ? 1.3094 1.8320 0.9479 -0.6593 -0.0449 0.2165  114 PHE A CE1 
788  C CE2 . PHE A 114 ? 1.3903 1.8899 1.0062 -0.7096 -0.0063 0.1982  114 PHE A CE2 
789  C CZ  . PHE A 114 ? 1.3115 1.8525 0.9741 -0.6551 -0.0267 0.2205  114 PHE A CZ  
790  N N   . MET A 115 ? 1.5292 1.4923 0.6967 -0.8697 0.0551  0.0758  115 MET A N   
791  C CA  . MET A 115 ? 1.6355 1.4771 0.6799 -0.9203 0.0815  0.0508  115 MET A CA  
792  C C   . MET A 115 ? 1.6948 1.5889 0.7048 -1.0134 0.0758  0.0450  115 MET A C   
793  O O   . MET A 115 ? 1.6315 1.6591 0.7105 -1.0465 0.0594  0.0566  115 MET A O   
794  C CB  . MET A 115 ? 1.7348 1.4665 0.7116 -0.9178 0.1231  0.0323  115 MET A CB  
795  C CG  . MET A 115 ? 1.7590 1.3972 0.7234 -0.8356 0.1356  0.0298  115 MET A CG  
796  N N   . THR A 116 ? 1.7342 1.5212 0.6328 -1.0537 0.0908  0.0274  116 THR A N   
797  C CA  . THR A 116 ? 2.0952 1.8815 0.9208 -1.1466 0.0932  0.0150  116 THR A CA  
798  C C   . THR A 116 ? 2.5823 2.2558 1.3157 -1.1459 0.0975  0.0075  116 THR A C   
799  O O   . THR A 116 ? 1.9371 1.6641 0.6852 -1.1635 0.0691  0.0160  116 THR A O   
800  C CB  . THR A 116 ? 2.1767 2.1463 1.0917 -1.1922 0.0569  0.0305  116 THR A CB  
801  N N   . ASP B 3   ? 1.5591 1.2379 0.8848 0.7556  -0.3114 -0.2054 3   ASP B N   
802  C CA  . ASP B 3   ? 1.5372 1.1594 0.8812 0.6857  -0.2988 -0.1819 3   ASP B CA  
803  C C   . ASP B 3   ? 1.5027 1.1668 0.9102 0.6291  -0.2460 -0.1557 3   ASP B C   
804  O O   . ASP B 3   ? 1.4613 1.2136 0.9069 0.6344  -0.2088 -0.1525 3   ASP B O   
805  C CB  . ASP B 3   ? 1.5642 1.2070 0.9127 0.6784  -0.2981 -0.1858 3   ASP B CB  
806  N N   . CYS B 4   ? 1.4322 1.0304 0.8434 0.5747  -0.2453 -0.1378 4   CYS B N   
807  C CA  . CYS B 4   ? 1.3481 0.9670 0.8068 0.5232  -0.2048 -0.1158 4   CYS B CA  
808  C C   . CYS B 4   ? 1.2790 0.9717 0.7850 0.4987  -0.1624 -0.1061 4   CYS B C   
809  O O   . CYS B 4   ? 1.2701 0.9602 0.7746 0.4889  -0.1685 -0.1080 4   CYS B O   
810  C CB  . CYS B 4   ? 1.3826 0.9213 0.8241 0.4771  -0.2238 -0.1049 4   CYS B CB  
811  S SG  . CYS B 4   ? 1.3706 0.9396 0.8653 0.4175  -0.1797 -0.0826 4   CYS B SG  
812  N N   . VAL B 5   ? 1.1661 0.9185 0.7068 0.4892  -0.1218 -0.0961 5   VAL B N   
813  C CA  . VAL B 5   ? 1.0926 0.9088 0.6693 0.4611  -0.0812 -0.0851 5   VAL B CA  
814  C C   . VAL B 5   ? 1.1032 0.8905 0.6960 0.4144  -0.0741 -0.0730 5   VAL B C   
815  O O   . VAL B 5   ? 1.0775 0.9008 0.6849 0.4024  -0.0625 -0.0729 5   VAL B O   
816  C CB  . VAL B 5   ? 1.0882 0.9414 0.6806 0.4524  -0.0452 -0.0733 5   VAL B CB  
817  C CG1 . VAL B 5   ? 1.0419 0.9404 0.6577 0.4149  -0.0075 -0.0598 5   VAL B CG1 
818  C CG2 . VAL B 5   ? 1.0917 0.9891 0.6692 0.4982  -0.0497 -0.0856 5   VAL B CG2 
819  N N   . LEU B 6   ? 1.0974 0.8280 0.6870 0.3888  -0.0821 -0.0647 6   LEU B N   
820  C CA  . LEU B 6   ? 1.0984 0.8085 0.7020 0.3454  -0.0762 -0.0541 6   LEU B CA  
821  C C   . LEU B 6   ? 1.1705 0.8552 0.7551 0.3476  -0.1038 -0.0620 6   LEU B C   
822  O O   . LEU B 6   ? 1.1748 0.8760 0.7772 0.3244  -0.0905 -0.0568 6   LEU B O   
823  C CB  . LEU B 6   ? 1.1051 0.7776 0.7077 0.3186  -0.0805 -0.0463 6   LEU B CB  
824  C CG  . LEU B 6   ? 1.1540 0.8243 0.7753 0.2746  -0.0679 -0.0354 6   LEU B CG  
825  C CD1 . LEU B 6   ? 1.1295 0.8404 0.7780 0.2637  -0.0304 -0.0272 6   LEU B CD1 
826  C CD2 . LEU B 6   ? 1.1776 0.8314 0.7960 0.2533  -0.0748 -0.0323 6   LEU B CD2 
827  N N   . ASP B 7   ? 1.1702 0.8105 0.7123 0.3793  -0.1441 -0.0756 7   ASP B N   
828  C CA  . ASP B 7   ? 1.2075 0.8086 0.7146 0.3906  -0.1775 -0.0859 7   ASP B CA  
829  C C   . ASP B 7   ? 1.2333 0.9050 0.7572 0.4162  -0.1644 -0.0968 7   ASP B C   
830  O O   . ASP B 7   ? 1.2255 0.8933 0.7490 0.4037  -0.1682 -0.0975 7   ASP B O   
831  C CB  . ASP B 7   ? 1.2995 0.8259 0.7428 0.4252  -0.2282 -0.1001 7   ASP B CB  
832  C CG  . ASP B 7   ? 1.4794 0.9270 0.8935 0.3898  -0.2503 -0.0901 7   ASP B CG  
833  O OD1 . ASP B 7   ? 1.4993 0.9420 0.9341 0.3364  -0.2353 -0.0741 7   ASP B OD1 
834  O OD2 . ASP B 7   ? 1.5884 0.9839 0.9570 0.4145  -0.2837 -0.0992 7   ASP B OD2 
835  N N   . VAL B 8   ? 1.1770 0.9209 0.7163 0.4483  -0.1473 -0.1050 8   VAL B N   
836  C CA  . VAL B 8   ? 1.1524 0.9891 0.7108 0.4687  -0.1305 -0.1162 8   VAL B CA  
837  C C   . VAL B 8   ? 1.1514 1.0246 0.7530 0.4168  -0.0919 -0.0992 8   VAL B C   
838  O O   . VAL B 8   ? 1.1373 1.0431 0.7454 0.4156  -0.0920 -0.1062 8   VAL B O   
839  C CB  . VAL B 8   ? 1.1926 1.1049 0.7577 0.5025  -0.1165 -0.1245 8   VAL B CB  
840  C CG1 . VAL B 8   ? 1.1679 1.1955 0.7552 0.5121  -0.0952 -0.1348 8   VAL B CG1 
841  C CG2 . VAL B 8   ? 1.2442 1.1176 0.7622 0.5599  -0.1586 -0.1439 8   VAL B CG2 
842  N N   . MET B 9   ? 1.0811 0.9415 0.7057 0.3773  -0.0631 -0.0788 9   MET B N   
843  C CA  . MET B 9   ? 1.0412 0.9179 0.6966 0.3296  -0.0302 -0.0624 9   MET B CA  
844  C C   . MET B 9   ? 1.0914 0.9252 0.7465 0.3061  -0.0435 -0.0596 9   MET B C   
845  O O   . MET B 9   ? 1.0646 0.9314 0.7393 0.2847  -0.0269 -0.0567 9   MET B O   
846  C CB  . MET B 9   ? 1.0565 0.9095 0.7203 0.3053  -0.0081 -0.0458 9   MET B CB  
847  C CG  . MET B 9   ? 1.1134 1.0114 0.7778 0.3148  0.0150  -0.0430 9   MET B CG  
848  S SD  . MET B 9   ? 1.1615 1.0167 0.8241 0.2904  0.0369  -0.0253 9   MET B SD  
849  C CE  . MET B 9   ? 1.1313 1.0332 0.7837 0.2953  0.0621  -0.0207 9   MET B CE  
850  N N   . HIS B 10  ? 1.0936 0.8545 0.7228 0.3064  -0.0739 -0.0600 10  HIS B N   
851  C CA  . HIS B 10  ? 1.1210 0.8349 0.7402 0.2813  -0.0902 -0.0563 10  HIS B CA  
852  C C   . HIS B 10  ? 1.1445 0.8732 0.7500 0.3038  -0.1072 -0.0710 10  HIS B C   
853  O O   . HIS B 10  ? 1.1128 0.8454 0.7311 0.2796  -0.0999 -0.0666 10  HIS B O   
854  C CB  . HIS B 10  ? 1.1946 0.8281 0.7762 0.2736  -0.1236 -0.0540 10  HIS B CB  
855  C CG  . HIS B 10  ? 1.2332 0.8588 0.8308 0.2420  -0.1083 -0.0403 10  HIS B CG  
856  N ND1 . HIS B 10  ? 1.2085 0.8749 0.8454 0.2163  -0.0716 -0.0292 10  HIS B ND1 
857  C CD2 . HIS B 10  ? 1.2996 0.8824 0.8734 0.2343  -0.1284 -0.0385 10  HIS B CD2 
858  C CE1 . HIS B 10  ? 1.2041 0.8580 0.8413 0.2006  -0.0705 -0.0233 10  HIS B CE1 
859  N NE2 . HIS B 10  ? 1.2554 0.8654 0.8591 0.2073  -0.1025 -0.0282 10  HIS B NE2 
860  N N   . ALA B 11  ? 1.1254 0.8678 0.7036 0.3549  -0.1304 -0.0906 11  ALA B N   
861  C CA  . ALA B 11  ? 1.1409 0.9088 0.7000 0.3909  -0.1507 -0.1111 11  ALA B CA  
862  C C   . ALA B 11  ? 1.1306 1.0027 0.7366 0.3794  -0.1141 -0.1125 11  ALA B C   
863  O O   . ALA B 11  ? 1.1440 1.0299 0.7500 0.3791  -0.1199 -0.1199 11  ALA B O   
864  C CB  . ALA B 11  ? 1.2022 0.9698 0.7188 0.4548  -0.1842 -0.1346 11  ALA B CB  
865  N N   . ILE B 12  ? 1.0438 0.9836 0.6843 0.3655  -0.0778 -0.1044 12  ILE B N   
866  C CA  . ILE B 12  ? 0.9941 1.0267 0.6721 0.3410  -0.0418 -0.1016 12  ILE B CA  
867  C C   . ILE B 12  ? 1.0328 1.0327 0.7328 0.2877  -0.0231 -0.0829 12  ILE B C   
868  O O   . ILE B 12  ? 0.9993 1.0485 0.7169 0.2727  -0.0114 -0.0863 12  ILE B O   
869  C CB  . ILE B 12  ? 0.9997 1.0956 0.6938 0.3332  -0.0111 -0.0947 12  ILE B CB  
870  C CG1 . ILE B 12  ? 1.0281 1.1648 0.7011 0.3891  -0.0300 -0.1146 12  ILE B CG1 
871  C CG2 . ILE B 12  ? 0.9638 1.1478 0.6857 0.2967  0.0238  -0.0896 12  ILE B CG2 
872  N N   . TYR B 13  ? 1.0098 0.9344 0.7076 0.2618  -0.0215 -0.0656 13  TYR B N   
873  C CA  . TYR B 13  ? 1.0059 0.9001 0.7202 0.2178  -0.0070 -0.0500 13  TYR B CA  
874  C C   . TYR B 13  ? 1.0645 0.9407 0.7710 0.2182  -0.0273 -0.0575 13  TYR B C   
875  O O   . TYR B 13  ? 1.0367 0.9388 0.7640 0.1929  -0.0109 -0.0538 13  TYR B O   
876  C CB  . TYR B 13  ? 1.0451 0.8747 0.7534 0.2001  -0.0086 -0.0360 13  TYR B CB  
877  C CG  . TYR B 13  ? 1.0949 0.9019 0.8175 0.1609  0.0034  -0.0232 13  TYR B CG  
878  C CD1 . TYR B 13  ? 1.1153 0.9414 0.8558 0.1356  0.0339  -0.0125 13  TYR B CD1 
879  C CD2 . TYR B 13  ? 1.1226 0.8866 0.8334 0.1494  -0.0180 -0.0224 13  TYR B CD2 
880  C CE1 . TYR B 13  ? 1.1392 0.9470 0.8891 0.1064  0.0423  -0.0038 13  TYR B CE1 
881  C CE2 . TYR B 13  ? 1.1248 0.8798 0.8495 0.1158  -0.0067 -0.0122 13  TYR B CE2 
882  C CZ  . TYR B 13  ? 1.2364 1.0161 0.9825 0.0976  0.0233  -0.0042 13  TYR B CZ  
883  O OH  . TYR B 13  ? 1.2755 1.0477 1.0316 0.0709  0.0320  0.0032  13  TYR B OH  
884  N N   . GLN B 14  ? 1.0554 0.8789 0.7244 0.2470  -0.0654 -0.0680 14  GLN B N   
885  C CA  . GLN B 14  ? 1.0898 0.8743 0.7321 0.2541  -0.0938 -0.0762 14  GLN B CA  
886  C C   . GLN B 14  ? 1.1433 1.0008 0.7960 0.2769  -0.0914 -0.0942 14  GLN B C   
887  O O   . GLN B 14  ? 1.1465 0.9997 0.8029 0.2623  -0.0927 -0.0944 14  GLN B O   
888  C CB  . GLN B 14  ? 1.1797 0.8836 0.7631 0.2846  -0.1393 -0.0850 14  GLN B CB  
889  C CG  . GLN B 14  ? 1.5427 1.1549 1.0918 0.2537  -0.1627 -0.0736 14  GLN B CG  
890  N N   . GLN B 15  ? 1.0943 1.0280 0.7526 0.3117  -0.0870 -0.1102 15  GLN B N   
891  C CA  . GLN B 15  ? 1.0814 1.1110 0.7523 0.3339  -0.0831 -0.1307 15  GLN B CA  
892  C C   . GLN B 15  ? 1.0930 1.1834 0.8116 0.2823  -0.0421 -0.1173 15  GLN B C   
893  O O   . GLN B 15  ? 1.0969 1.2306 0.8252 0.2809  -0.0418 -0.1277 15  GLN B O   
894  C CB  . GLN B 15  ? 1.0990 1.2104 0.7650 0.3797  -0.0862 -0.1506 15  GLN B CB  
895  C CG  . GLN B 15  ? 1.2771 1.4671 0.9300 0.4292  -0.1064 -0.1829 15  GLN B CG  
896  N N   . ASN B 16  ? 1.0090 1.0931 0.7499 0.2412  -0.0109 -0.0951 16  ASN B N   
897  C CA  . ASN B 16  ? 0.9728 1.0919 0.7446 0.1904  0.0242  -0.0806 16  ASN B CA  
898  C C   . ASN B 16  ? 1.0117 1.0707 0.7886 0.1613  0.0229  -0.0696 16  ASN B C   
899  O O   . ASN B 16  ? 0.9841 1.0780 0.7803 0.1320  0.0404  -0.0670 16  ASN B O   
900  C CB  . ASN B 16  ? 0.9578 1.0715 0.7350 0.1636  0.0508  -0.0622 16  ASN B CB  
901  C CG  . ASN B 16  ? 1.1818 1.3883 0.9626 0.1700  0.0658  -0.0698 16  ASN B CG  
902  O OD1 . ASN B 16  ? 1.1636 1.4347 0.9570 0.1353  0.0901  -0.0661 16  ASN B OD1 
903  N ND2 . ASN B 16  ? 1.0435 1.2632 0.8097 0.2131  0.0500  -0.0815 16  ASN B ND2 
904  N N   . LYS B 17  ? 0.9772 0.9493 0.7345 0.1660  0.0023  -0.0629 17  LYS B N   
905  C CA  . LYS B 17  ? 0.9513 0.8678 0.7086 0.1397  -0.0019 -0.0525 17  LYS B CA  
906  C C   . LYS B 17  ? 0.9650 0.8957 0.7155 0.1535  -0.0194 -0.0673 17  LYS B C   
907  O O   . LYS B 17  ? 0.9251 0.8636 0.6931 0.1263  -0.0072 -0.0622 17  LYS B O   
908  C CB  . LYS B 17  ? 1.0028 0.8388 0.7350 0.1398  -0.0221 -0.0437 17  LYS B CB  
909  C CG  . LYS B 17  ? 1.1206 0.9103 0.8513 0.1084  -0.0255 -0.0322 17  LYS B CG  
910  C CD  . LYS B 17  ? 1.2405 0.9663 0.9444 0.1009  -0.0452 -0.0238 17  LYS B CD  
911  C CE  . LYS B 17  ? 1.2235 0.9124 0.9174 0.0709  -0.0544 -0.0151 17  LYS B CE  
912  N NZ  . LYS B 17  ? 1.2949 0.9455 0.9719 0.0488  -0.0639 -0.0041 17  LYS B NZ  
913  N N   . GLU B 18  ? 0.9359 0.8690 0.6563 0.2001  -0.0499 -0.0875 18  GLU B N   
914  C CA  . GLU B 18  ? 0.9551 0.9016 0.6575 0.2278  -0.0730 -0.1073 18  GLU B CA  
915  C C   . GLU B 18  ? 1.0028 1.0575 0.7439 0.2191  -0.0474 -0.1173 18  GLU B C   
916  O O   . GLU B 18  ? 1.0100 1.0746 0.7581 0.2093  -0.0481 -0.1214 18  GLU B O   
917  C CB  . GLU B 18  ? 1.0301 0.9559 0.6828 0.2882  -0.1132 -0.1298 18  GLU B CB  
918  N N   . HIS B 19  ? 0.9540 1.0895 0.7190 0.2151  -0.0234 -0.1189 19  HIS B N   
919  C CA  . HIS B 19  ? 0.9250 1.1693 0.7229 0.1944  0.0028  -0.1258 19  HIS B CA  
920  C C   . HIS B 19  ? 0.9123 1.1353 0.7341 0.1370  0.0279  -0.1057 19  HIS B C   
921  O O   . HIS B 19  ? 0.9025 1.1796 0.7403 0.1240  0.0344  -0.1143 19  HIS B O   
922  C CB  . HIS B 19  ? 0.9340 1.2584 0.7439 0.1906  0.0241  -0.1263 19  HIS B CB  
923  C CG  . HIS B 19  ? 0.9682 1.4131 0.8048 0.1624  0.0489  -0.1336 19  HIS B CG  
924  N ND1 . HIS B 19  ? 0.9771 1.4201 0.8311 0.0981  0.0799  -0.1122 19  HIS B ND1 
925  C CD2 . HIS B 19  ? 0.9983 1.5653 0.8417 0.1895  0.0436  -0.1615 19  HIS B CD2 
926  C CE1 . HIS B 19  ? 0.9679 1.5286 0.8383 0.0804  0.0936  -0.1249 19  HIS B CE1 
927  N NE2 . HIS B 19  ? 0.9805 1.6283 0.8493 0.1340  0.0739  -0.1555 19  HIS B NE2 
928  N N   . PHE B 20  ? 0.8368 0.9836 0.6581 0.1068  0.0398  -0.0814 20  PHE B N   
929  C CA  . PHE B 20  ? 0.8142 0.9269 0.6491 0.0598  0.0596  -0.0630 20  PHE B CA  
930  C C   . PHE B 20  ? 0.8771 0.9578 0.7110 0.0606  0.0442  -0.0669 20  PHE B C   
931  O O   . PHE B 20  ? 0.8606 0.9649 0.7106 0.0336  0.0570  -0.0657 20  PHE B O   
932  C CB  . PHE B 20  ? 0.8262 0.8654 0.6526 0.0436  0.0676  -0.0423 20  PHE B CB  
933  C CG  . PHE B 20  ? 0.8329 0.8146 0.6618 0.0156  0.0726  -0.0282 20  PHE B CG  
934  C CD1 . PHE B 20  ? 0.8504 0.8429 0.6883 -0.0193 0.0922  -0.0214 20  PHE B CD1 
935  C CD2 . PHE B 20  ? 0.8604 0.7803 0.6782 0.0231  0.0558  -0.0229 20  PHE B CD2 
936  C CE1 . PHE B 20  ? 0.8467 0.7900 0.6839 -0.0379 0.0942  -0.0115 20  PHE B CE1 
937  C CE2 . PHE B 20  ? 0.8644 0.7483 0.6853 -0.0004 0.0604  -0.0123 20  PHE B CE2 
938  C CZ  . PHE B 20  ? 0.8301 0.7262 0.6613 -0.0265 0.0793  -0.0077 20  PHE B CZ  
939  N N   . GLN B 21  ? 0.8532 0.8743 0.6627 0.0883  0.0158  -0.0703 21  GLN B N   
940  C CA  . GLN B 21  ? 0.8695 0.8484 0.6666 0.0897  -0.0026 -0.0724 21  GLN B CA  
941  C C   . GLN B 21  ? 0.9898 1.0293 0.7897 0.1107  -0.0116 -0.0945 21  GLN B C   
942  O O   . GLN B 21  ? 1.0088 1.0502 0.8198 0.0919  -0.0070 -0.0934 21  GLN B O   
943  C CB  . GLN B 21  ? 0.9166 0.8123 0.6728 0.1099  -0.0342 -0.0702 21  GLN B CB  
944  C CG  . GLN B 21  ? 0.8497 0.6932 0.6065 0.0820  -0.0251 -0.0487 21  GLN B CG  
945  C CD  . GLN B 21  ? 1.0266 0.7920 0.7403 0.0900  -0.0560 -0.0447 21  GLN B CD  
946  O OE1 . GLN B 21  ? 0.9893 0.7203 0.6618 0.1195  -0.0885 -0.0571 21  GLN B OE1 
947  N NE2 . GLN B 21  ? 0.8745 0.6085 0.5902 0.0631  -0.0487 -0.0280 21  GLN B NE2 
948  N N   . ASP B 22  ? 0.9721 1.0705 0.7631 0.1511  -0.0235 -0.1162 22  ASP B N   
949  C CA  . ASP B 22  ? 0.9921 1.1688 0.7853 0.1788  -0.0333 -0.1428 22  ASP B CA  
950  C C   . ASP B 22  ? 1.0141 1.2807 0.8508 0.1371  0.0003  -0.1411 22  ASP B C   
951  O O   . ASP B 22  ? 1.0265 1.3317 0.8718 0.1373  -0.0025 -0.1538 22  ASP B O   
952  C CB  . ASP B 22  ? 1.0606 1.2928 0.8326 0.2362  -0.0540 -0.1691 22  ASP B CB  
953  C CG  . ASP B 22  ? 1.3774 1.5136 1.0906 0.2852  -0.0969 -0.1765 22  ASP B CG  
954  O OD1 . ASP B 22  ? 1.4046 1.4318 1.0908 0.2704  -0.1120 -0.1610 22  ASP B OD1 
955  O OD2 . ASP B 22  ? 1.5662 1.7364 1.2554 0.3369  -0.1168 -0.1982 22  ASP B OD2 
956  N N   . GLU B 23  ? 0.9459 1.2358 0.8032 0.0987  0.0301  -0.1246 23  GLU B N   
957  C CA  . GLU B 23  ? 0.9204 1.2777 0.8056 0.0488  0.0606  -0.1188 23  GLU B CA  
958  C C   . GLU B 23  ? 0.9727 1.2733 0.8653 0.0130  0.0676  -0.1049 23  GLU B C   
959  O O   . GLU B 23  ? 0.9805 1.3380 0.8894 -0.0112 0.0777  -0.1115 23  GLU B O   
960  C CB  . GLU B 23  ? 0.9289 1.2924 0.8157 0.0166  0.0853  -0.1012 23  GLU B CB  
961  C CG  . GLU B 23  ? 1.0154 1.4800 0.9165 -0.0250 0.1100  -0.1033 23  GLU B CG  
962  C CD  . GLU B 23  ? 1.1864 1.6432 1.0762 -0.0591 0.1317  -0.0842 23  GLU B CD  
963  N N   . CYS B 24  ? 0.9238 1.1212 0.8037 0.0101  0.0609  -0.0875 24  CYS B N   
964  C CA  . CYS B 24  ? 0.9160 1.0597 0.8001 -0.0185 0.0659  -0.0747 24  CYS B CA  
965  C C   . CYS B 24  ? 0.9918 1.1372 0.8734 0.0014  0.0464  -0.0889 24  CYS B C   
966  O O   . CYS B 24  ? 0.9654 1.1198 0.8597 -0.0219 0.0540  -0.0883 24  CYS B O   
967  C CB  . CYS B 24  ? 0.9138 0.9675 0.7846 -0.0246 0.0645  -0.0548 24  CYS B CB  
968  S SG  . CYS B 24  ? 0.9560 0.9933 0.8240 -0.0517 0.0886  -0.0369 24  CYS B SG  
969  N N   . THR B 25  ? 1.0098 1.1347 0.8673 0.0457  0.0183  -0.1014 25  THR B N   
970  C CA  . THR B 25  ? 1.0370 1.1468 0.8757 0.0733  -0.0075 -0.1163 25  THR B CA  
971  C C   . THR B 25  ? 1.0846 1.3002 0.9427 0.0838  -0.0040 -0.1410 25  THR B C   
972  O O   . THR B 25  ? 1.0842 1.3060 0.9490 0.0758  -0.0055 -0.1459 25  THR B O   
973  C CB  . THR B 25  ? 1.0895 1.1330 0.8812 0.1160  -0.0421 -0.1219 25  THR B CB  
974  O OG1 . THR B 25  ? 1.0283 0.9993 0.8118 0.0941  -0.0378 -0.0982 25  THR B OG1 
975  C CG2 . THR B 25  ? 1.0678 1.0570 0.8224 0.1374  -0.0723 -0.1303 25  THR B CG2 
976  N N   . LYS B 26  ? 1.0291 1.3372 0.8995 0.0956  0.0040  -0.1555 26  LYS B N   
977  C CA  . LYS B 26  ? 1.0284 1.4621 0.9207 0.0995  0.0104  -0.1802 26  LYS B CA  
978  C C   . LYS B 26  ? 1.0490 1.5094 0.9721 0.0388  0.0382  -0.1681 26  LYS B C   
979  O O   . LYS B 26  ? 1.0618 1.5726 0.9956 0.0396  0.0347  -0.1841 26  LYS B O   
980  C CB  . LYS B 26  ? 1.0708 1.6071 0.9709 0.1134  0.0180  -0.1942 26  LYS B CB  
981  C CG  . LYS B 26  ? 1.2612 1.9304 1.1665 0.1524  0.0060  -0.2321 26  LYS B CG  
982  N N   . LEU B 27  ? 0.9619 1.3746 0.8915 -0.0097 0.0616  -0.1406 27  LEU B N   
983  C CA  . LEU B 27  ? 0.9422 1.3532 0.8861 -0.0677 0.0844  -0.1262 27  LEU B CA  
984  C C   . LEU B 27  ? 0.9797 1.3272 0.9232 -0.0737 0.0772  -0.1211 27  LEU B C   
985  O O   . LEU B 27  ? 0.9864 1.3679 0.9427 -0.1059 0.0873  -0.1237 27  LEU B O   
986  C CB  . LEU B 27  ? 0.9458 1.2963 0.8798 -0.1028 0.1027  -0.0997 27  LEU B CB  
987  C CG  . LEU B 27  ? 1.0098 1.3398 0.9408 -0.1621 0.1228  -0.0836 27  LEU B CG  
988  C CD1 . LEU B 27  ? 1.0268 1.4271 0.9543 -0.2004 0.1413  -0.0821 27  LEU B CD1 
989  C CD2 . LEU B 27  ? 1.0210 1.2354 0.9330 -0.1712 0.1247  -0.0605 27  LEU B CD2 
990  N N   . LEU B 28  ? 0.9159 1.1732 0.8419 -0.0477 0.0600  -0.1130 28  LEU B N   
991  C CA  . LEU B 28  ? 0.8911 1.0838 0.8130 -0.0557 0.0542  -0.1045 28  LEU B CA  
992  C C   . LEU B 28  ? 0.9104 1.1082 0.8236 -0.0229 0.0310  -0.1224 28  LEU B C   
993  O O   . LEU B 28  ? 0.8954 1.0785 0.8143 -0.0380 0.0323  -0.1206 28  LEU B O   
994  C CB  . LEU B 28  ? 0.8993 0.9989 0.8040 -0.0560 0.0507  -0.0834 28  LEU B CB  
995  C CG  . LEU B 28  ? 0.9628 1.0280 0.8712 -0.0936 0.0718  -0.0634 28  LEU B CG  
996  C CD1 . LEU B 28  ? 0.9592 0.9779 0.8541 -0.0866 0.0721  -0.0499 28  LEU B CD1 
997  C CD2 . LEU B 28  ? 0.9993 1.0238 0.9076 -0.1100 0.0725  -0.0558 28  LEU B CD2 
998  N N   . VAL B 29  ? 0.8685 1.0761 0.7602 0.0247  0.0071  -0.1397 29  VAL B N   
999  C CA  . VAL B 29  ? 0.8780 1.0757 0.7452 0.0639  -0.0212 -0.1585 29  VAL B CA  
1000 C C   . VAL B 29  ? 0.9357 1.2293 0.8288 0.0610  -0.0147 -0.1802 29  VAL B C   
1001 O O   . VAL B 29  ? 0.9122 1.3085 0.8283 0.0576  -0.0025 -0.1951 29  VAL B O   
1002 C CB  . VAL B 29  ? 0.9484 1.1267 0.7737 0.1203  -0.0527 -0.1746 29  VAL B CB  
1003 C CG1 . VAL B 29  ? 0.9841 1.1550 0.7728 0.1680  -0.0860 -0.1993 29  VAL B CG1 
1004 C CG2 . VAL B 29  ? 0.9574 1.0287 0.7516 0.1160  -0.0624 -0.1515 29  VAL B CG2 
1005 N N   . GLY B 30  ? 0.9206 1.1839 0.8102 0.0564  -0.0211 -0.1802 30  GLY B N   
1006 C CA  . GLY B 30  ? 0.9060 1.2497 0.8184 0.0515  -0.0167 -0.1998 30  GLY B CA  
1007 C C   . GLY B 30  ? 0.9104 1.2663 0.8559 -0.0081 0.0119  -0.1839 30  GLY B C   
1008 O O   . GLY B 30  ? 0.8788 1.2883 0.8414 -0.0199 0.0155  -0.1969 30  GLY B O   
1009 N N   . ASN B 31  ? 0.8718 1.1753 0.8209 -0.0438 0.0301  -0.1573 31  ASN B N   
1010 C CA  . ASN B 31  ? 0.8485 1.1395 0.8131 -0.0966 0.0524  -0.1411 31  ASN B CA  
1011 C C   . ASN B 31  ? 0.8684 1.0757 0.8227 -0.1004 0.0473  -0.1268 31  ASN B C   
1012 O O   . ASN B 31  ? 0.8654 1.0124 0.7991 -0.0744 0.0316  -0.1206 31  ASN B O   
1013 C CB  . ASN B 31  ? 0.8482 1.1214 0.8116 -0.1270 0.0710  -0.1225 31  ASN B CB  
1014 C CG  . ASN B 31  ? 1.1696 1.5382 1.1443 -0.1380 0.0813  -0.1343 31  ASN B CG  
1015 O OD1 . ASN B 31  ? 1.1229 1.5474 1.1077 -0.1800 0.0959  -0.1370 31  ASN B OD1 
1016 N ND2 . ASN B 31  ? 0.9943 1.3869 0.9637 -0.1020 0.0726  -0.1425 31  ASN B ND2 
1017 N N   . ILE B 32  ? 0.7994 1.0035 0.7633 -0.1355 0.0593  -0.1216 32  ILE B N   
1018 C CA  . ILE B 32  ? 0.7821 0.9217 0.7383 -0.1410 0.0563  -0.1104 32  ILE B CA  
1019 C C   . ILE B 32  ? 0.7990 0.8815 0.7454 -0.1684 0.0696  -0.0894 32  ILE B C   
1020 O O   . ILE B 32  ? 0.7825 0.8761 0.7276 -0.1999 0.0825  -0.0864 32  ILE B O   
1021 C CB  . ILE B 32  ? 0.8189 0.9963 0.7870 -0.1491 0.0540  -0.1253 32  ILE B CB  
1022 C CG1 . ILE B 32  ? 0.8248 1.0510 0.7937 -0.1087 0.0355  -0.1485 32  ILE B CG1 
1023 C CG2 . ILE B 32  ? 0.8016 0.9177 0.7616 -0.1578 0.0528  -0.1139 32  ILE B CG2 
1024 C CD1 . ILE B 32  ? 0.9130 1.2010 0.8961 -0.1091 0.0317  -0.1699 32  ILE B CD1 
1025 N N   . VAL B 33  ? 0.7463 0.7688 0.6795 -0.1558 0.0644  -0.0757 33  VAL B N   
1026 C CA  . VAL B 33  ? 0.7405 0.7125 0.6602 -0.1701 0.0733  -0.0595 33  VAL B CA  
1027 C C   . VAL B 33  ? 0.7940 0.7342 0.7069 -0.1716 0.0699  -0.0560 33  VAL B C   
1028 O O   . VAL B 33  ? 0.7779 0.7270 0.6959 -0.1600 0.0605  -0.0617 33  VAL B O   
1029 C CB  . VAL B 33  ? 0.7689 0.7128 0.6790 -0.1550 0.0715  -0.0480 33  VAL B CB  
1030 C CG1 . VAL B 33  ? 0.7499 0.7214 0.6633 -0.1541 0.0766  -0.0506 33  VAL B CG1 
1031 C CG2 . VAL B 33  ? 0.7534 0.6813 0.6570 -0.1340 0.0563  -0.0460 33  VAL B CG2 
1032 N N   . ILE B 34  ? 0.7671 0.6676 0.6627 -0.1816 0.0755  -0.0473 34  ILE B N   
1033 C CA  . ILE B 34  ? 0.7656 0.6377 0.6493 -0.1771 0.0714  -0.0454 34  ILE B CA  
1034 C C   . ILE B 34  ? 0.8216 0.6670 0.6904 -0.1632 0.0714  -0.0353 34  ILE B C   
1035 O O   . ILE B 34  ? 0.8255 0.6524 0.6819 -0.1655 0.0767  -0.0302 34  ILE B O   
1036 C CB  . ILE B 34  ? 0.8232 0.6715 0.6887 -0.1977 0.0731  -0.0497 34  ILE B CB  
1037 C CG2 . ILE B 34  ? 0.8361 0.6684 0.6935 -0.1874 0.0648  -0.0538 34  ILE B CG2 
1038 N N   . THR B 35  ? 0.7712 0.6223 0.6405 -0.1498 0.0654  -0.0329 35  THR B N   
1039 C CA  . THR B 35  ? 0.7666 0.6111 0.6225 -0.1371 0.0649  -0.0265 35  THR B CA  
1040 C C   . THR B 35  ? 0.8490 0.6773 0.6860 -0.1290 0.0618  -0.0327 35  THR B C   
1041 O O   . THR B 35  ? 0.8403 0.6841 0.6825 -0.1265 0.0570  -0.0368 35  THR B O   
1042 C CB  . THR B 35  ? 0.7812 0.6518 0.6438 -0.1340 0.0593  -0.0201 35  THR B CB  
1043 O OG1 . THR B 35  ? 0.7721 0.6556 0.6400 -0.1367 0.0532  -0.0232 35  THR B OG1 
1044 C CG2 . THR B 35  ? 0.6861 0.5562 0.5535 -0.1377 0.0576  -0.0143 35  THR B CG2 
1045 N N   . ARG B 36  ? 0.8622 0.6515 0.6708 -0.1244 0.0621  -0.0345 36  ARG B N   
1046 C CA  . ARG B 36  ? 0.9111 0.6657 0.6865 -0.1130 0.0539  -0.0429 36  ARG B CA  
1047 C C   . ARG B 36  ? 0.9801 0.7600 0.7460 -0.0832 0.0470  -0.0480 36  ARG B C   
1048 O O   . ARG B 36  ? 1.0323 0.7947 0.7743 -0.0686 0.0376  -0.0575 36  ARG B O   
1049 C CB  . ARG B 36  ? 0.9436 0.6307 0.6743 -0.1181 0.0512  -0.0434 36  ARG B CB  
1050 C CG  . ARG B 36  ? 1.0589 0.7375 0.7985 -0.1534 0.0598  -0.0381 36  ARG B CG  
1051 C CD  . ARG B 36  ? 1.2302 0.8381 0.9180 -0.1746 0.0544  -0.0386 36  ARG B CD  
1052 N NE  . ARG B 36  ? 1.4370 1.0480 1.1293 -0.1999 0.0517  -0.0442 36  ARG B NE  
1053 C CZ  . ARG B 36  ? 1.4855 1.1115 1.1865 -0.2400 0.0586  -0.0428 36  ARG B CZ  
1054 N NH1 . ARG B 36  ? 1.1678 0.8035 0.8705 -0.2592 0.0687  -0.0353 36  ARG B NH1 
1055 N NH2 . ARG B 36  ? 1.2812 0.9192 0.9878 -0.2616 0.0552  -0.0500 36  ARG B NH2 
1056 N N   . TYR B 37  ? 0.9035 0.7319 0.6872 -0.0762 0.0506  -0.0427 37  TYR B N   
1057 C CA  . TYR B 37  ? 0.8857 0.7613 0.6629 -0.0525 0.0452  -0.0488 37  TYR B CA  
1058 C C   . TYR B 37  ? 0.9426 0.8526 0.7344 -0.0570 0.0424  -0.0510 37  TYR B C   
1059 O O   . TYR B 37  ? 0.9649 0.9031 0.7422 -0.0338 0.0357  -0.0607 37  TYR B O   
1060 C CB  . TYR B 37  ? 0.8452 0.7718 0.6342 -0.0515 0.0494  -0.0425 37  TYR B CB  
1061 C CG  . TYR B 37  ? 0.8014 0.7500 0.6194 -0.0818 0.0546  -0.0288 37  TYR B CG  
1062 C CD1 . TYR B 37  ? 0.8023 0.7999 0.6307 -0.0953 0.0525  -0.0238 37  TYR B CD1 
1063 C CD2 . TYR B 37  ? 0.7875 0.7054 0.6138 -0.0957 0.0590  -0.0212 37  TYR B CD2 
1064 C CE1 . TYR B 37  ? 0.7686 0.7670 0.6069 -0.1223 0.0517  -0.0111 37  TYR B CE1 
1065 C CE2 . TYR B 37  ? 0.7737 0.7019 0.6147 -0.1164 0.0583  -0.0110 37  TYR B CE2 
1066 C CZ  . TYR B 37  ? 0.8668 0.8274 0.7097 -0.1299 0.0532  -0.0058 37  TYR B CZ  
1067 O OH  . TYR B 37  ? 0.8878 0.8384 0.7295 -0.1499 0.0471  0.0040  37  TYR B OH  
1068 N N   . ASN B 38  ? 0.8834 0.7913 0.6994 -0.0822 0.0458  -0.0441 38  ASN B N   
1069 C CA  . ASN B 38  ? 0.8610 0.7941 0.6877 -0.0874 0.0424  -0.0455 38  ASN B CA  
1070 C C   . ASN B 38  ? 0.8955 0.7935 0.7297 -0.0995 0.0414  -0.0499 38  ASN B C   
1071 O O   . ASN B 38  ? 0.8888 0.8019 0.7314 -0.1026 0.0380  -0.0523 38  ASN B O   
1072 C CB  . ASN B 38  ? 0.8148 0.7882 0.6554 -0.1054 0.0435  -0.0334 38  ASN B CB  
1073 C CG  . ASN B 38  ? 0.9572 0.9068 0.8076 -0.1235 0.0454  -0.0244 38  ASN B CG  
1074 O OD1 . ASN B 38  ? 0.8766 0.7931 0.7324 -0.1247 0.0481  -0.0275 38  ASN B OD1 
1075 N ND2 . ASN B 38  ? 0.8452 0.8114 0.6926 -0.1391 0.0419  -0.0134 38  ASN B ND2 
1076 N N   . ASN B 39  ? 0.8851 0.7434 0.7151 -0.1085 0.0445  -0.0510 39  ASN B N   
1077 C CA  . ASN B 39  ? 0.8890 0.7266 0.7254 -0.1261 0.0448  -0.0563 39  ASN B CA  
1078 C C   . ASN B 39  ? 0.8795 0.7487 0.7437 -0.1358 0.0452  -0.0555 39  ASN B C   
1079 O O   . ASN B 39  ? 0.8699 0.7467 0.7410 -0.1387 0.0413  -0.0632 39  ASN B O   
1080 C CB  . ASN B 39  ? 0.9091 0.7177 0.7228 -0.1218 0.0369  -0.0669 39  ASN B CB  
1081 C CG  . ASN B 39  ? 1.1208 0.8684 0.8930 -0.1225 0.0325  -0.0696 39  ASN B CG  
1082 O OD1 . ASN B 39  ? 1.0576 0.7834 0.8197 -0.1308 0.0375  -0.0634 39  ASN B OD1 
1083 N ND2 . ASN B 39  ? 1.0842 0.7957 0.8236 -0.1122 0.0204  -0.0790 39  ASN B ND2 
1084 N N   . ARG B 40  ? 0.8115 0.6937 0.6855 -0.1380 0.0473  -0.0476 40  ARG B N   
1085 C CA  . ARG B 40  ? 0.7720 0.6705 0.6576 -0.1402 0.0422  -0.0479 40  ARG B CA  
1086 C C   . ARG B 40  ? 0.7912 0.6923 0.6865 -0.1455 0.0451  -0.0512 40  ARG B C   
1087 O O   . ARG B 40  ? 0.8059 0.6977 0.6982 -0.1478 0.0509  -0.0454 40  ARG B O   
1088 C CB  . ARG B 40  ? 0.7317 0.6358 0.6071 -0.1384 0.0366  -0.0363 40  ARG B CB  
1089 C CG  . ARG B 40  ? 0.8156 0.7362 0.6820 -0.1365 0.0331  -0.0337 40  ARG B CG  
1090 C CD  . ARG B 40  ? 0.9820 0.9056 0.8492 -0.1346 0.0259  -0.0407 40  ARG B CD  
1091 N NE  . ARG B 40  ? 1.1994 1.1149 1.0495 -0.1399 0.0147  -0.0336 40  ARG B NE  
1092 C CZ  . ARG B 40  ? 1.3832 1.2789 1.2273 -0.1356 0.0056  -0.0376 40  ARG B CZ  
1093 N NH1 . ARG B 40  ? 1.1774 1.0488 0.9900 -0.1382 -0.0096 -0.0310 40  ARG B NH1 
1094 N NH2 . ARG B 40  ? 1.1753 1.0754 1.0382 -0.1286 0.0098  -0.0492 40  ARG B NH2 
1095 N N   . THR B 41  ? 0.7197 0.6402 0.6253 -0.1447 0.0405  -0.0623 41  THR B N   
1096 C CA  . THR B 41  ? 0.7209 0.6639 0.6368 -0.1458 0.0420  -0.0700 41  THR B CA  
1097 C C   . THR B 41  ? 0.7728 0.7172 0.6803 -0.1271 0.0292  -0.0713 41  THR B C   
1098 O O   . THR B 41  ? 0.7828 0.7170 0.6776 -0.1165 0.0166  -0.0727 41  THR B O   
1099 C CB  . THR B 41  ? 0.8452 0.8236 0.7756 -0.1567 0.0446  -0.0860 41  THR B CB  
1100 O OG1 . THR B 41  ? 0.8447 0.8289 0.7763 -0.1494 0.0363  -0.0938 41  THR B OG1 
1101 C CG2 . THR B 41  ? 0.8485 0.8155 0.7749 -0.1826 0.0554  -0.0839 41  THR B CG2 
1102 N N   . TYR B 42  ? 0.7372 0.6873 0.6443 -0.1220 0.0298  -0.0711 42  TYR B N   
1103 C CA  . TYR B 42  ? 0.7646 0.7047 0.6528 -0.0998 0.0129  -0.0744 42  TYR B CA  
1104 C C   . TYR B 42  ? 0.8270 0.8056 0.7242 -0.0883 0.0135  -0.0873 42  TYR B C   
1105 O O   . TYR B 42  ? 0.8244 0.8173 0.7351 -0.1025 0.0283  -0.0827 42  TYR B O   
1106 C CB  . TYR B 42  ? 0.7903 0.6842 0.6548 -0.1020 0.0072  -0.0563 42  TYR B CB  
1107 C CG  . TYR B 42  ? 0.8464 0.7180 0.7005 -0.1158 0.0075  -0.0429 42  TYR B CG  
1108 C CD1 . TYR B 42  ? 0.8726 0.7497 0.7390 -0.1298 0.0226  -0.0339 42  TYR B CD1 
1109 C CD2 . TYR B 42  ? 0.8984 0.7455 0.7246 -0.1132 -0.0092 -0.0402 42  TYR B CD2 
1110 C CE1 . TYR B 42  ? 0.9001 0.7741 0.7572 -0.1386 0.0224  -0.0246 42  TYR B CE1 
1111 C CE2 . TYR B 42  ? 0.9141 0.7545 0.7304 -0.1295 -0.0077 -0.0277 42  TYR B CE2 
1112 C CZ  . TYR B 42  ? 1.0188 0.8805 0.8538 -0.1411 0.0087  -0.0208 42  TYR B CZ  
1113 O OH  . TYR B 42  ? 1.1032 0.9755 0.9291 -0.1532 0.0098  -0.0116 42  TYR B OH  
1114 N N   . ARG B 43  ? 0.8186 0.8141 0.7029 -0.0599 -0.0045 -0.1042 43  ARG B N   
1115 C CA  . ARG B 43  ? 0.8414 0.8841 0.7299 -0.0402 -0.0077 -0.1201 43  ARG B CA  
1116 C C   . ARG B 43  ? 0.9195 0.9108 0.7794 -0.0266 -0.0190 -0.1092 43  ARG B C   
1117 O O   . ARG B 43  ? 0.9555 0.8830 0.7781 -0.0167 -0.0384 -0.1014 43  ARG B O   
1118 C CB  . ARG B 43  ? 0.8772 0.9619 0.7562 -0.0051 -0.0269 -0.1473 43  ARG B CB  
1119 C CG  . ARG B 43  ? 0.8712 1.0063 0.7434 0.0293  -0.0379 -0.1678 43  ARG B CG  
1120 C CD  . ARG B 43  ? 1.0452 1.1765 0.8787 0.0815  -0.0708 -0.1922 43  ARG B CD  
1121 N NE  . ARG B 43  ? 1.3036 1.3235 1.0835 0.0919  -0.0943 -0.1776 43  ARG B NE  
1122 C CZ  . ARG B 43  ? 1.4939 1.4755 1.2444 0.1043  -0.1121 -0.1820 43  ARG B CZ  
1123 N NH1 . ARG B 43  ? 1.3396 1.3875 1.1115 0.1153  -0.1105 -0.2036 43  ARG B NH1 
1124 N NH2 . ARG B 43  ? 1.2913 1.1695 0.9868 0.1035  -0.1325 -0.1649 43  ARG B NH2 
1125 N N   . ILE B 44  ? 0.8506 0.8663 0.7236 -0.0305 -0.0076 -0.1072 44  ILE B N   
1126 C CA  . ILE B 44  ? 0.8581 0.8290 0.7060 -0.0184 -0.0176 -0.0978 44  ILE B CA  
1127 C C   . ILE B 44  ? 0.9493 0.9257 0.7659 0.0272  -0.0450 -0.1186 44  ILE B C   
1128 O O   . ILE B 44  ? 0.9356 0.9876 0.7681 0.0465  -0.0438 -0.1406 44  ILE B O   
1129 C CB  . ILE B 44  ? 0.8589 0.8474 0.7300 -0.0402 0.0056  -0.0866 44  ILE B CB  
1130 C CG1 . ILE B 44  ? 0.8204 0.7756 0.7014 -0.0736 0.0224  -0.0664 44  ILE B CG1 
1131 C CG2 . ILE B 44  ? 0.8635 0.8263 0.7129 -0.0207 -0.0054 -0.0836 44  ILE B CG2 
1132 N N   . ASP B 45  ? 0.9597 0.8561 0.7253 0.0440  -0.0719 -0.1126 45  ASP B N   
1133 C CA  . ASP B 45  ? 1.0310 0.9050 0.7469 0.0931  -0.1064 -0.1325 45  ASP B CA  
1134 C C   . ASP B 45  ? 1.1334 0.9729 0.8211 0.1100  -0.1194 -0.1297 45  ASP B C   
1135 O O   . ASP B 45  ? 1.1841 1.0211 0.8339 0.1581  -0.1469 -0.1513 45  ASP B O   
1136 C CB  . ASP B 45  ? 1.1139 0.9081 0.7731 0.1033  -0.1359 -0.1313 45  ASP B CB  
1137 C CG  . ASP B 45  ? 1.2072 1.0481 0.8912 0.1020  -0.1282 -0.1428 45  ASP B CG  
1138 O OD1 . ASP B 45  ? 1.2104 1.0070 0.8843 0.0769  -0.1276 -0.1275 45  ASP B OD1 
1139 O OD2 . ASP B 45  ? 1.2878 1.2196 1.0054 0.1217  -0.1203 -0.1666 45  ASP B OD2 
1140 N N   . ASP B 46  ? 1.0630 0.8819 0.7686 0.0751  -0.1005 -0.1062 46  ASP B N   
1141 C CA  . ASP B 46  ? 1.0772 0.8664 0.7638 0.0833  -0.1078 -0.1004 46  ASP B CA  
1142 C C   . ASP B 46  ? 1.0729 0.8559 0.7900 0.0402  -0.0810 -0.0754 46  ASP B C   
1143 O O   . ASP B 46  ? 1.0316 0.8212 0.7744 0.0070  -0.0617 -0.0623 46  ASP B O   
1144 C CB  . ASP B 46  ? 1.1916 0.8778 0.7981 0.1046  -0.1501 -0.0996 46  ASP B CB  
1145 C CG  . ASP B 46  ? 1.4261 1.1009 0.9962 0.1508  -0.1750 -0.1166 46  ASP B CG  
1146 O OD1 . ASP B 46  ? 1.3811 1.1222 0.9927 0.1553  -0.1544 -0.1207 46  ASP B OD1 
1147 O OD2 . ASP B 46  ? 1.6661 1.2616 1.1600 0.1841  -0.2171 -0.1265 46  ASP B OD2 
1148 N N   . VAL B 47  ? 1.0286 0.7995 0.7388 0.0458  -0.0821 -0.0709 47  VAL B N   
1149 C CA  . VAL B 47  ? 0.9880 0.7485 0.7171 0.0139  -0.0625 -0.0503 47  VAL B CA  
1150 C C   . VAL B 47  ? 1.0639 0.7490 0.7413 0.0170  -0.0893 -0.0419 47  VAL B C   
1151 O O   . VAL B 47  ? 1.0763 0.7436 0.7225 0.0511  -0.1113 -0.0545 47  VAL B O   
1152 C CB  . VAL B 47  ? 0.9975 0.8198 0.7683 0.0131  -0.0355 -0.0523 47  VAL B CB  
1153 C CG1 . VAL B 47  ? 0.9715 0.7787 0.7570 -0.0165 -0.0166 -0.0326 47  VAL B CG1 
1154 C CG2 . VAL B 47  ? 0.9642 0.8580 0.7733 0.0070  -0.0144 -0.0625 47  VAL B CG2 
1155 N N   . ASP B 48  ? 1.0418 0.6861 0.7056 -0.0185 -0.0897 -0.0222 48  ASP B N   
1156 C CA  . ASP B 48  ? 1.1052 0.6816 0.7181 -0.0267 -0.1142 -0.0124 48  ASP B CA  
1157 C C   . ASP B 48  ? 1.1311 0.7362 0.7749 -0.0360 -0.0941 -0.0049 48  ASP B C   
1158 O O   . ASP B 48  ? 1.0806 0.7165 0.7565 -0.0646 -0.0708 0.0070  48  ASP B O   
1159 C CB  . ASP B 48  ? 1.1728 0.6976 0.7470 -0.0661 -0.1278 0.0047  48  ASP B CB  
1160 C CG  . ASP B 48  ? 1.4183 0.8571 0.9195 -0.0797 -0.1622 0.0142  48  ASP B CG  
1161 O OD1 . ASP B 48  ? 1.4541 0.8768 0.9432 -0.0598 -0.1717 0.0091  48  ASP B OD1 
1162 O OD2 . ASP B 48  ? 1.5212 0.9072 0.9732 -0.1133 -0.1804 0.0272  48  ASP B OD2 
1163 N N   . TRP B 49  ? 1.1177 0.7158 0.7494 -0.0066 -0.1044 -0.0142 49  TRP B N   
1164 C CA  . TRP B 49  ? 1.0790 0.6999 0.7345 -0.0102 -0.0880 -0.0086 49  TRP B CA  
1165 C C   . TRP B 49  ? 1.1851 0.7534 0.8038 -0.0344 -0.1049 0.0050  49  TRP B C   
1166 O O   . TRP B 49  ? 1.1416 0.7327 0.7821 -0.0446 -0.0894 0.0116  49  TRP B O   
1167 C CB  . TRP B 49  ? 1.0468 0.6916 0.7063 0.0304  -0.0904 -0.0245 49  TRP B CB  
1168 C CG  . TRP B 49  ? 0.9997 0.7183 0.7033 0.0422  -0.0667 -0.0359 49  TRP B CG  
1169 C CD1 . TRP B 49  ? 1.0465 0.7907 0.7441 0.0710  -0.0776 -0.0546 49  TRP B CD1 
1170 C CD2 . TRP B 49  ? 0.9307 0.7060 0.6839 0.0228  -0.0304 -0.0299 49  TRP B CD2 
1171 N NE1 . TRP B 49  ? 0.9827 0.8049 0.7276 0.0650  -0.0485 -0.0598 49  TRP B NE1 
1172 C CE2 . TRP B 49  ? 0.9534 0.7867 0.7283 0.0338  -0.0205 -0.0437 49  TRP B CE2 
1173 C CE3 . TRP B 49  ? 0.9171 0.6976 0.6909 0.0003  -0.0083 -0.0162 49  TRP B CE3 
