data_3QOW
# 
_entry.id   3QOW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QOW         
RCSB  RCSB063917   
WWPDB D_1000063917 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3QOX 
_pdbx_database_related.details        'DOT1L Structure in complex with SAH' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QOW 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Jin, L.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Chemogenetic analysis of human protein methyltransferases.' 
_citation.journal_abbrev            'Chem.Biol.Drug Des.' 
_citation.journal_volume            78 
_citation.page_first                199 
_citation.page_last                 210 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1747-0277 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21564555 
_citation.pdbx_database_id_DOI      10.1111/j.1747-0285.2011.01135.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Richon, V.M.'     1 
primary 'Johnston, D.'     2 
primary 'Sneeringer, C.J.' 3 
primary 'Jin, L.'          4 
primary 'Majer, C.R.'      5 
primary 'Elliston, K.'     6 
primary 'Jerva, L.F.'      7 
primary 'Scott, M.P.'      8 
primary 'Copeland, R.A.'   9 
# 
_cell.entry_id           3QOW 
_cell.length_a           153.204 
_cell.length_b           153.204 
_cell.length_c           51.314 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QOW 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase' 48697.430 1   2.1.1.43 ? 'UNP residues 1-416' ? 
2 non-polymer syn S-ADENOSYLMETHIONINE                 398.437   1   ?        ? ?                    ? 
3 non-polymer syn 'SULFATE ION'                        96.063    2   ?        ? ?                    ? 
4 water       nat water                                18.015    144 ?        ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DOT1-like protein, Histone H3-K79 methyltransferase, H3-K79-HMTase, Lysine N-methyltransferase 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGMGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFES
MQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDE
IKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRE
RIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPV
SYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPS
PSKARKKKLNKKGRKMAGRKRGRPKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGMGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFES
MQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDE
IKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRE
RIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPV
SYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPS
PSKARKKKLNKKGRKMAGRKRGRPKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  MET n 
1 12  GLY n 
1 13  GLU n 
1 14  LYS n 
1 15  LEU n 
1 16  GLU n 
1 17  LEU n 
1 18  ARG n 
1 19  LEU n 
1 20  LYS n 
1 21  SER n 
1 22  PRO n 
1 23  VAL n 
1 24  GLY n 
1 25  ALA n 
1 26  GLU n 
1 27  PRO n 
1 28  ALA n 
1 29  VAL n 
1 30  TYR n 
1 31  PRO n 
1 32  TRP n 
1 33  PRO n 
1 34  LEU n 
1 35  PRO n 
1 36  VAL n 
1 37  TYR n 
1 38  ASP n 
1 39  LYS n 
1 40  HIS n 
1 41  HIS n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  HIS n 
1 46  GLU n 
1 47  ILE n 
1 48  ILE n 
1 49  GLU n 
1 50  THR n 
1 51  ILE n 
1 52  ARG n 
1 53  TRP n 
1 54  VAL n 
1 55  CYS n 
1 56  GLU n 
1 57  GLU n 
1 58  ILE n 
1 59  PRO n 
1 60  ASP n 
1 61  LEU n 
1 62  LYS n 
1 63  LEU n 
1 64  ALA n 
1 65  MET n 
1 66  GLU n 
1 67  ASN n 
1 68  TYR n 
1 69  VAL n 
1 70  LEU n 
1 71  ILE n 
1 72  ASP n 
1 73  TYR n 
1 74  ASP n 
1 75  THR n 
1 76  LYS n 
1 77  SER n 
1 78  PHE n 
1 79  GLU n 
1 80  SER n 
1 81  MET n 
1 82  GLN n 
1 83  ARG n 
1 84  LEU n 
1 85  CYS n 
1 86  ASP n 
1 87  LYS n 
1 88  TYR n 
1 89  ASN n 
1 90  ARG n 
1 91  ALA n 
1 92  ILE n 
1 93  ASP n 
1 94  SER n 
1 95  ILE n 
1 96  HIS n 
1 97  GLN n 
1 98  LEU n 
1 99  TRP n 
1 100 LYS n 
1 101 GLY n 
1 102 THR n 
1 103 THR n 
1 104 GLN n 
1 105 PRO n 
1 106 MET n 
1 107 LYS n 
1 108 LEU n 
1 109 ASN n 
1 110 THR n 
1 111 ARG n 
1 112 PRO n 
1 113 SER n 
1 114 THR n 
1 115 GLY n 
1 116 LEU n 
1 117 LEU n 
1 118 ARG n 
1 119 HIS n 
1 120 ILE n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 VAL n 
1 125 TYR n 
1 126 ASN n 
1 127 HIS n 
1 128 SER n 
1 129 VAL n 
1 130 THR n 
1 131 ASP n 
1 132 PRO n 
1 133 GLU n 
1 134 LYS n 
1 135 LEU n 
1 136 ASN n 
1 137 ASN n 
1 138 TYR n 
1 139 GLU n 
1 140 PRO n 
1 141 PHE n 
1 142 SER n 
1 143 PRO n 
1 144 GLU n 
1 145 VAL n 
1 146 TYR n 
1 147 GLY n 
1 148 GLU n 
1 149 THR n 
1 150 SER n 
1 151 PHE n 
1 152 ASP n 
1 153 LEU n 
1 154 VAL n 
1 155 ALA n 
1 156 GLN n 
1 157 MET n 
1 158 ILE n 
1 159 ASP n 
1 160 GLU n 
1 161 ILE n 
1 162 LYS n 
1 163 MET n 
1 164 THR n 
1 165 ASP n 
1 166 ASP n 
1 167 ASP n 
1 168 LEU n 
1 169 PHE n 
1 170 VAL n 
1 171 ASP n 
1 172 LEU n 
1 173 GLY n 
1 174 SER n 
1 175 GLY n 
1 176 VAL n 
1 177 GLY n 
1 178 GLN n 
1 179 VAL n 
1 180 VAL n 
1 181 LEU n 
1 182 GLN n 
1 183 VAL n 
1 184 ALA n 
1 185 ALA n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 CYS n 
1 190 LYS n 
1 191 HIS n 
1 192 HIS n 
1 193 TYR n 
1 194 GLY n 
1 195 VAL n 
1 196 GLU n 
1 197 LYS n 
1 198 ALA n 
1 199 ASP n 
1 200 ILE n 
1 201 PRO n 
1 202 ALA n 
1 203 LYS n 
1 204 TYR n 
1 205 ALA n 
1 206 GLU n 
1 207 THR n 
1 208 MET n 
1 209 ASP n 
1 210 ARG n 
1 211 GLU n 
1 212 PHE n 
1 213 ARG n 
1 214 LYS n 
1 215 TRP n 
1 216 MET n 
1 217 LYS n 
1 218 TRP n 
1 219 TYR n 
1 220 GLY n 
1 221 LYS n 
1 222 LYS n 
1 223 HIS n 
1 224 ALA n 
1 225 GLU n 
1 226 TYR n 
1 227 THR n 
1 228 LEU n 
1 229 GLU n 
1 230 ARG n 
1 231 GLY n 
1 232 ASP n 
1 233 PHE n 
1 234 LEU n 
1 235 SER n 
1 236 GLU n 
1 237 GLU n 
1 238 TRP n 
1 239 ARG n 
1 240 GLU n 
1 241 ARG n 
1 242 ILE n 
1 243 ALA n 
1 244 ASN n 
1 245 THR n 
1 246 SER n 
1 247 VAL n 
1 248 ILE n 
1 249 PHE n 
1 250 VAL n 
1 251 ASN n 
1 252 ASN n 
1 253 PHE n 
1 254 ALA n 
1 255 PHE n 
1 256 GLY n 
1 257 PRO n 
1 258 GLU n 
1 259 VAL n 
1 260 ASP n 
1 261 HIS n 
1 262 GLN n 
1 263 LEU n 
1 264 LYS n 
1 265 GLU n 
1 266 ARG n 
1 267 PHE n 
1 268 ALA n 
1 269 ASN n 
1 270 MET n 
1 271 LYS n 
1 272 GLU n 
1 273 GLY n 
1 274 GLY n 
1 275 ARG n 
1 276 ILE n 
1 277 VAL n 
1 278 SER n 
1 279 SER n 
1 280 LYS n 
1 281 PRO n 
1 282 PHE n 
1 283 ALA n 
1 284 PRO n 
1 285 LEU n 
1 286 ASN n 
1 287 PHE n 
1 288 ARG n 
1 289 ILE n 
1 290 ASN n 
1 291 SER n 
1 292 ARG n 
1 293 ASN n 
1 294 LEU n 
1 295 SER n 
1 296 ASP n 
1 297 ILE n 
1 298 GLY n 
1 299 THR n 
1 300 ILE n 
1 301 MET n 
1 302 ARG n 
1 303 VAL n 
1 304 VAL n 
1 305 GLU n 
1 306 LEU n 
1 307 SER n 
1 308 PRO n 
1 309 LEU n 
1 310 LYS n 
1 311 GLY n 
1 312 SER n 
1 313 VAL n 
1 314 SER n 
1 315 TRP n 
1 316 THR n 
1 317 GLY n 
1 318 LYS n 
1 319 PRO n 
1 320 VAL n 
1 321 SER n 
1 322 TYR n 
1 323 TYR n 
1 324 LEU n 
1 325 HIS n 
1 326 THR n 
1 327 ILE n 
1 328 ASP n 
1 329 ARG n 
1 330 THR n 
1 331 ILE n 
1 332 LEU n 
1 333 GLU n 
1 334 ASN n 
1 335 TYR n 
1 336 PHE n 
1 337 SER n 
1 338 SER n 
1 339 LEU n 
1 340 LYS n 
1 341 ASN n 
1 342 PRO n 
1 343 LYS n 
1 344 LEU n 
1 345 ARG n 
1 346 GLU n 
1 347 GLU n 
1 348 GLN n 
1 349 GLU n 
1 350 ALA n 
1 351 ALA n 
1 352 ARG n 
1 353 ARG n 
1 354 ARG n 
1 355 GLN n 
1 356 GLN n 
1 357 ARG n 
1 358 GLU n 
1 359 SER n 
1 360 LYS n 
1 361 SER n 
1 362 ASN n 
1 363 ALA n 
1 364 ALA n 
1 365 THR n 
1 366 PRO n 
1 367 THR n 
1 368 LYS n 
1 369 GLY n 
1 370 PRO n 
1 371 GLU n 
1 372 GLY n 
1 373 LYS n 
1 374 VAL n 
1 375 ALA n 
1 376 GLY n 
1 377 PRO n 
1 378 ALA n 
1 379 ASP n 
1 380 ALA n 
1 381 PRO n 
1 382 MET n 
1 383 ASP n 
1 384 SER n 
1 385 GLY n 
1 386 ALA n 
1 387 GLU n 
1 388 GLU n 
1 389 GLU n 
1 390 LYS n 
1 391 ALA n 
1 392 GLY n 
1 393 ALA n 
1 394 ALA n 
1 395 THR n 
1 396 VAL n 
1 397 LYS n 
1 398 LYS n 
1 399 PRO n 
1 400 SER n 
1 401 PRO n 
1 402 SER n 
1 403 LYS n 
1 404 ALA n 
1 405 ARG n 
1 406 LYS n 
1 407 LYS n 
1 408 LYS n 
1 409 LEU n 
1 410 ASN n 
1 411 LYS n 
1 412 LYS n 
1 413 GLY n 
1 414 ARG n 
1 415 LYS n 
1 416 MET n 
1 417 ALA n 
1 418 GLY n 
1 419 ARG n 
1 420 LYS n 
1 421 ARG n 
1 422 GLY n 
1 423 ARG n 
1 424 PRO n 
1 425 LYS n 
1 426 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DOT1L, KIAA1814, KMT4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DOT1L_HUMAN 
_struct_ref.pdbx_db_accession          Q8TEK3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNR
AIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFV
DLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRT
ILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLN
KKGRKMAGRKRGRPKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3QOW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 11 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 426 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8TEK3 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  416 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       416 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QOW MET A 1  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -9 1  
1 3QOW HIS A 2  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -8 2  
1 3QOW HIS A 3  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -7 3  
1 3QOW HIS A 4  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -6 4  
1 3QOW HIS A 5  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -5 5  
1 3QOW HIS A 6  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -4 6  
1 3QOW HIS A 7  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -3 7  
1 3QOW SER A 8  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -2 8  
1 3QOW SER A 9  ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' -1 9  
1 3QOW GLY A 10 ? UNP Q8TEK3 ? ? 'EXPRESSION TAG' 0  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3QOW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.57 
_exptl_crystal.density_percent_sol   65.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pdbx_details    
'2 M Ammonium Sulfate, 0.1 M Sodium Acetate, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-04-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     3QOW 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   40579 
_reflns.number_all                   40742 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.121 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.389 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.2 
_reflns_shell.pdbx_redundancy        9.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3998 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3QOW 
_refine.ls_number_reflns_obs                     38415 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.87 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.55 
_refine.ls_R_factor_obs                          0.16188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16035 
_refine.ls_R_factor_R_free                       0.19212 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1956 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.954 
_refine.B_iso_mean                               40.054 
_refine.aniso_B[1][1]                            -0.99 
_refine.aniso_B[2][2]                            -0.99 
_refine.aniso_B[3][3]                            1.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.023 
_refine.overall_SU_ML                            0.064 
_refine.overall_SU_B                             2.426 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2597 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             144 
_refine_hist.number_atoms_total               2778 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        35.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 2722 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.242  1.962  ? 3699 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.170  5.000  ? 325  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.008 23.817 ? 131  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.202 15.000 ? 460  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.521 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 399  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 2070 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.734  1.500  ? 1623 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.338  2.000  ? 2628 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.701  3.000  ? 1099 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.746  4.500  ? 1068 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.099 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             2777 
_refine_ls_shell.R_factor_R_work                  0.152 
_refine_ls_shell.percent_reflns_obs               97.80 
_refine_ls_shell.R_factor_R_free                  0.176 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             118 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QOW 
_struct.title                     'DOT1L Structure in complex with SAM' 
_struct.pdbx_descriptor           'Histone-lysine N-methyltransferase, H3 lysine-79 specific (E.C.2.1.1.43)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QOW 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'H3K79 methylation, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 43  ? ILE A 58  ? ALA A 33  ILE A 48  1 ? 16 
HELX_P HELX_P2  2  ILE A 58  ? ASN A 67  ? ILE A 48  ASN A 57  1 ? 10 
HELX_P HELX_P3  3  SER A 77  ? TRP A 99  ? SER A 67  TRP A 89  1 ? 23 
HELX_P HELX_P4  4  SER A 113 ? VAL A 129 ? SER A 103 VAL A 119 1 ? 17 
HELX_P HELX_P5  5  ASP A 131 ? ASN A 137 ? ASP A 121 ASN A 127 5 ? 7  
HELX_P HELX_P6  6  SER A 150 ? ILE A 161 ? SER A 140 ILE A 151 1 ? 12 
HELX_P HELX_P7  7  GLY A 177 ? THR A 187 ? GLY A 167 THR A 177 1 ? 11 
HELX_P HELX_P8  8  ALA A 198 ? GLY A 220 ? ALA A 188 GLY A 210 1 ? 23 
HELX_P HELX_P9  9  SER A 235 ? ASN A 244 ? SER A 225 ASN A 234 1 ? 10 
HELX_P HELX_P10 10 GLY A 256 ? ALA A 268 ? GLY A 246 ALA A 258 1 ? 13 
HELX_P HELX_P11 11 ASP A 296 ? THR A 299 ? ASP A 286 THR A 289 5 ? 4  
HELX_P HELX_P12 12 ARG A 329 ? LEU A 339 ? ARG A 319 LEU A 329 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TRP 
_struct_mon_prot_cis.label_seq_id           32 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TRP 
_struct_mon_prot_cis.auth_seq_id            22 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    33 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     23 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 16  ? LEU A 19  ? GLU A 6   LEU A 9   
A 2 ALA A 28  ? PRO A 31  ? ALA A 18  PRO A 21  
B 1 VAL A 36  ? ASP A 38  ? VAL A 26  ASP A 28  
B 2 HIS A 41  ? ASP A 42  ? HIS A 31  ASP A 32  
C 1 TYR A 226 ? ARG A 230 ? TYR A 216 ARG A 220 
C 2 HIS A 191 ? GLU A 196 ? HIS A 181 GLU A 186 
C 3 LEU A 168 ? LEU A 172 ? LEU A 158 LEU A 162 
C 4 VAL A 247 ? VAL A 250 ? VAL A 237 VAL A 240 
C 5 ARG A 275 ? SER A 278 ? ARG A 265 SER A 268 
C 6 TYR A 323 ? ILE A 327 ? TYR A 313 ILE A 317 
C 7 MET A 301 ? GLU A 305 ? MET A 291 GLU A 295 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 17  ? N LEU A 7   O TYR A 30  ? O TYR A 20  
B 1 2 N TYR A 37  ? N TYR A 27  O HIS A 41  ? O HIS A 31  
C 1 2 O GLU A 229 ? O GLU A 219 N GLY A 194 ? N GLY A 184 
C 2 3 O TYR A 193 ? O TYR A 183 N ASP A 171 ? N ASP A 161 
C 3 4 N VAL A 170 ? N VAL A 160 O PHE A 249 ? O PHE A 239 
C 4 5 N ILE A 248 ? N ILE A 238 O VAL A 277 ? O VAL A 267 
C 5 6 N ILE A 276 ? N ILE A 266 O HIS A 325 ? O HIS A 315 
C 6 7 O LEU A 324 ? O LEU A 314 N VAL A 304 ? N VAL A 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE SAM A 417' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 418' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 419' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 PRO A 143 ? PRO A 133 . ? 1_555 ? 
2  AC1 21 VAL A 145 ? VAL A 135 . ? 1_555 ? 
3  AC1 21 GLY A 147 ? GLY A 137 . ? 1_555 ? 
4  AC1 21 GLU A 148 ? GLU A 138 . ? 1_555 ? 
5  AC1 21 THR A 149 ? THR A 139 . ? 1_555 ? 
6  AC1 21 ASP A 171 ? ASP A 161 . ? 1_555 ? 
7  AC1 21 GLY A 173 ? GLY A 163 . ? 1_555 ? 
8  AC1 21 SER A 174 ? SER A 164 . ? 1_555 ? 
9  AC1 21 GLN A 178 ? GLN A 168 . ? 1_555 ? 
10 AC1 21 VAL A 179 ? VAL A 169 . ? 1_555 ? 
11 AC1 21 GLU A 196 ? GLU A 186 . ? 1_555 ? 
12 AC1 21 LYS A 197 ? LYS A 187 . ? 1_555 ? 
13 AC1 21 GLY A 231 ? GLY A 221 . ? 1_555 ? 
14 AC1 21 ASP A 232 ? ASP A 222 . ? 1_555 ? 
15 AC1 21 PHE A 233 ? PHE A 223 . ? 1_555 ? 
16 AC1 21 PHE A 249 ? PHE A 239 . ? 1_555 ? 
17 AC1 21 ASN A 251 ? ASN A 241 . ? 1_555 ? 
18 AC1 21 PHE A 255 ? PHE A 245 . ? 1_555 ? 
19 AC1 21 HOH E .   ? HOH A 441 . ? 1_555 ? 
20 AC1 21 HOH E .   ? HOH A 464 . ? 1_555 ? 
21 AC1 21 HOH E .   ? HOH A 524 . ? 1_555 ? 
22 AC2 4  ARG A 213 ? ARG A 203 . ? 1_555 ? 
23 AC2 4  HIS A 223 ? HIS A 213 . ? 1_555 ? 
24 AC2 4  HOH E .   ? HOH A 448 . ? 1_555 ? 
25 AC2 4  HOH E .   ? HOH A 553 . ? 1_555 ? 
26 AC3 4  ARG A 239 ? ARG A 229 . ? 1_555 ? 
27 AC3 4  GLN A 262 ? GLN A 252 . ? 1_555 ? 
28 AC3 4  GLU A 265 ? GLU A 255 . ? 1_555 ? 
29 AC3 4  ARG A 266 ? ARG A 256 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QOW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QOW 
_atom_sites.fract_transf_matrix[1][1]   0.006527 
_atom_sites.fract_transf_matrix[1][2]   0.003769 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019488 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 14  ? 55.455  43.720 -14.128 1.00 59.24 ? 4   LYS A N     1 
ATOM   2    C CA    . LYS A 1 14  ? 56.570  44.706 -13.963 1.00 59.02 ? 4   LYS A CA    1 
ATOM   3    C C     . LYS A 1 14  ? 56.802  45.056 -12.490 1.00 58.73 ? 4   LYS A C     1 
ATOM   4    O O     . LYS A 1 14  ? 56.489  44.256 -11.600 1.00 58.94 ? 4   LYS A O     1 
ATOM   5    C CB    . LYS A 1 14  ? 56.290  45.969 -14.785 1.00 59.21 ? 4   LYS A CB    1 
ATOM   6    N N     . LEU A 1 15  ? 57.359  46.241 -12.238 1.00 57.98 ? 5   LEU A N     1 
ATOM   7    C CA    . LEU A 1 15  ? 57.560  46.726 -10.875 1.00 57.17 ? 5   LEU A CA    1 
ATOM   8    C C     . LEU A 1 15  ? 56.220  46.823 -10.139 1.00 56.58 ? 5   LEU A C     1 
ATOM   9    O O     . LEU A 1 15  ? 55.221  47.303 -10.696 1.00 56.30 ? 5   LEU A O     1 
ATOM   10   C CB    . LEU A 1 15  ? 58.259  48.088 -10.871 1.00 57.39 ? 5   LEU A CB    1 
ATOM   11   C CG    . LEU A 1 15  ? 59.475  48.332 -11.770 1.00 57.69 ? 5   LEU A CG    1 
ATOM   12   C CD1   . LEU A 1 15  ? 59.028  48.710 -13.191 1.00 58.35 ? 5   LEU A CD1   1 
ATOM   13   C CD2   . LEU A 1 15  ? 60.352  49.429 -11.180 1.00 57.66 ? 5   LEU A CD2   1 
ATOM   14   N N     . GLU A 1 16  ? 56.212  46.361 -8.891  1.00 55.44 ? 6   GLU A N     1 
ATOM   15   C CA    . GLU A 1 16  ? 54.997  46.283 -8.090  1.00 54.19 ? 6   GLU A CA    1 
ATOM   16   C C     . GLU A 1 16  ? 55.258  46.675 -6.649  1.00 52.79 ? 6   GLU A C     1 
ATOM   17   O O     . GLU A 1 16  ? 56.348  46.429 -6.112  1.00 52.56 ? 6   GLU A O     1 
ATOM   18   C CB    . GLU A 1 16  ? 54.437  44.861 -8.111  1.00 54.91 ? 6   GLU A CB    1 
ATOM   19   C CG    . GLU A 1 16  ? 53.245  44.651 -9.027  1.00 56.20 ? 6   GLU A CG    1 
ATOM   20   C CD    . GLU A 1 16  ? 52.704  43.231 -8.949  1.00 58.69 ? 6   GLU A CD    1 
ATOM   21   O OE1   . GLU A 1 16  ? 51.933  42.836 -9.848  1.00 59.85 ? 6   GLU A OE1   1 
ATOM   22   O OE2   . GLU A 1 16  ? 53.044  42.505 -7.990  1.00 59.60 ? 6   GLU A OE2   1 
ATOM   23   N N     . LEU A 1 17  ? 54.259  47.306 -6.037  1.00 50.47 ? 7   LEU A N     1 
ATOM   24   C CA    . LEU A 1 17  ? 54.231  47.507 -4.600  1.00 48.51 ? 7   LEU A CA    1 
ATOM   25   C C     . LEU A 1 17  ? 53.063  46.716 -4.021  1.00 47.15 ? 7   LEU A C     1 
ATOM   26   O O     . LEU A 1 17  ? 51.972  46.715 -4.595  1.00 47.09 ? 7   LEU A O     1 
ATOM   27   C CB    . LEU A 1 17  ? 54.102  48.986 -4.257  1.00 48.28 ? 7   LEU A CB    1 
ATOM   28   C CG    . LEU A 1 17  ? 55.351  49.860 -4.368  1.00 48.97 ? 7   LEU A CG    1 
ATOM   29   C CD1   . LEU A 1 17  ? 55.076  51.248 -3.840  1.00 47.54 ? 7   LEU A CD1   1 
ATOM   30   C CD2   . LEU A 1 17  ? 56.534  49.235 -3.613  1.00 50.61 ? 7   LEU A CD2   1 
ATOM   31   N N     . ARG A 1 18  ? 53.298  46.046 -2.891  1.00 45.20 ? 8   ARG A N     1 
ATOM   32   C CA    . ARG A 1 18  ? 52.317  45.143 -2.292  1.00 43.52 ? 8   ARG A CA    1 
ATOM   33   C C     . ARG A 1 18  ? 52.165  45.448 -0.808  1.00 41.51 ? 8   ARG A C     1 
ATOM   34   O O     . ARG A 1 18  ? 53.160  45.557 -0.097  1.00 41.53 ? 8   ARG A O     1 
ATOM   35   C CB    . ARG A 1 18  ? 52.739  43.669 -2.457  1.00 43.98 ? 8   ARG A CB    1 
ATOM   36   C CG    . ARG A 1 18  ? 53.010  43.197 -3.887  1.00 46.12 ? 8   ARG A CG    1 
ATOM   37   C CD    . ARG A 1 18  ? 53.492  41.737 -3.928  1.00 49.25 ? 8   ARG A CD    1 
ATOM   38   N NE    . ARG A 1 18  ? 52.372  40.799 -3.841  1.00 51.99 ? 8   ARG A NE    1 
ATOM   39   C CZ    . ARG A 1 18  ? 51.648  40.386 -4.881  1.00 53.26 ? 8   ARG A CZ    1 
ATOM   40   N NH1   . ARG A 1 18  ? 51.929  40.814 -6.111  1.00 54.72 ? 8   ARG A NH1   1 
ATOM   41   N NH2   . ARG A 1 18  ? 50.638  39.545 -4.691  1.00 53.89 ? 8   ARG A NH2   1 
ATOM   42   N N     . LEU A 1 19  ? 50.920  45.576 -0.349  1.00 39.52 ? 9   LEU A N     1 
ATOM   43   C CA    . LEU A 1 19  ? 50.614  45.661 1.080   1.00 37.23 ? 9   LEU A CA    1 
ATOM   44   C C     . LEU A 1 19  ? 49.770  44.456 1.499   1.00 36.23 ? 9   LEU A C     1 
ATOM   45   O O     . LEU A 1 19  ? 48.684  44.241 0.960   1.00 35.90 ? 9   LEU A O     1 
ATOM   46   C CB    . LEU A 1 19  ? 49.853  46.968 1.425   1.00 36.97 ? 9   LEU A CB    1 
ATOM   47   C CG    . LEU A 1 19  ? 50.475  48.362 1.232   1.00 35.03 ? 9   LEU A CG    1 
ATOM   48   C CD1   . LEU A 1 19  ? 49.470  49.473 1.621   1.00 33.43 ? 9   LEU A CD1   1 
ATOM   49   C CD2   . LEU A 1 19  ? 51.776  48.540 2.004   1.00 30.94 ? 9   LEU A CD2   1 
ATOM   50   N N     . LYS A 1 20  ? 50.264  43.691 2.477   1.00 35.10 ? 10  LYS A N     1 
ATOM   51   C CA    . LYS A 1 20  ? 49.515  42.586 3.058   1.00 34.51 ? 10  LYS A CA    1 
ATOM   52   C C     . LYS A 1 20  ? 48.350  43.084 3.921   1.00 33.89 ? 10  LYS A C     1 
ATOM   53   O O     . LYS A 1 20  ? 48.474  44.083 4.625   1.00 34.17 ? 10  LYS A O     1 
ATOM   54   C CB    . LYS A 1 20  ? 50.437  41.688 3.906   1.00 34.36 ? 10  LYS A CB    1 
ATOM   55   C CG    . LYS A 1 20  ? 51.488  40.897 3.105   1.00 34.41 ? 10  LYS A CG    1 
ATOM   56   C CD    . LYS A 1 20  ? 52.250  39.935 4.029   1.00 37.83 ? 10  LYS A CD    1 
ATOM   57   C CE    . LYS A 1 20  ? 53.208  39.023 3.248   1.00 37.36 ? 10  LYS A CE    1 
ATOM   58   N NZ    . LYS A 1 20  ? 53.351  37.694 3.952   1.00 38.52 ? 10  LYS A NZ    1 
ATOM   59   N N     . SER A 1 21  ? 47.241  42.362 3.864   1.00 33.69 ? 11  SER A N     1 
ATOM   60   C CA    . SER A 1 21  ? 46.056  42.629 4.672   1.00 33.37 ? 11  SER A CA    1 
ATOM   61   C C     . SER A 1 21  ? 46.286  42.232 6.134   1.00 33.62 ? 11  SER A C     1 
ATOM   62   O O     . SER A 1 21  ? 46.904  41.188 6.410   1.00 33.72 ? 11  SER A O     1 
ATOM   63   C CB    . SER A 1 21  ? 44.858  41.877 4.081   1.00 33.38 ? 11  SER A CB    1 
ATOM   64   O OG    . SER A 1 21  ? 43.724  41.893 4.936   1.00 31.28 ? 11  SER A OG    1 
ATOM   65   N N     . PRO A 1 22  ? 45.807  43.062 7.084   1.00 33.37 ? 12  PRO A N     1 
ATOM   66   C CA    . PRO A 1 22  ? 45.941  42.703 8.494   1.00 33.83 ? 12  PRO A CA    1 
ATOM   67   C C     . PRO A 1 22  ? 45.108  41.478 8.881   1.00 34.15 ? 12  PRO A C     1 
ATOM   68   O O     . PRO A 1 22  ? 45.397  40.833 9.896   1.00 34.44 ? 12  PRO A O     1 
ATOM   69   C CB    . PRO A 1 22  ? 45.406  43.935 9.220   1.00 33.95 ? 12  PRO A CB    1 
ATOM   70   C CG    . PRO A 1 22  ? 44.547  44.648 8.207   1.00 33.27 ? 12  PRO A CG    1 
ATOM   71   C CD    . PRO A 1 22  ? 45.241  44.416 6.918   1.00 33.25 ? 12  PRO A CD    1 
ATOM   72   N N     . VAL A 1 23  ? 44.082  41.173 8.095   1.00 34.09 ? 13  VAL A N     1 
ATOM   73   C CA    . VAL A 1 23  ? 43.244  40.006 8.365   1.00 34.88 ? 13  VAL A CA    1 
ATOM   74   C C     . VAL A 1 23  ? 43.455  38.871 7.359   1.00 35.21 ? 13  VAL A C     1 
ATOM   75   O O     . VAL A 1 23  ? 42.674  37.928 7.312   1.00 34.98 ? 13  VAL A O     1 
ATOM   76   C CB    . VAL A 1 23  ? 41.736  40.368 8.457   1.00 35.03 ? 13  VAL A CB    1 
ATOM   77   C CG1   . VAL A 1 23  ? 41.472  41.322 9.655   1.00 34.52 ? 13  VAL A CG1   1 
ATOM   78   C CG2   . VAL A 1 23  ? 41.222  40.954 7.121   1.00 34.33 ? 13  VAL A CG2   1 
ATOM   79   N N     . GLY A 1 24  ? 44.509  38.970 6.560   1.00 35.78 ? 14  GLY A N     1 
ATOM   80   C CA    . GLY A 1 24  ? 44.844  37.914 5.600   1.00 36.93 ? 14  GLY A CA    1 
ATOM   81   C C     . GLY A 1 24  ? 43.986  37.857 4.344   1.00 37.56 ? 14  GLY A C     1 
ATOM   82   O O     . GLY A 1 24  ? 43.809  36.784 3.759   1.00 36.67 ? 14  GLY A O     1 
ATOM   83   N N     . ALA A 1 25  ? 43.444  39.000 3.918   1.00 37.71 ? 15  ALA A N     1 
ATOM   84   C CA    . ALA A 1 25  ? 42.762  39.047 2.621   1.00 38.67 ? 15  ALA A CA    1 
ATOM   85   C C     . ALA A 1 25  ? 43.822  39.150 1.528   1.00 39.32 ? 15  ALA A C     1 
ATOM   86   O O     . ALA A 1 25  ? 45.016  39.247 1.819   1.00 39.21 ? 15  ALA A O     1 
ATOM   87   C CB    . ALA A 1 25  ? 41.795  40.225 2.549   1.00 38.68 ? 15  ALA A CB    1 
ATOM   88   N N     . GLU A 1 26  ? 43.399  39.131 0.270   1.00 40.55 ? 16  GLU A N     1 
ATOM   89   C CA    . GLU A 1 26  ? 44.342  39.319 -0.821  1.00 42.01 ? 16  GLU A CA    1 
ATOM   90   C C     . GLU A 1 26  ? 45.101  40.628 -0.621  1.00 41.42 ? 16  GLU A C     1 
ATOM   91   O O     . GLU A 1 26  ? 44.510  41.620 -0.212  1.00 41.71 ? 16  GLU A O     1 
ATOM   92   C CB    . GLU A 1 26  ? 43.641  39.267 -2.184  1.00 42.47 ? 16  GLU A CB    1 
ATOM   93   C CG    . GLU A 1 26  ? 43.208  37.849 -2.598  1.00 46.50 ? 16  GLU A CG    1 
ATOM   94   C CD    . GLU A 1 26  ? 44.378  36.944 -2.936  1.00 49.83 ? 16  GLU A CD    1 
ATOM   95   O OE1   . GLU A 1 26  ? 44.854  36.976 -4.093  1.00 53.92 ? 16  GLU A OE1   1 
ATOM   96   O OE2   . GLU A 1 26  ? 44.822  36.199 -2.043  1.00 51.23 ? 16  GLU A OE2   1 
ATOM   97   N N     . PRO A 1 27  ? 46.424  40.614 -0.849  1.00 40.99 ? 17  PRO A N     1 
ATOM   98   C CA    . PRO A 1 27  ? 47.223  41.824 -0.749  1.00 40.95 ? 17  PRO A CA    1 
ATOM   99   C C     . PRO A 1 27  ? 46.760  42.892 -1.742  1.00 40.82 ? 17  PRO A C     1 
ATOM   100  O O     . PRO A 1 27  ? 46.282  42.557 -2.818  1.00 40.56 ? 17  PRO A O     1 
ATOM   101  C CB    . PRO A 1 27  ? 48.643  41.339 -1.102  1.00 40.83 ? 17  PRO A CB    1 
ATOM   102  C CG    . PRO A 1 27  ? 48.440  40.036 -1.806  1.00 40.45 ? 17  PRO A CG    1 
ATOM   103  C CD    . PRO A 1 27  ? 47.264  39.436 -1.136  1.00 41.33 ? 17  PRO A CD    1 
ATOM   104  N N     . ALA A 1 28  ? 46.879  44.163 -1.356  1.00 40.47 ? 18  ALA A N     1 
ATOM   105  C CA    . ALA A 1 28  ? 46.642  45.273 -2.263  1.00 40.55 ? 18  ALA A CA    1 
ATOM   106  C C     . ALA A 1 28  ? 47.890  45.444 -3.152  1.00 41.23 ? 18  ALA A C     1 
ATOM   107  O O     . ALA A 1 28  ? 49.012  45.428 -2.640  1.00 40.83 ? 18  ALA A O     1 
ATOM   108  C CB    . ALA A 1 28  ? 46.362  46.534 -1.467  1.00 39.56 ? 18  ALA A CB    1 
ATOM   109  N N     . VAL A 1 29  ? 47.683  45.587 -4.466  1.00 42.19 ? 19  VAL A N     1 
ATOM   110  C CA    . VAL A 1 29  ? 48.771  45.692 -5.468  1.00 43.77 ? 19  VAL A CA    1 
ATOM   111  C C     . VAL A 1 29  ? 48.783  47.054 -6.137  1.00 43.54 ? 19  VAL A C     1 
ATOM   112  O O     . VAL A 1 29  ? 47.744  47.496 -6.622  1.00 43.99 ? 19  VAL A O     1 
ATOM   113  C CB    . VAL A 1 29  ? 48.561  44.732 -6.668  1.00 43.86 ? 19  VAL A CB    1 
ATOM   114  C CG1   . VAL A 1 29  ? 49.879  44.134 -7.114  1.00 45.59 ? 19  VAL A CG1   1 
ATOM   115  C CG2   . VAL A 1 29  ? 47.532  43.691 -6.369  1.00 46.79 ? 19  VAL A CG2   1 
ATOM   116  N N     . TYR A 1 30  ? 49.947  47.702 -6.193  1.00 43.48 ? 20  TYR A N     1 
ATOM   117  C CA    . TYR A 1 30  ? 50.089  49.015 -6.832  1.00 43.12 ? 20  TYR A CA    1 
ATOM   118  C C     . TYR A 1 30  ? 51.197  49.034 -7.905  1.00 44.14 ? 20  TYR A C     1 
ATOM   119  O O     . TYR A 1 30  ? 52.337  48.640 -7.631  1.00 43.91 ? 20  TYR A O     1 
ATOM   120  C CB    . TYR A 1 30  ? 50.435  50.091 -5.803  1.00 42.79 ? 20  TYR A CB    1 
ATOM   121  C CG    . TYR A 1 30  ? 49.416  50.368 -4.721  1.00 40.07 ? 20  TYR A CG    1 
ATOM   122  C CD1   . TYR A 1 30  ? 49.386  49.594 -3.559  1.00 36.63 ? 20  TYR A CD1   1 
ATOM   123  C CD2   . TYR A 1 30  ? 48.520  51.437 -4.831  1.00 37.33 ? 20  TYR A CD2   1 
ATOM   124  C CE1   . TYR A 1 30  ? 48.474  49.848 -2.542  1.00 34.90 ? 20  TYR A CE1   1 
ATOM   125  C CE2   . TYR A 1 30  ? 47.589  51.707 -3.798  1.00 35.79 ? 20  TYR A CE2   1 
ATOM   126  C CZ    . TYR A 1 30  ? 47.583  50.902 -2.663  1.00 33.63 ? 20  TYR A CZ    1 
ATOM   127  O OH    . TYR A 1 30  ? 46.707  51.125 -1.637  1.00 32.57 ? 20  TYR A OH    1 
ATOM   128  N N     . PRO A 1 31  ? 50.883  49.546 -9.110  1.00 44.99 ? 21  PRO A N     1 
ATOM   129  C CA    . PRO A 1 31  ? 51.888  49.559 -10.177 1.00 45.29 ? 21  PRO A CA    1 
ATOM   130  C C     . PRO A 1 31  ? 52.942  50.651 -9.992  1.00 45.75 ? 21  PRO A C     1 
ATOM   131  O O     . PRO A 1 31  ? 52.678  51.673 -9.349  1.00 45.87 ? 21  PRO A O     1 
ATOM   132  C CB    . PRO A 1 31  ? 51.056  49.825 -11.436 1.00 45.81 ? 21  PRO A CB    1 
ATOM   133  C CG    . PRO A 1 31  ? 49.838  50.584 -10.956 1.00 45.69 ? 21  PRO A CG    1 
ATOM   134  C CD    . PRO A 1 31  ? 49.606  50.180 -9.515  1.00 44.71 ? 21  PRO A CD    1 
ATOM   135  N N     . TRP A 1 32  ? 54.137  50.441 -10.535 1.00 45.88 ? 22  TRP A N     1 
ATOM   136  C CA    . TRP A 1 32  ? 55.120  51.530 -10.599 1.00 45.79 ? 22  TRP A CA    1 
ATOM   137  C C     . TRP A 1 32  ? 55.314  51.965 -12.048 1.00 45.39 ? 22  TRP A C     1 
ATOM   138  O O     . TRP A 1 32  ? 55.414  51.107 -12.937 1.00 46.01 ? 22  TRP A O     1 
ATOM   139  C CB    . TRP A 1 32  ? 56.455  51.163 -9.928  1.00 46.12 ? 22  TRP A CB    1 
ATOM   140  C CG    . TRP A 1 32  ? 57.336  52.368 -9.691  1.00 46.13 ? 22  TRP A CG    1 
ATOM   141  C CD1   . TRP A 1 32  ? 58.200  52.936 -10.581 1.00 46.04 ? 22  TRP A CD1   1 
ATOM   142  C CD2   . TRP A 1 32  ? 57.417  53.156 -8.495  1.00 46.13 ? 22  TRP A CD2   1 
ATOM   143  N NE1   . TRP A 1 32  ? 58.809  54.034 -10.017 1.00 47.41 ? 22  TRP A NE1   1 
ATOM   144  C CE2   . TRP A 1 32  ? 58.351  54.183 -8.734  1.00 46.83 ? 22  TRP A CE2   1 
ATOM   145  C CE3   . TRP A 1 32  ? 56.789  53.093 -7.246  1.00 47.93 ? 22  TRP A CE3   1 
ATOM   146  C CZ2   . TRP A 1 32  ? 58.678  55.141 -7.769  1.00 48.02 ? 22  TRP A CZ2   1 
ATOM   147  C CZ3   . TRP A 1 32  ? 57.118  54.044 -6.281  1.00 48.04 ? 22  TRP A CZ3   1 
ATOM   148  C CH2   . TRP A 1 32  ? 58.051  55.059 -6.554  1.00 48.68 ? 22  TRP A CH2   1 
ATOM   149  N N     . PRO A 1 33  ? 55.342  53.294 -12.301 1.00 44.36 ? 23  PRO A N     1 
ATOM   150  C CA    . PRO A 1 33  ? 55.163  54.363 -11.315 1.00 43.58 ? 23  PRO A CA    1 
ATOM   151  C C     . PRO A 1 33  ? 53.762  54.404 -10.706 1.00 42.90 ? 23  PRO A C     1 
ATOM   152  O O     . PRO A 1 33  ? 52.789  53.943 -11.325 1.00 42.27 ? 23  PRO A O     1 
ATOM   153  C CB    . PRO A 1 33  ? 55.454  55.649 -12.113 1.00 43.88 ? 23  PRO A CB    1 
ATOM   154  C CG    . PRO A 1 33  ? 55.398  55.248 -13.558 1.00 43.92 ? 23  PRO A CG    1 
ATOM   155  C CD    . PRO A 1 33  ? 55.823  53.817 -13.592 1.00 44.41 ? 23  PRO A CD    1 
ATOM   156  N N     . LEU A 1 34  ? 53.684  54.914 -9.477  1.00 42.37 ? 24  LEU A N     1 
ATOM   157  C CA    . LEU A 1 34  ? 52.421  55.016 -8.748  1.00 41.74 ? 24  LEU A CA    1 
ATOM   158  C C     . LEU A 1 34  ? 51.533  56.114 -9.356  1.00 41.11 ? 24  LEU A C     1 
ATOM   159  O O     . LEU A 1 34  ? 52.007  57.207 -9.625  1.00 41.08 ? 24  LEU A O     1 
ATOM   160  C CB    . LEU A 1 34  ? 52.687  55.275 -7.265  1.00 41.72 ? 24  LEU A CB    1 
ATOM   161  C CG    . LEU A 1 34  ? 53.392  54.144 -6.486  1.00 42.27 ? 24  LEU A CG    1 
ATOM   162  C CD1   . LEU A 1 34  ? 53.931  54.648 -5.160  1.00 42.15 ? 24  LEU A CD1   1 
ATOM   163  C CD2   . LEU A 1 34  ? 52.481  52.931 -6.271  1.00 41.35 ? 24  LEU A CD2   1 
ATOM   164  N N     . PRO A 1 35  ? 50.245  55.818 -9.586  1.00 40.89 ? 25  PRO A N     1 
ATOM   165  C CA    . PRO A 1 35  ? 49.398  56.830 -10.224 1.00 40.39 ? 25  PRO A CA    1 
ATOM   166  C C     . PRO A 1 35  ? 49.051  58.040 -9.334  1.00 39.66 ? 25  PRO A C     1 
ATOM   167  O O     . PRO A 1 35  ? 49.185  57.978 -8.105  1.00 38.91 ? 25  PRO A O     1 
ATOM   168  C CB    . PRO A 1 35  ? 48.138  56.042 -10.613 1.00 40.65 ? 25  PRO A CB    1 
ATOM   169  C CG    . PRO A 1 35  ? 48.117  54.877 -9.675  1.00 41.31 ? 25  PRO A CG    1 
ATOM   170  C CD    . PRO A 1 35  ? 49.554  54.523 -9.451  1.00 40.87 ? 25  PRO A CD    1 
ATOM   171  N N     . VAL A 1 36  ? 48.679  59.138 -9.995  1.00 39.07 ? 26  VAL A N     1 
ATOM   172  C CA    A VAL A 1 36  ? 48.175  60.354 -9.350  0.50 39.19 ? 26  VAL A CA    1 
ATOM   173  C CA    B VAL A 1 36  ? 48.161  60.327 -9.323  0.50 39.14 ? 26  VAL A CA    1 
ATOM   174  C C     . VAL A 1 36  ? 46.655  60.424 -9.546  1.00 39.32 ? 26  VAL A C     1 
ATOM   175  O O     . VAL A 1 36  ? 46.142  60.058 -10.606 1.00 38.72 ? 26  VAL A O     1 
ATOM   176  C CB    A VAL A 1 36  ? 48.861  61.637 -9.920  0.50 39.15 ? 26  VAL A CB    1 
ATOM   177  C CB    B VAL A 1 36  ? 48.848  61.645 -9.779  0.50 39.12 ? 26  VAL A CB    1 
ATOM   178  C CG1   A VAL A 1 36  ? 48.124  62.914 -9.505  0.50 39.14 ? 26  VAL A CG1   1 
ATOM   179  C CG1   B VAL A 1 36  ? 50.119  61.892 -8.986  0.50 39.05 ? 26  VAL A CG1   1 
ATOM   180  C CG2   A VAL A 1 36  ? 50.292  61.717 -9.455  0.50 39.18 ? 26  VAL A CG2   1 
ATOM   181  C CG2   B VAL A 1 36  ? 49.118  61.648 -11.273 0.50 38.82 ? 26  VAL A CG2   1 
ATOM   182  N N     . TYR A 1 37  ? 45.947  60.894 -8.528  1.00 39.96 ? 27  TYR A N     1 
ATOM   183  C CA    . TYR A 1 37  ? 44.495  60.933 -8.573  1.00 41.30 ? 27  TYR A CA    1 
ATOM   184  C C     . TYR A 1 37  ? 44.009  62.322 -8.910  1.00 42.76 ? 27  TYR A C     1 
ATOM   185  O O     . TYR A 1 37  ? 43.143  62.484 -9.762  1.00 42.83 ? 27  TYR A O     1 
ATOM   186  C CB    . TYR A 1 37  ? 43.895  60.472 -7.244  1.00 41.21 ? 27  TYR A CB    1 
ATOM   187  C CG    . TYR A 1 37  ? 44.286  59.062 -6.843  1.00 39.49 ? 27  TYR A CG    1 
ATOM   188  C CD1   . TYR A 1 37  ? 44.131  57.996 -7.729  1.00 38.74 ? 27  TYR A CD1   1 
ATOM   189  C CD2   . TYR A 1 37  ? 44.806  58.800 -5.579  1.00 38.61 ? 27  TYR A CD2   1 
ATOM   190  C CE1   . TYR A 1 37  ? 44.477  56.707 -7.362  1.00 39.84 ? 27  TYR A CE1   1 
ATOM   191  C CE2   . TYR A 1 37  ? 45.145  57.505 -5.200  1.00 38.93 ? 27  TYR A CE2   1 
ATOM   192  C CZ    . TYR A 1 37  ? 44.992  56.474 -6.096  1.00 39.01 ? 27  TYR A CZ    1 
ATOM   193  O OH    . TYR A 1 37  ? 45.334  55.197 -5.727  1.00 38.57 ? 27  TYR A OH    1 
ATOM   194  N N     . ASP A 1 38  ? 44.571  63.316 -8.227  1.00 44.50 ? 28  ASP A N     1 
ATOM   195  C CA    . ASP A 1 38  ? 44.281  64.706 -8.506  1.00 46.60 ? 28  ASP A CA    1 
ATOM   196  C C     . ASP A 1 38  ? 45.441  65.546 -8.029  1.00 47.75 ? 28  ASP A C     1 
ATOM   197  O O     . ASP A 1 38  ? 46.510  65.019 -7.705  1.00 47.77 ? 28  ASP A O     1 
ATOM   198  C CB    . ASP A 1 38  ? 42.979  65.140 -7.822  1.00 47.23 ? 28  ASP A CB    1 
ATOM   199  C CG    . ASP A 1 38  ? 42.923  64.722 -6.377  1.00 47.80 ? 28  ASP A CG    1 
ATOM   200  O OD1   . ASP A 1 38  ? 43.661  65.315 -5.564  1.00 49.14 ? 28  ASP A OD1   1 
ATOM   201  O OD2   . ASP A 1 38  ? 42.148  63.794 -6.066  1.00 50.69 ? 28  ASP A OD2   1 
ATOM   202  N N     . LYS A 1 39  ? 45.218  66.854 -7.980  1.00 48.92 ? 29  LYS A N     1 
ATOM   203  C CA    . LYS A 1 39  ? 46.235  67.818 -7.575  1.00 49.80 ? 29  LYS A CA    1 
ATOM   204  C C     . LYS A 1 39  ? 46.738  67.532 -6.146  1.00 50.00 ? 29  LYS A C     1 
ATOM   205  O O     . LYS A 1 39  ? 47.906  67.786 -5.827  1.00 50.32 ? 29  LYS A O     1 
ATOM   206  C CB    . LYS A 1 39  ? 45.649  69.230 -7.718  1.00 50.10 ? 29  LYS A CB    1 
ATOM   207  C CG    . LYS A 1 39  ? 46.576  70.391 -7.411  1.00 51.81 ? 29  LYS A CG    1 
ATOM   208  C CD    . LYS A 1 39  ? 45.776  71.699 -7.339  1.00 53.71 ? 29  LYS A CD    1 
ATOM   209  C CE    . LYS A 1 39  ? 46.509  72.753 -6.507  1.00 55.04 ? 29  LYS A CE    1 
ATOM   210  N NZ    . LYS A 1 39  ? 45.574  73.650 -5.739  1.00 55.82 ? 29  LYS A NZ    1 
ATOM   211  N N     . HIS A 1 40  ? 45.867  66.979 -5.298  1.00 50.25 ? 30  HIS A N     1 
ATOM   212  C CA    . HIS A 1 40  ? 46.219  66.743 -3.890  1.00 50.40 ? 30  HIS A CA    1 
ATOM   213  C C     . HIS A 1 40  ? 46.147  65.277 -3.429  1.00 49.52 ? 30  HIS A C     1 
ATOM   214  O O     . HIS A 1 40  ? 46.208  65.006 -2.229  1.00 49.81 ? 30  HIS A O     1 
ATOM   215  C CB    . HIS A 1 40  ? 45.356  67.620 -2.965  1.00 50.93 ? 30  HIS A CB    1 
ATOM   216  C CG    . HIS A 1 40  ? 45.571  69.093 -3.143  1.00 52.56 ? 30  HIS A CG    1 
ATOM   217  N ND1   . HIS A 1 40  ? 46.767  69.716 -2.850  1.00 54.53 ? 30  HIS A ND1   1 
ATOM   218  C CD2   . HIS A 1 40  ? 44.731  70.071 -3.561  1.00 53.80 ? 30  HIS A CD2   1 
ATOM   219  C CE1   . HIS A 1 40  ? 46.658  71.011 -3.093  1.00 54.38 ? 30  HIS A CE1   1 
ATOM   220  N NE2   . HIS A 1 40  ? 45.433  71.252 -3.525  1.00 54.69 ? 30  HIS A NE2   1 
ATOM   221  N N     . HIS A 1 41  ? 46.019  64.340 -4.367  1.00 48.36 ? 31  HIS A N     1 
ATOM   222  C CA    . HIS A 1 41  ? 45.937  62.911 -4.024  1.00 47.18 ? 31  HIS A CA    1 
ATOM   223  C C     . HIS A 1 41  ? 46.780  62.033 -4.954  1.00 45.57 ? 31  HIS A C     1 
ATOM   224  O O     . HIS A 1 41  ? 46.666  62.126 -6.177  1.00 45.28 ? 31  HIS A O     1 
ATOM   225  C CB    . HIS A 1 41  ? 44.481  62.416 -4.052  1.00 47.56 ? 31  HIS A CB    1 
ATOM   226  C CG    . HIS A 1 41  ? 43.621  62.980 -2.964  1.00 48.93 ? 31  HIS A CG    1 
ATOM   227  N ND1   . HIS A 1 41  ? 43.507  62.389 -1.724  1.00 49.99 ? 31  HIS A ND1   1 
ATOM   228  C CD2   . HIS A 1 41  ? 42.821  64.073 -2.936  1.00 49.69 ? 31  HIS A CD2   1 
ATOM   229  C CE1   . HIS A 1 41  ? 42.690  63.103 -0.973  1.00 49.81 ? 31  HIS A CE1   1 
ATOM   230  N NE2   . HIS A 1 41  ? 42.255  64.127 -1.686  1.00 50.76 ? 31  HIS A NE2   1 
ATOM   231  N N     . ASP A 1 42  ? 47.614  61.174 -4.373  1.00 43.64 ? 32  ASP A N     1 
ATOM   232  C CA    . ASP A 1 42  ? 48.302  60.149 -5.157  1.00 42.32 ? 32  ASP A CA    1 
ATOM   233  C C     . ASP A 1 42  ? 48.351  58.781 -4.470  1.00 40.98 ? 32  ASP A C     1 
ATOM   234  O O     . ASP A 1 42  ? 48.017  58.647 -3.291  1.00 40.38 ? 32  ASP A O     1 
ATOM   235  C CB    . ASP A 1 42  ? 49.695  60.613 -5.619  1.00 42.51 ? 32  ASP A CB    1 
ATOM   236  C CG    . ASP A 1 42  ? 50.636  60.940 -4.468  1.00 44.47 ? 32  ASP A CG    1 
ATOM   237  O OD1   . ASP A 1 42  ? 50.700  60.172 -3.481  1.00 46.48 ? 32  ASP A OD1   1 
ATOM   238  O OD2   . ASP A 1 42  ? 51.346  61.964 -4.568  1.00 45.86 ? 32  ASP A OD2   1 
ATOM   239  N N     . ALA A 1 43  ? 48.758  57.775 -5.234  1.00 39.36 ? 33  ALA A N     1 
ATOM   240  C CA    . ALA A 1 43  ? 48.851  56.412 -4.738  1.00 38.46 ? 33  ALA A CA    1 
ATOM   241  C C     . ALA A 1 43  ? 49.972  56.257 -3.688  1.00 37.66 ? 33  ALA A C     1 
ATOM   242  O O     . ALA A 1 43  ? 49.839  55.473 -2.746  1.00 37.43 ? 33  ALA A O     1 
ATOM   243  C CB    . ALA A 1 43  ? 49.023  55.451 -5.890  1.00 37.95 ? 33  ALA A CB    1 
ATOM   244  N N     . ALA A 1 44  ? 51.038  57.048 -3.827  1.00 36.40 ? 34  ALA A N     1 
ATOM   245  C CA    . ALA A 1 44  ? 52.141  57.039 -2.867  1.00 35.61 ? 34  ALA A CA    1 
ATOM   246  C C     . ALA A 1 44  ? 51.637  57.345 -1.468  1.00 35.05 ? 34  ALA A C     1 
ATOM   247  O O     . ALA A 1 44  ? 51.893  56.584 -0.534  1.00 34.82 ? 34  ALA A O     1 
ATOM   248  C CB    . ALA A 1 44  ? 53.245  58.027 -3.280  1.00 35.64 ? 34  ALA A CB    1 
ATOM   249  N N     . HIS A 1 45  ? 50.894  58.445 -1.354  1.00 34.48 ? 35  HIS A N     1 
ATOM   250  C CA    A HIS A 1 45  ? 50.320  58.930 -0.090  0.50 34.14 ? 35  HIS A CA    1 
ATOM   251  C CA    B HIS A 1 45  ? 50.364  58.886 -0.075  0.50 33.88 ? 35  HIS A CA    1 
ATOM   252  C C     . HIS A 1 45  ? 49.220  58.007 0.425   1.00 33.44 ? 35  HIS A C     1 
ATOM   253  O O     . HIS A 1 45  ? 49.075  57.817 1.622   1.00 33.99 ? 35  HIS A O     1 
ATOM   254  C CB    A HIS A 1 45  ? 49.760  60.354 -0.271  0.50 34.25 ? 35  HIS A CB    1 
ATOM   255  C CB    B HIS A 1 45  ? 49.974  60.368 -0.148  0.50 33.88 ? 35  HIS A CB    1 
ATOM   256  C CG    A HIS A 1 45  ? 49.318  61.008 1.006   0.50 35.36 ? 35  HIS A CG    1 
ATOM   257  C CG    B HIS A 1 45  ? 51.157  61.281 -0.240  0.50 33.76 ? 35  HIS A CG    1 
ATOM   258  N ND1   A HIS A 1 45  ? 50.206  61.548 1.913   0.50 36.25 ? 35  HIS A ND1   1 
ATOM   259  N ND1   B HIS A 1 45  ? 51.752  61.839 0.870   0.50 33.36 ? 35  HIS A ND1   1 
ATOM   260  C CD2   A HIS A 1 45  ? 48.081  61.227 1.515   0.50 36.39 ? 35  HIS A CD2   1 
ATOM   261  C CD2   B HIS A 1 45  ? 51.886  61.693 -1.305  0.50 33.52 ? 35  HIS A CD2   1 
ATOM   262  C CE1   A HIS A 1 45  ? 49.536  62.060 2.931   0.50 36.31 ? 35  HIS A CE1   1 
ATOM   263  C CE1   B HIS A 1 45  ? 52.787  62.570 0.493   0.50 34.18 ? 35  HIS A CE1   1 
ATOM   264  N NE2   A HIS A 1 45  ? 48.245  61.882 2.713   0.50 36.66 ? 35  HIS A NE2   1 
ATOM   265  N NE2   B HIS A 1 45  ? 52.891  62.497 -0.823  0.50 33.83 ? 35  HIS A NE2   1 
ATOM   266  N N     . GLU A 1 46  ? 48.426  57.455 -0.487  1.00 32.68 ? 36  GLU A N     1 
ATOM   267  C CA    . GLU A 1 46  ? 47.422  56.450 -0.110  1.00 32.10 ? 36  GLU A CA    1 
ATOM   268  C C     . GLU A 1 46  ? 48.079  55.270 0.639   1.00 31.59 ? 36  GLU A C     1 
ATOM   269  O O     . GLU A 1 46  ? 47.564  54.809 1.664   1.00 31.75 ? 36  GLU A O     1 
ATOM   270  C CB    . GLU A 1 46  ? 46.693  55.915 -1.336  1.00 32.00 ? 36  GLU A CB    1 
ATOM   271  C CG    . GLU A 1 46  ? 45.573  54.940 -0.992  1.00 31.02 ? 36  GLU A CG    1 
ATOM   272  C CD    . GLU A 1 46  ? 44.941  54.351 -2.219  1.00 33.44 ? 36  GLU A CD    1 
ATOM   273  O OE1   . GLU A 1 46  ? 44.470  55.133 -3.070  1.00 33.20 ? 36  GLU A OE1   1 
ATOM   274  O OE2   . GLU A 1 46  ? 44.893  53.105 -2.335  1.00 32.78 ? 36  GLU A OE2   1 
ATOM   275  N N     . ILE A 1 47  ? 49.207  54.801 0.107   1.00 31.03 ? 37  ILE A N     1 
ATOM   276  C CA    . ILE A 1 47  ? 49.980  53.692 0.676   1.00 31.08 ? 37  ILE A CA    1 
ATOM   277  C C     . ILE A 1 47  ? 50.424  54.031 2.096   1.00 30.97 ? 37  ILE A C     1 
ATOM   278  O O     . ILE A 1 47  ? 50.216  53.257 3.036   1.00 31.35 ? 37  ILE A O     1 
ATOM   279  C CB    . ILE A 1 47  ? 51.193  53.327 -0.250  1.00 30.70 ? 37  ILE A CB    1 
ATOM   280  C CG1   . ILE A 1 47  ? 50.708  52.486 -1.420  1.00 31.22 ? 37  ILE A CG1   1 
ATOM   281  C CG2   . ILE A 1 47  ? 52.328  52.592 0.511   1.00 31.89 ? 37  ILE A CG2   1 
ATOM   282  C CD1   . ILE A 1 47  ? 51.577  52.529 -2.681  1.00 29.64 ? 37  ILE A CD1   1 
ATOM   283  N N     . ILE A 1 48  ? 51.017  55.207 2.256   1.00 31.01 ? 38  ILE A N     1 
ATOM   284  C CA    . ILE A 1 48  ? 51.547  55.621 3.547   1.00 30.46 ? 38  ILE A CA    1 
ATOM   285  C C     . ILE A 1 48  ? 50.431  55.778 4.587   1.00 29.97 ? 38  ILE A C     1 
ATOM   286  O O     . ILE A 1 48  ? 50.560  55.319 5.740   1.00 28.41 ? 38  ILE A O     1 
ATOM   287  C CB    . ILE A 1 48  ? 52.417  56.894 3.400   1.00 30.66 ? 38  ILE A CB    1 
ATOM   288  C CG1   . ILE A 1 48  ? 53.718  56.540 2.644   1.00 32.88 ? 38  ILE A CG1   1 
ATOM   289  C CG2   . ILE A 1 48  ? 52.730  57.478 4.757   1.00 31.86 ? 38  ILE A CG2   1 
ATOM   290  C CD1   . ILE A 1 48  ? 54.337  57.697 1.817   1.00 37.04 ? 38  ILE A CD1   1 
ATOM   291  N N     . GLU A 1 49  ? 49.318  56.376 4.164   1.00 29.06 ? 39  GLU A N     1 
ATOM   292  C CA    . GLU A 1 49  ? 48.131  56.488 5.026   1.00 29.78 ? 39  GLU A CA    1 
ATOM   293  C C     . GLU A 1 49  ? 47.463  55.169 5.330   1.00 29.05 ? 39  GLU A C     1 
ATOM   294  O O     . GLU A 1 49  ? 46.903  54.989 6.419   1.00 29.91 ? 39  GLU A O     1 
ATOM   295  C CB    . GLU A 1 49  ? 47.101  57.446 4.429   1.00 29.81 ? 39  GLU A CB    1 
ATOM   296  C CG    . GLU A 1 49  ? 47.656  58.854 4.264   1.00 32.69 ? 39  GLU A CG    1 
ATOM   297  C CD    . GLU A 1 49  ? 47.873  59.550 5.594   1.00 35.89 ? 39  GLU A CD    1 
ATOM   298  O OE1   . GLU A 1 49  ? 47.106  59.310 6.549   1.00 38.16 ? 39  GLU A OE1   1 
ATOM   299  O OE2   . GLU A 1 49  ? 48.813  60.343 5.683   1.00 40.66 ? 39  GLU A OE2   1 
ATOM   300  N N     . THR A 1 50  ? 47.496  54.250 4.373   1.00 28.38 ? 40  THR A N     1 
ATOM   301  C CA    . THR A 1 50  ? 46.961  52.923 4.614   1.00 28.10 ? 40  THR A CA    1 
ATOM   302  C C     . THR A 1 50  ? 47.778  52.232 5.724   1.00 28.49 ? 40  THR A C     1 
ATOM   303  O O     . THR A 1 50  ? 47.215  51.707 6.672   1.00 28.88 ? 40  THR A O     1 
ATOM   304  C CB    . THR A 1 50  ? 46.881  52.123 3.298   1.00 27.76 ? 40  THR A CB    1 
ATOM   305  O OG1   . THR A 1 50  ? 45.859  52.709 2.474   1.00 27.01 ? 40  THR A OG1   1 
ATOM   306  C CG2   . THR A 1 50  ? 46.574  50.627 3.550   1.00 27.39 ? 40  THR A CG2   1 
ATOM   307  N N     . ILE A 1 51  ? 49.099  52.272 5.622   1.00 29.24 ? 41  ILE A N     1 
ATOM   308  C CA    . ILE A 1 51  ? 49.953  51.727 6.694   1.00 30.33 ? 41  ILE A CA    1 
ATOM   309  C C     . ILE A 1 51  ? 49.651  52.397 8.040   1.00 30.63 ? 41  ILE A C     1 
ATOM   310  O O     . ILE A 1 51  ? 49.525  51.724 9.060   1.00 30.47 ? 41  ILE A O     1 
ATOM   311  C CB    . ILE A 1 51  ? 51.458  51.816 6.361   1.00 30.31 ? 41  ILE A CB    1 
ATOM   312  C CG1   . ILE A 1 51  ? 51.797  50.894 5.183   1.00 31.09 ? 41  ILE A CG1   1 
ATOM   313  C CG2   . ILE A 1 51  ? 52.324  51.432 7.618   1.00 29.67 ? 41  ILE A CG2   1 
ATOM   314  C CD1   . ILE A 1 51  ? 52.904  51.397 4.272   1.00 35.08 ? 41  ILE A CD1   1 
ATOM   315  N N     . ARG A 1 52  ? 49.516  53.721 8.037   1.00 31.67 ? 42  ARG A N     1 
ATOM   316  C CA    . ARG A 1 52  ? 49.201  54.462 9.266   1.00 31.91 ? 42  ARG A CA    1 
ATOM   317  C C     . ARG A 1 52  ? 47.899  54.003 9.923   1.00 31.79 ? 42  ARG A C     1 
ATOM   318  O O     . ARG A 1 52  ? 47.850  53.810 11.140  1.00 31.98 ? 42  ARG A O     1 
ATOM   319  C CB    . ARG A 1 52  ? 49.200  55.978 8.999   1.00 32.23 ? 42  ARG A CB    1 
ATOM   320  C CG    . ARG A 1 52  ? 48.191  56.757 9.799   1.00 36.01 ? 42  ARG A CG    1 
ATOM   321  C CD    . ARG A 1 52  ? 48.725  58.085 10.261  1.00 41.09 ? 42  ARG A CD    1 
ATOM   322  N NE    . ARG A 1 52  ? 47.817  59.182 9.953   1.00 42.85 ? 42  ARG A NE    1 
ATOM   323  C CZ    . ARG A 1 52  ? 46.630  59.394 10.525  1.00 44.50 ? 42  ARG A CZ    1 
ATOM   324  N NH1   . ARG A 1 52  ? 46.145  58.569 11.449  1.00 43.92 ? 42  ARG A NH1   1 
ATOM   325  N NH2   . ARG A 1 52  ? 45.915  60.446 10.151  1.00 44.86 ? 42  ARG A NH2   1 
ATOM   326  N N     . TRP A 1 53  ? 46.851  53.809 9.117   1.00 31.55 ? 43  TRP A N     1 
ATOM   327  C CA    . TRP A 1 53  ? 45.566  53.376 9.641   1.00 31.41 ? 43  TRP A CA    1 
ATOM   328  C C     . TRP A 1 53  ? 45.575  51.943 10.136  1.00 31.70 ? 43  TRP A C     1 
ATOM   329  O O     . TRP A 1 53  ? 44.930  51.620 11.138  1.00 31.34 ? 43  TRP A O     1 
ATOM   330  C CB    . TRP A 1 53  ? 44.434  53.643 8.636   1.00 31.14 ? 43  TRP A CB    1 
ATOM   331  C CG    . TRP A 1 53  ? 44.077  55.080 8.715   1.00 30.85 ? 43  TRP A CG    1 
ATOM   332  C CD1   . TRP A 1 53  ? 44.382  56.071 7.822   1.00 30.27 ? 43  TRP A CD1   1 
ATOM   333  C CD2   . TRP A 1 53  ? 43.433  55.709 9.819   1.00 30.32 ? 43  TRP A CD2   1 
ATOM   334  N NE1   . TRP A 1 53  ? 43.940  57.286 8.303   1.00 30.38 ? 43  TRP A NE1   1 
ATOM   335  C CE2   . TRP A 1 53  ? 43.346  57.083 9.526   1.00 30.93 ? 43  TRP A CE2   1 
ATOM   336  C CE3   . TRP A 1 53  ? 42.889  55.232 11.022  1.00 31.29 ? 43  TRP A CE3   1 
ATOM   337  C CZ2   . TRP A 1 53  ? 42.738  57.995 10.396  1.00 31.68 ? 43  TRP A CZ2   1 
ATOM   338  C CZ3   . TRP A 1 53  ? 42.302  56.139 11.895  1.00 32.05 ? 43  TRP A CZ3   1 
ATOM   339  C CH2   . TRP A 1 53  ? 42.238  57.503 11.577  1.00 31.48 ? 43  TRP A CH2   1 
ATOM   340  N N     . VAL A 1 54  ? 46.315  51.081 9.447   1.00 31.51 ? 44  VAL A N     1 
ATOM   341  C CA    . VAL A 1 54  ? 46.456  49.714 9.954   1.00 31.25 ? 44  VAL A CA    1 
ATOM   342  C C     . VAL A 1 54  ? 47.124  49.722 11.320  1.00 31.68 ? 44  VAL A C     1 
ATOM   343  O O     . VAL A 1 54  ? 46.661  49.039 12.225  1.00 31.95 ? 44  VAL A O     1 
ATOM   344  C CB    . VAL A 1 54  ? 47.125  48.751 8.944   1.00 30.77 ? 44  VAL A CB    1 
ATOM   345  C CG1   . VAL A 1 54  ? 47.234  47.356 9.524   1.00 30.26 ? 44  VAL A CG1   1 
ATOM   346  C CG2   . VAL A 1 54  ? 46.301  48.697 7.659   1.00 28.51 ? 44  VAL A CG2   1 
ATOM   347  N N     . CYS A 1 55  ? 48.173  50.522 11.468  1.00 32.96 ? 45  CYS A N     1 
ATOM   348  C CA    . CYS A 1 55  ? 48.853  50.698 12.747  1.00 34.67 ? 45  CYS A CA    1 
ATOM   349  C C     . CYS A 1 55  ? 47.895  51.185 13.828  1.00 35.58 ? 45  CYS A C     1 
ATOM   350  O O     . CYS A 1 55  ? 48.059  50.856 15.007  1.00 34.77 ? 45  CYS A O     1 
ATOM   351  C CB    . CYS A 1 55  ? 50.031  51.671 12.612  1.00 34.82 ? 45  CYS A CB    1 
ATOM   352  S SG    . CYS A 1 55  ? 51.462  50.983 11.724  1.00 38.08 ? 45  CYS A SG    1 
ATOM   353  N N     . GLU A 1 56  ? 46.894  51.965 13.425  1.00 36.86 ? 46  GLU A N     1 
ATOM   354  C CA    . GLU A 1 56  ? 45.855  52.375 14.363  1.00 38.82 ? 46  GLU A CA    1 
ATOM   355  C C     . GLU A 1 56  ? 45.010  51.186 14.807  1.00 39.62 ? 46  GLU A C     1 
ATOM   356  O O     . GLU A 1 56  ? 44.745  51.032 15.997  1.00 39.92 ? 46  GLU A O     1 
ATOM   357  C CB    . GLU A 1 56  ? 44.995  53.512 13.785  1.00 39.11 ? 46  GLU A CB    1 
ATOM   358  C CG    . GLU A 1 56  ? 45.746  54.831 13.660  1.00 40.54 ? 46  GLU A CG    1 
ATOM   359  C CD    . GLU A 1 56  ? 46.333  55.335 14.987  1.00 44.86 ? 46  GLU A CD    1 
ATOM   360  O OE1   . GLU A 1 56  ? 45.648  55.249 16.043  1.00 44.94 ? 46  GLU A OE1   1 
ATOM   361  O OE2   . GLU A 1 56  ? 47.485  55.835 14.969  1.00 45.70 ? 46  GLU A OE2   1 
ATOM   362  N N     . GLU A 1 57  ? 44.629  50.334 13.854  1.00 40.58 ? 47  GLU A N     1 
ATOM   363  C CA    . GLU A 1 57  ? 43.834  49.132 14.122  1.00 41.88 ? 47  GLU A CA    1 
ATOM   364  C C     . GLU A 1 57  ? 44.505  48.127 15.049  1.00 42.62 ? 47  GLU A C     1 
ATOM   365  O O     . GLU A 1 57  ? 43.833  47.413 15.785  1.00 43.51 ? 47  GLU A O     1 
ATOM   366  C CB    . GLU A 1 57  ? 43.550  48.386 12.817  1.00 42.11 ? 47  GLU A CB    1 
ATOM   367  C CG    . GLU A 1 57  ? 42.596  49.042 11.862  1.00 41.55 ? 47  GLU A CG    1 
ATOM   368  C CD    . GLU A 1 57  ? 42.230  48.092 10.736  1.00 44.25 ? 47  GLU A CD    1 
ATOM   369  O OE1   . GLU A 1 57  ? 43.108  47.768 9.898   1.00 42.36 ? 47  GLU A OE1   1 
ATOM   370  O OE2   . GLU A 1 57  ? 41.067  47.652 10.699  1.00 44.21 ? 47  GLU A OE2   1 
ATOM   371  N N     . ILE A 1 58  ? 45.824  48.020 14.955  1.00 43.44 ? 48  ILE A N     1 
ATOM   372  C CA    . ILE A 1 58  ? 46.562  47.009 15.700  1.00 44.06 ? 48  ILE A CA    1 
ATOM   373  C C     . ILE A 1 58  ? 47.733  47.677 16.419  1.00 44.42 ? 48  ILE A C     1 
ATOM   374  O O     . ILE A 1 58  ? 48.745  47.999 15.797  1.00 44.41 ? 48  ILE A O     1 
ATOM   375  C CB    . ILE A 1 58  ? 47.061  45.847 14.766  1.00 44.07 ? 48  ILE A CB    1 
ATOM   376  C CG1   . ILE A 1 58  ? 45.894  45.221 13.987  1.00 43.60 ? 48  ILE A CG1   1 
ATOM   377  C CG2   . ILE A 1 58  ? 47.763  44.773 15.581  1.00 44.56 ? 48  ILE A CG2   1 
ATOM   378  C CD1   . ILE A 1 58  ? 46.306  44.367 12.782  1.00 45.23 ? 48  ILE A CD1   1 
ATOM   379  N N     . PRO A 1 59  ? 47.591  47.905 17.736  1.00 45.10 ? 49  PRO A N     1 
ATOM   380  C CA    . PRO A 1 59  ? 48.644  48.517 18.560  1.00 45.56 ? 49  PRO A CA    1 
ATOM   381  C C     . PRO A 1 59  ? 50.015  47.827 18.432  1.00 45.40 ? 49  PRO A C     1 
ATOM   382  O O     . PRO A 1 59  ? 51.039  48.501 18.325  1.00 45.52 ? 49  PRO A O     1 
ATOM   383  C CB    . PRO A 1 59  ? 48.089  48.367 19.981  1.00 45.85 ? 49  PRO A CB    1 
ATOM   384  C CG    . PRO A 1 59  ? 46.606  48.436 19.790  1.00 46.02 ? 49  PRO A CG    1 
ATOM   385  C CD    . PRO A 1 59  ? 46.364  47.663 18.515  1.00 45.56 ? 49  PRO A CD    1 
ATOM   386  N N     . ASP A 1 60  ? 50.022  46.495 18.427  1.00 45.71 ? 50  ASP A N     1 
ATOM   387  C CA    . ASP A 1 60  ? 51.249  45.723 18.225  1.00 45.54 ? 50  ASP A CA    1 
ATOM   388  C C     . ASP A 1 60  ? 51.987  46.149 16.965  1.00 45.16 ? 50  ASP A C     1 
ATOM   389  O O     . ASP A 1 60  ? 53.198  46.363 16.995  1.00 44.63 ? 50  ASP A O     1 
ATOM   390  C CB    . ASP A 1 60  ? 50.941  44.225 18.195  1.00 46.13 ? 50  ASP A CB    1 
ATOM   391  C CG    . ASP A 1 60  ? 50.573  43.678 19.564  1.00 46.94 ? 50  ASP A CG    1 
ATOM   392  O OD1   . ASP A 1 60  ? 51.247  44.041 20.553  1.00 49.51 ? 50  ASP A OD1   1 
ATOM   393  O OD2   . ASP A 1 60  ? 49.621  42.880 19.658  1.00 48.70 ? 50  ASP A OD2   1 
ATOM   394  N N     . LEU A 1 61  ? 51.242  46.306 15.873  1.00 45.23 ? 51  LEU A N     1 
ATOM   395  C CA    . LEU A 1 61  ? 51.816  46.751 14.611  1.00 45.76 ? 51  LEU A CA    1 
ATOM   396  C C     . LEU A 1 61  ? 52.415  48.150 14.734  1.00 46.22 ? 51  LEU A C     1 
ATOM   397  O O     . LEU A 1 61  ? 53.520  48.401 14.242  1.00 46.07 ? 51  LEU A O     1 
ATOM   398  C CB    . LEU A 1 61  ? 50.788  46.662 13.473  1.00 45.47 ? 51  LEU A CB    1 
ATOM   399  C CG    . LEU A 1 61  ? 51.205  47.163 12.086  1.00 45.97 ? 51  LEU A CG    1 
ATOM   400  C CD1   . LEU A 1 61  ? 52.360  46.364 11.470  1.00 44.19 ? 51  LEU A CD1   1 
ATOM   401  C CD2   . LEU A 1 61  ? 50.015  47.160 11.164  1.00 45.25 ? 51  LEU A CD2   1 
ATOM   402  N N     . LYS A 1 62  ? 51.700  49.044 15.421  1.00 46.78 ? 52  LYS A N     1 
ATOM   403  C CA    . LYS A 1 62  ? 52.184  50.400 15.641  1.00 47.52 ? 52  LYS A CA    1 
ATOM   404  C C     . LYS A 1 62  ? 53.509  50.346 16.387  1.00 47.74 ? 52  LYS A C     1 
ATOM   405  O O     . LYS A 1 62  ? 54.450  51.046 16.024  1.00 48.07 ? 52  LYS A O     1 
ATOM   406  C CB    . LYS A 1 62  ? 51.156  51.226 16.421  1.00 47.66 ? 52  LYS A CB    1 
ATOM   407  C CG    . LYS A 1 62  ? 51.385  52.725 16.361  1.00 47.80 ? 52  LYS A CG    1 
ATOM   408  C CD    . LYS A 1 62  ? 50.162  53.484 16.883  1.00 47.53 ? 52  LYS A CD    1 
ATOM   409  C CE    . LYS A 1 62  ? 50.350  54.986 16.755  1.00 47.31 ? 52  LYS A CE    1 
ATOM   410  N NZ    . LYS A 1 62  ? 49.349  55.733 17.579  1.00 49.50 ? 52  LYS A NZ    1 
ATOM   411  N N     . LEU A 1 63  ? 53.573  49.498 17.413  1.00 48.40 ? 53  LEU A N     1 
ATOM   412  C CA    . LEU A 1 63  ? 54.819  49.244 18.138  1.00 49.09 ? 53  LEU A CA    1 
ATOM   413  C C     . LEU A 1 63  ? 55.938  48.905 17.182  1.00 49.16 ? 53  LEU A C     1 
ATOM   414  O O     . LEU A 1 63  ? 56.929  49.621 17.110  1.00 49.48 ? 53  LEU A O     1 
ATOM   415  C CB    . LEU A 1 63  ? 54.665  48.104 19.148  1.00 49.28 ? 53  LEU A CB    1 
ATOM   416  C CG    . LEU A 1 63  ? 54.193  48.420 20.564  1.00 49.60 ? 53  LEU A CG    1 
ATOM   417  C CD1   . LEU A 1 63  ? 54.069  47.137 21.355  1.00 48.89 ? 53  LEU A CD1   1 
ATOM   418  C CD2   . LEU A 1 63  ? 55.141  49.387 21.271  1.00 49.76 ? 53  LEU A CD2   1 
ATOM   419  N N     . ALA A 1 64  ? 55.773  47.817 16.437  1.00 49.46 ? 54  ALA A N     1 
ATOM   420  C CA    . ALA A 1 64  ? 56.783  47.399 15.478  1.00 49.64 ? 54  ALA A CA    1 
ATOM   421  C C     . ALA A 1 64  ? 57.144  48.533 14.508  1.00 49.95 ? 54  ALA A C     1 
ATOM   422  O O     . ALA A 1 64  ? 58.309  48.718 14.171  1.00 49.29 ? 54  ALA A O     1 
ATOM   423  C CB    . ALA A 1 64  ? 56.316  46.151 14.724  1.00 49.72 ? 54  ALA A CB    1 
ATOM   424  N N     . MET A 1 65  ? 56.147  49.308 14.078  1.00 50.57 ? 55  MET A N     1 
ATOM   425  C CA    . MET A 1 65  ? 56.413  50.405 13.149  1.00 51.58 ? 55  MET A CA    1 
ATOM   426  C C     . MET A 1 65  ? 57.037  51.601 13.868  1.00 52.96 ? 55  MET A C     1 
ATOM   427  O O     . MET A 1 65  ? 57.743  52.391 13.240  1.00 53.27 ? 55  MET A O     1 
ATOM   428  C CB    . MET A 1 65  ? 55.160  50.808 12.357  1.00 50.99 ? 55  MET A CB    1 
ATOM   429  C CG    . MET A 1 65  ? 54.609  49.728 11.390  1.00 49.61 ? 55  MET A CG    1 
ATOM   430  S SD    . MET A 1 65  ? 55.696  49.149 10.058  1.00 46.39 ? 55  MET A SD    1 
ATOM   431  C CE    . MET A 1 65  ? 56.110  50.661 9.182   1.00 45.62 ? 55  MET A CE    1 
ATOM   432  N N     . GLU A 1 66  ? 56.766  51.723 15.174  1.00 54.65 ? 56  GLU A N     1 
ATOM   433  C CA    . GLU A 1 66  ? 57.416  52.708 16.050  1.00 56.23 ? 56  GLU A CA    1 
ATOM   434  C C     . GLU A 1 66  ? 58.914  52.415 15.951  1.00 57.26 ? 56  GLU A C     1 
ATOM   435  O O     . GLU A 1 66  ? 59.711  53.273 15.540  1.00 57.14 ? 56  GLU A O     1 
ATOM   436  C CB    . GLU A 1 66  ? 56.946  52.525 17.506  1.00 56.42 ? 56  GLU A CB    1 
ATOM   437  C CG    . GLU A 1 66  ? 56.399  53.765 18.231  1.00 57.51 ? 56  GLU A CG    1 
ATOM   438  C CD    . GLU A 1 66  ? 54.896  53.666 18.559  1.00 59.22 ? 56  GLU A CD    1 
ATOM   439  O OE1   . GLU A 1 66  ? 54.467  52.636 19.136  1.00 59.18 ? 56  GLU A OE1   1 
ATOM   440  O OE2   . GLU A 1 66  ? 54.146  54.629 18.262  1.00 58.39 ? 56  GLU A OE2   1 
ATOM   441  N N     . ASN A 1 67  ? 59.265  51.168 16.285  1.00 58.38 ? 57  ASN A N     1 
ATOM   442  C CA    . ASN A 1 67  ? 60.626  50.646 16.188  1.00 59.15 ? 57  ASN A CA    1 
ATOM   443  C C     . ASN A 1 67  ? 61.093  50.497 14.741  1.00 59.74 ? 57  ASN A C     1 
ATOM   444  O O     . ASN A 1 67  ? 60.433  49.829 13.941  1.00 60.01 ? 57  ASN A O     1 
ATOM   445  C CB    . ASN A 1 67  ? 60.719  49.295 16.905  1.00 59.13 ? 57  ASN A CB    1 
ATOM   446  N N     . TYR A 1 68  ? 62.231  51.124 14.430  1.00 60.03 ? 58  TYR A N     1 
ATOM   447  C CA    . TYR A 1 68  ? 62.853  51.129 13.094  1.00 60.19 ? 58  TYR A CA    1 
ATOM   448  C C     . TYR A 1 68  ? 61.882  51.029 11.905  1.00 60.19 ? 58  TYR A C     1 
ATOM   449  O O     . TYR A 1 68  ? 61.459  49.935 11.504  1.00 60.44 ? 58  TYR A O     1 
ATOM   450  C CB    . TYR A 1 68  ? 63.972  50.084 13.001  1.00 60.21 ? 58  TYR A CB    1 
ATOM   451  N N     . LEU A 1 70  ? 60.344  54.021 11.592  1.00 64.01 ? 60  LEU A N     1 
ATOM   452  C CA    . LEU A 1 70  ? 60.312  55.356 11.000  1.00 64.19 ? 60  LEU A CA    1 
ATOM   453  C C     . LEU A 1 70  ? 61.503  55.567 10.074  1.00 64.24 ? 60  LEU A C     1 
ATOM   454  O O     . LEU A 1 70  ? 62.615  55.126 10.379  1.00 64.08 ? 60  LEU A O     1 
ATOM   455  C CB    . LEU A 1 70  ? 60.298  56.427 12.092  1.00 63.98 ? 60  LEU A CB    1 
ATOM   456  N N     . ILE A 1 71  ? 61.257  56.237 8.947   1.00 64.54 ? 61  ILE A N     1 
ATOM   457  C CA    . ILE A 1 71  ? 62.288  56.514 7.932   1.00 64.98 ? 61  ILE A CA    1 
ATOM   458  C C     . ILE A 1 71  ? 61.848  57.592 6.933   1.00 65.11 ? 61  ILE A C     1 
ATOM   459  O O     . ILE A 1 71  ? 60.651  57.784 6.695   1.00 65.42 ? 61  ILE A O     1 
ATOM   460  C CB    . ILE A 1 71  ? 62.689  55.238 7.146   1.00 64.88 ? 61  ILE A CB    1 
ATOM   461  N N     . ASP A 1 72  ? 62.826  58.291 6.357   1.00 65.30 ? 62  ASP A N     1 
ATOM   462  C CA    . ASP A 1 72  ? 62.568  59.309 5.341   1.00 65.36 ? 62  ASP A CA    1 
ATOM   463  C C     . ASP A 1 72  ? 62.060  58.644 4.067   1.00 65.37 ? 62  ASP A C     1 
ATOM   464  O O     . ASP A 1 72  ? 62.845  58.172 3.232   1.00 65.48 ? 62  ASP A O     1 
ATOM   465  C CB    . ASP A 1 72  ? 63.831  60.129 5.055   1.00 65.29 ? 62  ASP A CB    1 
ATOM   466  N N     . TYR A 1 73  ? 60.739  58.577 3.940   1.00 65.18 ? 63  TYR A N     1 
ATOM   467  C CA    . TYR A 1 73  ? 60.121  58.007 2.748   1.00 65.14 ? 63  TYR A CA    1 
ATOM   468  C C     . TYR A 1 73  ? 60.268  58.987 1.589   1.00 64.97 ? 63  TYR A C     1 
ATOM   469  O O     . TYR A 1 73  ? 59.846  60.143 1.683   1.00 64.94 ? 63  TYR A O     1 
ATOM   470  C CB    . TYR A 1 73  ? 58.643  57.677 2.994   1.00 65.04 ? 63  TYR A CB    1 
ATOM   471  N N     . ASP A 1 74  ? 60.902  58.528 0.517   1.00 64.71 ? 64  ASP A N     1 
ATOM   472  C CA    . ASP A 1 74  ? 60.919  59.284 -0.723  1.00 64.54 ? 64  ASP A CA    1 
ATOM   473  C C     . ASP A 1 74  ? 59.839  58.722 -1.640  1.00 64.30 ? 64  ASP A C     1 
ATOM   474  O O     . ASP A 1 74  ? 60.043  57.690 -2.292  1.00 64.02 ? 64  ASP A O     1 
ATOM   475  C CB    . ASP A 1 74  ? 62.293  59.220 -1.402  1.00 64.68 ? 64  ASP A CB    1 
ATOM   476  C CG    . ASP A 1 74  ? 62.423  60.213 -2.544  1.00 65.02 ? 64  ASP A CG    1 
ATOM   477  O OD1   . ASP A 1 74  ? 61.722  61.252 -2.521  1.00 65.67 ? 64  ASP A OD1   1 
ATOM   478  O OD2   . ASP A 1 74  ? 63.228  59.963 -3.463  1.00 64.80 ? 64  ASP A OD2   1 
ATOM   479  N N     . THR A 1 75  ? 58.691  59.402 -1.674  1.00 64.02 ? 65  THR A N     1 
ATOM   480  C CA    . THR A 1 75  ? 57.535  58.968 -2.471  1.00 63.85 ? 65  THR A CA    1 
ATOM   481  C C     . THR A 1 75  ? 57.874  59.009 -3.953  1.00 63.80 ? 65  THR A C     1 
ATOM   482  O O     . THR A 1 75  ? 57.078  58.601 -4.800  1.00 64.01 ? 65  THR A O     1 
ATOM   483  C CB    . THR A 1 75  ? 56.285  59.855 -2.221  1.00 63.91 ? 65  THR A CB    1 
ATOM   484  O OG1   . THR A 1 75  ? 56.449  61.121 -2.877  1.00 63.64 ? 65  THR A OG1   1 
ATOM   485  C CG2   . THR A 1 75  ? 56.036  60.064 -0.719  1.00 63.55 ? 65  THR A CG2   1 
ATOM   486  N N     . LYS A 1 76  ? 59.067  59.519 -4.241  1.00 63.62 ? 66  LYS A N     1 
ATOM   487  C CA    . LYS A 1 76  ? 59.599  59.609 -5.586  1.00 63.56 ? 66  LYS A CA    1 
ATOM   488  C C     . LYS A 1 76  ? 60.320  58.314 -5.936  1.00 63.24 ? 66  LYS A C     1 
ATOM   489  O O     . LYS A 1 76  ? 60.289  57.875 -7.085  1.00 63.42 ? 66  LYS A O     1 
ATOM   490  C CB    . LYS A 1 76  ? 60.577  60.789 -5.694  1.00 63.71 ? 66  LYS A CB    1 
ATOM   491  C CG    . LYS A 1 76  ? 60.099  62.106 -5.058  1.00 64.26 ? 66  LYS A CG    1 
ATOM   492  C CD    . LYS A 1 76  ? 59.241  62.937 -6.007  1.00 65.33 ? 66  LYS A CD    1 
ATOM   493  C CE    . LYS A 1 76  ? 58.980  64.335 -5.447  1.00 65.71 ? 66  LYS A CE    1 
ATOM   494  N NZ    . LYS A 1 76  ? 58.690  65.307 -6.546  1.00 65.90 ? 66  LYS A NZ    1 
ATOM   495  N N     . SER A 1 77  ? 60.947  57.698 -4.933  1.00 62.68 ? 67  SER A N     1 
ATOM   496  C CA    . SER A 1 77  ? 61.846  56.559 -5.140  1.00 62.30 ? 67  SER A CA    1 
ATOM   497  C C     . SER A 1 77  ? 61.189  55.195 -4.926  1.00 61.76 ? 67  SER A C     1 
ATOM   498  O O     . SER A 1 77  ? 60.616  54.932 -3.860  1.00 61.51 ? 67  SER A O     1 
ATOM   499  C CB    . SER A 1 77  ? 63.082  56.695 -4.239  1.00 62.29 ? 67  SER A CB    1 
ATOM   500  O OG    . SER A 1 77  ? 63.925  55.557 -4.346  1.00 63.02 ? 67  SER A OG    1 
ATOM   501  N N     . PHE A 1 78  ? 61.304  54.327 -5.936  1.00 61.09 ? 68  PHE A N     1 
ATOM   502  C CA    . PHE A 1 78  ? 60.760  52.970 -5.869  1.00 60.56 ? 68  PHE A CA    1 
ATOM   503  C C     . PHE A 1 78  ? 61.403  52.176 -4.745  1.00 60.10 ? 68  PHE A C     1 
ATOM   504  O O     . PHE A 1 78  ? 60.697  51.609 -3.908  1.00 59.64 ? 68  PHE A O     1 
ATOM   505  C CB    . PHE A 1 78  ? 60.921  52.218 -7.197  1.00 60.63 ? 68  PHE A CB    1 
ATOM   506  C CG    . PHE A 1 78  ? 60.443  50.786 -7.141  1.00 61.48 ? 68  PHE A CG    1 
ATOM   507  C CD1   . PHE A 1 78  ? 59.105  50.471 -7.374  1.00 62.21 ? 68  PHE A CD1   1 
ATOM   508  C CD2   . PHE A 1 78  ? 61.328  49.752 -6.843  1.00 62.33 ? 68  PHE A CD2   1 
ATOM   509  C CE1   . PHE A 1 78  ? 58.649  49.147 -7.318  1.00 62.42 ? 68  PHE A CE1   1 
ATOM   510  C CE2   . PHE A 1 78  ? 60.889  48.429 -6.786  1.00 62.89 ? 68  PHE A CE2   1 
ATOM   511  C CZ    . PHE A 1 78  ? 59.540  48.127 -7.021  1.00 63.32 ? 68  PHE A CZ    1 
ATOM   512  N N     . GLU A 1 79  ? 62.739  52.141 -4.740  1.00 59.46 ? 69  GLU A N     1 
ATOM   513  C CA    . GLU A 1 79  ? 63.505  51.470 -3.689  1.00 59.01 ? 69  GLU A CA    1 
ATOM   514  C C     . GLU A 1 79  ? 62.983  51.880 -2.325  1.00 58.00 ? 69  GLU A C     1 
ATOM   515  O O     . GLU A 1 79  ? 62.723  51.025 -1.474  1.00 58.02 ? 69  GLU A O     1 
ATOM   516  C CB    . GLU A 1 79  ? 65.001  51.808 -3.790  1.00 59.46 ? 69  GLU A CB    1 
ATOM   517  C CG    . GLU A 1 79  ? 65.812  50.870 -4.685  1.00 61.22 ? 69  GLU A CG    1 
ATOM   518  C CD    . GLU A 1 79  ? 67.310  51.153 -4.626  1.00 63.82 ? 69  GLU A CD    1 
ATOM   519  O OE1   . GLU A 1 79  ? 67.911  51.390 -5.697  1.00 64.96 ? 69  GLU A OE1   1 
ATOM   520  O OE2   . GLU A 1 79  ? 67.887  51.154 -3.512  1.00 65.17 ? 69  GLU A OE2   1 
ATOM   521  N N     . SER A 1 80  ? 62.811  53.189 -2.144  1.00 56.68 ? 70  SER A N     1 
ATOM   522  C CA    . SER A 1 80  ? 62.357  53.765 -0.884  1.00 55.81 ? 70  SER A CA    1 
ATOM   523  C C     . SER A 1 80  ? 60.941  53.296 -0.534  1.00 55.06 ? 70  SER A C     1 
ATOM   524  O O     . SER A 1 80  ? 60.650  52.988 0.627   1.00 54.74 ? 70  SER A O     1 
ATOM   525  C CB    . SER A 1 80  ? 62.419  55.291 -0.954  1.00 55.88 ? 70  SER A CB    1 
ATOM   526  O OG    . SER A 1 80  ? 62.310  55.891 0.329   1.00 56.94 ? 70  SER A OG    1 
ATOM   527  N N     . MET A 1 81  ? 60.071  53.234 -1.543  1.00 54.01 ? 71  MET A N     1 
ATOM   528  C CA    . MET A 1 81  ? 58.679  52.828 -1.325  1.00 52.86 ? 71  MET A CA    1 
ATOM   529  C C     . MET A 1 81  ? 58.570  51.313 -1.090  1.00 52.31 ? 71  MET A C     1 
ATOM   530  O O     . MET A 1 81  ? 57.843  50.874 -0.190  1.00 51.99 ? 71  MET A O     1 
ATOM   531  C CB    . MET A 1 81  ? 57.767  53.309 -2.462  1.00 52.55 ? 71  MET A CB    1 
ATOM   532  C CG    . MET A 1 81  ? 57.546  54.829 -2.495  1.00 50.77 ? 71  MET A CG    1 
ATOM   533  S SD    . MET A 1 81  ? 56.857  55.516 -0.970  1.00 49.53 ? 71  MET A SD    1 
ATOM   534  C CE    . MET A 1 81  ? 55.158  54.940 -1.104  1.00 48.15 ? 71  MET A CE    1 
ATOM   535  N N     . GLN A 1 82  ? 59.314  50.535 -1.879  1.00 51.73 ? 72  GLN A N     1 
ATOM   536  C CA    . GLN A 1 82  ? 59.447  49.094 -1.666  1.00 51.39 ? 72  GLN A CA    1 
ATOM   537  C C     . GLN A 1 82  ? 59.989  48.777 -0.274  1.00 50.98 ? 72  GLN A C     1 
ATOM   538  O O     . GLN A 1 82  ? 59.512  47.856 0.389   1.00 50.97 ? 72  GLN A O     1 
ATOM   539  C CB    . GLN A 1 82  ? 60.341  48.472 -2.731  1.00 51.47 ? 72  GLN A CB    1 
ATOM   540  C CG    . GLN A 1 82  ? 60.659  47.004 -2.489  1.00 51.70 ? 72  GLN A CG    1 
ATOM   541  C CD    . GLN A 1 82  ? 61.260  46.337 -3.706  1.00 51.62 ? 72  GLN A CD    1 
ATOM   542  O OE1   . GLN A 1 82  ? 62.287  46.774 -4.222  1.00 51.58 ? 72  GLN A OE1   1 
ATOM   543  N NE2   . GLN A 1 82  ? 60.625  45.266 -4.169  1.00 50.74 ? 72  GLN A NE2   1 
ATOM   544  N N     . ARG A 1 83  ? 60.984  49.551 0.155   1.00 50.47 ? 73  ARG A N     1 
ATOM   545  C CA    . ARG A 1 83  ? 61.555  49.435 1.491   1.00 49.30 ? 73  ARG A CA    1 
ATOM   546  C C     . ARG A 1 83  ? 60.497  49.618 2.591   1.00 48.03 ? 73  ARG A C     1 
ATOM   547  O O     . ARG A 1 83  ? 60.413  48.791 3.500   1.00 48.11 ? 73  ARG A O     1 
ATOM   548  C CB    . ARG A 1 83  ? 62.705  50.438 1.657   1.00 50.19 ? 73  ARG A CB    1 
ATOM   549  C CG    . ARG A 1 83  ? 63.580  50.230 2.880   1.00 51.24 ? 73  ARG A CG    1 
ATOM   550  C CD    . ARG A 1 83  ? 64.720  51.254 2.955   1.00 54.90 ? 73  ARG A CD    1 
ATOM   551  N NE    . ARG A 1 83  ? 65.288  51.270 4.301   1.00 56.98 ? 73  ARG A NE    1 
ATOM   552  C CZ    . ARG A 1 83  ? 66.453  51.808 4.654   1.00 58.74 ? 73  ARG A CZ    1 
ATOM   553  N NH1   . ARG A 1 83  ? 67.245  52.412 3.768   1.00 58.95 ? 73  ARG A NH1   1 
ATOM   554  N NH2   . ARG A 1 83  ? 66.824  51.734 5.927   1.00 59.91 ? 73  ARG A NH2   1 
ATOM   555  N N     . LEU A 1 84  ? 59.700  50.690 2.509   1.00 46.00 ? 74  LEU A N     1 
ATOM   556  C CA    . LEU A 1 84  ? 58.658  50.971 3.511   1.00 44.17 ? 74  LEU A CA    1 
ATOM   557  C C     . LEU A 1 84  ? 57.556  49.895 3.527   1.00 42.81 ? 74  LEU A C     1 
ATOM   558  O O     . LEU A 1 84  ? 57.083  49.508 4.593   1.00 43.06 ? 74  LEU A O     1 
ATOM   559  C CB    . LEU A 1 84  ? 58.050  52.374 3.315   1.00 44.07 ? 74  LEU A CB    1 
ATOM   560  C CG    . LEU A 1 84  ? 56.720  52.677 4.035   1.00 43.74 ? 74  LEU A CG    1 
ATOM   561  C CD1   . LEU A 1 84  ? 56.928  53.058 5.499   1.00 41.03 ? 74  LEU A CD1   1 