1174 C CZ2 . TRP B 49  ? 0.9081 0.7946 0.7194 0.0149  0.0102  -0.0411 49  TRP B CZ2 
1175 C CZ3 . TRP B 49  ? 0.9053 0.7296 0.7107 -0.0109 0.0202  -0.0149 49  TRP B CZ3 
1176 C CH2 . TRP B 49  ? 0.9040 0.7761 0.7256 -0.0076 0.0289  -0.0258 49  TRP B CH2 
1177 N N   . ASN B 50  ? 1.2325 0.7311 0.7920 -0.0479 -0.1364 0.0098  50  ASN B N   
1178 C CA  . ASN B 50  ? 1.3035 0.7479 0.8167 -0.0820 -0.1565 0.0242  50  ASN B CA  
1179 C C   . ASN B 50  ? 1.3591 0.8298 0.8851 -0.1346 -0.1421 0.0412  50  ASN B C   
1180 O O   . ASN B 50  ? 1.4030 0.8475 0.8945 -0.1729 -0.1553 0.0540  50  ASN B O   
1181 C CB  . ASN B 50  ? 1.4399 0.7794 0.8633 -0.0717 -0.2046 0.0209  50  ASN B CB  
1182 C CG  . ASN B 50  ? 1.5721 0.8911 0.9757 -0.0121 -0.2235 0.0002  50  ASN B CG  
1183 O OD1 . ASN B 50  ? 1.3594 0.7207 0.7979 0.0093  -0.2090 -0.0059 50  ASN B OD1 
1184 N ND2 . ASN B 50  ? 1.5131 0.7717 0.8580 0.0193  -0.2571 -0.0127 50  ASN B ND2 
1185 N N   . LYS B 51  ? 1.2577 0.7857 0.8313 -0.1370 -0.1158 0.0401  51  LYS B N   
1186 C CA  . LYS B 51  ? 1.2181 0.7873 0.8093 -0.1775 -0.1001 0.0522  51  LYS B CA  
1187 C C   . LYS B 51  ? 1.1183 0.7688 0.7763 -0.1682 -0.0637 0.0485  51  LYS B C   
1188 O O   . LYS B 51  ? 1.0533 0.7224 0.7428 -0.1361 -0.0493 0.0383  51  LYS B O   
1189 C CB  . LYS B 51  ? 1.2692 0.8196 0.8408 -0.1897 -0.1082 0.0546  51  LYS B CB  
1190 C CG  . LYS B 51  ? 1.3670 0.8391 0.8599 -0.2237 -0.1430 0.0667  51  LYS B CG  
1191 N N   . THR B 52  ? 1.0518 0.7498 0.7239 -0.1966 -0.0513 0.0561  52  THR B N   
1192 C CA  . THR B 52  ? 0.9799 0.7455 0.6994 -0.1853 -0.0231 0.0514  52  THR B CA  
1193 C C   . THR B 52  ? 0.9837 0.8035 0.7131 -0.2102 -0.0137 0.0554  52  THR B C   
1194 O O   . THR B 52  ? 1.0089 0.8215 0.7074 -0.2460 -0.0284 0.0650  52  THR B O   
1195 C CB  . THR B 52  ? 1.1321 0.9073 0.8523 -0.1804 -0.0224 0.0509  52  THR B CB  
1196 O OG1 . THR B 52  ? 1.2526 1.0742 1.0080 -0.1582 0.0010  0.0438  52  THR B OG1 
1197 C CG2 . THR B 52  ? 1.1323 0.9206 0.8254 -0.2200 -0.0358 0.0601  52  THR B CG2 
1198 N N   . PRO B 53  ? 0.8991 0.7718 0.6626 -0.1937 0.0079  0.0481  53  PRO B N   
1199 C CA  . PRO B 53  ? 0.8864 0.8185 0.6552 -0.2120 0.0138  0.0490  53  PRO B CA  
1200 C C   . PRO B 53  ? 0.9398 0.9225 0.6938 -0.2453 0.0075  0.0548  53  PRO B C   
1201 O O   . PRO B 53  ? 0.9271 0.9637 0.6776 -0.2702 0.0083  0.0576  53  PRO B O   
1202 C CB  . PRO B 53  ? 0.8653 0.8307 0.6626 -0.1774 0.0331  0.0368  53  PRO B CB  
1203 C CG  . PRO B 53  ? 0.8986 0.8111 0.7033 -0.1526 0.0374  0.0332  53  PRO B CG  
1204 C CD  . PRO B 53  ? 0.8697 0.7461 0.6593 -0.1581 0.0252  0.0384  53  PRO B CD  
1205 N N   . LYS B 54  ? 0.9299 0.9013 0.6742 -0.2481 0.0009  0.0562  54  LYS B N   
1206 C CA  . LYS B 54  ? 0.9437 0.9618 0.6706 -0.2851 -0.0074 0.0615  54  LYS B CA  
1207 C C   . LYS B 54  ? 1.0643 1.0405 0.7443 -0.3377 -0.0296 0.0777  54  LYS B C   
1208 O O   . LYS B 54  ? 1.1111 1.1370 0.7708 -0.3847 -0.0361 0.0851  54  LYS B O   
1209 C CB  . LYS B 54  ? 0.9513 0.9519 0.6762 -0.2720 -0.0113 0.0586  54  LYS B CB  
1210 C CG  . LYS B 54  ? 1.0090 1.0444 0.7669 -0.2241 0.0072  0.0439  54  LYS B CG  
1211 C CD  . LYS B 54  ? 0.9977 0.9911 0.7484 -0.2097 0.0009  0.0432  54  LYS B CD  
1212 C CE  . LYS B 54  ? 1.2478 1.2535 1.0202 -0.1626 0.0165  0.0309  54  LYS B CE  
1213 N NZ  . LYS B 54  ? 1.3943 1.4856 1.1757 -0.1550 0.0233  0.0200  54  LYS B NZ  
1214 N N   . ASP B 55  ? 1.0430 0.9272 0.6990 -0.3308 -0.0432 0.0824  55  ASP B N   
1215 C CA  . ASP B 55  ? 1.1102 0.9277 0.7060 -0.3737 -0.0698 0.0969  55  ASP B CA  
1216 C C   . ASP B 55  ? 1.1713 1.0269 0.7600 -0.4054 -0.0666 0.1039  55  ASP B C   
1217 O O   . ASP B 55  ? 1.0829 1.0086 0.7164 -0.3850 -0.0444 0.0953  55  ASP B O   
1218 C CB  . ASP B 55  ? 1.1712 0.8812 0.7382 -0.3450 -0.0886 0.0949  55  ASP B CB  
1219 C CG  . ASP B 55  ? 1.3947 1.0519 0.9444 -0.3257 -0.1025 0.0913  55  ASP B CG  
1220 O OD1 . ASP B 55  ? 1.4515 1.1220 0.9840 -0.3548 -0.1096 0.0971  55  ASP B OD1 
1221 O OD2 . ASP B 55  ? 1.4702 1.0789 1.0224 -0.2822 -0.1071 0.0818  55  ASP B OD2 
1222 N N   . SER B 56  ? 1.2501 1.0545 0.7743 -0.4575 -0.0912 0.1200  56  SER B N   
1223 C CA  . SER B 56  ? 1.2770 1.1128 0.7826 -0.4972 -0.0912 0.1299  56  SER B CA  
1224 C C   . SER B 56  ? 1.4307 1.1625 0.8895 -0.4933 -0.1113 0.1354  56  SER B C   
1225 O O   . SER B 56  ? 1.5038 1.1293 0.9223 -0.4741 -0.1345 0.1346  56  SER B O   
1226 C CB  . SER B 56  ? 1.3493 1.2223 0.8096 -0.5722 -0.1028 0.1459  56  SER B CB  
1227 N N   . PHE B 57  ? 1.3682 1.1354 0.8314 -0.5062 -0.1035 0.1386  57  PHE B N   
1228 C CA  . PHE B 57  ? 1.4185 1.0977 0.8316 -0.5089 -0.1231 0.1447  57  PHE B CA  
1229 C C   . PHE B 57  ? 1.5147 1.2179 0.8795 -0.5777 -0.1306 0.1635  57  PHE B C   
1230 O O   . PHE B 57  ? 1.4722 1.2949 0.8702 -0.6066 -0.1105 0.1654  57  PHE B O   
1231 C CB  . PHE B 57  ? 1.3798 1.0690 0.8449 -0.4504 -0.1068 0.1283  57  PHE B CB  
1232 C CG  . PHE B 57  ? 1.3272 1.1278 0.8530 -0.4434 -0.0772 0.1217  57  PHE B CG  
1233 C CD1 . PHE B 57  ? 1.3795 1.1940 0.8884 -0.4643 -0.0781 0.1280  57  PHE B CD1 
1234 C CD2 . PHE B 57  ? 1.2762 1.1587 0.8696 -0.4100 -0.0513 0.1077  57  PHE B CD2 
1235 C CE1 . PHE B 57  ? 1.3286 1.2445 0.8904 -0.4512 -0.0533 0.1194  57  PHE B CE1 
1236 C CE2 . PHE B 57  ? 1.2583 1.2311 0.8970 -0.3953 -0.0291 0.0987  57  PHE B CE2 
1237 C CZ  . PHE B 57  ? 1.2474 1.2388 0.8719 -0.4148 -0.0303 0.1040  57  PHE B CZ  
1238 N N   . THR B 58  ? 1.5544 1.1448 0.8339 -0.6039 -0.1617 0.1767  58  THR B N   
1239 C CA  . THR B 58  ? 1.6076 1.1984 0.8221 -0.6775 -0.1739 0.1983  58  THR B CA  
1240 C C   . THR B 58  ? 1.5912 1.2217 0.8306 -0.6623 -0.1596 0.1948  58  THR B C   
1241 O O   . THR B 58  ? 1.5827 1.1518 0.8297 -0.6084 -0.1641 0.1828  58  THR B O   
1242 C CB  . THR B 58  ? 1.7773 1.2067 0.8696 -0.7161 -0.2202 0.2154  58  THR B CB  
1243 O OG1 . THR B 58  ? 1.7571 1.1509 0.8360 -0.7169 -0.2325 0.2142  58  THR B OG1 
1244 C CG2 . THR B 58  ? 1.7987 1.2160 0.8060 -0.8076 -0.2366 0.2423  58  THR B CG2 
1245 N N   . MET B 59  ? 1.5179 1.2588 0.7694 -0.7095 -0.1431 0.2038  59  MET B N   
1246 C CA  . MET B 59  ? 1.4720 1.2593 0.7409 -0.7028 -0.1306 0.2023  59  MET B CA  
1247 C C   . MET B 59  ? 1.5699 1.2546 0.7313 -0.7596 -0.1614 0.2253  59  MET B C   
1248 O O   . MET B 59  ? 1.6372 1.2021 0.7107 -0.7941 -0.1941 0.2397  59  MET B O   
1249 C CB  . MET B 59  ? 1.4342 1.3996 0.7728 -0.7116 -0.0976 0.1955  59  MET B CB  
1250 C CG  . MET B 59  ? 1.4063 1.4438 0.8351 -0.6476 -0.0732 0.1716  59  MET B CG  
1251 S SD  . MET B 59  ? 1.3831 1.5917 0.8983 -0.6090 -0.0384 0.1507  59  MET B SD  
1252 C CE  . MET B 59  ? 1.3451 1.6927 0.8597 -0.6651 -0.0313 0.1553  59  MET B CE  
1253 N N   . SER B 60  ? 1.5097 1.2249 0.6695 -0.7641 -0.1545 0.2279  60  SER B N   
1254 C CA  . SER B 60  ? 1.6174 1.2248 0.6733 -0.8076 -0.1840 0.2478  60  SER B CA  
1255 C C   . SER B 60  ? 1.8006 1.3689 0.7527 -0.9080 -0.2081 0.2780  60  SER B C   
1256 O O   . SER B 60  ? 1.9180 1.3212 0.7588 -0.9320 -0.2481 0.2925  60  SER B O   
1257 C CB  . SER B 60  ? 1.6416 1.3185 0.7253 -0.7985 -0.1669 0.2449  60  SER B CB  
1258 O OG  . SER B 60  ? 1.7619 1.5931 0.8719 -0.8504 -0.1440 0.2531  60  SER B OG  
1259 N N   . ASP B 61  ? 1.7379 1.4557 0.7174 -0.9676 -0.1867 0.2868  61  ASP B N   
1260 C CA  . ASP B 61  ? 1.8472 1.5495 0.7294 -1.0759 -0.2072 0.3165  61  ASP B CA  
1261 C C   . ASP B 61  ? 1.9261 1.5554 0.7734 -1.0941 -0.2274 0.3204  61  ASP B C   
1262 O O   . ASP B 61  ? 2.0657 1.6017 0.7999 -1.1760 -0.2596 0.3459  61  ASP B O   
1263 C CB  . ASP B 61  ? 1.8231 1.7324 0.7476 -1.1344 -0.1771 0.3219  61  ASP B CB  
1264 C CG  . ASP B 61  ? 1.7878 1.8757 0.8329 -1.0924 -0.1411 0.2971  61  ASP B CG  
1265 O OD1 . ASP B 61  ? 1.6938 1.7596 0.8107 -1.0039 -0.1310 0.2730  61  ASP B OD1 
1266 O OD2 . ASP B 61  ? 1.8057 2.0618 0.8716 -1.1455 -0.1231 0.3001  61  ASP B OD2 
1267 N N   . GLY B 62  ? 1.7562 1.4155 0.6912 -1.0192 -0.2113 0.2959  62  GLY B N   
1268 C CA  . GLY B 62  ? 1.7858 1.3851 0.6998 -1.0245 -0.2277 0.2958  62  GLY B CA  
1269 C C   . GLY B 62  ? 1.7216 1.4789 0.7439 -0.9983 -0.1938 0.2774  62  GLY B C   
1270 O O   . GLY B 62  ? 1.7122 1.4310 0.7348 -0.9875 -0.2028 0.2728  62  GLY B O   
1271 N N   . LYS B 63  ? 1.5944 1.5267 0.7045 -0.9826 -0.1569 0.2650  63  LYS B N   
1272 C CA  . LYS B 63  ? 1.4966 1.5890 0.7041 -0.9517 -0.1255 0.2446  63  LYS B CA  
1273 C C   . LYS B 63  ? 1.5182 1.5581 0.7869 -0.8597 -0.1188 0.2221  63  LYS B C   
1274 O O   . LYS B 63  ? 1.4898 1.4608 0.7800 -0.7966 -0.1174 0.2115  63  LYS B O   
1275 C CB  . LYS B 63  ? 1.4425 1.7121 0.7186 -0.9386 -0.0934 0.2323  63  LYS B CB  
1276 C CG  . LYS B 63  ? 1.4978 1.9410 0.8570 -0.9112 -0.0661 0.2102  63  LYS B CG  
1277 C CD  . LYS B 63  ? 1.5268 2.1189 0.9521 -0.8705 -0.0389 0.1911  63  LYS B CD  
1278 C CE  . LYS B 63  ? 1.5791 2.3544 1.0670 -0.8503 -0.0174 0.1687  63  LYS B CE  
1279 N N   . GLU B 64  ? 1.4836 1.5576 0.7763 -0.8563 -0.1156 0.2152  64  GLU B N   
1280 C CA  . GLU B 64  ? 1.4202 1.4553 0.7674 -0.7771 -0.1085 0.1953  64  GLU B CA  
1281 C C   . GLU B 64  ? 1.3571 1.5412 0.8014 -0.7237 -0.0739 0.1714  64  GLU B C   
1282 O O   . GLU B 64  ? 1.3233 1.6495 0.7885 -0.7538 -0.0602 0.1683  64  GLU B O   
1283 C CB  . GLU B 64  ? 1.4944 1.4572 0.7996 -0.8007 -0.1299 0.2019  64  GLU B CB  
1284 C CG  . GLU B 64  ? 1.7858 1.5623 0.9901 -0.8245 -0.1703 0.2188  64  GLU B CG  
1285 C CD  . GLU B 64  ? 2.1618 1.8437 1.3332 -0.8160 -0.1927 0.2180  64  GLU B CD  
1286 O OE1 . GLU B 64  ? 2.2945 1.9254 1.3852 -0.8875 -0.2196 0.2362  64  GLU B OE1 
1287 O OE2 . GLU B 64  ? 2.0529 1.7076 1.2741 -0.7396 -0.1850 0.1995  64  GLU B OE2 
1288 N N   . ILE B 65  ? 1.2609 1.4116 0.7576 -0.6444 -0.0621 0.1534  65  ILE B N   
1289 C CA  . ILE B 65  ? 1.1756 1.4308 0.7505 -0.5843 -0.0346 0.1298  65  ILE B CA  
1290 C C   . ILE B 65  ? 1.2028 1.3788 0.8056 -0.5220 -0.0330 0.1177  65  ILE B C   
1291 O O   . ILE B 65  ? 1.2617 1.3198 0.8413 -0.5066 -0.0465 0.1221  65  ILE B O   
1292 C CB  . ILE B 65  ? 1.1841 1.4971 0.7884 -0.5590 -0.0195 0.1213  65  ILE B CB  
1293 C CG1 . ILE B 65  ? 1.1216 1.5521 0.7898 -0.5031 0.0039  0.0963  65  ILE B CG1 
1294 C CG2 . ILE B 65  ? 1.1875 1.3852 0.7861 -0.5249 -0.0257 0.1217  65  ILE B CG2 
1295 C CD1 . ILE B 65  ? 1.1132 1.6152 0.8058 -0.4768 0.0165  0.0850  65  ILE B CD1 
1296 N N   . THR B 66  ? 1.0542 1.2968 0.7020 -0.4855 -0.0179 0.1016  66  THR B N   
1297 C CA  . THR B 66  ? 1.0088 1.1834 0.6818 -0.4287 -0.0142 0.0908  66  THR B CA  
1298 C C   . THR B 66  ? 0.9919 1.1596 0.7005 -0.3763 0.0000  0.0782  66  THR B C   
1299 O O   . THR B 66  ? 0.9631 1.2027 0.6866 -0.3735 0.0099  0.0725  66  THR B O   
1300 C CB  . THR B 66  ? 1.0284 1.2623 0.7277 -0.4078 -0.0052 0.0788  66  THR B CB  
1301 O OG1 . THR B 66  ? 0.9677 1.3098 0.7045 -0.3755 0.0131  0.0612  66  THR B OG1 
1302 C CG2 . THR B 66  ? 0.9811 1.2384 0.6471 -0.4642 -0.0189 0.0897  66  THR B CG2 
1303 N N   . PHE B 67  ? 0.9238 1.0106 0.6437 -0.3366 0.0003  0.0730  67  PHE B N   
1304 C CA  . PHE B 67  ? 0.8986 0.9751 0.6482 -0.2929 0.0128  0.0613  67  PHE B CA  
1305 C C   . PHE B 67  ? 0.9238 1.0796 0.7046 -0.2595 0.0295  0.0454  67  PHE B C   
1306 O O   . PHE B 67  ? 0.8905 1.0709 0.6844 -0.2392 0.0371  0.0369  67  PHE B O   
1307 C CB  . PHE B 67  ? 0.9227 0.9131 0.6765 -0.2633 0.0102  0.0584  67  PHE B CB  
1308 C CG  . PHE B 67  ? 0.9828 0.8930 0.6996 -0.2823 -0.0101 0.0686  67  PHE B CG  
1309 C CD1 . PHE B 67  ? 1.0569 0.9169 0.7403 -0.2981 -0.0278 0.0761  67  PHE B CD1 
1310 C CD2 . PHE B 67  ? 0.9834 0.8618 0.6934 -0.2784 -0.0146 0.0683  67  PHE B CD2 
1311 C CE1 . PHE B 67  ? 1.1119 0.8855 0.7483 -0.3072 -0.0521 0.0825  67  PHE B CE1 
1312 C CE2 . PHE B 67  ? 1.0608 0.8601 0.7283 -0.2870 -0.0371 0.0742  67  PHE B CE2 
1313 C CZ  . PHE B 67  ? 1.0951 0.8394 0.7222 -0.3001 -0.0572 0.0810  67  PHE B CZ  
1314 N N   . LEU B 68  ? 0.8959 1.0928 0.6814 -0.2537 0.0322  0.0402  68  LEU B N   
1315 C CA  . LEU B 68  ? 0.8690 1.1405 0.6722 -0.2169 0.0430  0.0223  68  LEU B CA  
1316 C C   . LEU B 68  ? 0.8990 1.2701 0.7039 -0.2253 0.0457  0.0160  68  LEU B C   
1317 O O   . LEU B 68  ? 0.8961 1.2881 0.7097 -0.1854 0.0515  0.0012  68  LEU B O   
1318 C CB  . LEU B 68  ? 0.8706 1.1767 0.6732 -0.2155 0.0421  0.0183  68  LEU B CB  
1319 C CG  . LEU B 68  ? 0.9455 1.1680 0.7466 -0.2013 0.0400  0.0219  68  LEU B CG  
1320 C CD1 . LEU B 68  ? 0.9491 1.2178 0.7481 -0.2049 0.0379  0.0179  68  LEU B CD1 
1321 C CD2 . LEU B 68  ? 0.9866 1.1554 0.7975 -0.1511 0.0491  0.0117  68  LEU B CD2 
1322 N N   . GLU B 69  ? 0.8594 1.2882 0.6497 -0.2798 0.0396  0.0277  69  GLU B N   
1323 C CA  . GLU B 69  ? 0.8550 1.3959 0.6444 -0.2984 0.0423  0.0236  69  GLU B CA  
1324 C C   . GLU B 69  ? 0.8722 1.3807 0.6615 -0.2918 0.0434  0.0259  69  GLU B C   
1325 O O   . GLU B 69  ? 0.8539 1.4418 0.6522 -0.2702 0.0488  0.0124  69  GLU B O   
1326 C CB  . GLU B 69  ? 0.9118 1.5051 0.6761 -0.3723 0.0342  0.0407  69  GLU B CB  
1327 C CG  . GLU B 69  ? 1.0872 1.7315 0.8495 -0.3890 0.0318  0.0383  69  GLU B CG  
1328 C CD  . GLU B 69  ? 1.3643 2.0492 1.0928 -0.4722 0.0212  0.0572  69  GLU B CD  
1329 O OE1 . GLU B 69  ? 1.0942 1.7606 0.7929 -0.5225 0.0141  0.0749  69  GLU B OE1 
1330 O OE2 . GLU B 69  ? 1.3773 2.1102 1.1038 -0.4894 0.0185  0.0545  69  GLU B OE2 
1331 N N   . TYR B 70  ? 0.8191 1.2150 0.5959 -0.3074 0.0366  0.0410  70  TYR B N   
1332 C CA  . TYR B 70  ? 0.8118 1.1670 0.5867 -0.3029 0.0359  0.0436  70  TYR B CA  
1333 C C   . TYR B 70  ? 0.8310 1.1842 0.6304 -0.2432 0.0451  0.0241  70  TYR B C   
1334 O O   . TYR B 70  ? 0.7971 1.1949 0.5996 -0.2329 0.0477  0.0171  70  TYR B O   
1335 C CB  . TYR B 70  ? 0.8507 1.0855 0.6050 -0.3204 0.0243  0.0586  70  TYR B CB  
1336 C CG  . TYR B 70  ? 0.8790 1.0733 0.6314 -0.3127 0.0227  0.0591  70  TYR B CG  
1337 C CD1 . TYR B 70  ? 0.9235 1.1426 0.6517 -0.3496 0.0168  0.0697  70  TYR B CD1 
1338 C CD2 . TYR B 70  ? 0.8712 1.0061 0.6435 -0.2717 0.0269  0.0492  70  TYR B CD2 
1339 C CE1 . TYR B 70  ? 0.9155 1.0991 0.6416 -0.3398 0.0148  0.0689  70  TYR B CE1 
1340 C CE2 . TYR B 70  ? 0.8839 0.9886 0.6558 -0.2649 0.0250  0.0478  70  TYR B CE2 
1341 C CZ  . TYR B 70  ? 0.9631 1.0916 0.7130 -0.2959 0.0189  0.0570  70  TYR B CZ  
1342 O OH  . TYR B 70  ? 0.9159 1.0168 0.6645 -0.2871 0.0165  0.0547  70  TYR B OH  
1343 N N   . TYR B 71  ? 0.8016 1.0988 0.6116 -0.2064 0.0484  0.0160  71  TYR B N   
1344 C CA  . TYR B 71  ? 0.7981 1.0725 0.6171 -0.1572 0.0535  -0.0001 71  TYR B CA  
1345 C C   . TYR B 71  ? 0.8536 1.2130 0.6709 -0.1205 0.0554  -0.0201 71  TYR B C   
1346 O O   . TYR B 71  ? 0.8443 1.2043 0.6577 -0.0889 0.0546  -0.0328 71  TYR B O   
1347 C CB  . TYR B 71  ? 0.8213 1.0066 0.6431 -0.1373 0.0553  -0.0004 71  TYR B CB  
1348 C CG  . TYR B 71  ? 0.8688 0.9790 0.6922 -0.1576 0.0521  0.0116  71  TYR B CG  
1349 C CD1 . TYR B 71  ? 0.9070 0.9828 0.7231 -0.1839 0.0457  0.0243  71  TYR B CD1 
1350 C CD2 . TYR B 71  ? 0.8752 0.9526 0.7024 -0.1489 0.0527  0.0081  71  TYR B CD2 
1351 C CE1 . TYR B 71  ? 0.9211 0.9332 0.7317 -0.1942 0.0388  0.0311  71  TYR B CE1 
1352 C CE2 . TYR B 71  ? 0.8896 0.9115 0.7173 -0.1631 0.0482  0.0153  71  TYR B CE2 
1353 C CZ  . TYR B 71  ? 0.9918 0.9820 0.8102 -0.1822 0.0408  0.0256  71  TYR B CZ  
1354 O OH  . TYR B 71  ? 1.0432 0.9814 0.8558 -0.1868 0.0329  0.0285  71  TYR B OH  
1355 N N   . SER B 72  ? 0.8255 1.2609 0.6420 -0.1237 0.0556  -0.0246 72  SER B N   
1356 C CA  . SER B 72  ? 0.8275 1.3610 0.6391 -0.0838 0.0548  -0.0476 72  SER B CA  
1357 C C   . SER B 72  ? 0.8748 1.5091 0.6872 -0.0955 0.0545  -0.0521 72  SER B C   
1358 O O   . SER B 72  ? 0.8750 1.5416 0.6794 -0.0485 0.0512  -0.0724 72  SER B O   
1359 C CB  . SER B 72  ? 0.8369 1.4353 0.6492 -0.0855 0.0549  -0.0528 72  SER B CB  
1360 N N   . LYS B 73  ? 0.8474 1.5236 0.6621 -0.1582 0.0557  -0.0329 73  LYS B N   
1361 C CA  . LYS B 73  ? 0.8524 1.6310 0.6646 -0.1802 0.0563  -0.0336 73  LYS B CA  
1362 C C   . LYS B 73  ? 0.9207 1.6433 0.7315 -0.1683 0.0553  -0.0321 73  LYS B C   
1363 O O   . LYS B 73  ? 0.9418 1.7486 0.7512 -0.1511 0.0552  -0.0449 73  LYS B O   
1364 C CB  . LYS B 73  ? 0.8906 1.7142 0.6926 -0.2595 0.0556  -0.0103 73  LYS B CB  
1365 N N   . ASN B 74  ? 0.8664 1.4577 0.6773 -0.1763 0.0538  -0.0183 74  ASN B N   
1366 C CA  . ASN B 74  ? 0.8711 1.4088 0.6814 -0.1695 0.0523  -0.0166 74  ASN B CA  
1367 C C   . ASN B 74  ? 0.9096 1.3937 0.7216 -0.1104 0.0509  -0.0355 74  ASN B C   
1368 O O   . ASN B 74  ? 0.9175 1.4026 0.7272 -0.0956 0.0487  -0.0420 74  ASN B O   
1369 C CB  . ASN B 74  ? 0.9455 1.3817 0.7502 -0.2085 0.0489  0.0053  74  ASN B CB  
1370 C CG  . ASN B 74  ? 1.2982 1.7657 1.0828 -0.2702 0.0444  0.0254  74  ASN B CG  
1371 O OD1 . ASN B 74  ? 1.1348 1.6151 0.9070 -0.3067 0.0415  0.0369  74  ASN B OD1 
1372 N ND2 . ASN B 74  ? 1.2967 1.7738 1.0711 -0.2856 0.0422  0.0306  74  ASN B ND2 
1373 N N   . TYR B 75  ? 0.8352 1.2647 0.6454 -0.0802 0.0507  -0.0432 75  TYR B N   
1374 C CA  . TYR B 75  ? 0.8357 1.1938 0.6342 -0.0336 0.0465  -0.0579 75  TYR B CA  
1375 C C   . TYR B 75  ? 0.8890 1.2631 0.6658 0.0193  0.0407  -0.0796 75  TYR B C   
1376 O O   . TYR B 75  ? 0.9186 1.2280 0.6706 0.0584  0.0328  -0.0928 75  TYR B O   
1377 C CB  . TYR B 75  ? 0.8432 1.0858 0.6471 -0.0488 0.0490  -0.0454 75  TYR B CB  
1378 C CG  . TYR B 75  ? 0.8256 1.0412 0.6432 -0.0905 0.0506  -0.0281 75  TYR B CG  
1379 C CD1 . TYR B 75  ? 0.8343 1.0295 0.6576 -0.1266 0.0516  -0.0113 75  TYR B CD1 
1380 C CD2 . TYR B 75  ? 0.8275 1.0338 0.6456 -0.0901 0.0481  -0.0303 75  TYR B CD2 
1381 C CE1 . TYR B 75  ? 0.8482 1.0095 0.6715 -0.1578 0.0481  0.0020  75  TYR B CE1 
1382 C CE2 . TYR B 75  ? 0.8289 1.0074 0.6530 -0.1229 0.0471  -0.0166 75  TYR B CE2 
1383 C CZ  . TYR B 75  ? 0.9266 1.0805 0.7503 -0.1550 0.0460  -0.0010 75  TYR B CZ  
1384 O OH  . TYR B 75  ? 0.9589 1.0749 0.7767 -0.1800 0.0401  0.0099  75  TYR B OH  
1385 N N   . GLY B 76  ? 0.7994 1.2527 0.5788 0.0200  0.0423  -0.0837 76  GLY B N   
1386 C CA  . GLY B 76  ? 0.8149 1.2852 0.5695 0.0742  0.0349  -0.1060 76  GLY B CA  
1387 C C   . GLY B 76  ? 0.8915 1.2480 0.6328 0.0834  0.0346  -0.1011 76  GLY B C   
1388 O O   . GLY B 76  ? 0.9247 1.2484 0.6302 0.1337  0.0247  -0.1191 76  GLY B O   
1389 N N   . ILE B 77  ? 0.8239 1.1194 0.5879 0.0364  0.0437  -0.0776 77  ILE B N   
1390 C CA  . ILE B 77  ? 0.8321 1.0307 0.5896 0.0348  0.0461  -0.0696 77  ILE B CA  
1391 C C   . ILE B 77  ? 0.8903 1.1252 0.6588 0.0221  0.0502  -0.0643 77  ILE B C   
1392 O O   . ILE B 77  ? 0.8591 1.1445 0.6507 -0.0190 0.0544  -0.0513 77  ILE B O   
1393 C CB  . ILE B 77  ? 0.8561 0.9761 0.6300 -0.0017 0.0517  -0.0516 77  ILE B CB  
1394 C CG1 . ILE B 77  ? 0.8812 0.9607 0.6421 0.0108  0.0468  -0.0583 77  ILE B CG1 
1395 C CG2 . ILE B 77  ? 0.8634 0.9036 0.6338 -0.0077 0.0557  -0.0431 77  ILE B CG2 
1396 C CD1 . ILE B 77  ? 0.9472 0.9794 0.7288 -0.0248 0.0517  -0.0441 77  ILE B CD1 
1397 N N   . THR B 78  ? 0.8806 1.0797 0.6257 0.0557  0.0470  -0.0737 78  THR B N   
1398 C CA  . THR B 78  ? 0.8792 1.1020 0.6320 0.0487  0.0501  -0.0703 78  THR B CA  
1399 C C   . THR B 78  ? 0.9394 1.0630 0.6965 0.0278  0.0558  -0.0535 78  THR B C   
1400 O O   . THR B 78  ? 0.9612 1.0022 0.6925 0.0483  0.0541  -0.0561 78  THR B O   
1401 C CB  . THR B 78  ? 0.9893 1.2496 0.7113 0.1036  0.0415  -0.0941 78  THR B CB  
1402 O OG1 . THR B 78  ? 0.9983 1.3686 0.7195 0.1231  0.0361  -0.1116 78  THR B OG1 
1403 C CG2 . THR B 78  ? 0.9012 1.1893 0.6307 0.0994  0.0442  -0.0925 78  THR B CG2 
1404 N N   . VAL B 79  ? 0.8919 1.0231 0.6755 -0.0143 0.0605  -0.0367 79  VAL B N   
1405 C CA  . VAL B 79  ? 0.9007 0.9570 0.6908 -0.0323 0.0645  -0.0229 79  VAL B CA  
1406 C C   . VAL B 79  ? 0.9957 1.0407 0.7732 -0.0112 0.0648  -0.0272 79  VAL B C   
1407 O O   . VAL B 79  ? 0.9952 1.1006 0.7787 -0.0147 0.0629  -0.0295 79  VAL B O   
1408 C CB  . VAL B 79  ? 0.9299 0.9928 0.7404 -0.0768 0.0634  -0.0066 79  VAL B CB  
1409 C CG1 . VAL B 79  ? 0.9211 0.9154 0.7351 -0.0860 0.0647  0.0031  79  VAL B CG1 
1410 C CG2 . VAL B 79  ? 0.9203 0.9951 0.7371 -0.0948 0.0616  -0.0033 79  VAL B CG2 
1411 N N   . LYS B 80  ? 0.9951 0.9649 0.7509 0.0088  0.0667  -0.0288 80  LYS B N   
1412 C CA  . LYS B 80  ? 1.0201 0.9631 0.7547 0.0324  0.0664  -0.0329 80  LYS B CA  
1413 C C   . LYS B 80  ? 1.0676 0.9982 0.8219 0.0094  0.0709  -0.0200 80  LYS B C   
1414 O O   . LYS B 80  ? 1.0736 1.0335 0.8271 0.0189  0.0691  -0.0234 80  LYS B O   
1415 C CB  . LYS B 80  ? 1.1019 0.9596 0.7937 0.0555  0.0646  -0.0371 80  LYS B CB  
1416 N N   . GLU B 81  ? 1.0012 0.8931 0.7711 -0.0173 0.0750  -0.0077 81  GLU B N   
1417 C CA  . GLU B 81  ? 0.9684 0.8443 0.7513 -0.0326 0.0762  0.0019  81  GLU B CA  
1418 C C   . GLU B 81  ? 1.0233 0.9343 0.8255 -0.0601 0.0689  0.0088  81  GLU B C   
1419 O O   . GLU B 81  ? 1.0302 0.9310 0.8412 -0.0790 0.0662  0.0141  81  GLU B O   
1420 C CB  . GLU B 81  ? 0.9870 0.8103 0.7686 -0.0399 0.0822  0.0074  81  GLU B CB  
1421 N N   . GLU B 82  ? 0.9609 0.9096 0.7628 -0.0638 0.0636  0.0083  82  GLU B N   
1422 C CA  . GLU B 82  ? 0.9339 0.9085 0.7395 -0.0967 0.0531  0.0161  82  GLU B CA  
1423 C C   . GLU B 82  ? 0.9867 0.9111 0.7875 -0.1087 0.0442  0.0249  82  GLU B C   
1424 O O   . GLU B 82  ? 1.0065 0.9297 0.7962 -0.1369 0.0306  0.0323  82  GLU B O   
1425 C CB  . GLU B 82  ? 0.9385 0.9824 0.7414 -0.1016 0.0496  0.0111  82  GLU B CB  
1426 C CG  . GLU B 82  ? 1.0227 1.1328 0.8265 -0.0829 0.0547  -0.0021 82  GLU B CG  
1427 C CD  . GLU B 82  ? 1.2637 1.4661 1.0673 -0.0887 0.0510  -0.0102 82  GLU B CD  
1428 O OE1 . GLU B 82  ? 1.0891 1.3451 0.8885 -0.0540 0.0538  -0.0275 82  GLU B OE1 
1429 O OE2 . GLU B 82  ? 1.1441 1.3657 0.9465 -0.1272 0.0433  -0.0008 82  GLU B OE2 
1430 N N   . ASP B 83  ? 0.9434 0.8259 0.7457 -0.0883 0.0498  0.0236  83  ASP B N   
1431 C CA  . ASP B 83  ? 0.9621 0.8056 0.7581 -0.0891 0.0405  0.0276  83  ASP B CA  
1432 C C   . ASP B 83  ? 1.0198 0.8336 0.8196 -0.0856 0.0407  0.0272  83  ASP B C   
1433 O O   . ASP B 83  ? 1.0763 0.8648 0.8685 -0.0786 0.0312  0.0267  83  ASP B O   
1434 C CB  . ASP B 83  ? 0.9764 0.8116 0.7700 -0.0674 0.0453  0.0247  83  ASP B CB  
1435 N N   . GLN B 84  ? 0.8914 0.7133 0.7008 -0.0882 0.0495  0.0253  84  GLN B N   
1436 C CA  . GLN B 84  ? 0.8482 0.6562 0.6639 -0.0870 0.0507  0.0228  84  GLN B CA  
1437 C C   . GLN B 84  ? 0.8393 0.6304 0.6431 -0.0966 0.0314  0.0242  84  GLN B C   
1438 O O   . GLN B 84  ? 0.8455 0.6341 0.6346 -0.1143 0.0195  0.0300  84  GLN B O   
1439 C CB  . GLN B 84  ? 0.8464 0.6646 0.6707 -0.0897 0.0628  0.0201  84  GLN B CB  
1440 C CG  . GLN B 84  ? 0.8760 0.7127 0.7003 -0.1033 0.0578  0.0217  84  GLN B CG  
1441 C CD  . GLN B 84  ? 0.8958 0.7403 0.7236 -0.0995 0.0675  0.0172  84  GLN B CD  
1442 O OE1 . GLN B 84  ? 0.8593 0.6937 0.6925 -0.1026 0.0705  0.0146  84  GLN B OE1 
1443 N NE2 . GLN B 84  ? 0.8044 0.6690 0.6254 -0.0906 0.0704  0.0143  84  GLN B NE2 
1444 N N   . PRO B 85  ? 0.7680 0.5483 0.5715 -0.0859 0.0262  0.0181  85  PRO B N   
1445 C CA  . PRO B 85  ? 0.8023 0.5560 0.5828 -0.0883 0.0038  0.0170  85  PRO B CA  
1446 C C   . PRO B 85  ? 0.9226 0.6843 0.7080 -0.1025 0.0055  0.0179  85  PRO B C   
1447 O O   . PRO B 85  ? 0.9092 0.6976 0.7157 -0.1098 0.0230  0.0190  85  PRO B O   
1448 C CB  . PRO B 85  ? 0.8344 0.5893 0.6146 -0.0623 -0.0011 0.0052  85  PRO B CB  
1449 C CG  . PRO B 85  ? 0.8658 0.6605 0.6778 -0.0611 0.0246  0.0017  85  PRO B CG  
1450 C CD  . PRO B 85  ? 0.7878 0.5840 0.6066 -0.0722 0.0393  0.0107  85  PRO B CD  
1451 N N   . LEU B 86  ? 0.9136 0.6465 0.6734 -0.1030 -0.0148 0.0162  86  LEU B N   
1452 C CA  . LEU B 86  ? 0.9221 0.6602 0.6835 -0.1145 -0.0148 0.0165  86  LEU B CA  
1453 C C   . LEU B 86  ? 0.9635 0.7041 0.7277 -0.0933 -0.0199 0.0028  86  LEU B C   
1454 O O   . LEU B 86  ? 1.0096 0.7304 0.7525 -0.0705 -0.0371 -0.0061 86  LEU B O   
1455 C CB  . LEU B 86  ? 0.9752 0.6779 0.6961 -0.1396 -0.0353 0.0276  86  LEU B CB  
1456 C CG  . LEU B 86  ? 1.0442 0.7591 0.7586 -0.1672 -0.0328 0.0402  86  LEU B CG  
1457 C CD1 . LEU B 86  ? 1.0985 0.7885 0.7720 -0.2005 -0.0508 0.0517  86  LEU B CD1 
1458 C CD2 . LEU B 86  ? 1.0388 0.8150 0.7950 -0.1684 -0.0058 0.0394  86  LEU B CD2 
1459 N N   . LEU B 87  ? 0.8643 0.6329 0.6520 -0.0982 -0.0071 -0.0009 87  LEU B N   
1460 C CA  . LEU B 87  ? 0.8348 0.6195 0.6288 -0.0811 -0.0108 -0.0157 87  LEU B CA  
1461 C C   . LEU B 87  ? 0.9108 0.6597 0.6710 -0.0820 -0.0328 -0.0154 87  LEU B C   
1462 O O   . LEU B 87  ? 0.8847 0.6232 0.6384 -0.1053 -0.0315 -0.0039 87  LEU B O   
1463 C CB  . LEU B 87  ? 0.7959 0.6248 0.6276 -0.0897 0.0129  -0.0200 87  LEU B CB  
1464 C CG  . LEU B 87  ? 0.7951 0.6453 0.6485 -0.0966 0.0347  -0.0172 87  LEU B CG  
1465 C CD1 . LEU B 87  ? 0.7473 0.6186 0.6194 -0.1102 0.0507  -0.0199 87  LEU B CD1 
1466 C CD2 . LEU B 87  ? 0.7986 0.6679 0.6544 -0.0811 0.0351  -0.0251 87  LEU B CD2 
1467 N N   . ILE B 88  ? 0.9176 0.6479 0.6501 -0.0544 -0.0551 -0.0292 88  ILE B N   
1468 C CA  . ILE B 88  ? 0.9420 0.6229 0.6274 -0.0488 -0.0819 -0.0310 88  ILE B CA  
1469 C C   . ILE B 88  ? 0.9706 0.6887 0.6739 -0.0321 -0.0797 -0.0479 88  ILE B C   
1470 O O   . ILE B 88  ? 0.9427 0.7104 0.6683 -0.0066 -0.0755 -0.0668 88  ILE B O   
1471 C CB  . ILE B 88  ? 1.0551 0.6701 0.6771 -0.0229 -0.1175 -0.0368 88  ILE B CB  
1472 C CG1 . ILE B 88  ? 1.0822 0.6598 0.6842 -0.0417 -0.1216 -0.0208 88  ILE B CG1 
1473 C CG2 . ILE B 88  ? 1.1125 0.6569 0.6684 -0.0170 -0.1503 -0.0380 88  ILE B CG2 
1474 N N   . HIS B 89  ? 0.9415 0.6407 0.6322 -0.0474 -0.0836 -0.0418 89  HIS B N   
1475 C CA  . HIS B 89  ? 0.9355 0.6585 0.6332 -0.0318 -0.0866 -0.0572 89  HIS B CA  
1476 C C   . HIS B 89  ? 1.0839 0.7303 0.7108 -0.0220 -0.1210 -0.0563 89  HIS B C   
1477 O O   . HIS B 89  ? 1.1053 0.7008 0.6985 -0.0524 -0.1280 -0.0359 89  HIS B O   
1478 C CB  . HIS B 89  ? 0.8884 0.6546 0.6316 -0.0581 -0.0603 -0.0512 89  HIS B CB  
1479 C CG  . HIS B 89  ? 0.9367 0.7139 0.6777 -0.0472 -0.0672 -0.0636 89  HIS B CG  
1480 N ND1 . HIS B 89  ? 0.9485 0.7749 0.7082 -0.0205 -0.0682 -0.0876 89  HIS B ND1 
1481 C CD2 . HIS B 89  ? 0.9712 0.7223 0.6923 -0.0600 -0.0735 -0.0558 89  HIS B CD2 
1482 C CE1 . HIS B 89  ? 0.9428 0.7682 0.6951 -0.0163 -0.0752 -0.0942 89  HIS B CE1 
1483 N NE2 . HIS B 89  ? 0.9614 0.7390 0.6901 -0.0391 -0.0784 -0.0750 89  HIS B NE2 
1484 N N   . ARG B 90  ? 1.1102 0.7478 0.7071 0.0206  -0.1449 -0.0789 90  ARG B N   
1485 C CA  . ARG B 90  ? 1.2143 0.7662 0.7305 0.0372  -0.1829 -0.0812 90  ARG B CA  
1486 C C   . ARG B 90  ? 1.3026 0.8817 0.8293 0.0470  -0.1819 -0.0933 90  ARG B C   
1487 O O   . ARG B 90  ? 1.2931 0.9360 0.8475 0.0825  -0.1803 -0.1199 90  ARG B O   
1488 C CB  . ARG B 90  ? 1.2718 0.7748 0.7257 0.0868  -0.2197 -0.1001 90  ARG B CB  
1489 C CG  . ARG B 90  ? 1.3922 0.8547 0.8266 0.0743  -0.2244 -0.0861 90  ARG B CG  
1490 C CD  . ARG B 90  ? 1.4747 0.8600 0.8257 0.1218  -0.2692 -0.1018 90  ARG B CD  
1491 N NE  . ARG B 90  ? 1.5045 0.8795 0.8580 0.1142  -0.2666 -0.0931 90  ARG B NE  
1492 C CZ  . ARG B 90  ? 1.6211 1.0650 1.0144 0.1468  -0.2565 -0.1108 90  ARG B CZ  
1493 N NH1 . ARG B 90  ? 1.5431 1.0778 0.9761 0.1865  -0.2485 -0.1388 90  ARG B NH1 
1494 N NH2 . ARG B 90  ? 1.4229 0.8511 0.8151 0.1382  -0.2548 -0.1012 90  ARG B NH2 
1495 N N   . PRO B 91  ? 1.2797 0.8256 0.7906 0.0132  -0.1799 -0.0747 91  PRO B N   
1496 C CA  . PRO B 91  ? 1.2784 0.8460 0.7961 0.0241  -0.1804 -0.0864 91  PRO B CA  
1497 C C   . PRO B 91  ? 1.4033 0.8983 0.8374 0.0668  -0.2233 -0.1030 91  PRO B C   
1498 O O   . PRO B 91  ? 1.4007 0.9344 0.8396 0.1162  -0.2342 -0.1332 91  PRO B O   
1499 C CB  . PRO B 91  ? 1.2866 0.8424 0.8090 -0.0253 -0.1655 -0.0600 91  PRO B CB  
1500 C CG  . PRO B 91  ? 1.3428 0.8696 0.8530 -0.0617 -0.1608 -0.0356 91  PRO B CG  
1501 C CD  . PRO B 91  ? 1.3221 0.8138 0.8024 -0.0353 -0.1798 -0.0441 91  PRO B CD  
1502 N N   . GLY B 104 ? 1.6316 0.7993 0.8133 -0.1426 -0.2722 0.0249  104 GLY B N   
1503 C CA  . GLY B 104 ? 1.6024 0.7880 0.8058 -0.1705 -0.2601 0.0379  104 GLY B CA  
1504 C C   . GLY B 104 ? 1.5137 0.8175 0.8312 -0.1536 -0.2189 0.0263  104 GLY B C   
1505 O O   . GLY B 104 ? 1.4227 0.8067 0.8092 -0.1471 -0.1912 0.0188  104 GLY B O   
1506 N N   . GLU B 105 ? 1.4595 0.7660 0.7894 -0.1478 -0.2171 0.0254  105 GLU B N   
1507 C CA  . GLU B 105 ? 1.3525 0.7508 0.7726 -0.1324 -0.1836 0.0160  105 GLU B CA  
1508 C C   . GLU B 105 ? 1.3209 0.8095 0.8157 -0.1640 -0.1441 0.0263  105 GLU B C   
1509 O O   . GLU B 105 ? 1.3194 0.8098 0.8000 -0.2086 -0.1401 0.0463  105 GLU B O   
1510 C CB  . GLU B 105 ? 1.3873 0.7547 0.7874 -0.1345 -0.1932 0.0208  105 GLU B CB  
1511 C CG  . GLU B 105 ? 1.5408 0.8582 0.9007 -0.0829 -0.2219 0.0008  105 GLU B CG  
1512 C CD  . GLU B 105 ? 1.8825 1.1755 1.2282 -0.0852 -0.2290 0.0056  105 GLU B CD  
1513 O OE1 . GLU B 105 ? 1.8167 1.1005 1.1550 -0.1339 -0.2231 0.0276  105 GLU B OE1 
1514 O OE2 . GLU B 105 ? 1.8785 1.1681 1.2195 -0.0375 -0.2412 -0.0141 105 GLU B OE2 
1515 N N   . ILE B 106 ? 1.1963 0.7612 0.7656 -0.1407 -0.1167 0.0116  106 ILE B N   
1516 C CA  . ILE B 106 ? 1.1027 0.7428 0.7356 -0.1598 -0.0830 0.0172  106 ILE B CA  
1517 C C   . ILE B 106 ? 1.0798 0.7451 0.7449 -0.1528 -0.0691 0.0157  106 ILE B C   
1518 O O   . ILE B 106 ? 1.0552 0.7204 0.7293 -0.1231 -0.0719 0.0017  106 ILE B O   
1519 C CB  . ILE B 106 ? 1.0912 0.7811 0.7691 -0.1460 -0.0661 0.0047  106 ILE B CB  
1520 C CG1 . ILE B 106 ? 1.1239 0.7930 0.7696 -0.1584 -0.0778 0.0097  106 ILE B CG1 
1521 C CG2 . ILE B 106 ? 1.0198 0.7732 0.7544 -0.1548 -0.0359 0.0060  106 ILE B CG2 
1522 N N   . LEU B 107 ? 1.0007 0.6905 0.6780 -0.1788 -0.0561 0.0289  107 LEU B N   
1523 C CA  . LEU B 107 ? 0.9662 0.6758 0.6683 -0.1729 -0.0440 0.0285  107 LEU B CA  
1524 C C   . LEU B 107 ? 0.9419 0.7129 0.6951 -0.1723 -0.0157 0.0260  107 LEU B C   
1525 O O   . LEU B 107 ? 0.9415 0.7441 0.7006 -0.1899 -0.0076 0.0323  107 LEU B O   
1526 C CB  . LEU B 107 ? 1.0060 0.6865 0.6702 -0.1984 -0.0574 0.0429  107 LEU B CB  
1527 C CG  . LEU B 107 ? 1.1294 0.7261 0.7262 -0.1970 -0.0918 0.0451  107 LEU B CG  
1528 C CD1 . LEU B 107 ? 1.1521 0.7203 0.7057 -0.2358 -0.1052 0.0623  107 LEU B CD1 
1529 C CD2 . LEU B 107 ? 1.1924 0.7706 0.7926 -0.1563 -0.0987 0.0301  107 LEU B CD2 
1530 N N   . LEU B 108 ? 0.8514 0.6380 0.6348 -0.1509 -0.0029 0.0156  108 LEU B N   
1531 C CA  . LEU B 108 ? 0.8018 0.6254 0.6198 -0.1470 0.0195  0.0119  108 LEU B CA  
1532 C C   . LEU B 108 ? 0.8426 0.6696 0.6686 -0.1407 0.0283  0.0131  108 LEU B C   
1533 O O   . LEU B 108 ? 0.8486 0.6572 0.6660 -0.1321 0.0207  0.0119  108 LEU B O   
1534 C CB  . LEU B 108 ? 0.7765 0.6118 0.6151 -0.1356 0.0271  -0.0005 108 LEU B CB  
1535 C CG  . LEU B 108 ? 0.8264 0.6576 0.6576 -0.1352 0.0166  -0.0055 108 LEU B CG  
1536 C CD1 . LEU B 108 ? 0.8130 0.6605 0.6614 -0.1222 0.0197  -0.0205 108 LEU B CD1 
1537 C CD2 . LEU B 108 ? 0.7976 0.6434 0.6301 -0.1475 0.0209  -0.0007 108 LEU B CD2 
1538 N N   . LEU B 109 ? 0.7935 0.6421 0.6315 -0.1403 0.0424  0.0136  109 LEU B N   
1539 C CA  . LEU B 109 ? 0.7771 0.6259 0.6182 -0.1317 0.0510  0.0140  109 LEU B CA  
1540 C C   . LEU B 109 ? 0.8136 0.6547 0.6644 -0.1231 0.0622  0.0073  109 LEU B C   
1541 O O   . LEU B 109 ? 0.8155 0.6581 0.6693 -0.1244 0.0680  0.0029  109 LEU B O   
1542 C CB  . LEU B 109 ? 0.7754 0.6498 0.6134 -0.1308 0.0563  0.0157  109 LEU B CB  
1543 C CG  . LEU B 109 ? 0.8480 0.7505 0.6760 -0.1478 0.0478  0.0225  109 LEU B CG  
1544 C CD1 . LEU B 109 ? 0.8474 0.7921 0.6753 -0.1396 0.0539  0.0192  109 LEU B CD1 
1545 C CD2 . LEU B 109 ? 0.8964 0.7774 0.7095 -0.1610 0.0354  0.0304  109 LEU B CD2 
1546 N N   . PRO B 110 ? 0.7696 0.6026 0.6210 -0.1170 0.0649  0.0068  110 PRO B N   
1547 C CA  . PRO B 110 ? 0.7600 0.5905 0.6148 -0.1177 0.0766  0.0023  110 PRO B CA  
1548 C C   . PRO B 110 ? 0.8213 0.6338 0.6623 -0.1186 0.0853  0.0030  110 PRO B C   
1549 O O   . PRO B 110 ? 0.8380 0.6391 0.6726 -0.1283 0.0911  0.0001  110 PRO B O   
1550 C CB  . PRO B 110 ? 0.7818 0.6120 0.6351 -0.1100 0.0773  0.0035  110 PRO B CB  
1551 C CG  . PRO B 110 ? 0.8376 0.6657 0.6871 -0.1033 0.0616  0.0050  110 PRO B CG  
1552 C CD  . PRO B 110 ? 0.7901 0.6157 0.6341 -0.1118 0.0560  0.0102  110 PRO B CD  
1553 N N   . GLU B 111 ? 0.7785 0.5881 0.6087 -0.1079 0.0836  0.0055  111 GLU B N   
1554 C CA  . GLU B 111 ? 0.8022 0.5918 0.6085 -0.0967 0.0859  0.0026  111 GLU B CA  
1555 C C   . GLU B 111 ? 0.8876 0.6735 0.6881 -0.0981 0.0831  -0.0029 111 GLU B C   
1556 O O   . GLU B 111 ? 0.9117 0.6620 0.6827 -0.0912 0.0824  -0.0070 111 GLU B O   
1557 C CB  . GLU B 111 ? 0.8167 0.6291 0.6186 -0.0808 0.0820  0.0024  111 GLU B CB  
1558 C CG  . GLU B 111 ? 0.9591 0.7563 0.7299 -0.0570 0.0804  -0.0049 111 GLU B CG  
1559 C CD  . GLU B 111 ? 1.2525 1.0908 1.0210 -0.0388 0.0766  -0.0090 111 GLU B CD  