ATOM   562  C CD2   . LEU A 1 84  ? 55.933  53.768 3.305   1.00 44.27 ? 74  LEU A CD2   1 
ATOM   563  N N     . CYS A 1 85  ? 57.180  49.420 2.345   1.00 41.10 ? 75  CYS A N     1 
ATOM   564  C CA    . CYS A 1 85  ? 56.167  48.382 2.177   1.00 40.15 ? 75  CYS A CA    1 
ATOM   565  C C     . CYS A 1 85  ? 56.640  47.071 2.823   1.00 39.90 ? 75  CYS A C     1 
ATOM   566  O O     . CYS A 1 85  ? 55.849  46.355 3.444   1.00 38.88 ? 75  CYS A O     1 
ATOM   567  C CB    . CYS A 1 85  ? 55.878  48.156 0.688   1.00 39.98 ? 75  CYS A CB    1 
ATOM   568  S SG    . CYS A 1 85  ? 54.818  49.412 -0.141  1.00 40.63 ? 75  CYS A SG    1 
ATOM   569  N N     . ASP A 1 86  ? 57.939  46.787 2.660   1.00 39.02 ? 76  ASP A N     1 
ATOM   570  C CA    . ASP A 1 86  ? 58.599  45.625 3.250   1.00 38.63 ? 76  ASP A CA    1 
ATOM   571  C C     . ASP A 1 86  ? 58.548  45.660 4.756   1.00 37.56 ? 76  ASP A C     1 
ATOM   572  O O     . ASP A 1 86  ? 58.192  44.670 5.375   1.00 37.38 ? 76  ASP A O     1 
ATOM   573  C CB    . ASP A 1 86  ? 60.055  45.545 2.784   1.00 39.49 ? 76  ASP A CB    1 
ATOM   574  C CG    . ASP A 1 86  ? 60.178  45.106 1.359   1.00 41.19 ? 76  ASP A CG    1 
ATOM   575  O OD1   . ASP A 1 86  ? 59.238  44.465 0.860   1.00 46.07 ? 76  ASP A OD1   1 
ATOM   576  O OD2   . ASP A 1 86  ? 61.210  45.404 0.721   1.00 46.04 ? 76  ASP A OD2   1 
ATOM   577  N N     . LYS A 1 87  ? 58.879  46.814 5.340   1.00 37.06 ? 77  LYS A N     1 
ATOM   578  C CA    . LYS A 1 87  ? 58.853  46.982 6.795   1.00 36.38 ? 77  LYS A CA    1 
ATOM   579  C C     . LYS A 1 87  ? 57.469  46.690 7.368   1.00 35.53 ? 77  LYS A C     1 
ATOM   580  O O     . LYS A 1 87  ? 57.346  46.049 8.429   1.00 35.63 ? 77  LYS A O     1 
ATOM   581  C CB    . LYS A 1 87  ? 59.355  48.375 7.234   1.00 36.75 ? 77  LYS A CB    1 
ATOM   582  C CG    . LYS A 1 87  ? 60.763  48.734 6.729   1.00 39.84 ? 77  LYS A CG    1 
ATOM   583  C CD    . LYS A 1 87  ? 61.465  49.802 7.577   1.00 43.49 ? 77  LYS A CD    1 
ATOM   584  C CE    . LYS A 1 87  ? 62.866  50.161 6.997   1.00 45.10 ? 77  LYS A CE    1 
ATOM   585  N NZ    . LYS A 1 87  ? 63.799  48.978 6.933   1.00 48.32 ? 77  LYS A NZ    1 
ATOM   586  N N     . TYR A 1 88  ? 56.437  47.159 6.663   1.00 33.81 ? 78  TYR A N     1 
ATOM   587  C CA    . TYR A 1 88  ? 55.044  46.901 7.025   1.00 31.64 ? 78  TYR A CA    1 
ATOM   588  C C     . TYR A 1 88  ? 54.673  45.428 6.869   1.00 31.31 ? 78  TYR A C     1 
ATOM   589  O O     . TYR A 1 88  ? 54.095  44.819 7.775   1.00 29.94 ? 78  TYR A O     1 
ATOM   590  C CB    . TYR A 1 88  ? 54.089  47.773 6.195   1.00 30.46 ? 78  TYR A CB    1 
ATOM   591  C CG    . TYR A 1 88  ? 52.642  47.314 6.255   1.00 29.47 ? 78  TYR A CG    1 
ATOM   592  C CD1   . TYR A 1 88  ? 51.823  47.669 7.325   1.00 26.77 ? 78  TYR A CD1   1 
ATOM   593  C CD2   . TYR A 1 88  ? 52.091  46.542 5.233   1.00 27.71 ? 78  TYR A CD2   1 
ATOM   594  C CE1   . TYR A 1 88  ? 50.493  47.235 7.395   1.00 27.18 ? 78  TYR A CE1   1 
ATOM   595  C CE2   . TYR A 1 88  ? 50.770  46.110 5.287   1.00 28.46 ? 78  TYR A CE2   1 
ATOM   596  C CZ    . TYR A 1 88  ? 49.976  46.458 6.375   1.00 26.97 ? 78  TYR A CZ    1 
ATOM   597  O OH    . TYR A 1 88  ? 48.665  46.032 6.444   1.00 28.62 ? 78  TYR A OH    1 
ATOM   598  N N     . ASN A 1 89  ? 54.994  44.870 5.708   1.00 31.26 ? 79  ASN A N     1 
ATOM   599  C CA    . ASN A 1 89  ? 54.691  43.468 5.428   1.00 31.76 ? 79  ASN A CA    1 
ATOM   600  C C     . ASN A 1 89  ? 55.365  42.477 6.382   1.00 31.91 ? 79  ASN A C     1 
ATOM   601  O O     . ASN A 1 89  ? 54.750  41.491 6.776   1.00 31.84 ? 79  ASN A O     1 
ATOM   602  C CB    . ASN A 1 89  ? 55.022  43.136 3.976   1.00 32.01 ? 79  ASN A CB    1 
ATOM   603  C CG    . ASN A 1 89  ? 54.046  43.750 3.017   1.00 32.57 ? 79  ASN A CG    1 
ATOM   604  O OD1   . ASN A 1 89  ? 52.883  44.001 3.367   1.00 37.27 ? 79  ASN A OD1   1 
ATOM   605  N ND2   . ASN A 1 89  ? 54.497  44.003 1.799   1.00 32.96 ? 79  ASN A ND2   1 
ATOM   606  N N     . ARG A 1 90  ? 56.616  42.755 6.748   1.00 32.11 ? 80  ARG A N     1 
ATOM   607  C CA    . ARG A 1 90  ? 57.347  41.968 7.761   1.00 32.34 ? 80  ARG A CA    1 
ATOM   608  C C     . ARG A 1 90  ? 56.704  42.093 9.132   1.00 32.02 ? 80  ARG A C     1 
ATOM   609  O O     . ARG A 1 90  ? 56.543  41.099 9.853   1.00 31.76 ? 80  ARG A O     1 
ATOM   610  C CB    . ARG A 1 90  ? 58.833  42.396 7.829   1.00 32.43 ? 80  ARG A CB    1 
ATOM   611  C CG    . ARG A 1 90  ? 59.584  42.179 6.522   1.00 34.64 ? 80  ARG A CG    1 
ATOM   612  C CD    . ARG A 1 90  ? 61.087  42.191 6.669   1.00 39.08 ? 80  ARG A CD    1 
ATOM   613  N NE    . ARG A 1 90  ? 61.539  43.256 7.567   1.00 42.99 ? 80  ARG A NE    1 
ATOM   614  C CZ    . ARG A 1 90  ? 62.062  44.412 7.175   1.00 43.98 ? 80  ARG A CZ    1 
ATOM   615  N NH1   . ARG A 1 90  ? 62.423  45.313 8.090   1.00 44.68 ? 80  ARG A NH1   1 
ATOM   616  N NH2   . ARG A 1 90  ? 62.221  44.675 5.885   1.00 46.10 ? 80  ARG A NH2   1 
ATOM   617  N N     . ALA A 1 91  ? 56.331  43.320 9.501   1.00 32.11 ? 81  ALA A N     1 
ATOM   618  C CA    . ALA A 1 91  ? 55.606  43.527 10.749  1.00 31.56 ? 81  ALA A CA    1 
ATOM   619  C C     . ALA A 1 91  ? 54.253  42.818 10.782  1.00 30.91 ? 81  ALA A C     1 
ATOM   620  O O     . ALA A 1 91  ? 53.895  42.233 11.794  1.00 30.97 ? 81  ALA A O     1 
ATOM   621  C CB    . ALA A 1 91  ? 55.457  45.005 11.056  1.00 32.35 ? 81  ALA A CB    1 
ATOM   622  N N     . ILE A 1 92  ? 53.509  42.857 9.682   1.00 30.72 ? 82  ILE A N     1 
ATOM   623  C CA    . ILE A 1 92  ? 52.279  42.058 9.551   1.00 31.01 ? 82  ILE A CA    1 
ATOM   624  C C     . ILE A 1 92  ? 52.532  40.527 9.723   1.00 31.23 ? 82  ILE A C     1 
ATOM   625  O O     . ILE A 1 92  ? 51.717  39.808 10.297  1.00 30.44 ? 82  ILE A O     1 
ATOM   626  C CB    . ILE A 1 92  ? 51.604  42.306 8.177   1.00 31.06 ? 82  ILE A CB    1 
ATOM   627  C CG1   . ILE A 1 92  ? 51.000  43.718 8.083   1.00 31.51 ? 82  ILE A CG1   1 
ATOM   628  C CG2   . ILE A 1 92  ? 50.511  41.304 7.917   1.00 30.65 ? 82  ILE A CG2   1 
ATOM   629  C CD1   . ILE A 1 92  ? 49.792  43.957 8.982   1.00 30.76 ? 82  ILE A CD1   1 
ATOM   630  N N     . ASP A 1 93  ? 53.653  40.036 9.213   1.00 32.07 ? 83  ASP A N     1 
ATOM   631  C CA    . ASP A 1 93  ? 53.959  38.608 9.344   1.00 32.88 ? 83  ASP A CA    1 
ATOM   632  C C     . ASP A 1 93  ? 54.129  38.268 10.811  1.00 32.80 ? 83  ASP A C     1 
ATOM   633  O O     . ASP A 1 93  ? 53.484  37.359 11.319  1.00 32.74 ? 83  ASP A O     1 
ATOM   634  C CB    . ASP A 1 93  ? 55.223  38.239 8.560   1.00 33.08 ? 83  ASP A CB    1 
ATOM   635  C CG    . ASP A 1 93  ? 54.982  38.163 7.068   1.00 34.20 ? 83  ASP A CG    1 
ATOM   636  O OD1   . ASP A 1 93  ? 53.826  37.944 6.647   1.00 37.45 ? 83  ASP A OD1   1 
ATOM   637  O OD2   . ASP A 1 93  ? 55.957  38.338 6.311   1.00 37.04 ? 83  ASP A OD2   1 
ATOM   638  N N     . SER A 1 94  ? 54.965  39.036 11.499  1.00 33.68 ? 84  SER A N     1 
ATOM   639  C CA    . SER A 1 94  ? 55.182  38.811 12.916  1.00 35.00 ? 84  SER A CA    1 
ATOM   640  C C     . SER A 1 94  ? 53.907  38.923 13.754  1.00 35.27 ? 84  SER A C     1 
ATOM   641  O O     . SER A 1 94  ? 53.713  38.133 14.673  1.00 35.65 ? 84  SER A O     1 
ATOM   642  C CB    . SER A 1 94  ? 56.316  39.689 13.463  1.00 35.40 ? 84  SER A CB    1 
ATOM   643  O OG    . SER A 1 94  ? 55.944  41.046 13.597  1.00 38.66 ? 84  SER A OG    1 
ATOM   644  N N     . ILE A 1 95  ? 53.026  39.874 13.426  1.00 35.20 ? 85  ILE A N     1 
ATOM   645  C CA    . ILE A 1 95  ? 51.738  39.977 14.144  1.00 35.41 ? 85  ILE A CA    1 
ATOM   646  C C     . ILE A 1 95  ? 50.886  38.738 13.960  1.00 34.80 ? 85  ILE A C     1 
ATOM   647  O O     . ILE A 1 95  ? 50.272  38.263 14.922  1.00 34.96 ? 85  ILE A O     1 
ATOM   648  C CB    . ILE A 1 95  ? 50.919  41.277 13.802  1.00 35.21 ? 85  ILE A CB    1 
ATOM   649  C CG1   . ILE A 1 95  ? 51.163  42.349 14.853  1.00 37.09 ? 85  ILE A CG1   1 
ATOM   650  C CG2   . ILE A 1 95  ? 49.440  41.004 13.816  1.00 34.59 ? 85  ILE A CG2   1 
ATOM   651  C CD1   . ILE A 1 95  ? 52.363  43.225 14.582  1.00 38.76 ? 85  ILE A CD1   1 
ATOM   652  N N     . HIS A 1 96  ? 50.857  38.203 12.741  1.00 35.00 ? 86  HIS A N     1 
ATOM   653  C CA    . HIS A 1 96  ? 50.103  36.975 12.475  1.00 35.46 ? 86  HIS A CA    1 
ATOM   654  C C     . HIS A 1 96  ? 50.653  35.753 13.237  1.00 35.78 ? 86  HIS A C     1 
ATOM   655  O O     . HIS A 1 96  ? 49.897  34.858 13.595  1.00 35.63 ? 86  HIS A O     1 
ATOM   656  C CB    . HIS A 1 96  ? 50.013  36.691 10.972  1.00 35.63 ? 86  HIS A CB    1 
ATOM   657  C CG    . HIS A 1 96  ? 49.119  37.646 10.234  1.00 37.16 ? 86  HIS A CG    1 
ATOM   658  N ND1   . HIS A 1 96  ? 49.223  37.873 8.877   1.00 36.81 ? 86  HIS A ND1   1 
ATOM   659  C CD2   . HIS A 1 96  ? 48.121  38.450 10.676  1.00 37.66 ? 86  HIS A CD2   1 
ATOM   660  C CE1   . HIS A 1 96  ? 48.311  38.757 8.511   1.00 39.17 ? 86  HIS A CE1   1 
ATOM   661  N NE2   . HIS A 1 96  ? 47.627  39.121 9.584   1.00 38.61 ? 86  HIS A NE2   1 
ATOM   662  N N     . GLN A 1 97  ? 51.960  35.736 13.473  1.00 36.70 ? 87  GLN A N     1 
ATOM   663  C CA    . GLN A 1 97  ? 52.601  34.697 14.293  1.00 37.86 ? 87  GLN A CA    1 
ATOM   664  C C     . GLN A 1 97  ? 52.218  34.886 15.761  1.00 39.04 ? 87  GLN A C     1 
ATOM   665  O O     . GLN A 1 97  ? 51.881  33.921 16.458  1.00 39.48 ? 87  GLN A O     1 
ATOM   666  C CB    . GLN A 1 97  ? 54.128  34.742 14.134  1.00 37.22 ? 87  GLN A CB    1 
ATOM   667  C CG    . GLN A 1 97  ? 54.685  34.007 12.893  1.00 36.00 ? 87  GLN A CG    1 
ATOM   668  C CD    . GLN A 1 97  ? 54.239  32.549 12.792  1.00 34.45 ? 87  GLN A CD    1 
ATOM   669  O OE1   . GLN A 1 97  ? 54.017  31.884 13.792  1.00 35.27 ? 87  GLN A OE1   1 
ATOM   670  N NE2   . GLN A 1 97  ? 54.134  32.046 11.569  1.00 35.36 ? 87  GLN A NE2   1 
ATOM   671  N N     . LEU A 1 98  ? 52.264  36.141 16.213  1.00 40.19 ? 88  LEU A N     1 
ATOM   672  C CA    . LEU A 1 98  ? 51.817  36.526 17.553  1.00 41.33 ? 88  LEU A CA    1 
ATOM   673  C C     . LEU A 1 98  ? 50.414  36.000 17.840  1.00 41.78 ? 88  LEU A C     1 
ATOM   674  O O     . LEU A 1 98  ? 50.152  35.438 18.907  1.00 42.39 ? 88  LEU A O     1 
ATOM   675  C CB    . LEU A 1 98  ? 51.854  38.056 17.687  1.00 41.62 ? 88  LEU A CB    1 
ATOM   676  C CG    . LEU A 1 98  ? 52.258  38.685 19.011  1.00 42.41 ? 88  LEU A CG    1 
ATOM   677  C CD1   . LEU A 1 98  ? 53.514  38.012 19.550  1.00 42.51 ? 88  LEU A CD1   1 
ATOM   678  C CD2   . LEU A 1 98  ? 52.508  40.202 18.809  1.00 43.05 ? 88  LEU A CD2   1 
ATOM   679  N N     . TRP A 1 99  ? 49.515  36.172 16.876  1.00 42.69 ? 89  TRP A N     1 
ATOM   680  C CA    . TRP A 1 99  ? 48.149  35.666 16.999  1.00 43.16 ? 89  TRP A CA    1 
ATOM   681  C C     . TRP A 1 99  ? 48.061  34.129 17.008  1.00 44.19 ? 89  TRP A C     1 
ATOM   682  O O     . TRP A 1 99  ? 47.057  33.572 17.446  1.00 44.60 ? 89  TRP A O     1 
ATOM   683  C CB    . TRP A 1 99  ? 47.238  36.252 15.917  1.00 42.85 ? 89  TRP A CB    1 
ATOM   684  C CG    . TRP A 1 99  ? 47.100  37.781 15.901  1.00 42.03 ? 89  TRP A CG    1 
ATOM   685  C CD1   . TRP A 1 99  ? 47.517  38.676 16.858  1.00 41.53 ? 89  TRP A CD1   1 
ATOM   686  C CD2   . TRP A 1 99  ? 46.458  38.556 14.888  1.00 40.95 ? 89  TRP A CD2   1 
ATOM   687  N NE1   . TRP A 1 99  ? 47.190  39.961 16.485  1.00 40.04 ? 89  TRP A NE1   1 
ATOM   688  C CE2   . TRP A 1 99  ? 46.536  39.913 15.281  1.00 41.66 ? 89  TRP A CE2   1 
ATOM   689  C CE3   . TRP A 1 99  ? 45.834  38.237 13.675  1.00 41.76 ? 89  TRP A CE3   1 
ATOM   690  C CZ2   . TRP A 1 99  ? 46.015  40.947 14.497  1.00 40.27 ? 89  TRP A CZ2   1 
ATOM   691  C CZ3   . TRP A 1 99  ? 45.314  39.264 12.904  1.00 40.77 ? 89  TRP A CZ3   1 
ATOM   692  C CH2   . TRP A 1 99  ? 45.410  40.598 13.318  1.00 41.27 ? 89  TRP A CH2   1 
ATOM   693  N N     . LYS A 1 100 ? 49.104  33.442 16.541  1.00 45.49 ? 90  LYS A N     1 
ATOM   694  C CA    . LYS A 1 100 ? 49.156  31.973 16.669  1.00 46.22 ? 90  LYS A CA    1 
ATOM   695  C C     . LYS A 1 100 ? 49.476  31.527 18.104  1.00 46.86 ? 90  LYS A C     1 
ATOM   696  O O     . LYS A 1 100 ? 49.063  30.454 18.541  1.00 47.52 ? 90  LYS A O     1 
ATOM   697  C CB    . LYS A 1 100 ? 50.151  31.363 15.674  1.00 46.47 ? 90  LYS A CB    1 
ATOM   698  C CG    . LYS A 1 100 ? 49.677  31.361 14.225  1.00 45.12 ? 90  LYS A CG    1 
ATOM   699  C CD    . LYS A 1 100 ? 50.793  30.939 13.283  1.00 44.16 ? 90  LYS A CD    1 
ATOM   700  C CE    . LYS A 1 100 ? 50.412  31.172 11.829  1.00 43.41 ? 90  LYS A CE    1 
ATOM   701  N NZ    . LYS A 1 100 ? 49.302  30.289 11.404  1.00 43.85 ? 90  LYS A NZ    1 
ATOM   702  N N     . GLY A 1 101 ? 50.209  32.360 18.830  1.00 48.08 ? 91  GLY A N     1 
ATOM   703  C CA    . GLY A 1 101 ? 50.484  32.131 20.237  1.00 49.62 ? 91  GLY A CA    1 
ATOM   704  C C     . GLY A 1 101 ? 49.290  32.466 21.116  1.00 50.77 ? 91  GLY A C     1 
ATOM   705  O O     . GLY A 1 101 ? 48.151  32.094 20.820  1.00 50.75 ? 91  GLY A O     1 
ATOM   706  N N     . THR A 1 102 ? 49.553  33.182 22.201  1.00 52.14 ? 92  THR A N     1 
ATOM   707  C CA    . THR A 1 102 ? 48.520  33.479 23.193  1.00 53.52 ? 92  THR A CA    1 
ATOM   708  C C     . THR A 1 102 ? 47.778  34.786 22.906  1.00 54.15 ? 92  THR A C     1 
ATOM   709  O O     . THR A 1 102 ? 46.599  34.912 23.244  1.00 54.52 ? 92  THR A O     1 
ATOM   710  C CB    . THR A 1 102 ? 49.101  33.501 24.621  1.00 53.36 ? 92  THR A CB    1 
ATOM   711  O OG1   . THR A 1 102 ? 50.268  34.329 24.648  1.00 54.52 ? 92  THR A OG1   1 
ATOM   712  C CG2   . THR A 1 102 ? 49.485  32.087 25.067  1.00 54.47 ? 92  THR A CG2   1 
ATOM   713  N N     . THR A 1 103 ? 48.484  35.741 22.286  1.00 55.01 ? 93  THR A N     1 
ATOM   714  C CA    . THR A 1 103 ? 47.957  37.071 21.927  1.00 55.44 ? 93  THR A CA    1 
ATOM   715  C C     . THR A 1 103 ? 46.588  37.017 21.236  1.00 55.51 ? 93  THR A C     1 
ATOM   716  O O     . THR A 1 103 ? 46.374  36.231 20.310  1.00 55.61 ? 93  THR A O     1 
ATOM   717  C CB    . THR A 1 103 ? 48.965  37.843 21.029  1.00 55.55 ? 93  THR A CB    1 
ATOM   718  O OG1   . THR A 1 103 ? 50.178  38.077 21.758  1.00 56.01 ? 93  THR A OG1   1 
ATOM   719  C CG2   . THR A 1 103 ? 48.397  39.188 20.557  1.00 55.63 ? 93  THR A CG2   1 
ATOM   720  N N     . GLN A 1 104 ? 45.666  37.854 21.707  1.00 55.72 ? 94  GLN A N     1 
ATOM   721  C CA    . GLN A 1 104 ? 44.355  37.994 21.080  1.00 55.80 ? 94  GLN A CA    1 
ATOM   722  C C     . GLN A 1 104 ? 44.510  38.603 19.691  1.00 55.06 ? 94  GLN A C     1 
ATOM   723  O O     . GLN A 1 104 ? 45.191  39.620 19.537  1.00 55.02 ? 94  GLN A O     1 
ATOM   724  C CB    . GLN A 1 104 ? 43.422  38.861 21.946  1.00 56.36 ? 94  GLN A CB    1 
ATOM   725  C CG    . GLN A 1 104 ? 43.193  38.340 23.375  1.00 57.53 ? 94  GLN A CG    1 
ATOM   726  C CD    . GLN A 1 104 ? 42.241  37.151 23.442  1.00 59.71 ? 94  GLN A CD    1 
ATOM   727  O OE1   . GLN A 1 104 ? 42.395  36.160 22.715  1.00 60.25 ? 94  GLN A OE1   1 
ATOM   728  N NE2   . GLN A 1 104 ? 41.252  37.241 24.330  1.00 59.53 ? 94  GLN A NE2   1 
ATOM   729  N N     . PRO A 1 105 ? 43.903  37.969 18.669  1.00 54.68 ? 95  PRO A N     1 
ATOM   730  C CA    . PRO A 1 105 ? 43.898  38.566 17.329  1.00 54.16 ? 95  PRO A CA    1 
ATOM   731  C C     . PRO A 1 105 ? 42.963  39.766 17.276  1.00 53.88 ? 95  PRO A C     1 
ATOM   732  O O     . PRO A 1 105 ? 42.181  39.974 18.214  1.00 53.76 ? 95  PRO A O     1 
ATOM   733  C CB    . PRO A 1 105 ? 43.367  37.440 16.430  1.00 54.10 ? 95  PRO A CB    1 
ATOM   734  C CG    . PRO A 1 105 ? 42.588  36.555 17.347  1.00 54.93 ? 95  PRO A CG    1 
ATOM   735  C CD    . PRO A 1 105 ? 43.285  36.630 18.683  1.00 54.62 ? 95  PRO A CD    1 
ATOM   736  N N     . MET A 1 106 ? 43.057  40.548 16.198  1.00 53.04 ? 96  MET A N     1 
ATOM   737  C CA    . MET A 1 106 ? 42.173  41.692 15.977  1.00 52.37 ? 96  MET A CA    1 
ATOM   738  C C     . MET A 1 106 ? 40.728  41.221 16.009  1.00 51.74 ? 96  MET A C     1 
ATOM   739  O O     . MET A 1 106 ? 40.373  40.219 15.380  1.00 51.97 ? 96  MET A O     1 
ATOM   740  C CB    . MET A 1 106 ? 42.479  42.383 14.635  1.00 52.30 ? 96  MET A CB    1 
ATOM   741  C CG    . MET A 1 106 ? 41.888  43.791 14.481  1.00 52.63 ? 96  MET A CG    1 
ATOM   742  S SD    . MET A 1 106 ? 42.068  44.491 12.815  1.00 52.11 ? 96  MET A SD    1 
ATOM   743  C CE    . MET A 1 106 ? 40.483  44.107 12.075  1.00 50.23 ? 96  MET A CE    1 
ATOM   744  N N     . LYS A 1 107 ? 39.908  41.938 16.770  1.00 50.96 ? 97  LYS A N     1 
ATOM   745  C CA    . LYS A 1 107 ? 38.479  41.681 16.825  1.00 49.82 ? 97  LYS A CA    1 
ATOM   746  C C     . LYS A 1 107 ? 37.929  41.822 15.408  1.00 49.41 ? 97  LYS A C     1 
ATOM   747  O O     . LYS A 1 107 ? 38.223  42.793 14.702  1.00 49.20 ? 97  LYS A O     1 
ATOM   748  C CB    . LYS A 1 107 ? 37.810  42.661 17.792  1.00 49.70 ? 97  LYS A CB    1 
ATOM   749  C CG    . LYS A 1 107 ? 36.379  42.318 18.185  1.00 49.22 ? 97  LYS A CG    1 
ATOM   750  C CD    . LYS A 1 107 ? 35.737  43.488 18.940  1.00 47.17 ? 97  LYS A CD    1 
ATOM   751  C CE    . LYS A 1 107 ? 34.205  43.372 18.967  1.00 45.81 ? 97  LYS A CE    1 
ATOM   752  N NZ    . LYS A 1 107 ? 33.711  42.335 19.897  1.00 46.69 ? 97  LYS A NZ    1 
ATOM   753  N N     . LEU A 1 108 ? 37.170  40.824 14.976  1.00 48.68 ? 98  LEU A N     1 
ATOM   754  C CA    . LEU A 1 108 ? 36.641  40.827 13.627  1.00 48.09 ? 98  LEU A CA    1 
ATOM   755  C C     . LEU A 1 108 ? 35.256  41.466 13.573  1.00 47.76 ? 98  LEU A C     1 
ATOM   756  O O     . LEU A 1 108 ? 34.626  41.695 14.609  1.00 47.24 ? 98  LEU A O     1 
ATOM   757  C CB    . LEU A 1 108 ? 36.648  39.414 13.044  1.00 48.47 ? 98  LEU A CB    1 
ATOM   758  C CG    . LEU A 1 108 ? 38.039  38.758 12.994  1.00 48.54 ? 98  LEU A CG    1 
ATOM   759  C CD1   . LEU A 1 108 ? 37.997  37.439 12.246  1.00 48.45 ? 98  LEU A CD1   1 
ATOM   760  C CD2   . LEU A 1 108 ? 39.079  39.707 12.363  1.00 48.26 ? 98  LEU A CD2   1 
ATOM   761  N N     . ASN A 1 109 ? 34.816  41.761 12.352  1.00 47.18 ? 99  ASN A N     1 
ATOM   762  C CA    . ASN A 1 109 ? 33.538  42.421 12.070  1.00 46.52 ? 99  ASN A CA    1 
ATOM   763  C C     . ASN A 1 109 ? 33.060  43.517 13.044  1.00 44.96 ? 99  ASN A C     1 
ATOM   764  O O     . ASN A 1 109 ? 31.899  43.550 13.452  1.00 44.81 ? 99  ASN A O     1 
ATOM   765  C CB    . ASN A 1 109 ? 32.430  41.401 11.693  1.00 47.35 ? 99  ASN A CB    1 
ATOM   766  C CG    . ASN A 1 109 ? 31.919  40.571 12.884  1.00 49.15 ? 99  ASN A CG    1 
ATOM   767  O OD1   . ASN A 1 109 ? 32.206  40.855 14.048  1.00 50.69 ? 99  ASN A OD1   1 
ATOM   768  N ND2   . ASN A 1 109 ? 31.130  39.545 12.576  1.00 50.25 ? 99  ASN A ND2   1 
ATOM   769  N N     . THR A 1 110 ? 33.973  44.406 13.418  1.00 42.61 ? 100 THR A N     1 
ATOM   770  C CA    . THR A 1 110 ? 33.564  45.676 13.986  1.00 40.82 ? 100 THR A CA    1 
ATOM   771  C C     . THR A 1 110 ? 33.479  46.716 12.861  1.00 39.15 ? 100 THR A C     1 
ATOM   772  O O     . THR A 1 110 ? 34.109  46.574 11.810  1.00 37.83 ? 100 THR A O     1 
ATOM   773  C CB    . THR A 1 110 ? 34.511  46.174 15.091  1.00 40.98 ? 100 THR A CB    1 
ATOM   774  O OG1   . THR A 1 110 ? 35.777  46.509 14.522  1.00 42.96 ? 100 THR A OG1   1 
ATOM   775  C CG2   . THR A 1 110 ? 34.713  45.103 16.157  1.00 41.15 ? 100 THR A CG2   1 
ATOM   776  N N     . ARG A 1 111 ? 32.666  47.739 13.096  1.00 37.47 ? 101 ARG A N     1 
ATOM   777  C CA    . ARG A 1 111 ? 32.551  48.882 12.212  1.00 36.04 ? 101 ARG A CA    1 
ATOM   778  C C     . ARG A 1 111 ? 33.798  49.741 12.320  1.00 34.91 ? 101 ARG A C     1 
ATOM   779  O O     . ARG A 1 111 ? 34.398  49.820 13.384  1.00 34.12 ? 101 ARG A O     1 
ATOM   780  C CB    . ARG A 1 111 ? 31.316  49.712 12.591  1.00 36.71 ? 101 ARG A CB    1 
ATOM   781  C CG    . ARG A 1 111 ? 30.017  48.905 12.543  1.00 37.41 ? 101 ARG A CG    1 
ATOM   782  C CD    . ARG A 1 111 ? 29.481  48.840 11.136  1.00 42.66 ? 101 ARG A CD    1 
ATOM   783  N NE    . ARG A 1 111 ? 28.265  48.035 11.005  1.00 46.04 ? 101 ARG A NE    1 
ATOM   784  C CZ    . ARG A 1 111 ? 27.137  48.235 11.689  1.00 46.49 ? 101 ARG A CZ    1 
ATOM   785  N NH1   . ARG A 1 111 ? 27.058  49.209 12.586  1.00 46.54 ? 101 ARG A NH1   1 
ATOM   786  N NH2   . ARG A 1 111 ? 26.093  47.439 11.483  1.00 44.01 ? 101 ARG A NH2   1 
ATOM   787  N N     . PRO A 1 112 ? 34.188  50.390 11.218  1.00 34.17 ? 102 PRO A N     1 
ATOM   788  C CA    . PRO A 1 112 ? 35.419  51.173 11.240  1.00 34.15 ? 102 PRO A CA    1 
ATOM   789  C C     . PRO A 1 112 ? 35.225  52.439 12.061  1.00 34.30 ? 102 PRO A C     1 
ATOM   790  O O     . PRO A 1 112 ? 34.106  52.946 12.167  1.00 34.52 ? 102 PRO A O     1 
ATOM   791  C CB    . PRO A 1 112 ? 35.641  51.515 9.760   1.00 33.71 ? 102 PRO A CB    1 
ATOM   792  C CG    . PRO A 1 112 ? 34.246  51.534 9.162   1.00 34.56 ? 102 PRO A CG    1 
ATOM   793  C CD    . PRO A 1 112 ? 33.459  50.506 9.934   1.00 33.85 ? 102 PRO A CD    1 
ATOM   794  N N     . SER A 1 113 ? 36.301  52.944 12.644  1.00 34.34 ? 103 SER A N     1 
ATOM   795  C CA    . SER A 1 113 ? 36.260  54.235 13.297  1.00 33.89 ? 103 SER A CA    1 
ATOM   796  C C     . SER A 1 113 ? 35.970  55.289 12.233  1.00 33.90 ? 103 SER A C     1 
ATOM   797  O O     . SER A 1 113 ? 36.202  55.051 11.040  1.00 33.76 ? 103 SER A O     1 
ATOM   798  C CB    . SER A 1 113 ? 37.617  54.535 13.916  1.00 34.22 ? 103 SER A CB    1 
ATOM   799  O OG    . SER A 1 113 ? 38.534  54.937 12.906  1.00 34.83 ? 103 SER A OG    1 
ATOM   800  N N     . THR A 1 114 ? 35.512  56.458 12.668  1.00 33.12 ? 104 THR A N     1 
ATOM   801  C CA    . THR A 1 114 ? 35.232  57.571 11.764  1.00 33.32 ? 104 THR A CA    1 
ATOM   802  C C     . THR A 1 114 ? 36.447  57.935 10.924  1.00 32.62 ? 104 THR A C     1 
ATOM   803  O O     . THR A 1 114 ? 36.347  58.086 9.702   1.00 33.22 ? 104 THR A O     1 
ATOM   804  C CB    . THR A 1 114 ? 34.773  58.808 12.573  1.00 32.95 ? 104 THR A CB    1 
ATOM   805  O OG1   . THR A 1 114 ? 33.562  58.477 13.228  1.00 33.24 ? 104 THR A OG1   1 
ATOM   806  C CG2   . THR A 1 114 ? 34.553  60.022 11.678  1.00 31.81 ? 104 THR A CG2   1 
ATOM   807  N N     . GLY A 1 115 ? 37.591  58.082 11.584  1.00 32.27 ? 105 GLY A N     1 
ATOM   808  C CA    . GLY A 1 115 ? 38.844  58.372 10.897  1.00 30.54 ? 105 GLY A CA    1 
ATOM   809  C C     . GLY A 1 115 ? 39.270  57.289 9.902   1.00 29.92 ? 105 GLY A C     1 
ATOM   810  O O     . GLY A 1 115 ? 39.759  57.601 8.812   1.00 29.96 ? 105 GLY A O     1 
ATOM   811  N N     . LEU A 1 116 ? 39.100  56.017 10.264  1.00 29.26 ? 106 LEU A N     1 
ATOM   812  C CA    . LEU A 1 116 ? 39.373  54.959 9.311   1.00 27.75 ? 106 LEU A CA    1 
ATOM   813  C C     . LEU A 1 116 ? 38.388  55.009 8.136   1.00 27.52 ? 106 LEU A C     1 
ATOM   814  O O     . LEU A 1 116 ? 38.783  54.890 6.973   1.00 28.19 ? 106 LEU A O     1 
ATOM   815  C CB    . LEU A 1 116 ? 39.380  53.578 9.967   1.00 27.47 ? 106 LEU A CB    1 
ATOM   816  C CG    . LEU A 1 116 ? 39.554  52.433 8.967   1.00 26.61 ? 106 LEU A CG    1 
ATOM   817  C CD1   . LEU A 1 116 ? 40.947  52.511 8.329   1.00 24.89 ? 106 LEU A CD1   1 
ATOM   818  C CD2   . LEU A 1 116 ? 39.281  51.064 9.618   1.00 28.08 ? 106 LEU A CD2   1 
ATOM   819  N N     . LEU A 1 117 ? 37.107  55.191 8.435   1.00 26.62 ? 107 LEU A N     1 
ATOM   820  C CA    . LEU A 1 117 ? 36.091  55.267 7.390   1.00 25.05 ? 107 LEU A CA    1 
ATOM   821  C C     . LEU A 1 117 ? 36.400  56.365 6.358   1.00 24.88 ? 107 LEU A C     1 
ATOM   822  O O     . LEU A 1 117 ? 36.262  56.131 5.142   1.00 25.12 ? 107 LEU A O     1 
ATOM   823  C CB    . LEU A 1 117 ? 34.685  55.427 7.988   1.00 24.37 ? 107 LEU A CB    1 
ATOM   824  C CG    . LEU A 1 117 ? 33.477  55.411 7.039   1.00 24.42 ? 107 LEU A CG    1 
ATOM   825  C CD1   . LEU A 1 117 ? 33.516  54.259 6.044   1.00 19.46 ? 107 LEU A CD1   1 
ATOM   826  C CD2   . LEU A 1 117 ? 32.142  55.377 7.858   1.00 23.86 ? 107 LEU A CD2   1 
ATOM   827  N N     . ARG A 1 118 ? 36.817  57.545 6.831   1.00 24.58 ? 108 ARG A N     1 
ATOM   828  C CA    A ARG A 1 118 ? 37.164  58.646 5.927   0.50 24.65 ? 108 ARG A CA    1 
ATOM   829  C CA    B ARG A 1 118 ? 37.182  58.655 5.955   0.50 24.68 ? 108 ARG A CA    1 
ATOM   830  C C     . ARG A 1 118 ? 38.234  58.204 4.934   1.00 24.50 ? 108 ARG A C     1 
ATOM   831  O O     . ARG A 1 118 ? 38.145  58.505 3.730   1.00 23.72 ? 108 ARG A O     1 
ATOM   832  C CB    A ARG A 1 118 ? 37.657  59.891 6.686   0.50 24.34 ? 108 ARG A CB    1 
ATOM   833  C CB    B ARG A 1 118 ? 37.723  59.823 6.797   0.50 24.35 ? 108 ARG A CB    1 
ATOM   834  C CG    A ARG A 1 118 ? 37.809  61.134 5.786   0.50 25.17 ? 108 ARG A CG    1 
ATOM   835  C CG    B ARG A 1 118 ? 37.911  61.138 6.047   0.50 25.44 ? 108 ARG A CG    1 
ATOM   836  C CD    A ARG A 1 118 ? 38.656  62.242 6.422   0.50 25.10 ? 108 ARG A CD    1 
ATOM   837  C CD    B ARG A 1 118 ? 38.410  62.265 6.965   0.50 25.35 ? 108 ARG A CD    1 
ATOM   838  N NE    A ARG A 1 118 ? 38.039  62.767 7.630   0.50 25.45 ? 108 ARG A NE    1 
ATOM   839  N NE    B ARG A 1 118 ? 37.318  62.922 7.691   0.50 25.86 ? 108 ARG A NE    1 
ATOM   840  C CZ    A ARG A 1 118 ? 37.058  63.667 7.649   0.50 22.57 ? 108 ARG A CZ    1 
ATOM   841  C CZ    B ARG A 1 118 ? 37.171  62.884 9.012   0.50 24.95 ? 108 ARG A CZ    1 
ATOM   842  N NH1   A ARG A 1 118 ? 36.572  64.176 6.511   0.50 23.07 ? 108 ARG A NH1   1 
ATOM   843  N NH1   B ARG A 1 118 ? 38.046  62.218 9.760   0.50 24.47 ? 108 ARG A NH1   1 
ATOM   844  N NH2   A ARG A 1 118 ? 36.572  64.066 8.812   0.50 19.27 ? 108 ARG A NH2   1 
ATOM   845  N NH2   B ARG A 1 118 ? 36.151  63.507 9.582   0.50 23.29 ? 108 ARG A NH2   1 
ATOM   846  N N     . HIS A 1 119 ? 39.246  57.515 5.446   1.00 24.56 ? 109 HIS A N     1 
ATOM   847  C CA    . HIS A 1 119 ? 40.360  57.077 4.633   1.00 24.51 ? 109 HIS A CA    1 
ATOM   848  C C     . HIS A 1 119 ? 39.903  56.033 3.629   1.00 24.07 ? 109 HIS A C     1 
ATOM   849  O O     . HIS A 1 119 ? 40.276  56.101 2.465   1.00 24.59 ? 109 HIS A O     1 
ATOM   850  C CB    . HIS A 1 119 ? 41.504  56.533 5.503   1.00 25.08 ? 109 HIS A CB    1 
ATOM   851  C CG    . HIS A 1 119 ? 42.551  55.807 4.709   1.00 26.04 ? 109 HIS A CG    1 
ATOM   852  N ND1   . HIS A 1 119 ? 43.445  56.455 3.885   1.00 26.69 ? 109 HIS A ND1   1 
ATOM   853  C CD2   . HIS A 1 119 ? 42.797  54.484 4.568   1.00 25.68 ? 109 HIS A CD2   1 
ATOM   854  C CE1   . HIS A 1 119 ? 44.222  55.560 3.293   1.00 26.95 ? 109 HIS A CE1   1 
ATOM   855  N NE2   . HIS A 1 119 ? 43.845  54.358 3.690   1.00 26.74 ? 109 HIS A NE2   1 
ATOM   856  N N     . ILE A 1 120 ? 39.091  55.074 4.088   1.00 24.02 ? 110 ILE A N     1 
ATOM   857  C CA    . ILE A 1 120 ? 38.594  54.003 3.237   1.00 23.34 ? 110 ILE A CA    1 
ATOM   858  C C     . ILE A 1 120 ? 37.788  54.577 2.078   1.00 23.59 ? 110 ILE A C     1 
ATOM   859  O O     . ILE A 1 120 ? 38.016  54.203 0.910   1.00 22.33 ? 110 ILE A O     1 
ATOM   860  C CB    . ILE A 1 120 ? 37.740  52.970 4.031   1.00 22.62 ? 110 ILE A CB    1 
ATOM   861  C CG1   . ILE A 1 120 ? 38.645  52.114 4.948   1.00 24.11 ? 110 ILE A CG1   1 
ATOM   862  C CG2   . ILE A 1 120 ? 37.018  52.058 3.087   1.00 21.32 ? 110 ILE A CG2   1 
ATOM   863  C CD1   . ILE A 1 120 ? 37.870  51.224 5.946   1.00 23.78 ? 110 ILE A CD1   1 
ATOM   864  N N     . LEU A 1 121 ? 36.857  55.487 2.393   1.00 23.22 ? 111 LEU A N     1 
ATOM   865  C CA    . LEU A 1 121 ? 36.047  56.121 1.339   1.00 24.17 ? 111 LEU A CA    1 
ATOM   866  C C     . LEU A 1 121 ? 36.866  56.942 0.352   1.00 24.65 ? 111 LEU A C     1 
ATOM   867  O O     . LEU A 1 121 ? 36.532  56.995 -0.815  1.00 23.67 ? 111 LEU A O     1 
ATOM   868  C CB    . LEU A 1 121 ? 34.897  56.972 1.905   1.00 24.27 ? 111 LEU A CB    1 
ATOM   869  C CG    . LEU A 1 121 ? 33.896  56.169 2.754   1.00 24.31 ? 111 LEU A CG    1 
ATOM   870  C CD1   . LEU A 1 121 ? 32.913  57.072 3.510   1.00 21.96 ? 111 LEU A CD1   1 
ATOM   871  C CD2   . LEU A 1 121 ? 33.147  55.111 1.913   1.00 25.28 ? 111 LEU A CD2   1 
ATOM   872  N N     . GLN A 1 122 ? 37.917  57.614 0.817   1.00 25.55 ? 112 GLN A N     1 
ATOM   873  C CA    . GLN A 1 122 ? 38.766  58.337 -0.115  1.00 27.09 ? 112 GLN A CA    1 
ATOM   874  C C     . GLN A 1 122 ? 39.501  57.353 -1.050  1.00 27.17 ? 112 GLN A C     1 
ATOM   875  O O     . GLN A 1 122 ? 39.634  57.583 -2.265  1.00 27.54 ? 112 GLN A O     1 
ATOM   876  C CB    . GLN A 1 122 ? 39.741  59.252 0.644   1.00 28.08 ? 112 GLN A CB    1 
ATOM   877  C CG    . GLN A 1 122 ? 40.740  59.978 -0.253  1.00 32.54 ? 112 GLN A CG    1 
ATOM   878  C CD    . GLN A 1 122 ? 40.079  61.065 -1.128  1.00 38.31 ? 112 GLN A CD    1 
ATOM   879  O OE1   . GLN A 1 122 ? 39.863  60.882 -2.330  1.00 42.99 ? 112 GLN A OE1   1 
ATOM   880  N NE2   . GLN A 1 122 ? 39.732  62.176 -0.509  1.00 41.69 ? 112 GLN A NE2   1 
ATOM   881  N N     . GLN A 1 123 ? 39.963  56.263 -0.460  1.00 27.11 ? 113 GLN A N     1 
ATOM   882  C CA    . GLN A 1 123 ? 40.683  55.205 -1.165  1.00 27.30 ? 113 GLN A CA    1 
ATOM   883  C C     . GLN A 1 123 ? 39.780  54.592 -2.222  1.00 26.82 ? 113 GLN A C     1 
ATOM   884  O O     . GLN A 1 123 ? 40.153  54.494 -3.377  1.00 26.28 ? 113 GLN A O     1 
ATOM   885  C CB    . GLN A 1 123 ? 41.168  54.180 -0.132  1.00 27.42 ? 113 GLN A CB    1 
ATOM   886  C CG    . GLN A 1 123 ? 41.978  53.023 -0.637  1.00 28.48 ? 113 GLN A CG    1 
ATOM   887  C CD    . GLN A 1 123 ? 42.711  52.358 0.505   1.00 31.12 ? 113 GLN A CD    1 
ATOM   888  O OE1   . GLN A 1 123 ? 42.140  52.138 1.584   1.00 30.28 ? 113 GLN A OE1   1 
ATOM   889  N NE2   . GLN A 1 123 ? 43.989  52.047 0.287   1.00 31.84 ? 113 GLN A NE2   1 
ATOM   890  N N     . VAL A 1 124 ? 38.551  54.269 -1.835  1.00 26.56 ? 114 VAL A N     1 
ATOM   891  C CA    . VAL A 1 124 ? 37.566  53.728 -2.751  1.00 26.86 ? 114 VAL A CA    1 
ATOM   892  C C     . VAL A 1 124 ? 37.215  54.721 -3.870  1.00 27.05 ? 114 VAL A C     1 
ATOM   893  O O     . VAL A 1 124 ? 37.100  54.350 -5.038  1.00 26.02 ? 114 VAL A O     1 
ATOM   894  C CB    . VAL A 1 124 ? 36.301  53.324 -1.956  1.00 26.40 ? 114 VAL A CB    1 
ATOM   895  C CG1   . VAL A 1 124 ? 35.137  53.057 -2.859  1.00 26.97 ? 114 VAL A CG1   1 
ATOM   896  C CG2   . VAL A 1 124 ? 36.628  52.092 -1.073  1.00 26.70 ? 114 VAL A CG2   1 
ATOM   897  N N     . TYR A 1 125 ? 37.014  55.981 -3.504  1.00 27.87 ? 115 TYR A N     1 
ATOM   898  C CA    . TYR A 1 125 ? 36.721  56.993 -4.504  1.00 28.51 ? 115 TYR A CA    1 
ATOM   899  C C     . TYR A 1 125 ? 37.877  57.105 -5.532  1.00 29.16 ? 115 TYR A C     1 
ATOM   900  O O     . TYR A 1 125 ? 37.659  57.007 -6.736  1.00 27.95 ? 115 TYR A O     1 
ATOM   901  C CB    . TYR A 1 125 ? 36.444  58.329 -3.821  1.00 29.06 ? 115 TYR A CB    1 
ATOM   902  C CG    . TYR A 1 125 ? 35.898  59.415 -4.727  1.00 29.89 ? 115 TYR A CG    1 
ATOM   903  C CD1   . TYR A 1 125 ? 34.530  59.711 -4.744  1.00 30.35 ? 115 TYR A CD1   1 
ATOM   904  C CD2   . TYR A 1 125 ? 36.750  60.163 -5.547  1.00 32.32 ? 115 TYR A CD2   1 
ATOM   905  C CE1   . TYR A 1 125 ? 34.032  60.715 -5.549  1.00 32.44 ? 115 TYR A CE1   1 
ATOM   906  C CE2   . TYR A 1 125 ? 36.253  61.172 -6.366  1.00 33.10 ? 115 TYR A CE2   1 
ATOM   907  C CZ    . TYR A 1 125 ? 34.892  61.435 -6.364  1.00 33.00 ? 115 TYR A CZ    1 
ATOM   908  O OH    . TYR A 1 125 ? 34.394  62.436 -7.160  1.00 33.84 ? 115 TYR A OH    1 
ATOM   909  N N     . ASN A 1 126 ? 39.096  57.323 -5.050  1.00 29.73 ? 116 ASN A N     1 
ATOM   910  C CA    . ASN A 1 126 ? 40.263  57.443 -5.935  1.00 30.78 ? 116 ASN A CA    1 
ATOM   911  C C     . ASN A 1 126 ? 40.490  56.226 -6.833  1.00 30.40 ? 116 ASN A C     1 
ATOM   912  O O     . ASN A 1 126 ? 40.931  56.379 -7.959  1.00 30.72 ? 116 ASN A O     1 
ATOM   913  C CB    . ASN A 1 126 ? 41.532  57.727 -5.128  1.00 30.66 ? 116 ASN A CB    1 
ATOM   914  C CG    . ASN A 1 126 ? 41.576  59.130 -4.591  1.00 32.38 ? 116 ASN A CG    1 
ATOM   915  O OD1   . ASN A 1 126 ? 42.029  59.356 -3.475  1.00 35.19 ? 116 ASN A OD1   1 
ATOM   916  N ND2   . ASN A 1 126 ? 41.109  60.094 -5.385  1.00 33.34 ? 116 ASN A ND2   1 
ATOM   917  N N     . HIS A 1 127 ? 40.197  55.028 -6.337  1.00 30.53 ? 117 HIS A N     1 
ATOM   918  C CA    . HIS A 1 127 ? 40.293  53.828 -7.157  1.00 31.60 ? 117 HIS A CA    1 
ATOM   919  C C     . HIS A 1 127 ? 39.125  53.673 -8.127  1.00 31.93 ? 117 HIS A C     1 
ATOM   920  O O     . HIS A 1 127 ? 39.269  52.975 -9.105  1.00 32.28 ? 117 HIS A O     1 
ATOM   921  C CB    . HIS A 1 127 ? 40.383  52.556 -6.299  1.00 31.62 ? 117 HIS A CB    1 
ATOM   922  C CG    . HIS A 1 127 ? 41.738  52.309 -5.719  1.00 33.10 ? 117 HIS A CG    1 
ATOM   923  N ND1   . HIS A 1 127 ? 42.677  51.501 -6.330  1.00 35.08 ? 117 HIS A ND1   1 
ATOM   924  C CD2   . HIS A 1 127 ? 42.318  52.770 -4.587  1.00 32.58 ? 117 HIS A CD2   1 
ATOM   925  C CE1   . HIS A 1 127 ? 43.780  51.487 -5.603  1.00 32.96 ? 117 HIS A CE1   1 
ATOM   926  N NE2   . HIS A 1 127 ? 43.581  52.233 -4.531  1.00 34.25 ? 117 HIS A NE2   1 
ATOM   927  N N     . SER A 1 128 ? 37.970  54.292 -7.864  1.00 31.39 ? 118 SER A N     1 
ATOM   928  C CA    . SER A 1 128 ? 36.778  54.006 -8.694  1.00 30.78 ? 118 SER A CA    1 
ATOM   929  C C     . SER A 1 128 ? 36.452  55.125 -9.668  1.00 31.22 ? 118 SER A C     1 
ATOM   930  O O     . SER A 1 128 ? 36.006  54.875 -10.790 1.00 30.57 ? 118 SER A O     1 
ATOM   931  C CB    . SER A 1 128 ? 35.531  53.734 -7.839  1.00 31.06 ? 118 SER A CB    1 
ATOM   932  O OG    . SER A 1 128 ? 35.791  52.841 -6.770  1.00 28.93 ? 118 SER A OG    1 
ATOM   933  N N     . VAL A 1 129 ? 36.659  56.365 -9.234  1.00 32.09 ? 119 VAL A N     1 
ATOM   934  C CA    . VAL A 1 129 ? 36.301  57.522 -10.043 1.00 33.43 ? 119 VAL A CA    1 
ATOM   935  C C     . VAL A 1 129 ? 37.533  57.889 -10.871 1.00 35.06 ? 119 VAL A C     1 
ATOM   936  O O     . VAL A 1 129 ? 38.311  58.766 -10.497 1.00 35.58 ? 119 VAL A O     1 
ATOM   937  C CB    . VAL A 1 129 ? 35.787  58.691 -9.148  1.00 33.14 ? 119 VAL A CB    1 
ATOM   938  C CG1   . VAL A 1 129 ? 35.378  59.892 -9.986  1.00 32.65 ? 119 VAL A CG1   1 
ATOM   939  C CG2   . VAL A 1 129 ? 34.593  58.203 -8.284  1.00 31.77 ? 119 VAL A CG2   1 
ATOM   940  N N     . THR A 1 130 ? 37.720  57.184 -11.983 1.00 36.95 ? 120 THR A N     1 
ATOM   941  C CA    . THR A 1 130 ? 38.985  57.266 -12.733 1.00 39.03 ? 120 THR A CA    1 
ATOM   942  C C     . THR A 1 130 ? 39.208  58.620 -13.381 1.00 39.91 ? 120 THR A C     1 
ATOM   943  O O     . THR A 1 130 ? 40.323  59.151 -13.330 1.00 40.44 ? 120 THR A O     1 
ATOM   944  C CB    . THR A 1 130 ? 39.150  56.134 -13.765 1.00 39.02 ? 120 THR A CB    1 
ATOM   945  O OG1   . THR A 1 130 ? 37.967  56.033 -14.560 1.00 41.32 ? 120 THR A OG1   1 
ATOM   946  C CG2   . THR A 1 130 ? 39.417  54.796 -13.064 1.00 38.99 ? 120 THR A CG2   1 
ATOM   947  N N     . ASP A 1 131 ? 38.151  59.180 -13.975 1.00 40.39 ? 121 ASP A N     1 
ATOM   948  C CA    . ASP A 1 131 ? 38.204  60.557 -14.457 1.00 40.93 ? 121 ASP A CA    1 
ATOM   949  C C     . ASP A 1 131 ? 37.105  61.434 -13.830 1.00 40.65 ? 121 ASP A C     1 
ATOM   950  O O     . ASP A 1 131 ? 36.000  61.513 -14.374 1.00 40.35 ? 121 ASP A O     1 
ATOM   951  C CB    . ASP A 1 131 ? 38.138  60.609 -15.987 1.00 40.84 ? 121 ASP A CB    1 
ATOM   952  C CG    . ASP A 1 131 ? 38.422  61.991 -16.528 1.00 42.41 ? 121 ASP A CG    1 
ATOM   953  O OD1   . ASP A 1 131 ? 38.775  62.882 -15.729 1.00 42.18 ? 121 ASP A OD1   1 
ATOM   954  O OD2   . ASP A 1 131 ? 38.304  62.186 -17.758 1.00 45.90 ? 121 ASP A OD2   1 
ATOM   955  N N     . PRO A 1 132 ? 37.420  62.085 -12.685 1.00 40.75 ? 122 PRO A N     1 
ATOM   956  C CA    . PRO A 1 132 ? 36.522  62.943 -11.914 1.00 40.87 ? 122 PRO A CA    1 
ATOM   957  C C     . PRO A 1 132 ? 35.853  64.027 -12.768 1.00 41.51 ? 122 PRO A C     1 
ATOM   958  O O     . PRO A 1 132 ? 34.659  64.300 -12.590 1.00 41.01 ? 122 PRO A O     1 
ATOM   959  C CB    . PRO A 1 132 ? 37.447  63.569 -10.872 1.00 41.07 ? 122 PRO A CB    1 
ATOM   960  C CG    . PRO A 1 132 ? 38.521  62.564 -10.669 1.00 40.87 ? 122 PRO A CG    1 
ATOM   961  C CD    . PRO A 1 132 ? 38.726  61.917 -12.009 1.00 41.37 ? 122 PRO A CD    1 
ATOM   962  N N     . GLU A 1 133 ? 36.612  64.613 -13.701 1.00 41.49 ? 123 GLU A N     1 
ATOM   963  C CA    . GLU A 1 133 ? 36.086  65.645 -14.601 1.00 41.72 ? 123 GLU A CA    1 
ATOM   964  C C     . GLU A 1 133 ? 34.803  65.223 -15.313 1.00 41.23 ? 123 GLU A C     1 
ATOM   965  O O     . GLU A 1 133 ? 33.957  66.064 -15.609 1.00 41.84 ? 123 GLU A O     1 
ATOM   966  C CB    . GLU A 1 133 ? 37.149  66.063 -15.630 1.00 41.69 ? 123 GLU A CB    1 
ATOM   967  C CG    . GLU A 1 133 ? 36.658  67.019 -16.704 1.00 42.89 ? 123 GLU A CG    1 
ATOM   968  C CD    . GLU A 1 133 ? 35.961  68.261 -16.142 1.00 43.99 ? 123 GLU A CD    1 
ATOM   969  O OE1   . GLU A 1 133 ? 34.958  68.707 -16.753 1.00 44.62 ? 123 GLU A OE1   1 
ATOM   970  O OE2   . GLU A 1 133 ? 36.409  68.775 -15.093 1.00 44.16 ? 123 GLU A OE2   1 
ATOM   971  N N     . LYS A 1 134 ? 34.663  63.929 -15.586 1.00 41.01 ? 124 LYS A N     1 
ATOM   972  C CA    . LYS A 1 134 ? 33.495  63.397 -16.296 1.00 41.23 ? 124 LYS A CA    1 
ATOM   973  C C     . LYS A 1 134 ? 32.153  63.578 -15.558 1.00 41.20 ? 124 LYS A C     1 
ATOM   974  O O     . LYS A 1 134 ? 31.086  63.527 -16.180 1.00 40.96 ? 124 LYS A O     1 
ATOM   975  C CB    . LYS A 1 134 ? 33.707  61.922 -16.654 1.00 41.73 ? 124 LYS A CB    1 
ATOM   976  C CG    . LYS A 1 134 ? 34.569  61.675 -17.909 1.00 43.03 ? 124 LYS A CG    1 
ATOM   977  C CD    . LYS A 1 134 ? 34.566  60.197 -18.271 1.00 46.60 ? 124 LYS A CD    1 
ATOM   978  C CE    . LYS A 1 134 ? 34.895  59.966 -19.754 1.00 48.86 ? 124 LYS A CE    1 
ATOM   979  N NZ    . LYS A 1 134 ? 36.329  59.619 -19.969 1.00 49.78 ? 124 LYS A NZ    1 
ATOM   980  N N     . LEU A 1 135 ? 32.218  63.765 -14.240 1.00 40.96 ? 125 LEU A N     1 
ATOM   981  C CA    . LEU A 1 135 ? 31.031  64.003 -13.410 1.00 41.05 ? 125 LEU A CA    1 
ATOM   982  C C     . LEU A 1 135 ? 30.492  65.423 -13.582 1.00 41.53 ? 125 LEU A C     1 
ATOM   983  O O     . LEU A 1 135 ? 29.374  65.728 -13.143 1.00 41.69 ? 125 LEU A O     1 
ATOM   984  C CB    . LEU A 1 135 ? 31.344  63.746 -11.932 1.00 40.36 ? 125 LEU A CB    1 
ATOM   985  C CG    . LEU A 1 135 ? 31.553  62.285 -11.509 1.00 38.25 ? 125 LEU A CG    1 
ATOM   986  C CD1   . LEU A 1 135 ? 32.295  62.200 -10.167 1.00 35.33 ? 125 LEU A CD1   1 
ATOM   987  C CD2   . LEU A 1 135 ? 30.220  61.526 -11.474 1.00 35.04 ? 125 LEU A CD2   1 
ATOM   988  N N     . ASN A 1 136 ? 31.301  66.290 -14.190 1.00 41.81 ? 126 ASN A N     1 
ATOM   989  C CA    . ASN A 1 136 ? 30.870  67.655 -14.504 1.00 42.74 ? 126 ASN A CA    1 
ATOM   990  C C     . ASN A 1 136 ? 30.200  67.743 -15.872 1.00 42.49 ? 126 ASN A C     1 
ATOM   991  O O     . ASN A 1 136 ? 29.784  68.823 -16.284 1.00 42.72 ? 126 ASN A O     1 
ATOM   992  C CB    . ASN A 1 136 ? 32.030  68.661 -14.403 1.00 42.81 ? 126 ASN A CB    1 
ATOM   993  C CG    . ASN A 1 136 ? 32.524  68.864 -12.962 1.00 44.85 ? 126 ASN A CG    1 
ATOM   994  O OD1   . ASN A 1 136 ? 33.731  68.912 -12.710 1.00 46.28 ? 126 ASN A OD1   1 
ATOM   995  N ND2   . ASN A 1 136 ? 31.593  68.994 -12.021 1.00 45.60 ? 126 ASN A ND2   1 
ATOM   996  N N     . ASN A 1 137 ? 30.098  66.610 -16.568 1.00 42.68 ? 127 ASN A N     1 
ATOM   997  C CA    . ASN A 1 137 ? 29.440  66.566 -17.876 1.00 42.84 ? 127 ASN A CA    1 
ATOM   998  C C     . ASN A 1 137 ? 27.942  66.373 -17.696 1.00 42.37 ? 127 ASN A C     1 
ATOM   999  O O     . ASN A 1 137 ? 27.382  65.360 -18.092 1.00 42.92 ? 127 ASN A O     1 
ATOM   1000 C CB    . ASN A 1 137 ? 29.986  65.432 -18.752 1.00 43.07 ? 127 ASN A CB    1 
ATOM   1001 C CG    . ASN A 1 137 ? 31.434  65.626 -19.139 1.00 43.95 ? 127 ASN A CG    1 
ATOM   1002 O OD1   . ASN A 1 137 ? 32.008  66.704 -18.961 1.00 45.85 ? 127 ASN A OD1   1 
ATOM   1003 N ND2   . ASN A 1 137 ? 32.042  64.566 -19.675 1.00 45.97 ? 127 ASN A ND2   1 
ATOM   1004 N N     . TYR A 1 138 ? 27.293  67.340 -17.071 1.00 41.56 ? 128 TYR A N     1 
ATOM   1005 C CA    . TYR A 1 138 ? 25.862  67.264 -16.909 1.00 40.83 ? 128 TYR A CA    1 
ATOM   1006 C C     . TYR A 1 138 ? 25.221  68.435 -17.650 1.00 41.41 ? 128 TYR A C     1 
ATOM   1007 O O     . TYR A 1 138 ? 25.892  69.405 -17.981 1.00 41.01 ? 128 TYR A O     1 
ATOM   1008 C CB    . TYR A 1 138 ? 25.492  67.275 -15.423 1.00 39.86 ? 128 TYR A CB    1 
ATOM   1009 C CG    . TYR A 1 138 ? 26.114  68.410 -14.646 1.00 36.91 ? 128 TYR A CG    1 
ATOM   1010 C CD1   . TYR A 1 138 ? 25.595  69.702 -14.727 1.00 34.25 ? 128 TYR A CD1   1 
ATOM   1011 C CD2   . TYR A 1 138 ? 27.223  68.193 -13.824 1.00 31.69 ? 128 TYR A CD2   1 
ATOM   1012 C CE1   . TYR A 1 138 ? 26.163  70.749 -14.009 1.00 32.60 ? 128 TYR A CE1   1 
ATOM   1013 C CE2   . TYR A 1 138 ? 27.790  69.227 -13.104 1.00 31.46 ? 128 TYR A CE2   1 
ATOM   1014 C CZ    . TYR A 1 138 ? 27.253  70.497 -13.195 1.00 31.84 ? 128 TYR A CZ    1 
ATOM   1015 O OH    . TYR A 1 138 ? 27.821  71.528 -12.499 1.00 31.71 ? 128 TYR A OH    1 
ATOM   1016 N N     . GLU A 1 139 ? 23.920  68.340 -17.902 1.00 41.79 ? 129 GLU A N     1 
ATOM   1017 C CA    . GLU A 1 139 ? 23.177  69.482 -18.409 1.00 42.21 ? 129 GLU A CA    1 
ATOM   1018 C C     . GLU A 1 139 ? 23.053  70.531 -17.294 1.00 41.65 ? 129 GLU A C     1 
ATOM   1019 O O     . GLU A 1 139 ? 22.463  70.269 -16.251 1.00 41.41 ? 129 GLU A O     1 
ATOM   1020 C CB    . GLU A 1 139 ? 21.810  69.035 -18.947 1.00 42.86 ? 129 GLU A CB    1 
ATOM   1021 C CG    . GLU A 1 139 ? 21.027  70.127 -19.691 1.00 45.39 ? 129 GLU A CG    1 
ATOM   1022 C CD    . GLU A 1 139 ? 19.681  69.629 -20.182 1.00 49.88 ? 129 GLU A CD    1 
ATOM   1023 O OE1   . GLU A 1 139 ? 18.643  70.195 -19.765 1.00 52.91 ? 129 GLU A OE1   1 
ATOM   1024 O OE2   . GLU A 1 139 ? 19.657  68.657 -20.972 1.00 52.00 ? 129 GLU A OE2   1 
ATOM   1025 N N     . PRO A 1 140 ? 23.656  71.713 -17.495 1.00 41.75 ? 130 PRO A N     1 
ATOM   1026 C CA    . PRO A 1 140 ? 23.569  72.757 -16.487 1.00 41.51 ? 130 PRO A CA    1 
ATOM   1027 C C     . PRO A 1 140 ? 22.141  73.240 -16.417 1.00 41.70 ? 130 PRO A C     1 
ATOM   1028 O O     . PRO A 1 140 ? 21.384  73.052 -17.387 1.00 41.31 ? 130 PRO A O     1 
ATOM   1029 C CB    . PRO A 1 140 ? 24.474  73.867 -17.039 1.00 41.47 ? 130 PRO A CB    1 
ATOM   1030 C CG    . PRO A 1 140 ? 25.345  73.203 -18.055 1.00 41.86 ? 130 PRO A CG    1 
ATOM   1031 C CD    . PRO A 1 140 ? 24.470  72.139 -18.652 1.00 41.78 ? 130 PRO A CD    1 
ATOM   1032 N N     . PHE A 1 141 ? 21.776  73.818 -15.273 1.00 41.47 ? 131 PHE A N     1 
ATOM   1033 C CA    . PHE A 1 141 ? 20.435  74.365 -15.050 1.00 42.19 ? 131 PHE A CA    1 
ATOM   1034 C C     . PHE A 1 141 ? 19.337  73.296 -15.188 1.00 42.21 ? 131 PHE A C     1 
ATOM   1035 O O     . PHE A 1 141 ? 18.243  73.554 -15.719 1.00 42.82 ? 131 PHE A O     1 
ATOM   1036 C CB    . PHE A 1 141 ? 20.208  75.613 -15.935 1.00 42.23 ? 131 PHE A CB    1 
ATOM   1037 C CG    . PHE A 1 141 ? 21.253  76.690 -15.717 1.00 42.62 ? 131 PHE A CG    1 
ATOM   1038 C CD1   . PHE A 1 141 ? 21.303  77.399 -14.511 1.00 42.83 ? 131 PHE A CD1   1 
ATOM   1039 C CD2   . PHE A 1 141 ? 22.212  76.960 -16.687 1.00 43.64 ? 131 PHE A CD2   1 
ATOM   1040 C CE1   . PHE A 1 141 ? 22.280  78.373 -14.287 1.00 43.35 ? 131 PHE A CE1   1 
ATOM   1041 C CE2   . PHE A 1 141 ? 23.191  77.934 -16.472 1.00 42.13 ? 131 PHE A CE2   1 
ATOM   1042 C CZ    . PHE A 1 141 ? 23.223  78.639 -15.267 1.00 42.77 ? 131 PHE A CZ    1 
ATOM   1043 N N     . SER A 1 142 ? 19.649  72.097 -14.689 1.00 41.78 ? 132 SER A N     1 
ATOM   1044 C CA    . SER A 1 142 ? 18.752  70.947 -14.725 1.00 40.97 ? 132 SER A CA    1 
ATOM   1045 C C     . SER A 1 142 ? 18.919  70.137 -13.429 1.00 40.77 ? 132 SER A C     1 
ATOM   1046 O O     . SER A 1 142 ? 19.877  70.355 -12.689 1.00 40.39 ? 132 SER A O     1 
ATOM   1047 C CB    . SER A 1 142 ? 19.059  70.072 -15.956 1.00 41.27 ? 132 SER A CB    1 
ATOM   1048 O OG    . SER A 1 142 ? 19.997  69.037 -15.665 1.00 40.67 ? 132 SER A OG    1 
ATOM   1049 N N     . PRO A 1 143 ? 17.986  69.205 -13.146 1.00 40.55 ? 133 PRO A N     1 
ATOM   1050 C CA    . PRO A 1 143 ? 18.109  68.280 -12.001 1.00 39.93 ? 133 PRO A CA    1 
ATOM   1051 C C     . PRO A 1 143 ? 19.346  67.391 -12.039 1.00 39.31 ? 133 PRO A C     1 
ATOM   1052 O O     . PRO A 1 143 ? 19.703  66.785 -11.030 1.00 38.73 ? 133 PRO A O     1 
ATOM   1053 C CB    . PRO A 1 143 ? 16.845  67.420 -12.119 1.00 40.10 ? 133 PRO A CB    1 
ATOM   1054 C CG    . PRO A 1 143 ? 15.832  68.389 -12.663 1.00 40.80 ? 133 PRO A CG    1 
ATOM   1055 C CD    . PRO A 1 143 ? 16.620  69.180 -13.709 1.00 40.54 ? 133 PRO A CD    1 
ATOM   1056 N N     . GLU A 1 144 ? 20.002  67.331 -13.187 1.00 39.00 ? 134 GLU A N     1 
ATOM   1057 C CA    . GLU A 1 144 ? 21.188  66.508 -13.347 1.00 39.30 ? 134 GLU A CA    1 
ATOM   1058 C C     . GLU A 1 144 ? 22.437  67.096 -12.673 1.00 38.24 ? 134 GLU A C     1 
ATOM   1059 O O     . GLU A 1 144 ? 23.448  66.410 -12.539 1.00 38.10 ? 134 GLU A O     1 
ATOM   1060 C CB    . GLU A 1 144 ? 21.458  66.242 -14.827 1.00 40.06 ? 134 GLU A CB    1 
ATOM   1061 C CG    . GLU A 1 144 ? 22.468  65.131 -15.048 1.00 43.60 ? 134 GLU A CG    1 
ATOM   1062 C CD    . GLU A 1 144 ? 22.574  64.705 -16.494 1.00 47.97 ? 134 GLU A CD    1 
ATOM   1063 O OE1   . GLU A 1 144 ? 22.338  65.547 -17.403 1.00 49.83 ? 134 GLU A OE1   1 
ATOM   1064 O OE2   . GLU A 1 144 ? 22.906  63.522 -16.711 1.00 48.28 ? 134 GLU A OE2   1 
ATOM   1065 N N     . VAL A 1 145 ? 22.368  68.359 -12.256 1.00 37.14 ? 135 VAL A N     1 
ATOM   1066 C CA    . VAL A 1 145 ? 23.527  69.018 -11.640 1.00 36.00 ? 135 VAL A CA    1 
ATOM   1067 C C     . VAL A 1 145 ? 24.145  68.141 -10.529 1.00 35.55 ? 135 VAL A C     1 
ATOM   1068 O O     . VAL A 1 145 ? 23.451  67.760 -9.567  1.00 33.84 ? 135 VAL A O     1 
ATOM   1069 C CB    . VAL A 1 145 ? 23.156  70.413 -11.100 1.00 35.89 ? 135 VAL A CB    1 
ATOM   1070 C CG1   . VAL A 1 145 ? 24.242  70.947 -10.160 1.00 36.28 ? 135 VAL A CG1   1 
ATOM   1071 C CG2   . VAL A 1 145 ? 22.901  71.411 -12.275 1.00 35.92 ? 135 VAL A CG2   1 
ATOM   1072 N N     . TYR A 1 146 ? 25.433  67.810 -10.704 1.00 34.33 ? 136 TYR A N     1 
ATOM   1073 C CA    . TYR A 1 146 ? 26.187  66.983 -9.756  1.00 34.06 ? 136 TYR A CA    1 
ATOM   1074 C C     . TYR A 1 146 ? 26.883  67.843 -8.708  1.00 33.55 ? 136 TYR A C     1 
ATOM   1075 O O     . TYR A 1 146 ? 27.432  68.884 -9.018  1.00 34.48 ? 136 TYR A O     1 
ATOM   1076 C CB    . TYR A 1 146 ? 27.235  66.133 -10.489 1.00 33.39 ? 136 TYR A CB    1 
ATOM   1077 C CG    . TYR A 1 146 ? 27.934  65.114 -9.614  1.00 32.96 ? 136 TYR A CG    1 
ATOM   1078 C CD1   . TYR A 1 146 ? 27.350  63.867 -9.362  1.00 33.99 ? 136 TYR A CD1   1 
ATOM   1079 C CD2   . TYR A 1 146 ? 29.177  65.386 -9.041  1.00 31.75 ? 136 TYR A CD2   1 
ATOM   1080 C CE1   . TYR A 1 146 ? 27.988  62.921 -8.564  1.00 33.77 ? 136 TYR A CE1   1 
ATOM   1081 C CE2   . TYR A 1 146 ? 29.828  64.436 -8.238  1.00 30.71 ? 136 TYR A CE2   1 
ATOM   1082 C CZ    . TYR A 1 146 ? 29.224  63.212 -8.006  1.00 32.53 ? 136 TYR A CZ    1 
ATOM   1083 O OH    . TYR A 1 146 ? 29.841  62.268 -7.231  1.00 32.51 ? 136 TYR A OH    1 
ATOM   1084 N N     . GLY A 1 147 ? 26.839  67.386 -7.468  1.00 33.85 ? 137 GLY A N     1 
ATOM   1085 C CA    . GLY A 1 147 ? 27.635  67.933 -6.361  1.00 33.08 ? 137 GLY A CA    1 
ATOM   1086 C C     . GLY A 1 147 ? 27.665  66.867 -5.279  1.00 32.63 ? 137 GLY A C     1 
ATOM   1087 O O     . GLY A 1 147 ? 26.742  66.051 -5.211  1.00 32.60 ? 137 GLY A O     1 
ATOM   1088 N N     . GLU A 1 148 ? 28.707  66.858 -4.436  1.00 30.94 ? 138 GLU A N     1 
ATOM   1089 C CA    . GLU A 1 148 ? 28.831  65.832 -3.401  1.00 30.49 ? 138 GLU A CA    1 
ATOM   1090 C C     . GLU A 1 148 ? 28.721  66.470 -2.035  1.00 30.13 ? 138 GLU A C     1 
ATOM   1091 O O     . GLU A 1 148 ? 29.320  67.509 -1.774  1.00 30.94 ? 138 GLU A O     1 
ATOM   1092 C CB    . GLU A 1 148 ? 30.149  65.023 -3.516  1.00 30.45 ? 138 GLU A CB    1 
ATOM   1093 C CG    . GLU A 1 148 ? 30.542  64.693 -4.964  1.00 31.07 ? 138 GLU A CG    1 
ATOM   1094 C CD    . GLU A 1 148 ? 31.839  63.887 -5.119  1.00 32.06 ? 138 GLU A CD    1 
ATOM   1095 O OE1   . GLU A 1 148 ? 32.725  63.918 -4.230  1.00 32.45 ? 138 GLU A OE1   1 
ATOM   1096 O OE2   . GLU A 1 148 ? 31.975  63.233 -6.161  1.00 31.25 ? 138 GLU A OE2   1 
ATOM   1097 N N     . THR A 1 149 ? 27.903  65.857 -1.197  1.00 29.47 ? 139 THR A N     1 
ATOM   1098 C CA    . THR A 1 149 ? 27.798  66.187 0.200   1.00 29.54 ? 139 THR A CA    1 
ATOM   1099 C C     . THR A 1 149 ? 29.111  65.698 0.814   1.00 29.24 ? 139 THR A C     1 
ATOM   1100 O O     . THR A 1 149 ? 29.546  64.601 0.507   1.00 28.78 ? 139 THR A O     1 
ATOM   1101 C CB    . THR A 1 149 ? 26.621  65.433 0.808   1.00 29.35 ? 139 THR A CB    1 
ATOM   1102 O OG1   . THR A 1 149 ? 25.415  65.829 0.133   1.00 30.79 ? 139 THR A OG1   1 
ATOM   1103 C CG2   . THR A 1 149 ? 26.488  65.726 2.310   1.00 29.50 ? 139 THR A CG2   1 
ATOM   1104 N N     . SER A 1 150 ? 29.742  66.532 1.632   1.00 28.79 ? 140 SER A N     1 
ATOM   1105 C CA    . SER A 1 150 ? 31.016  66.184 2.271   1.00 29.20 ? 140 SER A CA    1 
ATOM   1106 C C     . SER A 1 150 ? 30.844  65.083 3.325   1.00 28.32 ? 140 SER A C     1 
ATOM   1107 O O     . SER A 1 150 ? 29.764  64.927 3.905   1.00 27.71 ? 140 SER A O     1 
ATOM   1108 C CB    . SER A 1 150 ? 31.626  67.414 2.937   1.00 29.37 ? 140 SER A CB    1 
ATOM   1109 O OG    . SER A 1 150 ? 30.821  67.801 4.052   1.00 32.07 ? 140 SER A OG    1 
ATOM   1110 N N     . PHE A 1 151 ? 31.920  64.333 3.565   1.00 27.32 ? 141 PHE A N     1 
ATOM   1111 C CA    . PHE A 1 151 ? 31.960  63.337 4.644   1.00 26.97 ? 141 PHE A CA    1 
ATOM   1112 C C     . PHE A 1 151 ? 31.508  63.937 5.970   1.00 26.37 ? 141 PHE A C     1 
ATOM   1113 O O     . PHE A 1 151 ? 30.720  63.325 6.696   1.00 26.07 ? 141 PHE A O     1 
ATOM   1114 C CB    . PHE A 1 151 ? 33.393  62.782 4.803   1.00 27.12 ? 141 PHE A CB    1 
ATOM   1115 C CG    . PHE A 1 151 ? 33.536  61.741 5.896   1.00 26.82 ? 141 PHE A CG    1 
ATOM   1116 C CD1   . PHE A 1 151 ? 33.569  60.393 5.582   1.00 26.58 ? 141 PHE A CD1   1 
ATOM   1117 C CD2   . PHE A 1 151 ? 33.671  62.121 7.235   1.00 28.22 ? 141 PHE A CD2   1 
ATOM   1118 C CE1   . PHE A 1 151 ? 33.714  59.429 6.572   1.00 26.09 ? 141 PHE A CE1   1 
ATOM   1119 C CE2   . PHE A 1 151 ? 33.801  61.169 8.252   1.00 24.92 ? 141 PHE A CE2   1 
ATOM   1120 C CZ    . PHE A 1 151 ? 33.830  59.815 7.915   1.00 29.27 ? 141 PHE A CZ    1 
ATOM   1121 N N     . ASP A 1 152 ? 32.012  65.126 6.291   1.00 26.32 ? 142 ASP A N     1 
ATOM   1122 C CA    . ASP A 1 152 ? 31.662  65.808 7.539   1.00 27.34 ? 142 ASP A CA    1 
ATOM   1123 C C     . ASP A 1 152 ? 30.153  66.046 7.732   1.00 27.40 ? 142 ASP A C     1 
ATOM   1124 O O     . ASP A 1 152 ? 29.619  65.820 8.827   1.00 26.37 ? 142 ASP A O     1 
ATOM   1125 C CB    . ASP A 1 152 ? 32.460  67.124 7.666   1.00 28.90 ? 142 ASP A CB    1 
ATOM   1126 C CG    . ASP A 1 152 ? 33.938  66.878 7.928   1.00 30.35 ? 142 ASP A CG    1 
ATOM   1127 O OD1   . ASP A 1 152 ? 34.280  65.778 8.407   1.00 33.06 ? 142 ASP A OD1   1 
ATOM   1128 O OD2   . ASP A 1 152 ? 34.762  67.775 7.663   1.00 33.89 ? 142 ASP A OD2   1 
ATOM   1129 N N     . LEU A 1 153 ? 29.462  66.488 6.681   1.00 27.50 ? 143 LEU A N     1 
ATOM   1130 C CA    . LEU A 1 153 ? 28.005  66.648 6.790   1.00 28.32 ? 143 LEU A CA    1 
ATOM   1131 C C     . LEU A 1 153 ? 27.245  65.320 6.948   1.00 27.57 ? 143 LEU A C     1 
ATOM   1132 O O     . LEU A 1 153 ? 26.363  65.205 7.811   1.00 27.37 ? 143 LEU A O     1 
ATOM   1133 C CB    . LEU A 1 153 ? 27.402  67.463 5.648   1.00 28.84 ? 143 LEU A CB    1 
ATOM   1134 C CG    . LEU A 1 153 ? 25.935  67.678 6.048   1.00 31.88 ? 143 LEU A CG    1 
ATOM   1135 C CD1   . LEU A 1 153 ? 25.649  69.105 6.436   1.00 34.05 ? 143 LEU A CD1   1 
ATOM   1136 C CD2   . LEU A 1 153 ? 24.996  67.183 4.973   1.00 34.85 ? 143 LEU A CD2   1 
ATOM   1137 N N     . VAL A 1 154 ? 27.579  64.328 6.127   1.00 27.19 ? 144 VAL A N     1 
ATOM   1138 C CA    . VAL A 1 154 ? 27.046  62.976 6.297   1.00 26.52 ? 144 VAL A CA    1 
ATOM   1139 C C     . VAL A 1 154 ? 27.255  62.498 7.748   1.00 27.53 ? 144 VAL A C     1 
ATOM   1140 O O     . VAL A 1 154 ? 26.305  61.991 8.387   1.00 26.59 ? 144 VAL A O     1 
ATOM   1141 C CB    . VAL A 1 154 ? 27.658  61.966 5.274   1.00 26.70 ? 144 VAL A CB    1 
ATOM   1142 C CG1   . VAL A 1 154 ? 27.036  60.587 5.411   1.00 26.17 ? 144 VAL A CG1   1 
ATOM   1143 C CG2   . VAL A 1 154 ? 27.463  62.443 3.830   1.00 26.38 ? 144 VAL A CG2   1 
ATOM   1144 N N     . ALA A 1 155 ? 28.476  62.669 8.284   1.00 27.51 ? 145 ALA A N     1 
ATOM   1145 C CA    . ALA A 1 155 ? 28.757  62.214 9.659   1.00 29.73 ? 145 ALA A CA    1 
ATOM   1146 C C     . ALA A 1 155 ? 27.864  62.944 10.672  1.00 30.86 ? 145 ALA A C     1 
ATOM   1147 O O     . ALA A 1 155 ? 27.371  62.332 11.625  1.00 31.35 ? 145 ALA A O     1 
ATOM   1148 C CB    . ALA A 1 155 ? 30.240  62.381 10.038  1.00 28.72 ? 145 ALA A CB    1 
ATOM   1149 N N     . GLN A 1 156 ? 27.661  64.242 10.461  1.00 32.20 ? 146 GLN A N     1 
ATOM   1150 C CA    . GLN A 1 156 ? 26.706  64.993 11.278  1.00 34.08 ? 146 GLN A CA    1 
ATOM   1151 C C     . GLN A 1 156 ? 25.296  64.397 11.200  1.00 35.34 ? 146 GLN A C     1 
ATOM   1152 O O     . GLN A 1 156 ? 24.596  64.279 12.205  1.00 35.71 ? 146 GLN A O     1 
ATOM   1153 C CB    . GLN A 1 156 ? 26.646  66.460 10.855  1.00 33.60 ? 146 GLN A CB    1 
ATOM   1154 C CG    . GLN A 1 156 ? 25.801  67.277 11.831  1.00 34.81 ? 146 GLN A CG    1 
ATOM   1155 C CD    . GLN A 1 156 ? 25.533  68.686 11.376  1.00 35.36 ? 146 GLN A CD    1 
ATOM   1156 O OE1   . GLN A 1 156 ? 25.696  69.025 10.202  1.00 36.94 ? 146 GLN A OE1   1 
ATOM   1157 N NE2   . GLN A 1 156 ? 25.102  69.521 12.305  1.00 35.80 ? 146 GLN A NE2   1 
ATOM   1158 N N     . MET A 1 157 ? 24.867  64.048 10.000  1.00 36.46 ? 147 MET A N     1 
ATOM   1159 C CA    . MET A 1 157 ? 23.551  63.482 9.852   1.00 38.71 ? 147 MET A CA    1 
ATOM   1160 C C     . MET A 1 157 ? 23.416  62.160 10.609  1.00 40.33 ? 147 MET A C     1 
ATOM   1161 O O     . MET A 1 157 ? 22.401  61.925 11.280  1.00 40.99 ? 147 MET A O     1 
ATOM   1162 C CB    . MET A 1 157 ? 23.203  63.305 8.389   1.00 38.04 ? 147 MET A CB    1 
ATOM   1163 C CG    . MET A 1 157 ? 22.170  62.235 8.226   1.00 39.07 ? 147 MET A CG    1 
ATOM   1164 S SD    . MET A 1 157 ? 21.634  62.094 6.559   1.00 38.60 ? 147 MET A SD    1 
ATOM   1165 C CE    . MET A 1 157 ? 22.922  61.062 5.868   1.00 40.28 ? 147 MET A CE    1 
ATOM   1166 N N     . ILE A 1 158 ? 24.431  61.306 10.490  1.00 41.43 ? 148 ILE A N     1 
ATOM   1167 C CA    . ILE A 1 158 ? 24.493  60.056 11.242  1.00 43.58 ? 148 ILE A CA    1 
ATOM   1168 C C     . ILE A 1 158 ? 24.458  60.331 12.761  1.00 45.32 ? 148 ILE A C     1 
ATOM   1169 O O     . ILE A 1 158 ? 23.613  59.785 13.465  1.00 46.27 ? 148 ILE A O     1 
ATOM   1170 C CB    . ILE A 1 158 ? 25.737  59.197 10.851  1.00 42.64 ? 148 ILE A CB    1 
ATOM   1171 C CG1   . ILE A 1 158 ? 25.679  58.794 9.364   1.00 41.40 ? 148 ILE A CG1   1 
ATOM   1172 C CG2   . ILE A 1 158 ? 25.829  57.950 11.732  1.00 42.90 ? 148 ILE A CG2   1 
ATOM   1173 C CD1   . ILE A 1 158 ? 27.026  58.282 8.786   1.00 37.97 ? 148 ILE A CD1   1 
ATOM   1174 N N     . ASP A 1 159 ? 25.348  61.200 13.241  1.00 47.38 ? 149 ASP A N     1 
ATOM   1175 C CA    . ASP A 1 159 ? 25.430  61.556 14.666  1.00 48.89 ? 149 ASP A CA    1 
ATOM   1176 C C     . ASP A 1 159 ? 24.094  61.992 15.280  1.00 49.92 ? 149 ASP A C     1 
ATOM   1177 O O     . ASP A 1 159 ? 23.778  61.620 16.418  1.00 49.85 ? 149 ASP A O     1 
ATOM   1178 C CB    . ASP A 1 159 ? 26.457  62.669 14.884  1.00 49.11 ? 149 ASP A CB    1 
ATOM   1179 C CG    . ASP A 1 159 ? 27.890  62.159 14.938  1.00 50.49 ? 149 ASP A CG    1 
ATOM   1180 O OD1   . ASP A 1 159 ? 28.107  60.966 15.247  1.00 50.90 ? 149 ASP A OD1   1 
ATOM   1181 O OD2   . ASP A 1 159 ? 28.812  62.968 14.674  1.00 52.23 ? 149 ASP A OD2   1 
ATOM   1182 N N     . GLU A 1 160 ? 23.315  62.764 14.520  1.00 51.11 ? 150 GLU A N     1 
ATOM   1183 C CA    . GLU A 1 160 ? 22.114  63.427 15.040  1.00 51.95 ? 150 GLU A CA    1 
ATOM   1184 C C     . GLU A 1 160 ? 20.790  62.700 14.776  1.00 52.71 ? 150 GLU A C     1 
ATOM   1185 O O     . GLU A 1 160 ? 19.953  62.587 15.678  1.00 52.65 ? 150 GLU A O     1 
ATOM   1186 C CB    . GLU A 1 160 ? 22.056  64.884 14.560  1.00 52.23 ? 150 GLU A CB    1 
ATOM   1187 C CG    . GLU A 1 160 ? 23.050  65.802 15.296  1.00 52.13 ? 150 GLU A CG    1 
ATOM   1188 C CD    . GLU A 1 160 ? 23.101  67.223 14.745  1.00 52.60 ? 150 GLU A CD    1 
ATOM   1189 O OE1   . GLU A 1 160 ? 22.093  67.680 14.156  1.00 52.33 ? 150 GLU A OE1   1 
ATOM   1190 O OE2   . GLU A 1 160 ? 24.156  67.886 14.907  1.00 52.40 ? 150 GLU A OE2   1 
ATOM   1191 N N     . ILE A 1 161 ? 20.583  62.216 13.552  1.00 53.12 ? 151 ILE A N     1 
ATOM   1192 C CA    . ILE A 1 161 ? 19.423  61.366 13.294  1.00 53.32 ? 151 ILE A CA    1 
ATOM   1193 C C     . ILE A 1 161 ? 19.855  59.958 13.665  1.00 53.64 ? 151 ILE A C     1 
ATOM   1194 O O     . ILE A 1 161 ? 20.685  59.350 12.979  1.00 54.11 ? 151 ILE A O     1 
ATOM   1195 C CB    . ILE A 1 161 ? 18.919  61.441 11.824  1.00 53.57 ? 151 ILE A CB    1 
ATOM   1196 C CG1   . ILE A 1 161 ? 19.401  60.228 11.014  1.00 53.40 ? 151 ILE A CG1   1 
ATOM   1197 C CG2   . ILE A 1 161 ? 19.280  62.783 11.178  1.00 52.89 ? 151 ILE A CG2   1 
ATOM   1198 C CD1   . ILE A 1 161 ? 19.594  60.485 9.543   1.00 55.23 ? 151 ILE A CD1   1 
ATOM   1199 N N     . LYS A 1 162 ? 19.336  59.432 14.764  1.00 53.55 ? 152 LYS A N     1 
ATOM   1200 C CA    . LYS A 1 162 ? 19.858  58.159 15.218  1.00 53.62 ? 152 LYS A CA    1 
ATOM   1201 C C     . LYS A 1 162 ? 19.034  57.034 14.639  1.00 53.11 ? 152 LYS A C     1 
ATOM   1202 O O     . LYS A 1 162 ? 17.834  56.931 14.882  1.00 53.49 ? 152 LYS A O     1 
ATOM   1203 C CB    . LYS A 1 162 ? 20.034  58.104 16.745  1.00 53.92 ? 152 LYS A CB    1 
ATOM   1204 C CG    . LYS A 1 162 ? 21.289  58.890 17.184  1.00 55.43 ? 152 LYS A CG    1 
ATOM   1205 C CD    . LYS A 1 162 ? 21.667  58.706 18.650  1.00 56.95 ? 152 LYS A CD    1 
ATOM   1206 C CE    . LYS A 1 162 ? 21.186  59.867 19.513  1.00 57.65 ? 152 LYS A CE    1 
ATOM   1207 N NZ    . LYS A 1 162 ? 21.735  61.190 19.071  1.00 57.09 ? 152 LYS A NZ    1 
ATOM   1208 N N     . MET A 1 163 ? 19.693  56.239 13.807  1.00 51.98 ? 153 MET A N     1 
ATOM   1209 C CA    . MET A 1 163 ? 19.059  55.124 13.138  1.00 51.29 ? 153 MET A CA    1 
ATOM   1210 C C     . MET A 1 163 ? 19.271  53.870 13.969  1.00 50.69 ? 153 MET A C     1 
ATOM   1211 O O     . MET A 1 163 ? 20.284  53.723 14.643  1.00 50.32 ? 153 MET A O     1 
ATOM   1212 C CB    . MET A 1 163 ? 19.645  54.934 11.737  1.00 51.11 ? 153 MET A CB    1 
ATOM   1213 C CG    . MET A 1 163 ? 19.069  55.862 10.657  1.00 51.28 ? 153 MET A CG    1 
ATOM   1214 S SD    . MET A 1 163 ? 20.076  55.847 9.149   1.00 50.23 ? 153 MET A SD    1 
ATOM   1215 C CE    . MET A 1 163 ? 21.097  57.287 9.414   1.00 50.06 ? 153 MET A CE    1 
ATOM   1216 N N     . THR A 1 164 ? 18.295  52.977 13.921  1.00 50.54 ? 154 THR A N     1 
ATOM   1217 C CA    . THR A 1 164 ? 18.405  51.680 14.568  1.00 50.42 ? 154 THR A CA    1 
ATOM   1218 C C     . THR A 1 164 ? 18.235  50.617 13.507  1.00 50.01 ? 154 THR A C     1 
ATOM   1219 O O     . THR A 1 164 ? 18.043  50.926 12.325  1.00 49.76 ? 154 THR A O     1 
ATOM   1220 C CB    . THR A 1 164 ? 17.309  51.460 15.630  1.00 50.50 ? 154 THR A CB    1 
ATOM   1221 O OG1   . THR A 1 164 ? 16.137  50.945 14.988  1.00 50.94 ? 154 THR A OG1   1 
ATOM   1222 C CG2   . THR A 1 164 ? 16.981  52.762 16.382  1.00 50.86 ? 154 THR A CG2   1 
ATOM   1223 N N     . ASP A 1 165 ? 18.283  49.359 13.938  1.00 49.42 ? 155 ASP A N     1 
ATOM   1224 C CA    . ASP A 1 165 ? 18.140  48.223 13.035  1.00 48.88 ? 155 ASP A CA    1 
ATOM   1225 C C     . ASP A 1 165 ? 16.747  48.113 12.433  1.00 48.05 ? 155 ASP A C     1 
ATOM   1226 O O     . ASP A 1 165 ? 16.513  47.264 11.586  1.00 48.16 ? 155 ASP A O     1 
ATOM   1227 C CB    . ASP A 1 165 ? 18.516  46.933 13.756  1.00 49.50 ? 155 ASP A CB    1 
ATOM   1228 C CG    . ASP A 1 165 ? 18.132  46.966 15.214  1.00 51.07 ? 155 ASP A CG    1 
ATOM   1229 O OD1   . ASP A 1 165 ? 18.888  47.581 16.011  1.00 53.07 ? 155 ASP A OD1   1 
ATOM   1230 O OD2   . ASP A 1 165 ? 17.073  46.395 15.552  1.00 52.12 ? 155 ASP A OD2   1 
ATOM   1231 N N     . ASP A 1 166 ? 15.824  48.964 12.869  1.00 46.85 ? 156 ASP A N     1 
ATOM   1232 C CA    . ASP A 1 166 ? 14.503  49.023 12.248  1.00 46.52 ? 156 ASP A CA    1 
ATOM   1233 C C     . ASP A 1 166 ? 14.503  49.908 10.996  1.00 45.24 ? 156 ASP A C     1 
ATOM   1234 O O     . ASP A 1 166 ? 13.664  49.744 10.110  1.00 45.45 ? 156 ASP A O     1 
ATOM   1235 C CB    . ASP A 1 166 ? 13.458  49.524 13.257  1.00 47.23 ? 156 ASP A CB    1 
ATOM   1236 C CG    . ASP A 1 166 ? 13.402  48.664 14.513  1.00 49.11 ? 156 ASP A CG    1 
ATOM   1237 O OD1   . ASP A 1 166 ? 13.308  47.424 14.386  1.00 51.08 ? 156 ASP A OD1   1 
ATOM   1238 O OD2   . ASP A 1 166 ? 13.457  49.229 15.627  1.00 52.70 ? 156 ASP A OD2   1 
ATOM   1239 N N     . ASP A 1 167 ? 15.462  50.828 10.923  1.00 43.60 ? 157 ASP A N     1 
ATOM   1240 C CA    . ASP A 1 167 ? 15.447  51.876 9.906   1.00 41.85 ? 157 ASP A CA    1 
ATOM   1241 C C     . ASP A 1 167 ? 15.912  51.456 8.519   1.00 40.30 ? 157 ASP A C     1 
ATOM   1242 O O     . ASP A 1 167 ? 16.752  50.562 8.364   1.00 40.42 ? 157 ASP A O     1 
ATOM   1243 C CB    . ASP A 1 167 ? 16.184  53.114 10.402  1.00 42.42 ? 157 ASP A CB    1 
ATOM   1244 C CG    . ASP A 1 167 ? 15.313  53.972 11.282  1.00 42.87 ? 157 ASP A CG    1 
ATOM   1245 O OD1   . ASP A 1 167 ? 14.085  53.930 11.084  1.00 45.48 ? 157 ASP A OD1   1 
ATOM   1246 O OD2   . ASP A 1 167 ? 15.828  54.675 12.169  1.00 44.54 ? 157 ASP A OD2   1 
ATOM   1247 N N     . LEU A 1 168 ? 15.309  52.097 7.522   1.00 37.70 ? 158 LEU A N     1 
ATOM   1248 C CA    . LEU A 1 168 ? 15.629  51.898 6.124   1.00 35.58 ? 158 LEU A CA    1 
ATOM   1249 C C     . LEU A 1 168 ? 16.031  53.261 5.572   1.00 34.32 ? 158 LEU A C     1 
ATOM   1250 O O     . LEU A 1 168 ? 15.303  54.254 5.734   1.00 33.58 ? 158 LEU A O     1 
ATOM   1251 C CB    . LEU A 1 168 ? 14.424  51.335 5.360   1.00 35.71 ? 158 LEU A CB    1 
ATOM   1252 C CG    . LEU A 1 168 ? 14.004  49.881 5.606   1.00 37.76 ? 158 LEU A CG    1 
ATOM   1253 C CD1   . LEU A 1 168 ? 12.674  49.575 4.902   1.00 38.41 ? 158 LEU A CD1   1 
ATOM   1254 C CD2   . LEU A 1 168 ? 15.063  48.906 5.138   1.00 38.44 ? 158 LEU A CD2   1 
ATOM   1255 N N     . PHE A 1 169 ? 17.204  53.303 4.946   1.00 32.58 ? 159 PHE A N     1 
ATOM   1256 C CA    . PHE A 1 169 ? 17.801  54.548 4.508   1.00 31.38 ? 159 PHE A CA    1 
ATOM   1257 C C     . PHE A 1 169 ? 17.919  54.553 3.003   1.00 30.64 ? 159 PHE A C     1 
ATOM   1258 O O     . PHE A 1 169 ? 18.281  53.530 2.395   1.00 30.38 ? 159 PHE A O     1 
ATOM   1259 C CB    . PHE A 1 169 ? 19.184  54.744 5.150   1.00 31.07 ? 159 PHE A CB    1 
ATOM   1260 C CG    . PHE A 1 169 ? 19.943  55.929 4.609   1.00 31.50 ? 159 PHE A CG    1 
ATOM   1261 C CD1   . PHE A 1 169 ? 19.917  57.151 5.266   1.00 31.37 ? 159 PHE A CD1   1 
ATOM   1262 C CD2   . PHE A 1 169 ? 20.684  55.821 3.432   1.00 31.36 ? 159 PHE A CD2   1 
ATOM   1263 C CE1   . PHE A 1 169 ? 20.607  58.252 4.752   1.00 32.26 ? 159 PHE A CE1   1 
ATOM   1264 C CE2   . PHE A 1 169 ? 21.375  56.909 2.925   1.00 31.13 ? 159 PHE A CE2   1 
ATOM   1265 C CZ    . PHE A 1 169 ? 21.342  58.121 3.580   1.00 29.20 ? 159 PHE A CZ    1 
ATOM   1266 N N     . VAL A 1 170 ? 17.633  55.712 2.409   1.00 29.50 ? 160 VAL A N     1 
ATOM   1267 C CA    . VAL A 1 170 ? 17.690  55.888 0.957   1.00 28.98 ? 160 VAL A CA    1 
ATOM   1268 C C     . VAL A 1 170 ? 18.274  57.268 0.597   1.00 28.22 ? 160 VAL A C     1 
ATOM   1269 O O     . VAL A 1 170 ? 17.813  58.293 1.098   1.00 29.04 ? 160 VAL A O     1 
ATOM   1270 C CB    . VAL A 1 170 ? 16.291  55.750 0.291   1.00 29.01 ? 160 VAL A CB    1 
ATOM   1271 C CG1   . VAL A 1 170 ? 16.398  55.968 -1.231  1.00 29.47 ? 160 VAL A CG1   1 
ATOM   1272 C CG2   . VAL A 1 170 ? 15.648  54.352 0.581   1.00 30.11 ? 160 VAL A CG2   1 
ATOM   1273 N N     . ASP A 1 171 ? 19.291  57.270 -0.254  1.00 27.64 ? 161 ASP A N     1 
ATOM   1274 C CA    . ASP A 1 171 ? 19.804  58.480 -0.868  1.00 27.67 ? 161 ASP A CA    1 
ATOM   1275 C C     . ASP A 1 171 ? 19.153  58.560 -2.238  1.00 27.11 ? 161 ASP A C     1 
ATOM   1276 O O     . ASP A 1 171 ? 19.466  57.768 -3.132  1.00 27.02 ? 161 ASP A O     1 
ATOM   1277 C CB    . ASP A 1 171 ? 21.343  58.439 -0.993  1.00 27.24 ? 161 ASP A CB    1 
ATOM   1278 C CG    . ASP A 1 171 ? 21.921  59.734 -1.539  1.00 27.15 ? 161 ASP A CG    1 
ATOM   1279 O OD1   . ASP A 1 171 ? 21.140  60.662 -1.865  1.00 27.90 ? 161 ASP A OD1   1 
ATOM   1280 O OD2   . ASP A 1 171 ? 23.161  59.834 -1.653  1.00 26.31 ? 161 ASP A OD2   1 
ATOM   1281 N N     . LEU A 1 172 ? 18.225  59.504 -2.372  1.00 27.15 ? 162 LEU A N     1 
ATOM   1282 C CA    . LEU A 1 172 ? 17.567  59.796 -3.644  1.00 26.39 ? 162 LEU A CA    1 
ATOM   1283 C C     . LEU A 1 172 ? 18.457  60.682 -4.492  1.00 25.64 ? 162 LEU A C     1 
ATOM   1284 O O     . LEU A 1 172 ? 18.687  61.839 -4.146  1.00 25.76 ? 162 LEU A O     1 
ATOM   1285 C CB    . LEU A 1 172 ? 16.230  60.506 -3.397  1.00 25.98 ? 162 LEU A CB    1 
ATOM   1286 C CG    . LEU A 1 172 ? 15.194  59.739 -2.566  1.00 27.61 ? 162 LEU A CG    1 
ATOM   1287 C CD1   . LEU A 1 172 ? 14.011  60.646 -2.246  1.00 25.47 ? 162 LEU A CD1   1 
ATOM   1288 C CD2   . LEU A 1 172 ? 14.776  58.468 -3.323  1.00 26.34 ? 162 LEU A CD2   1 
ATOM   1289 N N     . GLY A 1 173 ? 18.911  60.148 -5.622  1.00 25.18 ? 163 GLY A N     1 
ATOM   1290 C CA    . GLY A 1 173 ? 19.954  60.780 -6.419  1.00 25.54 ? 163 GLY A CA    1 
ATOM   1291 C C     . GLY A 1 173 ? 21.326  60.596 -5.800  1.00 25.10 ? 163 GLY A C     1 
ATOM   1292 O O     . GLY A 1 173 ? 21.980  61.558 -5.427  1.00 24.81 ? 163 GLY A O     1 
ATOM   1293 N N     . SER A 1 174 ? 21.771  59.347 -5.735  1.00 25.00 ? 164 SER A N     1 
ATOM   1294 C CA    . SER A 1 174 ? 22.916  58.959 -4.919  1.00 24.68 ? 164 SER A CA    1 
ATOM   1295 C C     . SER A 1 174 ? 24.317  59.216 -5.515  1.00 25.25 ? 164 SER A C     1 
ATOM   1296 O O     . SER A 1 174 ? 25.315  59.029 -4.828  1.00 25.09 ? 164 SER A O     1 
ATOM   1297 C CB    . SER A 1 174 ? 22.765  57.493 -4.512  1.00 24.76 ? 164 SER A CB    1 
ATOM   1298 O OG    . SER A 1 174 ? 22.366  56.700 -5.625  1.00 23.67 ? 164 SER A OG    1 
ATOM   1299 N N     . GLY A 1 175 ? 24.373  59.667 -6.771  1.00 25.47 ? 165 GLY A N     1 
ATOM   1300 C CA    . GLY A 1 175 ? 25.620  60.000 -7.444  1.00 25.94 ? 165 GLY A CA    1 
ATOM   1301 C C     . GLY A 1 175 ? 26.487  58.784 -7.642  1.00 26.64 ? 165 GLY A C     1 
ATOM   1302 O O     . GLY A 1 175 ? 26.046  57.803 -8.216  1.00 27.29 ? 165 GLY A O     1 
ATOM   1303 N N     . VAL A 1 176 ? 27.719  58.844 -7.134  1.00 27.27 ? 166 VAL A N     1 
ATOM   1304 C CA    . VAL A 1 176 ? 28.623  57.693 -7.166  1.00 27.06 ? 166 VAL A CA    1 
ATOM   1305 C C     . VAL A 1 176 ? 28.460  56.813 -5.929  1.00 27.30 ? 166 VAL A C     1 
ATOM   1306 O O     . VAL A 1 176 ? 29.115  55.768 -5.800  1.00 28.00 ? 166 VAL A O     1 
ATOM   1307 C CB    . VAL A 1 176 ? 30.107  58.118 -7.419  1.00 27.21 ? 166 VAL A CB    1 
ATOM   1308 C CG1   . VAL A 1 176 ? 30.171  58.933 -8.711  1.00 26.63 ? 166 VAL A CG1   1 
ATOM   1309 C CG2   . VAL A 1 176 ? 30.674  58.905 -6.234  1.00 26.80 ? 166 VAL A CG2   1 
ATOM   1310 N N     . GLY A 1 177 ? 27.558  57.206 -5.026  1.00 27.36 ? 167 GLY A N     1 
ATOM   1311 C CA    . GLY A 1 177 ? 27.133  56.296 -3.968  1.00 26.58 ? 167 GLY A CA    1 
ATOM   1312 C C     . GLY A 1 177 ? 27.843  56.438 -2.637  1.00 26.81 ? 167 GLY A C     1 