1560 O OE1 . GLU B 111 ? 1.1667 1.0235 0.9489 -0.0456 0.0773  -0.0035 111 GLU B OE1 
1561 O OE2 . GLU B 111 ? 1.2997 1.1530 1.0484 -0.0154 0.0713  -0.0196 111 GLU B OE2 
1562 N N   . LEU B 112 ? 0.8411 0.6563 0.6623 -0.1060 0.0791  -0.0030 112 LEU B N   
1563 C CA  . LEU B 112 ? 0.8343 0.6517 0.6526 -0.1060 0.0759  -0.0086 112 LEU B CA  
1564 C C   . LEU B 112 ? 0.8411 0.6528 0.6721 -0.1230 0.0772  -0.0107 112 LEU B C   
1565 O O   . LEU B 112 ? 0.8371 0.6495 0.6673 -0.1246 0.0741  -0.0157 112 LEU B O   
1566 C CB  . LEU B 112 ? 0.8175 0.6781 0.6451 -0.1036 0.0702  -0.0078 112 LEU B CB  
1567 C CG  . LEU B 112 ? 0.8652 0.7567 0.6865 -0.0929 0.0688  -0.0066 112 LEU B CG  
1568 C CD1 . LEU B 112 ? 0.8404 0.7820 0.6698 -0.1043 0.0639  -0.0032 112 LEU B CD1 
1569 C CD2 . LEU B 112 ? 0.9144 0.7983 0.7102 -0.0658 0.0679  -0.0166 112 LEU B CD2 
1570 N N   . SER B 113 ? 0.7835 0.5954 0.6246 -0.1332 0.0813  -0.0091 113 SER B N   
1571 C CA  . SER B 113 ? 0.7715 0.5979 0.6273 -0.1467 0.0822  -0.0143 113 SER B CA  
1572 C C   . SER B 113 ? 0.8620 0.6744 0.7058 -0.1641 0.0903  -0.0158 113 SER B C   
1573 O O   . SER B 113 ? 0.8838 0.6788 0.7129 -0.1659 0.0956  -0.0109 113 SER B O   
1574 C CB  . SER B 113 ? 0.7935 0.6454 0.6660 -0.1415 0.0768  -0.0148 113 SER B CB  
1575 O OG  . SER B 113 ? 0.8343 0.6874 0.7055 -0.1343 0.0669  -0.0107 113 SER B OG  
1576 N N   . PHE B 114 ? 0.8245 0.6452 0.6712 -0.1806 0.0906  -0.0223 114 PHE B N   
1577 C CA  . PHE B 114 ? 0.8517 0.6609 0.6804 -0.2091 0.0968  -0.0232 114 PHE B CA  
1578 C C   . PHE B 114 ? 0.9365 0.8037 0.7909 -0.2257 0.0992  -0.0327 114 PHE B C   
1579 O O   . PHE B 114 ? 0.9245 0.8180 0.7989 -0.2172 0.0933  -0.0408 114 PHE B O   
1580 C CB  . PHE B 114 ? 0.9034 0.6561 0.6952 -0.2174 0.0915  -0.0233 114 PHE B CB  
1581 C CG  . PHE B 114 ? 0.9237 0.6233 0.6819 -0.1940 0.0864  -0.0185 114 PHE B CG  
1582 C CD1 . PHE B 114 ? 0.8698 0.5825 0.6396 -0.1638 0.0807  -0.0204 114 PHE B CD1 
1583 C CD2 . PHE B 114 ? 0.9876 0.6286 0.6981 -0.2022 0.0862  -0.0131 114 PHE B CD2 
1584 C CE1 . PHE B 114 ? 0.8860 0.5692 0.6272 -0.1386 0.0757  -0.0198 114 PHE B CE1 
1585 C CE2 . PHE B 114 ? 1.0247 0.6216 0.7012 -0.1723 0.0791  -0.0124 114 PHE B CE2 
1586 C CZ  . PHE B 114 ? 0.9413 0.5666 0.6363 -0.1389 0.0741  -0.0172 114 PHE B CZ  
1587 N N   . MET B 115 ? 0.9537 0.8451 0.8041 -0.2499 0.1075  -0.0328 115 MET B N   
1588 C CA  . MET B 115 ? 0.9678 0.9337 0.8410 -0.2678 0.1109  -0.0449 115 MET B CA  
1589 C C   . MET B 115 ? 1.0668 1.0304 0.9309 -0.2975 0.1095  -0.0503 115 MET B C   
1590 O O   . MET B 115 ? 1.1096 1.0048 0.9351 -0.3180 0.1079  -0.0421 115 MET B O   
1591 C CB  . MET B 115 ? 1.0205 1.0233 0.8886 -0.2894 0.1216  -0.0428 115 MET B CB  
1592 C CG  . MET B 115 ? 1.0592 1.0522 0.9299 -0.2603 0.1220  -0.0366 115 MET B CG  
1593 S SD  . MET B 115 ? 1.0888 1.1692 0.9949 -0.2269 0.1173  -0.0519 115 MET B SD  
1594 C CE  . MET B 115 ? 1.0217 1.1185 0.9480 -0.2022 0.1027  -0.0656 115 MET B CE  
1595 N N   . THR B 116 ? 1.0240 1.0579 0.9183 -0.2961 0.1070  -0.0657 116 THR B N   
1596 C CA  . THR B 116 ? 1.0516 1.0965 0.9426 -0.3242 0.1048  -0.0736 116 THR B CA  
1597 C C   . THR B 116 ? 1.1823 1.3213 1.0871 -0.3585 0.1126  -0.0855 116 THR B C   
1598 O O   . THR B 116 ? 1.2234 1.3549 1.1001 -0.4070 0.1200  -0.0781 116 THR B O   
1599 C CB  . THR B 116 ? 0.9373 0.9879 0.8498 -0.2923 0.0940  -0.0834 116 THR B CB  
1600 O OG1 . THR B 116 ? 0.9318 1.0506 0.8749 -0.2615 0.0899  -0.0965 116 THR B OG1 
1601 C CG2 . THR B 116 ? 0.7618 0.7356 0.6595 -0.2654 0.0873  -0.0723 116 THR B CG2 
1602 N N   . GLY B 117 ? 1.1451 1.3723 1.0871 -0.3309 0.1091  -0.1040 117 GLY B N   
1603 C CA  . GLY B 117 ? 1.1449 1.4915 1.1090 -0.3482 0.1136  -0.1233 117 GLY B CA  
1604 C C   . GLY B 117 ? 1.2021 1.5962 1.1906 -0.3235 0.1025  -0.1441 117 GLY B C   
1605 O O   . GLY B 117 ? 1.2230 1.5685 1.2031 -0.3351 0.0980  -0.1414 117 GLY B O   
1606 N N   . ILE B 118 ? 1.1343 1.6139 1.1471 -0.2813 0.0949  -0.1659 118 ILE B N   
1607 C CA  . ILE B 118 ? 1.4399 1.9725 1.4705 -0.2474 0.0810  -0.1902 118 ILE B CA  
1608 C C   . ILE B 118 ? 1.6431 2.2452 1.6825 -0.1907 0.0685  -0.2119 118 ILE B C   
1609 O O   . ILE B 118 ? 1.1032 1.7038 1.1405 -0.1419 0.0498  -0.2276 118 ILE B O   
1610 C CB  . ILE B 118 ? 1.4763 1.9141 1.4972 -0.2269 0.0700  -0.1817 118 ILE B CB  
1611 N N   . ARG C 1   ? 2.2050 1.4604 1.3368 -0.6472 -0.2728 0.2937  1   ARG C N   
1612 C CA  . ARG C 1   ? 2.1417 1.3822 1.3043 -0.5521 -0.2292 0.2356  1   ARG C CA  
1613 C C   . ARG C 1   ? 2.2308 1.3618 1.3405 -0.5054 -0.2362 0.2013  1   ARG C C   
1614 O O   . ARG C 1   ? 2.1992 1.3586 1.3283 -0.5229 -0.2340 0.2079  1   ARG C O   
1616 N N   . ASN C 2   ? 2.2352 1.2443 1.2743 -0.4422 -0.2449 0.1662  2   ASN C N   
1617 C CA  . ASN C 2   ? 2.2698 1.1653 1.2420 -0.3764 -0.2515 0.1302  2   ASN C CA  
1618 C C   . ASN C 2   ? 2.2264 1.1106 1.2038 -0.2904 -0.2227 0.0924  2   ASN C C   
1619 O O   . ASN C 2   ? 2.2741 1.0807 1.1984 -0.2205 -0.2227 0.0625  2   ASN C O   
1620 C CB  . ASN C 2   ? 2.4682 1.1675 1.2793 -0.4080 -0.3266 0.1447  2   ASN C CB  
1621 N N   . ASP C 3   ? 2.0296 1.0028 1.0736 -0.2956 -0.1978 0.0972  3   ASP C N   
1622 C CA  . ASP C 3   ? 1.9546 0.9396 1.0165 -0.2309 -0.1716 0.0710  3   ASP C CA  
1623 C C   . ASP C 3   ? 1.7538 0.8607 0.9264 -0.1704 -0.1127 0.0441  3   ASP C C   
1624 O O   . ASP C 3   ? 1.6427 0.8446 0.8949 -0.1829 -0.0862 0.0459  3   ASP C O   
1625 C CB  . ASP C 3   ? 1.9587 0.9916 1.0477 -0.2696 -0.1720 0.0911  3   ASP C CB  
1626 N N   . CYS C 4   ? 1.6145 0.7168 0.7871 -0.1068 -0.0955 0.0220  4   CYS C N   
1627 C CA  . CYS C 4   ? 1.4652 0.6697 0.7277 -0.0489 -0.0484 0.0010  4   CYS C CA  
1628 C C   . CYS C 4   ? 1.3614 0.7091 0.7440 -0.0794 -0.0134 0.0096  4   CYS C C   
1629 O O   . CYS C 4   ? 1.3532 0.7141 0.7404 -0.1086 -0.0189 0.0221  4   CYS C O   
1630 C CB  . CYS C 4   ? 1.4975 0.6524 0.7116 0.0185  -0.0488 -0.0159 4   CYS C CB  
1631 S SG  . CYS C 4   ? 1.4001 0.6931 0.7269 0.0785  0.0032  -0.0306 4   CYS C SG  
1632 N N   . VAL C 5   ? 1.1900 0.6379 0.6608 -0.0713 0.0193  0.0034  5   VAL C N   
1633 C CA  . VAL C 5   ? 1.0538 0.6284 0.6270 -0.0910 0.0500  0.0085  5   VAL C CA  
1634 C C   . VAL C 5   ? 1.0792 0.6901 0.6836 -0.0695 0.0635  0.0036  5   VAL C C   
1635 O O   . VAL C 5   ? 1.0814 0.7466 0.7200 -0.0993 0.0690  0.0155  5   VAL C O   
1636 C CB  . VAL C 5   ? 1.0067 0.6575 0.6506 -0.0717 0.0781  -0.0025 5   VAL C CB  
1637 C CG1 . VAL C 5   ? 0.9059 0.6712 0.6406 -0.0793 0.1062  -0.0014 5   VAL C CG1 
1638 C CG2 . VAL C 5   ? 1.0147 0.6402 0.6345 -0.1011 0.0657  0.0051  5   VAL C CG2 
1639 N N   . LEU C 6   ? 1.0084 0.5934 0.5979 -0.0164 0.0678  -0.0114 6   LEU C N   
1640 C CA  . LEU C 6   ? 0.9543 0.5705 0.5701 0.0039  0.0782  -0.0145 6   LEU C CA  
1641 C C   . LEU C 6   ? 1.0537 0.6141 0.6164 -0.0250 0.0561  -0.0036 6   LEU C C   
1642 O O   . LEU C 6   ? 0.9967 0.6095 0.6006 -0.0373 0.0661  0.0012  6   LEU C O   
1643 C CB  . LEU C 6   ? 0.9570 0.5645 0.5623 0.0660  0.0850  -0.0264 6   LEU C CB  
1644 C CG  . LEU C 6   ? 0.9264 0.5943 0.5816 0.0875  0.1003  -0.0273 6   LEU C CG  
1645 N N   . ASP C 7   ? 1.1307 0.5818 0.5979 -0.0379 0.0231  0.0017  7   ASP C N   
1646 C CA  . ASP C 7   ? 1.2015 0.5894 0.6084 -0.0724 -0.0048 0.0160  7   ASP C CA  
1647 C C   . ASP C 7   ? 1.2053 0.6650 0.6581 -0.1351 -0.0030 0.0400  7   ASP C C   
1648 O O   . ASP C 7   ? 1.1942 0.6786 0.6579 -0.1521 -0.0033 0.0503  7   ASP C O   
1649 C CB  . ASP C 7   ? 1.3735 0.6151 0.6557 -0.0766 -0.0486 0.0187  7   ASP C CB  
1650 C CG  . ASP C 7   ? 1.6405 0.7984 0.8510 -0.0060 -0.0561 -0.0024 7   ASP C CG  
1651 O OD1 . ASP C 7   ? 1.6095 0.8160 0.8581 0.0374  -0.0328 -0.0134 7   ASP C OD1 
1652 O OD2 . ASP C 7   ? 1.8625 0.9061 0.9730 0.0081  -0.0873 -0.0062 7   ASP C OD2 
1653 N N   . VAL C 8   ? 1.1601 0.6633 0.6420 -0.1643 0.0011  0.0498  8   VAL C N   
1654 C CA  . VAL C 8   ? 1.1410 0.7334 0.6694 -0.2164 0.0064  0.0757  8   VAL C CA  
1655 C C   . VAL C 8   ? 1.1295 0.8324 0.7434 -0.1939 0.0417  0.0684  8   VAL C C   
1656 O O   . VAL C 8   ? 1.1250 0.8768 0.7532 -0.2177 0.0419  0.0867  8   VAL C O   
1657 C CB  . VAL C 8   ? 1.1842 0.8039 0.7273 -0.2409 0.0069  0.0843  8   VAL C CB  
1658 C CG1 . VAL C 8   ? 1.1316 0.8632 0.7256 -0.2860 0.0162  0.1134  8   VAL C CG1 
1659 C CG2 . VAL C 8   ? 1.3001 0.7959 0.7467 -0.2647 -0.0347 0.0926  8   VAL C CG2 
1660 N N   . MET C 9   ? 1.0349 0.7690 0.6966 -0.1467 0.0672  0.0434  9   MET C N   
1661 C CA  . MET C 9   ? 0.9529 0.7677 0.6819 -0.1211 0.0935  0.0337  9   MET C CA  
1662 C C   . MET C 9   ? 0.9913 0.7863 0.7061 -0.1095 0.0892  0.0326  9   MET C C   
1663 O O   . MET C 9   ? 0.9239 0.7809 0.6739 -0.1118 0.1001  0.0378  9   MET C O   
1664 C CB  . MET C 9   ? 0.9362 0.7705 0.7057 -0.0794 0.1118  0.0120  9   MET C CB  
1665 C CG  . MET C 9   ? 0.9489 0.8298 0.7530 -0.0877 0.1232  0.0115  9   MET C CG  
1666 S SD  . MET C 9   ? 0.9603 0.8696 0.8135 -0.0431 0.1414  -0.0090 9   MET C SD  
1667 C CE  . MET C 9   ? 0.9014 0.8491 0.7897 -0.0234 0.1486  -0.0130 9   MET C CE  
1668 N N   . HIS C 10  ? 1.0341 0.7409 0.6912 -0.0931 0.0725  0.0257  10  HIS C N   
1669 C CA  . HIS C 10  ? 1.0621 0.7412 0.6982 -0.0809 0.0667  0.0242  10  HIS C CA  
1670 C C   . HIS C 10  ? 1.1431 0.8296 0.7603 -0.1256 0.0529  0.0474  10  HIS C C   
1671 O O   . HIS C 10  ? 1.1048 0.8263 0.7442 -0.1204 0.0605  0.0491  10  HIS C O   
1672 C CB  . HIS C 10  ? 1.1617 0.7402 0.7259 -0.0509 0.0490  0.0135  10  HIS C CB  
1673 C CG  . HIS C 10  ? 1.1854 0.7771 0.7718 0.0038  0.0650  -0.0046 10  HIS C CG  
1674 N ND1 . HIS C 10  ? 1.1275 0.8088 0.7949 0.0214  0.0899  -0.0101 10  HIS C ND1 
1675 C CD2 . HIS C 10  ? 1.2748 0.8032 0.8065 0.0444  0.0562  -0.0142 10  HIS C CD2 
1676 C CE1 . HIS C 10  ? 1.1264 0.8066 0.7939 0.0651  0.0957  -0.0187 10  HIS C CE1 
1677 N NE2 . HIS C 10  ? 1.2136 0.8088 0.8015 0.0851  0.0785  -0.0219 10  HIS C NE2 
1678 N N   . ALA C 11  ? 1.1503 0.8094 0.7270 -0.1717 0.0310  0.0688  11  ALA C N   
1679 C CA  . ALA C 11  ? 1.1555 0.8352 0.7145 -0.2231 0.0141  0.1007  11  ALA C CA  
1680 C C   . ALA C 11  ? 1.1303 0.9418 0.7635 -0.2284 0.0403  0.1128  11  ALA C C   
1681 O O   . ALA C 11  ? 1.1170 0.9688 0.7564 -0.2396 0.0402  0.1287  11  ALA C O   
1682 C CB  . ALA C 11  ? 1.2359 0.8606 0.7356 -0.2744 -0.0189 0.1250  11  ALA C CB  
1683 N N   . ILE C 12  ? 1.0477 0.9237 0.7314 -0.2144 0.0621  0.1045  12  ILE C N   
1684 C CA  . ILE C 12  ? 0.9932 0.9854 0.7358 -0.2056 0.0864  0.1113  12  ILE C CA  
1685 C C   . ILE C 12  ? 1.0104 1.0187 0.7816 -0.1606 0.1030  0.0898  12  ILE C C   
1686 O O   . ILE C 12  ? 0.9812 1.0563 0.7698 -0.1561 0.1112  0.1011  12  ILE C O   
1687 C CB  . ILE C 12  ? 0.9898 1.0318 0.7683 -0.1991 0.1022  0.1054  12  ILE C CB  
1688 N N   . TYR C 13  ? 0.9701 0.9191 0.7413 -0.1273 0.1053  0.0624  13  TYR C N   
1689 C CA  . TYR C 13  ? 0.9530 0.9068 0.7464 -0.0903 0.1150  0.0450  13  TYR C CA  
1690 C C   . TYR C 13  ? 1.0234 0.9653 0.7924 -0.0988 0.1059  0.0562  13  TYR C C   
1691 O O   . TYR C 13  ? 0.9990 0.9867 0.7896 -0.0821 0.1148  0.0557  13  TYR C O   
1692 C CB  . TYR C 13  ? 0.9910 0.8908 0.7840 -0.0602 0.1152  0.0232  13  TYR C CB  
1693 C CG  . TYR C 13  ? 1.0388 0.9438 0.8524 -0.0290 0.1203  0.0112  13  TYR C CG  
1694 C CD1 . TYR C 13  ? 1.0197 0.9699 0.8765 -0.0084 0.1304  0.0021  13  TYR C CD1 
1695 C CD2 . TYR C 13  ? 1.0999 0.9589 0.8836 -0.0219 0.1113  0.0106  13  TYR C CD2 
1696 C CE1 . TYR C 13  ? 1.0464 0.9958 0.9170 0.0142  0.1290  -0.0051 13  TYR C CE1 
1697 C CE2 . TYR C 13  ? 1.0975 0.9647 0.9006 0.0036  0.1145  0.0024  13  TYR C CE2 
1698 C CZ  . TYR C 13  ? 1.2053 1.1176 1.0520 0.0195  0.1221  -0.0042 13  TYR C CZ  
1699 O OH  . TYR C 13  ? 1.2715 1.1850 1.1315 0.0391  0.1193  -0.0088 13  TYR C OH  
1700 N N   . GLN C 14  ? 1.0190 0.8922 0.7357 -0.1235 0.0853  0.0662  14  GLN C N   
1701 C CA  . GLN C 14  ? 1.0443 0.8916 0.7279 -0.1374 0.0718  0.0786  14  GLN C CA  
1702 C C   . GLN C 14  ? 1.0825 1.0141 0.7814 -0.1632 0.0743  0.1069  14  GLN C C   
1703 O O   . GLN C 14  ? 1.0733 1.0269 0.7768 -0.1529 0.0774  0.1101  14  GLN C O   
1704 C CB  . GLN C 14  ? 1.1489 0.8943 0.7601 -0.1624 0.0428  0.0856  14  GLN C CB  
1705 C CG  . GLN C 14  ? 1.4483 1.1136 1.0168 -0.1400 0.0318  0.0724  14  GLN C CG  
1706 C CD  . GLN C 14  ? 1.5904 1.2852 1.2022 -0.0933 0.0531  0.0508  14  GLN C CD  
1707 O OE1 . GLN C 14  ? 1.5551 1.2816 1.1825 -0.0912 0.0579  0.0551  14  GLN C OE1 
1708 N NE2 . GLN C 14  ? 1.3682 1.0536 0.9972 -0.0565 0.0637  0.0303  14  GLN C NE2 
1709 N N   . GLN C 15  ? 1.0332 1.0196 0.7401 -0.1938 0.0735  0.1294  15  GLN C N   
1710 C CA  . GLN C 15  ? 1.0160 1.1062 0.7390 -0.2150 0.0777  0.1631  15  GLN C CA  
1711 C C   . GLN C 15  ? 1.0340 1.2029 0.8011 -0.1660 0.1042  0.1491  15  GLN C C   
1712 O O   . GLN C 15  ? 1.0464 1.2764 0.8168 -0.1594 0.1083  0.1657  15  GLN C O   
1713 C CB  . GLN C 15  ? 1.0382 1.1751 0.7599 -0.2574 0.0704  0.1926  15  GLN C CB  
1714 C CG  . GLN C 15  ? 1.3113 1.4356 0.9881 -0.3222 0.0386  0.2360  15  GLN C CG  
1715 N N   . ASN C 16  ? 0.9540 1.1138 0.7476 -0.1303 0.1185  0.1190  16  ASN C N   
1716 C CA  . ASN C 16  ? 0.8979 1.1050 0.7187 -0.0827 0.1357  0.1021  16  ASN C CA  
1717 C C   . ASN C 16  ? 0.9280 1.0949 0.7444 -0.0536 0.1339  0.0845  16  ASN C C   
1718 O O   . ASN C 16  ? 0.8906 1.0996 0.7113 -0.0219 0.1407  0.0823  16  ASN C O   
1719 C CB  . ASN C 16  ? 0.8406 1.0385 0.6844 -0.0626 0.1445  0.0790  16  ASN C CB  
1720 C CG  . ASN C 16  ? 1.0635 1.3355 0.9182 -0.0721 0.1531  0.0951  16  ASN C CG  
1721 O OD1 . ASN C 16  ? 0.9335 1.2673 0.7971 -0.0405 0.1642  0.0937  16  ASN C OD1 
1722 N ND2 . ASN C 16  ? 0.9959 1.2601 0.8433 -0.1135 0.1457  0.1114  16  ASN C ND2 
1723 N N   . LYS C 17  ? 0.9171 1.0016 0.7190 -0.0606 0.1236  0.0723  17  LYS C N   
1724 C CA  . LYS C 17  ? 0.9209 0.9637 0.7176 -0.0372 0.1203  0.0577  17  LYS C CA  
1725 C C   . LYS C 17  ? 1.0101 1.0823 0.7894 -0.0453 0.1168  0.0776  17  LYS C C   
1726 O O   . LYS C 17  ? 0.9974 1.0861 0.7818 -0.0152 0.1208  0.0705  17  LYS C O   
1727 C CB  . LYS C 17  ? 0.9619 0.9205 0.7402 -0.0417 0.1106  0.0455  17  LYS C CB  
1728 C CG  . LYS C 17  ? 1.0322 0.9532 0.8058 -0.0180 0.1074  0.0329  17  LYS C CG  
1729 C CD  . LYS C 17  ? 1.0685 0.9187 0.8200 -0.0123 0.0997  0.0224  17  LYS C CD  
1730 C CE  . LYS C 17  ? 1.2383 1.0596 0.9802 0.0068  0.0959  0.0158  17  LYS C CE  
1731 N NZ  . LYS C 17  ? 1.4022 1.1787 1.1338 0.0291  0.0931  0.0043  17  LYS C NZ  
1732 N N   . GLU C 18  ? 1.0021 1.0801 0.7577 -0.0877 0.1062  0.1049  18  GLU C N   
1733 C CA  . GLU C 18  ? 1.0238 1.1400 0.7628 -0.1065 0.0999  0.1328  18  GLU C CA  
1734 C C   . GLU C 18  ? 1.0705 1.2964 0.8306 -0.0828 0.1152  0.1473  18  GLU C C   
1735 O O   . GLU C 18  ? 1.0817 1.3365 0.8381 -0.0609 0.1182  0.1515  18  GLU C O   
1736 C CB  . GLU C 18  ? 1.0883 1.1893 0.7951 -0.1656 0.0792  0.1648  18  GLU C CB  
1737 N N   . HIS C 19  ? 1.0132 1.2979 0.7909 -0.0797 0.1250  0.1528  19  HIS C N   
1738 C CA  . HIS C 19  ? 0.9978 1.3870 0.7860 -0.0462 0.1399  0.1648  19  HIS C CA  
1739 C C   . HIS C 19  ? 0.9971 1.3639 0.7843 0.0143  0.1465  0.1333  19  HIS C C   
1740 O O   . HIS C 19  ? 1.0108 1.4373 0.7866 0.0469  0.1518  0.1436  19  HIS C O   
1741 C CB  . HIS C 19  ? 1.0061 1.4480 0.8094 -0.0502 0.1484  0.1713  19  HIS C CB  
1742 C CG  . HIS C 19  ? 1.0554 1.6085 0.8598 -0.0091 0.1633  0.1855  19  HIS C CG  
1743 N ND1 . HIS C 19  ? 1.0764 1.6180 0.8756 0.0520  0.1714  0.1546  19  HIS C ND1 
1744 C CD2 . HIS C 19  ? 1.0933 1.7681 0.8958 -0.0174 0.1686  0.2290  19  HIS C CD2 
1745 C CE1 . HIS C 19  ? 1.0744 1.7230 0.8624 0.0856  0.1822  0.1761  19  HIS C CE1 
1746 N NE2 . HIS C 19  ? 1.0851 1.8265 0.8790 0.0472  0.1832  0.2225  19  HIS C NE2 
1747 N N   . PHE C 20  ? 0.8969 1.1794 0.6916 0.0287  0.1433  0.0984  20  PHE C N   
1748 C CA  . PHE C 20  ? 0.8736 1.1172 0.6630 0.0754  0.1411  0.0707  20  PHE C CA  
1749 C C   . PHE C 20  ? 0.9648 1.1878 0.7385 0.0857  0.1352  0.0718  20  PHE C C   
1750 O O   . PHE C 20  ? 0.9871 1.2268 0.7428 0.1278  0.1347  0.0668  20  PHE C O   
1751 C CB  . PHE C 20  ? 0.8565 1.0233 0.6616 0.0741  0.1352  0.0435  20  PHE C CB  
1752 C CG  . PHE C 20  ? 0.8571 0.9644 0.6570 0.1003  0.1244  0.0226  20  PHE C CG  
1753 C CD1 . PHE C 20  ? 0.8897 0.9965 0.6708 0.1419  0.1178  0.0116  20  PHE C CD1 
1754 C CD2 . PHE C 20  ? 0.8727 0.9222 0.6787 0.0850  0.1178  0.0160  20  PHE C CD2 
1755 C CE1 . PHE C 20  ? 0.9081 0.9552 0.6797 0.1598  0.1020  -0.0036 20  PHE C CE1 
1756 C CE2 . PHE C 20  ? 0.8986 0.9034 0.7020 0.1055  0.1065  0.0020  20  PHE C CE2 
1757 C CZ  . PHE C 20  ? 0.8835 0.8862 0.6712 0.1388  0.0973  -0.0066 20  PHE C CZ  
1758 N N   . GLN C 21  ? 0.9332 1.1125 0.7062 0.0511  0.1287  0.0770  21  GLN C N   
1759 C CA  . GLN C 21  ? 0.9617 1.1139 0.7204 0.0558  0.1227  0.0775  21  GLN C CA  
1760 C C   . GLN C 21  ? 1.0457 1.2793 0.7913 0.0617  0.1271  0.1054  21  GLN C C   
1761 O O   . GLN C 21  ? 1.0374 1.2751 0.7701 0.0967  0.1268  0.0999  21  GLN C O   
1762 C CB  . GLN C 21  ? 0.9949 1.0789 0.7466 0.0197  0.1133  0.0771  21  GLN C CB  
1763 C CG  . GLN C 21  ? 0.9377 0.9512 0.7003 0.0285  0.1101  0.0502  21  GLN C CG  
1764 C CD  . GLN C 21  ? 1.0116 0.9564 0.7555 0.0070  0.1008  0.0482  21  GLN C CD  
1765 O OE1 . GLN C 21  ? 0.9574 0.8915 0.6748 -0.0218 0.0928  0.0658  21  GLN C OE1 
1766 N NE2 . GLN C 21  ? 0.9004 0.7978 0.6521 0.0218  0.0992  0.0290  21  GLN C NE2 
1767 N N   . ASP C 22  ? 1.0332 1.3394 0.7813 0.0301  0.1304  0.1378  22  ASP C N   
1768 C CA  . ASP C 22  ? 1.0422 1.4540 0.7823 0.0325  0.1354  0.1747  22  ASP C CA  
1769 C C   . ASP C 22  ? 1.0663 1.5450 0.7986 0.0967  0.1477  0.1694  22  ASP C C   
1770 O O   . ASP C 22  ? 1.0968 1.6359 0.8130 0.1267  0.1514  0.1854  22  ASP C O   
1771 C CB  . ASP C 22  ? 1.0780 1.5569 0.8238 -0.0231 0.1321  0.2162  22  ASP C CB  
1772 C CG  . ASP C 22  ? 1.3439 1.7552 1.0766 -0.0872 0.1120  0.2297  22  ASP C CG  
1773 O OD1 . ASP C 22  ? 1.3967 1.7157 1.1161 -0.0851 0.1037  0.2073  22  ASP C OD1 
1774 O OD2 . ASP C 22  ? 1.4489 1.8952 1.1784 -0.1389 0.1019  0.2636  22  ASP C OD2 
1775 N N   . GLU C 23  ? 0.9767 1.4403 0.7132 0.1211  0.1520  0.1472  23  GLU C N   
1776 C CA  . GLU C 23  ? 0.9700 1.4743 0.6839 0.1869  0.1584  0.1373  23  GLU C CA  
1777 C C   . GLU C 23  ? 1.0246 1.4608 0.7098 0.2355  0.1487  0.1097  23  GLU C C   
1778 O O   . GLU C 23  ? 1.0577 1.5384 0.7076 0.2920  0.1506  0.1133  23  GLU C O   
1779 C CB  . GLU C 23  ? 0.9723 1.4541 0.6937 0.1941  0.1601  0.1175  23  GLU C CB  
1780 C CG  . GLU C 23  ? 1.0958 1.6565 0.7911 0.2488  0.1689  0.1236  23  GLU C CG  
1781 C CD  . GLU C 23  ? 1.4250 1.9541 1.1222 0.2588  0.1684  0.1016  23  GLU C CD  
1782 O OE1 . GLU C 23  ? 1.4308 1.9557 1.0875 0.3198  0.1649  0.0857  23  GLU C OE1 
1783 O OE2 . GLU C 23  ? 1.4262 1.9278 1.1589 0.2082  0.1691  0.0995  23  GLU C OE2 
1784 N N   . CYS C 24  ? 0.9644 1.2949 0.6602 0.2159  0.1368  0.0841  24  CYS C N   
1785 C CA  . CYS C 24  ? 0.9769 1.2330 0.6490 0.2499  0.1231  0.0602  24  CYS C CA  
1786 C C   . CYS C 24  ? 1.0483 1.3369 0.7063 0.2588  0.1251  0.0770  24  CYS C C   
1787 O O   . CYS C 24  ? 1.0821 1.3706 0.7024 0.3121  0.1197  0.0706  24  CYS C O   
1788 C CB  . CYS C 24  ? 0.9568 1.1154 0.6511 0.2200  0.1118  0.0378  24  CYS C CB  
1789 S SG  . CYS C 24  ? 0.9888 1.0931 0.6861 0.2305  0.1009  0.0128  24  CYS C SG  
1790 N N   . THR C 25  ? 1.0072 1.3193 0.6885 0.2074  0.1300  0.0996  25  THR C N   
1791 C CA  . THR C 25  ? 1.0374 1.3845 0.7087 0.2055  0.1308  0.1205  25  THR C CA  
1792 C C   . THR C 25  ? 1.1166 1.5824 0.7675 0.2457  0.1414  0.1488  25  THR C C   
1793 O O   . THR C 25  ? 1.1541 1.6307 0.7771 0.2906  0.1400  0.1477  25  THR C O   
1794 C CB  . THR C 25  ? 1.1541 1.4936 0.8441 0.1388  0.1280  0.1413  25  THR C CB  
1795 O OG1 . THR C 25  ? 1.1780 1.5908 0.8810 0.1024  0.1329  0.1717  25  THR C OG1 
1796 C CG2 . THR C 25  ? 1.1484 1.3748 0.8481 0.1126  0.1182  0.1138  25  THR C CG2 
1797 N N   . LYS C 26  ? 1.0554 1.6124 0.7165 0.2355  0.1517  0.1741  26  LYS C N   
1798 C CA  . LYS C 26  ? 1.0802 1.7698 0.7215 0.2791  0.1636  0.2060  26  LYS C CA  
1799 C C   . LYS C 26  ? 1.1942 1.8606 0.7853 0.3685  0.1613  0.1789  26  LYS C C   
1800 O O   . LYS C 26  ? 1.2498 1.9743 0.8114 0.4143  0.1645  0.1940  26  LYS C O   
1801 C CB  . LYS C 26  ? 1.0905 1.8738 0.7498 0.2588  0.1740  0.2329  26  LYS C CB  
1802 N N   . LEU C 27  ? 1.1504 1.7206 0.7265 0.3912  0.1514  0.1391  27  LEU C N   
1803 C CA  . LEU C 27  ? 1.1907 1.7053 0.7061 0.4696  0.1390  0.1097  27  LEU C CA  
1804 C C   . LEU C 27  ? 1.2788 1.7074 0.7668 0.4917  0.1228  0.0899  27  LEU C C   
1805 O O   . LEU C 27  ? 1.3493 1.7733 0.7756 0.5640  0.1146  0.0825  27  LEU C O   
1806 C CB  . LEU C 27  ? 1.1950 1.6215 0.7080 0.4667  0.1272  0.0777  27  LEU C CB  
1807 C CG  . LEU C 27  ? 1.3297 1.6739 0.7701 0.5388  0.1048  0.0465  27  LEU C CG  
1808 C CD1 . LEU C 27  ? 1.3668 1.7841 0.7603 0.6009  0.1120  0.0540  27  LEU C CD1 
1809 C CD2 . LEU C 27  ? 1.3568 1.5702 0.8068 0.5088  0.0820  0.0145  27  LEU C CD2 
1810 N N   . LEU C 28  ? 1.2122 1.5724 0.7397 0.4339  0.1173  0.0817  28  LEU C N   
1811 C CA  . LEU C 28  ? 1.2410 1.5147 0.7500 0.4458  0.1013  0.0627  28  LEU C CA  
1812 C C   . LEU C 28  ? 1.2679 1.5926 0.7837 0.4379  0.1098  0.0858  28  LEU C C   
1813 O O   . LEU C 28  ? 1.2958 1.5959 0.7703 0.4860  0.1006  0.0777  28  LEU C O   
1814 C CB  . LEU C 28  ? 1.2242 1.3933 0.7678 0.3947  0.0890  0.0398  28  LEU C CB  
1815 C CG  . LEU C 28  ? 1.3190 1.3979 0.8382 0.4151  0.0671  0.0108  28  LEU C CG  
1816 C CD1 . LEU C 28  ? 1.2772 1.3218 0.8459 0.3593  0.0676  0.0040  28  LEU C CD1 
1817 C CD2 . LEU C 28  ? 1.4184 1.4041 0.8999 0.4411  0.0414  -0.0084 28  LEU C CD2 
1818 N N   . VAL C 29  ? 1.1959 1.5763 0.7583 0.3749  0.1226  0.1133  29  VAL C N   
1819 C CA  . VAL C 29  ? 1.1998 1.6233 0.7714 0.3529  0.1272  0.1388  29  VAL C CA  
1820 C C   . VAL C 29  ? 1.3127 1.8543 0.8541 0.4071  0.1373  0.1680  29  VAL C C   
1821 O O   . VAL C 29  ? 1.3233 1.9834 0.8731 0.4044  0.1503  0.2024  29  VAL C O   
1822 C CB  . VAL C 29  ? 1.2176 1.6605 0.8317 0.2709  0.1307  0.1634  29  VAL C CB  
1823 N N   . GLY C 30  ? 1.3008 1.8086 0.8023 0.4623  0.1299  0.1535  30  GLY C N   
1824 C CA  . GLY C 30  ? 1.3292 1.9324 0.7869 0.5341  0.1370  0.1741  30  GLY C CA  
1825 C C   . GLY C 30  ? 1.4141 1.9398 0.8013 0.6204  0.1215  0.1381  30  GLY C C   
1826 O O   . GLY C 30  ? 1.4625 1.9972 0.8010 0.6824  0.1173  0.1384  30  GLY C O   
1827 N N   . ASN C 31  ? 1.3572 1.7977 0.7318 0.6247  0.1089  0.1073  31  ASN C N   
1828 C CA  . ASN C 31  ? 1.4066 1.7486 0.7034 0.6984  0.0845  0.0726  31  ASN C CA  
1829 C C   . ASN C 31  ? 1.4054 1.6178 0.6804 0.7001  0.0596  0.0449  31  ASN C C   
1830 O O   . ASN C 31  ? 1.3497 1.5388 0.6795 0.6375  0.0631  0.0469  31  ASN C O   
1831 C CB  . ASN C 31  ? 1.4436 1.7281 0.7375 0.6893  0.0744  0.0514  31  ASN C CB  
1832 C CG  . ASN C 31  ? 1.9085 2.1771 1.1114 0.7802  0.0601  0.0380  31  ASN C CG  
1833 O OD1 . ASN C 31  ? 1.9312 2.0669 1.0714 0.8128  0.0265  0.0053  31  ASN C OD1 
1834 N ND2 . ASN C 31  ? 1.8069 2.2105 0.9929 0.8252  0.0820  0.0658  31  ASN C ND2 
1835 N N   . ILE C 32  ? 1.3994 1.5250 0.5876 0.7732  0.0320  0.0204  32  ILE C N   
1836 C CA  . ILE C 32  ? 1.4309 1.4318 0.5879 0.7789  0.0032  -0.0032 32  ILE C CA  
1837 C C   . ILE C 32  ? 1.4968 1.3521 0.6277 0.7646  -0.0339 -0.0343 32  ILE C C   
1838 O O   . ILE C 32  ? 1.5344 1.3385 0.5934 0.8149  -0.0563 -0.0485 32  ILE C O   
1839 C CB  . ILE C 32  ? 1.5444 1.5463 0.6161 0.8679  -0.0068 -0.0031 32  ILE C CB  
1840 N N   . VAL C 33  ? 1.4566 1.2475 0.6417 0.6969  -0.0424 -0.0419 33  VAL C N   
1841 C CA  . VAL C 33  ? 1.5041 1.1708 0.6761 0.6711  -0.0789 -0.0629 33  VAL C CA  
1842 C C   . VAL C 33  ? 1.6602 1.2075 0.7622 0.7016  -0.1206 -0.0787 33  VAL C C   
1843 O O   . VAL C 33  ? 1.6727 1.2338 0.7683 0.7190  -0.1142 -0.0745 33  VAL C O   
1844 C CB  . VAL C 33  ? 1.4662 1.1423 0.7356 0.5831  -0.0651 -0.0577 33  VAL C CB  
1845 N N   . ILE C 34  ? 1.6841 1.1125 0.7332 0.7033  -0.1660 -0.0944 34  ILE C N   
1846 C CA  . ILE C 34  ? 1.7751 1.0750 0.7567 0.7179  -0.2147 -0.1063 34  ILE C CA  
1847 C C   . ILE C 34  ? 1.8095 1.0452 0.8408 0.6403  -0.2398 -0.1046 34  ILE C C   
1848 O O   . ILE C 34  ? 1.7858 1.0179 0.8389 0.6095  -0.2451 -0.1036 34  ILE C O   
1849 C CB  . ILE C 34  ? 1.9545 1.1543 0.7980 0.7998  -0.2597 -0.1224 34  ILE C CB  
1850 N N   . THR C 35  ? 1.7821 0.9802 0.8353 0.6091  -0.2526 -0.1012 35  THR C N   
1851 C CA  . THR C 35  ? 1.7651 0.9135 0.8614 0.5402  -0.2789 -0.0935 35  THR C CA  
1852 C C   . THR C 35  ? 1.9436 0.9464 0.9352 0.5607  -0.3482 -0.1001 35  THR C C   
1853 O O   . THR C 35  ? 1.9895 0.9366 0.9229 0.5955  -0.3682 -0.1059 35  THR C O   
1854 C CB  . THR C 35  ? 1.6644 0.8692 0.8473 0.4940  -0.2502 -0.0826 35  THR C CB  
1855 N N   . ARG C 36  ? 1.9665 0.9037 0.9279 0.5394  -0.3874 -0.0984 36  ARG C N   
1856 C CA  . ARG C 36  ? 2.1091 0.8919 0.9579 0.5511  -0.4640 -0.1017 36  ARG C CA  
1857 C C   . ARG C 36  ? 2.1959 0.9081 1.0391 0.5129  -0.5050 -0.0891 36  ARG C C   
1858 O O   . ARG C 36  ? 2.3407 0.9265 1.0717 0.5478  -0.5608 -0.0965 36  ARG C O   
1859 C CB  . ARG C 36  ? 2.1173 0.8635 0.9607 0.5140  -0.4941 -0.0949 36  ARG C CB  
1860 C CG  . ARG C 36  ? 2.3495 0.9291 1.0499 0.5413  -0.5743 -0.1020 36  ARG C CG  
1861 C CD  . ARG C 36  ? 2.4720 1.0212 1.1833 0.4857  -0.6067 -0.0884 36  ARG C CD  
1862 N NE  . ARG C 36  ? 2.6285 1.1884 1.3012 0.5306  -0.5923 -0.1049 36  ARG C NE  
1863 C CZ  . ARG C 36  ? 2.7288 1.2846 1.4177 0.4928  -0.6063 -0.0971 36  ARG C CZ  
1864 N NH1 . ARG C 36  ? 2.6393 1.1920 1.3882 0.4078  -0.6332 -0.0700 36  ARG C NH1 
1865 N NH2 . ARG C 36  ? 2.3949 0.9597 1.0425 0.5408  -0.5922 -0.1138 36  ARG C NH2 
1866 N N   . TYR C 37  ? 2.0152 0.8052 0.9705 0.4455  -0.4801 -0.0696 37  TYR C N   
1867 C CA  . TYR C 37  ? 2.0334 0.7754 0.9949 0.4029  -0.5167 -0.0521 37  TYR C CA  
1868 C C   . TYR C 37  ? 2.1238 0.8317 1.0413 0.4462  -0.5172 -0.0633 37  TYR C C   
1869 O O   . TYR C 37  ? 2.1930 0.8243 1.0785 0.4234  -0.5640 -0.0518 37  TYR C O   
1870 C CB  . TYR C 37  ? 1.9199 0.7692 1.0095 0.3315  -0.4842 -0.0279 37  TYR C CB  
1871 C CG  . TYR C 37  ? 1.8062 0.7853 0.9865 0.3398  -0.4065 -0.0352 37  TYR C CG  
1872 C CD1 . TYR C 37  ? 1.7925 0.8043 1.0009 0.3471  -0.3810 -0.0366 37  TYR C CD1 
1873 C CD2 . TYR C 37  ? 1.7373 0.8019 0.9746 0.3337  -0.3626 -0.0380 37  TYR C CD2 
1874 C CE1 . TYR C 37  ? 1.6933 0.8113 0.9750 0.3498  -0.3171 -0.0411 37  TYR C CE1 
1875 C CE2 . TYR C 37  ? 1.6530 0.8233 0.9637 0.3352  -0.2995 -0.0417 37  TYR C CE2 
1876 C CZ  . TYR C 37  ? 1.7621 0.9558 1.0926 0.3419  -0.2786 -0.0426 37  TYR C CZ  
1877 O OH  . TYR C 37  ? 1.7326 1.0174 1.1245 0.3399  -0.2234 -0.0446 37  TYR C OH  
1878 N N   . ASN C 38  ? 2.0257 0.7969 0.9455 0.5038  -0.4666 -0.0816 38  ASN C N   
1879 C CA  . ASN C 38  ? 2.0539 0.8031 0.9356 0.5467  -0.4640 -0.0907 38  ASN C CA  
1880 C C   . ASN C 38  ? 2.1807 0.9140 0.9716 0.6386  -0.4563 -0.1119 38  ASN C C   
1881 O O   . ASN C 38  ? 2.2166 0.9286 0.9606 0.6869  -0.4568 -0.1202 38  ASN C O   
1882 C CB  . ASN C 38  ? 1.8678 0.7333 0.8610 0.5157  -0.4062 -0.0826 38  ASN C CB  
1883 C CG  . ASN C 38  ? 2.0408 1.0336 1.0971 0.5324  -0.3376 -0.0873 38  ASN C CG  
1884 O OD1 . ASN C 38  ? 2.0281 1.0537 1.0795 0.5484  -0.3232 -0.0915 38  ASN C OD1 
1885 N ND2 . ASN C 38  ? 1.8728 0.9384 0.9873 0.5258  -0.2965 -0.0843 38  ASN C ND2 
1886 N N   . ASN C 39  ? 2.1619 0.9102 0.9260 0.6658  -0.4498 -0.1189 39  ASN C N   
1887 C CA  . ASN C 39  ? 2.2316 0.9868 0.9115 0.7573  -0.4389 -0.1349 39  ASN C CA  
1888 C C   . ASN C 39  ? 2.2081 1.0997 0.9462 0.7871  -0.3729 -0.1324 39  ASN C C   
1889 O O   . ASN C 39  ? 2.2787 1.1635 0.9406 0.8650  -0.3727 -0.1406 39  ASN C O   
1890 C CB  . ASN C 39  ? 2.4487 1.0406 0.9661 0.8260  -0.5079 -0.1501 39  ASN C CB  
1891 C CG  . ASN C 39  ? 2.8438 1.3118 1.2689 0.8281  -0.5685 -0.1557 39  ASN C CG  
1892 O OD1 . ASN C 39  ? 2.6669 1.1297 1.1478 0.7537  -0.5820 -0.1432 39  ASN C OD1 
1893 N ND2 . ASN C 39  ? 2.9652 1.3242 1.2381 0.9162  -0.6103 -0.1735 39  ASN C ND2 
1894 N N   . ARG C 40  ? 2.0218 1.0346 0.8896 0.7251  -0.3203 -0.1187 40  ARG C N   
1895 C CA  . ARG C 40  ? 1.9285 1.0691 0.8563 0.7373  -0.2621 -0.1110 40  ARG C CA  
1896 C C   . ARG C 40  ? 1.8724 1.1301 0.8417 0.7430  -0.2180 -0.1034 40  ARG C C   
1897 O O   . ARG C 40  ? 1.8345 1.0953 0.8344 0.7071  -0.2190 -0.1024 40  ARG C O   
1898 C CB  . ARG C 40  ? 1.8446 1.0254 0.8693 0.6703  -0.2395 -0.1006 40  ARG C CB  
1899 N N   . THR C 41  ? 1.7914 1.1499 0.7618 0.7866  -0.1809 -0.0949 41  THR C N   
1900 C CA  . THR C 41  ? 1.7346 1.2184 0.7405 0.7943  -0.1399 -0.0812 41  THR C CA  
1901 C C   . THR C 41  ? 1.6789 1.2812 0.7845 0.7425  -0.0928 -0.0604 41  THR C C   
1902 O O   . THR C 41  ? 1.6671 1.2813 0.7843 0.7416  -0.0851 -0.0554 41  THR C O   
1903 C CB  . THR C 41  ? 1.9577 1.4764 0.8726 0.8914  -0.1393 -0.0805 41  THR C CB  
1904 O OG1 . THR C 41  ? 2.1105 1.4971 0.9120 0.9528  -0.1882 -0.1004 41  THR C OG1 
1905 C CG2 . THR C 41  ? 1.9531 1.5220 0.8571 0.9099  -0.1292 -0.0775 41  THR C CG2 
1906 N N   . TYR C 42  ? 1.5575 1.2394 0.7305 0.6970  -0.0645 -0.0480 42  TYR C N   
1907 C CA  . TYR C 42  ? 1.4582 1.2405 0.7146 0.6433  -0.0262 -0.0264 42  TYR C CA  
1908 C C   . TYR C 42  ? 1.3991 1.2961 0.6832 0.6378  0.0029  -0.0059 42  TYR C C   
1909 O O   . TYR C 42  ? 1.3749 1.2577 0.6566 0.6340  -0.0027 -0.0130 42  TYR C O   
1910 C CB  . TYR C 42  ? 1.4295 1.1655 0.7530 0.5665  -0.0275 -0.0316 42  TYR C CB  
1911 C CG  . TYR C 42  ? 1.4960 1.1299 0.8038 0.5605  -0.0559 -0.0467 42  TYR C CG  
1912 C CD1 . TYR C 42  ? 1.5577 1.0926 0.8380 0.5568  -0.0927 -0.0619 42  TYR C CD1 
1913 C CD2 . TYR C 42  ? 1.5062 1.1455 0.8297 0.5516  -0.0478 -0.0423 42  TYR C CD2 
1914 C CE1 . TYR C 42  ? 1.6045 1.0546 0.8744 0.5431  -0.1214 -0.0693 42  TYR C CE1 
1915 C CE2 . TYR C 42  ? 1.5475 1.0997 0.8604 0.5430  -0.0732 -0.0537 42  TYR C CE2 
1916 C CZ  . TYR C 42  ? 1.7230 1.1838 1.0101 0.5379  -0.1103 -0.0657 42  TYR C CZ  
1917 O OH  . TYR C 42  ? 1.8297 1.2123 1.1066 0.5249  -0.1387 -0.0711 42  TYR C OH  
1918 N N   . ARG C 43  ? 1.3042 1.3167 0.6146 0.6338  0.0315  0.0225  43  ARG C N   
1919 C CA  . ARG C 43  ? 1.2490 1.3832 0.5935 0.6153  0.0580  0.0508  43  ARG C CA  
1920 C C   . ARG C 43  ? 1.2574 1.3756 0.6738 0.5284  0.0657  0.0526  43  ARG C C   
1921 O O   . ARG C 43  ? 1.2126 1.3210 0.6631 0.4836  0.0703  0.0588  43  ARG C O   
1922 C CB  . ARG C 43  ? 1.2017 1.4641 0.5503 0.6302  0.0796  0.0875  43  ARG C CB  
1923 N N   . ILE C 44  ? 1.2164 1.3195 0.6477 0.5098  0.0643  0.0442  44  ILE C N   
1924 C CA  . ILE C 44  ? 1.1598 1.2454 0.6496 0.4373  0.0704  0.0446  44  ILE C CA  
1925 C C   . ILE C 44  ? 1.2159 1.4059 0.7401 0.3970  0.0921  0.0802  44  ILE C C   
1926 O O   . ILE C 44  ? 1.2111 1.5021 0.7270 0.4172  0.1044  0.1047  44  ILE C O   
1927 C CB  . ILE C 44  ? 1.1822 1.2308 0.6755 0.4326  0.0628  0.0284  44  ILE C CB  
1928 C CG1 . ILE C 44  ? 1.2096 1.1405 0.6771 0.4479  0.0340  -0.0012 44  ILE C CG1 
1929 N N   . ASP C 45  ? 1.1787 1.3450 0.7325 0.3443  0.0935  0.0861  45  ASP C N   
1930 C CA  . ASP C 45  ? 1.1697 1.4120 0.7463 0.2964  0.1046  0.1218  45  ASP C CA  
1931 C C   . ASP C 45  ? 1.2090 1.4450 0.8152 0.2396  0.1064  0.1273  45  ASP C C   
1932 O O   . ASP C 45  ? 1.1953 1.5129 0.8123 0.2074  0.1128  0.1614  45  ASP C O   
1933 C CB  . ASP C 45  ? 1.2014 1.4111 0.7784 0.2740  0.1002  0.1259  45  ASP C CB  
1934 C CG  . ASP C 45  ? 1.3872 1.6577 0.9393 0.3177  0.1038  0.1419  45  ASP C CG  
1935 O OD1 . ASP C 45  ? 1.3999 1.7753 0.9567 0.3029  0.1121  0.1821  45  ASP C OD1 
1936 O OD2 . ASP C 45  ? 1.4719 1.6876 0.9975 0.3670  0.0961  0.1168  45  ASP C OD2 
1937 N N   . ASP C 46  ? 1.1651 1.3081 0.7822 0.2273  0.0989  0.0971  46  ASP C N   
1938 C CA  . ASP C 46  ? 1.1467 1.2656 0.7864 0.1808  0.0989  0.0962  46  ASP C CA  
1939 C C   . ASP C 46  ? 1.1840 1.2230 0.8322 0.1916  0.0919  0.0630  46  ASP C C   
1940 O O   . ASP C 46  ? 1.1871 1.1829 0.8231 0.2267  0.0832  0.0431  46  ASP C O   
1941 C CB  . ASP C 46  ? 1.1906 1.2750 0.8314 0.1296  0.0934  0.1078  46  ASP C CB  
1942 C CG  . ASP C 46  ? 1.4306 1.5403 1.0763 0.0765  0.0919  0.1324  46  ASP C CG  
1943 O OD1 . ASP C 46  ? 1.4291 1.5619 1.0880 0.0742  0.0966  0.1314  46  ASP C OD1 
1944 O OD2 . ASP C 46  ? 1.5951 1.6929 1.2265 0.0354  0.0825  0.1526  46  ASP C OD2 
1945 N N   . VAL C 47  ? 1.1345 1.1555 0.8013 0.1589  0.0930  0.0607  47  VAL C N   
1946 C CA  . VAL C 47  ? 1.1201 1.0800 0.8008 0.1604  0.0870  0.0367  47  VAL C CA  
1947 C C   . VAL C 47  ? 1.1594 1.0729 0.8468 0.1229  0.0852  0.0361  47  VAL C C   