ATOM   1313 O O     . GLY A 1 177 ? 27.614  55.643 -1.732  1.00 26.90 ? 167 GLY A O     1 
ATOM   1314 N N     . GLN A 1 178 ? 28.652  57.479 -2.483  1.00 26.76 ? 168 GLN A N     1 
ATOM   1315 C CA    . GLN A 1 178 ? 29.504  57.588 -1.297  1.00 26.69 ? 168 GLN A CA    1 
ATOM   1316 C C     . GLN A 1 178 ? 28.758  57.959 -0.013  1.00 26.16 ? 168 GLN A C     1 
ATOM   1317 O O     . GLN A 1 178 ? 29.259  57.681 1.073   1.00 26.15 ? 168 GLN A O     1 
ATOM   1318 C CB    . GLN A 1 178 ? 30.725  58.498 -1.548  1.00 26.65 ? 168 GLN A CB    1 
ATOM   1319 C CG    . GLN A 1 178 ? 30.572  60.002 -1.261  1.00 27.20 ? 168 GLN A CG    1 
ATOM   1320 C CD    . GLN A 1 178 ? 29.613  60.719 -2.191  1.00 27.99 ? 168 GLN A CD    1 
ATOM   1321 O OE1   . GLN A 1 178 ? 29.277  60.236 -3.293  1.00 27.35 ? 168 GLN A OE1   1 
ATOM   1322 N NE2   . GLN A 1 178 ? 29.157  61.885 -1.750  1.00 25.01 ? 168 GLN A NE2   1 
ATOM   1323 N N     . VAL A 1 179 ? 27.578  58.566 -0.139  1.00 25.42 ? 169 VAL A N     1 
ATOM   1324 C CA    . VAL A 1 179 ? 26.720  58.791 1.023   1.00 25.79 ? 169 VAL A CA    1 
ATOM   1325 C C     . VAL A 1 179 ? 26.224  57.469 1.596   1.00 26.46 ? 169 VAL A C     1 
ATOM   1326 O O     . VAL A 1 179 ? 26.349  57.235 2.809   1.00 26.33 ? 169 VAL A O     1 
ATOM   1327 C CB    . VAL A 1 179 ? 25.511  59.751 0.752   1.00 26.21 ? 169 VAL A CB    1 
ATOM   1328 C CG1   . VAL A 1 179 ? 24.680  59.979 2.044   1.00 25.38 ? 169 VAL A CG1   1 
ATOM   1329 C CG2   . VAL A 1 179 ? 25.993  61.103 0.212   1.00 23.75 ? 169 VAL A CG2   1 
ATOM   1330 N N     . VAL A 1 180 ? 25.668  56.622 0.721   1.00 26.21 ? 170 VAL A N     1 
ATOM   1331 C CA    . VAL A 1 180 ? 25.174  55.300 1.084   1.00 26.48 ? 170 VAL A CA    1 
ATOM   1332 C C     . VAL A 1 180 ? 26.261  54.392 1.712   1.00 26.86 ? 170 VAL A C     1 
ATOM   1333 O O     . VAL A 1 180 ? 25.980  53.662 2.680   1.00 26.95 ? 170 VAL A O     1 
ATOM   1334 C CB    . VAL A 1 180 ? 24.560  54.606 -0.139  1.00 26.68 ? 170 VAL A CB    1 
ATOM   1335 C CG1   . VAL A 1 180 ? 24.040  53.216 0.215   1.00 28.37 ? 170 VAL A CG1   1 
ATOM   1336 C CG2   . VAL A 1 180 ? 23.453  55.469 -0.757  1.00 27.19 ? 170 VAL A CG2   1 
ATOM   1337 N N     . LEU A 1 181 ? 27.486  54.437 1.176   1.00 25.96 ? 171 LEU A N     1 
ATOM   1338 C CA    . LEU A 1 181 ? 28.573  53.598 1.718   1.00 26.20 ? 171 LEU A CA    1 
ATOM   1339 C C     . LEU A 1 181 ? 28.920  54.062 3.108   1.00 25.64 ? 171 LEU A C     1 
ATOM   1340 O O     . LEU A 1 181 ? 29.161  53.246 3.994   1.00 26.16 ? 171 LEU A O     1 
ATOM   1341 C CB    . LEU A 1 181 ? 29.853  53.641 0.857   1.00 25.47 ? 171 LEU A CB    1 
ATOM   1342 C CG    . LEU A 1 181 ? 29.749  53.259 -0.616  1.00 27.06 ? 171 LEU A CG    1 
ATOM   1343 C CD1   . LEU A 1 181 ? 31.105  53.406 -1.299  1.00 24.42 ? 171 LEU A CD1   1 
ATOM   1344 C CD2   . LEU A 1 181 ? 29.183  51.857 -0.841  1.00 25.88 ? 171 LEU A CD2   1 
ATOM   1345 N N     . GLN A 1 182 ? 28.969  55.379 3.303   1.00 25.15 ? 172 GLN A N     1 
ATOM   1346 C CA    . GLN A 1 182 ? 29.320  55.911 4.609   1.00 25.28 ? 172 GLN A CA    1 
ATOM   1347 C C     . GLN A 1 182 ? 28.269  55.507 5.659   1.00 26.42 ? 172 GLN A C     1 
ATOM   1348 O O     . GLN A 1 182 ? 28.619  55.057 6.758   1.00 26.82 ? 172 GLN A O     1 
ATOM   1349 C CB    . GLN A 1 182 ? 29.526  57.426 4.574   1.00 24.59 ? 172 GLN A CB    1 
ATOM   1350 C CG    . GLN A 1 182 ? 29.904  58.028 5.932   1.00 24.30 ? 172 GLN A CG    1 
ATOM   1351 C CD    . GLN A 1 182 ? 30.227  59.503 5.893   1.00 25.11 ? 172 GLN A CD    1 
ATOM   1352 O OE1   . GLN A 1 182 ? 30.345  60.105 4.827   1.00 24.00 ? 172 GLN A OE1   1 
ATOM   1353 N NE2   . GLN A 1 182 ? 30.357  60.104 7.073   1.00 26.18 ? 172 GLN A NE2   1 
ATOM   1354 N N     . VAL A 1 183 ? 26.992  55.678 5.315   1.00 26.97 ? 173 VAL A N     1 
ATOM   1355 C CA    . VAL A 1 183 ? 25.897  55.257 6.191   1.00 27.16 ? 173 VAL A CA    1 
ATOM   1356 C C     . VAL A 1 183 ? 25.869  53.743 6.457   1.00 28.13 ? 173 VAL A C     1 
ATOM   1357 O O     . VAL A 1 183 ? 25.645  53.339 7.596   1.00 27.37 ? 173 VAL A O     1 
ATOM   1358 C CB    . VAL A 1 183 ? 24.515  55.784 5.706   1.00 27.77 ? 173 VAL A CB    1 
ATOM   1359 C CG1   . VAL A 1 183 ? 23.427  55.499 6.744   1.00 25.88 ? 173 VAL A CG1   1 
ATOM   1360 C CG2   . VAL A 1 183 ? 24.580  57.294 5.514   1.00 26.16 ? 173 VAL A CG2   1 
ATOM   1361 N N     . ALA A 1 184 ? 26.125  52.920 5.433   1.00 28.65 ? 174 ALA A N     1 
ATOM   1362 C CA    . ALA A 1 184 ? 26.169  51.475 5.630   1.00 30.24 ? 174 ALA A CA    1 
ATOM   1363 C C     . ALA A 1 184 ? 27.277  51.016 6.596   1.00 31.51 ? 174 ALA A C     1 
ATOM   1364 O O     . ALA A 1 184 ? 27.142  49.982 7.244   1.00 31.25 ? 174 ALA A O     1 
ATOM   1365 C CB    . ALA A 1 184 ? 26.270  50.729 4.275   1.00 29.97 ? 174 ALA A CB    1 
ATOM   1366 N N     . ALA A 1 185 ? 28.364  51.783 6.666   1.00 33.65 ? 175 ALA A N     1 
ATOM   1367 C CA    . ALA A 1 185 ? 29.518  51.472 7.514   1.00 35.92 ? 175 ALA A CA    1 
ATOM   1368 C C     . ALA A 1 185 ? 29.401  52.041 8.928   1.00 37.40 ? 175 ALA A C     1 
ATOM   1369 O O     . ALA A 1 185 ? 30.152  51.655 9.808   1.00 38.59 ? 175 ALA A O     1 
ATOM   1370 C CB    . ALA A 1 185 ? 30.796  51.975 6.866   1.00 35.41 ? 175 ALA A CB    1 
ATOM   1371 N N     . ALA A 1 186 ? 28.476  52.970 9.134   1.00 38.82 ? 176 ALA A N     1 
ATOM   1372 C CA    . ALA A 1 186 ? 28.372  53.663 10.401  1.00 40.54 ? 176 ALA A CA    1 
ATOM   1373 C C     . ALA A 1 186 ? 27.114  53.316 11.183  1.00 41.99 ? 176 ALA A C     1 
ATOM   1374 O O     . ALA A 1 186 ? 27.059  53.573 12.379  1.00 42.75 ? 176 ALA A O     1 
ATOM   1375 C CB    . ALA A 1 186 ? 28.477  55.171 10.198  1.00 40.16 ? 176 ALA A CB    1 
ATOM   1376 N N     . THR A 1 187 ? 26.113  52.741 10.519  1.00 43.51 ? 177 THR A N     1 
ATOM   1377 C CA    . THR A 1 187 ? 24.836  52.443 11.172  1.00 45.22 ? 177 THR A CA    1 
ATOM   1378 C C     . THR A 1 187 ? 24.429  50.984 10.995  1.00 46.94 ? 177 THR A C     1 
ATOM   1379 O O     . THR A 1 187 ? 24.997  50.257 10.174  1.00 47.69 ? 177 THR A O     1 
ATOM   1380 C CB    . THR A 1 187 ? 23.676  53.333 10.648  1.00 44.70 ? 177 THR A CB    1 
ATOM   1381 O OG1   . THR A 1 187 ? 23.196  52.816 9.405   1.00 43.62 ? 177 THR A OG1   1 
ATOM   1382 C CG2   . THR A 1 187 ? 24.101  54.784 10.481  1.00 44.43 ? 177 THR A CG2   1 
ATOM   1383 N N     . ASN A 1 188 ? 23.428  50.561 11.754  1.00 48.76 ? 178 ASN A N     1 
ATOM   1384 C CA    . ASN A 1 188 ? 22.940  49.195 11.627  1.00 50.35 ? 178 ASN A CA    1 
ATOM   1385 C C     . ASN A 1 188 ? 21.515  49.092 11.080  1.00 51.03 ? 178 ASN A C     1 
ATOM   1386 O O     . ASN A 1 188 ? 20.714  48.293 11.564  1.00 51.57 ? 178 ASN A O     1 
ATOM   1387 C CB    . ASN A 1 188 ? 23.174  48.372 12.922  1.00 50.75 ? 178 ASN A CB    1 
ATOM   1388 C CG    . ASN A 1 188 ? 22.404  48.903 14.148  1.00 52.55 ? 178 ASN A CG    1 
ATOM   1389 O OD1   . ASN A 1 188 ? 22.422  50.097 14.463  1.00 55.30 ? 178 ASN A OD1   1 
ATOM   1390 N ND2   . ASN A 1 188 ? 21.759  47.988 14.868  1.00 53.99 ? 178 ASN A ND2   1 
ATOM   1391 N N     . CYS A 1 189 ? 21.214  49.894 10.054  1.00 51.50 ? 179 CYS A N     1 
ATOM   1392 C CA    . CYS A 1 189 ? 19.975  49.748 9.290   1.00 52.18 ? 179 CYS A CA    1 
ATOM   1393 C C     . CYS A 1 189 ? 19.889  48.362 8.646   1.00 51.87 ? 179 CYS A C     1 
ATOM   1394 O O     . CYS A 1 189 ? 20.914  47.696 8.451   1.00 52.16 ? 179 CYS A O     1 
ATOM   1395 C CB    . CYS A 1 189 ? 19.869  50.811 8.188   1.00 52.54 ? 179 CYS A CB    1 
ATOM   1396 S SG    . CYS A 1 189 ? 19.792  52.518 8.745   1.00 55.57 ? 179 CYS A SG    1 
ATOM   1397 N N     . LYS A 1 190 ? 18.667  47.936 8.308   1.00 51.38 ? 180 LYS A N     1 
ATOM   1398 C CA    . LYS A 1 190 ? 18.454  46.635 7.660   1.00 50.52 ? 180 LYS A CA    1 
ATOM   1399 C C     . LYS A 1 190 ? 19.017  46.646 6.259   1.00 49.36 ? 180 LYS A C     1 
ATOM   1400 O O     . LYS A 1 190 ? 19.561  45.653 5.789   1.00 49.88 ? 180 LYS A O     1 
ATOM   1401 C CB    . LYS A 1 190 ? 16.970  46.279 7.536   1.00 51.05 ? 180 LYS A CB    1 
ATOM   1402 C CG    . LYS A 1 190 ? 16.046  46.754 8.638   1.00 52.09 ? 180 LYS A CG    1 
ATOM   1403 C CD    . LYS A 1 190 ? 14.585  46.720 8.163   1.00 54.04 ? 180 LYS A CD    1 
ATOM   1404 C CE    . LYS A 1 190 ? 14.234  45.387 7.510   1.00 54.42 ? 180 LYS A CE    1 
ATOM   1405 N NZ    . LYS A 1 190 ? 13.283  45.556 6.380   1.00 55.79 ? 180 LYS A NZ    1 
ATOM   1406 N N     . HIS A 1 191 ? 18.831  47.768 5.578   1.00 47.77 ? 181 HIS A N     1 
ATOM   1407 C CA    . HIS A 1 191 ? 19.302  47.925 4.221   1.00 46.40 ? 181 HIS A CA    1 
ATOM   1408 C C     . HIS A 1 191 ? 19.393  49.409 3.893   1.00 44.89 ? 181 HIS A C     1 
ATOM   1409 O O     . HIS A 1 191 ? 18.625  50.240 4.401   1.00 44.87 ? 181 HIS A O     1 
ATOM   1410 C CB    . HIS A 1 191 ? 18.365  47.219 3.238   1.00 46.77 ? 181 HIS A CB    1 
ATOM   1411 C CG    . HIS A 1 191 ? 19.063  46.648 2.041   1.00 47.80 ? 181 HIS A CG    1 
ATOM   1412 N ND1   . HIS A 1 191 ? 19.300  45.299 1.889   1.00 48.00 ? 181 HIS A ND1   1 
ATOM   1413 C CD2   . HIS A 1 191 ? 19.562  47.245 0.933   1.00 48.56 ? 181 HIS A CD2   1 
ATOM   1414 C CE1   . HIS A 1 191 ? 19.922  45.090 0.741   1.00 49.20 ? 181 HIS A CE1   1 
ATOM   1415 N NE2   . HIS A 1 191 ? 20.093  46.256 0.141   1.00 47.15 ? 181 HIS A NE2   1 
ATOM   1416 N N     . HIS A 1 192 ? 20.367  49.736 3.062   1.00 42.54 ? 182 HIS A N     1 
ATOM   1417 C CA    . HIS A 1 192 ? 20.539  51.091 2.576   1.00 39.85 ? 182 HIS A CA    1 
ATOM   1418 C C     . HIS A 1 192 ? 20.405  50.995 1.066   1.00 38.03 ? 182 HIS A C     1 
ATOM   1419 O O     . HIS A 1 192 ? 20.781  49.984 0.487   1.00 37.03 ? 182 HIS A O     1 
ATOM   1420 C CB    . HIS A 1 192 ? 21.919  51.622 2.968   1.00 40.19 ? 182 HIS A CB    1 
ATOM   1421 C CG    . HIS A 1 192 ? 22.220  51.530 4.434   1.00 39.78 ? 182 HIS A CG    1 
ATOM   1422 N ND1   . HIS A 1 192 ? 22.461  52.639 5.216   1.00 40.46 ? 182 HIS A ND1   1 
ATOM   1423 C CD2   . HIS A 1 192 ? 22.340  50.462 5.257   1.00 39.54 ? 182 HIS A CD2   1 
ATOM   1424 C CE1   . HIS A 1 192 ? 22.708  52.260 6.457   1.00 39.31 ? 182 HIS A CE1   1 
ATOM   1425 N NE2   . HIS A 1 192 ? 22.639  50.943 6.508   1.00 39.91 ? 182 HIS A NE2   1 
ATOM   1426 N N     . TYR A 1 193 ? 19.821  52.018 0.441   1.00 36.66 ? 183 TYR A N     1 
ATOM   1427 C CA    . TYR A 1 193 ? 19.751  52.101 -1.016  1.00 34.89 ? 183 TYR A CA    1 
ATOM   1428 C C     . TYR A 1 193 ? 20.168  53.464 -1.545  1.00 33.53 ? 183 TYR A C     1 
ATOM   1429 O O     . TYR A 1 193 ? 19.930  54.502 -0.918  1.00 31.86 ? 183 TYR A O     1 
ATOM   1430 C CB    . TYR A 1 193 ? 18.335  51.828 -1.534  1.00 35.98 ? 183 TYR A CB    1 
ATOM   1431 C CG    . TYR A 1 193 ? 17.722  50.525 -1.091  1.00 37.38 ? 183 TYR A CG    1 
ATOM   1432 C CD1   . TYR A 1 193 ? 17.007  50.453 0.102   1.00 40.53 ? 183 TYR A CD1   1 
ATOM   1433 C CD2   . TYR A 1 193 ? 17.832  49.373 -1.871  1.00 40.22 ? 183 TYR A CD2   1 
ATOM   1434 C CE1   . TYR A 1 193 ? 16.423  49.276 0.518   1.00 41.90 ? 183 TYR A CE1   1 
ATOM   1435 C CE2   . TYR A 1 193 ? 17.240  48.163 -1.452  1.00 41.83 ? 183 TYR A CE2   1 
ATOM   1436 C CZ    . TYR A 1 193 ? 16.535  48.142 -0.253  1.00 43.06 ? 183 TYR A CZ    1 
ATOM   1437 O OH    . TYR A 1 193 ? 15.940  46.994 0.212   1.00 46.15 ? 183 TYR A OH    1 
ATOM   1438 N N     . GLY A 1 194 ? 20.774  53.443 -2.726  1.00 32.12 ? 184 GLY A N     1 
ATOM   1439 C CA    . GLY A 1 194 ? 20.975  54.644 -3.483  1.00 30.98 ? 184 GLY A CA    1 
ATOM   1440 C C     . GLY A 1 194 ? 20.400  54.440 -4.861  1.00 30.29 ? 184 GLY A C     1 
ATOM   1441 O O     . GLY A 1 194 ? 20.514  53.362 -5.447  1.00 30.09 ? 184 GLY A O     1 
ATOM   1442 N N     . VAL A 1 195 ? 19.765  55.476 -5.375  1.00 30.23 ? 185 VAL A N     1 
ATOM   1443 C CA    . VAL A 1 195 ? 19.232  55.423 -6.706  1.00 30.62 ? 185 VAL A CA    1 
ATOM   1444 C C     . VAL A 1 195 ? 19.700  56.642 -7.462  1.00 31.55 ? 185 VAL A C     1 
ATOM   1445 O O     . VAL A 1 195 ? 19.542  57.778 -6.997  1.00 31.01 ? 185 VAL A O     1 
ATOM   1446 C CB    . VAL A 1 195 ? 17.696  55.247 -6.735  1.00 30.48 ? 185 VAL A CB    1 
ATOM   1447 C CG1   . VAL A 1 195 ? 16.978  56.290 -5.860  1.00 30.14 ? 185 VAL A CG1   1 
ATOM   1448 C CG2   . VAL A 1 195 ? 17.199  55.266 -8.160  1.00 29.66 ? 185 VAL A CG2   1 
ATOM   1449 N N     . GLU A 1 196 ? 20.320  56.378 -8.609  1.00 32.09 ? 186 GLU A N     1 
ATOM   1450 C CA    . GLU A 1 196 ? 20.904  57.413 -9.446  1.00 33.44 ? 186 GLU A CA    1 
ATOM   1451 C C     . GLU A 1 196 ? 20.437  57.188 -10.874 1.00 34.14 ? 186 GLU A C     1 
ATOM   1452 O O     . GLU A 1 196 ? 20.494  56.064 -11.385 1.00 34.95 ? 186 GLU A O     1 
ATOM   1453 C CB    . GLU A 1 196 ? 22.440  57.388 -9.375  1.00 32.69 ? 186 GLU A CB    1 
ATOM   1454 C CG    . GLU A 1 196 ? 23.136  58.343 -10.371 1.00 32.99 ? 186 GLU A CG    1 
ATOM   1455 C CD    . GLU A 1 196 ? 22.675  59.796 -10.218 1.00 34.22 ? 186 GLU A CD    1 
ATOM   1456 O OE1   . GLU A 1 196 ? 22.792  60.355 -9.101  1.00 33.37 ? 186 GLU A OE1   1 
ATOM   1457 O OE2   . GLU A 1 196 ? 22.213  60.384 -11.226 1.00 35.91 ? 186 GLU A OE2   1 
ATOM   1458 N N     . LYS A 1 197 ? 19.993  58.269 -11.504 1.00 35.37 ? 187 LYS A N     1 
ATOM   1459 C CA    . LYS A 1 197 ? 19.514  58.250 -12.884 1.00 36.60 ? 187 LYS A CA    1 
ATOM   1460 C C     . LYS A 1 197 ? 20.609  58.420 -13.941 1.00 36.35 ? 187 LYS A C     1 
ATOM   1461 O O     . LYS A 1 197 ? 20.550  57.781 -14.988 1.00 36.69 ? 187 LYS A O     1 
ATOM   1462 C CB    . LYS A 1 197 ? 18.491  59.361 -13.063 1.00 37.07 ? 187 LYS A CB    1 
ATOM   1463 C CG    . LYS A 1 197 ? 17.436  59.095 -14.124 1.00 39.34 ? 187 LYS A CG    1 
ATOM   1464 C CD    . LYS A 1 197 ? 16.324  60.134 -14.012 1.00 41.68 ? 187 LYS A CD    1 
ATOM   1465 C CE    . LYS A 1 197 ? 16.529  61.287 -14.991 1.00 44.47 ? 187 LYS A CE    1 
ATOM   1466 N NZ    . LYS A 1 197 ? 15.973  60.899 -16.329 1.00 45.51 ? 187 LYS A NZ    1 
ATOM   1467 N N     . ALA A 1 198 ? 21.580  59.302 -13.696 1.00 36.44 ? 188 ALA A N     1 
ATOM   1468 C CA    . ALA A 1 198 ? 22.524  59.698 -14.757 1.00 36.48 ? 188 ALA A CA    1 
ATOM   1469 C C     . ALA A 1 198 ? 23.598  58.644 -14.967 1.00 36.98 ? 188 ALA A C     1 
ATOM   1470 O O     . ALA A 1 198 ? 24.128  58.076 -14.002 1.00 36.79 ? 188 ALA A O     1 
ATOM   1471 C CB    . ALA A 1 198 ? 23.141  61.044 -14.476 1.00 36.81 ? 188 ALA A CB    1 
ATOM   1472 N N     . ASP A 1 199 ? 23.895  58.392 -16.240 1.00 36.98 ? 189 ASP A N     1 
ATOM   1473 C CA    . ASP A 1 199 ? 24.707  57.270 -16.676 1.00 37.59 ? 189 ASP A CA    1 
ATOM   1474 C C     . ASP A 1 199 ? 26.117  57.308 -16.106 1.00 36.91 ? 189 ASP A C     1 
ATOM   1475 O O     . ASP A 1 199 ? 26.613  56.308 -15.591 1.00 36.72 ? 189 ASP A O     1 
ATOM   1476 C CB    . ASP A 1 199 ? 24.748  57.223 -18.214 1.00 38.78 ? 189 ASP A CB    1 
ATOM   1477 C CG    . ASP A 1 199 ? 23.421  56.756 -18.835 1.00 41.42 ? 189 ASP A CG    1 
ATOM   1478 O OD1   . ASP A 1 199 ? 22.459  56.418 -18.097 1.00 45.90 ? 189 ASP A OD1   1 
ATOM   1479 O OD2   . ASP A 1 199 ? 23.335  56.725 -20.081 1.00 46.31 ? 189 ASP A OD2   1 
ATOM   1480 N N     . ILE A 1 200 ? 26.756  58.466 -16.195 1.00 36.12 ? 190 ILE A N     1 
ATOM   1481 C CA    . ILE A 1 200 ? 28.123  58.614 -15.712 1.00 35.79 ? 190 ILE A CA    1 
ATOM   1482 C C     . ILE A 1 200 ? 28.303  58.282 -14.200 1.00 35.10 ? 190 ILE A C     1 
ATOM   1483 O O     . ILE A 1 200 ? 29.110  57.407 -13.857 1.00 35.29 ? 190 ILE A O     1 
ATOM   1484 C CB    . ILE A 1 200 ? 28.740  59.981 -16.131 1.00 35.26 ? 190 ILE A CB    1 
ATOM   1485 C CG1   . ILE A 1 200 ? 28.937  60.004 -17.665 1.00 36.26 ? 190 ILE A CG1   1 
ATOM   1486 C CG2   . ILE A 1 200 ? 30.055  60.213 -15.399 1.00 36.27 ? 190 ILE A CG2   1 
ATOM   1487 C CD1   . ILE A 1 200 ? 29.431  61.351 -18.267 1.00 33.50 ? 190 ILE A CD1   1 
ATOM   1488 N N     . PRO A 1 201 ? 27.548  58.946 -13.302 1.00 34.91 ? 191 PRO A N     1 
ATOM   1489 C CA    . PRO A 1 201 ? 27.743  58.561 -11.879 1.00 34.47 ? 191 PRO A CA    1 
ATOM   1490 C C     . PRO A 1 201 ? 27.268  57.139 -11.555 1.00 34.35 ? 191 PRO A C     1 
ATOM   1491 O O     . PRO A 1 201 ? 27.940  56.421 -10.788 1.00 33.31 ? 191 PRO A O     1 
ATOM   1492 C CB    . PRO A 1 201 ? 26.954  59.615 -11.095 1.00 34.50 ? 191 PRO A CB    1 
ATOM   1493 C CG    . PRO A 1 201 ? 25.989  60.230 -12.108 1.00 34.99 ? 191 PRO A CG    1 
ATOM   1494 C CD    . PRO A 1 201 ? 26.629  60.091 -13.466 1.00 33.76 ? 191 PRO A CD    1 
ATOM   1495 N N     . ALA A 1 202 ? 26.159  56.706 -12.157 1.00 34.12 ? 192 ALA A N     1 
ATOM   1496 C CA    . ALA A 1 202 ? 25.692  55.335 -11.951 1.00 34.23 ? 192 ALA A CA    1 
ATOM   1497 C C     . ALA A 1 202 ? 26.730  54.299 -12.360 1.00 35.10 ? 192 ALA A C     1 
ATOM   1498 O O     . ALA A 1 202 ? 26.893  53.284 -11.672 1.00 35.38 ? 192 ALA A O     1 
ATOM   1499 C CB    . ALA A 1 202 ? 24.397  55.077 -12.654 1.00 34.77 ? 192 ALA A CB    1 
ATOM   1500 N N     . LYS A 1 203 ? 27.428  54.555 -13.468 1.00 35.01 ? 193 LYS A N     1 
ATOM   1501 C CA    . LYS A 1 203 ? 28.518  53.690 -13.913 1.00 35.69 ? 193 LYS A CA    1 
ATOM   1502 C C     . LYS A 1 203 ? 29.645  53.607 -12.858 1.00 35.10 ? 193 LYS A C     1 
ATOM   1503 O O     . LYS A 1 203 ? 30.049  52.514 -12.455 1.00 35.45 ? 193 LYS A O     1 
ATOM   1504 C CB    . LYS A 1 203 ? 29.046  54.160 -15.283 1.00 36.01 ? 193 LYS A CB    1 
ATOM   1505 C CG    . LYS A 1 203 ? 30.207  53.338 -15.846 1.00 39.66 ? 193 LYS A CG    1 
ATOM   1506 C CD    . LYS A 1 203 ? 29.800  51.888 -16.125 1.00 43.03 ? 193 LYS A CD    1 
ATOM   1507 C CE    . LYS A 1 203 ? 31.024  51.014 -16.327 1.00 45.69 ? 193 LYS A CE    1 
ATOM   1508 N NZ    . LYS A 1 203 ? 30.656  49.566 -16.414 1.00 47.75 ? 193 LYS A NZ    1 
ATOM   1509 N N     . TYR A 1 204 ? 30.120  54.760 -12.395 1.00 34.11 ? 194 TYR A N     1 
ATOM   1510 C CA    . TYR A 1 204 ? 31.160  54.812 -11.363 1.00 33.35 ? 194 TYR A CA    1 
ATOM   1511 C C     . TYR A 1 204 ? 30.742  54.150 -10.049 1.00 32.35 ? 194 TYR A C     1 
ATOM   1512 O O     . TYR A 1 204 ? 31.573  53.535 -9.358  1.00 31.18 ? 194 TYR A O     1 
ATOM   1513 C CB    . TYR A 1 204 ? 31.568  56.251 -11.087 1.00 33.00 ? 194 TYR A CB    1 
ATOM   1514 C CG    . TYR A 1 204 ? 32.500  56.867 -12.098 1.00 34.98 ? 194 TYR A CG    1 
ATOM   1515 C CD1   . TYR A 1 204 ? 33.517  56.118 -12.704 1.00 37.30 ? 194 TYR A CD1   1 
ATOM   1516 C CD2   . TYR A 1 204 ? 32.399  58.210 -12.423 1.00 35.58 ? 194 TYR A CD2   1 
ATOM   1517 C CE1   . TYR A 1 204 ? 34.390  56.691 -13.617 1.00 36.38 ? 194 TYR A CE1   1 
ATOM   1518 C CE2   . TYR A 1 204 ? 33.278  58.797 -13.342 1.00 38.07 ? 194 TYR A CE2   1 
ATOM   1519 C CZ    . TYR A 1 204 ? 34.265  58.025 -13.931 1.00 39.62 ? 194 TYR A CZ    1 
ATOM   1520 O OH    . TYR A 1 204 ? 35.128  58.596 -14.835 1.00 41.28 ? 194 TYR A OH    1 
ATOM   1521 N N     . ALA A 1 205 ? 29.460  54.278 -9.712  1.00 31.16 ? 195 ALA A N     1 
ATOM   1522 C CA    . ALA A 1 205 ? 28.917  53.687 -8.488  1.00 31.52 ? 195 ALA A CA    1 
ATOM   1523 C C     . ALA A 1 205 ? 29.055  52.166 -8.475  1.00 31.67 ? 195 ALA A C     1 
ATOM   1524 O O     . ALA A 1 205 ? 29.092  51.570 -7.415  1.00 31.72 ? 195 ALA A O     1 
ATOM   1525 C CB    . ALA A 1 205 ? 27.435  54.101 -8.283  1.00 30.78 ? 195 ALA A CB    1 
ATOM   1526 N N     . GLU A 1 206 ? 29.097  51.546 -9.658  1.00 32.55 ? 196 GLU A N     1 
ATOM   1527 C CA    . GLU A 1 206 ? 29.226  50.086 -9.782  1.00 32.33 ? 196 GLU A CA    1 
ATOM   1528 C C     . GLU A 1 206 ? 30.592  49.651 -9.309  1.00 31.57 ? 196 GLU A C     1 
ATOM   1529 O O     . GLU A 1 206 ? 30.713  48.644 -8.590  1.00 31.40 ? 196 GLU A O     1 
ATOM   1530 C CB    . GLU A 1 206 ? 29.013  49.623 -11.233 1.00 32.67 ? 196 GLU A CB    1 
ATOM   1531 C CG    . GLU A 1 206 ? 27.644  49.972 -11.806 1.00 35.26 ? 196 GLU A CG    1 
ATOM   1532 C CD    . GLU A 1 206 ? 27.386  49.389 -13.196 1.00 40.24 ? 196 GLU A CD    1 
ATOM   1533 O OE1   . GLU A 1 206 ? 28.315  49.328 -14.035 1.00 43.56 ? 196 GLU A OE1   1 
ATOM   1534 O OE2   . GLU A 1 206 ? 26.229  49.015 -13.461 1.00 43.08 ? 196 GLU A OE2   1 
ATOM   1535 N N     . THR A 1 207 ? 31.611  50.396 -9.744  1.00 31.07 ? 197 THR A N     1 
ATOM   1536 C CA    . THR A 1 207 ? 32.990  50.221 -9.281  1.00 30.91 ? 197 THR A CA    1 
ATOM   1537 C C     . THR A 1 207 ? 33.141  50.622 -7.820  1.00 30.38 ? 197 THR A C     1 
ATOM   1538 O O     . THR A 1 207 ? 33.833  49.925 -7.074  1.00 29.41 ? 197 THR A O     1 
ATOM   1539 C CB    . THR A 1 207 ? 34.028  51.036 -10.124 1.00 31.44 ? 197 THR A CB    1 
ATOM   1540 O OG1   . THR A 1 207 ? 33.803  50.820 -11.517 1.00 32.59 ? 197 THR A OG1   1 
ATOM   1541 C CG2   . THR A 1 207 ? 35.462  50.606 -9.805  1.00 30.27 ? 197 THR A CG2   1 
ATOM   1542 N N     . MET A 1 208 ? 32.512  51.739 -7.411  1.00 30.10 ? 198 MET A N     1 
ATOM   1543 C CA    . MET A 1 208 ? 32.549  52.155 -5.995  1.00 29.71 ? 198 MET A CA    1 
ATOM   1544 C C     . MET A 1 208 ? 32.059  51.012 -5.125  1.00 29.51 ? 198 MET A C     1 
ATOM   1545 O O     . MET A 1 208 ? 32.653  50.701 -4.113  1.00 29.61 ? 198 MET A O     1 
ATOM   1546 C CB    . MET A 1 208 ? 31.687  53.405 -5.729  1.00 29.22 ? 198 MET A CB    1 
ATOM   1547 C CG    . MET A 1 208 ? 32.216  54.696 -6.321  1.00 28.30 ? 198 MET A CG    1 
ATOM   1548 S SD    . MET A 1 208 ? 33.484  55.545 -5.399  1.00 27.93 ? 198 MET A SD    1 
ATOM   1549 C CE    . MET A 1 208 ? 32.620  56.049 -3.895  1.00 26.14 ? 198 MET A CE    1 
ATOM   1550 N N     . ASP A 1 209 ? 30.968  50.374 -5.541  1.00 30.52 ? 199 ASP A N     1 
ATOM   1551 C CA    . ASP A 1 209 ? 30.388  49.279 -4.777  1.00 31.14 ? 199 ASP A CA    1 
ATOM   1552 C C     . ASP A 1 209 ? 31.422  48.161 -4.569  1.00 31.55 ? 199 ASP A C     1 
ATOM   1553 O O     . ASP A 1 209 ? 31.662  47.733 -3.431  1.00 30.72 ? 199 ASP A O     1 
ATOM   1554 C CB    . ASP A 1 209 ? 29.127  48.762 -5.495  1.00 32.36 ? 199 ASP A CB    1 
ATOM   1555 C CG    . ASP A 1 209 ? 28.549  47.500 -4.867  1.00 33.47 ? 199 ASP A CG    1 
ATOM   1556 O OD1   . ASP A 1 209 ? 28.567  47.329 -3.629  1.00 33.51 ? 199 ASP A OD1   1 
ATOM   1557 O OD2   . ASP A 1 209 ? 28.060  46.664 -5.640  1.00 39.69 ? 199 ASP A OD2   1 
ATOM   1558 N N     . ARG A 1 210 ? 32.044  47.728 -5.668  1.00 31.93 ? 200 ARG A N     1 
ATOM   1559 C CA    . ARG A 1 210 ? 33.043  46.657 -5.648  1.00 32.27 ? 200 ARG A CA    1 
ATOM   1560 C C     . ARG A 1 210 ? 34.282  47.014 -4.842  1.00 31.48 ? 200 ARG A C     1 
ATOM   1561 O O     . ARG A 1 210 ? 34.767  46.185 -4.066  1.00 32.05 ? 200 ARG A O     1 
ATOM   1562 C CB    . ARG A 1 210 ? 33.477  46.265 -7.075  1.00 33.29 ? 200 ARG A CB    1 
ATOM   1563 C CG    . ARG A 1 210 ? 32.331  45.765 -7.974  1.00 35.68 ? 200 ARG A CG    1 
ATOM   1564 C CD    . ARG A 1 210 ? 32.837  45.359 -9.366  1.00 41.07 ? 200 ARG A CD    1 
ATOM   1565 N NE    . ARG A 1 210 ? 32.053  46.030 -10.410 1.00 45.51 ? 200 ARG A NE    1 
ATOM   1566 C CZ    . ARG A 1 210 ? 32.546  46.892 -11.298 1.00 47.79 ? 200 ARG A CZ    1 
ATOM   1567 N NH1   . ARG A 1 210 ? 33.847  47.186 -11.324 1.00 48.47 ? 200 ARG A NH1   1 
ATOM   1568 N NH2   . ARG A 1 210 ? 31.731  47.454 -12.176 1.00 49.49 ? 200 ARG A NH2   1 
ATOM   1569 N N     . GLU A 1 211 ? 34.812  48.221 -5.046  1.00 30.13 ? 201 GLU A N     1 
ATOM   1570 C CA    . GLU A 1 211 ? 36.018  48.656 -4.329  1.00 29.14 ? 201 GLU A CA    1 
ATOM   1571 C C     . GLU A 1 211 ? 35.777  48.770 -2.826  1.00 28.01 ? 201 GLU A C     1 
ATOM   1572 O O     . GLU A 1 211 ? 36.653  48.446 -2.029  1.00 27.30 ? 201 GLU A O     1 
ATOM   1573 C CB    . GLU A 1 211 ? 36.552  49.984 -4.879  1.00 28.74 ? 201 GLU A CB    1 
ATOM   1574 C CG    . GLU A 1 211 ? 37.132  49.916 -6.302  1.00 30.47 ? 201 GLU A CG    1 
ATOM   1575 C CD    . GLU A 1 211 ? 38.569  49.388 -6.349  1.00 31.74 ? 201 GLU A CD    1 
ATOM   1576 O OE1   . GLU A 1 211 ? 39.249  49.355 -5.304  1.00 29.17 ? 201 GLU A OE1   1 
ATOM   1577 O OE2   . GLU A 1 211 ? 39.017  49.015 -7.452  1.00 31.80 ? 201 GLU A OE2   1 
ATOM   1578 N N     . PHE A 1 212 ? 34.594  49.258 -2.448  1.00 27.76 ? 202 PHE A N     1 
ATOM   1579 C CA    . PHE A 1 212 ? 34.227  49.349 -1.044  1.00 27.78 ? 202 PHE A CA    1 
ATOM   1580 C C     . PHE A 1 212 ? 34.141  47.965 -0.389  1.00 28.46 ? 202 PHE A C     1 
ATOM   1581 O O     . PHE A 1 212 ? 34.729  47.744 0.672   1.00 28.14 ? 202 PHE A O     1 
ATOM   1582 C CB    . PHE A 1 212 ? 32.913  50.113 -0.884  1.00 27.92 ? 202 PHE A CB    1 
ATOM   1583 C CG    . PHE A 1 212 ? 32.475  50.283 0.551   1.00 26.87 ? 202 PHE A CG    1 
ATOM   1584 C CD1   . PHE A 1 212 ? 33.111  51.209 1.381   1.00 27.20 ? 202 PHE A CD1   1 
ATOM   1585 C CD2   . PHE A 1 212 ? 31.434  49.517 1.060   1.00 26.58 ? 202 PHE A CD2   1 
ATOM   1586 C CE1   . PHE A 1 212 ? 32.703  51.388 2.684   1.00 25.37 ? 202 PHE A CE1   1 
ATOM   1587 C CE2   . PHE A 1 212 ? 30.999  49.681 2.364   1.00 28.14 ? 202 PHE A CE2   1 
ATOM   1588 C CZ    . PHE A 1 212 ? 31.633  50.612 3.185   1.00 28.64 ? 202 PHE A CZ    1 
ATOM   1589 N N     . ARG A 1 213 ? 33.406  47.037 -1.002  1.00 28.49 ? 203 ARG A N     1 
ATOM   1590 C CA    . ARG A 1 213 ? 33.315  45.683 -0.433  1.00 29.46 ? 203 ARG A CA    1 
ATOM   1591 C C     . ARG A 1 213 ? 34.725  45.049 -0.333  1.00 29.39 ? 203 ARG A C     1 
ATOM   1592 O O     . ARG A 1 213 ? 35.044  44.396 0.660   1.00 28.19 ? 203 ARG A O     1 
ATOM   1593 C CB    . ARG A 1 213 ? 32.355  44.782 -1.239  1.00 29.62 ? 203 ARG A CB    1 
ATOM   1594 C CG    . ARG A 1 213 ? 30.871  45.183 -1.117  1.00 30.66 ? 203 ARG A CG    1 
ATOM   1595 C CD    . ARG A 1 213 ? 29.932  44.329 -2.016  1.00 34.74 ? 203 ARG A CD    1 
ATOM   1596 N NE    . ARG A 1 213 ? 28.645  45.010 -2.194  1.00 36.08 ? 203 ARG A NE    1 
ATOM   1597 C CZ    . ARG A 1 213 ? 27.593  44.900 -1.376  1.00 38.54 ? 203 ARG A CZ    1 
ATOM   1598 N NH1   . ARG A 1 213 ? 27.634  44.086 -0.322  1.00 37.20 ? 203 ARG A NH1   1 
ATOM   1599 N NH2   . ARG A 1 213 ? 26.479  45.593 -1.625  1.00 38.61 ? 203 ARG A NH2   1 
ATOM   1600 N N     . LYS A 1 214 ? 35.573  45.282 -1.343  1.00 29.85 ? 204 LYS A N     1 
ATOM   1601 C CA    . LYS A 1 214 ? 36.945  44.749 -1.293  1.00 30.18 ? 204 LYS A CA    1 
ATOM   1602 C C     . LYS A 1 214 ? 37.818  45.378 -0.193  1.00 29.79 ? 204 LYS A C     1 
ATOM   1603 O O     . LYS A 1 214 ? 38.463  44.651 0.574   1.00 29.42 ? 204 LYS A O     1 
ATOM   1604 C CB    . LYS A 1 214 ? 37.630  44.810 -2.674  1.00 31.01 ? 204 LYS A CB    1 
ATOM   1605 C CG    . LYS A 1 214 ? 39.154  44.551 -2.639  1.00 32.49 ? 204 LYS A CG    1 
ATOM   1606 C CD    . LYS A 1 214 ? 39.858  44.996 -3.923  1.00 35.69 ? 204 LYS A CD    1 
ATOM   1607 C CE    . LYS A 1 214 ? 39.860  46.502 -4.027  1.00 36.59 ? 204 LYS A CE    1 
ATOM   1608 N NZ    . LYS A 1 214 ? 40.790  47.034 -5.042  1.00 36.48 ? 204 LYS A NZ    1 
ATOM   1609 N N     . TRP A 1 215 ? 37.864  46.709 -0.124  1.00 28.94 ? 205 TRP A N     1 
ATOM   1610 C CA    . TRP A 1 215 ? 38.689  47.372 0.902   1.00 29.09 ? 205 TRP A CA    1 
ATOM   1611 C C     . TRP A 1 215 ? 38.197  47.093 2.313   1.00 29.49 ? 205 TRP A C     1 
ATOM   1612 O O     . TRP A 1 215 ? 39.015  46.903 3.203   1.00 28.51 ? 205 TRP A O     1 
ATOM   1613 C CB    . TRP A 1 215 ? 38.847  48.901 0.672   1.00 28.58 ? 205 TRP A CB    1 
ATOM   1614 C CG    . TRP A 1 215 ? 39.785  49.198 -0.431  1.00 27.52 ? 205 TRP A CG    1 
ATOM   1615 C CD1   . TRP A 1 215 ? 39.467  49.603 -1.699  1.00 29.02 ? 205 TRP A CD1   1 
ATOM   1616 C CD2   . TRP A 1 215 ? 41.214  49.054 -0.403  1.00 28.41 ? 205 TRP A CD2   1 
ATOM   1617 N NE1   . TRP A 1 215 ? 40.617  49.740 -2.456  1.00 30.67 ? 205 TRP A NE1   1 
ATOM   1618 C CE2   . TRP A 1 215 ? 41.699  49.418 -1.683  1.00 27.57 ? 205 TRP A CE2   1 
ATOM   1619 C CE3   . TRP A 1 215 ? 42.133  48.662 0.581   1.00 27.80 ? 205 TRP A CE3   1 
ATOM   1620 C CZ2   . TRP A 1 215 ? 43.060  49.395 -2.004  1.00 29.28 ? 205 TRP A CZ2   1 
ATOM   1621 C CZ3   . TRP A 1 215 ? 43.504  48.666 0.260   1.00 27.78 ? 205 TRP A CZ3   1 
ATOM   1622 C CH2   . TRP A 1 215 ? 43.941  49.010 -1.022  1.00 26.19 ? 205 TRP A CH2   1 
ATOM   1623 N N     . MET A 1 216 ? 36.871  47.048 2.510   1.00 30.05 ? 206 MET A N     1 
ATOM   1624 C CA    . MET A 1 216 ? 36.327  46.753 3.827   1.00 30.13 ? 206 MET A CA    1 
ATOM   1625 C C     . MET A 1 216 ? 36.753  45.351 4.292   1.00 31.10 ? 206 MET A C     1 
ATOM   1626 O O     . MET A 1 216 ? 37.062  45.160 5.460   1.00 30.95 ? 206 MET A O     1 
ATOM   1627 C CB    . MET A 1 216 ? 34.807  46.916 3.860   1.00 30.47 ? 206 MET A CB    1 
ATOM   1628 C CG    . MET A 1 216 ? 34.340  48.398 3.803   1.00 29.91 ? 206 MET A CG    1 
ATOM   1629 S SD    . MET A 1 216 ? 34.611  49.350 5.312   1.00 30.39 ? 206 MET A SD    1 
ATOM   1630 C CE    . MET A 1 216 ? 33.262  48.666 6.305   1.00 30.28 ? 206 MET A CE    1 
ATOM   1631 N N     . LYS A 1 217 ? 36.797  44.398 3.359   1.00 31.46 ? 207 LYS A N     1 
ATOM   1632 C CA    . LYS A 1 217 ? 37.290  43.049 3.646   1.00 32.54 ? 207 LYS A CA    1 
ATOM   1633 C C     . LYS A 1 217 ? 38.793  43.086 3.917   1.00 31.62 ? 207 LYS A C     1 
ATOM   1634 O O     . LYS A 1 217 ? 39.262  42.452 4.846   1.00 32.16 ? 207 LYS A O     1 
ATOM   1635 C CB    . LYS A 1 217 ? 36.958  42.088 2.506   1.00 32.50 ? 207 LYS A CB    1 
ATOM   1636 C CG    . LYS A 1 217 ? 35.504  41.620 2.527   1.00 36.77 ? 207 LYS A CG    1 
ATOM   1637 C CD    . LYS A 1 217 ? 35.174  40.670 1.366   1.00 40.89 ? 207 LYS A CD    1 
ATOM   1638 C CE    . LYS A 1 217 ? 35.414  39.216 1.747   1.00 44.55 ? 207 LYS A CE    1 
ATOM   1639 N NZ    . LYS A 1 217 ? 35.068  38.258 0.635   1.00 47.28 ? 207 LYS A NZ    1 
ATOM   1640 N N     . TRP A 1 218 ? 39.529  43.883 3.149   1.00 31.28 ? 208 TRP A N     1 
ATOM   1641 C CA    . TRP A 1 218 ? 40.974  44.063 3.369   1.00 30.53 ? 208 TRP A CA    1 
ATOM   1642 C C     . TRP A 1 218 ? 41.309  44.551 4.786   1.00 30.54 ? 208 TRP A C     1 
ATOM   1643 O O     . TRP A 1 218 ? 42.265  44.076 5.406   1.00 30.28 ? 208 TRP A O     1 
ATOM   1644 C CB    . TRP A 1 218 ? 41.555  45.034 2.345   1.00 30.07 ? 208 TRP A CB    1 
ATOM   1645 C CG    . TRP A 1 218 ? 43.067  44.988 2.221   1.00 30.06 ? 208 TRP A CG    1 
ATOM   1646 C CD1   . TRP A 1 218 ? 43.784  44.188 1.383   1.00 28.13 ? 208 TRP A CD1   1 
ATOM   1647 C CD2   . TRP A 1 218 ? 44.032  45.786 2.938   1.00 30.17 ? 208 TRP A CD2   1 
ATOM   1648 N NE1   . TRP A 1 218 ? 45.132  44.435 1.527   1.00 30.51 ? 208 TRP A NE1   1 
ATOM   1649 C CE2   . TRP A 1 218 ? 45.311  45.405 2.478   1.00 30.74 ? 208 TRP A CE2   1 
ATOM   1650 C CE3   . TRP A 1 218 ? 43.938  46.781 3.918   1.00 30.56 ? 208 TRP A CE3   1 
ATOM   1651 C CZ2   . TRP A 1 218 ? 46.488  45.989 2.959   1.00 32.77 ? 208 TRP A CZ2   1 
ATOM   1652 C CZ3   . TRP A 1 218 ? 45.107  47.349 4.412   1.00 30.84 ? 208 TRP A CZ3   1 
ATOM   1653 C CH2   . TRP A 1 218 ? 46.372  46.955 3.924   1.00 32.01 ? 208 TRP A CH2   1 
ATOM   1654 N N     . TYR A 1 219 ? 40.539  45.518 5.280   1.00 30.18 ? 209 TYR A N     1 
ATOM   1655 C CA    . TYR A 1 219 ? 40.780  46.085 6.614   1.00 30.19 ? 209 TYR A CA    1 
ATOM   1656 C C     . TYR A 1 219 ? 40.157  45.229 7.714   1.00 30.35 ? 209 TYR A C     1 
ATOM   1657 O O     . TYR A 1 219 ? 40.456  45.435 8.886   1.00 31.58 ? 209 TYR A O     1 
ATOM   1658 C CB    . TYR A 1 219 ? 40.232  47.515 6.725   1.00 29.11 ? 209 TYR A CB    1 
ATOM   1659 C CG    . TYR A 1 219 ? 41.046  48.560 5.992   1.00 28.34 ? 209 TYR A CG    1 
ATOM   1660 C CD1   . TYR A 1 219 ? 42.202  49.082 6.559   1.00 24.88 ? 209 TYR A CD1   1 
ATOM   1661 C CD2   . TYR A 1 219 ? 40.647  49.030 4.739   1.00 25.76 ? 209 TYR A CD2   1 
ATOM   1662 C CE1   . TYR A 1 219 ? 42.953  50.041 5.907   1.00 28.08 ? 209 TYR A CE1   1 
ATOM   1663 C CE2   . TYR A 1 219 ? 41.397  49.978 4.067   1.00 28.00 ? 209 TYR A CE2   1 
ATOM   1664 C CZ    . TYR A 1 219 ? 42.536  50.493 4.665   1.00 26.71 ? 209 TYR A CZ    1 
ATOM   1665 O OH    . TYR A 1 219 ? 43.281  51.435 4.027   1.00 29.62 ? 209 TYR A OH    1 
ATOM   1666 N N     . GLY A 1 220 ? 39.304  44.288 7.316   1.00 30.81 ? 210 GLY A N     1 
ATOM   1667 C CA    . GLY A 1 220 ? 38.568  43.406 8.211   1.00 31.53 ? 210 GLY A CA    1 
ATOM   1668 C C     . GLY A 1 220 ? 37.475  44.128 8.983   1.00 32.60 ? 210 GLY A C     1 
ATOM   1669 O O     . GLY A 1 220 ? 37.291  43.887 10.186  1.00 32.53 ? 210 GLY A O     1 
ATOM   1670 N N     . LYS A 1 221 ? 36.757  45.020 8.298   1.00 32.24 ? 211 LYS A N     1 
ATOM   1671 C CA    . LYS A 1 221 ? 35.726  45.827 8.954   1.00 33.27 ? 211 LYS A CA    1 
ATOM   1672 C C     . LYS A 1 221 ? 34.357  45.503 8.407   1.00 33.71 ? 211 LYS A C     1 
ATOM   1673 O O     . LYS A 1 221 ? 34.240  45.080 7.257   1.00 33.10 ? 211 LYS A O     1 
ATOM   1674 C CB    . LYS A 1 221 ? 36.016  47.319 8.779   1.00 33.15 ? 211 LYS A CB    1 
ATOM   1675 C CG    . LYS A 1 221 ? 37.282  47.792 9.440   1.00 33.20 ? 211 LYS A CG    1 
ATOM   1676 C CD    . LYS A 1 221 ? 37.170  47.610 10.938  1.00 33.81 ? 211 LYS A CD    1 
ATOM   1677 C CE    . LYS A 1 221 ? 38.403  48.076 11.667  1.00 34.99 ? 211 LYS A CE    1 
ATOM   1678 N NZ    . LYS A 1 221 ? 38.187  47.831 13.121  1.00 37.46 ? 211 LYS A NZ    1 
ATOM   1679 N N     . LYS A 1 222 ? 33.319  45.702 9.226   1.00 34.85 ? 212 LYS A N     1 
ATOM   1680 C CA    . LYS A 1 222 ? 31.954  45.363 8.829   1.00 36.07 ? 212 LYS A CA    1 
ATOM   1681 C C     . LYS A 1 222 ? 31.149  46.560 8.293   1.00 36.06 ? 212 LYS A C     1 
ATOM   1682 O O     . LYS A 1 222 ? 31.380  47.694 8.689   1.00 36.07 ? 212 LYS A O     1 
ATOM   1683 C CB    . LYS A 1 222 ? 31.210  44.771 10.032  1.00 37.02 ? 212 LYS A CB    1 
ATOM   1684 C CG    . LYS A 1 222 ? 29.802  44.307 9.745   1.00 38.85 ? 212 LYS A CG    1 
ATOM   1685 C CD    . LYS A 1 222 ? 28.834  44.773 10.841  1.00 42.72 ? 212 LYS A CD    1 
ATOM   1686 C CE    . LYS A 1 222 ? 28.985  43.964 12.112  1.00 44.07 ? 212 LYS A CE    1 
ATOM   1687 N NZ    . LYS A 1 222 ? 28.371  44.676 13.262  1.00 46.08 ? 212 LYS A NZ    1 