1948 O O   . VAL C 47  ? 1.1602 1.0913 0.8437 0.0896  0.0876  0.0530  47  VAL C O   
1949 C CB  . VAL C 47  ? 1.1456 1.1332 0.8362 0.1681  0.0904  0.0335  47  VAL C CB  
1950 N N   . ASP C 48  ? 1.1155 0.9697 0.8057 0.1296  0.0782  0.0196  48  ASP C N   
1951 C CA  . ASP C 48  ? 1.1133 0.9214 0.7999 0.1068  0.0761  0.0172  48  ASP C CA  
1952 C C   . ASP C 48  ? 1.0773 0.8791 0.7843 0.1066  0.0770  0.0083  48  ASP C C   
1953 O O   . ASP C 48  ? 1.0163 0.8063 0.7398 0.1245  0.0721  -0.0026 48  ASP C O   
1954 C CB  . ASP C 48  ? 1.1536 0.9137 0.8297 0.1173  0.0701  0.0086  48  ASP C CB  
1955 C CG  . ASP C 48  ? 1.3006 1.0118 0.9540 0.1013  0.0670  0.0084  48  ASP C CG  
1956 O OD1 . ASP C 48  ? 1.3061 1.0098 0.9530 0.0845  0.0673  0.0115  48  ASP C OD1 
1957 O OD2 . ASP C 48  ? 1.3849 1.0604 1.0200 0.1089  0.0627  0.0047  48  ASP C OD2 
1958 N N   . TRP C 49  ? 1.0482 0.8605 0.7529 0.0835  0.0809  0.0161  49  TRP C N   
1959 C CA  . TRP C 49  ? 1.0375 0.8483 0.7598 0.0811  0.0831  0.0097  49  TRP C CA  
1960 C C   . TRP C 49  ? 1.1389 0.9014 0.8534 0.0847  0.0794  0.0020  49  TRP C C   
1961 O O   . TRP C 49  ? 1.1480 0.9143 0.8822 0.0923  0.0807  -0.0036 49  TRP C O   
1962 C CB  . TRP C 49  ? 1.0230 0.8633 0.7417 0.0558  0.0873  0.0226  49  TRP C CB  
1963 C CG  . TRP C 49  ? 1.0209 0.9264 0.7495 0.0620  0.0934  0.0321  49  TRP C CG  
1964 C CD1 . TRP C 49  ? 1.0693 1.0202 0.7848 0.0507  0.0951  0.0528  49  TRP C CD1 
1965 C CD2 . TRP C 49  ? 0.9931 0.9278 0.7402 0.0862  0.0966  0.0232  49  TRP C CD2 
1966 N NE1 . TRP C 49  ? 1.0471 1.0617 0.7717 0.0722  0.1024  0.0573  49  TRP C NE1 
1967 C CE2 . TRP C 49  ? 1.0398 1.0368 0.7792 0.0954  0.1022  0.0370  49  TRP C CE2 
1968 C CE3 . TRP C 49  ? 0.9898 0.9052 0.7551 0.1007  0.0931  0.0076  49  TRP C CE3 
1969 C CZ2 . TRP C 49  ? 1.0196 1.0486 0.7600 0.1259  0.1040  0.0311  49  TRP C CZ2 
1970 C CZ3 . TRP C 49  ? 0.9971 0.9383 0.7654 0.1218  0.0920  0.0029  49  TRP C CZ3 
1971 C CH2 . TRP C 49  ? 1.0142 1.0062 0.7660 0.1374  0.0973  0.0124  49  TRP C CH2 
1972 N N   . ASN C 50  ? 1.1507 0.8724 0.8342 0.0836  0.0743  0.0029  50  ASN C N   
1973 C CA  . ASN C 50  ? 1.1918 0.8669 0.8533 0.0960  0.0704  -0.0034 50  ASN C CA  
1974 C C   . ASN C 50  ? 1.2362 0.9129 0.9137 0.1226  0.0697  -0.0093 50  ASN C C   
1975 O O   . ASN C 50  ? 1.2789 0.9306 0.9384 0.1401  0.0681  -0.0118 50  ASN C O   
1976 C CB  . ASN C 50  ? 1.2850 0.9024 0.8885 0.0807  0.0606  0.0017  50  ASN C CB  
1977 C CG  . ASN C 50  ? 1.6281 1.2388 1.2086 0.0462  0.0544  0.0139  50  ASN C CG  
1978 O OD1 . ASN C 50  ? 1.4296 1.0570 1.0244 0.0402  0.0579  0.0140  50  ASN C OD1 
1979 N ND2 . ASN C 50  ? 1.6126 1.2014 1.1569 0.0194  0.0429  0.0277  50  ASN C ND2 
1980 N N   . LYS C 51  ? 1.1376 0.8423 0.8421 0.1282  0.0686  -0.0098 51  LYS C N   
1981 C CA  . LYS C 51  ? 1.1164 0.8219 0.8349 0.1470  0.0629  -0.0114 51  LYS C CA  
1982 C C   . LYS C 51  ? 1.1229 0.8600 0.8782 0.1502  0.0565  -0.0097 51  LYS C C   
1983 O O   . LYS C 51  ? 1.1029 0.8567 0.8676 0.1426  0.0574  -0.0109 51  LYS C O   
1984 C CB  . LYS C 51  ? 1.1510 0.8418 0.8545 0.1511  0.0592  -0.0125 51  LYS C CB  
1985 N N   . THR C 52  ? 1.0751 0.8217 0.8479 0.1602  0.0476  -0.0040 52  THR C N   
1986 C CA  . THR C 52  ? 1.0453 0.8174 0.8490 0.1564  0.0336  0.0040  52  THR C CA  
1987 C C   . THR C 52  ? 1.0690 0.8399 0.8795 0.1604  0.0152  0.0133  52  THR C C   
1988 O O   . THR C 52  ? 1.0766 0.8402 0.8757 0.1707  0.0197  0.0145  52  THR C O   
1989 C CB  . THR C 52  ? 1.1445 0.9481 0.9678 0.1556  0.0401  0.0118  52  THR C CB  
1990 O OG1 . THR C 52  ? 1.0656 0.8944 0.9172 0.1447  0.0265  0.0206  52  THR C OG1 
1991 C CG2 . THR C 52  ? 1.1899 1.0109 1.0121 0.1724  0.0440  0.0221  52  THR C CG2 
1992 N N   . PRO C 53  ? 0.9946 0.7672 0.8176 0.1511  -0.0090 0.0217  53  PRO C N   
1993 C CA  . PRO C 53  ? 0.9957 0.7637 0.8212 0.1488  -0.0318 0.0351  53  PRO C CA  
1994 C C   . PRO C 53  ? 1.0640 0.8791 0.9130 0.1503  -0.0290 0.0555  53  PRO C C   
1995 O O   . PRO C 53  ? 1.0960 0.9148 0.9463 0.1500  -0.0430 0.0680  53  PRO C O   
1996 C CB  . PRO C 53  ? 1.0257 0.7796 0.8518 0.1331  -0.0637 0.0434  53  PRO C CB  
1997 C CG  . PRO C 53  ? 1.0706 0.8078 0.8820 0.1380  -0.0544 0.0258  53  PRO C CG  
1998 C CD  . PRO C 53  ? 0.9894 0.7595 0.8163 0.1413  -0.0213 0.0205  53  PRO C CD  
1999 N N   . LYS C 54  ? 1.0014 0.8558 0.8655 0.1557  -0.0110 0.0601  54  LYS C N   
2000 C CA  . LYS C 54  ? 0.9861 0.8959 0.8650 0.1695  -0.0036 0.0798  54  LYS C CA  
2001 C C   . LYS C 54  ? 1.0512 0.9378 0.8985 0.1950  0.0123  0.0688  54  LYS C C   
2002 O O   . LYS C 54  ? 1.0645 0.9914 0.9157 0.2118  0.0133  0.0860  54  LYS C O   
2003 C CB  . LYS C 54  ? 0.9835 0.9298 0.8730 0.1777  0.0122  0.0828  54  LYS C CB  
2004 C CG  . LYS C 54  ? 1.0127 0.9956 0.9368 0.1544  -0.0025 0.0989  54  LYS C CG  
2005 C CD  . LYS C 54  ? 0.9140 0.9178 0.8413 0.1652  0.0172  0.0938  54  LYS C CD  
2006 N N   . ASP C 55  ? 0.9981 0.8254 0.8120 0.1982  0.0238  0.0435  55  ASP C N   
2007 C CA  . ASP C 55  ? 1.0180 0.8085 0.7935 0.2169  0.0348  0.0318  55  ASP C CA  
2008 C C   . ASP C 55  ? 1.1130 0.8971 0.8888 0.2187  0.0233  0.0367  55  ASP C C   
2009 O O   . ASP C 55  ? 1.0776 0.8650 0.8735 0.2021  0.0047  0.0436  55  ASP C O   
2010 C CB  . ASP C 55  ? 1.0402 0.7774 0.7840 0.2091  0.0441  0.0112  55  ASP C CB  
2011 C CG  . ASP C 55  ? 1.0789 0.8134 0.8136 0.2064  0.0539  0.0067  55  ASP C CG  
2012 N N   . SER C 56  ? 1.1571 0.9247 0.9035 0.2403  0.0316  0.0330  56  SER C N   
2013 C CA  . SER C 56  ? 1.1892 0.9507 0.9329 0.2449  0.0230  0.0370  56  SER C CA  
2014 C C   . SER C 56  ? 1.3253 1.0247 1.0337 0.2452  0.0277  0.0169  56  SER C C   
2015 O O   . SER C 56  ? 1.3652 1.0284 1.0428 0.2452  0.0383  0.0033  56  SER C O   
2016 C CB  . SER C 56  ? 1.2372 1.0389 0.9750 0.2732  0.0279  0.0524  56  SER C CB  
2017 O OG  . SER C 56  ? 1.2913 1.1699 1.0673 0.2719  0.0220  0.0791  56  SER C OG  
2018 N N   . PHE C 57  ? 1.2962 0.9847 1.0079 0.2428  0.0168  0.0180  57  PHE C N   
2019 C CA  . PHE C 57  ? 1.3176 0.9580 0.9986 0.2461  0.0204  0.0032  57  PHE C CA  
2020 C C   . PHE C 57  ? 1.3641 1.0065 1.0385 0.2620  0.0164  0.0093  57  PHE C C   
2021 O O   . PHE C 57  ? 1.3478 1.0323 1.0494 0.2624  0.0052  0.0277  57  PHE C O   
2022 C CB  . PHE C 57  ? 1.3345 0.9557 1.0189 0.2323  0.0120  -0.0041 57  PHE C CB  
2023 C CG  . PHE C 57  ? 1.3525 0.9781 1.0548 0.2277  -0.0107 0.0041  57  PHE C CG  
2024 C CD1 . PHE C 57  ? 1.4047 1.0059 1.0941 0.2350  -0.0207 0.0022  57  PHE C CD1 
2025 C CD2 . PHE C 57  ? 1.3705 1.0151 1.0953 0.2145  -0.0262 0.0137  57  PHE C CD2 
2026 C CE1 . PHE C 57  ? 1.4266 1.0166 1.1207 0.2296  -0.0482 0.0103  57  PHE C CE1 
2027 C CE2 . PHE C 57  ? 1.4216 1.0521 1.1485 0.2068  -0.0559 0.0225  57  PHE C CE2 
2028 C CZ  . PHE C 57  ? 1.4209 1.0210 1.1299 0.2145  -0.0678 0.0207  57  PHE C CZ  
2029 N N   . THR C 58  ? 1.3054 0.9064 0.9429 0.2728  0.0242  -0.0027 58  THR C N   
2030 C CA  . THR C 58  ? 1.2889 0.8865 0.9138 0.2908  0.0227  0.0003  58  THR C CA  
2031 C C   . THR C 58  ? 1.2510 0.8319 0.8850 0.2820  0.0106  -0.0019 58  THR C C   
2032 O O   . THR C 58  ? 1.2237 0.7743 0.8468 0.2728  0.0109  -0.0132 58  THR C O   
2033 C CB  . THR C 58  ? 1.4130 0.9648 0.9830 0.3091  0.0341  -0.0118 58  THR C CB  
2034 O OG1 . THR C 58  ? 1.4335 0.9903 0.9859 0.3199  0.0409  -0.0108 58  THR C OG1 
2035 C CG2 . THR C 58  ? 1.3756 0.9242 0.9251 0.3347  0.0345  -0.0095 58  THR C CG2 
2036 N N   . MET C 59  ? 1.1697 0.7750 0.8210 0.2865  -0.0014 0.0119  59  MET C N   
2037 C CA  . MET C 59  ? 1.1549 0.7370 0.8070 0.2820  -0.0168 0.0108  59  MET C CA  
2038 C C   . MET C 59  ? 1.1647 0.7160 0.7859 0.2999  -0.0068 0.0002  59  MET C C   
2039 O O   . MET C 59  ? 1.1528 0.6937 0.7465 0.3145  0.0094  -0.0066 59  MET C O   
2040 C CB  . MET C 59  ? 1.1836 0.8012 0.8664 0.2695  -0.0418 0.0346  59  MET C CB  
2041 C CG  . MET C 59  ? 1.2311 0.8680 0.9370 0.2490  -0.0549 0.0442  59  MET C CG  
2042 S SD  . MET C 59  ? 1.3046 0.9451 1.0285 0.2214  -0.0990 0.0693  59  MET C SD  
2043 C CE  . MET C 59  ? 1.3014 0.8590 0.9863 0.2286  -0.1132 0.0461  59  MET C CE  
2044 N N   . SER C 60  ? 1.1185 0.6453 0.7356 0.3000  -0.0187 -0.0026 60  SER C N   
2045 C CA  . SER C 60  ? 1.1242 0.6177 0.7124 0.3147  -0.0106 -0.0137 60  SER C CA  
2046 C C   . SER C 60  ? 1.1446 0.6516 0.7178 0.3348  0.0000  -0.0094 60  SER C C   
2047 O O   . SER C 60  ? 1.1796 0.6500 0.7146 0.3467  0.0123  -0.0226 60  SER C O   
2048 C CB  . SER C 60  ? 1.1837 0.6550 0.7726 0.3144  -0.0282 -0.0142 60  SER C CB  
2049 O OG  . SER C 60  ? 1.3277 0.8244 0.9373 0.3105  -0.0471 0.0045  60  SER C OG  
2050 N N   . ASP C 61  ? 1.0488 0.6097 0.6462 0.3399  -0.0064 0.0113  61  ASP C N   
2051 C CA  . ASP C 61  ? 1.0637 0.6485 0.6418 0.3689  0.0044  0.0178  61  ASP C CA  
2052 C C   . ASP C 61  ? 1.1424 0.7542 0.7063 0.3874  0.0177  0.0215  61  ASP C C   
2053 O O   . ASP C 61  ? 1.1923 0.8340 0.7358 0.4202  0.0255  0.0301  61  ASP C O   
2054 C CB  . ASP C 61  ? 1.0772 0.7204 0.6863 0.3689  -0.0100 0.0445  61  ASP C CB  
2055 C CG  . ASP C 61  ? 1.1263 0.8440 0.7816 0.3497  -0.0245 0.0753  61  ASP C CG  
2056 O OD1 . ASP C 61  ? 1.0737 0.7816 0.7433 0.3286  -0.0296 0.0717  61  ASP C OD1 
2057 O OD2 . ASP C 61  ? 1.2064 0.9968 0.8831 0.3544  -0.0320 0.1058  61  ASP C OD2 
2058 N N   . GLY C 62  ? 1.0821 0.6837 0.6511 0.3720  0.0201  0.0152  62  GLY C N   
2059 C CA  . GLY C 62  ? 1.0902 0.7112 0.6417 0.3908  0.0307  0.0179  62  GLY C CA  
2060 C C   . GLY C 62  ? 1.1104 0.8107 0.7111 0.3814  0.0256  0.0424  62  GLY C C   
2061 O O   . GLY C 62  ? 1.1142 0.8344 0.7032 0.3976  0.0344  0.0451  62  GLY C O   
2062 N N   . LYS C 63  ? 1.0251 0.7672 0.6760 0.3547  0.0077  0.0622  63  LYS C N   
2063 C CA  . LYS C 63  ? 0.9920 0.8096 0.6892 0.3381  -0.0034 0.0909  63  LYS C CA  
2064 C C   . LYS C 63  ? 1.0343 0.8268 0.7399 0.3170  -0.0029 0.0787  63  LYS C C   
2065 O O   . LYS C 63  ? 1.0275 0.7599 0.7262 0.2981  -0.0076 0.0588  63  LYS C O   
2066 C CB  . LYS C 63  ? 1.0021 0.8533 0.7378 0.3087  -0.0314 0.1174  63  LYS C CB  
2067 C CG  . LYS C 63  ? 1.1323 1.0681 0.9141 0.2852  -0.0495 0.1561  63  LYS C CG  
2068 C CD  . LYS C 63  ? 1.2966 1.2317 1.1024 0.2447  -0.0878 0.1792  63  LYS C CD  
2069 C CE  . LYS C 63  ? 1.3503 1.3725 1.1988 0.2138  -0.1133 0.2261  63  LYS C CE  
2070 N NZ  . LYS C 63  ? 1.4692 1.4961 1.3300 0.1775  -0.1545 0.2569  63  LYS C NZ  
2071 N N   . GLU C 64  ? 0.9902 0.8340 0.7080 0.3246  0.0041  0.0915  64  GLU C N   
2072 C CA  . GLU C 64  ? 0.9818 0.8119 0.7098 0.3064  0.0054  0.0828  64  GLU C CA  
2073 C C   . GLU C 64  ? 1.0260 0.9045 0.8032 0.2726  -0.0174 0.1083  64  GLU C C   
2074 O O   . GLU C 64  ? 1.0113 0.9657 0.8181 0.2687  -0.0296 0.1426  64  GLU C O   
2075 C CB  . GLU C 64  ? 1.0108 0.8546 0.7139 0.3358  0.0249  0.0787  64  GLU C CB  
2076 C CG  . GLU C 64  ? 1.2230 0.9863 0.8625 0.3585  0.0391  0.0492  64  GLU C CG  
2077 C CD  . GLU C 64  ? 1.6706 1.4130 1.2728 0.3778  0.0504  0.0393  64  GLU C CD  
2078 O OE1 . GLU C 64  ? 1.7194 1.4619 1.2749 0.4213  0.0581  0.0399  64  GLU C OE1 
2079 O OE2 . GLU C 64  ? 1.6328 1.3559 1.2469 0.3524  0.0500  0.0310  64  GLU C OE2 
2080 N N   . ILE C 65  ? 0.9892 0.8253 0.7712 0.2479  -0.0255 0.0943  65  ILE C N   
2081 C CA  . ILE C 65  ? 0.9739 0.8320 0.7883 0.2152  -0.0515 0.1135  65  ILE C CA  
2082 C C   . ILE C 65  ? 1.0528 0.8866 0.8653 0.2080  -0.0429 0.0959  65  ILE C C   
2083 O O   . ILE C 65  ? 1.0715 0.8520 0.8565 0.2172  -0.0269 0.0674  65  ILE C O   
2084 C CB  . ILE C 65  ? 1.0185 0.8302 0.8269 0.1939  -0.0822 0.1150  65  ILE C CB  
2085 N N   . THR C 66  ? 1.0008 0.8792 0.8428 0.1899  -0.0544 0.1157  66  THR C N   
2086 C CA  . THR C 66  ? 0.9782 0.8351 0.8198 0.1818  -0.0482 0.1000  66  THR C CA  
2087 C C   . THR C 66  ? 1.0565 0.8530 0.8843 0.1630  -0.0722 0.0890  66  THR C C   
2088 O O   . THR C 66  ? 1.0767 0.8561 0.9006 0.1501  -0.1010 0.1014  66  THR C O   
2089 C CB  . THR C 66  ? 1.0279 0.9538 0.9035 0.1713  -0.0515 0.1248  66  THR C CB  
2090 O OG1 . THR C 66  ? 1.1305 1.0822 1.0300 0.1394  -0.0880 0.1558  66  THR C OG1 
2091 C CG2 . THR C 66  ? 0.8783 0.8718 0.7599 0.2008  -0.0287 0.1385  66  THR C CG2 
2092 N N   . PHE C 67  ? 1.0102 0.7734 0.8249 0.1637  -0.0628 0.0673  67  PHE C N   
2093 C CA  . PHE C 67  ? 1.0236 0.7318 0.8151 0.1566  -0.0851 0.0563  67  PHE C CA  
2094 C C   . PHE C 67  ? 1.1044 0.8156 0.9059 0.1303  -0.1247 0.0802  67  PHE C C   
2095 O O   . PHE C 67  ? 1.1504 0.8086 0.9233 0.1243  -0.1578 0.0812  67  PHE C O   
2096 C CB  . PHE C 67  ? 1.0286 0.7192 0.8062 0.1651  -0.0657 0.0339  67  PHE C CB  
2097 C CG  . PHE C 67  ? 1.0253 0.7066 0.7860 0.1819  -0.0359 0.0162  67  PHE C CG  
2098 C CD1 . PHE C 67  ? 1.0226 0.7280 0.7906 0.1849  -0.0105 0.0143  67  PHE C CD1 
2099 C CD2 . PHE C 67  ? 1.0661 0.7108 0.7973 0.1947  -0.0368 0.0033  67  PHE C CD2 
2100 C CE1 . PHE C 67  ? 1.0488 0.7344 0.7921 0.1935  0.0090  0.0016  67  PHE C CE1 
2101 C CE2 . PHE C 67  ? 1.1000 0.7405 0.8156 0.2035  -0.0131 -0.0073 67  PHE C CE2 
2102 C CZ  . PHE C 67  ? 1.0662 0.7235 0.7869 0.1996  0.0074  -0.0073 67  PHE C CZ  
2103 N N   . LEU C 68  ? 1.0375 0.8100 0.8751 0.1147  -0.1248 0.1029  68  LEU C N   
2104 C CA  . LEU C 68  ? 1.0552 0.8455 0.9079 0.0817  -0.1644 0.1346  68  LEU C CA  
2105 C C   . LEU C 68  ? 1.1197 0.9053 0.9679 0.0641  -0.1995 0.1607  68  LEU C C   
2106 O O   . LEU C 68  ? 1.1521 0.8798 0.9715 0.0420  -0.2448 0.1693  68  LEU C O   
2107 C CB  . LEU C 68  ? 1.0261 0.9067 0.9247 0.0729  -0.1512 0.1595  68  LEU C CB  
2108 C CG  . LEU C 68  ? 1.0614 0.9525 0.9674 0.0856  -0.1207 0.1396  68  LEU C CG  
2109 C CD1 . LEU C 68  ? 1.0348 1.0185 0.9816 0.0844  -0.1080 0.1664  68  LEU C CD1 
2110 C CD2 . LEU C 68  ? 1.0910 0.9290 0.9778 0.0706  -0.1422 0.1285  68  LEU C CD2 
2111 N N   . GLU C 69  ? 1.0589 0.8977 0.9272 0.0764  -0.1805 0.1721  69  GLU C N   
2112 C CA  . GLU C 69  ? 1.0778 0.9268 0.9470 0.0611  -0.2088 0.1994  69  GLU C CA  
2113 C C   . GLU C 69  ? 1.1736 0.9238 0.9943 0.0693  -0.2261 0.1747  69  GLU C C   
2114 O O   . GLU C 69  ? 1.2005 0.9187 1.0040 0.0453  -0.2701 0.1952  69  GLU C O   
2115 C CB  . GLU C 69  ? 1.0624 0.9965 0.9599 0.0822  -0.1786 0.2144  69  GLU C CB  
2116 N N   . TYR C 70  ? 1.1210 0.8245 0.9166 0.1021  -0.1944 0.1338  70  TYR C N   
2117 C CA  . TYR C 70  ? 1.1467 0.7674 0.8956 0.1188  -0.2040 0.1090  70  TYR C CA  
2118 C C   . TYR C 70  ? 1.2798 0.8222 0.9845 0.1065  -0.2504 0.1077  70  TYR C C   
2119 O O   . TYR C 70  ? 1.3474 0.8300 1.0151 0.1033  -0.2859 0.1115  70  TYR C O   
2120 C CB  . TYR C 70  ? 1.1290 0.7356 0.8649 0.1523  -0.1605 0.0731  70  TYR C CB  
2121 C CG  . TYR C 70  ? 1.1905 0.7269 0.8795 0.1742  -0.1672 0.0504  70  TYR C CG  
2122 C CD1 . TYR C 70  ? 1.2385 0.7608 0.9176 0.1841  -0.1673 0.0495  70  TYR C CD1 
2123 C CD2 . TYR C 70  ? 1.2126 0.7018 0.8645 0.1894  -0.1735 0.0313  70  TYR C CD2 
2124 C CE1 . TYR C 70  ? 1.2865 0.7484 0.9213 0.2073  -0.1742 0.0304  70  TYR C CE1 
2125 C CE2 . TYR C 70  ? 1.2540 0.6882 0.8585 0.2173  -0.1798 0.0134  70  TYR C CE2 
2126 C CZ  . TYR C 70  ? 1.3404 0.7606 0.9372 0.2256  -0.1803 0.0131  70  TYR C CZ  
2127 O OH  . TYR C 70  ? 1.3545 0.7252 0.9041 0.2563  -0.1859 -0.0034 70  TYR C OH  
2128 N N   . TYR C 71  ? 1.2346 0.7693 0.9351 0.1026  -0.2526 0.1016  71  TYR C N   
2129 C CA  . TYR C 71  ? 1.2943 0.7433 0.9385 0.0984  -0.2982 0.0972  71  TYR C CA  
2130 C C   . TYR C 71  ? 1.3736 0.8023 1.0094 0.0537  -0.3584 0.1352  71  TYR C C   
2131 O O   . TYR C 71  ? 1.4385 0.7702 1.0085 0.0514  -0.4085 0.1341  71  TYR C O   
2132 C CB  . TYR C 71  ? 1.2797 0.7262 0.9171 0.1114  -0.2814 0.0780  71  TYR C CB  
2133 C CG  . TYR C 71  ? 1.2716 0.7127 0.8926 0.1540  -0.2395 0.0439  71  TYR C CG  
2134 C CD1 . TYR C 71  ? 1.2277 0.7374 0.8932 0.1614  -0.1881 0.0358  71  TYR C CD1 
2135 C CD2 . TYR C 71  ? 1.3405 0.7087 0.8963 0.1875  -0.2545 0.0234  71  TYR C CD2 
2136 C CE1 . TYR C 71  ? 1.2331 0.7433 0.8838 0.1917  -0.1549 0.0122  71  TYR C CE1 
2137 C CE2 . TYR C 71  ? 1.3369 0.7186 0.8819 0.2244  -0.2165 -0.0001 71  TYR C CE2 
2138 C CZ  . TYR C 71  ? 1.3820 0.8369 0.9772 0.2216  -0.1680 -0.0036 71  TYR C CZ  
2139 O OH  . TYR C 71  ? 1.4407 0.9133 1.0251 0.2490  -0.1361 -0.0196 71  TYR C OH  
2140 N N   . SER C 72  ? 1.2883 0.8081 0.9845 0.0196  -0.3564 0.1715  72  SER C N   
2141 C CA  . SER C 72  ? 1.3447 0.8685 1.0424 -0.0315 -0.4142 0.2183  72  SER C CA  
2142 C C   . SER C 72  ? 1.4825 0.9792 1.1612 -0.0420 -0.4437 0.2348  72  SER C C   
2143 O O   . SER C 72  ? 1.5669 0.9810 1.1930 -0.0703 -0.5075 0.2521  72  SER C O   
2144 C CB  . SER C 72  ? 1.3291 0.9785 1.0996 -0.0602 -0.4003 0.2571  72  SER C CB  
2145 O OG  . SER C 72  ? 1.4275 1.1688 1.2487 -0.0294 -0.3383 0.2477  72  SER C OG  
2146 N N   . LYS C 73  ? 1.4121 0.9673 1.1249 -0.0181 -0.4006 0.2281  73  LYS C N   
2147 C CA  . LYS C 73  ? 1.4494 0.9903 1.1506 -0.0246 -0.4213 0.2427  73  LYS C CA  
2148 C C   . LYS C 73  ? 1.5951 1.0063 1.2198 0.0010  -0.4439 0.2091  73  LYS C C   
2149 O O   . LYS C 73  ? 1.6702 1.0279 1.2602 -0.0198 -0.4922 0.2280  73  LYS C O   
2150 C CB  . LYS C 73  ? 1.4083 1.0450 1.1609 0.0001  -0.3669 0.2421  73  LYS C CB  
2151 N N   . ASN C 74  ? 1.5304 0.8962 1.1267 0.0467  -0.4105 0.1627  74  ASN C N   
2152 C CA  . ASN C 74  ? 1.5796 0.8392 1.1032 0.0827  -0.4243 0.1308  74  ASN C CA  
2153 C C   . ASN C 74  ? 1.7076 0.8517 1.1482 0.0867  -0.4774 0.1219  74  ASN C C   
2154 O O   . ASN C 74  ? 1.7859 0.8312 1.1539 0.1062  -0.5127 0.1106  74  ASN C O   
2155 C CB  . ASN C 74  ? 1.5216 0.8023 1.0530 0.1325  -0.3627 0.0914  74  ASN C CB  
2156 C CG  . ASN C 74  ? 1.6483 0.9956 1.2261 0.1395  -0.3226 0.0926  74  ASN C CG  
2157 O OD1 . ASN C 74  ? 1.5419 0.8543 1.0963 0.1519  -0.3308 0.0879  74  ASN C OD1 
2158 N ND2 . ASN C 74  ? 1.4138 0.8533 1.0519 0.1329  -0.2824 0.1000  74  ASN C ND2 
2159 N N   . TYR C 75  ? 1.6366 0.7857 1.0791 0.0751  -0.4831 0.1242  75  TYR C N   
2160 C CA  . TYR C 75  ? 1.7175 0.7503 1.0703 0.0873  -0.5321 0.1117  75  TYR C CA  
2161 C C   . TYR C 75  ? 1.8383 0.8463 1.1797 0.0330  -0.5898 0.1464  75  TYR C C   
2162 O O   . TYR C 75  ? 1.9408 0.8328 1.1927 0.0396  -0.6427 0.1392  75  TYR C O   
2163 C CB  . TYR C 75  ? 1.6860 0.7240 1.0256 0.1391  -0.4871 0.0728  75  TYR C CB  
2164 C CG  . TYR C 75  ? 1.6506 0.7185 0.9990 0.1887  -0.4331 0.0433  75  TYR C CG  
2165 C CD1 . TYR C 75  ? 1.5621 0.7373 0.9877 0.1932  -0.3669 0.0363  75  TYR C CD1 
2166 C CD2 . TYR C 75  ? 1.7385 0.7241 1.0127 0.2302  -0.4518 0.0248  75  TYR C CD2 
2167 C CE1 . TYR C 75  ? 1.5073 0.7079 0.9378 0.2311  -0.3229 0.0143  75  TYR C CE1 
2168 C CE2 . TYR C 75  ? 1.7114 0.7336 0.9967 0.2719  -0.4037 0.0029  75  TYR C CE2 
2169 C CZ  . TYR C 75  ? 1.6451 0.7754 1.0097 0.2689  -0.3403 -0.0010 75  TYR C CZ  
2170 O OH  . TYR C 75  ? 1.5339 0.6959 0.9037 0.3042  -0.2988 -0.0186 75  TYR C OH  
2171 N N   . GLY C 76  ? 1.7405 0.8560 1.1651 -0.0166 -0.5810 0.1847  76  GLY C N   
2172 C CA  . GLY C 76  ? 1.7758 0.8926 1.2029 -0.0739 -0.6318 0.2248  76  GLY C CA  
2173 C C   . GLY C 76  ? 1.8032 0.9272 1.2327 -0.0611 -0.6123 0.2066  76  GLY C C   
2174 O O   . GLY C 76  ? 1.8633 0.9415 1.2603 -0.0964 -0.6637 0.2275  76  GLY C O   
2175 N N   . ILE C 77  ? 1.6760 0.8550 1.1408 -0.0129 -0.5404 0.1692  77  ILE C N   
2176 C CA  . ILE C 77  ? 1.6369 0.8353 1.1108 0.0053  -0.5110 0.1484  77  ILE C CA  
2177 C C   . ILE C 77  ? 1.5940 0.9301 1.1681 -0.0188 -0.4661 0.1688  77  ILE C C   
2178 O O   . ILE C 77  ? 1.5217 0.9425 1.1543 -0.0085 -0.4186 0.1688  77  ILE C O   
2179 C CB  . ILE C 77  ? 1.6564 0.8283 1.0981 0.0717  -0.4658 0.0990  77  ILE C CB  
2180 C CG1 . ILE C 77  ? 1.7684 0.8031 1.0979 0.1081  -0.5115 0.0780  77  ILE C CG1 
2181 C CG2 . ILE C 77  ? 1.6044 0.8150 1.0661 0.0865  -0.4311 0.0820  77  ILE C CG2 
2182 C CD1 . ILE C 77  ? 1.7295 0.7590 1.0310 0.1757  -0.4668 0.0379  77  ILE C CD1 
2183 N N   . THR C 78  ? 1.5360 0.8883 1.1219 -0.0459 -0.4821 0.1845  78  THR C N   
2184 C CA  . THR C 78  ? 1.4446 0.9207 1.1154 -0.0631 -0.4432 0.2031  78  THR C CA  
2185 C C   . THR C 78  ? 1.4944 0.9766 1.1681 -0.0247 -0.3953 0.1639  78  THR C C   
2186 O O   . THR C 78  ? 1.5602 0.9759 1.1861 -0.0201 -0.4184 0.1505  78  THR C O   
2187 C CB  . THR C 78  ? 1.5515 1.0552 1.2392 -0.1236 -0.4943 0.2540  78  THR C CB  
2188 O OG1 . THR C 78  ? 1.6621 1.1527 1.3378 -0.1625 -0.5455 0.2933  78  THR C OG1 
2189 C CG2 . THR C 78  ? 1.4067 1.0511 1.1826 -0.1365 -0.4538 0.2776  78  THR C CG2 
2190 N N   . VAL C 79  ? 1.3685 0.9245 1.0908 0.0030  -0.3323 0.1465  79  VAL C N   
2191 C CA  . VAL C 79  ? 1.3145 0.8892 1.0463 0.0341  -0.2847 0.1146  79  VAL C CA  
2192 C C   . VAL C 79  ? 1.3341 0.9733 1.1117 0.0099  -0.2785 0.1331  79  VAL C C   
2193 O O   . VAL C 79  ? 1.2958 1.0226 1.1300 -0.0066 -0.2638 0.1595  79  VAL C O   
2194 C CB  . VAL C 79  ? 1.3041 0.9233 1.0622 0.0649  -0.2291 0.0945  79  VAL C CB  
2195 C CG1 . VAL C 79  ? 1.2608 0.8973 1.0244 0.0896  -0.1860 0.0670  79  VAL C CG1 
2196 C CG2 . VAL C 79  ? 1.3368 0.8998 1.0539 0.0855  -0.2373 0.0810  79  VAL C CG2 
2197 N N   . LYS C 80  ? 1.3077 0.9045 1.0559 0.0117  -0.2914 0.1204  80  LYS C N   
2198 C CA  . LYS C 80  ? 1.2729 0.9186 1.0565 -0.0105 -0.2897 0.1355  80  LYS C CA  
2199 C C   . LYS C 80  ? 1.2542 0.9707 1.0836 0.0118  -0.2290 0.1176  80  LYS C C   
2200 O O   . LYS C 80  ? 1.2135 1.0087 1.0951 -0.0036 -0.2146 0.1390  80  LYS C O   
2201 C CB  . LYS C 80  ? 1.3611 0.9218 1.0854 -0.0161 -0.3319 0.1280  80  LYS C CB  
2202 C CG  . LYS C 80  ? 1.4018 0.9116 1.0942 -0.0612 -0.4036 0.1638  80  LYS C CG  
2203 C CD  . LYS C 80  ? 1.6301 1.0319 1.2449 -0.0514 -0.4471 0.1563  80  LYS C CD  
2204 N N   . GLU C 81  ? 1.2065 0.8972 1.0128 0.0474  -0.1965 0.0821  81  GLU C N   
2205 C CA  . GLU C 81  ? 1.1452 0.8878 0.9829 0.0643  -0.1458 0.0659  81  GLU C CA  
2206 C C   . GLU C 81  ? 1.1719 0.9489 1.0296 0.0784  -0.1126 0.0626  81  GLU C C   
2207 O O   . GLU C 81  ? 1.1850 0.9316 1.0161 0.0992  -0.1003 0.0439  81  GLU C O   
2208 C CB  . GLU C 81  ? 1.1713 0.8770 0.9724 0.0888  -0.1332 0.0369  81  GLU C CB  
2209 N N   . GLU C 82  ? 1.0789 0.9207 0.9791 0.0698  -0.0995 0.0826  82  GLU C N   
2210 C CA  . GLU C 82  ? 1.0423 0.9142 0.9540 0.0861  -0.0726 0.0823  82  GLU C CA  
2211 C C   . GLU C 82  ? 1.0590 0.9348 0.9662 0.1060  -0.0333 0.0600  82  GLU C C   
2212 O O   . GLU C 82  ? 1.0544 0.9394 0.9578 0.1213  -0.0142 0.0573  82  GLU C O   
2213 C CB  . GLU C 82  ? 1.0393 0.9841 0.9887 0.0769  -0.0774 0.1163  82  GLU C CB  
2214 C CG  . GLU C 82  ? 1.1203 1.0707 1.0760 0.0483  -0.1210 0.1479  82  GLU C CG  
2215 C CD  . GLU C 82  ? 1.3694 1.4123 1.3655 0.0375  -0.1272 0.1902  82  GLU C CD  
2216 O OE1 . GLU C 82  ? 1.2533 1.3619 1.2723 0.0588  -0.0963 0.1952  82  GLU C OE1 
2217 O OE2 . GLU C 82  ? 1.3921 1.4430 1.3924 0.0087  -0.1659 0.2212  82  GLU C OE2 
2218 N N   . ASP C 83  ? 0.9992 0.8639 0.9012 0.1049  -0.0244 0.0455  83  ASP C N   
2219 C CA  . ASP C 83  ? 0.9696 0.8369 0.8651 0.1158  0.0068  0.0293  83  ASP C CA  
2220 C C   . ASP C 83  ? 1.0121 0.8442 0.8772 0.1219  0.0142  0.0098  83  ASP C C   
2221 O O   . ASP C 83  ? 1.0135 0.8488 0.8711 0.1232  0.0350  0.0011  83  ASP C O   
2222 C CB  . ASP C 83  ? 0.9668 0.8669 0.8851 0.1091  0.0147  0.0336  83  ASP C CB  
2223 N N   . GLN C 84  ? 0.9583 0.7594 0.8017 0.1264  -0.0053 0.0059  84  GLN C N   
2224 C CA  . GLN C 84  ? 0.9461 0.7269 0.7574 0.1404  -0.0001 -0.0081 84  GLN C CA  
2225 C C   . GLN C 84  ? 0.9598 0.7402 0.7588 0.1467  0.0192  -0.0122 84  GLN C C   
2226 O O   . GLN C 84  ? 0.9275 0.7025 0.7316 0.1458  0.0195  -0.0075 84  GLN C O   
2227 C CB  . GLN C 84  ? 0.9864 0.7261 0.7657 0.1521  -0.0301 -0.0106 84  GLN C CB  
2228 C CG  . GLN C 84  ? 1.0382 0.7514 0.8073 0.1548  -0.0464 -0.0056 84  GLN C CG  
2229 C CD  . GLN C 84  ? 1.2254 0.8844 0.9551 0.1634  -0.0843 -0.0060 84  GLN C CD  
2230 O OE1 . GLN C 84  ? 1.2773 0.9065 0.9631 0.1898  -0.0893 -0.0184 84  GLN C OE1 
2231 N NE2 . GLN C 84  ? 1.1563 0.8013 0.8948 0.1424  -0.1150 0.0102  84  GLN C NE2 
2232 N N   . PRO C 85  ? 0.9153 0.7056 0.6962 0.1524  0.0335  -0.0177 85  PRO C N   
2233 C CA  . PRO C 85  ? 0.9117 0.7013 0.6778 0.1524  0.0462  -0.0167 85  PRO C CA  
2234 C C   . PRO C 85  ? 1.0351 0.8027 0.7792 0.1709  0.0341  -0.0192 85  PRO C C   
2235 O O   . PRO C 85  ? 1.0494 0.7947 0.7853 0.1827  0.0135  -0.0220 85  PRO C O   
2236 C CB  . PRO C 85  ? 0.9213 0.7433 0.6791 0.1471  0.0610  -0.0137 85  PRO C CB  
2237 C CG  . PRO C 85  ? 0.9888 0.8234 0.7440 0.1609  0.0542  -0.0177 85  PRO C CG  
2238 C CD  . PRO C 85  ? 0.9300 0.7391 0.7010 0.1591  0.0368  -0.0212 85  PRO C CD  
2239 N N   . LEU C 86  ? 1.0166 0.7848 0.7459 0.1722  0.0433  -0.0171 86  LEU C N   
2240 C CA  . LEU C 86  ? 1.0425 0.7921 0.7499 0.1918  0.0337  -0.0195 86  LEU C CA  
2241 C C   . LEU C 86  ? 1.1243 0.9053 0.8087 0.2061  0.0426  -0.0154 86  LEU C C   
2242 O O   . LEU C 86  ? 1.1320 0.9493 0.8199 0.1897  0.0581  -0.0057 86  LEU C O   
2243 C CB  . LEU C 86  ? 1.0478 0.7746 0.7563 0.1857  0.0347  -0.0184 86  LEU C CB  
2244 C CG  . LEU C 86  ? 1.0888 0.8012 0.8187 0.1776  0.0278  -0.0168 86  LEU C CG  
2245 C CD1 . LEU C 86  ? 1.0902 0.7830 0.8122 0.1811  0.0282  -0.0159 86  LEU C CD1 
2246 C CD2 . LEU C 86  ? 1.0898 0.7925 0.8287 0.1814  0.0050  -0.0152 86  LEU C CD2 
2247 N N   . LEU C 87  ? 1.0833 0.8522 0.7398 0.2373  0.0304  -0.0198 87  LEU C N   
2248 C CA  . LEU C 87  ? 1.0836 0.8938 0.7139 0.2615  0.0387  -0.0129 87  LEU C CA  
2249 C C   . LEU C 87  ? 1.1569 0.9636 0.7802 0.2608  0.0425  -0.0079 87  LEU C C   
2250 O O   . LEU C 87  ? 1.1391 0.8968 0.7579 0.2660  0.0296  -0.0164 87  LEU C O   
2251 C CB  . LEU C 87  ? 1.1019 0.8969 0.6905 0.3076  0.0216  -0.0214 87  LEU C CB  
2252 C CG  . LEU C 87  ? 1.1146 0.8920 0.6985 0.3124  0.0093  -0.0293 87  LEU C CG  
2253 C CD1 . LEU C 87  ? 1.1412 0.8785 0.6653 0.3613  -0.0152 -0.0392 87  LEU C CD1 
2254 C CD2 . LEU C 87  ? 1.0996 0.9420 0.7039 0.2994  0.0308  -0.0202 87  LEU C CD2 
2255 N N   . ILE C 88  ? 1.1596 1.0206 0.7827 0.2500  0.0585  0.0090  88  ILE C N   
2256 C CA  . ILE C 88  ? 1.1865 1.0504 0.8020 0.2436  0.0623  0.0179  88  ILE C CA  
2257 C C   . ILE C 88  ? 1.2933 1.2028 0.8813 0.2815  0.0641  0.0273  88  ILE C C   
2258 O O   . ILE C 88  ? 1.3046 1.2851 0.8862 0.2933  0.0732  0.0431  88  ILE C O   
2259 C CB  . ILE C 88  ? 1.2222 1.1069 0.8499 0.1974  0.0721  0.0352  88  ILE C CB  
2260 N N   . HIS C 89  ? 1.2743 1.1472 0.8440 0.3043  0.0553  0.0189  89  HIS C N   
2261 C CA  . HIS C 89  ? 1.3007 1.2106 0.8393 0.3454  0.0562  0.0273  89  HIS C CA  
2262 C C   . HIS C 89  ? 1.3644 1.2786 0.9092 0.3232  0.0618  0.0385  89  HIS C C   
2263 O O   . HIS C 89  ? 1.3512 1.1992 0.8989 0.3145  0.0534  0.0242  89  HIS C O   
2264 C CB  . HIS C 89  ? 1.3473 1.1981 0.8464 0.3972  0.0356  0.0065  89  HIS C CB  
2265 C CG  . HIS C 89  ? 1.4285 1.3051 0.8887 0.4447  0.0351  0.0127  89  HIS C CG  
2266 N ND1 . HIS C 89  ? 1.4773 1.2961 0.9206 0.4581  0.0226  0.0018  89  HIS C ND1 
2267 C CD2 . HIS C 89  ? 1.4673 1.4310 0.9049 0.4809  0.0472  0.0319  89  HIS C CD2 
2268 C CE1 . HIS C 89  ? 1.4973 1.3615 0.9053 0.5045  0.0266  0.0118  89  HIS C CE1 
2269 N NE2 . HIS C 89  ? 1.4985 1.4556 0.9021 0.5212  0.0419  0.0315  89  HIS C NE2 
2270 N N   . ARG C 90  ? 1.3480 1.3446 0.8942 0.3113  0.0743  0.0675  90  ARG C N   
2271 C CA  . ARG C 90  ? 1.3603 1.3698 0.9080 0.2846  0.0772  0.0849  90  ARG C CA  
2272 C C   . ARG C 90  ? 1.4512 1.5047 0.9734 0.3307  0.0789  0.0946  90  ARG C C   
2273 O O   . ARG C 90  ? 1.4557 1.6084 0.9701 0.3498  0.0881  0.1218  90  ARG C O   
2274 C CB  . ARG C 90  ? 1.3457 1.4144 0.9082 0.2301  0.0832  0.1174  90  ARG C CB  
2275 C CG  . ARG C 90  ? 1.3124 1.3297 0.8908 0.1874  0.0796  0.1078  90  ARG C CG  
2276 C CD  . ARG C 90  ? 1.4374 1.5237 1.0231 0.1458  0.0825  0.1408  90  ARG C CD  
2277 N NE  . ARG C 90  ? 1.5351 1.5621 1.1265 0.1045  0.0762  0.1325  90  ARG C NE  
2278 C CZ  . ARG C 90  ? 1.7056 1.7706 1.3022 0.0679  0.0752  0.1543  90  ARG C CZ  
2279 N NH1 . ARG C 90  ? 1.4722 1.6455 1.0744 0.0649  0.0812  0.1886  90  ARG C NH1 
2280 N NH2 . ARG C 90  ? 1.6381 1.6371 1.2317 0.0371  0.0677  0.1436  90  ARG C NH2 
2281 N N   . PRO C 91  ? 1.4389 1.4265 0.9462 0.3531  0.0702  0.0747  91  PRO C N   
2282 C CA  . PRO C 91  ? 1.4601 1.4844 0.9384 0.4020  0.0709  0.0825  91  PRO C CA  
2283 C C   . PRO C 91  ? 1.4756 1.5562 0.9617 0.3731  0.0787  0.1124  91  PRO C C   
2284 O O   . PRO C 91  ? 1.4671 1.6504 0.9450 0.3919  0.0876  0.1433  91  PRO C O   
2285 C CB  . PRO C 91  ? 1.5072 1.4278 0.9656 0.4311  0.0543  0.0491  91  PRO C CB  
2286 C CG  . PRO C 91  ? 1.5424 1.3860 1.0277 0.3890  0.0471  0.0298  91  PRO C CG  
2287 C CD  . PRO C 91  ? 1.4591 1.3441 0.9740 0.3373  0.0592  0.0474  91  PRO C CD  
2288 N N   . GLU C 105 ? 1.1904 0.9047 0.7718 0.2098  0.0525  0.0134  105 GLU C N   
2289 C CA  . GLU C 105 ? 1.1976 0.8861 0.7702 0.2390  0.0456  0.0031  105 GLU C CA  
2290 C C   . GLU C 105 ? 1.2360 0.9049 0.8137 0.2662  0.0336  -0.0111 105 GLU C C   
2291 O O   . GLU C 105 ? 1.2321 0.8590 0.8184 0.2649  0.0241  -0.0209 105 GLU C O   
2292 C CB  . GLU C 105 ? 1.2278 0.9554 0.7824 0.2536  0.0494  0.0162  105 GLU C CB  
2293 N N   . ILE C 106 ? 1.1846 0.8831 0.7521 0.2902  0.0312  -0.0098 106 ILE C N   
2294 C CA  . ILE C 106 ? 1.1838 0.8483 0.7435 0.3122  0.0126  -0.0223 106 ILE C CA  
2295 C C   . ILE C 106 ? 1.2408 0.9200 0.8220 0.2930  0.0156  -0.0217 106 ILE C C   
2296 O O   . ILE C 106 ? 1.2263 0.9553 0.8101 0.2890  0.0289  -0.0127 106 ILE C O   
2297 C CB  . ILE C 106 ? 1.2478 0.9095 0.7650 0.3607  0.0003  -0.0259 106 ILE C CB  
2298 C CG1 . ILE C 106 ? 1.2725 0.9081 0.7681 0.3807  -0.0059 -0.0286 106 ILE C CG1 
2299 C CG2 . ILE C 106 ? 1.2586 0.8710 0.7542 0.3789  -0.0259 -0.0374 106 ILE C CG2 
2300 N N   . LEU C 107 ? 1.1941 0.8371 0.7926 0.2792  0.0032  -0.0280 107 LEU C N   
2301 C CA  . LEU C 107 ? 1.1822 0.8365 0.8025 0.2618  0.0043  -0.0274 107 LEU C CA  
2302 C C   . LEU C 107 ? 1.2350 0.8558 0.8414 0.2761  -0.0220 -0.0331 107 LEU C C   
2303 O O   . LEU C 107 ? 1.2416 0.8198 0.8417 0.2771  -0.0447 -0.0343 107 LEU C O   
2304 C CB  . LEU C 107 ? 1.1644 0.8158 0.8147 0.2327  0.0120  -0.0246 107 LEU C CB  
2305 C CG  . LEU C 107 ? 1.2250 0.8909 0.8743 0.2160  0.0312  -0.0194 107 LEU C CG  
2306 C CD1 . LEU C 107 ? 1.2236 0.8689 0.8831 0.2034  0.0330  -0.0199 107 LEU C CD1 
2307 C CD2 . LEU C 107 ? 1.2336 0.9371 0.8852 0.2019  0.0437  -0.0123 107 LEU C CD2 
2308 N N   . LEU C 108 ? 1.1639 0.8020 0.7599 0.2865  -0.0221 -0.0344 108 LEU C N   
2309 C CA  . LEU C 108 ? 1.1769 0.7750 0.7464 0.3013  -0.0505 -0.0399 108 LEU C CA  
2310 C C   . LEU C 108 ? 1.1596 0.7740 0.7585 0.2770  -0.0487 -0.0373 108 LEU C C   
2311 O O   . LEU C 108 ? 1.0919 0.7552 0.7182 0.2621  -0.0226 -0.0337 108 LEU C O   
2312 C CB  . LEU C 108 ? 1.2239 0.8212 0.7393 0.3478  -0.0558 -0.0456 108 LEU C CB  
2313 C CG  . LEU C 108 ? 1.2998 0.9023 0.7857 0.3787  -0.0506 -0.0457 108 LEU C CG  
2314 C CD1 . LEU C 108 ? 1.3105 0.9589 0.7581 0.4232  -0.0399 -0.0436 108 LEU C CD1 
2315 C CD2 . LEU C 108 ? 1.3526 0.8766 0.8028 0.3933  -0.0839 -0.0528 108 LEU C CD2 
2316 N N   . LEU C 109 ? 1.1535 0.7238 0.7422 0.2713  -0.0798 -0.0371 109 LEU C N   
2317 C CA  . LEU C 109 ? 1.1339 0.7165 0.7474 0.2492  -0.0830 -0.0330 109 LEU C CA  
2318 C C   . LEU C 109 ? 1.2141 0.7857 0.7877 0.2751  -0.0916 -0.0412 109 LEU C C   
2319 O O   . LEU C 109 ? 1.2659 0.7802 0.7805 0.3043  -0.1215 -0.0478 109 LEU C O   
2320 C CB  . LEU C 109 ? 1.1537 0.7032 0.7791 0.2228  -0.1158 -0.0214 109 LEU C CB  
2321 C CG  . LEU C 109 ? 1.2132 0.7770 0.8731 0.2020  -0.1130 -0.0095 109 LEU C CG  
2322 C CD1 . LEU C 109 ? 1.2192 0.7760 0.8971 0.1724  -0.1443 0.0102  109 LEU C CD1 
2323 C CD2 . LEU C 109 ? 1.2292 0.8511 0.9323 0.1918  -0.0730 -0.0084 109 LEU C CD2 
2324 N N   . PRO C 110 ? 1.1542 0.7733 0.7530 0.2663  -0.0692 -0.0408 110 PRO C N   
2325 C CA  . PRO C 110 ? 1.1770 0.7911 0.7368 0.2937  -0.0762 -0.0481 110 PRO C CA  
2326 C C   . PRO C 110 ? 1.2995 0.8371 0.8167 0.2979  -0.1217 -0.0512 110 PRO C C   
2327 O O   . PRO C 110 ? 1.3725 0.8718 0.8243 0.3374  -0.1406 -0.0609 110 PRO C O   
2328 C CB  . PRO C 110 ? 1.1380 0.8149 0.7453 0.2702  -0.0466 -0.0438 110 PRO C CB  
2329 C CG  . PRO C 110 ? 1.1353 0.8506 0.7877 0.2439  -0.0202 -0.0364 110 PRO C CG  
2330 C CD  . PRO C 110 ? 1.1015 0.7769 0.7567 0.2353  -0.0377 -0.0342 110 PRO C CD  
2331 N N   . GLU C 111 ? 1.2264 0.7415 0.7739 0.2586  -0.1425 -0.0404 111 GLU C N   
2332 C CA  . GLU C 111 ? 1.2772 0.7204 0.7896 0.2465  -0.1928 -0.0348 111 GLU C CA  
2333 C C   . GLU C 111 ? 1.3998 0.7531 0.8332 0.2749  -0.2349 -0.0403 111 GLU C C   
2334 O O   . GLU C 111 ? 1.4947 0.7670 0.8655 0.2804  -0.2822 -0.0409 111 GLU C O   
2335 C CB  . GLU C 111 ? 1.2539 0.7221 0.8281 0.1949  -0.2000 -0.0131 111 GLU C CB  
2336 C CG  . GLU C 111 ? 1.3752 0.7879 0.9270 0.1666  -0.2535 0.0031  111 GLU C CG  
2337 C CD  . GLU C 111 ? 1.6353 1.0936 1.2501 0.1175  -0.2609 0.0326  111 GLU C CD  
2338 O OE1 . GLU C 111 ? 1.5710 1.1120 1.2518 0.1067  -0.2197 0.0374  111 GLU C OE1 
2339 O OE2 . GLU C 111 ? 1.5963 1.0085 1.1893 0.0906  -0.3110 0.0537  111 GLU C OE2 
2340 N N   . LEU C 112 ? 1.3345 0.6945 0.7652 0.2920  -0.2213 -0.0438 112 LEU C N   
2341 C CA  . LEU C 112 ? 1.4082 0.6838 0.7647 0.3209  -0.2592 -0.0492 112 LEU C CA  
2342 C C   . LEU C 112 ? 1.5133 0.7885 0.8112 0.3854  -0.2437 -0.0667 112 LEU C C   
2343 O O   . LEU C 112 ? 1.5762 0.7803 0.8016 0.4216  -0.2732 -0.0739 112 LEU C O   
2344 C CB  . LEU C 112 ? 1.3730 0.6538 0.7657 0.2937  -0.2605 -0.0373 112 LEU C CB  
2345 C CG  . LEU C 112 ? 1.3684 0.6804 0.8281 0.2352  -0.2672 -0.0142 112 LEU C CG  
2346 C CD1 . LEU C 112 ? 1.3456 0.6762 0.8371 0.2208  -0.2601 -0.0044 112 LEU C CD1 
2347 C CD2 . LEU C 112 ? 1.4520 0.6933 0.8749 0.2085  -0.3264 0.0006  112 LEU C CD2 
2348 N N   . SER C 113 ? 1.4375 0.7950 0.7633 0.4007  -0.1998 -0.0706 113 SER C N   
2349 C CA  . SER C 113 ? 1.4504 0.8430 0.7336 0.4594  -0.1781 -0.0790 113 SER C CA  
2350 C C   . SER C 113 ? 1.5426 0.9199 0.7664 0.4999  -0.1891 -0.0878 113 SER C C   
2351 O O   . SER C 113 ? 1.5113 0.9019 0.7635 0.4728  -0.1870 -0.0859 113 SER C O   
2352 C CB  . SER C 113 ? 1.4000 0.9058 0.7553 0.4435  -0.1233 -0.0700 113 SER C CB  
2353 O OG  . SER C 113 ? 1.4071 0.9225 0.8166 0.4034  -0.1135 -0.0628 113 SER C OG  
2354 N N   . PHE C 114 ? 1.5923 0.9422 0.7287 0.5699  -0.2009 -0.0972 114 PHE C N   
2355 C CA  . PHE C 114 ? 1.6691 0.9970 0.7261 0.6268  -0.2145 -0.1072 114 PHE C CA  
2356 C C   . PHE C 114 ? 1.7502 1.1731 0.7867 0.6885  -0.1779 -0.1038 114 PHE C C   
2357 O O   . PHE C 114 ? 1.7551 1.2003 0.7814 0.7139  -0.1681 -0.1002 114 PHE C O   
2358 C CB  . PHE C 114 ? 1.8258 1.0003 0.7635 0.6642  -0.2809 -0.1212 114 PHE C CB  
2359 C CG  . PHE C 114 ? 1.8515 0.9388 0.8061 0.5973  -0.3238 -0.1166 114 PHE C CG  
2360 C CD1 . PHE C 114 ? 1.8448 0.9086 0.8449 0.5453  -0.3366 -0.1061 114 PHE C CD1 
2361 C CD2 . PHE C 114 ? 1.9035 0.9458 0.8344 0.5835  -0.3496 -0.1188 114 PHE C CD2 
2362 C CE1 . PHE C 114 ? 1.8590 0.8674 0.8831 0.4806  -0.3741 -0.0937 114 PHE C CE1 
2363 C CE2 . PHE C 114 ? 1.9427 0.9212 0.8957 0.5164  -0.3894 -0.1074 114 PHE C CE2 
2364 C CZ  . PHE C 114 ? 1.8899 0.8581 0.8912 0.4650  -0.4011 -0.0928 114 PHE C CZ  
2365 N N   . MET C 115 ? 1.7153 1.1988 0.7428 0.7145  -0.1593 -0.1023 115 MET C N   
2366 C CA  . MET C 115 ? 1.7101 1.3045 0.7176 0.7748  -0.1249 -0.0921 115 MET C CA  
2367 C C   . MET C 115 ? 1.8656 1.3893 0.7444 0.8689  -0.1570 -0.1048 115 MET C C   
2368 O O   . MET C 115 ? 1.9523 1.3338 0.7451 0.8895  -0.2091 -0.1241 115 MET C O   
2369 C CB  . MET C 115 ? 1.7073 1.3835 0.7377 0.7755  -0.1001 -0.0853 115 MET C CB  
2370 C CG  . MET C 115 ? 1.6424 1.3694 0.7887 0.6846  -0.0743 -0.0751 115 MET C CG  
2371 S SD  . MET C 115 ? 1.6048 1.5128 0.8340 0.6619  -0.0153 -0.0441 115 MET C SD  
2372 C CE  . MET C 115 ? 1.5457 1.4684 0.8081 0.6400  -0.0058 -0.0334 115 MET C CE  
2373 N N   . THR C 116 ? 1.8292 1.4457 0.6903 0.9237  -0.1304 -0.0920 116 THR C N   
2374 C CA  . THR C 116 ? 1.9543 1.5136 0.6870 1.0249  -0.1579 -0.1029 116 THR C CA  
2375 C C   . THR C 116 ? 2.0881 1.6738 0.7347 1.1071  -0.1594 -0.1062 116 THR C C   
2376 O O   . THR C 116 ? 2.2288 1.7430 0.7434 1.2030  -0.1905 -0.1200 116 THR C O   
2377 C CB  . THR C 116 ? 1.9535 1.5921 0.7031 1.0470  -0.1331 -0.0871 116 THR C CB  
2378 O OG1 . THR C 116 ? 1.7924 1.6114 0.6390 1.0167  -0.0774 -0.0558 116 THR C OG1 
2379 C CG2 . THR C 116 ? 1.9160 1.4708 0.7052 0.9871  -0.1508 -0.0940 116 THR C CG2 
2380 N N   . GLY C 117 ? 1.9618 1.6387 0.6789 1.0682  -0.1291 -0.0947 117 GLY C N   
2381 C CA  . GLY C 117 ? 2.0049 1.7207 0.6679 1.1242  -0.1247 -0.0955 117 GLY C CA  
2382 C C   . GLY C 117 ? 2.0019 1.7179 0.7483 1.0407  -0.1173 -0.0968 117 GLY C C   
2383 O O   . GLY C 117 ? 1.9980 1.5957 0.7646 0.9787  -0.1482 -0.1119 117 GLY C O   
2384 N N   . ILE C 118 ? 1.8980 1.7528 0.6991 1.0328  -0.0766 -0.0774 118 ILE C N   
2385 C CA  . ILE C 118 ? 2.0231 2.0434 0.8115 1.0973  -0.0385 -0.0505 118 ILE C CA  
2386 C C   . ILE C 118 ? 2.5458 2.5369 1.3260 1.0825  -0.0521 -0.0591 118 ILE C C   
2387 O O   . ILE C 118 ? 2.3654 2.2319 0.9022 1.2761  -0.0994 -0.0882 118 ILE C O   
2388 C CB  . ILE C 118 ? 1.9177 2.1070 0.8393 1.0199  0.0127  -0.0158 118 ILE C CB  
2389 C CG1 . ILE C 118 ? 1.8161 2.0065 0.8428 0.9235  0.0243  -0.0065 118 ILE C CG1 
2390 C CG2 . ILE C 118 ? 1.9293 2.3061 0.8415 1.0798  0.0490  0.0218  118 ILE C CG2 
2391 C CD1 . ILE C 118 ? 1.6988 1.9952 0.8453 0.8316  0.0595  0.0192  118 ILE C CD1 
2392 N N   . ASP D 3   ? 1.2635 1.8708 0.7728 -0.5324 -0.0514 0.0732  3   ASP D N   
2393 C CA  . ASP D 3   ? 1.1966 1.9295 0.7622 -0.4647 -0.0258 0.0551  3   ASP D CA  
2394 C C   . ASP D 3   ? 1.1313 1.7533 0.7347 -0.3762 -0.0237 0.0349  3   ASP D C   
2395 O O   . ASP D 3   ? 1.1200 1.6101 0.6936 -0.3820 -0.0369 0.0359  3   ASP D O   
2396 C CB  . ASP D 3   ? 1.1831 2.0814 0.7952 -0.4442 -0.0089 0.0497  3   ASP D CB  
2397 C CG  . ASP D 3   ? 1.2849 2.3631 0.9291 -0.4021 0.0127  0.0349  3   ASP D CG  
2398 O OD1 . ASP D 3   ? 1.2317 2.3984 0.9248 -0.3385 0.0245  0.0179  3   ASP D OD1 
2399 O OD2 . ASP D 3   ? 1.3643 2.4938 0.9800 -0.4307 0.0157  0.0390  3   ASP D OD2 
2400 N N   . CYS D 4   ? 1.0016 1.6763 0.6639 -0.2979 -0.0099 0.0173  4   CYS D N   
2401 C CA  . CYS D 4   ? 0.9581 1.5396 0.6533 -0.2183 -0.0100 0.0006  4   CYS D CA  
2402 C C   . CYS D 4   ? 0.9705 1.3990 0.6610 -0.2259 -0.0252 0.0053  4   CYS D C   
2403 O O   . CYS D 4   ? 0.9777 1.4141 0.6721 -0.2475 -0.0281 0.0115  4   CYS D O   
2404 C CB  . CYS D 4   ? 0.9279 1.6092 0.6703 -0.1454 0.0026  -0.0170 4   CYS D CB  
2405 S SG  . CYS D 4   ? 0.9525 1.5135 0.7274 -0.0578 -0.0032 -0.0332 4   CYS D SG  
2406 N N   . VAL D 5   ? 0.8839 1.1795 0.5636 -0.2090 -0.0358 0.0018  5   VAL D N   
2407 C CA  . VAL D 5   ? 0.8621 1.0173 0.5341 -0.2105 -0.0515 0.0029  5   VAL D CA  
2408 C C   . VAL D 5   ? 0.8741 1.0334 0.5896 -0.1715 -0.0471 -0.0030 5   VAL D C   
2409 O O   . VAL D 5   ? 0.8961 1.0050 0.5996 -0.1967 -0.0573 0.0030  5   VAL D O   
2410 C CB  . VAL D 5   ? 0.8994 0.9384 0.5643 -0.1828 -0.0604 -0.0045 5   VAL D CB  
2411 C CG1 . VAL D 5   ? 0.8915 0.8042 0.5495 -0.1799 -0.0770 -0.0064 5   VAL D CG1 
2412 C CG2 . VAL D 5   ? 0.9395 0.9643 0.5565 -0.2233 -0.0665 0.0012  5   VAL D CG2 
2413 N N   . LEU D 6   ? 0.7837 1.0004 0.5417 -0.1110 -0.0346 -0.0148 6   LEU D N   
2414 C CA  . LEU D 6   ? 0.7486 0.9668 0.5420 -0.0759 -0.0320 -0.0202 6   LEU D CA  
2415 C C   . LEU D 6   ? 0.7787 1.0760 0.5730 -0.1106 -0.0281 -0.0128 6   LEU D C   
2416 O O   . LEU D 6   ? 0.7627 1.0156 0.5657 -0.1133 -0.0329 -0.0105 6   LEU D O   
2417 C CB  . LEU D 6   ? 0.7168 0.9684 0.5399 -0.0063 -0.0258 -0.0342 6   LEU D CB  
2418 C CG  . LEU D 6   ? 0.7308 0.9501 0.5823 0.0319  -0.0280 -0.0398 6   LEU D CG  
2419 C CD1 . LEU D 6   ? 0.7069 0.8067 0.5599 0.0233  -0.0376 -0.0354 6   LEU D CD1 
2420 C CD2 . LEU D 6   ? 0.7217 0.9542 0.5836 0.0951  -0.0295 -0.0525 6   LEU D CD2 
2421 N N   . ASP D 7   ? 0.7871 1.2021 0.5698 -0.1405 -0.0203 -0.0084 7   ASP D N   
2422 C CA  . ASP D 7   ? 0.8021 1.3057 0.5821 -0.1813 -0.0174 0.0005  7   ASP D CA  
2423 C C   . ASP D 7   ? 0.8821 1.2984 0.6210 -0.2463 -0.0340 0.0173  7   ASP D C   
2424 O O   . ASP D 7   ? 0.8600 1.2711 0.6041 -0.2573 -0.0377 0.0218  7   ASP D O   
2425 C CB  . ASP D 7   ? 0.8499 1.5099 0.6228 -0.2042 -0.0064 0.0021  7   ASP D CB  
2426 C CG  . ASP D 7   ? 1.0341 1.8021 0.8424 -0.1332 0.0067  -0.0178 7   ASP D CG  
2427 O OD1 . ASP D 7   ? 1.0195 1.7596 0.8575 -0.0742 0.0066  -0.0306 7   ASP D OD1 
2428 O OD2 . ASP D 7   ? 1.1442 2.0229 0.9446 -0.1355 0.0147  -0.0214 7   ASP D OD2 
2429 N N   . VAL D 8   ? 0.9010 1.2370 0.5938 -0.2843 -0.0472 0.0248  8   VAL D N   
2430 C CA  . VAL D 8   ? 0.9535 1.1807 0.5895 -0.3406 -0.0710 0.0379  8   VAL D CA  
2431 C C   . VAL D 8   ? 0.9949 1.1145 0.6474 -0.3031 -0.0797 0.0303  8   VAL D C   
2432 O O   . VAL D 8   ? 1.0321 1.1185 0.6634 -0.3293 -0.0924 0.0379  8   VAL D O   
2433 C CB  . VAL D 8   ? 1.0504 1.2052 0.6306 -0.3769 -0.0855 0.0431  8   VAL D CB  
2434 C CG1 . VAL D 8   ? 1.1153 1.1400 0.6237 -0.4279 -0.1173 0.0534  8   VAL D CG1 
2435 C CG2 . VAL D 8   ? 1.0667 1.3418 0.6286 -0.4201 -0.0761 0.0521  8   VAL D CG2 
2436 N N   . MET D 9   ? 0.9203 0.9960 0.6106 -0.2420 -0.0729 0.0158  9   MET D N   
2437 C CA  . MET D 9   ? 0.8967 0.8917 0.6110 -0.2015 -0.0777 0.0073  9   MET D CA  
2438 C C   . MET D 9   ? 0.9210 0.9713 0.6702 -0.1857 -0.0687 0.0070  9   MET D C   
2439 O O   . MET D 9   ? 0.9187 0.9084 0.6614 -0.1870 -0.0793 0.0078  9   MET D O   
2440 C CB  . MET D 9   ? 0.8868 0.8500 0.6352 -0.1453 -0.0706 -0.0055 9   MET D CB  
2441 C CG  . MET D 9   ? 0.9600 0.8355 0.6761 -0.1529 -0.0835 -0.0077 9   MET D CG  
2442 S SD  . MET D 9   ? 0.9733 0.8151 0.7312 -0.0886 -0.0765 -0.0204 9   MET D SD  
2443 C CE  . MET D 9   ? 0.9715 0.7017 0.6844 -0.1053 -0.0957 -0.0231 9   MET D CE  
2444 N N   . HIS D 10  ? 0.8705 1.0360 0.6532 -0.1679 -0.0511 0.0044  10  HIS D N   
2445 C CA  . HIS D 10  ? 0.8493 1.0739 0.6635 -0.1508 -0.0429 0.0025  10  HIS D CA  
2446 C C   . HIS D 10  ? 0.9395 1.1700 0.7235 -0.2059 -0.0527 0.0164  10  HIS D C   
2447 O O   . HIS D 10  ? 0.9275 1.1331 0.7233 -0.1968 -0.0556 0.0164  10  HIS D O   
2448 C CB  . HIS D 10  ? 0.8420 1.1933 0.6862 -0.1203 -0.0266 -0.0058 10  HIS D CB  
2449 C CG  . HIS D 10  ? 0.8756 1.2148 0.7465 -0.0550 -0.0216 -0.0208 10  HIS D CG  
2450 N ND1 . HIS D 10  ? 0.8924 1.1302 0.7752 -0.0239 -0.0275 -0.0252 10  HIS D ND1 
2451 C CD2 . HIS D 10  ? 0.8937 1.3110 0.7752 -0.0166 -0.0141 -0.0320 10  HIS D CD2 
2452 C CE1 . HIS D 10  ? 0.8678 1.1157 0.7636 0.0260  -0.0253 -0.0362 10  HIS D CE1 
2453 N NE2 . HIS D 10  ? 0.8773 1.2263 0.7707 0.0362  -0.0185 -0.0418 10  HIS D NE2 
2454 N N   . ALA D 11  ? 0.9335 1.1917 0.6726 -0.2662 -0.0603 0.0295  11  ALA D N   
2455 C CA  . ALA D 11  ? 0.9666 1.2214 0.6612 -0.3292 -0.0755 0.0463  11  ALA D CA  
2456 C C   . ALA D 11  ? 1.0855 1.1947 0.7394 -0.3385 -0.1002 0.0489  11  ALA D C   
2457 O O   . ALA D 11  ? 1.1057 1.1958 0.7474 -0.3529 -0.1100 0.0552  11  ALA D O   
2458 C CB  . ALA D 11  ? 1.0190 1.3302 0.6665 -0.3954 -0.0809 0.0609  11  ALA D CB  
2459 N N   . ILE D 12  ? 1.0821 1.0907 0.7156 -0.3239 -0.1111 0.0420  12  ILE D N   
2460 C CA  . ILE D 12  ? 1.1231 0.9974 0.7172 -0.3199 -0.1364 0.0388  12  ILE D CA  
2461 C C   . ILE D 12  ? 1.1134 0.9783 0.7608 -0.2637 -0.1267 0.0272  12  ILE D C   
2462 O O   . ILE D 12  ? 1.1030 0.9063 0.7252 -0.2662 -0.1437 0.0281  12  ILE D O   
2463 C CB  . ILE D 12  ? 1.1874 0.9687 0.7500 -0.3124 -0.1499 0.0310  12  ILE D CB  
2464 C CG1 . ILE D 12  ? 1.2484 1.0373 0.7537 -0.3720 -0.1601 0.0434  12  ILE D CG1 
2465 C CG2 . ILE D 12  ? 1.2321 0.8821 0.7513 -0.2991 -0.1786 0.0231  12  ILE D CG2 
2466 C CD1 . ILE D 12  ? 1.2725 1.0195 0.7744 -0.3544 -0.1593 0.0343  12  ILE D CD1 
2467 N N   . TYR D 13  ? 1.0232 0.9467 0.7368 -0.2145 -0.1021 0.0169  13  TYR D N   
2468 C CA  . TYR D 13  ? 0.9904 0.9123 0.7524 -0.1661 -0.0923 0.0074  13  TYR D CA  
2469 C C   . TYR D 13  ? 1.0422 1.0072 0.8110 -0.1782 -0.0904 0.0139  13  TYR D C   
2470 O O   . TYR D 13  ? 1.0333 0.9510 0.8029 -0.1640 -0.0977 0.0112  13  TYR D O   
2471 C CB  . TYR D 13  ? 0.9633 0.9374 0.7785 -0.1203 -0.0718 -0.0021 13  TYR D CB  
2472 C CG  . TYR D 13  ? 0.9763 0.9469 0.8325 -0.0783 -0.0644 -0.0095 13  TYR D CG  
2473 C CD1 . TYR D 13  ? 1.0080 0.9081 0.8714 -0.0531 -0.0704 -0.0165 13  TYR D CD1 
2474 C CD2 . TYR D 13  ? 0.9618 1.0030 0.8460 -0.0659 -0.0529 -0.0097 13  TYR D CD2 
2475 C CE1 . TYR D 13  ? 1.0101 0.9114 0.9063 -0.0223 -0.0646 -0.0211 13  TYR D CE1 
2476 C CE2 . TYR D 13  ? 0.9420 0.9726 0.8560 -0.0322 -0.0487 -0.0154 13  TYR D CE2 
2477 C CZ  . TYR D 13  ? 1.0691 1.0304 0.9882 -0.0135 -0.0542 -0.0199 13  TYR D CZ  
2478 O OH  . TYR D 13  ? 1.1319 1.0878 1.0763 0.0127  -0.0506 -0.0237 13  TYR D OH  
2479 N N   . GLN D 14  ? 0.9975 1.0582 0.7704 -0.2040 -0.0809 0.0218  14  GLN D N   
2480 C CA  . GLN D 14  ? 0.9808 1.1000 0.7603 -0.2204 -0.0783 0.0288  14  GLN D CA  
2481 C C   . GLN D 14  ? 1.0587 1.1045 0.7827 -0.2620 -0.1029 0.0406  14  GLN D C   
2482 O O   . GLN D 14  ? 1.0330 1.0727 0.7664 -0.2535 -0.1047 0.0414  14  GLN D O   
2483 C CB  . GLN D 14  ? 0.9957 1.2412 0.7828 -0.2449 -0.0659 0.0343  14  GLN D CB  
2484 C CG  . GLN D 14  ? 1.1755 1.5229 1.0128 -0.2109 -0.0479 0.0262  14  GLN D CG  
2485 C CD  . GLN D 14  ? 1.2552 1.5607 1.1316 -0.1521 -0.0418 0.0129  14  GLN D CD  
2486 O OE1 . GLN D 14  ? 1.1364 1.4156 1.0174 -0.1498 -0.0455 0.0148  14  GLN D OE1 
2487 N NE2 . GLN D 14  ? 1.1364 1.4357 1.0371 -0.1063 -0.0338 0.0003  14  GLN D NE2 
2488 N N   . GLN D 15  ? 1.0830 1.0636 0.7425 -0.3052 -0.1250 0.0492  15  GLN D N   
2489 C CA  . GLN D 15  ? 1.1543 1.0422 0.7414 -0.3439 -0.1572 0.0596  15  GLN D CA  
2490 C C   . GLN D 15  ? 1.2146 1.0025 0.8007 -0.2974 -0.1691 0.0462  15  GLN D C   
2491 O O   . GLN D 15  ? 1.2425 0.9875 0.8023 -0.3012 -0.1852 0.0496  15  GLN D O   
2492 C CB  . GLN D 15  ? 1.2527 1.0859 0.7609 -0.4002 -0.1821 0.0707  15  GLN D CB  
2493 C CG  . GLN D 15  ? 1.5350 1.4181 0.9925 -0.4772 -0.1943 0.0938  15  GLN D CG  
2494 C CD  . GLN D 15  ? 1.6749 1.7234 1.1914 -0.4859 -0.1624 0.0979  15  GLN D CD  
2495 O OE1 . GLN D 15  ? 1.5588 1.6732 1.1016 -0.4789 -0.1444 0.0929  15  GLN D OE1 
2496 N NE2 . GLN D 15  ? 1.4800 1.6005 1.0152 -0.4983 -0.1565 0.1055  15  GLN D NE2 
2497 N N   . ASN D 16  ? 1.1396 0.9014 0.7575 -0.2516 -0.1600 0.0306  16  ASN D N   
2498 C CA  . ASN D 16  ? 1.1328 0.8237 0.7581 -0.2046 -0.1677 0.0160  16  ASN D CA  
2499 C C   . ASN D 16  ? 1.1261 0.8678 0.8131 -0.1676 -0.1476 0.0111  16  ASN D C   
2500 O O   . ASN D 16  ? 1.1175 0.8110 0.7968 -0.1438 -0.1584 0.0041  16  ASN D O   
2501 C CB  . ASN D 16  ? 1.1159 0.7769 0.7568 -0.1738 -0.1639 0.0028  16  ASN D CB  
2502 C CG  . ASN D 16  ? 1.5008 1.0655 1.0654 -0.1959 -0.1949 0.0013  16  ASN D CG  
2503 O OD1 . ASN D 16  ? 1.4595 0.9412 0.9887 -0.1733 -0.2181 -0.0103 16  ASN D OD1 
2504 N ND2 . ASN D 16  ? 1.4244 0.9996 0.9570 -0.2397 -0.1982 0.0118  16  ASN D ND2 
2505 N N   . LYS D 17  ? 1.0349 0.8729 0.7779 -0.1605 -0.1206 0.0132  17  LYS D N   
2506 C CA  . LYS D 17  ? 0.9848 0.8727 0.7810 -0.1290 -0.1026 0.0090  17  LYS D CA  
2507 C C   . LYS D 17  ? 1.0805 0.9672 0.8556 -0.1500 -0.1123 0.0177  17  LYS D C   
2508 O O   . LYS D 17  ? 1.0751 0.9403 0.8645 -0.1242 -0.1125 0.0126  17  LYS D O   
2509 C CB  . LYS D 17  ? 0.9573 0.9387 0.8002 -0.1165 -0.0791 0.0074  17  LYS D CB  
2510 C CG  . LYS D 17  ? 0.9276 0.9500 0.8164 -0.0822 -0.0645 0.0016  17  LYS D CG  
2511 C CD  . LYS D 17  ? 0.8653 0.9671 0.7869 -0.0619 -0.0482 -0.0036 17  LYS D CD  
2512 C CE  . LYS D 17  ? 0.8331 0.9657 0.7856 -0.0324 -0.0398 -0.0093 17  LYS D CE  
2513 N NZ  . LYS D 17  ? 0.9350 1.1089 0.9102 0.0041  -0.0309 -0.0195 17  LYS D NZ  
2514 N N   . GLU D 18  ? 1.0797 0.9900 0.8175 -0.1996 -0.1217 0.0318  18  GLU D N   
2515 C CA  . GLU D 18  ? 1.1114 1.0172 0.8170 -0.2310 -0.1355 0.0439  18  GLU D CA  
2516 C C   . GLU D 18  ? 1.2566 1.0474 0.9070 -0.2267 -0.1648 0.0421  18  GLU D C   
2517 O O   . GLU D 18  ? 1.2685 1.0428 0.9196 -0.2138 -0.1695 0.0421  18  GLU D O   
2518 C CB  . GLU D 18  ? 1.1620 1.1143 0.8284 -0.2942 -0.1434 0.0613  18  GLU D CB  
2519 N N   . HIS D 19  ? 1.2766 0.9877 0.8787 -0.2307 -0.1852 0.0380  19  HIS D N   
2520 C CA  . HIS D 19  ? 1.3449 0.9433 0.8861 -0.2168 -0.2177 0.0312  19  HIS D CA  
2521 C C   . HIS D 19  ? 1.2973 0.8949 0.8869 -0.1559 -0.2058 0.0144  19  HIS D C   
2522 O O   . HIS D 19  ? 1.3393 0.8880 0.8986 -0.1418 -0.2239 0.0115  19  HIS D O   
2523 C CB  . HIS D 19  ? 1.4245 0.9444 0.9097 -0.2242 -0.2404 0.0256  19  HIS D CB  
2524 C CG  . HIS D 19  ? 1.5648 0.9631 0.9690 -0.2106 -0.2818 0.0170  19  HIS D CG  
2525 N ND1 . HIS D 19  ? 1.6938 1.0137 1.0015 -0.2546 -0.3212 0.0303  19  HIS D ND1 
2526 C CD2 . HIS D 19  ? 1.6008 0.9465 1.0017 -0.1568 -0.2920 -0.0045 19  HIS D CD2 
2527 C CE1 . HIS D 19  ? 1.7577 0.9716 1.0029 -0.2206 -0.3560 0.0148  19  HIS D CE1 
2528 N NE2 . HIS D 19  ? 1.7068 0.9390 1.0073 -0.1603 -0.3389 -0.0075 19  HIS D NE2 
2529 N N   . PHE D 20  ? 1.1390 0.7913 0.7985 -0.1225 -0.1772 0.0044  20  PHE D N   
2530 C CA  . PHE D 20  ? 1.0653 0.7320 0.7740 -0.0728 -0.1633 -0.0092 20  PHE D CA  
2531 C C   . PHE D 20  ? 1.0848 0.7916 0.8214 -0.0675 -0.1523 -0.0044 20  PHE D C   
2532 O O   . PHE D 20  ? 1.1069 0.7886 0.8404 -0.0404 -0.1590 -0.0119 20  PHE D O   
2533 C CB  . PHE D 20  ? 1.0007 0.7182 0.7699 -0.0511 -0.1375 -0.0157 20  PHE D CB  
2534 C CG  . PHE D 20  ? 0.9324 0.6954 0.7605 -0.0173 -0.1166 -0.0216 20  PHE D CG  
2535 C CD1 . PHE D 20  ? 0.9504 0.6910 0.7823 0.0139  -0.1219 -0.0327 20  PHE D CD1 
2536 C CD2 . PHE D 20  ? 0.8739 0.7034 0.7475 -0.0169 -0.0942 -0.0168 20  PHE D CD2 
2537 C CE1 . PHE D 20  ? 0.9019 0.6863 0.7822 0.0367  -0.1039 -0.0356 20  PHE D CE1 
2538 C CE2 . PHE D 20  ? 0.8423 0.7008 0.7578 0.0094  -0.0799 -0.0211 20  PHE D CE2 
2539 C CZ  . PHE D 20  ? 0.8160 0.6520 0.7347 0.0319  -0.0842 -0.0289 20  PHE D CZ  
2540 N N   . GLN D 21  ? 0.9884 0.7620 0.7515 -0.0905 -0.1358 0.0065  21  GLN D N   
2541 C CA  . GLN D 21  ? 0.9578 0.7746 0.7484 -0.0871 -0.1248 0.0107  21  GLN D CA  
2542 C C   . GLN D 21  ? 1.1264 0.8914 0.8640 -0.1050 -0.1490 0.0181  21  GLN D C   
2543 O O   . GLN D 21  ? 1.1326 0.8906 0.8818 -0.0819 -0.1479 0.0143  21  GLN D O   
2544 C CB  . GLN D 21  ? 0.9225 0.8259 0.7466 -0.1044 -0.1056 0.0175  21  GLN D CB  
2545 C CG  . GLN D 21  ? 0.6611 0.6096 0.5363 -0.0746 -0.0837 0.0079  21  GLN D CG  
2546 C CD  . GLN D 21  ? 0.8796 0.9149 0.7819 -0.0806 -0.0683 0.0099  21  GLN D CD  
2547 O OE1 . GLN D 21  ? 0.9149 0.9923 0.8032 -0.1113 -0.0710 0.0190  21  GLN D OE1 
2548 N NE2 . GLN D 21  ? 0.7669 0.8327 0.7043 -0.0499 -0.0541 0.0007  21  GLN D NE2 
2549 N N   . ASP D 22  ? 1.1807 0.9011 0.8527 -0.1464 -0.1740 0.0289  22  ASP D N   
2550 C CA  . ASP D 22  ? 1.2561 0.9078 0.8584 -0.1684 -0.2056 0.0379  22  ASP D CA  
2551 C C   . ASP D 22  ? 1.3438 0.9098 0.9112 -0.1271 -0.2275 0.0233  22  ASP D C   
2552 O O   . ASP D 22  ? 1.3844 0.9136 0.9236 -0.1181 -0.2431 0.0243  22  ASP D O   
2553 C CB  . ASP D 22  ? 1.3642 0.9792 0.8924 -0.2283 -0.2321 0.0541  22  ASP D CB  
2554 C CG  . ASP D 22  ? 1.5812 1.2926 1.1325 -0.2758 -0.2152 0.0703  22  ASP D CG  
2555 O OD1 . ASP D 22  ? 1.5230 1.3274 1.1463 -0.2577 -0.1846 0.0674  22  ASP D OD1 
2556 O OD2 . ASP D 22  ? 1.7826 1.4790 1.2759 -0.3311 -0.2344 0.0850  22  ASP D OD2 
2557 N N   . GLU D 23  ? 1.3036 0.8447 0.8736 -0.0991 -0.2286 0.0085  23  GLU D N   
2558 C CA  . GLU D 23  ? 1.3433 0.8199 0.8832 -0.0533 -0.2488 -0.0098 23  GLU D CA  
2559 C C   . GLU D 23  ? 1.3475 0.8731 0.9463 -0.0105 -0.2275 -0.0194 23  GLU D C   
2560 O O   . GLU D 23  ? 1.3888 0.8710 0.9532 0.0189  -0.2472 -0.0288 23  GLU D O   
2561 C CB  . GLU D 23  ? 1.3619 0.8196 0.9009 -0.0351 -0.2510 -0.0237 23  GLU D CB  
2562 C CG  . GLU D 23  ? 1.5398 0.9015 1.0024 -0.0051 -0.2906 -0.0405 23  GLU D CG  
2563 C CD  . GLU D 23  ? 1.8750 1.2183 1.3354 0.0163  -0.2946 -0.0564 23  GLU D CD  
2564 O OE1 . GLU D 23  ? 1.9954 1.3038 1.4309 0.0638  -0.3134 -0.0778 23  GLU D OE1 
2565 O OE2 . GLU D 23  ? 1.6856 1.0524 1.1677 -0.0116 -0.2799 -0.0488 23  GLU D OE2 
2566 N N   . CYS D 24  ? 1.2189 0.8316 0.8990 -0.0068 -0.1901 -0.0174 24  CYS D N   
2567 C CA  . CYS D 24  ? 1.1581 0.8219 0.8945 0.0244  -0.1680 -0.0235 24  CYS D CA  
2568 C C   . CYS D 24  ? 1.2298 0.8914 0.9549 0.0156  -0.1722 -0.0146 24  CYS D C   
2569 O O   . CYS D 24  ? 1.2387 0.8910 0.9618 0.0451  -0.1763 -0.0223 24  CYS D O   
2570 C CB  . CYS D 24  ? 1.0903 0.8285 0.8974 0.0241  -0.1351 -0.0219 24  CYS D CB  
2571 S SG  . CYS D 24  ? 1.1183 0.8670 0.9524 0.0492  -0.1267 -0.0351 24  CYS D SG  
2572 N N   . THR D 25  ? 1.1775 0.8540 0.8950 -0.0251 -0.1713 0.0015  25  THR D N   
2573 C CA  . THR D 25  ? 1.1859 0.8633 0.8917 -0.0395 -0.1761 0.0120  25  THR D CA  
2574 C C   . THR D 25  ? 1.3191 0.9073 0.9484 -0.0337 -0.2127 0.0112  25  THR D C   
2575 O O   . THR D 25  ? 1.3060 0.8865 0.9365 -0.0108 -0.2146 0.0081  25  THR D O   
2576 C CB  . THR D 25  ? 1.2728 0.9939 0.9816 -0.0862 -0.1705 0.0286  25  THR D CB  
2577 O OG1 . THR D 25  ? 1.5069 1.1841 1.1548 -0.1241 -0.1944 0.0375  25  THR D OG1 
2578 C CG2 . THR D 25  ? 1.1254 0.9347 0.9036 -0.0819 -0.1378 0.0260  25  THR D CG2 
2579 N N   . LYS D 26  ? 1.3575 0.8718 0.9140 -0.0511 -0.2445 0.0126  26  LYS D N   
2580 C CA  . LYS D 26  ? 1.4567 0.8671 0.9213 -0.0424 -0.2884 0.0101  26  LYS D CA  
2581 C C   . LYS D 26  ? 1.5144 0.9157 0.9887 0.0209  -0.2897 -0.0113 26  LYS D C   
2582 O O   . LYS D 26  ? 1.5624 0.9304 1.0059 0.0376  -0.3057 -0.0118 26  LYS D O   
2583 C CB  . LYS D 26  ? 1.5730 0.9001 0.9554 -0.0646 -0.3237 0.0107  26  LYS D CB  
2584 N N   . LEU D 27  ? 1.4105 0.8552 0.9343 0.0540  -0.2697 -0.0276 27  LEU D N   
2585 C CA  . LEU D 27  ? 1.3920 0.8541 0.9338 0.1110  -0.2668 -0.0487 27  LEU D CA  
2586 C C   . LEU D 27  ? 1.3890 0.9186 0.9916 0.1263  -0.2390 -0.0473 27  LEU D C   
2587 O O   . LEU D 27  ? 1.4232 0.9469 1.0111 0.1665  -0.2486 -0.0602 27  LEU D O   
2588 C CB  . LEU D 27  ? 1.3480 0.8522 0.9322 0.1289  -0.2499 -0.0620 27  LEU D CB  
2589 C CG  . LEU D 27  ? 1.3920 0.9257 0.9911 0.1838  -0.2490 -0.0849 27  LEU D CG  
2590 C CD1 . LEU D 27  ? 1.4754 0.9319 0.9940 0.2157  -0.2904 -0.1042 27  LEU D CD1 
2591 C CD2 . LEU D 27  ? 1.3441 0.9630 1.0231 0.1856  -0.2136 -0.0874 27  LEU D CD2 
2592 N N   . LEU D 28  ? 1.2465 0.8394 0.9120 0.0974  -0.2070 -0.0335 28  LEU D N   
2593 C CA  . LEU D 28  ? 1.1600 0.8130 0.8815 0.1093  -0.1809 -0.0326 28  LEU D CA  
2594 C C   . LEU D 28  ? 1.1567 0.7950 0.8640 0.0941  -0.1856 -0.0203 28  LEU D C   
2595 O O   . LEU D 28  ? 1.1267 0.7858 0.8529 0.1167  -0.1772 -0.0245 28  LEU D O   
2596 C CB  . LEU D 28  ? 1.0915 0.8167 0.8844 0.0952  -0.1466 -0.0284 28  LEU D CB  
2597 C CG  . LEU D 28  ? 1.1416 0.9034 0.9681 0.1189  -0.1338 -0.0411 28  LEU D CG  
2598 C CD1 . LEU D 28  ? 1.1227 0.9118 0.9815 0.0985  -0.1180 -0.0365 28  LEU D CD1 
2599 C CD2 . LEU D 28  ? 1.1192 0.9316 0.9849 0.1393  -0.1159 -0.0458 28  LEU D CD2 
2600 N N   . VAL D 29  ? 1.0983 0.7120 0.7776 0.0530  -0.1964 -0.0044 29  VAL D N   
2601 C CA  . VAL D 29  ? 1.0989 0.7049 0.7660 0.0332  -0.2011 0.0089  29  VAL D CA  
2602 C C   . VAL D 29  ? 1.2492 0.7824 0.8529 0.0591  -0.2321 0.0043  29  VAL D C   
2603 O O   . VAL D 29  ? 1.3313 0.7882 0.8619 0.0642  -0.2669 0.0006  29  VAL D O   
2604 C CB  . VAL D 29  ? 1.1539 0.7603 0.8002 -0.0211 -0.2083 0.0276  29  VAL D CB  
2605 C CG1 . VAL D 29  ? 1.1661 0.7558 0.7867 -0.0429 -0.2205 0.0419  29  VAL D CG1 
2606 C CG2 . VAL D 29  ? 1.0784 0.7712 0.7922 -0.0368 -0.1756 0.0294  29  VAL D CG2 
2607 N N   . GLY D 30  ? 1.1896 0.7448 0.8187 0.0801  -0.2207 0.0022  30  GLY D N   
2608 C CA  . GLY D 30  ? 1.2427 0.7399 0.8184 0.1118  -0.2467 -0.0039 30  GLY D CA  
2609 C C   . GLY D 30  ? 1.2741 0.8022 0.8717 0.1656  -0.2376 -0.0250 30  GLY D C   
2610 O O   . GLY D 30  ? 1.3140 0.8198 0.8839 0.1982  -0.2507 -0.0322 30  GLY D O   
2611 N N   . ASN D 31  ? 1.1575 0.7415 0.8025 0.1742  -0.2161 -0.0349 31  ASN D N   
2612 C CA  . ASN D 31  ? 1.1217 0.7567 0.7949 0.2168  -0.2041 -0.0536 31  ASN D CA  
2613 C C   . ASN D 31  ? 1.0713 0.7797 0.8111 0.2146  -0.1700 -0.0501 31  ASN D C   
2614 O O   . ASN D 31  ? 1.0056 0.7364 0.7838 0.1815  -0.1502 -0.0365 31  ASN D O   
2615 C CB  . ASN D 31  ? 1.1831 0.8469 0.8785 0.2174  -0.1959 -0.0620 31  ASN D CB  
2616 C CG  . ASN D 31  ? 1.5847 1.2870 1.2835 0.2634  -0.1974 -0.0841 31  ASN D CG  
2617 O OD1 . ASN D 31  ? 1.4843 1.2670 1.2389 0.2714  -0.1706 -0.0881 31  ASN D OD1 
2618 N ND2 . ASN D 31  ? 1.5409 1.1888 1.1763 0.2925  -0.2308 -0.0990 31  ASN D ND2 
2619 N N   . ILE D 32  ? 0.9978 0.7456 0.7463 0.2511  -0.1655 -0.0638 32  ILE D N   
2620 C CA  . ILE D 32  ? 0.9147 0.7300 0.7153 0.2500  -0.1372 -0.0619 32  ILE D CA  
2621 C C   . ILE D 32  ? 0.8886 0.7764 0.7349 0.2496  -0.1163 -0.0685 32  ILE D C   
2622 O O   . ILE D 32  ? 0.9245 0.8319 0.7577 0.2774  -0.1257 -0.0836 32  ILE D O   
2623 C CB  . ILE D 32  ? 0.9722 0.7886 0.7452 0.2879  -0.1481 -0.0716 32  ILE D CB  
2624 C CG1 . ILE D 32  ? 1.0296 0.7637 0.7506 0.2860  -0.1724 -0.0630 32  ILE D CG1 
2625 C CG2 . ILE D 32  ? 0.9115 0.8036 0.7332 0.2857  -0.1200 -0.0708 32  ILE D CG2 
2626 N N   . VAL D 33  ? 0.7771 0.7023 0.6709 0.2200  -0.0914 -0.0580 33  VAL D N   
2627 C CA  . VAL D 33  ? 0.7475 0.7355 0.6802 0.2115  -0.0731 -0.0601 33  VAL D CA  
2628 C C   . VAL D 33  ? 0.7829 0.8261 0.7401 0.2068  -0.0560 -0.0578 33  VAL D C   
2629 O O   . VAL D 33  ? 0.7853 0.8111 0.7394 0.2015  -0.0534 -0.0515 33  VAL D O   
2630 C CB  . VAL D 33  ? 0.7695 0.7493 0.7263 0.1796  -0.0631 -0.0502 33  VAL D CB  
2631 C CG1 . VAL D 33  ? 0.7853 0.7249 0.7192 0.1814  -0.0783 -0.0532 33  VAL D CG1 
2632 C CG2 . VAL D 33  ? 0.7482 0.7081 0.7164 0.1553  -0.0548 -0.0376 33  VAL D CG2 
2633 N N   . ILE D 34  ? 0.7367 0.8459 0.7161 0.2039  -0.0453 -0.0616 34  ILE D N   
2634 C CA  . ILE D 34  ? 0.7166 0.8854 0.7152 0.1890  -0.0301 -0.0572 34  ILE D CA  
2635 C C   . ILE D 34  ? 0.7935 0.9746 0.8150 0.1518  -0.0191 -0.0462 34  ILE D C   
2636 O O   . ILE D 34  ? 0.7786 0.9665 0.8073 0.1499  -0.0210 -0.0486 34  ILE D O   
2637 C CB  . ILE D 34  ? 0.7507 0.9996 0.7472 0.2158  -0.0307 -0.0711 34  ILE D CB  
2638 C CG2 . ILE D 34  ? 0.7304 1.0359 0.7358 0.2007  -0.0176 -0.0655 34  ILE D CG2 
2639 N N   . THR D 35  ? 0.7522 0.9252 0.7779 0.1239  -0.0111 -0.0345 35  THR D N   
2640 C CA  . THR D 35  ? 0.7497 0.9236 0.7826 0.0893  -0.0064 -0.0238 35  THR D CA  
2641 C C   . THR D 35  ? 0.8330 1.0779 0.8672 0.0720  0.0000  -0.0209 35  THR D C   
2642 O O   . THR D 35  ? 0.8533 1.1068 0.8790 0.0652  0.0034  -0.0176 35  THR D O   
2643 C CB  . THR D 35  ? 0.7893 0.8997 0.8136 0.0734  -0.0080 -0.0154 35  THR D CB  
2644 O OG1 . THR D 35  ? 0.8143 0.9154 0.8296 0.0767  -0.0065 -0.0145 35  THR D OG1 
2645 C CG2 . THR D 35  ? 0.6979 0.7595 0.7239 0.0851  -0.0133 -0.0177 35  THR D CG2 
2646 N N   . ARG D 36  ? 0.8059 1.1095 0.8500 0.0664  0.0014  -0.0230 36  ARG D N   
2647 C CA  . ARG D 36  ? 0.8130 1.2078 0.8598 0.0478  0.0074  -0.0207 36  ARG D CA  
2648 C C   . ARG D 36  ? 0.9042 1.2920 0.9344 -0.0038 0.0084  -0.0024 36  ARG D C   
2649 O O   . ARG D 36  ? 0.9383 1.3980 0.9642 -0.0237 0.0135  0.0016  36  ARG D O   
2650 C CB  . ARG D 36  ? 0.8041 1.2661 0.8654 0.0514  0.0071  -0.0271 36  ARG D CB  
2651 C CG  . ARG D 36  ? 0.9362 1.4283 1.0029 0.1047  0.0028  -0.0488 36  ARG D CG  
2652 C CD  . ARG D 36  ? 1.0515 1.6166 1.1315 0.1091  0.0015  -0.0568 36  ARG D CD  
2653 N NE  . ARG D 36  ? 1.1834 1.8653 1.2681 0.1295  0.0046  -0.0703 36  ARG D NE  
2654 C CZ  . ARG D 36  ? 1.4362 2.2255 1.5346 0.1086  0.0096  -0.0693 36  ARG D CZ  
2655 N NH1 . ARG D 36  ? 1.3023 2.0846 1.4073 0.0643  0.0103  -0.0536 36  ARG D NH1 
2656 N NH2 . ARG D 36  ? 1.2845 2.1930 1.3874 0.1323  0.0125  -0.0841 36  ARG D NH2 
2657 N N   . TYR D 37  ? 0.8456 1.1483 0.8599 -0.0249 0.0010  0.0080  37  TYR D N   
2658 C CA  . TYR D 37  ? 0.8620 1.1368 0.8448 -0.0719 -0.0058 0.0243  37  TYR D CA  
2659 C C   . TYR D 37  ? 0.9301 1.1919 0.8961 -0.0771 -0.0039 0.0265  37  TYR D C   
2660 O O   . TYR D 37  ? 0.9692 1.2355 0.9057 -0.1194 -0.0087 0.0392  37  TYR D O   
2661 C CB  . TYR D 37  ? 0.8812 1.0643 0.8427 -0.0827 -0.0193 0.0305  37  TYR D CB  
2662 C CG  . TYR D 37  ? 0.8632 0.9744 0.8281 -0.0495 -0.0212 0.0219  37  TYR D CG  
2663 C CD1 . TYR D 37  ? 0.9002 0.9526 0.8394 -0.0536 -0.0280 0.0239  37  TYR D CD1 
2664 C CD2 . TYR D 37  ? 0.8379 0.9410 0.8274 -0.0176 -0.0182 0.0122  37  TYR D CD2 
2665 C CE1 . TYR D 37  ? 0.8900 0.8910 0.8338 -0.0245 -0.0299 0.0157  37  TYR D CE1 
2666 C CE2 . TYR D 37  ? 0.8268 0.8766 0.8178 0.0059  -0.0204 0.0061  37  TYR D CE2 
2667 C CZ  . TYR D 37  ? 0.9043 0.9094 0.8751 0.0031  -0.0254 0.0076  37  TYR D CZ  
2668 O OH  . TYR D 37  ? 0.8468 0.8153 0.8216 0.0257  -0.0271 0.0011  37  TYR D OH  
2669 N N   . ASN D 38  ? 0.8677 1.1107 0.8475 -0.0375 0.0011  0.0151  38  ASN D N   
2670 C CA  . ASN D 38  ? 0.8719 1.0982 0.8382 -0.0363 0.0030  0.0157  38  ASN D CA  
2671 C C   . ASN D 38  ? 0.9244 1.2008 0.9096 0.0038  0.0115  0.0030  38  ASN D C   
2672 O O   . ASN D 38  ? 0.9551 1.2188 0.9308 0.0110  0.0132  0.0022  38  ASN D O   
2673 C CB  . ASN D 38  ? 0.8342 0.9608 0.7849 -0.0296 -0.0056 0.0160  38  ASN D CB  
2674 C CG  . ASN D 38  ? 0.9496 1.0408 0.9205 0.0066  -0.0064 0.0065  38  ASN D CG  
2675 O OD1 . ASN D 38  ? 0.8454 0.9708 0.8377 0.0319  -0.0019 -0.0014 38  ASN D OD1 
2676 N ND2 . ASN D 38  ? 0.7407 0.7638 0.7003 0.0098  -0.0141 0.0063  38  ASN D ND2 
2677 N N   . ASN D 39  ? 0.8534 1.1793 0.8591 0.0325  0.0136  -0.0080 39  ASN D N   
2678 C CA  . ASN D 39  ? 0.8449 1.2106 0.8573 0.0784  0.0147  -0.0233 39  ASN D CA  
2679 C C   . ASN D 39  ? 0.8862 1.1760 0.8884 0.1060  0.0091  -0.0271 39  ASN D C   
2680 O O   . ASN D 39  ? 0.9072 1.2125 0.9004 0.1283  0.0092  -0.0329 39  ASN D O   
2681 C CB  . ASN D 39  ? 0.8623 1.3323 0.8741 0.0755  0.0224  -0.0262 39  ASN D CB  
2682 C CG  . ASN D 39  ? 1.1772 1.7449 1.2036 0.0932  0.0237  -0.0380 39  ASN D CG  
2683 O OD1 . ASN D 39  ? 1.0678 1.6442 1.1048 0.0778  0.0224  -0.0353 39  ASN D OD1 
2684 N ND2 . ASN D 39  ? 1.0883 1.7294 1.1132 0.1329  0.0242  -0.0539 39  ASN D ND2 
2685 N N   . ARG D 40  ? 0.8032 1.0159 0.8054 0.1035  0.0035  -0.0235 40  ARG D N   
2686 C CA  . ARG D 40  ? 0.7751 0.9197 0.7680 0.1227  -0.0032 -0.0250 40  ARG D CA  
2687 C C   . ARG D 40  ? 0.7435 0.8654 0.7342 0.1510  -0.0131 -0.0333 40  ARG D C   
2688 O O   . ARG D 40  ? 0.7154 0.8483 0.7150 0.1486  -0.0142 -0.0354 40  ARG D O   
2689 C CB  . ARG D 40  ? 0.7530 0.8364 0.7427 0.0982  -0.0039 -0.0157 40  ARG D CB  
2690 C CG  . ARG D 40  ? 0.8294 0.9024 0.8057 0.0842  -0.0013 -0.0106 40  ARG D CG  
2691 C CD  . ARG D 40  ? 1.0665 1.0848 1.0357 0.1014  -0.0066 -0.0120 40  ARG D CD  
2692 N NE  . ARG D 40  ? 1.2538 1.2369 1.2090 0.0841  -0.0072 -0.0070 40  ARG D NE  
2693 C CZ  . ARG D 40  ? 1.5610 1.5047 1.5077 0.0660  -0.0120 -0.0040 40  ARG D CZ  
2694 N NH1 . ARG D 40  ? 1.3029 1.2423 1.2567 0.0614  -0.0148 -0.0043 40  ARG D NH1 
2695 N NH2 . ARG D 40  ? 1.6002 1.5061 1.5263 0.0552  -0.0162 -0.0022 40  ARG D NH2 
2696 N N   . THR D 41  ? 0.6993 0.7823 0.6723 0.1751  -0.0228 -0.0370 41  THR D N   
2697 C CA  . THR D 41  ? 0.7197 0.7670 0.6746 0.1996  -0.0386 -0.0437 41  THR D CA  
2698 C C   . THR D 41  ? 0.7767 0.7547 0.7228 0.1878  -0.0459 -0.0353 41  THR D C   
2699 O O   . THR D 41  ? 0.7533 0.7096 0.6973 0.1808  -0.0437 -0.0295 41  THR D O   
2700 C CB  . THR D 41  ? 0.7964 0.8605 0.7246 0.2402  -0.0503 -0.0564 41  THR D CB  
2701 O OG1 . THR D 41  ? 0.7843 0.8619 0.6992 0.2658  -0.0624 -0.0692 41  THR D OG1 
2702 C CG2 . THR D 41  ? 0.7461 0.7463 0.6428 0.2553  -0.0649 -0.0545 41  THR D CG2 
2703 N N   . TYR D 42  ? 0.7715 0.7202 0.7113 0.1841  -0.0549 -0.0346 42  TYR D N   
2704 C CA  . TYR D 42  ? 0.7843 0.6831 0.7149 0.1684  -0.0622 -0.0260 42  TYR D CA  
2705 C C   . TYR D 42  ? 0.8670 0.7284 0.7670 0.1740  -0.0816 -0.0276 42  TYR D C   
2706 O O   . TYR D 42  ? 0.8628 0.7380 0.7645 0.1790  -0.0830 -0.0337 42  TYR D O   
2707 C CB  . TYR D 42  ? 0.7833 0.6938 0.7428 0.1418  -0.0492 -0.0198 42  TYR D CB  
2708 C CG  . TYR D 42  ? 0.8140 0.7469 0.7927 0.1317  -0.0353 -0.0180 42  TYR D CG  
2709 C CD1 . TYR D 42  ? 0.8302 0.7988 0.8229 0.1246  -0.0262 -0.0195 42  TYR D CD1 
2710 C CD2 . TYR D 42  ? 0.8372 0.7508 0.8142 0.1261  -0.0343 -0.0141 42  TYR D CD2 
2711 C CE1 . TYR D 42  ? 0.8453 0.8218 0.8423 0.1091  -0.0189 -0.0159 42  TYR D CE1 
2712 C CE2 . TYR D 42  ? 0.8470 0.7680 0.8305 0.1159  -0.0262 -0.0131 42  TYR D CE2 
2713 C CZ  . TYR D 42  ? 0.9727 0.9211 0.9626 0.1057  -0.0198 -0.0134 42  TYR D CZ  
2714 O OH  . TYR D 42  ? 1.1089 1.0528 1.0923 0.0903  -0.0171 -0.0107 42  TYR D OH  
2715 N N   . ARG D 43  ? 0.8659 0.6776 0.7360 0.1667  -0.0974 -0.0204 43  ARG D N   
2716 C CA  . ARG D 43  ? 0.9092 0.6744 0.7393 0.1612  -0.1199 -0.0183 43  ARG D CA  
2717 C C   . ARG D 43  ? 0.9619 0.7403 0.8140 0.1276  -0.1111 -0.0095 43  ARG D C   
2718 O O   . ARG D 43  ? 0.9462 0.7444 0.8234 0.1102  -0.0989 -0.0026 43  ARG D O   
2719 C CB  . ARG D 43  ? 0.9450 0.6457 0.7202 0.1639  -0.1465 -0.0125 43  ARG D CB  
2720 C CG  . ARG D 43  ? 1.1003 0.7399 0.8165 0.1583  -0.1770 -0.0109 43  ARG D CG  