ATOM   1688 N N     . HIS A 1 223 ? 30.196  46.281 7.407   1.00 36.68 ? 213 HIS A N     1 
ATOM   1689 C CA    . HIS A 1 223 ? 29.178  47.247 6.980   1.00 37.25 ? 213 HIS A CA    1 
ATOM   1690 C C     . HIS A 1 223 ? 27.823  46.549 6.878   1.00 37.97 ? 213 HIS A C     1 
ATOM   1691 O O     . HIS A 1 223 ? 27.764  45.335 6.714   1.00 38.26 ? 213 HIS A O     1 
ATOM   1692 C CB    . HIS A 1 223 ? 29.534  47.848 5.621   1.00 36.95 ? 213 HIS A CB    1 
ATOM   1693 C CG    . HIS A 1 223 ? 29.649  46.832 4.527   1.00 37.57 ? 213 HIS A CG    1 
ATOM   1694 N ND1   . HIS A 1 223 ? 28.557  46.350 3.840   1.00 36.00 ? 213 HIS A ND1   1 
ATOM   1695 C CD2   . HIS A 1 223 ? 30.729  46.196 4.009   1.00 37.75 ? 213 HIS A CD2   1 
ATOM   1696 C CE1   . HIS A 1 223 ? 28.954  45.462 2.945   1.00 36.52 ? 213 HIS A CE1   1 
ATOM   1697 N NE2   . HIS A 1 223 ? 30.269  45.360 3.018   1.00 37.50 ? 213 HIS A NE2   1 
ATOM   1698 N N     . ALA A 1 224 ? 26.743  47.321 6.954   1.00 39.06 ? 214 ALA A N     1 
ATOM   1699 C CA    . ALA A 1 224 ? 25.394  46.816 6.687   1.00 39.71 ? 214 ALA A CA    1 
ATOM   1700 C C     . ALA A 1 224 ? 25.162  46.556 5.196   1.00 40.11 ? 214 ALA A C     1 
ATOM   1701 O O     . ALA A 1 224 ? 25.923  47.018 4.344   1.00 40.50 ? 214 ALA A O     1 
ATOM   1702 C CB    . ALA A 1 224 ? 24.354  47.801 7.207   1.00 40.26 ? 214 ALA A CB    1 
ATOM   1703 N N     . GLU A 1 225 ? 24.090  45.827 4.893   1.00 39.78 ? 215 GLU A N     1 
ATOM   1704 C CA    . GLU A 1 225 ? 23.679  45.571 3.518   1.00 39.41 ? 215 GLU A CA    1 
ATOM   1705 C C     . GLU A 1 225 ? 23.311  46.887 2.840   1.00 38.28 ? 215 GLU A C     1 
ATOM   1706 O O     . GLU A 1 225 ? 22.747  47.788 3.472   1.00 37.88 ? 215 GLU A O     1 
ATOM   1707 C CB    . GLU A 1 225 ? 22.471  44.625 3.494   1.00 39.95 ? 215 GLU A CB    1 
ATOM   1708 C CG    . GLU A 1 225 ? 22.404  43.656 4.705   1.00 43.38 ? 215 GLU A CG    1 
ATOM   1709 C CD    . GLU A 1 225 ? 21.400  42.505 4.530   1.00 47.83 ? 215 GLU A CD    1 
ATOM   1710 O OE1   . GLU A 1 225 ? 20.373  42.673 3.825   1.00 49.09 ? 215 GLU A OE1   1 
ATOM   1711 O OE2   . GLU A 1 225 ? 21.638  41.429 5.120   1.00 49.62 ? 215 GLU A OE2   1 
ATOM   1712 N N     . TYR A 1 226 ? 23.647  47.005 1.561   1.00 37.18 ? 216 TYR A N     1 
ATOM   1713 C CA    . TYR A 1 226 ? 23.281  48.193 0.787   1.00 36.83 ? 216 TYR A CA    1 
ATOM   1714 C C     . TYR A 1 226 ? 23.208  47.842 -0.683  1.00 36.77 ? 216 TYR A C     1 
ATOM   1715 O O     . TYR A 1 226 ? 23.837  46.896 -1.132  1.00 37.21 ? 216 TYR A O     1 
ATOM   1716 C CB    . TYR A 1 226 ? 24.284  49.334 1.001   1.00 36.23 ? 216 TYR A CB    1 
ATOM   1717 C CG    . TYR A 1 226 ? 25.632  49.076 0.365   1.00 35.13 ? 216 TYR A CG    1 
ATOM   1718 C CD1   . TYR A 1 226 ? 25.878  49.402 -0.975  1.00 35.35 ? 216 TYR A CD1   1 
ATOM   1719 C CD2   . TYR A 1 226 ? 26.655  48.485 1.097   1.00 34.65 ? 216 TYR A CD2   1 
ATOM   1720 C CE1   . TYR A 1 226 ? 27.140  49.146 -1.557  1.00 35.19 ? 216 TYR A CE1   1 
ATOM   1721 C CE2   . TYR A 1 226 ? 27.898  48.220 0.531   1.00 32.31 ? 216 TYR A CE2   1 
ATOM   1722 C CZ    . TYR A 1 226 ? 28.135  48.546 -0.785  1.00 32.95 ? 216 TYR A CZ    1 
ATOM   1723 O OH    . TYR A 1 226 ? 29.382  48.269 -1.314  1.00 33.05 ? 216 TYR A OH    1 
ATOM   1724 N N     . THR A 1 227 ? 22.462  48.623 -1.445  1.00 36.93 ? 217 THR A N     1 
ATOM   1725 C CA    . THR A 1 227 ? 22.444  48.431 -2.881  1.00 37.54 ? 217 THR A CA    1 
ATOM   1726 C C     . THR A 1 227 ? 22.494  49.782 -3.555  1.00 37.66 ? 217 THR A C     1 
ATOM   1727 O O     . THR A 1 227 ? 21.743  50.699 -3.185  1.00 37.34 ? 217 THR A O     1 
ATOM   1728 C CB    . THR A 1 227 ? 21.166  47.691 -3.325  1.00 37.54 ? 217 THR A CB    1 
ATOM   1729 O OG1   . THR A 1 227 ? 21.007  46.514 -2.522  1.00 38.34 ? 217 THR A OG1   1 
ATOM   1730 C CG2   . THR A 1 227 ? 21.258  47.302 -4.804  1.00 38.82 ? 217 THR A CG2   1 
ATOM   1731 N N     . LEU A 1 228 ? 23.374  49.895 -4.542  1.00 37.10 ? 218 LEU A N     1 
ATOM   1732 C CA    . LEU A 1 228 ? 23.421  51.064 -5.390  1.00 37.51 ? 218 LEU A CA    1 
ATOM   1733 C C     . LEU A 1 228 ? 22.802  50.721 -6.740  1.00 38.00 ? 218 LEU A C     1 
ATOM   1734 O O     . LEU A 1 228 ? 23.334  49.898 -7.481  1.00 38.23 ? 218 LEU A O     1 
ATOM   1735 C CB    . LEU A 1 228 ? 24.865  51.581 -5.534  1.00 36.94 ? 218 LEU A CB    1 
ATOM   1736 C CG    . LEU A 1 228 ? 25.607  51.969 -4.246  1.00 36.15 ? 218 LEU A CG    1 
ATOM   1737 C CD1   . LEU A 1 228 ? 27.069  52.331 -4.576  1.00 35.10 ? 218 LEU A CD1   1 
ATOM   1738 C CD2   . LEU A 1 228 ? 24.926  53.151 -3.544  1.00 32.43 ? 218 LEU A CD2   1 
ATOM   1739 N N     . GLU A 1 229 ? 21.668  51.357 -7.038  1.00 38.85 ? 219 GLU A N     1 
ATOM   1740 C CA    . GLU A 1 229 ? 20.867  51.075 -8.240  1.00 39.82 ? 219 GLU A CA    1 
ATOM   1741 C C     . GLU A 1 229 ? 20.872  52.234 -9.224  1.00 40.62 ? 219 GLU A C     1 
ATOM   1742 O O     . GLU A 1 229 ? 20.926  53.410 -8.833  1.00 40.59 ? 219 GLU A O     1 
ATOM   1743 C CB    . GLU A 1 229 ? 19.401  50.807 -7.841  1.00 39.41 ? 219 GLU A CB    1 
ATOM   1744 C CG    . GLU A 1 229 ? 19.204  49.606 -6.935  1.00 40.29 ? 219 GLU A CG    1 
ATOM   1745 C CD    . GLU A 1 229 ? 17.798  49.498 -6.370  1.00 41.52 ? 219 GLU A CD    1 
ATOM   1746 O OE1   . GLU A 1 229 ? 16.830  49.905 -7.047  1.00 42.17 ? 219 GLU A OE1   1 
ATOM   1747 O OE2   . GLU A 1 229 ? 17.666  48.994 -5.238  1.00 42.60 ? 219 GLU A OE2   1 
ATOM   1748 N N     . ARG A 1 230 ? 20.809  51.898 -10.505 1.00 41.24 ? 220 ARG A N     1 
ATOM   1749 C CA    . ARG A 1 230 ? 20.473  52.871 -11.525 1.00 42.31 ? 220 ARG A CA    1 
ATOM   1750 C C     . ARG A 1 230 ? 18.933  52.996 -11.557 1.00 42.29 ? 220 ARG A C     1 
ATOM   1751 O O     . ARG A 1 230 ? 18.227  51.994 -11.405 1.00 42.81 ? 220 ARG A O     1 
ATOM   1752 C CB    . ARG A 1 230 ? 21.042  52.421 -12.869 1.00 43.05 ? 220 ARG A CB    1 
ATOM   1753 C CG    . ARG A 1 230 ? 20.479  53.139 -14.099 1.00 45.56 ? 220 ARG A CG    1 
ATOM   1754 C CD    . ARG A 1 230 ? 20.867  52.399 -15.377 1.00 48.89 ? 220 ARG A CD    1 
ATOM   1755 N NE    . ARG A 1 230 ? 22.307  52.478 -15.623 1.00 51.42 ? 220 ARG A NE    1 
ATOM   1756 C CZ    . ARG A 1 230 ? 22.923  53.539 -16.134 1.00 52.53 ? 220 ARG A CZ    1 
ATOM   1757 N NH1   . ARG A 1 230 ? 22.225  54.621 -16.456 1.00 53.48 ? 220 ARG A NH1   1 
ATOM   1758 N NH2   . ARG A 1 230 ? 24.239  53.523 -16.318 1.00 53.88 ? 220 ARG A NH2   1 
ATOM   1759 N N     . GLY A 1 231 ? 18.410  54.213 -11.703 1.00 41.82 ? 221 GLY A N     1 
ATOM   1760 C CA    . GLY A 1 231 ? 16.950  54.407 -11.808 1.00 41.23 ? 221 GLY A CA    1 
ATOM   1761 C C     . GLY A 1 231 ? 16.434  55.834 -11.649 1.00 40.84 ? 221 GLY A C     1 
ATOM   1762 O O     . GLY A 1 231 ? 17.205  56.757 -11.380 1.00 40.76 ? 221 GLY A O     1 
ATOM   1763 N N     . ASP A 1 232 ? 15.118  56.001 -11.811 1.00 40.11 ? 222 ASP A N     1 
ATOM   1764 C CA    . ASP A 1 232 ? 14.434  57.290 -11.652 1.00 39.46 ? 222 ASP A CA    1 
ATOM   1765 C C     . ASP A 1 232 ? 13.603  57.294 -10.355 1.00 38.73 ? 222 ASP A C     1 
ATOM   1766 O O     . ASP A 1 232 ? 12.604  56.578 -10.243 1.00 38.10 ? 222 ASP A O     1 
ATOM   1767 C CB    . ASP A 1 232 ? 13.523  57.516 -12.869 1.00 40.12 ? 222 ASP A CB    1 
ATOM   1768 C CG    . ASP A 1 232 ? 12.961  58.931 -12.964 1.00 40.32 ? 222 ASP A CG    1 
ATOM   1769 O OD1   . ASP A 1 232 ? 12.852  59.652 -11.953 1.00 39.26 ? 222 ASP A OD1   1 
ATOM   1770 O OD2   . ASP A 1 232 ? 12.598  59.324 -14.095 1.00 43.94 ? 222 ASP A OD2   1 
ATOM   1771 N N     . PHE A 1 233 ? 13.986  58.100 -9.369  1.00 37.44 ? 223 PHE A N     1 
ATOM   1772 C CA    . PHE A 1 233 ? 13.243  58.050 -8.096  1.00 36.56 ? 223 PHE A CA    1 
ATOM   1773 C C     . PHE A 1 233 ? 11.809  58.615 -8.193  1.00 35.72 ? 223 PHE A C     1 
ATOM   1774 O O     . PHE A 1 233 ? 11.058  58.636 -7.211  1.00 34.93 ? 223 PHE A O     1 
ATOM   1775 C CB    . PHE A 1 233 ? 14.020  58.715 -6.956  1.00 36.01 ? 223 PHE A CB    1 
ATOM   1776 C CG    . PHE A 1 233 ? 14.337  60.164 -7.190  1.00 37.78 ? 223 PHE A CG    1 
ATOM   1777 C CD1   . PHE A 1 233 ? 13.328  61.095 -7.441  1.00 37.04 ? 223 PHE A CD1   1 
ATOM   1778 C CD2   . PHE A 1 233 ? 15.658  60.614 -7.115  1.00 37.01 ? 223 PHE A CD2   1 
ATOM   1779 C CE1   . PHE A 1 233 ? 13.632  62.449 -7.653  1.00 37.33 ? 223 PHE A CE1   1 
ATOM   1780 C CE2   . PHE A 1 233 ? 15.969  61.958 -7.320  1.00 36.48 ? 223 PHE A CE2   1 
ATOM   1781 C CZ    . PHE A 1 233 ? 14.948  62.878 -7.591  1.00 37.13 ? 223 PHE A CZ    1 
ATOM   1782 N N     . LEU A 1 234 ? 11.443  59.093 -9.367  1.00 35.95 ? 224 LEU A N     1 
ATOM   1783 C CA    . LEU A 1 234 ? 10.077  59.567 -9.579  1.00 37.28 ? 224 LEU A CA    1 
ATOM   1784 C C     . LEU A 1 234 ? 9.151   58.500 -10.185 1.00 37.91 ? 224 LEU A C     1 
ATOM   1785 O O     . LEU A 1 234 ? 7.927   58.703 -10.255 1.00 38.39 ? 224 LEU A O     1 
ATOM   1786 C CB    . LEU A 1 234 ? 10.068  60.844 -10.420 1.00 36.82 ? 224 LEU A CB    1 
ATOM   1787 C CG    . LEU A 1 234 ? 10.718  62.084 -9.801  1.00 37.27 ? 224 LEU A CG    1 
ATOM   1788 C CD1   . LEU A 1 234 ? 10.609  63.238 -10.749 1.00 36.33 ? 224 LEU A CD1   1 
ATOM   1789 C CD2   . LEU A 1 234 ? 10.070  62.451 -8.476  1.00 38.49 ? 224 LEU A CD2   1 
ATOM   1790 N N     . SER A 1 235 ? 9.730   57.370 -10.595 1.00 38.92 ? 225 SER A N     1 
ATOM   1791 C CA    . SER A 1 235 ? 8.985   56.244 -11.199 1.00 39.46 ? 225 SER A CA    1 
ATOM   1792 C C     . SER A 1 235 ? 7.874   55.686 -10.303 1.00 40.62 ? 225 SER A C     1 
ATOM   1793 O O     . SER A 1 235 ? 7.839   55.945 -9.086  1.00 39.97 ? 225 SER A O     1 
ATOM   1794 C CB    . SER A 1 235 ? 9.944   55.103 -11.545 1.00 39.67 ? 225 SER A CB    1 
ATOM   1795 O OG    . SER A 1 235 ? 10.366  54.421 -10.370 1.00 38.25 ? 225 SER A OG    1 
ATOM   1796 N N     . GLU A 1 236 ? 6.986   54.893 -10.911 1.00 41.65 ? 226 GLU A N     1 
ATOM   1797 C CA    . GLU A 1 236 ? 5.903   54.231 -10.185 1.00 42.66 ? 226 GLU A CA    1 
ATOM   1798 C C     . GLU A 1 236 ? 6.439   53.304 -9.103  1.00 42.26 ? 226 GLU A C     1 
ATOM   1799 O O     . GLU A 1 236 ? 5.987   53.357 -7.961  1.00 42.55 ? 226 GLU A O     1 
ATOM   1800 C CB    . GLU A 1 236 ? 4.991   53.454 -11.152 1.00 43.42 ? 226 GLU A CB    1 
ATOM   1801 C CG    . GLU A 1 236 ? 3.561   53.304 -10.653 1.00 47.15 ? 226 GLU A CG    1 
ATOM   1802 C CD    . GLU A 1 236 ? 2.811   54.632 -10.627 1.00 51.67 ? 226 GLU A CD    1 
ATOM   1803 O OE1   . GLU A 1 236 ? 2.265   54.994 -9.563  1.00 52.47 ? 226 GLU A OE1   1 
ATOM   1804 O OE2   . GLU A 1 236 ? 2.777   55.315 -11.676 1.00 54.31 ? 226 GLU A OE2   1 
ATOM   1805 N N     . GLU A 1 237 ? 7.403   52.459 -9.460  1.00 41.97 ? 227 GLU A N     1 
ATOM   1806 C CA    . GLU A 1 237 ? 8.057   51.576 -8.491  1.00 41.93 ? 227 GLU A CA    1 
ATOM   1807 C C     . GLU A 1 237 ? 8.515   52.361 -7.250  1.00 41.03 ? 227 GLU A C     1 
ATOM   1808 O O     . GLU A 1 237 ? 8.296   51.929 -6.121  1.00 41.19 ? 227 GLU A O     1 
ATOM   1809 C CB    . GLU A 1 237 ? 9.245   50.841 -9.147  1.00 42.54 ? 227 GLU A CB    1 
ATOM   1810 C CG    . GLU A 1 237 ? 10.348  50.324 -8.180  1.00 44.92 ? 227 GLU A CG    1 
ATOM   1811 C CD    . GLU A 1 237 ? 11.742  50.160 -8.839  1.00 48.43 ? 227 GLU A CD    1 
ATOM   1812 O OE1   . GLU A 1 237 ? 11.847  50.003 -10.077 1.00 50.03 ? 227 GLU A OE1   1 
ATOM   1813 O OE2   . GLU A 1 237 ? 12.752  50.184 -8.103  1.00 49.50 ? 227 GLU A OE2   1 
ATOM   1814 N N     . TRP A 1 238 ? 9.138   53.516 -7.469  1.00 40.06 ? 228 TRP A N     1 
ATOM   1815 C CA    . TRP A 1 238 ? 9.751   54.267 -6.379  1.00 38.77 ? 228 TRP A CA    1 
ATOM   1816 C C     . TRP A 1 238 ? 8.784   54.938 -5.404  1.00 38.74 ? 228 TRP A C     1 
ATOM   1817 O O     . TRP A 1 238 ? 9.167   55.227 -4.251  1.00 38.26 ? 228 TRP A O     1 
ATOM   1818 C CB    . TRP A 1 238 ? 10.833  55.219 -6.909  1.00 38.39 ? 228 TRP A CB    1 
ATOM   1819 C CG    . TRP A 1 238 ? 12.154  54.527 -6.971  1.00 38.00 ? 228 TRP A CG    1 
ATOM   1820 C CD1   . TRP A 1 238 ? 12.747  53.977 -8.073  1.00 37.61 ? 228 TRP A CD1   1 
ATOM   1821 C CD2   . TRP A 1 238 ? 13.032  54.264 -5.866  1.00 36.94 ? 228 TRP A CD2   1 
ATOM   1822 N NE1   . TRP A 1 238 ? 13.955  53.402 -7.719  1.00 38.65 ? 228 TRP A NE1   1 
ATOM   1823 C CE2   . TRP A 1 238 ? 14.150  53.565 -6.373  1.00 37.04 ? 228 TRP A CE2   1 
ATOM   1824 C CE3   . TRP A 1 238 ? 12.986  54.566 -4.493  1.00 37.33 ? 228 TRP A CE3   1 
ATOM   1825 C CZ2   . TRP A 1 238 ? 15.215  53.152 -5.554  1.00 37.27 ? 228 TRP A CZ2   1 
ATOM   1826 C CZ3   . TRP A 1 238 ? 14.043  54.159 -3.678  1.00 36.40 ? 228 TRP A CZ3   1 
ATOM   1827 C CH2   . TRP A 1 238 ? 15.144  53.460 -4.213  1.00 36.41 ? 228 TRP A CH2   1 
ATOM   1828 N N     . ARG A 1 239 ? 7.524   55.126 -5.837  1.00 38.55 ? 229 ARG A N     1 
ATOM   1829 C CA    . ARG A 1 239 ? 6.476   55.727 -4.994  1.00 38.54 ? 229 ARG A CA    1 
ATOM   1830 C C     . ARG A 1 239 ? 6.287   54.965 -3.705  1.00 38.34 ? 229 ARG A C     1 
ATOM   1831 O O     . ARG A 1 239 ? 6.322   55.551 -2.629  1.00 37.75 ? 229 ARG A O     1 
ATOM   1832 C CB    . ARG A 1 239 ? 5.119   55.791 -5.712  1.00 38.40 ? 229 ARG A CB    1 
ATOM   1833 C CG    . ARG A 1 239 ? 5.011   56.870 -6.758  1.00 39.68 ? 229 ARG A CG    1 
ATOM   1834 C CD    . ARG A 1 239 ? 3.590   56.943 -7.327  1.00 41.26 ? 229 ARG A CD    1 
ATOM   1835 N NE    . ARG A 1 239 ? 3.502   57.894 -8.436  1.00 41.03 ? 229 ARG A NE    1 
ATOM   1836 C CZ    . ARG A 1 239 ? 3.092   59.152 -8.323  1.00 42.21 ? 229 ARG A CZ    1 
ATOM   1837 N NH1   . ARG A 1 239 ? 3.052   59.928 -9.394  1.00 42.08 ? 229 ARG A NH1   1 
ATOM   1838 N NH2   . ARG A 1 239 ? 2.711   59.637 -7.149  1.00 42.58 ? 229 ARG A NH2   1 
ATOM   1839 N N     . GLU A 1 240 ? 6.089   53.652 -3.829  1.00 38.30 ? 230 GLU A N     1 
ATOM   1840 C CA    . GLU A 1 240 ? 5.911   52.782 -2.671  1.00 38.40 ? 230 GLU A CA    1 
ATOM   1841 C C     . GLU A 1 240 ? 7.215   52.612 -1.880  1.00 36.98 ? 230 GLU A C     1 
ATOM   1842 O O     . GLU A 1 240 ? 7.190   52.461 -0.659  1.00 36.25 ? 230 GLU A O     1 
ATOM   1843 C CB    . GLU A 1 240 ? 5.368   51.411 -3.107  1.00 39.27 ? 230 GLU A CB    1 
ATOM   1844 C CG    . GLU A 1 240 ? 4.717   50.603 -1.964  1.00 43.32 ? 230 GLU A CG    1 
ATOM   1845 C CD    . GLU A 1 240 ? 3.353   51.147 -1.542  1.00 49.07 ? 230 GLU A CD    1 
ATOM   1846 O OE1   . GLU A 1 240 ? 2.386   51.059 -2.338  1.00 52.17 ? 230 GLU A OE1   1 
ATOM   1847 O OE2   . GLU A 1 240 ? 3.235   51.650 -0.403  1.00 51.50 ? 230 GLU A OE2   1 
ATOM   1848 N N     . ARG A 1 241 ? 8.354   52.631 -2.566  1.00 36.03 ? 231 ARG A N     1 
ATOM   1849 C CA    . ARG A 1 241 ? 9.628   52.471 -1.854  1.00 35.43 ? 231 ARG A CA    1 
ATOM   1850 C C     . ARG A 1 241 ? 9.840   53.667 -0.930  1.00 34.37 ? 231 ARG A C     1 
ATOM   1851 O O     . ARG A 1 241 ? 10.171  53.491 0.241   1.00 35.20 ? 231 ARG A O     1 
ATOM   1852 C CB    . ARG A 1 241 ? 10.800  52.283 -2.810  1.00 35.35 ? 231 ARG A CB    1 
ATOM   1853 C CG    . ARG A 1 241 ? 10.770  50.948 -3.581  1.00 36.07 ? 231 ARG A CG    1 
ATOM   1854 C CD    . ARG A 1 241 ? 11.910  50.866 -4.595  1.00 35.87 ? 231 ARG A CD    1 
ATOM   1855 N NE    . ARG A 1 241 ? 13.170  50.540 -3.937  1.00 36.94 ? 231 ARG A NE    1 
ATOM   1856 C CZ    . ARG A 1 241 ? 14.266  50.105 -4.549  1.00 36.85 ? 231 ARG A CZ    1 
ATOM   1857 N NH1   . ARG A 1 241 ? 15.354  49.847 -3.824  1.00 37.03 ? 231 ARG A NH1   1 
ATOM   1858 N NH2   . ARG A 1 241 ? 14.290  49.929 -5.870  1.00 34.99 ? 231 ARG A NH2   1 
ATOM   1859 N N     . ILE A 1 242 ? 9.603   54.868 -1.454  1.00 33.86 ? 232 ILE A N     1 
ATOM   1860 C CA    . ILE A 1 242 ? 9.711   56.108 -0.681  1.00 33.50 ? 232 ILE A CA    1 
ATOM   1861 C C     . ILE A 1 242 ? 8.752   56.109 0.518   1.00 33.83 ? 232 ILE A C     1 
ATOM   1862 O O     . ILE A 1 242 ? 9.147   56.472 1.636   1.00 32.94 ? 232 ILE A O     1 
ATOM   1863 C CB    . ILE A 1 242 ? 9.524   57.356 -1.584  1.00 33.21 ? 232 ILE A CB    1 
ATOM   1864 C CG1   . ILE A 1 242 ? 10.740  57.499 -2.508  1.00 33.87 ? 232 ILE A CG1   1 
ATOM   1865 C CG2   . ILE A 1 242 ? 9.329   58.614 -0.749  1.00 34.12 ? 232 ILE A CG2   1 
ATOM   1866 C CD1   . ILE A 1 242 ? 10.548  58.438 -3.655  1.00 35.63 ? 232 ILE A CD1   1 
ATOM   1867 N N     . ALA A 1 243 ? 7.510   55.657 0.285   1.00 34.14 ? 233 ALA A N     1 
ATOM   1868 C CA    . ALA A 1 243 ? 6.498   55.534 1.344   1.00 35.23 ? 233 ALA A CA    1 
ATOM   1869 C C     . ALA A 1 243 ? 6.965   54.679 2.528   1.00 35.92 ? 233 ALA A C     1 
ATOM   1870 O O     . ALA A 1 243 ? 6.668   54.992 3.669   1.00 36.42 ? 233 ALA A O     1 
ATOM   1871 C CB    . ALA A 1 243 ? 5.169   54.979 0.763   1.00 35.67 ? 233 ALA A CB    1 
ATOM   1872 N N     . ASN A 1 244 ? 7.737   53.633 2.249   1.00 36.82 ? 234 ASN A N     1 
ATOM   1873 C CA    . ASN A 1 244 ? 8.175   52.675 3.275   1.00 37.67 ? 234 ASN A CA    1 
ATOM   1874 C C     . ASN A 1 244 ? 9.602   52.928 3.819   1.00 37.53 ? 234 ASN A C     1 
ATOM   1875 O O     . ASN A 1 244 ? 10.121  52.166 4.630   1.00 38.09 ? 234 ASN A O     1 
ATOM   1876 C CB    . ASN A 1 244 ? 8.019   51.246 2.728   1.00 38.03 ? 234 ASN A CB    1 
ATOM   1877 C CG    . ASN A 1 244 ? 6.543   50.859 2.494   1.00 40.39 ? 234 ASN A CG    1 
ATOM   1878 O OD1   . ASN A 1 244 ? 5.688   51.032 3.380   1.00 42.72 ? 234 ASN A OD1   1 
ATOM   1879 N ND2   . ASN A 1 244 ? 6.246   50.330 1.307   1.00 40.71 ? 234 ASN A ND2   1 
ATOM   1880 N N     . THR A 1 245 ? 10.229  54.008 3.365   1.00 36.91 ? 235 THR A N     1 
ATOM   1881 C CA    . THR A 1 245 ? 11.555  54.384 3.838   1.00 36.08 ? 235 THR A CA    1 
ATOM   1882 C C     . THR A 1 245 ? 11.423  55.220 5.093   1.00 35.29 ? 235 THR A C     1 
ATOM   1883 O O     . THR A 1 245 ? 10.618  56.144 5.140   1.00 35.82 ? 235 THR A O     1 
ATOM   1884 C CB    . THR A 1 245 ? 12.330  55.191 2.757   1.00 36.06 ? 235 THR A CB    1 
ATOM   1885 O OG1   . THR A 1 245 ? 12.436  54.407 1.568   1.00 35.86 ? 235 THR A OG1   1 
ATOM   1886 C CG2   . THR A 1 245 ? 13.723  55.555 3.241   1.00 34.64 ? 235 THR A CG2   1 
ATOM   1887 N N     . SER A 1 246 ? 12.219  54.921 6.111   1.00 34.22 ? 236 SER A N     1 
ATOM   1888 C CA    . SER A 1 246 ? 12.127  55.708 7.329   1.00 34.30 ? 236 SER A CA    1 
ATOM   1889 C C     . SER A 1 246 ? 13.088  56.894 7.348   1.00 33.25 ? 236 SER A C     1 
ATOM   1890 O O     . SER A 1 246 ? 12.869  57.854 8.093   1.00 33.24 ? 236 SER A O     1 
ATOM   1891 C CB    . SER A 1 246 ? 12.266  54.832 8.583   1.00 35.32 ? 236 SER A CB    1 
ATOM   1892 O OG    . SER A 1 246 ? 13.486  54.111 8.587   1.00 37.33 ? 236 SER A OG    1 
ATOM   1893 N N     . VAL A 1 247 ? 14.147  56.840 6.542   1.00 31.69 ? 237 VAL A N     1 
ATOM   1894 C CA    . VAL A 1 247 ? 15.075  57.959 6.457   1.00 31.21 ? 237 VAL A CA    1 
ATOM   1895 C C     . VAL A 1 247 ? 15.481  58.211 5.015   1.00 30.45 ? 237 VAL A C     1 
ATOM   1896 O O     . VAL A 1 247 ? 16.095  57.363 4.369   1.00 29.76 ? 237 VAL A O     1 
ATOM   1897 C CB    . VAL A 1 247 ? 16.367  57.777 7.311   1.00 30.86 ? 237 VAL A CB    1 
ATOM   1898 C CG1   . VAL A 1 247 ? 17.231  59.030 7.207   1.00 30.95 ? 237 VAL A CG1   1 
ATOM   1899 C CG2   . VAL A 1 247 ? 16.042  57.495 8.770   1.00 31.22 ? 237 VAL A CG2   1 
ATOM   1900 N N     . ILE A 1 248 ? 15.117  59.391 4.534   1.00 30.42 ? 238 ILE A N     1 
ATOM   1901 C CA    . ILE A 1 248 ? 15.406  59.823 3.179   1.00 29.47 ? 238 ILE A CA    1 
ATOM   1902 C C     . ILE A 1 248 ? 16.538  60.852 3.269   1.00 28.80 ? 238 ILE A C     1 
ATOM   1903 O O     . ILE A 1 248 ? 16.475  61.762 4.085   1.00 28.60 ? 238 ILE A O     1 
ATOM   1904 C CB    . ILE A 1 248 ? 14.154  60.489 2.549   1.00 29.55 ? 238 ILE A CB    1 
ATOM   1905 C CG1   . ILE A 1 248 ? 13.054  59.460 2.208   1.00 30.28 ? 238 ILE A CG1   1 
ATOM   1906 C CG2   . ILE A 1 248 ? 14.545  61.376 1.341   1.00 29.63 ? 238 ILE A CG2   1 
ATOM   1907 C CD1   . ILE A 1 248 ? 13.233  58.709 0.886   1.00 31.94 ? 238 ILE A CD1   1 
ATOM   1908 N N     . PHE A 1 249 ? 17.588  60.670 2.471   1.00 27.93 ? 239 PHE A N     1 
ATOM   1909 C CA    . PHE A 1 249 ? 18.557  61.733 2.242   1.00 27.67 ? 239 PHE A CA    1 
ATOM   1910 C C     . PHE A 1 249 ? 18.405  62.150 0.795   1.00 26.79 ? 239 PHE A C     1 
ATOM   1911 O O     . PHE A 1 249 ? 18.375  61.301 -0.082  1.00 27.66 ? 239 PHE A O     1 
ATOM   1912 C CB    . PHE A 1 249 ? 20.007  61.266 2.490   1.00 26.70 ? 239 PHE A CB    1 
ATOM   1913 C CG    . PHE A 1 249 ? 21.035  62.343 2.198   1.00 26.89 ? 239 PHE A CG    1 
ATOM   1914 C CD1   . PHE A 1 249 ? 21.310  63.320 3.143   1.00 25.40 ? 239 PHE A CD1   1 
ATOM   1915 C CD2   . PHE A 1 249 ? 21.674  62.415 0.956   1.00 26.63 ? 239 PHE A CD2   1 
ATOM   1916 C CE1   . PHE A 1 249 ? 22.203  64.325 2.878   1.00 26.76 ? 239 PHE A CE1   1 
ATOM   1917 C CE2   . PHE A 1 249 ? 22.577  63.430 0.678   1.00 27.41 ? 239 PHE A CE2   1 
ATOM   1918 C CZ    . PHE A 1 249 ? 22.850  64.386 1.640   1.00 26.65 ? 239 PHE A CZ    1 
ATOM   1919 N N     . VAL A 1 250 ? 18.317  63.454 0.545   1.00 27.52 ? 240 VAL A N     1 
ATOM   1920 C CA    . VAL A 1 250 ? 18.164  63.970 -0.817  1.00 26.31 ? 240 VAL A CA    1 
ATOM   1921 C C     . VAL A 1 250 ? 18.838  65.347 -1.011  1.00 26.45 ? 240 VAL A C     1 
ATOM   1922 O O     . VAL A 1 250 ? 18.502  66.336 -0.343  1.00 25.36 ? 240 VAL A O     1 
ATOM   1923 C CB    . VAL A 1 250 ? 16.669  63.959 -1.236  1.00 26.81 ? 240 VAL A CB    1 
ATOM   1924 C CG1   . VAL A 1 250 ? 15.849  64.982 -0.439  1.00 25.49 ? 240 VAL A CG1   1 
ATOM   1925 C CG2   . VAL A 1 250 ? 16.516  64.135 -2.723  1.00 26.69 ? 240 VAL A CG2   1 
ATOM   1926 N N     . ASN A 1 251 ? 19.814  65.399 -1.911  1.00 25.54 ? 241 ASN A N     1 
ATOM   1927 C CA    . ASN A 1 251 ? 20.579  66.632 -2.114  1.00 26.89 ? 241 ASN A CA    1 
ATOM   1928 C C     . ASN A 1 251 ? 19.874  67.370 -3.232  1.00 27.73 ? 241 ASN A C     1 
ATOM   1929 O O     . ASN A 1 251 ? 20.292  67.287 -4.377  1.00 27.91 ? 241 ASN A O     1 
ATOM   1930 C CB    . ASN A 1 251 ? 22.049  66.330 -2.492  1.00 26.25 ? 241 ASN A CB    1 
ATOM   1931 C CG    . ASN A 1 251 ? 22.929  67.608 -2.554  1.00 28.04 ? 241 ASN A CG    1 
ATOM   1932 O OD1   . ASN A 1 251 ? 22.434  68.750 -2.537  1.00 29.41 ? 241 ASN A OD1   1 
ATOM   1933 N ND2   . ASN A 1 251 ? 24.220  67.408 -2.657  1.00 27.42 ? 241 ASN A ND2   1 
ATOM   1934 N N     . ASN A 1 252 ? 18.791  68.074 -2.898  1.00 28.80 ? 242 ASN A N     1 
ATOM   1935 C CA    . ASN A 1 252 ? 17.863  68.559 -3.922  1.00 30.51 ? 242 ASN A CA    1 
ATOM   1936 C C     . ASN A 1 252 ? 18.105  70.003 -4.337  1.00 32.00 ? 242 ASN A C     1 
ATOM   1937 O O     . ASN A 1 252 ? 17.339  70.551 -5.119  1.00 32.85 ? 242 ASN A O     1 
ATOM   1938 C CB    . ASN A 1 252 ? 16.429  68.410 -3.430  1.00 29.60 ? 242 ASN A CB    1 
ATOM   1939 C CG    . ASN A 1 252 ? 16.189  69.170 -2.148  1.00 29.21 ? 242 ASN A CG    1 
ATOM   1940 O OD1   . ASN A 1 252 ? 17.053  69.195 -1.260  1.00 26.58 ? 242 ASN A OD1   1 
ATOM   1941 N ND2   . ASN A 1 252 ? 15.031  69.819 -2.047  1.00 27.18 ? 242 ASN A ND2   1 
ATOM   1942 N N     . PHE A 1 253 ? 19.182  70.609 -3.835  1.00 33.69 ? 243 PHE A N     1 
ATOM   1943 C CA    . PHE A 1 253 ? 19.422  72.027 -4.050  1.00 35.04 ? 243 PHE A CA    1 
ATOM   1944 C C     . PHE A 1 253 ? 19.158  72.509 -5.475  1.00 35.27 ? 243 PHE A C     1 
ATOM   1945 O O     . PHE A 1 253 ? 18.605  73.610 -5.680  1.00 35.84 ? 243 PHE A O     1 
ATOM   1946 C CB    . PHE A 1 253 ? 20.849  72.397 -3.664  1.00 35.65 ? 243 PHE A CB    1 
ATOM   1947 C CG    . PHE A 1 253 ? 21.085  73.873 -3.601  1.00 38.07 ? 243 PHE A CG    1 
ATOM   1948 C CD1   . PHE A 1 253 ? 20.704  74.600 -2.483  1.00 38.24 ? 243 PHE A CD1   1 
ATOM   1949 C CD2   . PHE A 1 253 ? 21.706  74.538 -4.664  1.00 40.94 ? 243 PHE A CD2   1 
ATOM   1950 C CE1   . PHE A 1 253 ? 20.927  75.977 -2.420  1.00 40.67 ? 243 PHE A CE1   1 
ATOM   1951 C CE2   . PHE A 1 253 ? 21.933  75.904 -4.612  1.00 41.03 ? 243 PHE A CE2   1 
ATOM   1952 C CZ    . PHE A 1 253 ? 21.545  76.627 -3.486  1.00 42.58 ? 243 PHE A CZ    1 
ATOM   1953 N N     . ALA A 1 254 ? 19.579  71.717 -6.453  1.00 34.83 ? 244 ALA A N     1 
ATOM   1954 C CA    . ALA A 1 254 ? 19.417  72.106 -7.855  1.00 35.22 ? 244 ALA A CA    1 
ATOM   1955 C C     . ALA A 1 254 ? 18.282  71.352 -8.576  1.00 35.10 ? 244 ALA A C     1 
ATOM   1956 O O     . ALA A 1 254 ? 18.190  71.413 -9.802  1.00 36.03 ? 244 ALA A O     1 
ATOM   1957 C CB    . ALA A 1 254 ? 20.732  71.924 -8.601  1.00 35.12 ? 244 ALA A CB    1 
ATOM   1958 N N     . PHE A 1 255 ? 17.425  70.644 -7.842  1.00 34.72 ? 245 PHE A N     1 
ATOM   1959 C CA    . PHE A 1 255 ? 16.329  69.897 -8.498  1.00 34.50 ? 245 PHE A CA    1 
ATOM   1960 C C     . PHE A 1 255 ? 15.294  70.814 -9.172  1.00 34.77 ? 245 PHE A C     1 
ATOM   1961 O O     . PHE A 1 255 ? 14.807  70.507 -10.254 1.00 34.53 ? 245 PHE A O     1 
ATOM   1962 C CB    . PHE A 1 255 ? 15.620  68.930 -7.523  1.00 34.07 ? 245 PHE A CB    1 
ATOM   1963 C CG    . PHE A 1 255 ? 16.407  67.695 -7.177  1.00 33.07 ? 245 PHE A CG    1 
ATOM   1964 C CD1   . PHE A 1 255 ? 17.643  67.421 -7.777  1.00 31.72 ? 245 PHE A CD1   1 
ATOM   1965 C CD2   . PHE A 1 255 ? 15.881  66.767 -6.278  1.00 30.83 ? 245 PHE A CD2   1 
ATOM   1966 C CE1   . PHE A 1 255 ? 18.355  66.251 -7.459  1.00 29.91 ? 245 PHE A CE1   1 
ATOM   1967 C CE2   . PHE A 1 255 ? 16.586  65.618 -5.942  1.00 30.78 ? 245 PHE A CE2   1 
ATOM   1968 C CZ    . PHE A 1 255 ? 17.822  65.351 -6.532  1.00 31.80 ? 245 PHE A CZ    1 
ATOM   1969 N N     . GLY A 1 256 ? 14.969  71.938 -8.533  1.00 35.50 ? 246 GLY A N     1 
ATOM   1970 C CA    . GLY A 1 256 ? 13.918  72.851 -9.026  1.00 36.46 ? 246 GLY A CA    1 
ATOM   1971 C C     . GLY A 1 256 ? 12.546  72.601 -8.405  1.00 37.13 ? 246 GLY A C     1 
ATOM   1972 O O     . GLY A 1 256 ? 12.320  71.551 -7.795  1.00 36.79 ? 246 GLY A O     1 
ATOM   1973 N N     . PRO A 1 257 ? 11.600  73.551 -8.597  1.00 37.81 ? 247 PRO A N     1 
ATOM   1974 C CA    . PRO A 1 257 ? 10.273  73.442 -7.988  1.00 37.79 ? 247 PRO A CA    1 
ATOM   1975 C C     . PRO A 1 257 ? 9.443   72.256 -8.478  1.00 37.76 ? 247 PRO A C     1 
ATOM   1976 O O     . PRO A 1 257 ? 8.692   71.698 -7.695  1.00 38.11 ? 247 PRO A O     1 
ATOM   1977 C CB    . PRO A 1 257 ? 9.595   74.773 -8.357  1.00 37.63 ? 247 PRO A CB    1 
ATOM   1978 C CG    . PRO A 1 257 ? 10.302  75.228 -9.589  1.00 38.33 ? 247 PRO A CG    1 
ATOM   1979 C CD    . PRO A 1 257 ? 11.733  74.778 -9.406  1.00 37.85 ? 247 PRO A CD    1 
ATOM   1980 N N     . GLU A 1 258 ? 9.603   71.867 -9.740  1.00 37.90 ? 248 GLU A N     1 
ATOM   1981 C CA    . GLU A 1 258 ? 8.845   70.765 -10.332 1.00 37.56 ? 248 GLU A CA    1 
ATOM   1982 C C     . GLU A 1 258 ? 9.190   69.421 -9.720  1.00 36.93 ? 248 GLU A C     1 
ATOM   1983 O O     . GLU A 1 258 ? 8.290   68.647 -9.353  1.00 36.61 ? 248 GLU A O     1 
ATOM   1984 C CB    . GLU A 1 258 ? 9.069   70.711 -11.845 1.00 38.41 ? 248 GLU A CB    1 
ATOM   1985 C CG    . GLU A 1 258 ? 8.281   69.611 -12.556 1.00 42.07 ? 248 GLU A CG    1 
ATOM   1986 C CD    . GLU A 1 258 ? 6.786   69.881 -12.577 1.00 46.81 ? 248 GLU A CD    1 
ATOM   1987 O OE1   . GLU A 1 258 ? 6.385   70.982 -13.036 1.00 49.66 ? 248 GLU A OE1   1 
ATOM   1988 O OE2   . GLU A 1 258 ? 6.017   68.996 -12.130 1.00 48.06 ? 248 GLU A OE2   1 
ATOM   1989 N N     . VAL A 1 259 ? 10.488  69.137 -9.610  1.00 35.07 ? 249 VAL A N     1 
ATOM   1990 C CA    . VAL A 1 259 ? 10.933  67.893 -8.990  1.00 34.17 ? 249 VAL A CA    1 
ATOM   1991 C C     . VAL A 1 259 ? 10.592  67.901 -7.497  1.00 33.73 ? 249 VAL A C     1 
ATOM   1992 O O     . VAL A 1 259 ? 10.029  66.937 -7.002  1.00 33.40 ? 249 VAL A O     1 
ATOM   1993 C CB    . VAL A 1 259 ? 12.435  67.573 -9.311  1.00 33.69 ? 249 VAL A CB    1 
ATOM   1994 C CG1   . VAL A 1 259 ? 12.952  66.339 -8.552  1.00 33.32 ? 249 VAL A CG1   1 
ATOM   1995 C CG2   . VAL A 1 259 ? 12.624  67.378 -10.821 1.00 34.50 ? 249 VAL A CG2   1 
ATOM   1996 N N     . ASP A 1 260 ? 10.884  68.995 -6.790  1.00 34.47 ? 250 ASP A N     1 
ATOM   1997 C CA    . ASP A 1 260 ? 10.546  69.066 -5.366  1.00 34.41 ? 250 ASP A CA    1 
ATOM   1998 C C     . ASP A 1 260 ? 9.047   68.831 -5.136  1.00 35.03 ? 250 ASP A C     1 
ATOM   1999 O O     . ASP A 1 260 ? 8.672   68.094 -4.218  1.00 34.16 ? 250 ASP A O     1 
ATOM   2000 C CB    . ASP A 1 260 ? 10.984  70.385 -4.710  1.00 34.65 ? 250 ASP A CB    1 
ATOM   2001 C CG    . ASP A 1 260 ? 12.511  70.495 -4.511  1.00 34.08 ? 250 ASP A CG    1 
ATOM   2002 O OD1   . ASP A 1 260 ? 13.239  69.482 -4.588  1.00 33.29 ? 250 ASP A OD1   1 
ATOM   2003 O OD2   . ASP A 1 260 ? 12.987  71.623 -4.296  1.00 34.20 ? 250 ASP A OD2   1 
ATOM   2004 N N     . HIS A 1 261 ? 8.202   69.464 -5.961  1.00 35.56 ? 251 HIS A N     1 
ATOM   2005 C CA    . HIS A 1 261 ? 6.760   69.293 -5.841  1.00 36.05 ? 251 HIS A CA    1 
ATOM   2006 C C     . HIS A 1 261 ? 6.411   67.813 -5.953  1.00 35.90 ? 251 HIS A C     1 
ATOM   2007 O O     . HIS A 1 261 ? 5.654   67.299 -5.138  1.00 35.77 ? 251 HIS A O     1 
ATOM   2008 C CB    . HIS A 1 261 ? 6.021   70.114 -6.896  1.00 36.52 ? 251 HIS A CB    1 
ATOM   2009 C CG    . HIS A 1 261 ? 4.545   69.863 -6.933  1.00 39.10 ? 251 HIS A CG    1 
ATOM   2010 N ND1   . HIS A 1 261 ? 3.651   70.557 -6.147  1.00 40.72 ? 251 HIS A ND1   1 
ATOM   2011 C CD2   . HIS A 1 261 ? 3.808   68.995 -7.666  1.00 40.94 ? 251 HIS A CD2   1 
ATOM   2012 C CE1   . HIS A 1 261 ? 2.426   70.131 -6.394  1.00 42.11 ? 251 HIS A CE1   1 
ATOM   2013 N NE2   . HIS A 1 261 ? 2.495   69.182 -7.314  1.00 43.02 ? 251 HIS A NE2   1 
ATOM   2014 N N     . GLN A 1 262 ? 6.978   67.120 -6.946  1.00 35.58 ? 252 GLN A N     1 
ATOM   2015 C CA    . GLN A 1 262 ? 6.699   65.695 -7.099  1.00 35.60 ? 252 GLN A CA    1 
ATOM   2016 C C     . GLN A 1 262 ? 7.199   64.880 -5.903  1.00 35.05 ? 252 GLN A C     1 
ATOM   2017 O O     . GLN A 1 262 ? 6.537   63.923 -5.484  1.00 34.76 ? 252 GLN A O     1 
ATOM   2018 C CB    . GLN A 1 262 ? 7.269   65.151 -8.411  1.00 36.68 ? 252 GLN A CB    1 
ATOM   2019 C CG    . GLN A 1 262 ? 6.723   65.870 -9.657  1.00 38.37 ? 252 GLN A CG    1 
ATOM   2020 C CD    . GLN A 1 262 ? 7.515   65.558 -10.903 1.00 40.60 ? 252 GLN A CD    1 
ATOM   2021 O OE1   . GLN A 1 262 ? 8.306   66.379 -11.368 1.00 44.42 ? 252 GLN A OE1   1 
ATOM   2022 N NE2   . GLN A 1 262 ? 7.306   64.373 -11.460 1.00 41.79 ? 252 GLN A NE2   1 
ATOM   2023 N N     . LEU A 1 263 ? 8.344   65.266 -5.333  1.00 33.61 ? 253 LEU A N     1 
ATOM   2024 C CA    . LEU A 1 263 ? 8.827   64.592 -4.117  1.00 32.84 ? 253 LEU A CA    1 
ATOM   2025 C C     . LEU A 1 263 ? 7.897   64.793 -2.912  1.00 32.24 ? 253 LEU A C     1 
ATOM   2026 O O     . LEU A 1 263 ? 7.636   63.835 -2.193  1.00 31.22 ? 253 LEU A O     1 
ATOM   2027 C CB    . LEU A 1 263 ? 10.281  64.974 -3.771  1.00 32.22 ? 253 LEU A CB    1 
ATOM   2028 C CG    . LEU A 1 263 ? 11.357  64.313 -4.645  1.00 31.10 ? 253 LEU A CG    1 
ATOM   2029 C CD1   . LEU A 1 263 ? 12.645  65.075 -4.568  1.00 29.95 ? 253 LEU A CD1   1 
ATOM   2030 C CD2   . LEU A 1 263 ? 11.582  62.848 -4.251  1.00 30.34 ? 253 LEU A CD2   1 
ATOM   2031 N N     . LYS A 1 264 ? 7.408   66.023 -2.713  1.00 32.09 ? 254 LYS A N     1 
ATOM   2032 C CA    . LYS A 1 264 ? 6.432   66.337 -1.649  1.00 33.57 ? 254 LYS A CA    1 
ATOM   2033 C C     . LYS A 1 264 ? 5.281   65.325 -1.669  1.00 33.50 ? 254 LYS A C     1 
ATOM   2034 O O     . LYS A 1 264 ? 4.862   64.801 -0.633  1.00 33.33 ? 254 LYS A O     1 
ATOM   2035 C CB    . LYS A 1 264 ? 5.847   67.744 -1.839  1.00 33.62 ? 254 LYS A CB    1 
ATOM   2036 C CG    . LYS A 1 264 ? 6.771   68.891 -1.448  1.00 34.41 ? 254 LYS A CG    1 
ATOM   2037 C CD    . LYS A 1 264 ? 6.158   70.230 -1.821  1.00 34.70 ? 254 LYS A CD    1 
ATOM   2038 C CE    . LYS A 1 264 ? 7.246   71.252 -2.051  1.00 36.38 ? 254 LYS A CE    1 
ATOM   2039 N NZ    . LYS A 1 264 ? 6.849   72.617 -1.593  1.00 39.64 ? 254 LYS A NZ    1 
ATOM   2040 N N     . GLU A 1 265 ? 4.803   65.054 -2.878  1.00 34.03 ? 255 GLU A N     1 
ATOM   2041 C CA    . GLU A 1 265 ? 3.686   64.144 -3.108  1.00 34.62 ? 255 GLU A CA    1 
ATOM   2042 C C     . GLU A 1 265 ? 4.033   62.747 -2.637  1.00 34.33 ? 255 GLU A C     1 
ATOM   2043 O O     . GLU A 1 265 ? 3.186   62.038 -2.068  1.00 34.65 ? 255 GLU A O     1 
ATOM   2044 C CB    . GLU A 1 265 ? 3.356   64.151 -4.594  1.00 34.87 ? 255 GLU A CB    1 
ATOM   2045 C CG    . GLU A 1 265 ? 2.587   62.959 -5.100  1.00 39.21 ? 255 GLU A CG    1 
ATOM   2046 C CD    . GLU A 1 265 ? 1.860   63.279 -6.383  1.00 42.17 ? 255 GLU A CD    1 
ATOM   2047 O OE1   . GLU A 1 265 ? 1.772   62.386 -7.246  1.00 45.64 ? 255 GLU A OE1   1 
ATOM   2048 O OE2   . GLU A 1 265 ? 1.394   64.430 -6.531  1.00 44.33 ? 255 GLU A OE2   1 
ATOM   2049 N N     . ARG A 1 266 ? 5.275   62.336 -2.884  1.00 33.36 ? 256 ARG A N     1 
ATOM   2050 C CA    . ARG A 1 266 ? 5.707   61.025 -2.449  1.00 33.13 ? 256 ARG A CA    1 
ATOM   2051 C C     . ARG A 1 266 ? 6.002   60.976 -0.964  1.00 32.66 ? 256 ARG A C     1 
ATOM   2052 O O     . ARG A 1 266 ? 5.774   59.947 -0.336  1.00 32.52 ? 256 ARG A O     1 
ATOM   2053 C CB    . ARG A 1 266 ? 6.878   60.508 -3.292  1.00 33.53 ? 256 ARG A CB    1 
ATOM   2054 C CG    . ARG A 1 266 ? 6.403   60.059 -4.679  1.00 34.84 ? 256 ARG A CG    1 
ATOM   2055 C CD    . ARG A 1 266 ? 7.346   60.616 -5.683  1.00 37.12 ? 256 ARG A CD    1 
ATOM   2056 N NE    . ARG A 1 266 ? 7.046   60.214 -7.055  1.00 38.85 ? 256 ARG A NE    1 
ATOM   2057 C CZ    . ARG A 1 266 ? 6.392   60.973 -7.931  1.00 36.10 ? 256 ARG A CZ    1 
ATOM   2058 N NH1   . ARG A 1 266 ? 5.921   62.162 -7.574  1.00 35.92 ? 256 ARG A NH1   1 
ATOM   2059 N NH2   . ARG A 1 266 ? 6.204   60.535 -9.157  1.00 35.67 ? 256 ARG A NH2   1 
ATOM   2060 N N     . PHE A 1 267 ? 6.476   62.083 -0.394  1.00 32.41 ? 257 PHE A N     1 
ATOM   2061 C CA    . PHE A 1 267 ? 6.678   62.145 1.058   1.00 32.90 ? 257 PHE A CA    1 
ATOM   2062 C C     . PHE A 1 267 ? 5.361   62.060 1.849   1.00 33.56 ? 257 PHE A C     1 
ATOM   2063 O O     . PHE A 1 267 ? 5.314   61.500 2.945   1.00 32.92 ? 257 PHE A O     1 