2721 C CD  . ARG D 43  ? 1.3188 0.8863 0.9736 0.1460  -0.2068 0.0005  43  ARG D CD  
2722 N NE  . ARG D 43  ? 1.5137 1.0491 1.1349 0.1833  -0.2217 -0.0068 43  ARG D NE  
2723 C CZ  . ARG D 43  ? 1.5771 1.0660 1.1404 0.2224  -0.2498 -0.0203 43  ARG D CZ  
2724 N NH1 . ARG D 43  ? 1.3294 0.7939 0.8612 0.2288  -0.2666 -0.0283 43  ARG D NH1 
2725 N NH2 . ARG D 43  ? 1.3649 0.8313 0.8980 0.2591  -0.2629 -0.0276 43  ARG D NH2 
2726 N N   . ILE D 44  ? 0.9364 0.7067 0.7773 0.1216  -0.1182 -0.0115 44  ILE D N   
2727 C CA  . ILE D 44  ? 0.8996 0.6890 0.7590 0.0921  -0.1103 -0.0044 44  ILE D CA  
2728 C C   . ILE D 44  ? 0.9380 0.6922 0.7585 0.0635  -0.1292 0.0080  44  ILE D C   
2729 O O   . ILE D 44  ? 0.9870 0.6823 0.7510 0.0636  -0.1562 0.0097  44  ILE D O   
2730 C CB  . ILE D 44  ? 0.9337 0.7342 0.8009 0.0965  -0.1076 -0.0116 44  ILE D CB  
2731 C CG1 . ILE D 44  ? 0.9068 0.7493 0.8109 0.1181  -0.0898 -0.0212 44  ILE D CG1 
2732 C CG2 . ILE D 44  ? 0.9162 0.7367 0.7983 0.0689  -0.1006 -0.0051 44  ILE D CG2 
2733 C CD1 . ILE D 44  ? 1.1212 0.9543 1.0056 0.1407  -0.1010 -0.0325 44  ILE D CD1 
2734 N N   . ASP D 45  ? 0.8628 0.6538 0.7083 0.0394  -0.1177 0.0162  45  ASP D N   
2735 C CA  . ASP D 45  ? 0.8865 0.6693 0.7041 0.0041  -0.1314 0.0300  45  ASP D CA  
2736 C C   . ASP D 45  ? 0.9482 0.7622 0.7703 -0.0229 -0.1286 0.0341  45  ASP D C   
2737 O O   . ASP D 45  ? 1.0057 0.8013 0.7869 -0.0575 -0.1471 0.0464  45  ASP D O   
2738 C CB  . ASP D 45  ? 0.8792 0.6965 0.7218 -0.0018 -0.1211 0.0344  45  ASP D CB  
2739 C CG  . ASP D 45  ? 1.1224 0.9025 0.9523 0.0197  -0.1271 0.0330  45  ASP D CG  
2740 O OD1 . ASP D 45  ? 1.2169 0.9342 0.9935 0.0202  -0.1520 0.0377  45  ASP D OD1 
2741 O OD2 . ASP D 45  ? 1.1451 0.9540 1.0123 0.0369  -0.1092 0.0267  45  ASP D OD2 
2742 N N   . ASP D 46  ? 0.8663 0.7244 0.7319 -0.0097 -0.1079 0.0249  46  ASP D N   
2743 C CA  . ASP D 46  ? 0.8538 0.7482 0.7286 -0.0292 -0.1025 0.0266  46  ASP D CA  
2744 C C   . ASP D 46  ? 0.8526 0.7716 0.7660 -0.0045 -0.0844 0.0148  46  ASP D C   
2745 O O   . ASP D 46  ? 0.8172 0.7338 0.7523 0.0218  -0.0751 0.0070  46  ASP D O   
2746 C CB  . ASP D 46  ? 0.8672 0.8273 0.7603 -0.0514 -0.0945 0.0328  46  ASP D CB  
2747 C CG  . ASP D 46  ? 1.0891 1.0775 0.9602 -0.0915 -0.1026 0.0433  46  ASP D CG  
2748 O OD1 . ASP D 46  ? 1.1338 1.0942 0.9829 -0.1006 -0.1102 0.0441  46  ASP D OD1 
2749 O OD2 . ASP D 46  ? 1.2260 1.2703 1.1017 -0.1147 -0.1013 0.0502  46  ASP D OD2 
2750 N N   . VAL D 47  ? 0.8024 0.7448 0.7200 -0.0167 -0.0812 0.0149  47  VAL D N   
2751 C CA  . VAL D 47  ? 0.7640 0.7286 0.7124 0.0017  -0.0670 0.0058  47  VAL D CA  
2752 C C   . VAL D 47  ? 0.7971 0.8244 0.7647 -0.0073 -0.0573 0.0058  47  VAL D C   
2753 O O   . VAL D 47  ? 0.8045 0.8529 0.7543 -0.0357 -0.0635 0.0135  47  VAL D O   
2754 C CB  . VAL D 47  ? 0.8300 0.7586 0.7608 0.0030  -0.0746 0.0030  47  VAL D CB  
2755 C CG1 . VAL D 47  ? 0.7905 0.7385 0.7531 0.0225  -0.0609 -0.0053 47  VAL D CG1 
2756 C CG2 . VAL D 47  ? 0.8628 0.7345 0.7639 0.0153  -0.0897 0.0003  47  VAL D CG2 
2757 N N   . ASP D 48  ? 0.7208 0.7789 0.7181 0.0164  -0.0450 -0.0029 48  ASP D N   
2758 C CA  . ASP D 48  ? 0.7123 0.8322 0.7232 0.0189  -0.0387 -0.0074 48  ASP D CA  
2759 C C   . ASP D 48  ? 0.7509 0.8669 0.7659 0.0278  -0.0356 -0.0120 48  ASP D C   
2760 O O   . ASP D 48  ? 0.7293 0.8220 0.7539 0.0505  -0.0326 -0.0184 48  ASP D O   
2761 C CB  . ASP D 48  ? 0.7272 0.8742 0.7545 0.0443  -0.0338 -0.0170 48  ASP D CB  
2762 C CG  . ASP D 48  ? 0.9453 1.1684 0.9798 0.0511  -0.0313 -0.0243 48  ASP D CG  
2763 O OD1 . ASP D 48  ? 0.9840 1.2429 1.0161 0.0392  -0.0301 -0.0228 48  ASP D OD1 
2764 O OD2 . ASP D 48  ? 1.0385 1.2886 1.0787 0.0700  -0.0316 -0.0329 48  ASP D OD2 
2765 N N   . TRP D 49  ? 0.7181 0.8537 0.7214 0.0059  -0.0381 -0.0071 49  TRP D N   
2766 C CA  . TRP D 49  ? 0.7026 0.8349 0.7073 0.0119  -0.0359 -0.0107 49  TRP D CA  
2767 C C   . TRP D 49  ? 0.7811 0.9693 0.8007 0.0348  -0.0294 -0.0206 49  TRP D C   
2768 O O   . TRP D 49  ? 0.7923 0.9684 0.8139 0.0502  -0.0283 -0.0256 49  TRP D O   
2769 C CB  . TRP D 49  ? 0.6930 0.8184 0.6722 -0.0221 -0.0434 -0.0016 49  TRP D CB  
2770 C CG  . TRP D 49  ? 0.7100 0.7629 0.6629 -0.0338 -0.0560 0.0038  49  TRP D CG  
2771 C CD1 . TRP D 49  ? 0.7744 0.8030 0.6957 -0.0597 -0.0695 0.0133  49  TRP D CD1 
2772 C CD2 . TRP D 49  ? 0.6973 0.6932 0.6477 -0.0160 -0.0595 -0.0016 49  TRP D CD2 
2773 N NE1 . TRP D 49  ? 0.7925 0.7474 0.6870 -0.0546 -0.0832 0.0123  49  TRP D NE1 
2774 C CE2 . TRP D 49  ? 0.7778 0.7190 0.6928 -0.0273 -0.0760 0.0024  49  TRP D CE2 
2775 C CE3 . TRP D 49  ? 0.6807 0.6681 0.6505 0.0071  -0.0527 -0.0093 49  TRP D CE3 
2776 C CZ2 . TRP D 49  ? 0.7746 0.6628 0.6762 -0.0105 -0.0849 -0.0043 49  TRP D CZ2 
2777 C CZ3 . TRP D 49  ? 0.7021 0.6413 0.6628 0.0171  -0.0596 -0.0133 49  TRP D CZ3 
2778 C CH2 . TRP D 49  ? 0.7474 0.6422 0.6758 0.0110  -0.0750 -0.0123 49  TRP D CH2 
2779 N N   . ASN D 50  ? 0.7561 1.0017 0.7826 0.0417  -0.0274 -0.0251 50  ASN D N   
2780 C CA  . ASN D 50  ? 0.7598 1.0645 0.7931 0.0716  -0.0254 -0.0386 50  ASN D CA  
2781 C C   . ASN D 50  ? 0.8448 1.1148 0.8781 0.1110  -0.0297 -0.0504 50  ASN D C   
2782 O O   . ASN D 50  ? 0.8857 1.1874 0.9135 0.1439  -0.0340 -0.0644 50  ASN D O   
2783 C CB  . ASN D 50  ? 0.7551 1.1528 0.7916 0.0592  -0.0235 -0.0393 50  ASN D CB  
2784 C CG  . ASN D 50  ? 0.9252 1.3590 0.9515 0.0111  -0.0229 -0.0250 50  ASN D CG  
2785 O OD1 . ASN D 50  ? 0.7884 1.2053 0.8050 -0.0036 -0.0230 -0.0201 50  ASN D OD1 
2786 N ND2 . ASN D 50  ? 0.8334 1.3143 0.8563 -0.0176 -0.0246 -0.0170 50  ASN D ND2 
2787 N N   . LYS D 51  ? 0.7733 0.9777 0.8063 0.1081  -0.0312 -0.0454 51  LYS D N   
2788 C CA  . LYS D 51  ? 0.7591 0.9202 0.7839 0.1347  -0.0376 -0.0529 51  LYS D CA  
2789 C C   . LYS D 51  ? 0.7777 0.8750 0.7976 0.1319  -0.0394 -0.0478 51  LYS D C   
2790 O O   . LYS D 51  ? 0.7609 0.8426 0.7879 0.1110  -0.0347 -0.0389 51  LYS D O   
2791 C CB  . LYS D 51  ? 0.7701 0.9227 0.7968 0.1324  -0.0380 -0.0520 51  LYS D CB  
2792 C CG  . LYS D 51  ? 0.9608 1.1679 0.9852 0.1524  -0.0418 -0.0640 51  LYS D CG  
2793 C CD  . LYS D 51  ? 1.0188 1.2050 1.0424 0.1523  -0.0437 -0.0637 51  LYS D CD  
2794 C CE  . LYS D 51  ? 1.0728 1.3282 1.1013 0.1598  -0.0446 -0.0716 51  LYS D CE  
2795 N N   . THR D 52  ? 0.7513 0.8110 0.7533 0.1527  -0.0492 -0.0536 52  THR D N   
2796 C CA  . THR D 52  ? 0.7690 0.7756 0.7616 0.1482  -0.0537 -0.0482 52  THR D CA  
2797 C C   . THR D 52  ? 0.8312 0.7888 0.7982 0.1557  -0.0661 -0.0495 52  THR D C   
2798 O O   . THR D 52  ? 0.8293 0.7894 0.7794 0.1754  -0.0747 -0.0590 52  THR D O   
2799 C CB  . THR D 52  ? 0.8972 0.9075 0.8801 0.1616  -0.0586 -0.0525 52  THR D CB  
2800 O OG1 . THR D 52  ? 0.9700 0.9372 0.9487 0.1508  -0.0613 -0.0450 52  THR D OG1 
2801 C CG2 . THR D 52  ? 0.9051 0.9146 0.8577 0.1972  -0.0743 -0.0662 52  THR D CG2 
2802 N N   . PRO D 53  ? 0.7742 0.6897 0.7332 0.1395  -0.0693 -0.0406 53  PRO D N   
2803 C CA  . PRO D 53  ? 0.8061 0.6740 0.7317 0.1389  -0.0838 -0.0397 53  PRO D CA  
2804 C C   . PRO D 53  ? 0.9386 0.7679 0.8165 0.1659  -0.1075 -0.0498 53  PRO D C   
2805 O O   . PRO D 53  ? 0.9814 0.7650 0.8202 0.1698  -0.1246 -0.0522 53  PRO D O   
2806 C CB  . PRO D 53  ? 0.8256 0.6731 0.7522 0.1118  -0.0826 -0.0270 53  PRO D CB  
2807 C CG  . PRO D 53  ? 0.8284 0.7176 0.7962 0.1022  -0.0642 -0.0239 53  PRO D CG  
2808 C CD  . PRO D 53  ? 0.7663 0.6803 0.7429 0.1193  -0.0613 -0.0314 53  PRO D CD  
2809 N N   . LYS D 54  ? 0.9310 0.7752 0.8059 0.1866  -0.1109 -0.0569 54  LYS D N   
2810 C CA  . LYS D 54  ? 0.9889 0.8021 0.8148 0.2226  -0.1357 -0.0702 54  LYS D CA  
2811 C C   . LYS D 54  ? 1.0487 0.8933 0.8674 0.2534  -0.1403 -0.0871 54  LYS D C   
2812 O O   . LYS D 54  ? 1.1159 0.9218 0.8818 0.2870  -0.1667 -0.1012 54  LYS D O   
2813 C CB  . LYS D 54  ? 0.9925 0.8301 0.8239 0.2389  -0.1345 -0.0744 54  LYS D CB  
2814 C CG  . LYS D 54  ? 1.1372 0.9389 0.9678 0.2160  -0.1350 -0.0607 54  LYS D CG  
2815 N N   . ASP D 55  ? 0.9482 0.8602 0.8141 0.2430  -0.1177 -0.0864 55  ASP D N   
2816 C CA  . ASP D 55  ? 0.9584 0.9152 0.8256 0.2669  -0.1191 -0.1010 55  ASP D CA  
2817 C C   . ASP D 55  ? 1.1054 1.0085 0.9420 0.2697  -0.1331 -0.1039 55  ASP D C   
2818 O O   . ASP D 55  ? 1.1150 0.9593 0.9395 0.2431  -0.1359 -0.0909 55  ASP D O   
2819 C CB  . ASP D 55  ? 0.9227 0.9613 0.8431 0.2464  -0.0937 -0.0954 55  ASP D CB  
2820 C CG  . ASP D 55  ? 1.1425 1.2468 1.0824 0.2491  -0.0843 -0.0974 55  ASP D CG  
2821 O OD1 . ASP D 55  ? 1.2384 1.3524 1.1538 0.2828  -0.0972 -0.1110 55  ASP D OD1 
2822 O OD2 . ASP D 55  ? 1.1941 1.3392 1.1677 0.2187  -0.0666 -0.0863 55  ASP D OD2 
2823 N N   . SER D 56  ? 1.1332 1.0610 0.9545 0.3025  -0.1433 -0.1219 56  SER D N   
2824 C CA  . SER D 56  ? 1.1933 1.0681 0.9794 0.3104  -0.1598 -0.1280 56  SER D CA  
2825 C C   . SER D 56  ? 1.2384 1.1679 1.0637 0.3008  -0.1423 -0.1278 56  SER D C   
2826 O O   . SER D 56  ? 1.2112 1.2271 1.0799 0.2985  -0.1241 -0.1284 56  SER D O   
2827 C CB  . SER D 56  ? 1.3236 1.1631 1.0438 0.3633  -0.1943 -0.1526 56  SER D CB  
2828 O OG  . SER D 56  ? 1.4461 1.3766 1.1829 0.4015  -0.1913 -0.1714 56  SER D OG  
2829 N N   . PHE D 57  ? 1.2043 1.0806 1.0102 0.2912  -0.1494 -0.1253 57  PHE D N   
2830 C CA  . PHE D 57  ? 1.1690 1.0798 1.0006 0.2863  -0.1385 -0.1264 57  PHE D CA  
2831 C C   . PHE D 57  ? 1.2848 1.1408 1.0621 0.3163  -0.1655 -0.1439 57  PHE D C   
2832 O O   . PHE D 57  ? 1.3422 1.1114 1.0595 0.3237  -0.1911 -0.1470 57  PHE D O   
2833 C CB  . PHE D 57  ? 1.1448 1.0484 1.0121 0.2414  -0.1169 -0.1042 57  PHE D CB  
2834 C CG  . PHE D 57  ? 1.1866 1.0105 1.0243 0.2190  -0.1247 -0.0933 57  PHE D CG  
2835 C CD1 . PHE D 57  ? 1.2467 1.0309 1.0634 0.2154  -0.1318 -0.0944 57  PHE D CD1 
2836 C CD2 . PHE D 57  ? 1.2154 1.0118 1.0481 0.1971  -0.1235 -0.0805 57  PHE D CD2 
2837 C CE1 . PHE D 57  ? 1.2888 1.0096 1.0770 0.1881  -0.1381 -0.0825 57  PHE D CE1 
2838 C CE2 . PHE D 57  ? 1.2820 1.0213 1.0887 0.1696  -0.1297 -0.0686 57  PHE D CE2 
2839 C CZ  . PHE D 57  ? 1.2835 0.9876 1.0676 0.1637  -0.1366 -0.0691 57  PHE D CZ  
2840 N N   . THR D 58  ? 1.2139 1.1178 1.0055 0.3336  -0.1632 -0.1559 58  THR D N   
2841 C CA  . THR D 58  ? 1.2496 1.1073 0.9899 0.3673  -0.1899 -0.1761 58  THR D CA  
2842 C C   . THR D 58  ? 1.2803 1.0773 1.0150 0.3369  -0.1870 -0.1633 58  THR D C   
2843 O O   . THR D 58  ? 1.2176 1.0538 1.0038 0.3055  -0.1612 -0.1474 58  THR D O   
2844 C CB  . THR D 58  ? 1.2845 1.2359 1.0418 0.4061  -0.1906 -0.1985 58  THR D CB  
2845 N N   . MET D 59  ? 1.2935 0.9901 0.9586 0.3455  -0.2163 -0.1702 59  MET D N   
2846 C CA  . MET D 59  ? 1.2905 0.9256 0.9399 0.3176  -0.2172 -0.1598 59  MET D CA  
2847 C C   . MET D 59  ? 1.2937 0.9374 0.9322 0.3491  -0.2277 -0.1799 59  MET D C   
2848 O O   . MET D 59  ? 1.2675 0.9765 0.9159 0.3902  -0.2321 -0.2008 59  MET D O   
2849 C CB  . MET D 59  ? 1.4021 0.9246 0.9790 0.2975  -0.2430 -0.1519 59  MET D CB  
2850 C CG  . MET D 59  ? 1.4368 0.9647 1.0315 0.2647  -0.2306 -0.1316 59  MET D CG  
2851 S SD  . MET D 59  ? 1.5505 0.9818 1.0892 0.2119  -0.2451 -0.1093 59  MET D SD  
2852 C CE  . MET D 59  ? 1.6051 0.9398 1.0431 0.2389  -0.2942 -0.1227 59  MET D CE  
2853 N N   . SER D 60  ? 1.2376 0.8277 0.8606 0.3288  -0.2294 -0.1733 60  SER D N   
2854 C CA  . SER D 60  ? 1.2217 0.8172 0.8397 0.3525  -0.2364 -0.1893 60  SER D CA  
2855 C C   . SER D 60  ? 1.2953 0.8727 0.8552 0.4125  -0.2721 -0.2233 60  SER D C   
2856 O O   . SER D 60  ? 1.2587 0.9097 0.8458 0.4434  -0.2687 -0.2405 60  SER D O   
2857 C CB  . SER D 60  ? 1.3025 0.8221 0.8966 0.3212  -0.2385 -0.1772 60  SER D CB  
2858 O OG  . SER D 60  ? 1.5594 0.9643 1.0663 0.3171  -0.2721 -0.1801 60  SER D OG  
2859 N N   . ASP D 61  ? 1.3200 0.8027 0.7962 0.4306  -0.3087 -0.2340 61  ASP D N   
2860 C CA  . ASP D 61  ? 1.3888 0.8403 0.7939 0.4964  -0.3502 -0.2704 61  ASP D CA  
2861 C C   . ASP D 61  ? 1.4790 1.0037 0.8929 0.5392  -0.3542 -0.2870 61  ASP D C   
2862 O O   . ASP D 61  ? 1.5688 1.0803 0.9227 0.6024  -0.3899 -0.3202 61  ASP D O   
2863 C CB  . ASP D 61  ? 1.5141 0.8050 0.8036 0.4970  -0.3972 -0.2758 61  ASP D CB  
2864 C CG  . ASP D 61  ? 1.6570 0.8751 0.8962 0.4756  -0.4142 -0.2618 61  ASP D CG  
2865 O OD1 . ASP D 61  ? 1.5425 0.8229 0.8486 0.4391  -0.3801 -0.2378 61  ASP D OD1 
2866 O OD2 . ASP D 61  ? 1.8522 0.9482 0.9788 0.4988  -0.4655 -0.2765 61  ASP D OD2 
2867 N N   . GLY D 62  ? 1.3630 0.9649 0.8478 0.5075  -0.3193 -0.2655 62  GLY D N   
2868 C CA  . GLY D 62  ? 1.3486 1.0282 0.8497 0.5398  -0.3177 -0.2771 62  GLY D CA  
2869 C C   . GLY D 62  ? 1.4332 1.0451 0.8932 0.5309  -0.3318 -0.2674 62  GLY D C   
2870 O O   . GLY D 62  ? 1.4133 1.0867 0.8874 0.5556  -0.3292 -0.2752 62  GLY D O   
2871 N N   . LYS D 63  ? 1.4417 0.9294 0.8470 0.4947  -0.3485 -0.2504 63  LYS D N   
2872 C CA  . LYS D 63  ? 1.4820 0.8989 0.8441 0.4770  -0.3637 -0.2372 63  LYS D CA  
2873 C C   . LYS D 63  ? 1.4389 0.9445 0.8907 0.4380  -0.3197 -0.2126 63  LYS D C   
2874 O O   . LYS D 63  ? 1.3746 0.9319 0.8974 0.3954  -0.2832 -0.1925 63  LYS D O   
2875 C CB  . LYS D 63  ? 1.5774 0.8592 0.8684 0.4324  -0.3868 -0.2193 63  LYS D CB  
2876 C CG  . LYS D 63  ? 1.6497 0.8488 0.8819 0.4105  -0.4097 -0.2049 63  LYS D CG  
2877 C CD  . LYS D 63  ? 1.8111 0.9058 0.9898 0.3484  -0.4235 -0.1798 63  LYS D CD  
2878 C CE  . LYS D 63  ? 1.9292 0.9176 1.0180 0.3313  -0.4619 -0.1697 63  LYS D CE  
2879 N N   . GLU D 64  ? 1.4029 0.9238 0.8464 0.4576  -0.3262 -0.2167 64  GLU D N   
2880 C CA  . GLU D 64  ? 1.3227 0.9153 0.8378 0.4264  -0.2912 -0.1966 64  GLU D CA  
2881 C C   . GLU D 64  ? 1.4078 0.9164 0.8930 0.3819  -0.2982 -0.1724 64  GLU D C   
2882 O O   . GLU D 64  ? 1.4962 0.8999 0.8928 0.3924  -0.3383 -0.1767 64  GLU D O   
2883 C CB  . GLU D 64  ? 1.3236 0.9936 0.8511 0.4731  -0.2920 -0.2152 64  GLU D CB  
2884 C CG  . GLU D 64  ? 1.3883 1.1841 0.9719 0.4996  -0.2721 -0.2316 64  GLU D CG  
2885 N N   . ILE D 65  ? 1.2945 0.8499 0.8491 0.3327  -0.2618 -0.1474 65  ILE D N   
2886 C CA  . ILE D 65  ? 1.2957 0.8017 0.8401 0.2857  -0.2607 -0.1230 65  ILE D CA  
2887 C C   . ILE D 65  ? 1.2590 0.8515 0.8829 0.2675  -0.2246 -0.1104 65  ILE D C   
2888 O O   . ILE D 65  ? 1.1967 0.8730 0.8872 0.2662  -0.1951 -0.1106 65  ILE D O   
2889 C CB  . ILE D 65  ? 1.3378 0.7947 0.8684 0.2389  -0.2595 -0.1060 65  ILE D CB  
2890 C CG1 . ILE D 65  ? 1.3714 0.7701 0.8689 0.1907  -0.2688 -0.0830 65  ILE D CG1 
2891 C CG2 . ILE D 65  ? 1.2418 0.7786 0.8538 0.2174  -0.2200 -0.0970 65  ILE D CG2 
2892 N N   . THR D 66  ? 1.2201 0.7876 0.8313 0.2533  -0.2298 -0.0997 66  THR D N   
2893 C CA  . THR D 66  ? 1.1274 0.7674 0.8085 0.2346  -0.1977 -0.0881 66  THR D CA  
2894 C C   . THR D 66  ? 1.1329 0.7857 0.8525 0.1857  -0.1750 -0.0674 66  THR D C   
2895 O O   . THR D 66  ? 1.1790 0.7810 0.8648 0.1631  -0.1862 -0.0600 66  THR D O   
2896 C CB  . THR D 66  ? 1.1884 0.8000 0.8446 0.2385  -0.2109 -0.0848 66  THR D CB  
2897 O OG1 . THR D 66  ? 1.2631 0.7883 0.8629 0.2079  -0.2337 -0.0707 66  THR D OG1 
2898 C CG2 . THR D 66  ? 1.1597 0.7692 0.7789 0.2935  -0.2328 -0.1073 66  THR D CG2 
2899 N N   . PHE D 67  ? 1.0214 0.7414 0.8056 0.1704  -0.1454 -0.0591 67  PHE D N   
2900 C CA  . PHE D 67  ? 0.9643 0.7022 0.7817 0.1326  -0.1261 -0.0430 67  PHE D CA  
2901 C C   . PHE D 67  ? 1.0757 0.7701 0.8623 0.1027  -0.1378 -0.0291 67  PHE D C   
2902 O O   . PHE D 67  ? 1.1040 0.7907 0.8856 0.0722  -0.1355 -0.0180 67  PHE D O   
2903 C CB  . PHE D 67  ? 0.9003 0.7076 0.7798 0.1285  -0.0989 -0.0400 67  PHE D CB  
2904 C CG  . PHE D 67  ? 0.8687 0.7209 0.7746 0.1460  -0.0885 -0.0491 67  PHE D CG  
2905 C CD1 . PHE D 67  ? 0.8754 0.7628 0.7875 0.1704  -0.0893 -0.0600 67  PHE D CD1 
2906 C CD2 . PHE D 67  ? 0.8657 0.7315 0.7900 0.1355  -0.0780 -0.0457 67  PHE D CD2 
2907 C CE1 . PHE D 67  ? 0.8552 0.7952 0.7909 0.1794  -0.0802 -0.0663 67  PHE D CE1 
2908 C CE2 . PHE D 67  ? 0.8710 0.7770 0.8160 0.1468  -0.0706 -0.0518 67  PHE D CE2 
2909 C CZ  . PHE D 67  ? 0.8393 0.7847 0.7900 0.1664  -0.0719 -0.0615 67  PHE D CZ  
2910 N N   . LEU D 68  ? 1.0578 0.7235 0.8175 0.1108  -0.1532 -0.0297 68  LEU D N   
2911 C CA  . LEU D 68  ? 1.0967 0.7170 0.8193 0.0808  -0.1691 -0.0154 68  LEU D CA  
2912 C C   . LEU D 68  ? 1.2266 0.7755 0.8816 0.0589  -0.1957 -0.0090 68  LEU D C   
2913 O O   . LEU D 68  ? 1.2367 0.7880 0.8877 0.0156  -0.1932 0.0073  68  LEU D O   
2914 C CB  . LEU D 68  ? 1.1243 0.7134 0.8189 0.1012  -0.1866 -0.0195 68  LEU D CB  
2915 C CG  . LEU D 68  ? 1.1203 0.7707 0.8709 0.1179  -0.1644 -0.0241 68  LEU D CG  
2916 C CD1 . LEU D 68  ? 1.1652 0.7752 0.8758 0.1428  -0.1864 -0.0299 68  LEU D CD1 
2917 C CD2 . LEU D 68  ? 1.0672 0.7633 0.8671 0.0848  -0.1414 -0.0104 68  LEU D CD2 
2918 N N   . GLU D 69  ? 1.2573 0.7472 0.8568 0.0888  -0.2219 -0.0230 69  GLU D N   
2919 C CA  . GLU D 69  ? 1.3461 0.7501 0.8658 0.0720  -0.2540 -0.0197 69  GLU D CA  
2920 C C   . GLU D 69  ? 1.3646 0.7982 0.9107 0.0470  -0.2358 -0.0140 69  GLU D C   
2921 O O   . GLU D 69  ? 1.3987 0.7896 0.8994 0.0051  -0.2502 0.0003  69  GLU D O   
2922 C CB  . GLU D 69  ? 1.4410 0.7763 0.8932 0.1223  -0.2888 -0.0416 69  GLU D CB  
2923 N N   . TYR D 70  ? 1.2549 0.7643 0.8728 0.0688  -0.2044 -0.0233 70  TYR D N   
2924 C CA  . TYR D 70  ? 1.2157 0.7592 0.8651 0.0516  -0.1848 -0.0192 70  TYR D CA  
2925 C C   . TYR D 70  ? 1.2451 0.8255 0.9175 0.0037  -0.1687 0.0008  70  TYR D C   
2926 O O   . TYR D 70  ? 1.2770 0.8391 0.9226 -0.0268 -0.1739 0.0097  70  TYR D O   
2927 C CB  . TYR D 70  ? 1.1558 0.7709 0.8736 0.0817  -0.1572 -0.0306 70  TYR D CB  
2928 C CG  . TYR D 70  ? 1.1460 0.7910 0.8933 0.0671  -0.1389 -0.0261 70  TYR D CG  
2929 C CD1 . TYR D 70  ? 1.2022 0.8057 0.9150 0.0729  -0.1518 -0.0326 70  TYR D CD1 
2930 C CD2 . TYR D 70  ? 1.0946 0.8046 0.8984 0.0509  -0.1114 -0.0170 70  TYR D CD2 
2931 C CE1 . TYR D 70  ? 1.1604 0.7880 0.8976 0.0601  -0.1358 -0.0281 70  TYR D CE1 
2932 C CE2 . TYR D 70  ? 1.0778 0.8120 0.9026 0.0422  -0.0974 -0.0139 70  TYR D CE2 
2933 C CZ  . TYR D 70  ? 1.1895 0.8830 0.9824 0.0453  -0.1086 -0.0185 70  TYR D CZ  
2934 O OH  . TYR D 70  ? 1.1357 0.8498 0.9467 0.0374  -0.0955 -0.0152 70  TYR D OH  
2935 N N   . TYR D 71  ? 1.1542 0.7903 0.8736 -0.0021 -0.1503 0.0065  71  TYR D N   
2936 C CA  . TYR D 71  ? 1.1273 0.8153 0.8725 -0.0403 -0.1347 0.0216  71  TYR D CA  
2937 C C   . TYR D 71  ? 1.2459 0.8917 0.9314 -0.0854 -0.1582 0.0381  71  TYR D C   
2938 O O   . TYR D 71  ? 1.2494 0.9279 0.9337 -0.1240 -0.1523 0.0506  71  TYR D O   
2939 C CB  . TYR D 71  ? 1.0587 0.8172 0.8682 -0.0283 -0.1106 0.0197  71  TYR D CB  
2940 C CG  . TYR D 71  ? 0.9869 0.7910 0.8478 -0.0009 -0.0883 0.0094  71  TYR D CG  
2941 C CD1 . TYR D 71  ? 0.9870 0.7885 0.8635 0.0328  -0.0861 -0.0026 71  TYR D CD1 
2942 C CD2 . TYR D 71  ? 0.9549 0.8039 0.8417 -0.0098 -0.0723 0.0119  71  TYR D CD2 
2943 C CE1 . TYR D 71  ? 0.9457 0.7830 0.8596 0.0506  -0.0700 -0.0093 71  TYR D CE1 
2944 C CE2 . TYR D 71  ? 0.9081 0.7849 0.8303 0.0141  -0.0574 0.0037  71  TYR D CE2 
2945 C CZ  . TYR D 71  ? 0.8942 0.7626 0.8287 0.0411  -0.0570 -0.0056 71  TYR D CZ  
2946 O OH  . TYR D 71  ? 0.7987 0.6907 0.7606 0.0574  -0.0459 -0.0108 71  TYR D OH  
2947 N N   . SER D 72  ? 1.2619 0.8346 0.8915 -0.0816 -0.1872 0.0384  72  SER D N   
2948 C CA  . SER D 72  ? 1.3466 0.8582 0.9012 -0.1277 -0.2181 0.0558  72  SER D CA  
2949 C C   . SER D 72  ? 1.4531 0.8990 0.9378 -0.1537 -0.2417 0.0609  72  SER D C   
2950 O O   . SER D 72  ? 1.4828 0.9390 0.9417 -0.2094 -0.2465 0.0799  72  SER D O   
2951 C CB  . SER D 72  ? 1.4474 0.8847 0.9509 -0.1106 -0.2477 0.0533  72  SER D CB  
2952 N N   . LYS D 73  ? 1.4334 0.8211 0.8890 -0.1154 -0.2554 0.0439  73  LYS D N   
2953 C CA  . LYS D 73  ? 1.5191 0.8318 0.9014 -0.1348 -0.2813 0.0457  73  LYS D CA  
2954 C C   . LYS D 73  ? 1.5322 0.9106 0.9570 -0.1595 -0.2537 0.0517  73  LYS D C   
2955 O O   . LYS D 73  ? 1.5937 0.9302 0.9588 -0.2041 -0.2719 0.0643  73  LYS D O   
2956 C CB  . LYS D 73  ? 1.5909 0.8282 0.9309 -0.0786 -0.3051 0.0216  73  LYS D CB  
2957 N N   . ASN D 74  ? 1.3953 0.8696 0.9143 -0.1314 -0.2134 0.0430  74  ASN D N   
2958 C CA  . ASN D 74  ? 1.3556 0.8900 0.9137 -0.1449 -0.1885 0.0459  74  ASN D CA  
2959 C C   . ASN D 74  ? 1.3730 1.0015 0.9718 -0.1846 -0.1653 0.0617  74  ASN D C   
2960 O O   . ASN D 74  ? 1.3839 1.0433 0.9813 -0.2113 -0.1571 0.0688  74  ASN D O   
2961 C CB  . ASN D 74  ? 1.2979 0.8758 0.9225 -0.0942 -0.1633 0.0283  74  ASN D CB  
2962 C CG  . ASN D 74  ? 1.6636 1.1702 1.2508 -0.0597 -0.1827 0.0121  74  ASN D CG  
2963 O OD1 . ASN D 74  ? 1.6195 1.0935 1.1783 -0.0665 -0.1898 0.0107  74  ASN D OD1 
2964 N ND2 . ASN D 74  ? 1.5790 1.0614 1.1611 -0.0211 -0.1937 -0.0014 74  ASN D ND2 
2965 N N   . TYR D 75  ? 1.2843 0.9652 0.9207 -0.1849 -0.1542 0.0652  75  TYR D N   
2966 C CA  . TYR D 75  ? 1.2311 1.0159 0.9113 -0.2130 -0.1316 0.0755  75  TYR D CA  
2967 C C   . TYR D 75  ? 1.3086 1.1052 0.9642 -0.2553 -0.1441 0.0917  75  TYR D C   
2968 O O   . TYR D 75  ? 1.2818 1.1728 0.9675 -0.2825 -0.1283 0.1003  75  TYR D O   
2969 C CB  . TYR D 75  ? 1.1417 1.0050 0.9054 -0.1679 -0.1002 0.0615  75  TYR D CB  
2970 C CG  . TYR D 75  ? 1.1064 0.9638 0.8961 -0.1290 -0.0881 0.0475  75  TYR D CG  
2971 C CD1 . TYR D 75  ? 1.1094 0.9328 0.9157 -0.0859 -0.0880 0.0337  75  TYR D CD1 
2972 C CD2 . TYR D 75  ? 1.1010 0.9909 0.8966 -0.1374 -0.0775 0.0487  75  TYR D CD2 
2973 C CE1 . TYR D 75  ? 1.0823 0.9034 0.9096 -0.0556 -0.0787 0.0229  75  TYR D CE1 
2974 C CE2 . TYR D 75  ? 1.0847 0.9635 0.9003 -0.1035 -0.0687 0.0372  75  TYR D CE2 
2975 C CZ  . TYR D 75  ? 1.1528 0.9968 0.9839 -0.0644 -0.0698 0.0250  75  TYR D CZ  
2976 O OH  . TYR D 75  ? 1.1643 1.0026 1.0136 -0.0361 -0.0624 0.0156  75  TYR D OH  
2977 N N   . GLY D 76  ? 1.3175 1.0243 0.9186 -0.2577 -0.1732 0.0947  76  GLY D N   
2978 C CA  . GLY D 76  ? 1.3583 1.0620 0.9292 -0.2974 -0.1895 0.1111  76  GLY D CA  
2979 C C   . GLY D 76  ? 1.3538 1.1309 0.9951 -0.2716 -0.1667 0.1047  76  GLY D C   
2980 O O   . GLY D 76  ? 1.3592 1.1741 0.9988 -0.3055 -0.1698 0.1178  76  GLY D O   
2981 N N   . ILE D 77  ? 1.2454 1.0414 0.9452 -0.2137 -0.1454 0.0848  77  ILE D N   
2982 C CA  . ILE D 77  ? 1.1706 1.0242 0.9334 -0.1832 -0.1250 0.0756  77  ILE D CA  
2983 C C   . ILE D 77  ? 1.2686 1.0507 1.0113 -0.1568 -0.1412 0.0700  77  ILE D C   
2984 O O   . ILE D 77  ? 1.3024 1.0200 1.0217 -0.1264 -0.1523 0.0596  77  ILE D O   
2985 C CB  . ILE D 77  ? 1.1254 1.0398 0.9539 -0.1424 -0.0957 0.0595  77  ILE D CB  
2986 C CG1 . ILE D 77  ? 1.1062 1.0999 0.9542 -0.1628 -0.0802 0.0634  77  ILE D CG1 
2987 C CG2 . ILE D 77  ? 1.0728 1.0264 0.9528 -0.1103 -0.0806 0.0492  77  ILE D CG2 
2988 C CD1 . ILE D 77  ? 1.0485 1.0793 0.9418 -0.1232 -0.0591 0.0485  77  ILE D CD1 
2989 N N   . THR D 78  ? 1.2013 1.0025 0.9539 -0.1660 -0.1424 0.0756  78  THR D N   
2990 C CA  . THR D 78  ? 1.2148 0.9607 0.9536 -0.1403 -0.1553 0.0703  78  THR D CA  
2991 C C   . THR D 78  ? 1.2095 1.0162 1.0209 -0.1012 -0.1275 0.0557  78  THR D C   
2992 O O   . THR D 78  ? 1.1886 1.0661 1.0415 -0.1098 -0.1112 0.0572  78  THR D O   
2993 C CB  . THR D 78  ? 1.3001 1.0129 0.9913 -0.1795 -0.1796 0.0878  78  THR D CB  
2994 O OG1 . THR D 78  ? 1.3845 1.0296 0.9964 -0.2194 -0.2097 0.1022  78  THR D OG1 
2995 C CG2 . THR D 78  ? 1.2540 0.9091 0.9287 -0.1504 -0.1939 0.0823  78  THR D CG2 
2996 N N   . VAL D 79  ? 1.1145 0.8953 0.9362 -0.0592 -0.1241 0.0410  79  VAL D N   
2997 C CA  . VAL D 79  ? 1.0376 0.8615 0.9144 -0.0267 -0.1028 0.0285  79  VAL D CA  
2998 C C   . VAL D 79  ? 1.1014 0.9126 0.9774 -0.0222 -0.1089 0.0297  79  VAL D C   
2999 O O   . VAL D 79  ? 1.1601 0.9116 0.9962 -0.0123 -0.1285 0.0294  79  VAL D O   
3000 C CB  . VAL D 79  ? 1.0476 0.8577 0.9312 0.0078  -0.0986 0.0151  79  VAL D CB  
3001 C CG1 . VAL D 79  ? 0.9846 0.8359 0.9156 0.0320  -0.0799 0.0054  79  VAL D CG1 
3002 C CG2 . VAL D 79  ? 1.0356 0.8523 0.9166 0.0017  -0.0944 0.0149  79  VAL D CG2 
3003 N N   . LYS D 80  ? 1.0104 0.8750 0.9250 -0.0275 -0.0948 0.0301  80  LYS D N   
3004 C CA  . LYS D 80  ? 1.0126 0.8692 0.9297 -0.0255 -0.0993 0.0315  80  LYS D CA  
3005 C C   . LYS D 80  ? 1.0719 0.9183 1.0073 0.0099  -0.0927 0.0190  80  LYS D C   
3006 O O   . LYS D 80  ? 1.1151 0.9202 1.0276 0.0193  -0.1053 0.0192  80  LYS D O   
3007 C CB  . LYS D 80  ? 1.0097 0.9307 0.9580 -0.0425 -0.0889 0.0344  80  LYS D CB  
3008 N N   . GLU D 81  ? 0.9917 0.8739 0.9621 0.0275  -0.0753 0.0089  81  GLU D N   
3009 C CA  . GLU D 81  ? 0.9680 0.8489 0.9528 0.0521  -0.0690 -0.0008 81  GLU D CA  
3010 C C   . GLU D 81  ? 1.0221 0.8874 0.9937 0.0694  -0.0716 -0.0065 81  GLU D C   
3011 O O   . GLU D 81  ? 1.0117 0.8977 0.9967 0.0727  -0.0628 -0.0100 81  GLU D O   
3012 C CB  . GLU D 81  ? 0.9554 0.8753 0.9731 0.0570  -0.0548 -0.0071 81  GLU D CB  
3013 C CG  . GLU D 81  ? 1.1745 1.1124 1.2039 0.0500  -0.0544 -0.0067 81  GLU D CG  
3014 C CD  . GLU D 81  ? 1.6205 1.5374 1.6479 0.0568  -0.0584 -0.0086 81  GLU D CD  
3015 O OE1 . GLU D 81  ? 1.7306 1.6461 1.7547 0.0462  -0.0644 -0.0037 81  GLU D OE1 
3016 O OE2 . GLU D 81  ? 1.5799 1.4857 1.6081 0.0700  -0.0557 -0.0141 81  GLU D OE2 
3017 N N   . GLU D 82  ? 1.0098 0.8400 0.9522 0.0832  -0.0855 -0.0086 82  GLU D N   
3018 C CA  . GLU D 82  ? 1.0262 0.8468 0.9499 0.1065  -0.0920 -0.0174 82  GLU D CA  
3019 C C   . GLU D 82  ? 1.0490 0.9115 0.9981 0.1240  -0.0793 -0.0266 82  GLU D C   
3020 O O   . GLU D 82  ? 1.0663 0.9397 1.0050 0.1444  -0.0830 -0.0354 82  GLU D O   
3021 C CB  . GLU D 82  ? 1.1020 0.8667 0.9738 0.1207  -0.1173 -0.0187 82  GLU D CB  
3022 C CG  . GLU D 82  ? 1.3114 1.0237 1.1421 0.0963  -0.1364 -0.0069 82  GLU D CG  
3023 C CD  . GLU D 82  ? 1.6591 1.2957 1.4204 0.1090  -0.1697 -0.0074 82  GLU D CD  
3024 O OE1 . GLU D 82  ? 1.6867 1.3136 1.4327 0.1439  -0.1783 -0.0188 82  GLU D OE1 
3025 O OE2 . GLU D 82  ? 1.5865 1.1723 1.3024 0.0834  -0.1899 0.0037  82  GLU D OE2 
3026 N N   . ASP D 83  ? 0.9644 0.8518 0.9416 0.1147  -0.0667 -0.0249 83  ASP D N   
3027 C CA  . ASP D 83  ? 0.9379 0.8614 0.9311 0.1209  -0.0572 -0.0303 83  ASP D CA  
3028 C C   . ASP D 83  ? 0.9385 0.8877 0.9534 0.1061  -0.0457 -0.0285 83  ASP D C   
3029 O O   . ASP D 83  ? 0.9487 0.9234 0.9693 0.1024  -0.0407 -0.0301 83  ASP D O   
3030 C CB  . ASP D 83  ? 0.9535 0.8712 0.9472 0.1216  -0.0578 -0.0301 83  ASP D CB  
3031 N N   . GLN D 84  ? 0.8313 0.7728 0.8519 0.0966  -0.0438 -0.0248 84  GLN D N   
3032 C CA  . GLN D 84  ? 0.7910 0.7459 0.8228 0.0877  -0.0376 -0.0240 84  GLN D CA  
3033 C C   . GLN D 84  ? 0.7932 0.7683 0.8248 0.0890  -0.0352 -0.0255 84  GLN D C   
3034 O O   . GLN D 84  ? 0.7956 0.7755 0.8211 0.0994  -0.0377 -0.0284 84  GLN D O   
3035 C CB  . GLN D 84  ? 0.7977 0.7479 0.8334 0.0823  -0.0370 -0.0214 84  GLN D CB  
3036 C CG  . GLN D 84  ? 0.8341 0.7791 0.8621 0.0823  -0.0389 -0.0194 84  GLN D CG  
3037 C CD  . GLN D 84  ? 0.8659 0.8154 0.8955 0.0720  -0.0382 -0.0154 84  GLN D CD  
3038 O OE1 . GLN D 84  ? 0.7587 0.7254 0.7972 0.0718  -0.0334 -0.0166 84  GLN D OE1 
3039 N NE2 . GLN D 84  ? 0.6807 0.6163 0.6967 0.0624  -0.0451 -0.0103 84  GLN D NE2 
3040 N N   . PRO D 85  ? 0.7240 0.7071 0.7562 0.0785  -0.0336 -0.0237 85  PRO D N   
3041 C CA  . PRO D 85  ? 0.7101 0.7146 0.7410 0.0750  -0.0326 -0.0230 85  PRO D CA  
3042 C C   . PRO D 85  ? 0.7577 0.7523 0.7907 0.0790  -0.0319 -0.0224 85  PRO D C   
3043 O O   . PRO D 85  ? 0.7334 0.7109 0.7683 0.0823  -0.0317 -0.0222 85  PRO D O   
3044 C CB  . PRO D 85  ? 0.7278 0.7291 0.7472 0.0568  -0.0364 -0.0186 85  PRO D CB  
3045 C CG  . PRO D 85  ? 0.7699 0.7374 0.7839 0.0589  -0.0406 -0.0196 85  PRO D CG  
3046 C CD  . PRO D 85  ? 0.7116 0.6778 0.7376 0.0699  -0.0370 -0.0227 85  PRO D CD  
3047 N N   . LEU D 86  ? 0.7131 0.7230 0.7448 0.0763  -0.0318 -0.0216 86  LEU D N   
3048 C CA  . LEU D 86  ? 0.6921 0.6910 0.7241 0.0800  -0.0314 -0.0211 86  LEU D CA  
3049 C C   . LEU D 86  ? 0.7298 0.7199 0.7537 0.0694  -0.0346 -0.0161 86  LEU D C   
3050 O O   . LEU D 86  ? 0.7302 0.7302 0.7448 0.0556  -0.0387 -0.0123 86  LEU D O   
3051 C CB  . LEU D 86  ? 0.6875 0.7022 0.7191 0.0908  -0.0320 -0.0260 86  LEU D CB  
3052 C CG  . LEU D 86  ? 0.7553 0.7662 0.7797 0.1072  -0.0361 -0.0330 86  LEU D CG  
3053 C CD1 . LEU D 86  ? 0.7706 0.7870 0.7850 0.1232  -0.0416 -0.0408 86  LEU D CD1 
3054 C CD2 . LEU D 86  ? 0.7804 0.7556 0.7980 0.1055  -0.0386 -0.0303 86  LEU D CD2 
3055 N N   . LEU D 87  ? 0.6838 0.6549 0.7054 0.0746  -0.0350 -0.0158 87  LEU D N   
3056 C CA  . LEU D 87  ? 0.6917 0.6444 0.6972 0.0710  -0.0422 -0.0125 87  LEU D CA  
3057 C C   . LEU D 87  ? 0.7194 0.6785 0.7262 0.0700  -0.0412 -0.0104 87  LEU D C   
3058 O O   . LEU D 87  ? 0.6772 0.6417 0.6946 0.0787  -0.0355 -0.0135 87  LEU D O   
3059 C CB  . LEU D 87  ? 0.6943 0.6318 0.6949 0.0836  -0.0442 -0.0159 87  LEU D CB  
3060 C CG  . LEU D 87  ? 0.7418 0.6812 0.7449 0.0892  -0.0446 -0.0205 87  LEU D CG  
3061 C CD1 . LEU D 87  ? 0.7370 0.6826 0.7382 0.1046  -0.0455 -0.0260 87  LEU D CD1 
3062 C CD2 . LEU D 87  ? 0.7633 0.6815 0.7455 0.0830  -0.0557 -0.0205 87  LEU D CD2 
3063 N N   . ILE D 88  ? 0.6948 0.6504 0.6859 0.0567  -0.0492 -0.0045 88  ILE D N   
3064 C CA  . ILE D 88  ? 0.6885 0.6536 0.6798 0.0533  -0.0499 -0.0018 88  ILE D CA  
3065 C C   . ILE D 88  ? 0.7696 0.6974 0.7402 0.0555  -0.0589 0.0023  88  ILE D C   
3066 O O   . ILE D 88  ? 0.7763 0.6722 0.7174 0.0484  -0.0727 0.0069  88  ILE D O   
3067 C CB  . ILE D 88  ? 0.7281 0.7288 0.7156 0.0323  -0.0534 0.0034  88  ILE D CB  
3068 C CG1 . ILE D 88  ? 0.7026 0.7484 0.7080 0.0354  -0.0454 -0.0029 88  ILE D CG1 
3069 C CG2 . ILE D 88  ? 0.7047 0.7225 0.6937 0.0293  -0.0547 0.0053  88  ILE D CG2 
3070 C CD1 . ILE D 88  ? 0.6588 0.7480 0.6558 0.0093  -0.0494 0.0035  88  ILE D CD1 
3071 N N   . HIS D 89  ? 0.7283 0.6548 0.7078 0.0666  -0.0539 -0.0001 89  HIS D N   
3072 C CA  . HIS D 89  ? 0.7413 0.6375 0.7028 0.0711  -0.0615 0.0033  89  HIS D CA  
3073 C C   . HIS D 89  ? 0.7915 0.7017 0.7584 0.0644  -0.0609 0.0058  89  HIS D C   
3074 O O   . HIS D 89  ? 0.7397 0.6727 0.7267 0.0724  -0.0516 -0.0008 89  HIS D O   
3075 C CB  . HIS D 89  ? 0.7491 0.6354 0.7153 0.0908  -0.0556 -0.0024 89  HIS D CB  
3076 C CG  . HIS D 89  ? 0.8118 0.6716 0.7603 0.0995  -0.0623 -0.0003 89  HIS D CG  
3077 N ND1 . HIS D 89  ? 0.8264 0.6898 0.7858 0.1053  -0.0545 -0.0022 89  HIS D ND1 
3078 C CD2 . HIS D 89  ? 0.8669 0.6901 0.7815 0.1036  -0.0790 0.0034  89  HIS D CD2 
3079 C CE1 . HIS D 89  ? 0.8401 0.6756 0.7780 0.1137  -0.0635 0.0004  89  HIS D CE1 
3080 N NE2 . HIS D 89  ? 0.8718 0.6806 0.7805 0.1144  -0.0795 0.0036  89  HIS D NE2 
3081 N N   . ARG D 90  ? 0.8181 0.7117 0.7613 0.0495  -0.0741 0.0150  90  ARG D N   
3082 C CA  . ARG D 90  ? 0.8302 0.7405 0.7768 0.0414  -0.0756 0.0182  90  ARG D CA  
3083 C C   . ARG D 90  ? 0.8626 0.7308 0.7960 0.0550  -0.0800 0.0192  90  ARG D C   
3084 O O   . ARG D 90  ? 0.8733 0.6978 0.7733 0.0523  -0.0952 0.0264  90  ARG D O   
3085 C CB  . ARG D 90  ? 0.8717 0.7995 0.7990 0.0089  -0.0881 0.0301  90  ARG D CB  
3086 C CG  . ARG D 90  ? 0.9081 0.8882 0.8513 -0.0025 -0.0811 0.0276  90  ARG D CG  
3087 C CD  . ARG D 90  ? 1.0412 1.0629 0.9705 -0.0393 -0.0902 0.0389  90  ARG D CD  
3088 N NE  . ARG D 90  ? 1.0832 1.1481 1.0219 -0.0490 -0.0844 0.0367  90  ARG D NE  
3089 C CZ  . ARG D 90  ? 1.2498 1.2870 1.1601 -0.0705 -0.0948 0.0450  90  ARG D CZ  
3090 N NH1 . ARG D 90  ? 1.0490 1.0121 0.9132 -0.0834 -0.1150 0.0553  90  ARG D NH1 
3091 N NH2 . ARG D 90  ? 1.1348 1.2136 1.0561 -0.0776 -0.0880 0.0421  90  ARG D NH2 
3092 N N   . PRO D 91  ? 0.8381 0.7115 0.7902 0.0718  -0.0695 0.0113  91  PRO D N   
3093 C CA  . PRO D 91  ? 0.8573 0.6921 0.7959 0.0849  -0.0726 0.0121  91  PRO D CA  
3094 C C   . PRO D 91  ? 0.9274 0.7447 0.8496 0.0762  -0.0840 0.0198  91  PRO D C   
3095 O O   . PRO D 91  ? 0.9456 0.7621 0.8495 0.0549  -0.0969 0.0300  91  PRO D O   
3096 C CB  . PRO D 91  ? 0.8597 0.7044 0.8182 0.0989  -0.0593 0.0021  91  PRO D CB  
3097 C CG  . PRO D 91  ? 0.8905 0.7718 0.8667 0.0952  -0.0548 -0.0040 91  PRO D CG  
3098 C CD  . PRO D 91  ? 0.8363 0.7427 0.8137 0.0808  -0.0578 0.0007  91  PRO D CD  
3099 N N   . GLU D 93  ? 1.0756 0.8299 0.9723 0.0880  -0.0965 0.0258  93  GLU D N   
3100 C CA  . GLU D 93  ? 1.0881 0.8485 0.9884 0.0820  -0.1000 0.0271  93  GLU D CA  
3101 C C   . GLU D 93  ? 1.1342 0.9522 1.0660 0.0821  -0.0891 0.0158  93  GLU D C   
3102 O O   . GLU D 93  ? 1.1499 0.9680 1.0922 0.0980  -0.0831 0.0044  93  GLU D O   
3103 C CB  . GLU D 93  ? 1.1125 0.8300 1.0030 0.1005  -0.0999 0.0247  93  GLU D CB  
3104 N N   . ARG D 94  ? 1.0495 0.9134 0.9894 0.0654  -0.0896 0.0182  94  ARG D N   
3105 C CA  . ARG D 94  ? 0.9993 0.9258 0.9644 0.0695  -0.0815 0.0062  94  ARG D CA  
3106 C C   . ARG D 94  ? 0.9964 0.9794 0.9707 0.0632  -0.0861 0.0028  94  ARG D C   
3107 O O   . ARG D 94  ? 0.9731 1.0077 0.9645 0.0783  -0.0814 -0.0124 94  ARG D O   
3108 C CB  . ARG D 94  ? 0.9736 0.9286 0.9430 0.0567  -0.0788 0.0093  94  ARG D CB  
3109 C CG  . ARG D 94  ? 1.0103 0.9824 0.9626 0.0227  -0.0902 0.0253  94  ARG D CG  
3110 C CD  . ARG D 94  ? 0.9422 0.9311 0.8963 0.0139  -0.0869 0.0263  94  ARG D CD  
3111 N NE  . ARG D 94  ? 0.9101 0.8989 0.8358 -0.0232 -0.1014 0.0432  94  ARG D NE  
3112 C CZ  . ARG D 94  ? 1.0556 0.9768 0.9431 -0.0327 -0.1162 0.0541  94  ARG D CZ  
3113 N NH1 . ARG D 94  ? 1.0242 0.9367 0.8749 -0.0699 -0.1342 0.0696  94  ARG D NH1 
3114 N NH2 . ARG D 94  ? 0.8363 0.6988 0.7162 -0.0050 -0.1156 0.0489  94  ARG D NH2 
3115 N N   . GLN D 95  ? 0.9320 0.9083 0.8912 0.0425  -0.0975 0.0162  95  GLN D N   
3116 C CA  . GLN D 95  ? 0.8933 0.9348 0.8613 0.0316  -0.1027 0.0148  95  GLN D CA  
3117 C C   . GLN D 95  ? 0.9121 0.9132 0.8658 0.0308  -0.1123 0.0207  95  GLN D C   
3118 O O   . GLN D 95  ? 0.9090 0.8392 0.8355 0.0210  -0.1212 0.0354  95  GLN D O   
3119 C CB  . GLN D 95  ? 0.9092 1.0053 0.8697 -0.0094 -0.1098 0.0305  95  GLN D CB  
3120 C CG  . GLN D 95  ? 1.0033 1.2099 0.9844 -0.0175 -0.1091 0.0232  95  GLN D CG  
3121 C CD  . GLN D 95  ? 1.0503 1.3193 1.0219 -0.0643 -0.1152 0.0400  95  GLN D CD  
3122 O OE1 . GLN D 95  ? 0.9507 1.1661 0.8922 -0.0939 -0.1241 0.0588  95  GLN D OE1 
3123 N NE2 . GLN D 95  ? 0.8780 1.2642 0.8703 -0.0715 -0.1124 0.0324  95  GLN D NE2 
3124 N N   . ASP D 96  ? 0.8461 0.8908 0.8147 0.0453  -0.1124 0.0073  96  ASP D N   
3125 C CA  . ASP D 96  ? 0.8544 0.8685 0.8118 0.0451  -0.1218 0.0114  96  ASP D CA  
3126 C C   . ASP D 96  ? 0.8999 0.9767 0.8521 0.0058  -0.1341 0.0270  96  ASP D C   
3127 O O   . ASP D 96  ? 0.9028 1.0471 0.8599 -0.0203 -0.1339 0.0334  96  ASP D O   
3128 C CB  . ASP D 96  ? 0.8763 0.8884 0.8453 0.0851  -0.1180 -0.0133 96  ASP D CB  
3129 C CG  . ASP D 96  ? 1.0532 1.1617 1.0417 0.1001  -0.1197 -0.0331 96  ASP D CG  
3130 O OD1 . ASP D 96  ? 1.0536 1.2481 1.0561 0.0867  -0.1173 -0.0331 96  ASP D OD1 
3131 O OD2 . ASP D 96  ? 1.1453 1.2443 1.1322 0.1286  -0.1243 -0.0506 96  ASP D OD2 
3132 N N   . ASN D 97  ? 0.8696 0.9266 0.8096 -0.0021 -0.1454 0.0342  97  ASN D N   
3133 C CA  . ASN D 97  ? 0.8933 1.0086 0.8230 -0.0462 -0.1600 0.0520  97  ASN D CA  
3134 C C   . ASN D 97  ? 0.9322 1.1883 0.8950 -0.0468 -0.1547 0.0369  97  ASN D C   
3135 O O   . ASN D 97  ? 0.9380 1.2715 0.8955 -0.0924 -0.1636 0.0530  97  ASN D O   
3136 C CB  . ASN D 97  ? 0.8846 0.9378 0.7910 -0.0520 -0.1747 0.0631  97  ASN D CB  
3137 C CG  . ASN D 97  ? 1.0744 1.1202 0.9999 -0.0094 -0.1688 0.0404  97  ASN D CG  
3138 O OD1 . ASN D 97  ? 1.0678 1.1265 1.0159 0.0312  -0.1554 0.0149  97  ASN D OD1 
3139 N ND2 . ASN D 97  ? 0.9797 0.9947 0.8890 -0.0191 -0.1822 0.0499  97  ASN D ND2 
3140 N N   . HIS D 98  ? 0.8540 1.1440 0.8447 0.0035  -0.1426 0.0057  98  HIS D N   
3141 C CA  . HIS D 98  ? 0.8210 1.2439 0.8393 0.0192  -0.1392 -0.0159 98  HIS D CA  
3142 C C   . HIS D 98  ? 0.8566 1.3492 0.8870 0.0113  -0.1301 -0.0180 98  HIS D C   
3143 O O   . HIS D 98  ? 0.8470 1.4593 0.8984 0.0261  -0.1271 -0.0365 98  HIS D O   
3144 C CB  . HIS D 98  ? 0.8149 1.2250 0.8422 0.0810  -0.1377 -0.0499 98  HIS D CB  
3145 C CG  . HIS D 98  ? 0.8699 1.2386 0.8881 0.0869  -0.1477 -0.0501 98  HIS D CG  
3146 N ND1 . HIS D 98  ? 0.9031 1.1412 0.8995 0.0876  -0.1496 -0.0385 98  HIS D ND1 
3147 C CD2 . HIS D 98  ? 0.8935 1.3407 0.9210 0.0912  -0.1565 -0.0601 98  HIS D CD2 
3148 C CE1 . HIS D 98  ? 0.9066 1.1395 0.8989 0.0921  -0.1594 -0.0411 98  HIS D CE1 
3149 N NE2 . HIS D 98  ? 0.9071 1.2625 0.9180 0.0940  -0.1642 -0.0540 98  HIS D NE2 
3150 N N   . GLY D 99  ? 0.8113 1.2315 0.8261 -0.0099 -0.1271 0.0000  99  GLY D N   
3151 C CA  . GLY D 99  ? 0.8026 1.2657 0.8237 -0.0212 -0.1192 0.0016  99  GLY D CA  
3152 C C   . GLY D 99  ? 0.8544 1.2997 0.8894 0.0307  -0.1078 -0.0243 99  GLY D C   
3153 O O   . GLY D 99  ? 0.8359 1.3151 0.8775 0.0287  -0.1008 -0.0262 99  GLY D O   
3154 N N   . MET D 100 ? 0.8232 1.2094 0.8569 0.0749  -0.1081 -0.0434 100 MET D N   
3155 C CA  . MET D 100 ? 0.8122 1.1663 0.8463 0.1212  -0.1032 -0.0669 100 MET D CA  
3156 C C   . MET D 100 ? 0.8674 1.1262 0.8908 0.1139  -0.0963 -0.0546 100 MET D C   
3157 O O   . MET D 100 ? 0.8596 1.0406 0.8699 0.0954  -0.0972 -0.0369 100 MET D O   
3158 C CB  . MET D 100 ? 0.8497 1.1662 0.8743 0.1649  -0.1109 -0.0901 100 MET D CB  
3159 N N   . LEU D 101 ? 0.8413 1.1114 0.8683 0.1313  -0.0908 -0.0654 101 LEU D N   
3160 C CA  . LEU D 101 ? 0.8518 1.0490 0.8713 0.1291  -0.0843 -0.0582 101 LEU D CA  
3161 C C   . LEU D 101 ? 0.9558 1.0624 0.9586 0.1535  -0.0865 -0.0664 101 LEU D C   
3162 O O   . LEU D 101 ? 0.9807 1.0822 0.9730 0.1870  -0.0934 -0.0878 101 LEU D O   
3163 C CB  . LEU D 101 ? 0.8438 1.0847 0.8698 0.1437  -0.0803 -0.0698 101 LEU D CB  
3164 N N   . LEU D 102 ? 0.9489 0.9853 0.9430 0.1370  -0.0837 -0.0503 102 LEU D N   
3165 C CA  . LEU D 102 ? 0.9793 0.9359 0.9563 0.1522  -0.0844 -0.0545 102 LEU D CA  
3166 C C   . LEU D 102 ? 1.0487 0.9708 1.0200 0.1544  -0.0782 -0.0544 102 LEU D C   
3167 O O   . LEU D 102 ? 1.0833 0.9637 1.0365 0.1706  -0.0819 -0.0653 102 LEU D O   
3168 C CB  . LEU D 102 ? 0.9853 0.8938 0.9545 0.1362  -0.0849 -0.0381 102 LEU D CB  
3169 C CG  . LEU D 102 ? 1.0504 0.9774 1.0198 0.1277  -0.0928 -0.0332 102 LEU D CG  
3170 C CD1 . LEU D 102 ? 1.0637 0.9336 1.0179 0.1117  -0.0957 -0.0145 102 LEU D CD1 
3171 C CD2 . LEU D 102 ? 1.0605 0.9842 1.0248 0.1541  -0.0993 -0.0524 102 LEU D CD2 
3172 N N   . LYS D 103 ? 0.9527 0.8888 0.9339 0.1354  -0.0715 -0.0413 103 LYS D N   
3173 C CA  . LYS D 103 ? 0.9413 0.8568 0.9209 0.1342  -0.0653 -0.0395 103 LYS D CA  
3174 C C   . LYS D 103 ? 0.9691 0.9382 0.9620 0.1295  -0.0629 -0.0406 103 LYS D C   
3175 O O   . LYS D 103 ? 0.9694 0.9809 0.9711 0.1127  -0.0636 -0.0326 103 LYS D O   
3176 C CB  . LYS D 103 ? 0.9657 0.8467 0.9416 0.1198  -0.0609 -0.0244 103 LYS D CB  
3177 C CG  . LYS D 103 ? 1.1236 0.9548 1.0855 0.1254  -0.0609 -0.0232 103 LYS D CG  
3178 C CD  . LYS D 103 ? 1.1599 0.9707 1.1152 0.1177  -0.0608 -0.0103 103 LYS D CD  
3179 C CE  . LYS D 103 ? 1.2589 1.0300 1.2001 0.1251  -0.0605 -0.0092 103 LYS D CE  
3180 N NZ  . LYS D 103 ? 1.4060 1.1592 1.3345 0.1263  -0.0635 0.0000  103 LYS D NZ  
3181 N N   . GLY D 104 ? 0.8910 0.8552 0.8806 0.1403  -0.0617 -0.0485 104 GLY D N   
3182 C CA  . GLY D 104 ? 0.8618 0.8721 0.8627 0.1369  -0.0589 -0.0492 104 GLY D CA  
3183 C C   . GLY D 104 ? 0.8644 0.8596 0.8702 0.1164  -0.0523 -0.0347 104 GLY D C   
3184 O O   . GLY D 104 ? 0.8562 0.8092 0.8556 0.1106  -0.0505 -0.0269 104 GLY D O   
3185 N N   . GLU D 105 ? 0.7919 0.8218 0.8059 0.1081  -0.0497 -0.0325 105 GLU D N   
3186 C CA  . GLU D 105 ? 0.7682 0.7760 0.7811 0.0929  -0.0464 -0.0215 105 GLU D CA  
3187 C C   . GLU D 105 ? 0.7954 0.7705 0.8059 0.1034  -0.0426 -0.0255 105 GLU D C   
3188 O O   . GLU D 105 ? 0.7835 0.7528 0.7885 0.1180  -0.0449 -0.0353 105 GLU D O   
3189 C CB  . GLU D 105 ? 0.7761 0.8225 0.7925 0.0749  -0.0470 -0.0155 105 GLU D CB  
3190 C CG  . GLU D 105 ? 0.8633 0.9453 0.8885 0.0839  -0.0435 -0.0241 105 GLU D CG  
3191 C CD  . GLU D 105 ? 1.2682 1.4067 1.2964 0.0643  -0.0443 -0.0194 105 GLU D CD  
3192 O OE1 . GLU D 105 ? 1.2302 1.4086 1.2655 0.0748  -0.0417 -0.0279 105 GLU D OE1 
3193 O OE2 . GLU D 105 ? 1.2009 1.3429 1.2190 0.0371  -0.0495 -0.0067 105 GLU D OE2 
3194 N N   . ILE D 106 ? 0.7313 0.6819 0.7392 0.0962  -0.0402 -0.0181 106 ILE D N   
3195 C CA  . ILE D 106 ? 0.7062 0.6388 0.7127 0.0997  -0.0364 -0.0194 106 ILE D CA  
3196 C C   . ILE D 106 ? 0.7298 0.6777 0.7429 0.0954  -0.0346 -0.0188 106 ILE D C   
3197 O O   . ILE D 106 ? 0.6996 0.6534 0.7122 0.0874  -0.0364 -0.0139 106 ILE D O   
3198 C CB  . ILE D 106 ? 0.7481 0.6594 0.7484 0.0995  -0.0347 -0.0149 106 ILE D CB  
3199 C CG1 . ILE D 106 ? 0.7560 0.6481 0.7479 0.1039  -0.0360 -0.0166 106 ILE D CG1 
3200 C CG2 . ILE D 106 ? 0.7238 0.6380 0.7256 0.0980  -0.0302 -0.0149 106 ILE D CG2 
3201 C CD1 . ILE D 106 ? 0.8126 0.6910 0.7973 0.1061  -0.0344 -0.0128 106 ILE D CD1 
3202 N N   . LEU D 107 ? 0.7051 0.6520 0.7173 0.0999  -0.0344 -0.0235 107 LEU D N   
3203 C CA  . LEU D 107 ? 0.7078 0.6656 0.7251 0.0975  -0.0332 -0.0234 107 LEU D CA  
3204 C C   . LEU D 107 ? 0.7346 0.6787 0.7498 0.0931  -0.0311 -0.0209 107 LEU D C   
3205 O O   . LEU D 107 ? 0.7597 0.6866 0.7630 0.0915  -0.0337 -0.0213 107 LEU D O   
3206 C CB  . LEU D 107 ? 0.7203 0.6925 0.7342 0.1079  -0.0374 -0.0311 107 LEU D CB  
3207 C CG  . LEU D 107 ? 0.7793 0.7901 0.7991 0.1108  -0.0383 -0.0345 107 LEU D CG  
3208 C CD1 . LEU D 107 ? 0.7900 0.8202 0.8021 0.1308  -0.0445 -0.0465 107 LEU D CD1 
3209 C CD2 . LEU D 107 ? 0.8214 0.8573 0.8495 0.0943  -0.0353 -0.0274 107 LEU D CD2 
3210 N N   . LEU D 108 ? 0.6342 0.5867 0.6565 0.0892  -0.0286 -0.0182 108 LEU D N   
3211 C CA  . LEU D 108 ? 0.6272 0.5833 0.6513 0.0858  -0.0263 -0.0169 108 LEU D CA  
3212 C C   . LEU D 108 ? 0.6784 0.6403 0.7072 0.0840  -0.0268 -0.0176 108 LEU D C   
3213 O O   . LEU D 108 ? 0.7027 0.6668 0.7336 0.0852  -0.0283 -0.0186 108 LEU D O   
3214 C CB  . LEU D 108 ? 0.6120 0.5747 0.6355 0.0911  -0.0257 -0.0170 108 LEU D CB  
3215 C CG  . LEU D 108 ? 0.6380 0.5913 0.6546 0.0953  -0.0263 -0.0160 108 LEU D CG  
3216 C CD1 . LEU D 108 ? 0.6571 0.6046 0.6628 0.1064  -0.0322 -0.0175 108 LEU D CD1 
3217 C CD2 . LEU D 108 ? 0.5495 0.5074 0.5635 0.0899  -0.0222 -0.0147 108 LEU D CD2 
3218 N N   . LEU D 109 ? 0.6362 0.6023 0.6645 0.0778  -0.0265 -0.0160 109 LEU D N   
3219 C CA  . LEU D 109 ? 0.6471 0.6163 0.6791 0.0757  -0.0277 -0.0161 109 LEU D CA  
3220 C C   . LEU D 109 ? 0.6711 0.6593 0.7111 0.0794  -0.0260 -0.0187 109 LEU D C   
3221 O O   . LEU D 109 ? 0.6813 0.6914 0.7232 0.0789  -0.0238 -0.0190 109 LEU D O   
3222 C CB  . LEU D 109 ? 0.6748 0.6339 0.6948 0.0640  -0.0325 -0.0118 109 LEU D CB  
3223 C CG  . LEU D 109 ? 0.7871 0.7136 0.7836 0.0645  -0.0417 -0.0117 109 LEU D CG  
3224 C CD1 . LEU D 109 ? 0.8370 0.7393 0.8088 0.0508  -0.0530 -0.0062 109 LEU D CD1 
3225 C CD2 . LEU D 109 ? 0.7961 0.7181 0.7932 0.0818  -0.0439 -0.0185 109 LEU D CD2 
3226 N N   . PRO D 110 ? 0.6095 0.5920 0.6505 0.0843  -0.0286 -0.0217 110 PRO D N   
3227 C CA  . PRO D 110 ? 0.5954 0.5877 0.6357 0.0927  -0.0318 -0.0273 110 PRO D CA  
3228 C C   . PRO D 110 ? 0.6523 0.6764 0.7014 0.0903  -0.0294 -0.0282 110 PRO D C   
3229 O O   . PRO D 110 ? 0.6457 0.6939 0.6942 0.1031  -0.0316 -0.0355 110 PRO D O   
3230 C CB  . PRO D 110 ? 0.6179 0.5909 0.6531 0.0918  -0.0364 -0.0286 110 PRO D CB  
3231 C CG  . PRO D 110 ? 0.6645 0.6274 0.6978 0.0846  -0.0350 -0.0242 110 PRO D CG  
3232 C CD  . PRO D 110 ? 0.6281 0.5976 0.6668 0.0827  -0.0304 -0.0213 110 PRO D CD  
3233 N N   . GLU D 111 ? 0.6391 0.6636 0.6911 0.0746  -0.0277 -0.0213 111 GLU D N   
3234 C CA  . GLU D 111 ? 0.6594 0.7137 0.7148 0.0611  -0.0275 -0.0176 111 GLU D CA  
3235 C C   . GLU D 111 ? 0.7637 0.8574 0.8196 0.0539  -0.0236 -0.0157 111 GLU D C   
3236 O O   . GLU D 111 ? 0.7858 0.9295 0.8480 0.0472  -0.0222 -0.0162 111 GLU D O   
3237 C CB  . GLU D 111 ? 0.6984 0.7223 0.7412 0.0438  -0.0328 -0.0085 111 GLU D CB  
3238 C CG  . GLU D 111 ? 0.9049 0.9479 0.9418 0.0211  -0.0372 -0.0005 111 GLU D CG  
3239 C CD  . GLU D 111 ? 1.1177 1.1138 1.1279 0.0053  -0.0494 0.0088  111 GLU D CD  
3240 O OE1 . GLU D 111 ? 0.8800 0.8383 0.8847 0.0201  -0.0533 0.0054  111 GLU D OE1 
3241 O OE2 . GLU D 111 ? 1.1016 1.1001 1.0915 -0.0227 -0.0573 0.0197  111 GLU D OE2 
3242 N N   . LEU D 112 ? 0.7178 0.7957 0.7669 0.0548  -0.0217 -0.0140 112 LEU D N   
3243 C CA  . LEU D 112 ? 0.6945 0.8061 0.7411 0.0468  -0.0178 -0.0117 112 LEU D CA  
3244 C C   . LEU D 112 ? 0.6928 0.8220 0.7433 0.0725  -0.0154 -0.0214 112 LEU D C   
3245 O O   . LEU D 112 ? 0.6897 0.8533 0.7386 0.0711  -0.0117 -0.0213 112 LEU D O   
3246 C CB  . LEU D 112 ? 0.7108 0.7844 0.7388 0.0285  -0.0208 -0.0028 112 LEU D CB  
3247 C CG  . LEU D 112 ? 0.8073 0.8406 0.8150 0.0091  -0.0307 0.0052  112 LEU D CG  
3248 C CD1 . LEU D 112 ? 0.8496 0.8340 0.8299 0.0023  -0.0388 0.0088  112 LEU D CD1 
3249 C CD2 . LEU D 112 ? 0.8157 0.8795 0.8157 -0.0193 -0.0344 0.0141  112 LEU D CD2 
3250 N N   . SER D 113 ? 0.6160 0.7189 0.6652 0.0946  -0.0202 -0.0292 113 SER D N   
3251 C CA  . SER D 113 ? 0.6095 0.7067 0.6481 0.1202  -0.0254 -0.0379 113 SER D CA  
3252 C C   . SER D 113 ? 0.6731 0.7955 0.7060 0.1451  -0.0330 -0.0512 113 SER D C   
3253 O O   . SER D 113 ? 0.6676 0.7877 0.7038 0.1450  -0.0362 -0.0541 113 SER D O   
3254 C CB  . SER D 113 ? 0.6334 0.6738 0.6604 0.1223  -0.0312 -0.0356 113 SER D CB  
3255 O OG  . SER D 113 ? 0.6836 0.7051 0.7154 0.1047  -0.0259 -0.0268 113 SER D OG  
3256 N N   . PHE D 114 ? 0.6737 0.8183 0.6941 0.1704  -0.0381 -0.0609 114 PHE D N   
3257 C CA  . PHE D 114 ? 0.6993 0.8713 0.7053 0.2050  -0.0498 -0.0783 114 PHE D CA  
3258 C C   . PHE D 114 ? 0.8212 0.9428 0.7893 0.2352  -0.0676 -0.0869 114 PHE D C   
3259 O O   . PHE D 114 ? 0.8131 0.9282 0.7749 0.2372  -0.0659 -0.0831 114 PHE D O   
3260 C CB  . PHE D 114 ? 0.7028 0.9715 0.7252 0.2103  -0.0410 -0.0844 114 PHE D CB  
3261 C CG  . PHE D 114 ? 0.6917 1.0060 0.7416 0.1748  -0.0284 -0.0738 114 PHE D CG  
3262 C CD1 . PHE D 114 ? 0.7154 1.0220 0.7756 0.1349  -0.0174 -0.0556 114 PHE D CD1 
3263 C CD2 . PHE D 114 ? 0.7092 1.0653 0.7676 0.1810  -0.0312 -0.0820 114 PHE D CD2 
3264 C CE1 . PHE D 114 ? 0.7098 1.0391 0.7818 0.0999  -0.0122 -0.0442 114 PHE D CE1 
3265 C CE2 . PHE D 114 ? 0.7260 1.1156 0.8039 0.1442  -0.0227 -0.0697 114 PHE D CE2 
3266 C CZ  . PHE D 114 ? 0.6963 1.0689 0.7778 0.1030  -0.0144 -0.0502 114 PHE D CZ  
3267 N N   . MET D 115 ? 0.8592 0.9351 0.7955 0.2563  -0.0877 -0.0973 115 MET D N   
3268 C CA  . MET D 115 ? 0.9256 0.9360 0.8090 0.2835  -0.1131 -0.1051 115 MET D CA  
3269 C C   . MET D 115 ? 0.9638 1.0144 0.8257 0.3292  -0.1238 -0.1235 115 MET D C   
3270 O O   . MET D 115 ? 0.9356 1.0586 0.8105 0.3510  -0.1212 -0.1380 115 MET D O   
3271 C CB  . MET D 115 ? 1.0075 0.9508 0.8520 0.2893  -0.1359 -0.1109 115 MET D CB  
3272 C CG  . MET D 115 ? 1.0592 0.9552 0.9118 0.2469  -0.1299 -0.0926 115 MET D CG  
3273 S SD  . MET D 115 ? 1.1749 1.0165 0.9934 0.2462  -0.1501 -0.0988 115 MET D SD  
3274 C CE  . MET D 115 ? 1.2230 0.9575 0.9566 0.2510  -0.1885 -0.0979 115 MET D CE  
3275 N N   . THR D 116 ? 0.9391 0.9502 0.7694 0.3432  -0.1354 -0.1225 116 THR D N   
3276 C CA  . THR D 116 ? 0.9644 1.0048 0.7666 0.3906  -0.1482 -0.1397 116 THR D CA  
3277 C C   . THR D 116 ? 1.1277 1.0704 0.8494 0.4278  -0.1894 -0.1517 116 THR D C   
3278 O O   . THR D 116 ? 1.1469 1.0989 0.8276 0.4803  -0.2102 -0.1719 116 THR D O   
3279 C CB  . THR D 116 ? 0.9034 0.9717 0.7289 0.3761  -0.1297 -0.1278 116 THR D CB  
3280 O OG1 . THR D 116 ? 0.9370 0.9156 0.7386 0.3569  -0.1389 -0.1131 116 THR D OG1 
3281 C CG2 . THR D 116 ? 0.7426 0.8869 0.6317 0.3344  -0.0955 -0.1142 116 THR D CG2 
3282 N N   . GLY D 117 ? 1.1531 1.0036 0.8479 0.3988  -0.2029 -0.1390 117 GLY D N   
3283 C CA  . GLY D 117 ? 1.2533 0.9902 0.8620 0.4156  -0.2456 -0.1431 117 GLY D CA  
3284 C C   . GLY D 117 ? 1.3530 1.0234 0.9410 0.3854  -0.2509 -0.1222 117 GLY D C   
3285 O O   . GLY D 117 ? 1.2854 0.9959 0.9310 0.3495  -0.2198 -0.1049 117 GLY D O   
3286 N N   . ILE D 118 ? 1.4223 0.9867 0.9213 0.4002  -0.2941 -0.1242 118 ILE D N   
3287 C CA  . ILE D 118 ? 1.7965 1.2896 1.2613 0.3728  -0.3071 -0.1046 118 ILE D CA  
3288 C C   . ILE D 118 ? 2.1069 1.5961 1.5421 0.4174  -0.3198 -0.1143 118 ILE D C   
3289 O O   . ILE D 118 ? 1.4887 1.0654 0.9857 0.4260  -0.2877 -0.1162 118 ILE D O   
3290 C CB  . ILE D 118 ? 1.9234 1.2952 1.2998 0.3502  -0.3501 -0.0961 118 ILE D CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   CYS 4   4   4   CYS CYS A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   MET 9   9   9   MET MET A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  CYS 24  24  24  CYS CYS A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  TRP 49  49  49  TRP TRP A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  MET 59  59  59  MET MET A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  HIS 98  98  ?   ?   ?   A . n 
A 1 99  GLY 99  99  ?   ?   ?   A . n 
A 1 100 MET 100 100 ?   ?   ?   A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 MET 115 115 115 MET MET A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 GLY 117 117 ?   ?   ?   A . n 
A 1 118 ILE 118 118 ?   ?   ?   A . n 
A 1 119 PRO 119 119 ?   ?   ?   A . n 
A 1 120 GLU 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 MET 122 122 ?   ?   ?   A . n 
A 1 123 LYS 123 123 ?   ?   ?   A . n 
A 1 124 LYS 124 124 ?   ?   ?   A . n 
A 1 125 ASP 125 125 ?   ?   ?   A . n 
A 1 126 PHE 126 126 ?   ?   ?   A . n 
A 1 127 ARG 127 127 ?   ?   ?   A . n 
A 1 128 ALA 128 128 ?   ?   ?   A . n 
A 1 129 MET 129 129 ?   ?   ?   A . n 
A 1 130 LYS 130 130 ?   ?   ?   A . n 
A 1 131 ASP 131 131 ?   ?   ?   A . n 
A 1 132 LEU 132 132 ?   ?   ?   A . n 
A 1 133 ALA 133 133 ?   ?   ?   A . n 
A 1 134 GLN 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ILE 136 136 ?   ?   ?   A . n 
A 1 137 ASN 137 137 ?   ?   ?   A . n 
A 1 138 LEU 138 138 ?   ?   ?   A . n 
A 1 139 SER 139 139 ?   ?   ?   A . n 
A 1 140 PRO 140 140 ?   ?   ?   A . n 
A 1 141 LYS 141 141 ?   ?   ?   A . n 
A 1 142 GLN 142 142 ?   ?   ?   A . n 
A 1 143 HIS 143 143 ?   ?   ?   A . n 
A 1 144 HIS 144 144 ?   ?   ?   A . n 
A 1 145 SER 145 145 ?   ?   ?   A . n 
A 1 146 ALA 146 146 ?   ?   ?   A . n 
A 1 147 LEU 147 147 ?   ?   ?   A . n 
A 1 148 GLU 148 148 ?   ?   ?   A . n 
B 1 1   ARG 1   1   ?   ?   ?   B . n 
B 1 2   ASN 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   3   ASP ASP B . n 
B 1 4   CYS 4   4   4   CYS CYS B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   ASP 7   7   7   ASP ASP B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   MET 9   9   9   MET MET B . n 
B 1 10  HIS 10  10  10  HIS HIS B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  TYR 13  13  13  TYR TYR B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  PHE 20  20  20  PHE PHE B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  ASP 22  22  22  ASP ASP B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  CYS 24  24  24  CYS CYS B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  TYR 37  37  37  TYR TYR B . n 
B 1 38  ASN 38  38  38  ASN ASN B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ARG 40  40  40  ARG ARG B . n 
B 1 41  THR 41  41  41  THR THR B . n 
B 1 42  TYR 42  42  42  TYR TYR B . n 
B 1 43  ARG 43  43  43  ARG ARG B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  ASP 48  48  48  ASP ASP B . n 
B 1 49  TRP 49  49  49  TRP TRP B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  SER 56  56  56  SER SER B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  MET 59  59  59  MET MET B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  PHE 67  67  67  PHE PHE B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  TYR 71  71  71  TYR TYR B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  TYR 75  75  75  TYR TYR B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  GLN 84  84  84  GLN GLN B . n 
B 1 85  PRO 85  85  85  PRO PRO B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  HIS 89  89  89  HIS HIS B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  PRO 91  91  91  PRO PRO B . n 
B 1 92  SER 92  92  ?   ?   ?   B . n 
B 1 93  GLU 93  93  ?   ?   ?   B . n 
B 1 94  ARG 94  94  ?   ?   ?   B . n 
B 1 95  GLN 95  95  ?   ?   ?   B . n 
B 1 96  ASP 96  96  ?   ?   ?   B . n 
B 1 97  ASN 97  97  ?   ?   ?   B . n 
B 1 98  HIS 98  98  ?   ?   ?   B . n 
B 1 99  GLY 99  99  ?   ?   ?   B . n 
B 1 100 MET 100 100 ?   ?   ?   B . n 
B 1 101 LEU 101 101 ?   ?   ?   B . n 
B 1 102 LEU 102 102 ?   ?   ?   B . n 
B 1 103 LYS 103 103 ?   ?   ?   B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 PHE 114 114 114 PHE PHE B . n 
B 1 115 MET 115 115 115 MET MET B . n 
B 1 116 THR 116 116 116 THR THR B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 PRO 119 119 ?   ?   ?   B . n 
B 1 120 GLU 120 120 ?   ?   ?   B . n 
B 1 121 LYS 121 121 ?   ?   ?   B . n 
B 1 122 MET 122 122 ?   ?   ?   B . n 
B 1 123 LYS 123 123 ?   ?   ?   B . n 
B 1 124 LYS 124 124 ?   ?   ?   B . n 
B 1 125 ASP 125 125 ?   ?   ?   B . n 
B 1 126 PHE 126 126 ?   ?   ?   B . n 
B 1 127 ARG 127 127 ?   ?   ?   B . n 
B 1 128 ALA 128 128 ?   ?   ?   B . n 
B 1 129 MET 129 129 ?   ?   ?   B . n 
B 1 130 LYS 130 130 ?   ?   ?   B . n 
B 1 131 ASP 131 131 ?   ?   ?   B . n 
B 1 132 LEU 132 132 ?   ?   ?   B . n 
B 1 133 ALA 133 133 ?   ?   ?   B . n 
B 1 134 GLN 134 134 ?   ?   ?   B . n 
B 1 135 GLN 135 135 ?   ?   ?   B . n 
B 1 136 ILE 136 136 ?   ?   ?   B . n 
B 1 137 ASN 137 137 ?   ?   ?   B . n 
B 1 138 LEU 138 138 ?   ?   ?   B . n 
B 1 139 SER 139 139 ?   ?   ?   B . n 
B 1 140 PRO 140 140 ?   ?   ?   B . n 
B 1 141 LYS 141 141 ?   ?   ?   B . n 
B 1 142 GLN 142 142 ?   ?   ?   B . n 
B 1 143 HIS 143 143 ?   ?   ?   B . n 
B 1 144 HIS 144 144 ?   ?   ?   B . n 
B 1 145 SER 145 145 ?   ?   ?   B . n 
B 1 146 ALA 146 146 ?   ?   ?   B . n 
B 1 147 LEU 147 147 ?   ?   ?   B . n 
B 1 148 GLU 148 148 ?   ?   ?   B . n 
C 1 1   ARG 1   1   1   ARG ARG C . n 
C 1 2   ASN 2   2   2   ASN ASN C . n 
C 1 3   ASP 3   3   3   ASP ASP C . n 
C 1 4   CYS 4   4   4   CYS CYS C . n 
C 1 5   VAL 5   5   5   VAL VAL C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   ASP 7   7   7   ASP ASP C . n 
C 1 8   VAL 8   8   8   VAL VAL C . n 
C 1 9   MET 9   9   9   MET MET C . n 
C 1 10  HIS 10  10  10  HIS HIS C . n 
C 1 11  ALA 11  11  11  ALA ALA C . n 
C 1 12  ILE 12  12  12  ILE ILE C . n 
C 1 13  TYR 13  13  13  TYR TYR C . n 
C 1 14  GLN 14  14  14  GLN GLN C . n 
C 1 15  GLN 15  15  15  GLN GLN C . n 
C 1 16  ASN 16  16  16  ASN ASN C . n 
C 1 17  LYS 17  17  17  LYS LYS C . n 
C 1 18  GLU 18  18  18  GLU GLU C . n 
C 1 19  HIS 19  19  19  HIS HIS C . n 
C 1 20  PHE 20  20  20  PHE PHE C . n 
C 1 21  GLN 21  21  21  GLN GLN C . n 
C 1 22  ASP 22  22  22  ASP ASP C . n 
C 1 23  GLU 23  23  23  GLU GLU C . n 
C 1 24  CYS 24  24  24  CYS CYS C . n 
C 1 25  THR 25  25  25  THR THR C . n 
C 1 26  LYS 26  26  26  LYS LYS C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  LEU 28  28  28  LEU LEU C . n 
C 1 29  VAL 29  29  29  VAL VAL C . n 
C 1 30  GLY 30  30  30  GLY GLY C . n 
C 1 31  ASN 31  31  31  ASN ASN C . n 
C 1 32  ILE 32  32  32  ILE ILE C . n 
C 1 33  VAL 33  33  33  VAL VAL C . n 
C 1 34  ILE 34  34  34  ILE ILE C . n 
C 1 35  THR 35  35  35  THR THR C . n 
C 1 36  ARG 36  36  36  ARG ARG C . n 
C 1 37  TYR 37  37  37  TYR TYR C . n 
C 1 38  ASN 38  38  38  ASN ASN C . n 
C 1 39  ASN 39  39  39  ASN ASN C . n 
C 1 40  ARG 40  40  40  ARG ARG C . n 
C 1 41  THR 41  41  41  THR THR C . n 
C 1 42  TYR 42  42  42  TYR TYR C . n 
C 1 43  ARG 43  43  43  ARG ARG C . n 
C 1 44  ILE 44  44  44  ILE ILE C . n 
C 1 45  ASP 45  45  45  ASP ASP C . n 
C 1 46  ASP 46  46  46  ASP ASP C . n 
C 1 47  VAL 47  47  47  VAL VAL C . n 
C 1 48  ASP 48  48  48  ASP ASP C . n 
C 1 49  TRP 49  49  49  TRP TRP C . n 
C 1 50  ASN 50  50  50  ASN ASN C . n 
C 1 51  LYS 51  51  51  LYS LYS C . n 
C 1 52  THR 52  52  52  THR THR C . n 
C 1 53  PRO 53  53  53  PRO PRO C . n 
C 1 54  LYS 54  54  54  LYS LYS C . n 
C 1 55  ASP 55  55  55  ASP ASP C . n 
C 1 56  SER 56  56  56  SER SER C . n 
C 1 57  PHE 57  57  57  PHE PHE C . n 
C 1 58  THR 58  58  58  THR THR C . n 
C 1 59  MET 59  59  59  MET MET C . n 
C 1 60  SER 60  60  60  SER SER C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  GLY 62  62  62  GLY GLY C . n 
C 1 63  LYS 63  63  63  LYS LYS C . n 
C 1 64  GLU 64  64  64  GLU GLU C . n 
C 1 65  ILE 65  65  65  ILE ILE C . n 
C 1 66  THR 66  66  66  THR THR C . n 
C 1 67  PHE 67  67  67  PHE PHE C . n 
C 1 68  LEU 68  68  68  LEU LEU C . n 
C 1 69  GLU 69  69  69  GLU GLU C . n 
C 1 70  TYR 70  70  70  TYR TYR C . n 
C 1 71  TYR 71  71  71  TYR TYR C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  LYS 73  73  73  LYS LYS C . n 
C 1 74  ASN 74  74  74  ASN ASN C . n 
C 1 75  TYR 75  75  75  TYR TYR C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  ILE 77  77  77  ILE ILE C . n 
C 1 78  THR 78  78  78  THR THR C . n 
C 1 79  VAL 79  79  79  VAL VAL C . n 
C 1 80  LYS 80  80  80  LYS LYS C . n 
C 1 81  GLU 81  81  81  GLU GLU C . n 
C 1 82  GLU 82  82  82  GLU GLU C . n 
C 1 83  ASP 83  83  83  ASP ASP C . n 
C 1 84  GLN 84  84  84  GLN GLN C . n 
C 1 85  PRO 85  85  85  PRO PRO C . n 
C 1 86  LEU 86  86  86  LEU LEU C . n 
C 1 87  LEU 87  87  87  LEU LEU C . n 
C 1 88  ILE 88  88  88  ILE ILE C . n 
C 1 89  HIS 89  89  89  HIS HIS C . n 
C 1 90  ARG 90  90  90  ARG ARG C . n 
C 1 91  PRO 91  91  91  PRO PRO C . n 
C 1 92  SER 92  92  ?   ?   ?   C . n 
C 1 93  GLU 93  93  ?   ?   ?   C . n 
C 1 94  ARG 94  94  ?   ?   ?   C . n 
C 1 95  GLN 95  95  ?   ?   ?   C . n 
C 1 96  ASP 96  96  ?   ?   ?   C . n 
C 1 97  ASN 97  97  ?   ?   ?   C . n 
C 1 98  HIS 98  98  ?   ?   ?   C . n 
C 1 99  GLY 99  99  ?   ?   ?   C . n 
C 1 100 MET 100 100 ?   ?   ?   C . n 
C 1 101 LEU 101 101 ?   ?   ?   C . n 
C 1 102 LEU 102 102 ?   ?   ?   C . n 
C 1 103 LYS 103 103 ?   ?   ?   C . n 
C 1 104 GLY 104 104 ?   ?   ?   C . n 
C 1 105 GLU 105 105 105 GLU GLU C . n 
C 1 106 ILE 106 106 106 ILE ILE C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 LEU 108 108 108 LEU LEU C . n 
C 1 109 LEU 109 109 109 LEU LEU C . n 
C 1 110 PRO 110 110 110 PRO PRO C . n 
C 1 111 GLU 111 111 111 GLU GLU C . n 
C 1 112 LEU 112 112 112 LEU LEU C . n 
C 1 113 SER 113 113 113 SER SER C . n 
C 1 114 PHE 114 114 114 PHE PHE C . n 
C 1 115 MET 115 115 115 MET MET C . n 
C 1 116 THR 116 116 116 THR THR C . n 
C 1 117 GLY 117 117 117 GLY GLY C . n 
C 1 118 ILE 118 118 118 ILE ILE C . n 
C 1 119 PRO 119 119 ?   ?   ?   C . n 
C 1 120 GLU 120 120 ?   ?   ?   C . n 
C 1 121 LYS 121 121 ?   ?   ?   C . n 
C 1 122 MET 122 122 ?   ?   ?   C . n 
C 1 123 LYS 123 123 ?   ?   ?   C . n 
C 1 124 LYS 124 124 ?   ?   ?   C . n 
C 1 125 ASP 125 125 ?   ?   ?   C . n 
C 1 126 PHE 126 126 ?   ?   ?   C . n 
C 1 127 ARG 127 127 ?   ?   ?   C . n 
C 1 128 ALA 128 128 ?   ?   ?   C . n 
C 1 129 MET 129 129 ?   ?   ?   C . n 
C 1 130 LYS 130 130 ?   ?   ?   C . n 
C 1 131 ASP 131 131 ?   ?   ?   C . n 
C 1 132 LEU 132 132 ?   ?   ?   C . n 
C 1 133 ALA 133 133 ?   ?   ?   C . n 
C 1 134 GLN 134 134 ?   ?   ?   C . n 
C 1 135 GLN 135 135 ?   ?   ?   C . n 
C 1 136 ILE 136 136 ?   ?   ?   C . n 
C 1 137 ASN 137 137 ?   ?   ?   C . n 
C 1 138 LEU 138 138 ?   ?   ?   C . n 
C 1 139 SER 139 139 ?   ?   ?   C . n 
C 1 140 PRO 140 140 ?   ?   ?   C . n 
C 1 141 LYS 141 141 ?   ?   ?   C . n 
C 1 142 GLN 142 142 ?   ?   ?   C . n 
C 1 143 HIS 143 143 ?   ?   ?   C . n 
C 1 144 HIS 144 144 ?   ?   ?   C . n 
C 1 145 SER 145 145 ?   ?   ?   C . n 
C 1 146 ALA 146 146 ?   ?   ?   C . n 
C 1 147 LEU 147 147 ?   ?   ?   C . n 
C 1 148 GLU 148 148 ?   ?   ?   C . n 
D 1 1   ARG 1   1   ?   ?   ?   D . n 
D 1 2   ASN 2   2   ?   ?   ?   D . n 
D 1 3   ASP 3   3   3   ASP ASP D . n 
D 1 4   CYS 4   4   4   CYS CYS D . n 
D 1 5   VAL 5   5   5   VAL VAL D . n 
D 1 6   LEU 6   6   6   LEU LEU D . n 
D 1 7   ASP 7   7   7   ASP ASP D . n 
D 1 8   VAL 8   8   8   VAL VAL D . n 
D 1 9   MET 9   9   9   MET MET D . n 
D 1 10  HIS 10  10  10  HIS HIS D . n 
D 1 11  ALA 11  11  11  ALA ALA D . n 
D 1 12  ILE 12  12  12  ILE ILE D . n 
D 1 13  TYR 13  13  13  TYR TYR D . n 
D 1 14  GLN 14  14  14  GLN GLN D . n 
D 1 15  GLN 15  15  15  GLN GLN D . n 
D 1 16  ASN 16  16  16  ASN ASN D . n 
D 1 17  LYS 17  17  17  LYS LYS D . n 
D 1 18  GLU 18  18  18  GLU GLU D . n 
D 1 19  HIS 19  19  19  HIS HIS D . n 
D 1 20  PHE 20  20  20  PHE PHE D . n 
D 1 21  GLN 21  21  21  GLN GLN D . n 
D 1 22  ASP 22  22  22  ASP ASP D . n 
D 1 23  GLU 23  23  23  GLU GLU D . n 
D 1 24  CYS 24  24  24  CYS CYS D . n 
D 1 25  THR 25  25  25  THR THR D . n 
D 1 26  LYS 26  26  26  LYS LYS D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  LEU 28  28  28  LEU LEU D . n 
D 1 29  VAL 29  29  29  VAL VAL D . n 
D 1 30  GLY 30  30  30  GLY GLY D . n 
D 1 31  ASN 31  31  31  ASN ASN D . n 
D 1 32  ILE 32  32  32  ILE ILE D . n 
D 1 33  VAL 33  33  33  VAL VAL D . n 
D 1 34  ILE 34  34  34  ILE ILE D . n 
D 1 35  THR 35  35  35  THR THR D . n 
D 1 36  ARG 36  36  36  ARG ARG D . n 
D 1 37  TYR 37  37  37  TYR TYR D . n 
D 1 38  ASN 38  38  38  ASN ASN D . n 
D 1 39  ASN 39  39  39  ASN ASN D . n 
D 1 40  ARG 40  40  40  ARG ARG D . n 
D 1 41  THR 41  41  41  THR THR D . n 
D 1 42  TYR 42  42  42  TYR TYR D . n 
D 1 43  ARG 43  43  43  ARG ARG D . n 
D 1 44  ILE 44  44  44  ILE ILE D . n 
D 1 45  ASP 45  45  45  ASP ASP D . n 
D 1 46  ASP 46  46  46  ASP ASP D . n 
D 1 47  VAL 47  47  47  VAL VAL D . n 
D 1 48  ASP 48  48  48  ASP ASP D . n 
D 1 49  TRP 49  49  49  TRP TRP D . n 
D 1 50  ASN 50  50  50  ASN ASN D . n 
D 1 51  LYS 51  51  51  LYS LYS D . n 
D 1 52  THR 52  52  52  THR THR D . n 
D 1 53  PRO 53  53  53  PRO PRO D . n 
D 1 54  LYS 54  54  54  LYS LYS D . n 
D 1 55  ASP 55  55  55  ASP ASP D . n 
D 1 56  SER 56  56  56  SER SER D . n 
D 1 57  PHE 57  57  57  PHE PHE D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  MET 59  59  59  MET MET D . n 
D 1 60  SER 60  60  60  SER SER D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLY 62  62  62  GLY GLY D . n 
D 1 63  LYS 63  63  63  LYS LYS D . n 
D 1 64  GLU 64  64  64  GLU GLU D . n 
D 1 65  ILE 65  65  65  ILE ILE D . n 
D 1 66  THR 66  66  66  THR THR D . n 
D 1 67  PHE 67  67  67  PHE PHE D . n 
D 1 68  LEU 68  68  68  LEU LEU D . n 
D 1 69  GLU 69  69  69  GLU GLU D . n 
D 1 70  TYR 70  70  70  TYR TYR D . n 
D 1 71  TYR 71  71  71  TYR TYR D . n 
D 1 72  SER 72  72  72  SER SER D . n 
D 1 73  LYS 73  73  73  LYS LYS D . n 
D 1 74  ASN 74  74  74  ASN ASN D . n 
D 1 75  TYR 75  75  75  TYR TYR D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  ILE 77  77  77  ILE ILE D . n 
D 1 78  THR 78  78  78  THR THR D . n 
D 1 79  VAL 79  79  79  VAL VAL D . n 
D 1 80  LYS 80  80  80  LYS LYS D . n 
D 1 81  GLU 81  81  81  GLU GLU D . n 
D 1 82  GLU 82  82  82  GLU GLU D . n 
D 1 83  ASP 83  83  83  ASP ASP D . n 
D 1 84  GLN 84  84  84  GLN GLN D . n 
D 1 85  PRO 85  85  85  PRO PRO D . n 
D 1 86  LEU 86  86  86  LEU LEU D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  ILE 88  88  88  ILE ILE D . n 
D 1 89  HIS 89  89  89  HIS HIS D . n 
D 1 90  ARG 90  90  90  ARG ARG D . n 
D 1 91  PRO 91  91  91  PRO PRO D . n 
D 1 92  SER 92  92  ?   ?   ?   D . n 
D 1 93  GLU 93  93  93  GLU GLU D . n 
D 1 94  ARG 94  94  94  ARG ARG D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  ASP 96  96  96  ASP ASP D . n 
D 1 97  ASN 97  97  97  ASN ASN D . n 
D 1 98  HIS 98  98  98  HIS HIS D . n 
D 1 99  GLY 99  99  99  GLY GLY D . n 
D 1 100 MET 100 100 100 MET MET D . n 
D 1 101 LEU 101 101 101 LEU LEU D . n 
D 1 102 LEU 102 102 102 LEU LEU D . n 
D 1 103 LYS 103 103 103 LYS LYS D . n 
D 1 104 GLY 104 104 104 GLY GLY D . n 
D 1 105 GLU 105 105 105 GLU GLU D . n 
D 1 106 ILE 106 106 106 ILE ILE D . n 
D 1 107 LEU 107 107 107 LEU LEU D . n 
D 1 108 LEU 108 108 108 LEU LEU D . n 
D 1 109 LEU 109 109 109 LEU LEU D . n 
D 1 110 PRO 110 110 110 PRO PRO D . n 
D 1 111 GLU 111 111 111 GLU GLU D . n 
D 1 112 LEU 112 112 112 LEU LEU D . n 
D 1 113 SER 113 113 113 SER SER D . n 
D 1 114 PHE 114 114 114 PHE PHE D . n 
D 1 115 MET 115 115 115 MET MET D . n 
D 1 116 THR 116 116 116 THR THR D . n 
D 1 117 GLY 117 117 117 GLY GLY D . n 
D 1 118 ILE 118 118 118 ILE ILE D . n 
D 1 119 PRO 119 119 ?   ?   ?   D . n 
D 1 120 GLU 120 120 ?   ?   ?   D . n 
D 1 121 LYS 121 121 ?   ?   ?   D . n 
D 1 122 MET 122 122 ?   ?   ?   D . n 
D 1 123 LYS 123 123 ?   ?   ?   D . n 
D 1 124 LYS 124 124 ?   ?   ?   D . n 
D 1 125 ASP 125 125 ?   ?   ?   D . n 
D 1 126 PHE 126 126 ?   ?   ?   D . n 
D 1 127 ARG 127 127 ?   ?   ?   D . n 
D 1 128 ALA 128 128 ?   ?   ?   D . n 
D 1 129 MET 129 129 ?   ?   ?   D . n 
D 1 130 LYS 130 130 ?   ?   ?   D . n 
D 1 131 ASP 131 131 ?   ?   ?   D . n 
D 1 132 LEU 132 132 ?   ?   ?   D . n 
D 1 133 ALA 133 133 ?   ?   ?   D . n 
D 1 134 GLN 134 134 ?   ?   ?   D . n 
D 1 135 GLN 135 135 ?   ?   ?   D . n 
D 1 136 ILE 136 136 ?   ?   ?   D . n 
D 1 137 ASN 137 137 ?   ?   ?   D . n 
D 1 138 LEU 138 138 ?   ?   ?   D . n 
D 1 139 SER 139 139 ?   ?   ?   D . n 
D 1 140 PRO 140 140 ?   ?   ?   D . n 
D 1 141 LYS 141 141 ?   ?   ?   D . n 
D 1 142 GLN 142 142 ?   ?   ?   D . n 
D 1 143 HIS 143 143 ?   ?   ?   D . n 
D 1 144 HIS 144 144 ?   ?   ?   D . n 
D 1 145 SER 145 145 ?   ?   ?   D . n 
D 1 146 ALA 146 146 ?   ?   ?   D . n 
D 1 147 LEU 147 147 ?   ?   ?   D . n 
D 1 148 GLU 148 148 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A   
2 1   B,C 
3 1,3 D   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1970  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  13250 ? 