ATOM   2064 C CB    . PHE A 1 267 ? 7.467   63.385 1.459   1.00 32.35 ? 257 PHE A CB    1 
ATOM   2065 C CG    . PHE A 1 267 ? 8.848   63.462 0.836   1.00 31.54 ? 257 PHE A CG    1 
ATOM   2066 C CD1   . PHE A 1 267 ? 9.518   62.313 0.429   1.00 32.13 ? 257 PHE A CD1   1 
ATOM   2067 C CD2   . PHE A 1 267 ? 9.467   64.688 0.665   1.00 31.66 ? 257 PHE A CD2   1 
ATOM   2068 C CE1   . PHE A 1 267 ? 10.807  62.385 -0.147  1.00 32.21 ? 257 PHE A CE1   1 
ATOM   2069 C CE2   . PHE A 1 267 ? 10.744  64.781 0.109   1.00 30.58 ? 257 PHE A CE2   1 
ATOM   2070 C CZ    . PHE A 1 267 ? 11.414  63.635 -0.313  1.00 29.79 ? 257 PHE A CZ    1 
ATOM   2071 N N     . ALA A 1 268 ? 4.291   62.589 1.260   1.00 34.25 ? 258 ALA A N     1 
ATOM   2072 C CA    . ALA A 1 268 ? 2.997   62.663 1.934   1.00 35.11 ? 258 ALA A CA    1 
ATOM   2073 C C     . ALA A 1 268 ? 2.428   61.279 2.249   1.00 35.65 ? 258 ALA A C     1 
ATOM   2074 O O     . ALA A 1 268 ? 1.411   61.169 2.936   1.00 36.69 ? 258 ALA A O     1 
ATOM   2075 C CB    . ALA A 1 268 ? 2.002   63.517 1.094   1.00 35.29 ? 258 ALA A CB    1 
ATOM   2076 N N     . ASN A 1 269 ? 3.100   60.229 1.767   1.00 35.70 ? 259 ASN A N     1 
ATOM   2077 C CA    . ASN A 1 269 ? 2.720   58.840 2.014   1.00 36.03 ? 259 ASN A CA    1 
ATOM   2078 C C     . ASN A 1 269 ? 3.614   58.108 3.019   1.00 36.29 ? 259 ASN A C     1 
ATOM   2079 O O     . ASN A 1 269 ? 3.447   56.895 3.256   1.00 35.95 ? 259 ASN A O     1 
ATOM   2080 C CB    . ASN A 1 269 ? 2.669   58.060 0.694   1.00 36.15 ? 259 ASN A CB    1 
ATOM   2081 C CG    . ASN A 1 269 ? 1.362   58.279 -0.064  1.00 37.78 ? 259 ASN A CG    1 
ATOM   2082 O OD1   . ASN A 1 269 ? 0.314   58.506 0.535   1.00 39.25 ? 259 ASN A OD1   1 
ATOM   2083 N ND2   . ASN A 1 269 ? 1.425   58.205 -1.387  1.00 38.73 ? 259 ASN A ND2   1 
ATOM   2084 N N     . MET A 1 270 ? 4.566   58.851 3.586   1.00 35.86 ? 260 MET A N     1 
ATOM   2085 C CA    . MET A 1 270 ? 5.522   58.316 4.543   1.00 36.79 ? 260 MET A CA    1 
ATOM   2086 C C     . MET A 1 270 ? 4.888   58.167 5.909   1.00 37.14 ? 260 MET A C     1 
ATOM   2087 O O     . MET A 1 270 ? 3.942   58.893 6.259   1.00 36.70 ? 260 MET A O     1 
ATOM   2088 C CB    . MET A 1 270 ? 6.765   59.226 4.656   1.00 36.13 ? 260 MET A CB    1 
ATOM   2089 C CG    . MET A 1 270 ? 7.716   59.128 3.465   1.00 36.85 ? 260 MET A CG    1 
ATOM   2090 S SD    . MET A 1 270 ? 9.112   60.271 3.603   1.00 35.82 ? 260 MET A SD    1 
ATOM   2091 C CE    . MET A 1 270 ? 10.046  59.505 4.931   1.00 35.15 ? 260 MET A CE    1 
ATOM   2092 N N     . LYS A 1 271 ? 5.440   57.224 6.666   1.00 37.77 ? 261 LYS A N     1 
ATOM   2093 C CA    . LYS A 1 271 ? 4.990   56.886 8.005   1.00 38.55 ? 261 LYS A CA    1 
ATOM   2094 C C     . LYS A 1 271 ? 5.341   57.961 9.006   1.00 38.74 ? 261 LYS A C     1 
ATOM   2095 O O     . LYS A 1 271 ? 6.270   58.759 8.784   1.00 38.81 ? 261 LYS A O     1 
ATOM   2096 C CB    . LYS A 1 271 ? 5.588   55.540 8.428   1.00 38.87 ? 261 LYS A CB    1 
ATOM   2097 C CG    . LYS A 1 271 ? 5.105   54.382 7.580   1.00 41.31 ? 261 LYS A CG    1 
ATOM   2098 C CD    . LYS A 1 271 ? 6.085   53.214 7.635   1.00 44.17 ? 261 LYS A CD    1 
ATOM   2099 C CE    . LYS A 1 271 ? 5.788   52.184 6.559   1.00 46.17 ? 261 LYS A CE    1 
ATOM   2100 N NZ    . LYS A 1 271 ? 6.624   50.952 6.739   1.00 46.43 ? 261 LYS A NZ    1 
ATOM   2101 N N     . GLU A 1 272 ? 4.552   58.006 10.079  1.00 38.34 ? 262 GLU A N     1 
ATOM   2102 C CA    . GLU A 1 272 ? 4.820   58.831 11.251  1.00 38.74 ? 262 GLU A CA    1 
ATOM   2103 C C     . GLU A 1 272 ? 6.256   58.656 11.734  1.00 37.98 ? 262 GLU A C     1 
ATOM   2104 O O     . GLU A 1 272 ? 6.740   57.547 11.841  1.00 37.96 ? 262 GLU A O     1 
ATOM   2105 C CB    . GLU A 1 272 ? 3.878   58.417 12.384  1.00 38.99 ? 262 GLU A CB    1 
ATOM   2106 C CG    . GLU A 1 272 ? 3.504   59.552 13.303  1.00 40.55 ? 262 GLU A CG    1 
ATOM   2107 C CD    . GLU A 1 272 ? 2.504   60.525 12.665  1.00 41.84 ? 262 GLU A CD    1 
ATOM   2108 O OE1   . GLU A 1 272 ? 2.369   61.648 13.181  1.00 41.33 ? 262 GLU A OE1   1 
ATOM   2109 O OE2   . GLU A 1 272 ? 1.859   60.163 11.650  1.00 42.58 ? 262 GLU A OE2   1 
ATOM   2110 N N     . GLY A 1 273 ? 6.930   59.762 12.031  1.00 38.21 ? 263 GLY A N     1 
ATOM   2111 C CA    . GLY A 1 273 ? 8.304   59.706 12.518  1.00 37.61 ? 263 GLY A CA    1 
ATOM   2112 C C     . GLY A 1 273 ? 9.363   59.504 11.438  1.00 37.25 ? 263 GLY A C     1 
ATOM   2113 O O     . GLY A 1 273 ? 10.574  59.500 11.743  1.00 37.23 ? 263 GLY A O     1 
ATOM   2114 N N     . GLY A 1 274 ? 8.931   59.333 10.186  1.00 35.51 ? 264 GLY A N     1 
ATOM   2115 C CA    . GLY A 1 274 ? 9.864   59.258 9.071   1.00 34.16 ? 264 GLY A CA    1 
ATOM   2116 C C     . GLY A 1 274 ? 10.656  60.553 8.991   1.00 34.03 ? 264 GLY A C     1 
ATOM   2117 O O     . GLY A 1 274 ? 10.181  61.614 9.434   1.00 32.69 ? 264 GLY A O     1 
ATOM   2118 N N     . ARG A 1 275 ? 11.873  60.474 8.449   1.00 33.12 ? 265 ARG A N     1 
ATOM   2119 C CA    . ARG A 1 275 ? 12.727  61.656 8.393   1.00 32.42 ? 265 ARG A CA    1 
ATOM   2120 C C     . ARG A 1 275 ? 13.264  61.871 7.005   1.00 31.36 ? 265 ARG A C     1 
ATOM   2121 O O     . ARG A 1 275 ? 13.494  60.911 6.284   1.00 31.26 ? 265 ARG A O     1 
ATOM   2122 C CB    . ARG A 1 275 ? 13.859  61.572 9.424   1.00 33.34 ? 265 ARG A CB    1 
ATOM   2123 C CG    . ARG A 1 275 ? 13.359  61.710 10.867  1.00 34.96 ? 265 ARG A CG    1 
ATOM   2124 C CD    . ARG A 1 275 ? 14.349  61.137 11.878  1.00 36.87 ? 265 ARG A CD    1 
ATOM   2125 N NE    . ARG A 1 275 ? 14.514  59.687 11.755  1.00 37.07 ? 265 ARG A NE    1 
ATOM   2126 C CZ    . ARG A 1 275 ? 15.342  58.965 12.519  1.00 37.98 ? 265 ARG A CZ    1 
ATOM   2127 N NH1   . ARG A 1 275 ? 15.430  57.650 12.351  1.00 36.41 ? 265 ARG A NH1   1 
ATOM   2128 N NH2   . ARG A 1 275 ? 16.077  59.557 13.462  1.00 37.18 ? 265 ARG A NH2   1 
ATOM   2129 N N     . ILE A 1 276 ? 13.412  63.146 6.638   1.00 30.55 ? 266 ILE A N     1 
ATOM   2130 C CA    . ILE A 1 276 ? 13.982  63.562 5.372   1.00 29.47 ? 266 ILE A CA    1 
ATOM   2131 C C     . ILE A 1 276 ? 15.082  64.609 5.659   1.00 29.41 ? 266 ILE A C     1 
ATOM   2132 O O     . ILE A 1 276 ? 14.824  65.653 6.294   1.00 28.72 ? 266 ILE A O     1 
ATOM   2133 C CB    . ILE A 1 276 ? 12.903  64.176 4.446   1.00 29.64 ? 266 ILE A CB    1 
ATOM   2134 C CG1   . ILE A 1 276 ? 11.767  63.173 4.162   1.00 30.78 ? 266 ILE A CG1   1 
ATOM   2135 C CG2   . ILE A 1 276 ? 13.520  64.672 3.136   1.00 28.50 ? 266 ILE A CG2   1 
ATOM   2136 C CD1   . ILE A 1 276 ? 10.403  63.790 4.125   1.00 32.02 ? 266 ILE A CD1   1 
ATOM   2137 N N     . VAL A 1 277 ? 16.298  64.323 5.194   1.00 28.57 ? 267 VAL A N     1 
ATOM   2138 C CA    . VAL A 1 277 ? 17.407  65.280 5.258   1.00 28.49 ? 267 VAL A CA    1 
ATOM   2139 C C     . VAL A 1 277 ? 17.652  65.827 3.871   1.00 28.09 ? 267 VAL A C     1 
ATOM   2140 O O     . VAL A 1 277 ? 17.893  65.063 2.950   1.00 29.56 ? 267 VAL A O     1 
ATOM   2141 C CB    . VAL A 1 277 ? 18.725  64.615 5.822   1.00 28.94 ? 267 VAL A CB    1 
ATOM   2142 C CG1   . VAL A 1 277 ? 19.903  65.593 5.751   1.00 27.26 ? 267 VAL A CG1   1 
ATOM   2143 C CG2   . VAL A 1 277 ? 18.499  64.180 7.264   1.00 29.63 ? 267 VAL A CG2   1 
ATOM   2144 N N     . SER A 1 278 ? 17.604  67.143 3.697   1.00 28.69 ? 268 SER A N     1 
ATOM   2145 C CA    . SER A 1 278 ? 17.790  67.722 2.358   1.00 28.07 ? 268 SER A CA    1 
ATOM   2146 C C     . SER A 1 278 ? 18.576  69.030 2.372   1.00 28.79 ? 268 SER A C     1 
ATOM   2147 O O     . SER A 1 278 ? 18.774  69.623 3.432   1.00 30.17 ? 268 SER A O     1 
ATOM   2148 C CB    . SER A 1 278 ? 16.428  67.930 1.680   1.00 28.18 ? 268 SER A CB    1 
ATOM   2149 O OG    . SER A 1 278 ? 15.782  69.072 2.194   1.00 24.63 ? 268 SER A OG    1 
ATOM   2150 N N     . SER A 1 279 ? 19.030  69.481 1.204   1.00 29.51 ? 269 SER A N     1 
ATOM   2151 C CA    . SER A 1 279 ? 19.780  70.754 1.099   1.00 30.71 ? 269 SER A CA    1 
ATOM   2152 C C     . SER A 1 279 ? 18.908  71.970 0.759   1.00 30.71 ? 269 SER A C     1 
ATOM   2153 O O     . SER A 1 279 ? 19.423  73.082 0.606   1.00 30.74 ? 269 SER A O     1 
ATOM   2154 C CB    . SER A 1 279 ? 20.937  70.651 0.094   1.00 30.20 ? 269 SER A CB    1 
ATOM   2155 O OG    . SER A 1 279 ? 20.528  70.003 -1.093  1.00 32.32 ? 269 SER A OG    1 
ATOM   2156 N N     . LYS A 1 280 ? 17.603  71.736 0.613   1.00 31.59 ? 270 LYS A N     1 
ATOM   2157 C CA    . LYS A 1 280 ? 16.596  72.798 0.417   1.00 32.21 ? 270 LYS A CA    1 
ATOM   2158 C C     . LYS A 1 280 ? 15.308  72.310 1.078   1.00 31.88 ? 270 LYS A C     1 
ATOM   2159 O O     . LYS A 1 280 ? 14.834  71.217 0.755   1.00 31.48 ? 270 LYS A O     1 
ATOM   2160 C CB    . LYS A 1 280 ? 16.348  73.096 -1.068  1.00 32.42 ? 270 LYS A CB    1 
ATOM   2161 C CG    . LYS A 1 280 ? 15.353  74.269 -1.324  1.00 35.76 ? 270 LYS A CG    1 
ATOM   2162 C CD    . LYS A 1 280 ? 14.967  74.461 -2.804  1.00 38.75 ? 270 LYS A CD    1 
ATOM   2163 C CE    . LYS A 1 280 ? 16.162  74.918 -3.645  1.00 42.30 ? 270 LYS A CE    1 
ATOM   2164 N NZ    . LYS A 1 280 ? 15.871  74.955 -5.123  1.00 43.69 ? 270 LYS A NZ    1 
ATOM   2165 N N     . PRO A 1 281 ? 14.745  73.106 2.014   1.00 31.80 ? 271 PRO A N     1 
ATOM   2166 C CA    . PRO A 1 281 ? 13.578  72.646 2.764   1.00 32.46 ? 271 PRO A CA    1 
ATOM   2167 C C     . PRO A 1 281 ? 12.401  72.325 1.846   1.00 32.77 ? 271 PRO A C     1 
ATOM   2168 O O     . PRO A 1 281 ? 12.233  72.978 0.810   1.00 33.30 ? 271 PRO A O     1 
ATOM   2169 C CB    . PRO A 1 281 ? 13.210  73.856 3.636   1.00 32.31 ? 271 PRO A CB    1 
ATOM   2170 C CG    . PRO A 1 281 ? 14.394  74.736 3.613   1.00 32.08 ? 271 PRO A CG    1 
ATOM   2171 C CD    . PRO A 1 281 ? 15.087  74.504 2.331   1.00 31.61 ? 271 PRO A CD    1 
ATOM   2172 N N     . PHE A 1 282 ? 11.600  71.336 2.224   1.00 33.01 ? 272 PHE A N     1 
ATOM   2173 C CA    . PHE A 1 282 ? 10.390  71.009 1.476   1.00 33.74 ? 272 PHE A CA    1 
ATOM   2174 C C     . PHE A 1 282 ? 9.158   71.747 2.028   1.00 34.84 ? 272 PHE A C     1 
ATOM   2175 O O     . PHE A 1 282 ? 8.099   71.730 1.410   1.00 34.97 ? 272 PHE A O     1 
ATOM   2176 C CB    . PHE A 1 282 ? 10.155  69.495 1.439   1.00 32.66 ? 272 PHE A CB    1 
ATOM   2177 C CG    . PHE A 1 282 ? 11.094  68.764 0.522   1.00 32.18 ? 272 PHE A CG    1 
ATOM   2178 C CD1   . PHE A 1 282 ? 10.920  68.828 -0.862  1.00 29.63 ? 272 PHE A CD1   1 
ATOM   2179 C CD2   . PHE A 1 282 ? 12.153  68.018 1.039   1.00 30.66 ? 272 PHE A CD2   1 
ATOM   2180 C CE1   . PHE A 1 282 ? 11.788  68.156 -1.724  1.00 31.18 ? 272 PHE A CE1   1 
ATOM   2181 C CE2   . PHE A 1 282 ? 13.042  67.329 0.182   1.00 31.73 ? 272 PHE A CE2   1 
ATOM   2182 C CZ    . PHE A 1 282 ? 12.859  67.411 -1.207  1.00 31.82 ? 272 PHE A CZ    1 
ATOM   2183 N N     . ALA A 1 283 ? 9.317   72.377 3.189   1.00 36.01 ? 273 ALA A N     1 
ATOM   2184 C CA    . ALA A 1 283 ? 8.295   73.223 3.797   1.00 37.07 ? 273 ALA A CA    1 
ATOM   2185 C C     . ALA A 1 283 ? 8.994   74.401 4.488   1.00 37.98 ? 273 ALA A C     1 
ATOM   2186 O O     . ALA A 1 283 ? 10.086  74.227 5.038   1.00 37.69 ? 273 ALA A O     1 
ATOM   2187 C CB    . ALA A 1 283 ? 7.493   72.411 4.802   1.00 37.21 ? 273 ALA A CB    1 
ATOM   2188 N N     . PRO A 1 284 ? 8.366   75.601 4.487   1.00 38.96 ? 274 PRO A N     1 
ATOM   2189 C CA    . PRO A 1 284 ? 9.070   76.729 5.100   1.00 39.65 ? 274 PRO A CA    1 
ATOM   2190 C C     . PRO A 1 284 ? 9.268   76.499 6.597   1.00 40.60 ? 274 PRO A C     1 
ATOM   2191 O O     . PRO A 1 284 ? 8.427   75.869 7.243   1.00 39.87 ? 274 PRO A O     1 
ATOM   2192 C CB    . PRO A 1 284 ? 8.155   77.934 4.812   1.00 39.59 ? 274 PRO A CB    1 
ATOM   2193 C CG    . PRO A 1 284 ? 6.804   77.355 4.614   1.00 39.52 ? 274 PRO A CG    1 
ATOM   2194 C CD    . PRO A 1 284 ? 6.987   75.952 4.089   1.00 38.52 ? 274 PRO A CD    1 
ATOM   2195 N N     . LEU A 1 285 ? 10.401  76.968 7.121   1.00 41.41 ? 275 LEU A N     1 
ATOM   2196 C CA    . LEU A 1 285 ? 10.753  76.754 8.520   1.00 43.11 ? 275 LEU A CA    1 
ATOM   2197 C C     . LEU A 1 285 ? 9.713   77.333 9.486   1.00 44.12 ? 275 LEU A C     1 
ATOM   2198 O O     . LEU A 1 285 ? 9.459   76.771 10.566  1.00 44.08 ? 275 LEU A O     1 
ATOM   2199 C CB    . LEU A 1 285 ? 12.159  77.303 8.809   1.00 43.17 ? 275 LEU A CB    1 
ATOM   2200 C CG    . LEU A 1 285 ? 13.327  76.387 8.402   1.00 44.23 ? 275 LEU A CG    1 
ATOM   2201 C CD1   . LEU A 1 285 ? 14.652  77.147 8.339   1.00 43.51 ? 275 LEU A CD1   1 
ATOM   2202 C CD2   . LEU A 1 285 ? 13.436  75.225 9.352   1.00 42.77 ? 275 LEU A CD2   1 
ATOM   2203 N N     . ASN A 1 286 ? 9.104   78.440 9.070   1.00 45.36 ? 276 ASN A N     1 
ATOM   2204 C CA    . ASN A 1 286 ? 8.086   79.135 9.859   1.00 47.34 ? 276 ASN A CA    1 
ATOM   2205 C C     . ASN A 1 286 ? 6.640   78.799 9.452   1.00 47.85 ? 276 ASN A C     1 
ATOM   2206 O O     . ASN A 1 286 ? 5.765   79.667 9.477   1.00 47.90 ? 276 ASN A O     1 
ATOM   2207 C CB    . ASN A 1 286 ? 8.301   80.648 9.742   1.00 47.51 ? 276 ASN A CB    1 
ATOM   2208 C CG    . ASN A 1 286 ? 7.984   81.179 8.351   1.00 49.14 ? 276 ASN A CG    1 
ATOM   2209 O OD1   . ASN A 1 286 ? 7.858   80.417 7.387   1.00 51.71 ? 276 ASN A OD1   1 
ATOM   2210 N ND2   . ASN A 1 286 ? 7.848   82.490 8.245   1.00 50.16 ? 276 ASN A ND2   1 
ATOM   2211 N N     . PHE A 1 287 ? 6.392   77.549 9.074   1.00 48.59 ? 277 PHE A N     1 
ATOM   2212 C CA    . PHE A 1 287 ? 5.058   77.149 8.637   1.00 49.38 ? 277 PHE A CA    1 
ATOM   2213 C C     . PHE A 1 287 ? 4.025   77.252 9.759   1.00 50.23 ? 277 PHE A C     1 
ATOM   2214 O O     . PHE A 1 287 ? 4.282   76.826 10.879  1.00 50.34 ? 277 PHE A O     1 
ATOM   2215 C CB    . PHE A 1 287 ? 5.076   75.735 8.061   1.00 49.14 ? 277 PHE A CB    1 
ATOM   2216 C CG    . PHE A 1 287 ? 3.788   75.339 7.408   1.00 48.12 ? 277 PHE A CG    1 
ATOM   2217 C CD1   . PHE A 1 287 ? 3.578   75.586 6.056   1.00 47.47 ? 277 PHE A CD1   1 
ATOM   2218 C CD2   . PHE A 1 287 ? 2.777   74.728 8.146   1.00 47.12 ? 277 PHE A CD2   1 
ATOM   2219 C CE1   . PHE A 1 287 ? 2.377   75.229 5.441   1.00 47.66 ? 277 PHE A CE1   1 
ATOM   2220 C CE2   . PHE A 1 287 ? 1.575   74.369 7.537   1.00 46.39 ? 277 PHE A CE2   1 
ATOM   2221 C CZ    . PHE A 1 287 ? 1.380   74.621 6.183   1.00 46.72 ? 277 PHE A CZ    1 
ATOM   2222 N N     . ARG A 1 288 ? 2.862   77.824 9.435   1.00 51.54 ? 278 ARG A N     1 
ATOM   2223 C CA    . ARG A 1 288 ? 1.711   77.890 10.344  1.00 52.45 ? 278 ARG A CA    1 
ATOM   2224 C C     . ARG A 1 288 ? 0.441   77.472 9.587   1.00 52.84 ? 278 ARG A C     1 
ATOM   2225 O O     . ARG A 1 288 ? 0.117   78.057 8.544   1.00 52.64 ? 278 ARG A O     1 
ATOM   2226 C CB    . ARG A 1 288 ? 1.561   79.306 10.902  1.00 52.87 ? 278 ARG A CB    1 
ATOM   2227 C CG    . ARG A 1 288 ? 0.862   79.382 12.247  1.00 54.87 ? 278 ARG A CG    1 
ATOM   2228 C CD    . ARG A 1 288 ? 1.297   80.618 13.032  1.00 58.90 ? 278 ARG A CD    1 
ATOM   2229 N NE    . ARG A 1 288 ? 0.975   80.484 14.457  1.00 61.02 ? 278 ARG A NE    1 
ATOM   2230 C CZ    . ARG A 1 288 ? 0.805   81.499 15.301  1.00 62.08 ? 278 ARG A CZ    1 
ATOM   2231 N NH1   . ARG A 1 288 ? 0.919   82.756 14.886  1.00 62.89 ? 278 ARG A NH1   1 
ATOM   2232 N NH2   . ARG A 1 288 ? 0.510   81.255 16.570  1.00 63.09 ? 278 ARG A NH2   1 
ATOM   2233 N N     . ILE A 1 289 ? -0.260  76.453 10.087  1.00 53.21 ? 279 ILE A N     1 
ATOM   2234 C CA    . ILE A 1 289 ? -1.475  75.976 9.410   1.00 54.17 ? 279 ILE A CA    1 
ATOM   2235 C C     . ILE A 1 289 ? -2.585  77.027 9.473   1.00 53.99 ? 279 ILE A C     1 
ATOM   2236 O O     . ILE A 1 289 ? -2.868  77.587 10.530  1.00 54.39 ? 279 ILE A O     1 
ATOM   2237 C CB    . ILE A 1 289 ? -2.027  74.619 9.958   1.00 54.12 ? 279 ILE A CB    1 
ATOM   2238 C CG1   . ILE A 1 289 ? -0.980  73.512 9.895   1.00 55.09 ? 279 ILE A CG1   1 
ATOM   2239 C CG2   . ILE A 1 289 ? -3.258  74.175 9.150   1.00 54.64 ? 279 ILE A CG2   1 
ATOM   2240 C CD1   . ILE A 1 289 ? -1.535  72.132 10.198  1.00 56.49 ? 279 ILE A CD1   1 
ATOM   2241 N N     . ASN A 1 290 ? -3.174  77.306 8.318   1.00 54.32 ? 280 ASN A N     1 
ATOM   2242 C CA    . ASN A 1 290 ? -4.407  78.087 8.223   1.00 54.31 ? 280 ASN A CA    1 
ATOM   2243 C C     . ASN A 1 290 ? -5.333  77.457 7.177   1.00 54.23 ? 280 ASN A C     1 
ATOM   2244 O O     . ASN A 1 290 ? -5.043  76.373 6.677   1.00 54.28 ? 280 ASN A O     1 
ATOM   2245 C CB    . ASN A 1 290 ? -4.109  79.557 7.920   1.00 54.56 ? 280 ASN A CB    1 
ATOM   2246 C CG    . ASN A 1 290 ? -3.193  79.741 6.729   1.00 55.20 ? 280 ASN A CG    1 
ATOM   2247 O OD1   . ASN A 1 290 ? -3.478  79.280 5.621   1.00 57.38 ? 280 ASN A OD1   1 
ATOM   2248 N ND2   . ASN A 1 290 ? -2.089  80.442 6.946   1.00 56.71 ? 280 ASN A ND2   1 
ATOM   2249 N N     . SER A 1 291 ? -6.430  78.132 6.844   1.00 53.80 ? 281 SER A N     1 
ATOM   2250 C CA    . SER A 1 291 ? -7.468  77.542 5.999   1.00 53.38 ? 281 SER A CA    1 
ATOM   2251 C C     . SER A 1 291 ? -7.158  77.577 4.500   1.00 53.14 ? 281 SER A C     1 
ATOM   2252 O O     . SER A 1 291 ? -7.911  77.019 3.702   1.00 53.26 ? 281 SER A O     1 
ATOM   2253 C CB    . SER A 1 291 ? -8.825  78.196 6.282   1.00 53.34 ? 281 SER A CB    1 
ATOM   2254 O OG    . SER A 1 291 ? -8.720  79.608 6.198   1.00 53.51 ? 281 SER A OG    1 
ATOM   2255 N N     . ARG A 1 292 ? -6.058  78.226 4.117   1.00 52.82 ? 282 ARG A N     1 
ATOM   2256 C CA    . ARG A 1 292 ? -5.623  78.233 2.713   1.00 52.49 ? 282 ARG A CA    1 
ATOM   2257 C C     . ARG A 1 292 ? -4.495  77.238 2.430   1.00 51.62 ? 282 ARG A C     1 
ATOM   2258 O O     . ARG A 1 292 ? -4.343  76.790 1.295   1.00 51.42 ? 282 ARG A O     1 
ATOM   2259 C CB    . ARG A 1 292 ? -5.178  79.636 2.278   1.00 52.99 ? 282 ARG A CB    1 
ATOM   2260 C CG    . ARG A 1 292 ? -5.753  80.108 0.930   1.00 54.95 ? 282 ARG A CG    1 
ATOM   2261 C CD    . ARG A 1 292 ? -5.175  79.400 -0.316  1.00 57.64 ? 282 ARG A CD    1 
ATOM   2262 N NE    . ARG A 1 292 ? -5.942  79.756 -1.516  1.00 60.54 ? 282 ARG A NE    1 
ATOM   2263 C CZ    . ARG A 1 292 ? -5.687  79.339 -2.754  1.00 60.76 ? 282 ARG A CZ    1 
ATOM   2264 N NH1   . ARG A 1 292 ? -6.463  79.746 -3.750  1.00 61.73 ? 282 ARG A NH1   1 
ATOM   2265 N NH2   . ARG A 1 292 ? -4.669  78.523 -3.005  1.00 61.87 ? 282 ARG A NH2   1 
ATOM   2266 N N     . ASN A 1 293 ? -3.699  76.905 3.450   1.00 50.64 ? 283 ASN A N     1 
ATOM   2267 C CA    . ASN A 1 293 ? -2.541  76.019 3.260   1.00 49.16 ? 283 ASN A CA    1 
ATOM   2268 C C     . ASN A 1 293 ? -2.788  74.590 3.751   1.00 48.69 ? 283 ASN A C     1 
ATOM   2269 O O     . ASN A 1 293 ? -1.859  73.774 3.856   1.00 47.82 ? 283 ASN A O     1 
ATOM   2270 C CB    . ASN A 1 293 ? -1.262  76.633 3.863   1.00 49.47 ? 283 ASN A CB    1 
ATOM   2271 C CG    . ASN A 1 293 ? -1.316  76.779 5.378   1.00 48.89 ? 283 ASN A CG    1 
ATOM   2272 O OD1   . ASN A 1 293 ? -2.122  76.148 6.059   1.00 49.06 ? 283 ASN A OD1   1 
ATOM   2273 N ND2   . ASN A 1 293 ? -0.435  77.609 5.912   1.00 49.53 ? 283 ASN A ND2   1 
ATOM   2274 N N     . LEU A 1 294 ? -4.068  74.291 3.994   1.00 47.55 ? 284 LEU A N     1 
ATOM   2275 C CA    . LEU A 1 294 ? -4.509  73.026 4.577   1.00 46.56 ? 284 LEU A CA    1 
ATOM   2276 C C     . LEU A 1 294 ? -3.986  71.763 3.895   1.00 45.56 ? 284 LEU A C     1 
ATOM   2277 O O     . LEU A 1 294 ? -3.889  70.723 4.535   1.00 45.38 ? 284 LEU A O     1 
ATOM   2278 C CB    . LEU A 1 294 ? -6.043  72.986 4.630   1.00 46.88 ? 284 LEU A CB    1 
ATOM   2279 C CG    . LEU A 1 294 ? -6.674  72.240 5.806   1.00 47.30 ? 284 LEU A CG    1 
ATOM   2280 C CD1   . LEU A 1 294 ? -5.941  72.536 7.127   1.00 48.51 ? 284 LEU A CD1   1 
ATOM   2281 C CD2   . LEU A 1 294 ? -8.139  72.604 5.915   1.00 47.20 ? 284 LEU A CD2   1 
ATOM   2282 N N     . SER A 1 295 ? -3.649  71.856 2.610   1.00 44.69 ? 285 SER A N     1 
ATOM   2283 C CA    . SER A 1 295 ? -3.141  70.707 1.857   1.00 43.86 ? 285 SER A CA    1 
ATOM   2284 C C     . SER A 1 295 ? -1.615  70.700 1.640   1.00 43.24 ? 285 SER A C     1 
ATOM   2285 O O     . SER A 1 295 ? -1.072  69.738 1.088   1.00 43.00 ? 285 SER A O     1 
ATOM   2286 C CB    . SER A 1 295 ? -3.849  70.611 0.505   1.00 43.73 ? 285 SER A CB    1 
ATOM   2287 O OG    . SER A 1 295 ? -3.528  71.728 -0.301  1.00 45.13 ? 285 SER A OG    1 
ATOM   2288 N N     . ASP A 1 296 ? -0.944  71.771 2.060   1.00 42.53 ? 286 ASP A N     1 
ATOM   2289 C CA    . ASP A 1 296 ? 0.508   71.895 1.930   1.00 42.33 ? 286 ASP A CA    1 
ATOM   2290 C C     . ASP A 1 296 ? 1.223   70.857 2.792   1.00 41.20 ? 286 ASP A C     1 
ATOM   2291 O O     . ASP A 1 296 ? 0.839   70.634 3.942   1.00 41.11 ? 286 ASP A O     1 
ATOM   2292 C CB    . ASP A 1 296 ? 0.964   73.299 2.344   1.00 42.40 ? 286 ASP A CB    1 
ATOM   2293 C CG    . ASP A 1 296 ? 0.609   74.370 1.313   1.00 44.65 ? 286 ASP A CG    1 
ATOM   2294 O OD1   . ASP A 1 296 ? 0.090   74.034 0.227   1.00 46.59 ? 286 ASP A OD1   1 
ATOM   2295 O OD2   . ASP A 1 296 ? 0.854   75.561 1.591   1.00 46.48 ? 286 ASP A OD2   1 
ATOM   2296 N N     . ILE A 1 297 ? 2.274   70.251 2.242   1.00 40.52 ? 287 ILE A N     1 
ATOM   2297 C CA    . ILE A 1 297 ? 3.097   69.265 2.970   1.00 38.71 ? 287 ILE A CA    1 
ATOM   2298 C C     . ILE A 1 297 ? 3.540   69.755 4.363   1.00 38.01 ? 287 ILE A C     1 
ATOM   2299 O O     . ILE A 1 297 ? 3.747   68.946 5.274   1.00 37.40 ? 287 ILE A O     1 
ATOM   2300 C CB    . ILE A 1 297 ? 4.311   68.769 2.117   1.00 39.11 ? 287 ILE A CB    1 
ATOM   2301 C CG1   . ILE A 1 297 ? 4.986   67.556 2.765   1.00 37.91 ? 287 ILE A CG1   1 
ATOM   2302 C CG2   . ILE A 1 297 ? 5.330   69.892 1.879   1.00 39.20 ? 287 ILE A CG2   1 
ATOM   2303 C CD1   . ILE A 1 297 ? 4.409   66.235 2.337   1.00 40.79 ? 287 ILE A CD1   1 
ATOM   2304 N N     . GLY A 1 298 ? 3.654   71.074 4.521   1.00 37.32 ? 288 GLY A N     1 
ATOM   2305 C CA    . GLY A 1 298 ? 3.981   71.704 5.809   1.00 37.77 ? 288 GLY A CA    1 
ATOM   2306 C C     . GLY A 1 298 ? 3.082   71.314 6.975   1.00 37.74 ? 288 GLY A C     1 
ATOM   2307 O O     . GLY A 1 298 ? 3.487   71.397 8.141   1.00 37.35 ? 288 GLY A O     1 
ATOM   2308 N N     . THR A 1 299 ? 1.864   70.869 6.654   1.00 37.41 ? 289 THR A N     1 
ATOM   2309 C CA    . THR A 1 299 ? 0.870   70.457 7.651   1.00 37.09 ? 289 THR A CA    1 
ATOM   2310 C C     . THR A 1 299 ? 1.206   69.128 8.330   1.00 36.93 ? 289 THR A C     1 
ATOM   2311 O O     . THR A 1 299 ? 0.676   68.832 9.409   1.00 37.01 ? 289 THR A O     1 
ATOM   2312 C CB    . THR A 1 299 ? -0.541  70.281 7.006   1.00 37.37 ? 289 THR A CB    1 
ATOM   2313 O OG1   . THR A 1 299 ? -0.458  69.329 5.941   1.00 36.31 ? 289 THR A OG1   1 
ATOM   2314 C CG2   . THR A 1 299 ? -1.084  71.608 6.458   1.00 36.85 ? 289 THR A CG2   1 
ATOM   2315 N N     . ILE A 1 300 ? 2.043   68.308 7.693   1.00 36.39 ? 290 ILE A N     1 
ATOM   2316 C CA    . ILE A 1 300 ? 2.361   66.987 8.254   1.00 36.48 ? 290 ILE A CA    1 
ATOM   2317 C C     . ILE A 1 300 ? 3.810   66.754 8.691   1.00 36.57 ? 290 ILE A C     1 
ATOM   2318 O O     . ILE A 1 300 ? 4.201   65.614 8.940   1.00 36.85 ? 290 ILE A O     1 
ATOM   2319 C CB    . ILE A 1 300 ? 1.926   65.826 7.331   1.00 36.29 ? 290 ILE A CB    1 
ATOM   2320 C CG1   . ILE A 1 300 ? 2.636   65.899 5.971   1.00 34.71 ? 290 ILE A CG1   1 
ATOM   2321 C CG2   . ILE A 1 300 ? 0.392   65.805 7.209   1.00 36.53 ? 290 ILE A CG2   1 
ATOM   2322 C CD1   . ILE A 1 300 ? 2.800   64.531 5.292   1.00 32.94 ? 290 ILE A CD1   1 
ATOM   2323 N N     . MET A 1 301 ? 4.596   67.818 8.800   1.00 36.86 ? 291 MET A N     1 
ATOM   2324 C CA    . MET A 1 301 ? 6.003   67.661 9.202   1.00 37.42 ? 291 MET A CA    1 
ATOM   2325 C C     . MET A 1 301 ? 6.583   68.838 9.954   1.00 37.86 ? 291 MET A C     1 
ATOM   2326 O O     . MET A 1 301 ? 6.222   69.991 9.699   1.00 37.98 ? 291 MET A O     1 
ATOM   2327 C CB    . MET A 1 301 ? 6.895   67.309 8.001   1.00 37.22 ? 291 MET A CB    1 
ATOM   2328 C CG    . MET A 1 301 ? 6.741   68.232 6.798   1.00 36.89 ? 291 MET A CG    1 
ATOM   2329 S SD    . MET A 1 301 ? 7.912   67.942 5.442   1.00 39.14 ? 291 MET A SD    1 
ATOM   2330 C CE    . MET A 1 301 ? 7.602   66.252 4.980   1.00 37.20 ? 291 MET A CE    1 
ATOM   2331 N N     . ARG A 1 302 ? 7.470   68.533 10.898  1.00 38.22 ? 292 ARG A N     1 
ATOM   2332 C CA    . ARG A 1 302 ? 8.345   69.549 11.473  1.00 39.27 ? 292 ARG A CA    1 
ATOM   2333 C C     . ARG A 1 302 ? 9.563   69.717 10.572  1.00 38.72 ? 292 ARG A C     1 
ATOM   2334 O O     . ARG A 1 302 ? 9.963   68.791 9.873   1.00 38.39 ? 292 ARG A O     1 
ATOM   2335 C CB    . ARG A 1 302 ? 8.781   69.178 12.892  1.00 39.74 ? 292 ARG A CB    1 
ATOM   2336 C CG    . ARG A 1 302 ? 7.679   69.345 13.940  1.00 42.81 ? 292 ARG A CG    1 
ATOM   2337 C CD    . ARG A 1 302 ? 8.161   68.927 15.323  1.00 45.31 ? 292 ARG A CD    1 
ATOM   2338 N NE    . ARG A 1 302 ? 7.923   67.500 15.520  1.00 49.06 ? 292 ARG A NE    1 
ATOM   2339 C CZ    . ARG A 1 302 ? 8.870   66.571 15.632  1.00 48.48 ? 292 ARG A CZ    1 
ATOM   2340 N NH1   . ARG A 1 302 ? 10.156  66.901 15.592  1.00 49.58 ? 292 ARG A NH1   1 
ATOM   2341 N NH2   . ARG A 1 302 ? 8.521   65.305 15.800  1.00 48.34 ? 292 ARG A NH2   1 
ATOM   2342 N N     . VAL A 1 303 ? 10.131  70.912 10.575  1.00 38.49 ? 293 VAL A N     1 
ATOM   2343 C CA    . VAL A 1 303 ? 11.315  71.185 9.784   1.00 38.42 ? 293 VAL A CA    1 
ATOM   2344 C C     . VAL A 1 303 ? 12.271  71.979 10.660  1.00 39.11 ? 293 VAL A C     1 
ATOM   2345 O O     . VAL A 1 303 ? 11.881  72.970 11.300  1.00 38.48 ? 293 VAL A O     1 
ATOM   2346 C CB    . VAL A 1 303 ? 10.986  71.989 8.502   1.00 38.88 ? 293 VAL A CB    1 
ATOM   2347 C CG1   . VAL A 1 303 ? 12.189  72.036 7.568   1.00 36.92 ? 293 VAL A CG1   1 
ATOM   2348 C CG2   . VAL A 1 303 ? 9.771   71.393 7.768   1.00 39.16 ? 293 VAL A CG2   1 
ATOM   2349 N N     . VAL A 1 304 ? 13.519  71.521 10.708  1.00 39.14 ? 294 VAL A N     1 
ATOM   2350 C CA    . VAL A 1 304 ? 14.563  72.191 11.464  1.00 39.61 ? 294 VAL A CA    1 
ATOM   2351 C C     . VAL A 1 304 ? 15.845  72.248 10.619  1.00 40.21 ? 294 VAL A C     1 
ATOM   2352 O O     . VAL A 1 304 ? 16.120  71.343 9.817   1.00 39.52 ? 294 VAL A O     1 
ATOM   2353 C CB    . VAL A 1 304 ? 14.816  71.505 12.847  1.00 39.69 ? 294 VAL A CB    1 
ATOM   2354 C CG1   . VAL A 1 304 ? 13.577  71.603 13.752  1.00 40.45 ? 294 VAL A CG1   1 
ATOM   2355 C CG2   . VAL A 1 304 ? 15.207  70.050 12.690  1.00 39.78 ? 294 VAL A CG2   1 
ATOM   2356 N N     . GLU A 1 305 ? 16.601  73.328 10.774  1.00 40.21 ? 295 GLU A N     1 
ATOM   2357 C CA    . GLU A 1 305 ? 17.860  73.479 10.073  1.00 40.87 ? 295 GLU A CA    1 
ATOM   2358 C C     . GLU A 1 305 ? 18.931  72.826 10.948  1.00 40.33 ? 295 GLU A C     1 
ATOM   2359 O O     . GLU A 1 305 ? 19.024  73.124 12.125  1.00 40.31 ? 295 GLU A O     1 
ATOM   2360 C CB    . GLU A 1 305 ? 18.127  74.967 9.815   1.00 41.00 ? 295 GLU A CB    1 
ATOM   2361 C CG    . GLU A 1 305 ? 19.316  75.298 8.934   1.00 44.29 ? 295 GLU A CG    1 
ATOM   2362 C CD    . GLU A 1 305 ? 19.419  76.791 8.633   1.00 46.73 ? 295 GLU A CD    1 
ATOM   2363 O OE1   . GLU A 1 305 ? 18.456  77.543 8.900   1.00 49.06 ? 295 GLU A OE1   1 
ATOM   2364 O OE2   . GLU A 1 305 ? 20.474  77.216 8.132   1.00 50.31 ? 295 GLU A OE2   1 
ATOM   2365 N N     . LEU A 1 306 ? 19.701  71.893 10.387  1.00 40.54 ? 296 LEU A N     1 
ATOM   2366 C CA    . LEU A 1 306 ? 20.815  71.277 11.123  1.00 39.98 ? 296 LEU A CA    1 
ATOM   2367 C C     . LEU A 1 306 ? 21.846  72.337 11.506  1.00 40.01 ? 296 LEU A C     1 
ATOM   2368 O O     . LEU A 1 306 ? 22.092  73.259 10.725  1.00 39.28 ? 296 LEU A O     1 
ATOM   2369 C CB    . LEU A 1 306 ? 21.484  70.175 10.295  1.00 40.19 ? 296 LEU A CB    1 
ATOM   2370 C CG    . LEU A 1 306 ? 20.732  68.849 10.094  1.00 40.74 ? 296 LEU A CG    1 
ATOM   2371 C CD1   . LEU A 1 306 ? 21.669  67.844 9.435   1.00 40.57 ? 296 LEU A CD1   1 
ATOM   2372 C CD2   . LEU A 1 306 ? 20.154  68.280 11.405  1.00 39.64 ? 296 LEU A CD2   1 
ATOM   2373 N N     . SER A 1 307 ? 22.427  72.208 12.704  1.00 39.89 ? 297 SER A N     1 
ATOM   2374 C CA    . SER A 1 307 ? 23.434  73.163 13.182  1.00 40.73 ? 297 SER A CA    1 
ATOM   2375 C C     . SER A 1 307 ? 24.566  73.254 12.176  1.00 40.36 ? 297 SER A C     1 
ATOM   2376 O O     . SER A 1 307 ? 24.977  72.240 11.620  1.00 40.17 ? 297 SER A O     1 
ATOM   2377 C CB    . SER A 1 307 ? 23.997  72.749 14.543  1.00 40.95 ? 297 SER A CB    1 
ATOM   2378 O OG    . SER A 1 307 ? 22.979  72.604 15.510  1.00 42.02 ? 297 SER A OG    1 
ATOM   2379 N N     . PRO A 1 308 ? 25.039  74.472 11.899  1.00 40.41 ? 298 PRO A N     1 
ATOM   2380 C CA    . PRO A 1 308 ? 26.145  74.540 10.953  1.00 40.79 ? 298 PRO A CA    1 
ATOM   2381 C C     . PRO A 1 308 ? 27.425  73.937 11.521  1.00 40.99 ? 298 PRO A C     1 
ATOM   2382 O O     . PRO A 1 308 ? 27.639  73.945 12.732  1.00 40.71 ? 298 PRO A O     1 
ATOM   2383 C CB    . PRO A 1 308 ? 26.328  76.035 10.711  1.00 40.43 ? 298 PRO A CB    1 
ATOM   2384 C CG    . PRO A 1 308 ? 25.602  76.715 11.827  1.00 40.83 ? 298 PRO A CG    1 
ATOM   2385 C CD    . PRO A 1 308 ? 24.506  75.799 12.240  1.00 40.24 ? 298 PRO A CD    1 
ATOM   2386 N N     . LEU A 1 309 ? 28.247  73.398 10.635  1.00 41.63 ? 299 LEU A N     1 
ATOM   2387 C CA    . LEU A 1 309 ? 29.571  72.920 11.004  1.00 42.74 ? 299 LEU A CA    1 
ATOM   2388 C C     . LEU A 1 309 ? 30.530  74.099 10.959  1.00 43.25 ? 299 LEU A C     1 
ATOM   2389 O O     . LEU A 1 309 ? 30.612  74.805 9.945   1.00 43.16 ? 299 LEU A O     1 
ATOM   2390 C CB    . LEU A 1 309 ? 30.005  71.792 10.065  1.00 42.77 ? 299 LEU A CB    1 
ATOM   2391 C CG    . LEU A 1 309 ? 29.116  70.537 10.122  1.00 43.20 ? 299 LEU A CG    1 
ATOM   2392 C CD1   . LEU A 1 309 ? 29.479  69.537 9.028   1.00 44.24 ? 299 LEU A CD1   1 
ATOM   2393 C CD2   . LEU A 1 309 ? 29.178  69.862 11.489  1.00 45.11 ? 299 LEU A CD2   1 
ATOM   2394 N N     . LYS A 1 310 ? 31.229  74.333 12.069  1.00 44.10 ? 300 LYS A N     1 
ATOM   2395 C CA    . LYS A 1 310 ? 32.171  75.461 12.166  1.00 44.90 ? 300 LYS A CA    1 
ATOM   2396 C C     . LYS A 1 310 ? 33.349  75.257 11.222  1.00 44.96 ? 300 LYS A C     1 
ATOM   2397 O O     . LYS A 1 310 ? 33.407  75.862 10.152  1.00 45.73 ? 300 LYS A O     1 
ATOM   2398 C CB    . LYS A 1 310 ? 32.673  75.640 13.611  1.00 45.30 ? 300 LYS A CB    1 
ATOM   2399 N N     . TRP A 1 315 ? 27.530  82.332 3.285   1.00 66.92 ? 305 TRP A N     1 
ATOM   2400 C CA    . TRP A 1 315 ? 26.883  82.000 2.018   1.00 66.70 ? 305 TRP A CA    1 
ATOM   2401 C C     . TRP A 1 315 ? 27.879  82.002 0.857   1.00 66.48 ? 305 TRP A C     1 
ATOM   2402 O O     . TRP A 1 315 ? 28.658  82.947 0.698   1.00 66.58 ? 305 TRP A O     1 
ATOM   2403 C CB    . TRP A 1 315 ? 25.724  82.960 1.728   1.00 66.80 ? 305 TRP A CB    1 
ATOM   2404 C CG    . TRP A 1 315 ? 24.920  82.536 0.539   1.00 67.25 ? 305 TRP A CG    1 
ATOM   2405 C CD1   . TRP A 1 315 ? 23.787  81.774 0.543   1.00 68.04 ? 305 TRP A CD1   1 
ATOM   2406 C CD2   . TRP A 1 315 ? 25.207  82.824 -0.835  1.00 67.50 ? 305 TRP A CD2   1 
ATOM   2407 N NE1   . TRP A 1 315 ? 23.345  81.576 -0.746  1.00 67.78 ? 305 TRP A NE1   1 
ATOM   2408 C CE2   . TRP A 1 315 ? 24.200  82.210 -1.609  1.00 67.85 ? 305 TRP A CE2   1 
ATOM   2409 C CE3   . TRP A 1 315 ? 26.217  83.549 -1.488  1.00 67.87 ? 305 TRP A CE3   1 
ATOM   2410 C CZ2   . TRP A 1 315 ? 24.172  82.296 -3.004  1.00 68.49 ? 305 TRP A CZ2   1 
ATOM   2411 C CZ3   . TRP A 1 315 ? 26.186  83.636 -2.877  1.00 67.66 ? 305 TRP A CZ3   1 
ATOM   2412 C CH2   . TRP A 1 315 ? 25.170  83.014 -3.618  1.00 68.29 ? 305 TRP A CH2   1 
ATOM   2413 N N     . THR A 1 316 ? 27.823  80.953 0.036   1.00 66.19 ? 306 THR A N     1 
ATOM   2414 C CA    . THR A 1 316 ? 28.803  80.743 -1.042  1.00 65.57 ? 306 THR A CA    1 
ATOM   2415 C C     . THR A 1 316 ? 28.207  80.643 -2.452  1.00 64.90 ? 306 THR A C     1 
ATOM   2416 O O     . THR A 1 316 ? 28.824  81.102 -3.423  1.00 65.02 ? 306 THR A O     1 
ATOM   2417 C CB    . THR A 1 316 ? 29.684  79.494 -0.784  1.00 65.78 ? 306 THR A CB    1 
ATOM   2418 O OG1   . THR A 1 316 ? 28.861  78.390 -0.375  1.00 66.14 ? 306 THR A OG1   1 
ATOM   2419 C CG2   . THR A 1 316 ? 30.734  79.783 0.288   1.00 65.63 ? 306 THR A CG2   1 
ATOM   2420 N N     . GLY A 1 317 ? 27.021  80.048 -2.560  1.00 63.88 ? 307 GLY A N     1 
ATOM   2421 C CA    . GLY A 1 317 ? 26.422  79.728 -3.860  1.00 62.68 ? 307 GLY A CA    1 
ATOM   2422 C C     . GLY A 1 317 ? 26.126  78.244 -4.005  1.00 61.76 ? 307 GLY A C     1 
ATOM   2423 O O     . GLY A 1 317 ? 25.190  77.856 -4.711  1.00 61.56 ? 307 GLY A O     1 
ATOM   2424 N N     . LYS A 1 318 ? 26.940  77.424 -3.333  1.00 60.80 ? 308 LYS A N     1 
ATOM   2425 C CA    . LYS A 1 318 ? 26.779  75.961 -3.277  1.00 59.63 ? 308 LYS A CA    1 
ATOM   2426 C C     . LYS A 1 318 ? 25.940  75.523 -2.060  1.00 58.65 ? 308 LYS A C     1 
ATOM   2427 O O     . LYS A 1 318 ? 25.881  76.253 -1.062  1.00 58.52 ? 308 LYS A O     1 
ATOM   2428 C CB    . LYS A 1 318 ? 28.149  75.288 -3.246  1.00 59.69 ? 308 LYS A CB    1 
ATOM   2429 N N     . PRO A 1 319 ? 25.286  74.335 -2.136  1.00 57.54 ? 309 PRO A N     1 
ATOM   2430 C CA    . PRO A 1 319 ? 24.567  73.817 -0.958  1.00 56.48 ? 309 PRO A CA    1 
ATOM   2431 C C     . PRO A 1 319 ? 25.473  73.646 0.275   1.00 55.24 ? 309 PRO A C     1 
ATOM   2432 O O     . PRO A 1 319 ? 26.444  72.883 0.239   1.00 55.44 ? 309 PRO A O     1 
ATOM   2433 C CB    . PRO A 1 319 ? 24.013  72.460 -1.436  1.00 56.55 ? 309 PRO A CB    1 
ATOM   2434 C CG    . PRO A 1 319 ? 24.722  72.152 -2.717  1.00 57.02 ? 309 PRO A CG    1 
ATOM   2435 C CD    . PRO A 1 319 ? 25.095  73.470 -3.316  1.00 57.66 ? 309 PRO A CD    1 
ATOM   2436 N N     . VAL A 1 320 ? 25.165  74.384 1.341   1.00 53.62 ? 310 VAL A N     1 
ATOM   2437 C CA    . VAL A 1 320 ? 25.912  74.289 2.596   1.00 51.83 ? 310 VAL A CA    1 
ATOM   2438 C C     . VAL A 1 320 ? 25.018  73.743 3.702   1.00 50.59 ? 310 VAL A C     1 