2 'ABSA (A^2)' 2280  ? 
2 MORE         -28   ? 
2 'SSA (A^2)'  11760 ? 
3 'ABSA (A^2)' 2310  ? 
3 MORE         -32   ? 
3 'SSA (A^2)'  13500 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 3_555 -x,y,-z+1/2   -1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 112.4670000000  
3 'crystal symmetry operation' 3_454 -x-1,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 -41.5480000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -112.4670000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-02-16 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -1.9905  -34.2243 40.7769  0.2837  0.0069  -0.3602 -0.3040 0.0045  0.0680  0.0666 2.1619 7.4745 
-0.4603 -2.8906 -0.4251 -0.5566 0.3720  0.2184  -0.1229 0.5318  0.3393  1.0885  -0.5041 0.0248  
'X-RAY DIFFRACTION' 2 ? refined 5.7705   -18.1515 15.0225  0.0193  -0.2010 -0.1800 -0.1096 0.0125  0.0136  1.4469 0.7297 9.6928 
-0.4210 2.8202  1.5324  0.4899  -0.0735 -0.0573 0.0522  -0.0234 -0.1346 0.6871  0.0319  -0.4665 
'X-RAY DIFFRACTION' 3 ? refined 0.0774   -16.4020 -16.4003 0.0508  -0.1827 -0.2379 0.1974  0.0270  -0.0228 1.1546 1.0555 8.7080 
-1.5807 3.5549  -3.2506 0.5326  0.2286  -0.0698 -0.5456 -0.2966 0.2712  0.3434  0.7202  -0.2359 
'X-RAY DIFFRACTION' 4 ? refined -16.9165 -0.3998  -39.0422 -0.1249 -0.1352 -0.0957 0.0770  -0.0321 -0.0186 0.4399 0.8049 8.2761 
-0.0228 3.6156  0.5591  -0.0880 0.1793  -0.0313 0.0214  0.0458  0.0113  -0.1141 0.4408  0.0422  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 ? 0 ? 0 '{ A|* }' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 ? 0 ? 0 '{ B|* }' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 ? 0 ? 0 '{ C|* }' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 ? 0 ? 0 '{ D|* }' ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-3000 'data collection' .     ? 1 
PHASER   phasing           .     ? 2 
BUSTER   refinement        2.8.0 ? 3 
Coot     'model building'  0.6   ? 4 
HKL-3000 'data reduction'  .     ? 5 
HKL-3000 'data scaling'    .     ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 93  ? ? -156.95 55.32  
2 1 THR B 116 ? ? -118.48 -84.07 
3 1 ASN C 2   ? ? -150.21 1.97   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A CYS 4   ? SG  ? A CYS 4   SG  
2   1 Y 1 A VAL 8   ? CG1 ? A VAL 8   CG1 
3   1 Y 1 A VAL 8   ? CG2 ? A VAL 8   CG2 
4   1 Y 1 A MET 9   ? CG  ? A MET 9   CG  
5   1 Y 1 A MET 9   ? SD  ? A MET 9   SD  
6   1 Y 1 A MET 9   ? CE  ? A MET 9   CE  
7   1 Y 1 A GLN 15  ? CG  ? A GLN 15  CG  
8   1 Y 1 A GLN 15  ? CD  ? A GLN 15  CD  
9   1 Y 1 A GLN 15  ? OE1 ? A GLN 15  OE1 
10  1 Y 1 A GLN 15  ? NE2 ? A GLN 15  NE2 
11  1 Y 1 A LYS 17  ? CD  ? A LYS 17  CD  
12  1 Y 1 A LYS 17  ? CE  ? A LYS 17  CE  
13  1 Y 1 A LYS 17  ? NZ  ? A LYS 17  NZ  
14  1 Y 1 A ASP 22  ? CG  ? A ASP 22  CG  
15  1 Y 1 A ASP 22  ? OD1 ? A ASP 22  OD1 
16  1 Y 1 A ASP 22  ? OD2 ? A ASP 22  OD2 
17  1 Y 1 A GLU 23  ? CG  ? A GLU 23  CG  
18  1 Y 1 A GLU 23  ? CD  ? A GLU 23  CD  
19  1 Y 1 A GLU 23  ? OE1 ? A GLU 23  OE1 
20  1 Y 1 A GLU 23  ? OE2 ? A GLU 23  OE2 
21  1 Y 1 A LYS 26  ? CG  ? A LYS 26  CG  
22  1 Y 1 A LYS 26  ? CD  ? A LYS 26  CD  
23  1 Y 1 A LYS 26  ? CE  ? A LYS 26  CE  
24  1 Y 1 A LYS 26  ? NZ  ? A LYS 26  NZ  
25  1 Y 1 A LEU 27  ? CG  ? A LEU 27  CG  
26  1 Y 1 A LEU 27  ? CD1 ? A LEU 27  CD1 
27  1 Y 1 A LEU 27  ? CD2 ? A LEU 27  CD2 
28  1 Y 1 A LEU 28  ? CG  ? A LEU 28  CG  
29  1 Y 1 A LEU 28  ? CD1 ? A LEU 28  CD1 
30  1 Y 1 A LEU 28  ? CD2 ? A LEU 28  CD2 
31  1 Y 1 A VAL 29  ? CG1 ? A VAL 29  CG1 
32  1 Y 1 A VAL 29  ? CG2 ? A VAL 29  CG2 
33  1 Y 1 A ASN 31  ? CG  ? A ASN 31  CG  
34  1 Y 1 A ASN 31  ? OD1 ? A ASN 31  OD1 
35  1 Y 1 A ASN 31  ? ND2 ? A ASN 31  ND2 
36  1 Y 1 A ILE 32  ? CG1 ? A ILE 32  CG1 
37  1 Y 1 A ILE 32  ? CG2 ? A ILE 32  CG2 
38  1 Y 1 A ILE 32  ? CD1 ? A ILE 32  CD1 
39  1 Y 1 A ILE 34  ? CG1 ? A ILE 34  CG1 
40  1 Y 1 A ILE 34  ? CG2 ? A ILE 34  CG2 
41  1 Y 1 A ILE 34  ? CD1 ? A ILE 34  CD1 
42  1 Y 1 A THR 35  ? OG1 ? A THR 35  OG1 
43  1 Y 1 A THR 35  ? CG2 ? A THR 35  CG2 
44  1 Y 1 A ARG 36  ? CG  ? A ARG 36  CG  
45  1 Y 1 A ARG 36  ? CD  ? A ARG 36  CD  
46  1 Y 1 A ARG 36  ? NE  ? A ARG 36  NE  
47  1 Y 1 A ARG 36  ? CZ  ? A ARG 36  CZ  
48  1 Y 1 A ARG 36  ? NH1 ? A ARG 36  NH1 
49  1 Y 1 A ARG 36  ? NH2 ? A ARG 36  NH2 
50  1 Y 1 A ASN 38  ? CG  ? A ASN 38  CG  
51  1 Y 1 A ASN 38  ? OD1 ? A ASN 38  OD1 
52  1 Y 1 A ASN 38  ? ND2 ? A ASN 38  ND2 
53  1 Y 1 A ASN 39  ? CG  ? A ASN 39  CG  
54  1 Y 1 A ASN 39  ? OD1 ? A ASN 39  OD1 
55  1 Y 1 A ASN 39  ? ND2 ? A ASN 39  ND2 
56  1 Y 1 A ARG 40  ? CG  ? A ARG 40  CG  
57  1 Y 1 A ARG 40  ? CD  ? A ARG 40  CD  
58  1 Y 1 A ARG 40  ? NE  ? A ARG 40  NE  
59  1 Y 1 A ARG 40  ? CZ  ? A ARG 40  CZ  
60  1 Y 1 A ARG 40  ? NH1 ? A ARG 40  NH1 
61  1 Y 1 A ARG 40  ? NH2 ? A ARG 40  NH2 
62  1 Y 1 A THR 41  ? OG1 ? A THR 41  OG1 
63  1 Y 1 A THR 41  ? CG2 ? A THR 41  CG2 
64  1 Y 1 A ARG 43  ? CZ  ? A ARG 43  CZ  
65  1 Y 1 A ARG 43  ? NH1 ? A ARG 43  NH1 
66  1 Y 1 A ARG 43  ? NH2 ? A ARG 43  NH2 
67  1 Y 1 A VAL 47  ? CG1 ? A VAL 47  CG1 
68  1 Y 1 A VAL 47  ? CG2 ? A VAL 47  CG2 
69  1 Y 1 A LYS 51  ? CD  ? A LYS 51  CD  
70  1 Y 1 A LYS 51  ? CE  ? A LYS 51  CE  
71  1 Y 1 A LYS 51  ? NZ  ? A LYS 51  NZ  
72  1 Y 1 A LYS 54  ? CE  ? A LYS 54  CE  
73  1 Y 1 A LYS 54  ? NZ  ? A LYS 54  NZ  
74  1 Y 1 A THR 58  ? OG1 ? A THR 58  OG1 
75  1 Y 1 A THR 58  ? CG2 ? A THR 58  CG2 
76  1 Y 1 A ILE 65  ? CD1 ? A ILE 65  CD1 
77  1 Y 1 A GLU 69  ? CG  ? A GLU 69  CG  
78  1 Y 1 A GLU 69  ? CD  ? A GLU 69  CD  
79  1 Y 1 A GLU 69  ? OE1 ? A GLU 69  OE1 
80  1 Y 1 A GLU 69  ? OE2 ? A GLU 69  OE2 
81  1 Y 1 A LYS 73  ? CG  ? A LYS 73  CG  
82  1 Y 1 A LYS 73  ? CD  ? A LYS 73  CD  
83  1 Y 1 A LYS 73  ? CE  ? A LYS 73  CE  
84  1 Y 1 A LYS 73  ? NZ  ? A LYS 73  NZ  
85  1 Y 1 A ILE 77  ? CD1 ? A ILE 77  CD1 
86  1 Y 1 A LYS 80  ? CG  ? A LYS 80  CG  
87  1 Y 1 A LYS 80  ? CD  ? A LYS 80  CD  
88  1 Y 1 A LYS 80  ? CE  ? A LYS 80  CE  
89  1 Y 1 A LYS 80  ? NZ  ? A LYS 80  NZ  
90  1 Y 1 A GLU 81  ? CG  ? A GLU 81  CG  
91  1 Y 1 A GLU 81  ? CD  ? A GLU 81  CD  
92  1 Y 1 A GLU 81  ? OE1 ? A GLU 81  OE1 
93  1 Y 1 A GLU 81  ? OE2 ? A GLU 81  OE2 
94  1 Y 1 A ASP 83  ? CG  ? A ASP 83  CG  
95  1 Y 1 A ASP 83  ? OD1 ? A ASP 83  OD1 
96  1 Y 1 A ASP 83  ? OD2 ? A ASP 83  OD2 
97  1 Y 1 A ILE 88  ? CD1 ? A ILE 88  CD1 
98  1 Y 1 A ARG 90  ? CD  ? A ARG 90  CD  
99  1 Y 1 A ARG 90  ? NE  ? A ARG 90  NE  
100 1 Y 1 A ARG 90  ? CZ  ? A ARG 90  CZ  
101 1 Y 1 A ARG 90  ? NH1 ? A ARG 90  NH1 
102 1 Y 1 A ARG 90  ? NH2 ? A ARG 90  NH2 
103 1 Y 1 A SER 92  ? OG  ? A SER 92  OG  
104 1 Y 1 A GLU 93  ? CG  ? A GLU 93  CG  
105 1 Y 1 A GLU 93  ? CD  ? A GLU 93  CD  
106 1 Y 1 A GLU 93  ? OE1 ? A GLU 93  OE1 
107 1 Y 1 A GLU 93  ? OE2 ? A GLU 93  OE2 
108 1 Y 1 A ARG 94  ? CG  ? A ARG 94  CG  
109 1 Y 1 A ARG 94  ? CD  ? A ARG 94  CD  
110 1 Y 1 A ARG 94  ? NE  ? A ARG 94  NE  
111 1 Y 1 A ARG 94  ? CZ  ? A ARG 94  CZ  
112 1 Y 1 A ARG 94  ? NH1 ? A ARG 94  NH1 
113 1 Y 1 A ARG 94  ? NH2 ? A ARG 94  NH2 
114 1 Y 1 A ASP 96  ? CG  ? A ASP 96  CG  
115 1 Y 1 A ASP 96  ? OD1 ? A ASP 96  OD1 
116 1 Y 1 A ASP 96  ? OD2 ? A ASP 96  OD2 
117 1 Y 1 A ASN 97  ? CG  ? A ASN 97  CG  
118 1 Y 1 A ASN 97  ? OD1 ? A ASN 97  OD1 
119 1 Y 1 A ASN 97  ? ND2 ? A ASN 97  ND2 
120 1 Y 1 A LEU 101 ? CG  ? A LEU 101 CG  
121 1 Y 1 A LEU 101 ? CD1 ? A LEU 101 CD1 
122 1 Y 1 A LEU 101 ? CD2 ? A LEU 101 CD2 
123 1 Y 1 A LYS 103 ? CD  ? A LYS 103 CD  
124 1 Y 1 A LYS 103 ? CE  ? A LYS 103 CE  
125 1 Y 1 A LYS 103 ? NZ  ? A LYS 103 NZ  
126 1 Y 1 A LEU 112 ? CD1 ? A LEU 112 CD1 
127 1 Y 1 A MET 115 ? SD  ? A MET 115 SD  
128 1 Y 1 A MET 115 ? CE  ? A MET 115 CE  
129 1 Y 1 A THR 116 ? OG1 ? A THR 116 OG1 
130 1 Y 1 A THR 116 ? CG2 ? A THR 116 CG2 
131 1 Y 1 B ASP 3   ? CG  ? B ASP 3   CG  
132 1 Y 1 B ASP 3   ? OD1 ? B ASP 3   OD1 
133 1 Y 1 B ASP 3   ? OD2 ? B ASP 3   OD2 
134 1 Y 1 B ILE 12  ? CD1 ? B ILE 12  CD1 
135 1 Y 1 B GLN 14  ? CD  ? B GLN 14  CD  
136 1 Y 1 B GLN 14  ? OE1 ? B GLN 14  OE1 
137 1 Y 1 B GLN 14  ? NE2 ? B GLN 14  NE2 
138 1 Y 1 B GLN 15  ? CD  ? B GLN 15  CD  
139 1 Y 1 B GLN 15  ? OE1 ? B GLN 15  OE1 
140 1 Y 1 B GLN 15  ? NE2 ? B GLN 15  NE2 
141 1 Y 1 B GLU 18  ? CG  ? B GLU 18  CG  
142 1 Y 1 B GLU 18  ? CD  ? B GLU 18  CD  
143 1 Y 1 B GLU 18  ? OE1 ? B GLU 18  OE1 
144 1 Y 1 B GLU 18  ? OE2 ? B GLU 18  OE2 
145 1 Y 1 B GLU 23  ? OE1 ? B GLU 23  OE1 
146 1 Y 1 B GLU 23  ? OE2 ? B GLU 23  OE2 
147 1 Y 1 B LYS 26  ? CD  ? B LYS 26  CD  
148 1 Y 1 B LYS 26  ? CE  ? B LYS 26  CE  
149 1 Y 1 B LYS 26  ? NZ  ? B LYS 26  NZ  
150 1 Y 1 B ILE 34  ? CG1 ? B ILE 34  CG1 
151 1 Y 1 B ILE 34  ? CD1 ? B ILE 34  CD1 
152 1 Y 1 B ILE 44  ? CD1 ? B ILE 44  CD1 
153 1 Y 1 B LYS 51  ? CD  ? B LYS 51  CD  
154 1 Y 1 B LYS 51  ? CE  ? B LYS 51  CE  
155 1 Y 1 B LYS 51  ? NZ  ? B LYS 51  NZ  
156 1 Y 1 B SER 56  ? OG  ? B SER 56  OG  
157 1 Y 1 B LYS 63  ? NZ  ? B LYS 63  NZ  
158 1 Y 1 B SER 72  ? OG  ? B SER 72  OG  
159 1 Y 1 B LYS 73  ? CG  ? B LYS 73  CG  
160 1 Y 1 B LYS 73  ? CD  ? B LYS 73  CD  
161 1 Y 1 B LYS 73  ? CE  ? B LYS 73  CE  
162 1 Y 1 B LYS 73  ? NZ  ? B LYS 73  NZ  
163 1 Y 1 B LYS 80  ? CG  ? B LYS 80  CG  
164 1 Y 1 B LYS 80  ? CD  ? B LYS 80  CD  
165 1 Y 1 B LYS 80  ? CE  ? B LYS 80  CE  
166 1 Y 1 B LYS 80  ? NZ  ? B LYS 80  NZ  
167 1 Y 1 B GLU 81  ? CG  ? B GLU 81  CG  
168 1 Y 1 B GLU 81  ? CD  ? B GLU 81  CD  
169 1 Y 1 B GLU 81  ? OE1 ? B GLU 81  OE1 
170 1 Y 1 B GLU 81  ? OE2 ? B GLU 81  OE2 
171 1 Y 1 B ASP 83  ? CG  ? B ASP 83  CG  
172 1 Y 1 B ASP 83  ? OD1 ? B ASP 83  OD1 
173 1 Y 1 B ASP 83  ? OD2 ? B ASP 83  OD2 
174 1 Y 1 B ILE 88  ? CD1 ? B ILE 88  CD1 
175 1 Y 1 B ILE 106 ? CD1 ? B ILE 106 CD1 
176 1 Y 1 B ILE 118 ? CG1 ? B ILE 118 CG1 
177 1 Y 1 B ILE 118 ? CG2 ? B ILE 118 CG2 
178 1 Y 1 B ILE 118 ? CD1 ? B ILE 118 CD1 
179 1 Y 1 C ARG 1   ? CG  ? C ARG 1   CG  
180 1 Y 1 C ARG 1   ? CD  ? C ARG 1   CD  
181 1 Y 1 C ARG 1   ? NE  ? C ARG 1   NE  
182 1 Y 1 C ARG 1   ? CZ  ? C ARG 1   CZ  
183 1 Y 1 C ARG 1   ? NH1 ? C ARG 1   NH1 
184 1 Y 1 C ARG 1   ? NH2 ? C ARG 1   NH2 
185 1 Y 1 C ASN 2   ? CG  ? C ASN 2   CG  
186 1 Y 1 C ASN 2   ? OD1 ? C ASN 2   OD1 
187 1 Y 1 C ASN 2   ? ND2 ? C ASN 2   ND2 
188 1 Y 1 C ASP 3   ? CG  ? C ASP 3   CG  
189 1 Y 1 C ASP 3   ? OD1 ? C ASP 3   OD1 
190 1 Y 1 C ASP 3   ? OD2 ? C ASP 3   OD2 
191 1 Y 1 C LEU 6   ? CD1 ? C LEU 6   CD1 
192 1 Y 1 C LEU 6   ? CD2 ? C LEU 6   CD2 
193 1 Y 1 C ILE 12  ? CG1 ? C ILE 12  CG1 
194 1 Y 1 C ILE 12  ? CG2 ? C ILE 12  CG2 
195 1 Y 1 C ILE 12  ? CD1 ? C ILE 12  CD1 
196 1 Y 1 C GLN 15  ? CD  ? C GLN 15  CD  
197 1 Y 1 C GLN 15  ? OE1 ? C GLN 15  OE1 
198 1 Y 1 C GLN 15  ? NE2 ? C GLN 15  NE2 
199 1 Y 1 C GLU 18  ? CG  ? C GLU 18  CG  
200 1 Y 1 C GLU 18  ? CD  ? C GLU 18  CD  
201 1 Y 1 C GLU 18  ? OE1 ? C GLU 18  OE1 
202 1 Y 1 C GLU 18  ? OE2 ? C GLU 18  OE2 
203 1 Y 1 C LYS 26  ? CG  ? C LYS 26  CG  
204 1 Y 1 C LYS 26  ? CD  ? C LYS 26  CD  
205 1 Y 1 C LYS 26  ? CE  ? C LYS 26  CE  
206 1 Y 1 C LYS 26  ? NZ  ? C LYS 26  NZ  
207 1 Y 1 C VAL 29  ? CG1 ? C VAL 29  CG1 
208 1 Y 1 C VAL 29  ? CG2 ? C VAL 29  CG2 
209 1 Y 1 C ILE 32  ? CG1 ? C ILE 32  CG1 
210 1 Y 1 C ILE 32  ? CG2 ? C ILE 32  CG2 
211 1 Y 1 C ILE 32  ? CD1 ? C ILE 32  CD1 
212 1 Y 1 C VAL 33  ? CG1 ? C VAL 33  CG1 
213 1 Y 1 C VAL 33  ? CG2 ? C VAL 33  CG2 
214 1 Y 1 C ILE 34  ? CG1 ? C ILE 34  CG1 
215 1 Y 1 C ILE 34  ? CG2 ? C ILE 34  CG2 
216 1 Y 1 C ILE 34  ? CD1 ? C ILE 34  CD1 
217 1 Y 1 C THR 35  ? OG1 ? C THR 35  OG1 
218 1 Y 1 C THR 35  ? CG2 ? C THR 35  CG2 
219 1 Y 1 C ARG 40  ? CG  ? C ARG 40  CG  
220 1 Y 1 C ARG 40  ? CD  ? C ARG 40  CD  
221 1 Y 1 C ARG 40  ? NE  ? C ARG 40  NE  
222 1 Y 1 C ARG 40  ? CZ  ? C ARG 40  CZ  
223 1 Y 1 C ARG 40  ? NH1 ? C ARG 40  NH1 
224 1 Y 1 C ARG 40  ? NH2 ? C ARG 40  NH2 
225 1 Y 1 C ARG 43  ? CG  ? C ARG 43  CG  
226 1 Y 1 C ARG 43  ? CD  ? C ARG 43  CD  
227 1 Y 1 C ARG 43  ? NE  ? C ARG 43  NE  
228 1 Y 1 C ARG 43  ? CZ  ? C ARG 43  CZ  
229 1 Y 1 C ARG 43  ? NH1 ? C ARG 43  NH1 
230 1 Y 1 C ARG 43  ? NH2 ? C ARG 43  NH2 
231 1 Y 1 C ILE 44  ? CG2 ? C ILE 44  CG2 
232 1 Y 1 C ILE 44  ? CD1 ? C ILE 44  CD1 
233 1 Y 1 C VAL 47  ? CG1 ? C VAL 47  CG1 
234 1 Y 1 C VAL 47  ? CG2 ? C VAL 47  CG2 
235 1 Y 1 C LYS 51  ? CG  ? C LYS 51  CG  
236 1 Y 1 C LYS 51  ? CD  ? C LYS 51  CD  
237 1 Y 1 C LYS 51  ? CE  ? C LYS 51  CE  
238 1 Y 1 C LYS 51  ? NZ  ? C LYS 51  NZ  
239 1 Y 1 C LYS 54  ? CE  ? C LYS 54  CE  
240 1 Y 1 C LYS 54  ? NZ  ? C LYS 54  NZ  
241 1 Y 1 C ASP 55  ? OD1 ? C ASP 55  OD1 
242 1 Y 1 C ASP 55  ? OD2 ? C ASP 55  OD2 
243 1 Y 1 C ILE 65  ? CG1 ? C ILE 65  CG1 
244 1 Y 1 C ILE 65  ? CG2 ? C ILE 65  CG2 
245 1 Y 1 C ILE 65  ? CD1 ? C ILE 65  CD1 
246 1 Y 1 C GLU 69  ? CG  ? C GLU 69  CG  
247 1 Y 1 C GLU 69  ? CD  ? C GLU 69  CD  
248 1 Y 1 C GLU 69  ? OE1 ? C GLU 69  OE1 
249 1 Y 1 C GLU 69  ? OE2 ? C GLU 69  OE2 
250 1 Y 1 C LYS 73  ? CG  ? C LYS 73  CG  
251 1 Y 1 C LYS 73  ? CD  ? C LYS 73  CD  
252 1 Y 1 C LYS 73  ? CE  ? C LYS 73  CE  
253 1 Y 1 C LYS 73  ? NZ  ? C LYS 73  NZ  
254 1 Y 1 C LYS 80  ? CE  ? C LYS 80  CE  
255 1 Y 1 C LYS 80  ? NZ  ? C LYS 80  NZ  
256 1 Y 1 C GLU 81  ? CG  ? C GLU 81  CG  
257 1 Y 1 C GLU 81  ? CD  ? C GLU 81  CD  
258 1 Y 1 C GLU 81  ? OE1 ? C GLU 81  OE1 
259 1 Y 1 C GLU 81  ? OE2 ? C GLU 81  OE2 
260 1 Y 1 C ASP 83  ? CG  ? C ASP 83  CG  
261 1 Y 1 C ASP 83  ? OD1 ? C ASP 83  OD1 
262 1 Y 1 C ASP 83  ? OD2 ? C ASP 83  OD2 
263 1 Y 1 C ILE 88  ? CG1 ? C ILE 88  CG1 
264 1 Y 1 C ILE 88  ? CG2 ? C ILE 88  CG2 
265 1 Y 1 C ILE 88  ? CD1 ? C ILE 88  CD1 
266 1 Y 1 C GLU 105 ? CG  ? C GLU 105 CG  
267 1 Y 1 C GLU 105 ? CD  ? C GLU 105 CD  
268 1 Y 1 C GLU 105 ? OE1 ? C GLU 105 OE1 
269 1 Y 1 C GLU 105 ? OE2 ? C GLU 105 OE2 
270 1 Y 1 C ILE 106 ? CD1 ? C ILE 106 CD1 
271 1 Y 1 D GLU 18  ? CG  ? D GLU 18  CG  
272 1 Y 1 D GLU 18  ? CD  ? D GLU 18  CD  
273 1 Y 1 D GLU 18  ? OE1 ? D GLU 18  OE1 
274 1 Y 1 D GLU 18  ? OE2 ? D GLU 18  OE2 
275 1 Y 1 D LYS 26  ? CG  ? D LYS 26  CG  
276 1 Y 1 D LYS 26  ? CD  ? D LYS 26  CD  
277 1 Y 1 D LYS 26  ? CE  ? D LYS 26  CE  
278 1 Y 1 D LYS 26  ? NZ  ? D LYS 26  NZ  
279 1 Y 1 D ILE 32  ? CD1 ? D ILE 32  CD1 
280 1 Y 1 D ILE 34  ? CG1 ? D ILE 34  CG1 
281 1 Y 1 D ILE 34  ? CD1 ? D ILE 34  CD1 
282 1 Y 1 D LYS 51  ? NZ  ? D LYS 51  NZ  
283 1 Y 1 D LYS 54  ? CD  ? D LYS 54  CD  
284 1 Y 1 D LYS 54  ? CE  ? D LYS 54  CE  
285 1 Y 1 D LYS 54  ? NZ  ? D LYS 54  NZ  
286 1 Y 1 D THR 58  ? OG1 ? D THR 58  OG1 
287 1 Y 1 D THR 58  ? CG2 ? D THR 58  CG2 
288 1 Y 1 D LYS 63  ? NZ  ? D LYS 63  NZ  
289 1 Y 1 D GLU 64  ? CD  ? D GLU 64  CD  
290 1 Y 1 D GLU 64  ? OE1 ? D GLU 64  OE1 
291 1 Y 1 D GLU 64  ? OE2 ? D GLU 64  OE2 
292 1 Y 1 D ILE 65  ? CD1 ? D ILE 65  CD1 
293 1 Y 1 D GLU 69  ? CG  ? D GLU 69  CG  
294 1 Y 1 D GLU 69  ? CD  ? D GLU 69  CD  
295 1 Y 1 D GLU 69  ? OE1 ? D GLU 69  OE1 
296 1 Y 1 D GLU 69  ? OE2 ? D GLU 69  OE2 
297 1 Y 1 D SER 72  ? OG  ? D SER 72  OG  
298 1 Y 1 D LYS 73  ? CG  ? D LYS 73  CG  
299 1 Y 1 D LYS 73  ? CD  ? D LYS 73  CD  
300 1 Y 1 D LYS 73  ? CE  ? D LYS 73  CE  
301 1 Y 1 D LYS 73  ? NZ  ? D LYS 73  NZ  
302 1 Y 1 D LYS 80  ? CG  ? D LYS 80  CG  
303 1 Y 1 D LYS 80  ? CD  ? D LYS 80  CD  
304 1 Y 1 D LYS 80  ? CE  ? D LYS 80  CE  
305 1 Y 1 D LYS 80  ? NZ  ? D LYS 80  NZ  
306 1 Y 1 D ASP 83  ? CG  ? D ASP 83  CG  
307 1 Y 1 D ASP 83  ? OD1 ? D ASP 83  OD1 
308 1 Y 1 D ASP 83  ? OD2 ? D ASP 83  OD2 
309 1 Y 1 D GLU 93  ? CG  ? D GLU 93  CG  
310 1 Y 1 D GLU 93  ? CD  ? D GLU 93  CD  
311 1 Y 1 D GLU 93  ? OE1 ? D GLU 93  OE1 
312 1 Y 1 D GLU 93  ? OE2 ? D GLU 93  OE2 
313 1 Y 1 D MET 100 ? CG  ? D MET 100 CG  
314 1 Y 1 D MET 100 ? SD  ? D MET 100 SD  
315 1 Y 1 D MET 100 ? CE  ? D MET 100 CE  
316 1 Y 1 D LEU 101 ? CG  ? D LEU 101 CG  
317 1 Y 1 D LEU 101 ? CD1 ? D LEU 101 CD1 
318 1 Y 1 D LEU 101 ? CD2 ? D LEU 101 CD2 
319 1 Y 1 D ILE 118 ? CG1 ? D ILE 118 CG1 
320 1 Y 1 D ILE 118 ? CG2 ? D ILE 118 CG2 
321 1 Y 1 D ILE 118 ? CD1 ? D ILE 118 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ARG 1   ? A ARG 1   
2   1 Y 1 A HIS 98  ? A HIS 98  
3   1 Y 1 A GLY 99  ? A GLY 99  
4   1 Y 1 A MET 100 ? A MET 100 
5   1 Y 1 A GLY 117 ? A GLY 117 
6   1 Y 1 A ILE 118 ? A ILE 118 
7   1 Y 1 A PRO 119 ? A PRO 119 
8   1 Y 1 A GLU 120 ? A GLU 120 
9   1 Y 1 A LYS 121 ? A LYS 121 
10  1 Y 1 A MET 122 ? A MET 122 
11  1 Y 1 A LYS 123 ? A LYS 123 
12  1 Y 1 A LYS 124 ? A LYS 124 
13  1 Y 1 A ASP 125 ? A ASP 125 
14  1 Y 1 A PHE 126 ? A PHE 126 
15  1 Y 1 A ARG 127 ? A ARG 127 
16  1 Y 1 A ALA 128 ? A ALA 128 
17  1 Y 1 A MET 129 ? A MET 129 
18  1 Y 1 A LYS 130 ? A LYS 130 
19  1 Y 1 A ASP 131 ? A ASP 131 
20  1 Y 1 A LEU 132 ? A LEU 132 
21  1 Y 1 A ALA 133 ? A ALA 133 
22  1 Y 1 A GLN 134 ? A GLN 134 
23  1 Y 1 A GLN 135 ? A GLN 135 
24  1 Y 1 A ILE 136 ? A ILE 136 
25  1 Y 1 A ASN 137 ? A ASN 137 
26  1 Y 1 A LEU 138 ? A LEU 138 
27  1 Y 1 A SER 139 ? A SER 139 
28  1 Y 1 A PRO 140 ? A PRO 140 
29  1 Y 1 A LYS 141 ? A LYS 141 
30  1 Y 1 A GLN 142 ? A GLN 142 
31  1 Y 1 A HIS 143 ? A HIS 143 
32  1 Y 1 A HIS 144 ? A HIS 144 
33  1 Y 1 A SER 145 ? A SER 145 
34  1 Y 1 A ALA 146 ? A ALA 146 
35  1 Y 1 A LEU 147 ? A LEU 147 
36  1 Y 1 A GLU 148 ? A GLU 148 
37  1 Y 1 B ARG 1   ? B ARG 1   
38  1 Y 1 B ASN 2   ? B ASN 2   
39  1 Y 1 B SER 92  ? B SER 92  
40  1 Y 1 B GLU 93  ? B GLU 93  
41  1 Y 1 B ARG 94  ? B ARG 94  
42  1 Y 1 B GLN 95  ? B GLN 95  
43  1 Y 1 B ASP 96  ? B ASP 96  
44  1 Y 1 B ASN 97  ? B ASN 97  
45  1 Y 1 B HIS 98  ? B HIS 98  
46  1 Y 1 B GLY 99  ? B GLY 99  
47  1 Y 1 B MET 100 ? B MET 100 
48  1 Y 1 B LEU 101 ? B LEU 101 
49  1 Y 1 B LEU 102 ? B LEU 102 
50  1 Y 1 B LYS 103 ? B LYS 103 
51  1 Y 1 B PRO 119 ? B PRO 119 
52  1 Y 1 B GLU 120 ? B GLU 120 
53  1 Y 1 B LYS 121 ? B LYS 121 
54  1 Y 1 B MET 122 ? B MET 122 
55  1 Y 1 B LYS 123 ? B LYS 123 
56  1 Y 1 B LYS 124 ? B LYS 124 
57  1 Y 1 B ASP 125 ? B ASP 125 
58  1 Y 1 B PHE 126 ? B PHE 126 
59  1 Y 1 B ARG 127 ? B ARG 127 
60  1 Y 1 B ALA 128 ? B ALA 128 
61  1 Y 1 B MET 129 ? B MET 129 
62  1 Y 1 B LYS 130 ? B LYS 130 
63  1 Y 1 B ASP 131 ? B ASP 131 
64  1 Y 1 B LEU 132 ? B LEU 132 
65  1 Y 1 B ALA 133 ? B ALA 133 
66  1 Y 1 B GLN 134 ? B GLN 134 
67  1 Y 1 B GLN 135 ? B GLN 135 
68  1 Y 1 B ILE 136 ? B ILE 136 
69  1 Y 1 B ASN 137 ? B ASN 137 
70  1 Y 1 B LEU 138 ? B LEU 138 
71  1 Y 1 B SER 139 ? B SER 139 
72  1 Y 1 B PRO 140 ? B PRO 140 
73  1 Y 1 B LYS 141 ? B LYS 141 
74  1 Y 1 B GLN 142 ? B GLN 142 
75  1 Y 1 B HIS 143 ? B HIS 143 
76  1 Y 1 B HIS 144 ? B HIS 144 
77  1 Y 1 B SER 145 ? B SER 145 
78  1 Y 1 B ALA 146 ? B ALA 146 
79  1 Y 1 B LEU 147 ? B LEU 147 
80  1 Y 1 B GLU 148 ? B GLU 148 
81  1 Y 1 C SER 92  ? C SER 92  
82  1 Y 1 C GLU 93  ? C GLU 93  
83  1 Y 1 C ARG 94  ? C ARG 94  
84  1 Y 1 C GLN 95  ? C GLN 95  
85  1 Y 1 C ASP 96  ? C ASP 96  
86  1 Y 1 C ASN 97  ? C ASN 97  
87  1 Y 1 C HIS 98  ? C HIS 98  
88  1 Y 1 C GLY 99  ? C GLY 99  
89  1 Y 1 C MET 100 ? C MET 100 
90  1 Y 1 C LEU 101 ? C LEU 101 
91  1 Y 1 C LEU 102 ? C LEU 102 
92  1 Y 1 C LYS 103 ? C LYS 103 
93  1 Y 1 C GLY 104 ? C GLY 104 
94  1 Y 1 C PRO 119 ? C PRO 119 
95  1 Y 1 C GLU 120 ? C GLU 120 
96  1 Y 1 C LYS 121 ? C LYS 121 
97  1 Y 1 C MET 122 ? C MET 122 
98  1 Y 1 C LYS 123 ? C LYS 123 
99  1 Y 1 C LYS 124 ? C LYS 124 
100 1 Y 1 C ASP 125 ? C ASP 125 
101 1 Y 1 C PHE 126 ? C PHE 126 
102 1 Y 1 C ARG 127 ? C ARG 127 
103 1 Y 1 C ALA 128 ? C ALA 128 
104 1 Y 1 C MET 129 ? C MET 129 
105 1 Y 1 C LYS 130 ? C LYS 130 
106 1 Y 1 C ASP 131 ? C ASP 131 
107 1 Y 1 C LEU 132 ? C LEU 132 
108 1 Y 1 C ALA 133 ? C ALA 133 
109 1 Y 1 C GLN 134 ? C GLN 134 
110 1 Y 1 C GLN 135 ? C GLN 135 
111 1 Y 1 C ILE 136 ? C ILE 136 
112 1 Y 1 C ASN 137 ? C ASN 137 
113 1 Y 1 C LEU 138 ? C LEU 138 
114 1 Y 1 C SER 139 ? C SER 139 
115 1 Y 1 C PRO 140 ? C PRO 140 
116 1 Y 1 C LYS 141 ? C LYS 141 
117 1 Y 1 C GLN 142 ? C GLN 142 
118 1 Y 1 C HIS 143 ? C HIS 143 
119 1 Y 1 C HIS 144 ? C HIS 144 
120 1 Y 1 C SER 145 ? C SER 145 
121 1 Y 1 C ALA 146 ? C ALA 146 
122 1 Y 1 C LEU 147 ? C LEU 147 
123 1 Y 1 C GLU 148 ? C GLU 148 
124 1 Y 1 D ARG 1   ? D ARG 1   
125 1 Y 1 D ASN 2   ? D ASN 2   
126 1 Y 1 D SER 92  ? D SER 92  
127 1 Y 1 D PRO 119 ? D PRO 119 
128 1 Y 1 D GLU 120 ? D GLU 120 
129 1 Y 1 D LYS 121 ? D LYS 121 
130 1 Y 1 D MET 122 ? D MET 122 
131 1 Y 1 D LYS 123 ? D LYS 123 
132 1 Y 1 D LYS 124 ? D LYS 124 
133 1 Y 1 D ASP 125 ? D ASP 125 
134 1 Y 1 D PHE 126 ? D PHE 126 
135 1 Y 1 D ARG 127 ? D ARG 127 
136 1 Y 1 D ALA 128 ? D ALA 128 
137 1 Y 1 D MET 129 ? D MET 129 
138 1 Y 1 D LYS 130 ? D LYS 130 
139 1 Y 1 D ASP 131 ? D ASP 131 
140 1 Y 1 D LEU 132 ? D LEU 132 
141 1 Y 1 D ALA 133 ? D ALA 133 
142 1 Y 1 D GLN 134 ? D GLN 134 
143 1 Y 1 D GLN 135 ? D GLN 135 
144 1 Y 1 D ILE 136 ? D ILE 136 
145 1 Y 1 D ASN 137 ? D ASN 137 
146 1 Y 1 D LEU 138 ? D LEU 138 
147 1 Y 1 D SER 139 ? D SER 139 
148 1 Y 1 D PRO 140 ? D PRO 140 
149 1 Y 1 D LYS 141 ? D LYS 141 
150 1 Y 1 D GLN 142 ? D GLN 142 
151 1 Y 1 D HIS 143 ? D HIS 143 
152 1 Y 1 D HIS 144 ? D HIS 144 
153 1 Y 1 D SER 145 ? D SER 145 
154 1 Y 1 D ALA 146 ? D ALA 146 
155 1 Y 1 D LEU 147 ? D LEU 147 
156 1 Y 1 D GLU 148 ? D GLU 148 
#