ATOM   2439 O O     . VAL A 1 320 ? 25.339  72.721 4.318   1.00 50.53 ? 310 VAL A O     1 
ATOM   2440 C CB    . VAL A 1 320 ? 26.516  75.649 3.053   1.00 52.24 ? 310 VAL A CB    1 
ATOM   2441 C CG1   . VAL A 1 320 ? 27.761  75.412 3.909   1.00 51.67 ? 310 VAL A CG1   1 
ATOM   2442 C CG2   . VAL A 1 320 ? 26.879  76.530 1.857   1.00 52.39 ? 310 VAL A CG2   1 
ATOM   2443 N N     . SER A 1 321 ? 23.896  74.425 3.936   1.00 48.17 ? 311 SER A N     1 
ATOM   2444 C CA    . SER A 1 321 ? 22.956  74.074 4.999   1.00 46.00 ? 311 SER A CA    1 
ATOM   2445 C C     . SER A 1 321 ? 22.063  72.891 4.648   1.00 44.12 ? 311 SER A C     1 
ATOM   2446 O O     . SER A 1 321 ? 21.628  72.745 3.508   1.00 43.91 ? 311 SER A O     1 
ATOM   2447 C CB    . SER A 1 321 ? 22.077  75.284 5.327   1.00 46.34 ? 311 SER A CB    1 
ATOM   2448 O OG    . SER A 1 321 ? 22.884  76.413 5.612   1.00 46.18 ? 311 SER A OG    1 
ATOM   2449 N N     . TYR A 1 322 ? 21.798  72.044 5.636   1.00 41.85 ? 312 TYR A N     1 
ATOM   2450 C CA    . TYR A 1 322 ? 20.887  70.919 5.456   1.00 39.89 ? 312 TYR A CA    1 
ATOM   2451 C C     . TYR A 1 322 ? 19.754  70.986 6.478   1.00 38.45 ? 312 TYR A C     1 
ATOM   2452 O O     . TYR A 1 322 ? 19.884  71.620 7.532   1.00 37.98 ? 312 TYR A O     1 
ATOM   2453 C CB    . TYR A 1 322 ? 21.621  69.567 5.490   1.00 39.73 ? 312 TYR A CB    1 
ATOM   2454 C CG    . TYR A 1 322 ? 22.331  69.204 4.186   1.00 39.48 ? 312 TYR A CG    1 
ATOM   2455 C CD1   . TYR A 1 322 ? 21.824  68.220 3.335   1.00 40.33 ? 312 TYR A CD1   1 
ATOM   2456 C CD2   . TYR A 1 322 ? 23.505  69.851 3.806   1.00 39.40 ? 312 TYR A CD2   1 
ATOM   2457 C CE1   . TYR A 1 322 ? 22.494  67.891 2.121   1.00 40.73 ? 312 TYR A CE1   1 
ATOM   2458 C CE2   . TYR A 1 322 ? 24.173  69.528 2.618   1.00 40.02 ? 312 TYR A CE2   1 
ATOM   2459 C CZ    . TYR A 1 322 ? 23.668  68.552 1.783   1.00 40.11 ? 312 TYR A CZ    1 
ATOM   2460 O OH    . TYR A 1 322 ? 24.356  68.251 0.615   1.00 39.65 ? 312 TYR A OH    1 
ATOM   2461 N N     . TYR A 1 323 ? 18.642  70.335 6.149   1.00 36.90 ? 313 TYR A N     1 
ATOM   2462 C CA    . TYR A 1 323 ? 17.399  70.497 6.904   1.00 35.13 ? 313 TYR A CA    1 
ATOM   2463 C C     . TYR A 1 323 ? 16.766  69.150 7.194   1.00 34.94 ? 313 TYR A C     1 
ATOM   2464 O O     . TYR A 1 323 ? 16.642  68.308 6.305   1.00 34.26 ? 313 TYR A O     1 
ATOM   2465 C CB    . TYR A 1 323 ? 16.415  71.380 6.135   1.00 34.25 ? 313 TYR A CB    1 
ATOM   2466 C CG    . TYR A 1 323 ? 16.950  72.744 5.752   1.00 34.67 ? 313 TYR A CG    1 
ATOM   2467 C CD1   . TYR A 1 323 ? 16.603  73.888 6.477   1.00 33.68 ? 313 TYR A CD1   1 
ATOM   2468 C CD2   . TYR A 1 323 ? 17.798  72.898 4.651   1.00 34.32 ? 313 TYR A CD2   1 
ATOM   2469 C CE1   . TYR A 1 323 ? 17.109  75.144 6.120   1.00 34.03 ? 313 TYR A CE1   1 
ATOM   2470 C CE2   . TYR A 1 323 ? 18.311  74.139 4.302   1.00 34.81 ? 313 TYR A CE2   1 
ATOM   2471 C CZ    . TYR A 1 323 ? 17.949  75.257 5.024   1.00 33.75 ? 313 TYR A CZ    1 
ATOM   2472 O OH    . TYR A 1 323 ? 18.458  76.478 4.651   1.00 34.29 ? 313 TYR A OH    1 
ATOM   2473 N N     . LEU A 1 324 ? 16.365  68.960 8.447   1.00 34.19 ? 314 LEU A N     1 
ATOM   2474 C CA    . LEU A 1 324 ? 15.732  67.738 8.880   1.00 34.00 ? 314 LEU A CA    1 
ATOM   2475 C C     . LEU A 1 324 ? 14.231  67.931 8.923   1.00 34.05 ? 314 LEU A C     1 
ATOM   2476 O O     . LEU A 1 324 ? 13.736  68.864 9.561   1.00 34.16 ? 314 LEU A O     1 
ATOM   2477 C CB    . LEU A 1 324 ? 16.248  67.322 10.265  1.00 34.01 ? 314 LEU A CB    1 
ATOM   2478 C CG    . LEU A 1 324 ? 15.523  66.222 11.041  1.00 34.19 ? 314 LEU A CG    1 
ATOM   2479 C CD1   . LEU A 1 324 ? 15.719  64.845 10.408  1.00 32.58 ? 314 LEU A CD1   1 
ATOM   2480 C CD2   . LEU A 1 324 ? 15.971  66.208 12.522  1.00 36.47 ? 314 LEU A CD2   1 
ATOM   2481 N N     . HIS A 1 325 ? 13.521  67.038 8.245   1.00 33.61 ? 315 HIS A N     1 
ATOM   2482 C CA    . HIS A 1 325 ? 12.057  67.023 8.239   1.00 33.65 ? 315 HIS A CA    1 
ATOM   2483 C C     . HIS A 1 325 ? 11.625  65.774 8.978   1.00 33.69 ? 315 HIS A C     1 
ATOM   2484 O O     . HIS A 1 325 ? 12.120  64.700 8.671   1.00 33.99 ? 315 HIS A O     1 
ATOM   2485 C CB    . HIS A 1 325 ? 11.530  66.951 6.804   1.00 32.86 ? 315 HIS A CB    1 
ATOM   2486 C CG    . HIS A 1 325 ? 12.101  67.997 5.898   1.00 33.38 ? 315 HIS A CG    1 
ATOM   2487 N ND1   . HIS A 1 325 ? 13.357  67.890 5.336   1.00 32.78 ? 315 HIS A ND1   1 
ATOM   2488 C CD2   . HIS A 1 325 ? 11.586  69.166 5.448   1.00 32.31 ? 315 HIS A CD2   1 
ATOM   2489 C CE1   . HIS A 1 325 ? 13.592  68.951 4.583   1.00 32.65 ? 315 HIS A CE1   1 
ATOM   2490 N NE2   . HIS A 1 325 ? 12.533  69.740 4.633   1.00 31.07 ? 315 HIS A NE2   1 
ATOM   2491 N N     . THR A 1 326 ? 10.716  65.905 9.947   1.00 33.69 ? 316 THR A N     1 
ATOM   2492 C CA    . THR A 1 326 ? 10.168  64.729 10.633  1.00 34.45 ? 316 THR A CA    1 
ATOM   2493 C C     . THR A 1 326 ? 8.648   64.644 10.421  1.00 35.23 ? 316 THR A C     1 
ATOM   2494 O O     . THR A 1 326 ? 7.927   65.607 10.689  1.00 34.60 ? 316 THR A O     1 
ATOM   2495 C CB    . THR A 1 326 ? 10.519  64.746 12.141  1.00 35.02 ? 316 THR A CB    1 
ATOM   2496 O OG1   . THR A 1 326 ? 11.942  64.905 12.290  1.00 34.41 ? 316 THR A OG1   1 
ATOM   2497 C CG2   . THR A 1 326 ? 10.084  63.443 12.840  1.00 34.44 ? 316 THR A CG2   1 
ATOM   2498 N N     . ILE A 1 327 ? 8.174   63.494 9.937   1.00 36.56 ? 317 ILE A N     1 
ATOM   2499 C CA    . ILE A 1 327 ? 6.746   63.299 9.655   1.00 37.86 ? 317 ILE A CA    1 
ATOM   2500 C C     . ILE A 1 327 ? 5.976   63.329 10.976  1.00 38.25 ? 317 ILE A C     1 
ATOM   2501 O O     . ILE A 1 327 ? 6.129   62.431 11.795  1.00 38.82 ? 317 ILE A O     1 
ATOM   2502 C CB    . ILE A 1 327 ? 6.451   61.952 8.904   1.00 37.26 ? 317 ILE A CB    1 
ATOM   2503 C CG1   . ILE A 1 327 ? 7.229   61.825 7.578   1.00 39.09 ? 317 ILE A CG1   1 
ATOM   2504 C CG2   . ILE A 1 327 ? 4.940   61.769 8.693   1.00 37.95 ? 317 ILE A CG2   1 
ATOM   2505 C CD1   . ILE A 1 327 ? 6.715   62.675 6.397   1.00 40.49 ? 317 ILE A CD1   1 
ATOM   2506 N N     . ASP A 1 328 ? 5.165   64.369 11.173  1.00 39.24 ? 318 ASP A N     1 
ATOM   2507 C CA    . ASP A 1 328 ? 4.437   64.596 12.437  1.00 39.81 ? 318 ASP A CA    1 
ATOM   2508 C C     . ASP A 1 328 ? 3.022   65.070 12.131  1.00 39.78 ? 318 ASP A C     1 
ATOM   2509 O O     . ASP A 1 328 ? 2.802   66.247 11.888  1.00 39.23 ? 318 ASP A O     1 
ATOM   2510 C CB    . ASP A 1 328 ? 5.151   65.633 13.331  1.00 39.56 ? 318 ASP A CB    1 
ATOM   2511 C CG    . ASP A 1 328 ? 4.391   65.923 14.642  1.00 40.11 ? 318 ASP A CG    1 
ATOM   2512 O OD1   . ASP A 1 328 ? 3.181   65.673 14.709  1.00 40.22 ? 318 ASP A OD1   1 
ATOM   2513 O OD2   . ASP A 1 328 ? 4.990   66.428 15.617  1.00 41.61 ? 318 ASP A OD2   1 
ATOM   2514 N N     . ARG A 1 329 ? 2.078   64.143 12.161  1.00 40.99 ? 319 ARG A N     1 
ATOM   2515 C CA    . ARG A 1 329 ? 0.690   64.451 11.812  1.00 42.47 ? 319 ARG A CA    1 
ATOM   2516 C C     . ARG A 1 329 ? -0.093  65.084 12.959  1.00 43.66 ? 319 ARG A C     1 
ATOM   2517 O O     . ARG A 1 329 ? -1.173  65.651 12.731  1.00 44.27 ? 319 ARG A O     1 
ATOM   2518 C CB    . ARG A 1 329 ? -0.016  63.224 11.236  1.00 41.67 ? 319 ARG A CB    1 
ATOM   2519 C CG    . ARG A 1 329 ? 0.165   63.130 9.731   1.00 42.36 ? 319 ARG A CG    1 
ATOM   2520 C CD    . ARG A 1 329 ? -0.161  61.758 9.155   1.00 41.72 ? 319 ARG A CD    1 
ATOM   2521 N NE    . ARG A 1 329 ? 0.323   61.663 7.779   1.00 41.26 ? 319 ARG A NE    1 
ATOM   2522 C CZ    . ARG A 1 329 ? 1.316   60.879 7.369   1.00 40.35 ? 319 ARG A CZ    1 
ATOM   2523 N NH1   . ARG A 1 329 ? 1.948   60.084 8.228   1.00 39.50 ? 319 ARG A NH1   1 
ATOM   2524 N NH2   . ARG A 1 329 ? 1.677   60.888 6.087   1.00 39.38 ? 319 ARG A NH2   1 
ATOM   2525 N N     . THR A 1 330 ? 0.470   65.044 14.172  1.00 44.66 ? 320 THR A N     1 
ATOM   2526 C CA    . THR A 1 330 ? -0.175  65.682 15.324  1.00 45.90 ? 320 THR A CA    1 
ATOM   2527 C C     . THR A 1 330 ? -0.446  67.174 15.075  1.00 46.37 ? 320 THR A C     1 
ATOM   2528 O O     . THR A 1 330 ? -1.373  67.742 15.661  1.00 46.71 ? 320 THR A O     1 
ATOM   2529 C CB    . THR A 1 330 ? 0.567   65.422 16.691  1.00 46.11 ? 320 THR A CB    1 
ATOM   2530 O OG1   . THR A 1 330 ? 1.760   66.209 16.778  1.00 46.87 ? 320 THR A OG1   1 
ATOM   2531 C CG2   . THR A 1 330 ? 0.918   63.950 16.863  1.00 46.59 ? 320 THR A CG2   1 
ATOM   2532 N N     . ILE A 1 331 ? 0.333   67.783 14.176  1.00 46.46 ? 321 ILE A N     1 
ATOM   2533 C CA    . ILE A 1 331 ? 0.184   69.204 13.807  1.00 46.70 ? 321 ILE A CA    1 
ATOM   2534 C C     . ILE A 1 331 ? -1.162  69.459 13.093  1.00 46.99 ? 321 ILE A C     1 
ATOM   2535 O O     . ILE A 1 331 ? -1.866  70.427 13.400  1.00 47.22 ? 321 ILE A O     1 
ATOM   2536 C CB    . ILE A 1 331 ? 1.364   69.702 12.910  1.00 46.58 ? 321 ILE A CB    1 
ATOM   2537 C CG1   . ILE A 1 331 ? 2.727   69.459 13.586  1.00 46.97 ? 321 ILE A CG1   1 
ATOM   2538 C CG2   . ILE A 1 331 ? 1.218   71.190 12.575  1.00 46.22 ? 321 ILE A CG2   1 
ATOM   2539 C CD1   . ILE A 1 331 ? 3.949   69.774 12.666  1.00 44.76 ? 321 ILE A CD1   1 
ATOM   2540 N N     . LEU A 1 332 ? -1.502  68.588 12.144  1.00 47.04 ? 322 LEU A N     1 
ATOM   2541 C CA    . LEU A 1 332 ? -2.774  68.666 11.431  1.00 47.36 ? 322 LEU A CA    1 
ATOM   2542 C C     . LEU A 1 332 ? -3.945  68.327 12.361  1.00 48.07 ? 322 LEU A C     1 
ATOM   2543 O O     . LEU A 1 332 ? -4.977  69.009 12.338  1.00 48.10 ? 322 LEU A O     1 
ATOM   2544 C CB    . LEU A 1 332 ? -2.775  67.732 10.224  1.00 46.74 ? 322 LEU A CB    1 
ATOM   2545 C CG    . LEU A 1 332 ? -3.931  67.796 9.218   1.00 45.76 ? 322 LEU A CG    1 
ATOM   2546 C CD1   . LEU A 1 332 ? -4.020  69.156 8.538   1.00 43.06 ? 322 LEU A CD1   1 
ATOM   2547 C CD2   . LEU A 1 332 ? -3.763  66.688 8.181   1.00 43.94 ? 322 LEU A CD2   1 
ATOM   2548 N N     . GLU A 1 333 ? -3.761  67.279 13.162  1.00 48.80 ? 323 GLU A N     1 
ATOM   2549 C CA    . GLU A 1 333 ? -4.742  66.825 14.147  1.00 50.20 ? 323 GLU A CA    1 
ATOM   2550 C C     . GLU A 1 333 ? -5.073  67.952 15.121  1.00 50.61 ? 323 GLU A C     1 
ATOM   2551 O O     . GLU A 1 333 ? -6.250  68.224 15.376  1.00 50.46 ? 323 GLU A O     1 
ATOM   2552 C CB    . GLU A 1 333 ? -4.225  65.606 14.903  1.00 50.12 ? 323 GLU A CB    1 
ATOM   2553 C CG    . GLU A 1 333 ? -3.928  64.382 14.021  1.00 52.07 ? 323 GLU A CG    1 
ATOM   2554 C CD    . GLU A 1 333 ? -2.983  63.369 14.676  1.00 54.16 ? 323 GLU A CD    1 
ATOM   2555 O OE1   . GLU A 1 333 ? -2.261  63.736 15.637  1.00 54.96 ? 323 GLU A OE1   1 
ATOM   2556 O OE2   . GLU A 1 333 ? -2.958  62.196 14.227  1.00 53.98 ? 323 GLU A OE2   1 
ATOM   2557 N N     . ASN A 1 334 ? -4.029  68.607 15.635  1.00 51.07 ? 324 ASN A N     1 
ATOM   2558 C CA    . ASN A 1 334 ? -4.160  69.733 16.557  1.00 51.99 ? 324 ASN A CA    1 
ATOM   2559 C C     . ASN A 1 334 ? -5.010  70.856 15.984  1.00 52.57 ? 324 ASN A C     1 
ATOM   2560 O O     . ASN A 1 334 ? -5.896  71.385 16.670  1.00 52.34 ? 324 ASN A O     1 
ATOM   2561 C CB    . ASN A 1 334 ? -2.785  70.305 16.936  1.00 52.01 ? 324 ASN A CB    1 
ATOM   2562 C CG    . ASN A 1 334 ? -2.016  69.422 17.908  1.00 52.57 ? 324 ASN A CG    1 
ATOM   2563 O OD1   . ASN A 1 334 ? -2.494  68.371 18.342  1.00 52.36 ? 324 ASN A OD1   1 
ATOM   2564 N ND2   . ASN A 1 334 ? -0.799  69.850 18.247  1.00 53.32 ? 324 ASN A ND2   1 
ATOM   2565 N N     . TYR A 1 335 ? -4.738  71.217 14.730  1.00 52.99 ? 325 TYR A N     1 
ATOM   2566 C CA    . TYR A 1 335 ? -5.460  72.308 14.077  1.00 53.96 ? 325 TYR A CA    1 
ATOM   2567 C C     . TYR A 1 335 ? -6.968  72.042 14.026  1.00 54.53 ? 325 TYR A C     1 
ATOM   2568 O O     . TYR A 1 335 ? -7.766  72.973 14.160  1.00 54.72 ? 325 TYR A O     1 
ATOM   2569 C CB    . TYR A 1 335 ? -4.918  72.581 12.665  1.00 53.53 ? 325 TYR A CB    1 
ATOM   2570 C CG    . TYR A 1 335 ? -5.731  73.605 11.885  1.00 54.06 ? 325 TYR A CG    1 
ATOM   2571 C CD1   . TYR A 1 335 ? -5.592  74.971 12.132  1.00 53.70 ? 325 TYR A CD1   1 
ATOM   2572 C CD2   . TYR A 1 335 ? -6.641  73.202 10.903  1.00 53.93 ? 325 TYR A CD2   1 
ATOM   2573 C CE1   . TYR A 1 335 ? -6.334  75.913 11.422  1.00 55.03 ? 325 TYR A CE1   1 
ATOM   2574 C CE2   . TYR A 1 335 ? -7.386  74.132 10.186  1.00 54.80 ? 325 TYR A CE2   1 
ATOM   2575 C CZ    . TYR A 1 335 ? -7.232  75.486 10.452  1.00 55.30 ? 325 TYR A CZ    1 
ATOM   2576 O OH    . TYR A 1 335 ? -7.974  76.406 9.750   1.00 56.02 ? 325 TYR A OH    1 
ATOM   2577 N N     . PHE A 1 336 ? -7.337  70.777 13.825  1.00 55.31 ? 326 PHE A N     1 
ATOM   2578 C CA    . PHE A 1 336 ? -8.739  70.369 13.757  1.00 56.24 ? 326 PHE A CA    1 
ATOM   2579 C C     . PHE A 1 336 ? -9.400  70.393 15.138  1.00 57.13 ? 326 PHE A C     1 
ATOM   2580 O O     . PHE A 1 336 ? -10.527 70.874 15.272  1.00 57.49 ? 326 PHE A O     1 
ATOM   2581 C CB    . PHE A 1 336 ? -8.886  68.995 13.085  1.00 55.83 ? 326 PHE A CB    1 
ATOM   2582 C CG    . PHE A 1 336 ? -8.921  69.053 11.576  1.00 55.12 ? 326 PHE A CG    1 
ATOM   2583 C CD1   . PHE A 1 336 ? -7.738  69.065 10.834  1.00 54.05 ? 326 PHE A CD1   1 
ATOM   2584 C CD2   . PHE A 1 336 ? -10.135 69.090 10.898  1.00 54.04 ? 326 PHE A CD2   1 
ATOM   2585 C CE1   . PHE A 1 336 ? -7.763  69.120 9.439   1.00 53.69 ? 326 PHE A CE1   1 
ATOM   2586 C CE2   . PHE A 1 336 ? -10.178 69.146 9.504   1.00 54.22 ? 326 PHE A CE2   1 
ATOM   2587 C CZ    . PHE A 1 336 ? -8.988  69.159 8.769   1.00 54.41 ? 326 PHE A CZ    1 
ATOM   2588 N N     . SER A 1 337 ? -8.698  69.890 16.156  1.00 58.01 ? 327 SER A N     1 
ATOM   2589 C CA    . SER A 1 337 ? -9.160  69.996 17.549  1.00 59.12 ? 327 SER A CA    1 
ATOM   2590 C C     . SER A 1 337 ? -9.414  71.441 17.974  1.00 59.72 ? 327 SER A C     1 
ATOM   2591 O O     . SER A 1 337 ? -10.306 71.707 18.780  1.00 59.89 ? 327 SER A O     1 
ATOM   2592 C CB    . SER A 1 337 ? -8.171  69.347 18.517  1.00 58.90 ? 327 SER A CB    1 
ATOM   2593 O OG    . SER A 1 337 ? -8.270  67.937 18.469  1.00 59.51 ? 327 SER A OG    1 
ATOM   2594 N N     . SER A 1 338 ? -8.630  72.367 17.424  1.00 60.43 ? 328 SER A N     1 
ATOM   2595 C CA    . SER A 1 338 ? -8.799  73.785 17.714  1.00 61.09 ? 328 SER A CA    1 
ATOM   2596 C C     . SER A 1 338 ? -10.000 74.390 16.973  1.00 61.47 ? 328 SER A C     1 
ATOM   2597 O O     . SER A 1 338 ? -10.538 75.422 17.392  1.00 61.62 ? 328 SER A O     1 
ATOM   2598 C CB    . SER A 1 338 ? -7.511  74.567 17.418  1.00 61.13 ? 328 SER A CB    1 
ATOM   2599 O OG    . SER A 1 338 ? -7.404  74.898 16.042  1.00 61.45 ? 328 SER A OG    1 
ATOM   2600 N N     . LEU A 1 339 ? -10.426 73.745 15.885  1.00 61.93 ? 329 LEU A N     1 
ATOM   2601 C CA    . LEU A 1 339 ? -11.609 74.194 15.141  1.00 62.15 ? 329 LEU A CA    1 
ATOM   2602 C C     . LEU A 1 339 ? -12.914 73.792 15.838  1.00 62.39 ? 329 LEU A C     1 
ATOM   2603 O O     . LEU A 1 339 ? -14.004 74.141 15.372  1.00 62.47 ? 329 LEU A O     1 
ATOM   2604 C CB    . LEU A 1 339 ? -11.598 73.679 13.694  1.00 61.96 ? 329 LEU A CB    1 
ATOM   2605 C CG    . LEU A 1 339 ? -10.535 74.160 12.697  1.00 61.79 ? 329 LEU A CG    1 
ATOM   2606 C CD1   . LEU A 1 339 ? -10.675 73.392 11.390  1.00 61.34 ? 329 LEU A CD1   1 
ATOM   2607 C CD2   . LEU A 1 339 ? -10.576 75.674 12.440  1.00 61.43 ? 329 LEU A CD2   1 
ATOM   2608 N N     . LYS A 1 340 ? -12.789 73.079 16.958  1.00 62.62 ? 330 LYS A N     1 
ATOM   2609 C CA    . LYS A 1 340 ? -13.932 72.579 17.718  1.00 62.72 ? 330 LYS A CA    1 
ATOM   2610 C C     . LYS A 1 340 ? -14.119 73.327 19.036  1.00 62.81 ? 330 LYS A C     1 
ATOM   2611 O O     . LYS A 1 340 ? -13.186 73.454 19.830  1.00 62.96 ? 330 LYS A O     1 
ATOM   2612 C CB    . LYS A 1 340 ? -13.773 71.082 17.978  1.00 62.79 ? 330 LYS A CB    1 
ATOM   2613 C CG    . LYS A 1 340 ? -13.739 70.256 16.710  1.00 62.72 ? 330 LYS A CG    1 
ATOM   2614 C CD    . LYS A 1 340 ? -13.512 68.791 16.995  1.00 63.70 ? 330 LYS A CD    1 
ATOM   2615 C CE    . LYS A 1 340 ? -13.385 68.014 15.687  1.00 64.52 ? 330 LYS A CE    1 
ATOM   2616 N NZ    . LYS A 1 340 ? -13.391 66.541 15.906  1.00 65.40 ? 330 LYS A NZ    1 
HETATM 2617 N N     . SAM B 2 .   ? 23.564  62.164 -3.272  1.00 28.40 ? 417 SAM A N     1 
HETATM 2618 C CA    . SAM B 2 .   ? 24.946  62.582 -3.671  1.00 28.57 ? 417 SAM A CA    1 
HETATM 2619 C C     . SAM B 2 .   ? 25.540  63.513 -2.605  1.00 28.92 ? 417 SAM A C     1 
HETATM 2620 O O     . SAM B 2 .   ? 24.794  64.234 -1.917  1.00 28.53 ? 417 SAM A O     1 
HETATM 2621 O OXT   . SAM B 2 .   ? 26.765  63.570 -2.414  1.00 27.74 ? 417 SAM A OXT   1 
HETATM 2622 C CB    . SAM B 2 .   ? 24.913  63.262 -5.047  1.00 29.13 ? 417 SAM A CB    1 
HETATM 2623 C CG    . SAM B 2 .   ? 23.919  64.439 -5.154  1.00 29.84 ? 417 SAM A CG    1 
HETATM 2624 S SD    . SAM B 2 .   ? 23.905  65.262 -6.767  1.00 32.12 ? 417 SAM A SD    1 
HETATM 2625 C CE    . SAM B 2 .   ? 23.872  67.034 -6.380  1.00 33.57 ? 417 SAM A CE    1 
HETATM 2626 C "C5'" . SAM B 2 .   ? 22.191  65.028 -7.293  1.00 32.35 ? 417 SAM A "C5'" 1 
HETATM 2627 C "C4'" . SAM B 2 .   ? 21.995  63.741 -8.077  1.00 31.74 ? 417 SAM A "C4'" 1 
HETATM 2628 O "O4'" . SAM B 2 .   ? 20.595  63.533 -8.208  1.00 34.46 ? 417 SAM A "O4'" 1 
HETATM 2629 C "C3'" . SAM B 2 .   ? 22.550  63.896 -9.486  1.00 31.87 ? 417 SAM A "C3'" 1 
HETATM 2630 O "O3'" . SAM B 2 .   ? 23.625  63.012 -9.745  1.00 30.00 ? 417 SAM A "O3'" 1 
HETATM 2631 C "C2'" . SAM B 2 .   ? 21.357  63.672 -10.408 1.00 30.57 ? 417 SAM A "C2'" 1 
HETATM 2632 O "O2'" . SAM B 2 .   ? 21.665  62.824 -11.485 1.00 27.61 ? 417 SAM A "O2'" 1 
HETATM 2633 C "C1'" . SAM B 2 .   ? 20.398  62.952 -9.480  1.00 32.92 ? 417 SAM A "C1'" 1 
HETATM 2634 N N9    . SAM B 2 .   ? 18.997  62.959 -9.950  1.00 31.87 ? 417 SAM A N9    1 
HETATM 2635 C C8    . SAM B 2 .   ? 18.276  64.027 -10.427 1.00 33.23 ? 417 SAM A C8    1 
HETATM 2636 N N7    . SAM B 2 .   ? 17.036  63.589 -10.756 1.00 32.52 ? 417 SAM A N7    1 
HETATM 2637 C C5    . SAM B 2 .   ? 16.952  62.269 -10.497 1.00 32.90 ? 417 SAM A C5    1 
HETATM 2638 C C6    . SAM B 2 .   ? 15.929  61.333 -10.634 1.00 32.05 ? 417 SAM A C6    1 
HETATM 2639 N N6    . SAM B 2 .   ? 14.731  61.664 -11.123 1.00 34.22 ? 417 SAM A N6    1 
HETATM 2640 N N1    . SAM B 2 .   ? 16.169  60.027 -10.272 1.00 32.52 ? 417 SAM A N1    1 
HETATM 2641 C C2    . SAM B 2 .   ? 17.394  59.624 -9.765  1.00 31.76 ? 417 SAM A C2    1 
HETATM 2642 N N3    . SAM B 2 .   ? 18.394  60.567 -9.636  1.00 31.61 ? 417 SAM A N3    1 
HETATM 2643 C C4    . SAM B 2 .   ? 18.186  61.860 -9.987  1.00 30.78 ? 417 SAM A C4    1 
HETATM 2644 S S     . SO4 C 3 .   ? 30.459  41.786 1.098   1.00 67.14 ? 418 SO4 A S     1 
HETATM 2645 O O1    . SO4 C 3 .   ? 29.165  42.124 0.516   1.00 67.20 ? 418 SO4 A O1    1 
HETATM 2646 O O2    . SO4 C 3 .   ? 31.314  41.184 0.076   1.00 65.66 ? 418 SO4 A O2    1 
HETATM 2647 O O3    . SO4 C 3 .   ? 31.102  42.992 1.622   1.00 66.62 ? 418 SO4 A O3    1 
HETATM 2648 O O4    . SO4 C 3 .   ? 30.235  40.854 2.200   1.00 67.55 ? 418 SO4 A O4    1 
HETATM 2649 S S     . SO4 D 3 .   ? 3.518   63.008 -10.494 1.00 95.11 ? 419 SO4 A S     1 
HETATM 2650 O O1    . SO4 D 3 .   ? 3.052   64.047 -11.410 1.00 95.28 ? 419 SO4 A O1    1 
HETATM 2651 O O2    . SO4 D 3 .   ? 4.498   62.161 -11.171 1.00 94.66 ? 419 SO4 A O2    1 
HETATM 2652 O O3    . SO4 D 3 .   ? 4.127   63.630 -9.321  1.00 95.18 ? 419 SO4 A O3    1 
HETATM 2653 O O4    . SO4 D 3 .   ? 2.377   62.202 -10.078 1.00 94.92 ? 419 SO4 A O4    1 
HETATM 2654 O O     . HOH E 4 .   ? 20.902  67.821 -8.772  1.00 35.09 ? 420 HOH A O     1 
HETATM 2655 O O     . HOH E 4 .   ? 4.347   73.601 2.991   1.00 55.97 ? 421 HOH A O     1 
HETATM 2656 O O     . HOH E 4 .   ? 43.438  59.261 3.970   1.00 45.21 ? 422 HOH A O     1 
HETATM 2657 O O     . HOH E 4 .   ? 21.853  70.125 14.269  1.00 43.57 ? 423 HOH A O     1 
HETATM 2658 O O     . HOH E 4 .   ? 16.508  77.008 11.529  1.00 61.32 ? 424 HOH A O     1 
HETATM 2659 O O     . HOH E 4 .   ? 61.592  43.722 -1.952  1.00 58.20 ? 425 HOH A O     1 
HETATM 2660 O O     . HOH E 4 .   ? 8.285   57.882 -7.168  1.00 27.29 ? 426 HOH A O     1 
HETATM 2661 O O     . HOH E 4 .   ? 25.626  60.984 -16.988 1.00 37.78 ? 427 HOH A O     1 
HETATM 2662 O O     . HOH E 4 .   ? 8.755   56.025 10.583  1.00 50.32 ? 428 HOH A O     1 
HETATM 2663 O O     . HOH E 4 .   ? 28.285  61.358 -5.453  1.00 23.93 ? 429 HOH A O     1 
HETATM 2664 O O     . HOH E 4 .   ? 30.536  59.688 2.363   1.00 25.15 ? 430 HOH A O     1 
HETATM 2665 O O     . HOH E 4 .   ? 40.532  44.449 17.657  1.00 67.08 ? 431 HOH A O     1 
HETATM 2666 O O     . HOH E 4 .   ? 15.439  72.291 -5.523  1.00 35.01 ? 432 HOH A O     1 
HETATM 2667 O O     . HOH E 4 .   ? 53.398  35.152 10.159  1.00 46.51 ? 433 HOH A O     1 
HETATM 2668 O O     . HOH E 4 .   ? 35.007  56.898 15.661  1.00 46.85 ? 434 HOH A O     1 
HETATM 2669 O O     . HOH E 4 .   ? 23.069  72.587 8.071   1.00 41.15 ? 435 HOH A O     1 
HETATM 2670 O O     . HOH E 4 .   ? 38.957  57.931 14.197  1.00 46.80 ? 436 HOH A O     1 
HETATM 2671 O O     . HOH E 4 .   ? 12.317  70.753 -11.393 1.00 37.22 ? 437 HOH A O     1 
HETATM 2672 O O     . HOH E 4 .   ? 30.407  58.735 9.709   1.00 25.63 ? 438 HOH A O     1 
HETATM 2673 O O     . HOH E 4 .   ? 8.014   56.042 5.730   1.00 36.82 ? 439 HOH A O     1 
HETATM 2674 O O     . HOH E 4 .   ? 22.288  57.180 12.522  1.00 44.72 ? 440 HOH A O     1 
HETATM 2675 O O     . HOH E 4 .   ? 20.846  63.198 -2.840  1.00 27.25 ? 441 HOH A O     1 
HETATM 2676 O O     . HOH E 4 .   ? 47.733  34.259 12.476  1.00 36.72 ? 442 HOH A O     1 
HETATM 2677 O O     . HOH E 4 .   ? 12.251  67.443 12.078  1.00 29.40 ? 443 HOH A O     1 
HETATM 2678 O O     . HOH E 4 .   ? 23.771  53.885 -8.518  1.00 35.68 ? 444 HOH A O     1 
HETATM 2679 O O     . HOH E 4 .   ? 37.989  40.610 5.878   1.00 36.57 ? 445 HOH A O     1 
HETATM 2680 O O     . HOH E 4 .   ? 36.082  60.296 2.866   1.00 34.90 ? 446 HOH A O     1 
HETATM 2681 O O     . HOH E 4 .   ? -0.864  60.897 0.121   1.00 58.26 ? 447 HOH A O     1 
HETATM 2682 O O     . HOH E 4 .   ? 33.179  44.037 2.718   1.00 39.78 ? 448 HOH A O     1 
HETATM 2683 O O     . HOH E 4 .   ? 10.046  66.260 -13.227 1.00 51.69 ? 449 HOH A O     1 
HETATM 2684 O O     . HOH E 4 .   ? 43.401  57.523 -2.160  1.00 32.76 ? 450 HOH A O     1 
HETATM 2685 O O     . HOH E 4 .   ? 33.479  70.632 6.751   1.00 57.11 ? 451 HOH A O     1 
HETATM 2686 O O     . HOH E 4 .   ? 28.710  69.151 1.703   1.00 48.39 ? 452 HOH A O     1 
HETATM 2687 O O     . HOH E 4 .   ? 51.756  58.446 -6.461  1.00 45.12 ? 453 HOH A O     1 
HETATM 2688 O O     . HOH E 4 .   ? 25.082  52.017 -10.237 1.00 35.06 ? 454 HOH A O     1 
HETATM 2689 O O     . HOH E 4 .   ? 4.900   57.907 -1.820  1.00 47.99 ? 455 HOH A O     1 
HETATM 2690 O O     . HOH E 4 .   ? 2.736   78.874 6.901   1.00 56.48 ? 456 HOH A O     1 
HETATM 2691 O O     . HOH E 4 .   ? 42.408  43.057 -1.231  1.00 48.19 ? 457 HOH A O     1 
HETATM 2692 O O     . HOH E 4 .   ? 47.588  39.816 2.441   1.00 41.16 ? 458 HOH A O     1 
HETATM 2693 O O     . HOH E 4 .   ? 55.919  37.374 2.304   1.00 47.00 ? 459 HOH A O     1 
HETATM 2694 O O     . HOH E 4 .   ? 29.977  62.141 1.034   1.00 42.96 ? 460 HOH A O     1 
HETATM 2695 O O     . HOH E 4 .   ? 29.238  60.169 12.236  1.00 39.60 ? 461 HOH A O     1 
HETATM 2696 O O     . HOH E 4 .   ? 27.430  63.777 -13.140 1.00 34.25 ? 462 HOH A O     1 
HETATM 2697 O O     . HOH E 4 .   ? 13.674  53.762 -12.727 1.00 45.71 ? 463 HOH A O     1 
HETATM 2698 O O     . HOH E 4 .   ? 24.820  63.974 -12.300 1.00 30.76 ? 464 HOH A O     1 
HETATM 2699 O O     . HOH E 4 .   ? 11.686  72.656 -1.970  1.00 40.89 ? 465 HOH A O     1 
HETATM 2700 O O     . HOH E 4 .   ? 39.615  42.328 -0.044  1.00 35.93 ? 466 HOH A O     1 
HETATM 2701 O O     . HOH E 4 .   ? 25.984  63.697 -15.952 1.00 74.08 ? 467 HOH A O     1 
HETATM 2702 O O     . HOH E 4 .   ? 3.499   76.106 2.628   1.00 47.18 ? 468 HOH A O     1 
HETATM 2703 O O     . HOH E 4 .   ? 31.691  70.055 5.015   1.00 36.57 ? 469 HOH A O     1 
HETATM 2704 O O     . HOH E 4 .   ? 58.144  45.522 -4.065  1.00 53.96 ? 470 HOH A O     1 
HETATM 2705 O O     . HOH E 4 .   ? 35.517  52.779 -13.261 1.00 54.27 ? 471 HOH A O     1 
HETATM 2706 O O     . HOH E 4 .   ? 25.262  71.260 8.909   1.00 43.30 ? 472 HOH A O     1 
HETATM 2707 O O     . HOH E 4 .   ? 21.964  45.463 7.409   1.00 70.87 ? 473 HOH A O     1 
HETATM 2708 O O     . HOH E 4 .   ? 30.229  43.466 6.263   1.00 44.52 ? 474 HOH A O     1 
HETATM 2709 O O     . HOH E 4 .   ? 25.630  49.766 -8.974  1.00 39.11 ? 475 HOH A O     1 
HETATM 2710 O O     . HOH E 4 .   ? 23.082  70.640 -5.347  1.00 50.95 ? 476 HOH A O     1 
HETATM 2711 O O     . HOH E 4 .   ? 13.197  47.775 -1.349  1.00 46.14 ? 477 HOH A O     1 
HETATM 2712 O O     . HOH E 4 .   ? 43.535  46.800 -4.068  1.00 39.41 ? 478 HOH A O     1 
HETATM 2713 O O     . HOH E 4 .   ? 20.538  68.777 -6.459  1.00 29.78 ? 479 HOH A O     1 
HETATM 2714 O O     . HOH E 4 .   ? 44.198  59.440 6.501   1.00 41.22 ? 480 HOH A O     1 
HETATM 2715 O O     . HOH E 4 .   ? 16.790  73.626 -12.129 1.00 55.87 ? 481 HOH A O     1 
HETATM 2716 O O     . HOH E 4 .   ? 5.784   73.119 0.812   1.00 36.99 ? 482 HOH A O     1 
HETATM 2717 O O     . HOH E 4 .   ? 3.435   71.920 0.001   1.00 41.10 ? 483 HOH A O     1 
HETATM 2718 O O     . HOH E 4 .   ? 0.424   61.954 -2.039  1.00 39.04 ? 484 HOH A O     1 
HETATM 2719 O O     . HOH E 4 .   ? 7.395   54.660 -14.013 1.00 56.76 ? 485 HOH A O     1 
HETATM 2720 O O     . HOH E 4 .   ? 25.548  58.441 -2.156  1.00 29.16 ? 486 HOH A O     1 
HETATM 2721 O O     . HOH E 4 .   ? 42.562  49.233 -8.583  1.00 53.24 ? 487 HOH A O     1 
HETATM 2722 O O     . HOH E 4 .   ? 24.683  55.698 -6.690  1.00 31.39 ? 488 HOH A O     1 
HETATM 2723 O O     . HOH E 4 .   ? 40.746  59.696 8.181   1.00 40.45 ? 489 HOH A O     1 
HETATM 2724 O O     . HOH E 4 .   ? 19.550  73.177 -11.419 1.00 49.90 ? 490 HOH A O     1 
HETATM 2725 O O     . HOH E 4 .   ? 42.591  45.850 -1.570  1.00 39.56 ? 491 HOH A O     1 
HETATM 2726 O O     . HOH E 4 .   ? 35.543  63.600 -3.660  1.00 43.17 ? 492 HOH A O     1 
HETATM 2727 O O     . HOH E 4 .   ? 31.774  54.140 11.640  1.00 37.24 ? 493 HOH A O     1 
HETATM 2728 O O     . HOH E 4 .   ? 31.478  56.715 11.192  1.00 34.86 ? 494 HOH A O     1 
HETATM 2729 O O     . HOH E 4 .   ? 29.377  57.606 13.178  1.00 39.35 ? 495 HOH A O     1 
HETATM 2730 O O     . HOH E 4 .   ? 13.346  50.319 -1.345  1.00 54.57 ? 496 HOH A O     1 
HETATM 2731 O O     . HOH E 4 .   ? -7.682  80.655 8.251   1.00 50.67 ? 497 HOH A O     1 
HETATM 2732 O O     . HOH E 4 .   ? 57.677  36.592 13.073  1.00 45.75 ? 498 HOH A O     1 
HETATM 2733 O O     . HOH E 4 .   ? 28.598  66.169 14.308  1.00 54.24 ? 499 HOH A O     1 
HETATM 2734 O O     . HOH E 4 .   ? 20.496  49.735 16.765  1.00 67.17 ? 500 HOH A O     1 
HETATM 2735 O O     . HOH E 4 .   ? 36.811  63.272 3.451   1.00 45.08 ? 501 HOH A O     1 
HETATM 2736 O O     . HOH E 4 .   ? 41.430  60.645 4.827   1.00 36.87 ? 502 HOH A O     1 
HETATM 2737 O O     . HOH E 4 .   ? 11.561  59.960 14.164  1.00 38.13 ? 503 HOH A O     1 
HETATM 2738 O O     . HOH E 4 .   ? 13.345  64.124 14.178  1.00 28.52 ? 504 HOH A O     1 
HETATM 2739 O O     . HOH E 4 .   ? 40.800  38.459 -0.333  1.00 45.19 ? 505 HOH A O     1 
HETATM 2740 O O     . HOH E 4 .   ? 39.223  64.929 -17.874 1.00 57.82 ? 506 HOH A O     1 
HETATM 2741 O O     . HOH E 4 .   ? 22.102  74.118 1.443   1.00 50.91 ? 507 HOH A O     1 
HETATM 2742 O O     . HOH E 4 .   ? 57.128  43.712 0.157   1.00 49.42 ? 508 HOH A O     1 
HETATM 2743 O O     . HOH E 4 .   ? 30.605  68.918 -5.373  1.00 40.75 ? 509 HOH A O     1 
HETATM 2744 O O     . HOH E 4 .   ? 34.958  65.967 -9.912  1.00 50.44 ? 510 HOH A O     1 
HETATM 2745 O O     . HOH E 4 .   ? 13.050  57.829 11.037  1.00 34.84 ? 511 HOH A O     1 
HETATM 2746 O O     . HOH E 4 .   ? 12.174  74.078 -5.324  1.00 49.34 ? 512 HOH A O     1 
HETATM 2747 O O     . HOH E 4 .   ? 40.995  58.764 -9.459  1.00 40.52 ? 513 HOH A O     1 
HETATM 2748 O O     . HOH E 4 .   ? 34.438  43.469 -4.409  1.00 42.53 ? 514 HOH A O     1 
HETATM 2749 O O     . HOH E 4 .   ? 26.285  69.117 -2.577  1.00 44.05 ? 515 HOH A O     1 
HETATM 2750 O O     . HOH E 4 .   ? 51.465  36.969 7.373   1.00 46.09 ? 516 HOH A O     1 
HETATM 2751 O O     . HOH E 4 .   ? 5.462   72.396 9.520   1.00 38.91 ? 517 HOH A O     1 
HETATM 2752 O O     . HOH E 4 .   ? 20.502  49.000 -10.981 1.00 47.68 ? 518 HOH A O     1 
HETATM 2753 O O     . HOH E 4 .   ? 8.857   72.868 12.205  1.00 43.71 ? 519 HOH A O     1 
HETATM 2754 O O     . HOH E 4 .   ? 2.273   56.142 10.191  1.00 45.99 ? 520 HOH A O     1 
HETATM 2755 O O     . HOH E 4 .   ? 41.152  47.151 16.706  1.00 62.47 ? 521 HOH A O     1 
HETATM 2756 O O     . HOH E 4 .   ? 56.470  45.854 -1.987  1.00 49.72 ? 522 HOH A O     1 
HETATM 2757 O O     . HOH E 4 .   ? 35.711  56.533 -16.978 1.00 54.92 ? 523 HOH A O     1 
HETATM 2758 O O     . HOH E 4 .   ? 14.695  64.299 -12.133 1.00 48.92 ? 524 HOH A O     1 
HETATM 2759 O O     . HOH E 4 .   ? 35.703  64.530 -7.675  1.00 51.62 ? 525 HOH A O     1 
HETATM 2760 O O     . HOH E 4 .   ? 18.372  76.041 0.462   1.00 43.41 ? 526 HOH A O     1 
HETATM 2761 O O     . HOH E 4 .   ? 8.088   72.889 -5.373  1.00 53.41 ? 527 HOH A O     1 
HETATM 2762 O O     . HOH E 4 .   ? 31.251  61.542 13.622  1.00 57.04 ? 528 HOH A O     1 
HETATM 2763 O O     . HOH E 4 .   ? 26.834  47.372 -8.545  1.00 54.42 ? 529 HOH A O     1 
HETATM 2764 O O     . HOH E 4 .   ? 47.357  42.064 18.964  1.00 57.23 ? 530 HOH A O     1 
HETATM 2765 O O     . HOH E 4 .   ? 27.078  44.332 -5.494  1.00 42.91 ? 531 HOH A O     1 
HETATM 2766 O O     . HOH E 4 .   ? 20.438  76.805 1.939   1.00 51.56 ? 532 HOH A O     1 
HETATM 2767 O O     . HOH E 4 .   ? 14.362  46.473 -3.712  1.00 54.20 ? 533 HOH A O     1 
HETATM 2768 O O     . HOH E 4 .   ? 51.035  36.351 3.175   1.00 48.19 ? 534 HOH A O     1 
HETATM 2769 O O     . HOH E 4 .   ? 8.855   54.566 8.443   1.00 56.53 ? 535 HOH A O     1 
HETATM 2770 O O     . HOH E 4 .   ? 56.759  40.176 4.174   1.00 44.70 ? 536 HOH A O     1 
HETATM 2771 O O     . HOH E 4 .   ? 56.745  35.302 10.282  1.00 54.99 ? 537 HOH A O     1 
HETATM 2772 O O     . HOH E 4 .   ? 37.194  44.690 13.181  1.00 56.36 ? 538 HOH A O     1 
HETATM 2773 O O     . HOH E 4 .   ? 40.639  52.356 13.724  1.00 53.35 ? 539 HOH A O     1 
HETATM 2774 O O     . HOH E 4 .   ? 33.463  60.274 1.182   1.00 35.08 ? 540 HOH A O     1 
HETATM 2775 O O     . HOH E 4 .   ? 45.951  59.742 -2.062  1.00 42.11 ? 541 HOH A O     1 
HETATM 2776 O O     . HOH E 4 .   ? 45.451  48.634 -4.638  1.00 43.56 ? 542 HOH A O     1 
HETATM 2777 O O     . HOH E 4 .   ? 3.786   72.667 -4.243  1.00 69.00 ? 543 HOH A O     1 
HETATM 2778 O O     . HOH E 4 .   ? 12.439  75.464 0.105   1.00 44.04 ? 544 HOH A O     1 
HETATM 2779 O O     . HOH E 4 .   ? 16.024  62.754 14.293  1.00 46.68 ? 545 HOH A O     1 
HETATM 2780 O O     . HOH E 4 .   ? 51.162  52.256 -13.706 1.00 60.44 ? 546 HOH A O     1 
HETATM 2781 O O     . HOH E 4 .   ? 8.306   51.721 -12.188 1.00 52.83 ? 547 HOH A O     1 
HETATM 2782 O O     . HOH E 4 .   ? 26.185  43.010 3.748   1.00 51.06 ? 548 HOH A O     1 
HETATM 2783 O O     . HOH E 4 .   ? 24.751  43.333 1.368   1.00 57.20 ? 549 HOH A O     1 
HETATM 2784 O O     . HOH E 4 .   ? 33.477  52.955 -14.691 1.00 61.37 ? 550 HOH A O     1 
HETATM 2785 O O     . HOH E 4 .   ? 17.548  60.373 16.435  1.00 58.90 ? 551 HOH A O     1 
HETATM 2786 O O     . HOH E 4 .   ? 14.399  52.594 14.232  1.00 64.76 ? 552 HOH A O     1 
HETATM 2787 O O     . HOH E 4 .   ? 28.127  40.844 -1.954  1.00 70.55 ? 553 HOH A O     1 
HETATM 2788 O O     . HOH E 4 .   ? 26.948  58.697 16.486  1.00 47.60 ? 554 HOH A O     1 
HETATM 2789 O O     . HOH E 4 .   ? 18.248  65.077 14.773  1.00 59.94 ? 555 HOH A O     1 
HETATM 2790 O O     . HOH E 4 .   ? 7.868   84.220 10.766  1.00 59.33 ? 556 HOH A O     1 
HETATM 2791 O O     . HOH E 4 .   ? 23.452  76.668 1.854   1.00 63.50 ? 557 HOH A O     1 
HETATM 2792 O O     . HOH E 4 .   ? 29.931  52.631 13.433  1.00 72.45 ? 558 HOH A O     1 
HETATM 2793 O O     . HOH E 4 .   ? 31.189  65.847 11.095  1.00 37.70 ? 559 HOH A O     1 
HETATM 2794 O O     . HOH E 4 .   ? 41.440  64.547 -10.765 1.00 58.30 ? 560 HOH A O     1 
HETATM 2795 O O     . HOH E 4 .   ? 36.558  46.912 -9.484  1.00 64.61 ? 561 HOH A O     1 
HETATM 2796 O O     . HOH E 4 .   ? 34.970  71.578 -13.662 1.00 42.97 ? 562 HOH A O     1 
HETATM 2797 O O     . HOH E 4 .   ? 36.048  66.813 11.041  1.00 46.99 ? 563 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -9  ?   ?   ?   A . n 
A 1 2   HIS 2   -8  ?   ?   ?   A . n 
A 1 3   HIS 3   -7  ?   ?   ?   A . n 
A 1 4   HIS 4   -6  ?   ?   ?   A . n 
A 1 5   HIS 5   -5  ?   ?   ?   A . n 
A 1 6   HIS 6   -4  ?   ?   ?   A . n 
A 1 7   HIS 7   -3  ?   ?   ?   A . n 
A 1 8   SER 8   -2  ?   ?   ?   A . n 
A 1 9   SER 9   -1  ?   ?   ?   A . n 
A 1 10  GLY 10  0   ?   ?   ?   A . n 
A 1 11  MET 11  1   ?   ?   ?   A . n 
A 1 12  GLY 12  2   ?   ?   ?   A . n 
A 1 13  GLU 13  3   ?   ?   ?   A . n 
A 1 14  LYS 14  4   4   LYS LYS A . n 
A 1 15  LEU 15  5   5   LEU LEU A . n 
A 1 16  GLU 16  6   6   GLU GLU A . n 
A 1 17  LEU 17  7   7   LEU LEU A . n 
A 1 18  ARG 18  8   8   ARG ARG A . n 
A 1 19  LEU 19  9   9   LEU LEU A . n 
A 1 20  LYS 20  10  10  LYS LYS A . n 
A 1 21  SER 21  11  11  SER SER A . n 
A 1 22  PRO 22  12  12  PRO PRO A . n 
A 1 23  VAL 23  13  13  VAL VAL A . n 
A 1 24  GLY 24  14  14  GLY GLY A . n 
A 1 25  ALA 25  15  15  ALA ALA A . n 
A 1 26  GLU 26  16  16  GLU GLU A . n 
A 1 27  PRO 27  17  17  PRO PRO A . n 
A 1 28  ALA 28  18  18  ALA ALA A . n 
A 1 29  VAL 29  19  19  VAL VAL A . n 
A 1 30  TYR 30  20  20  TYR TYR A . n 
A 1 31  PRO 31  21  21  PRO PRO A . n 
A 1 32  TRP 32  22  22  TRP TRP A . n 
A 1 33  PRO 33  23  23  PRO PRO A . n 
A 1 34  LEU 34  24  24  LEU LEU A . n 
A 1 35  PRO 35  25  25  PRO PRO A . n 
A 1 36  VAL 36  26  26  VAL VAL A . n 
A 1 37  TYR 37  27  27  TYR TYR A . n 
A 1 38  ASP 38  28  28  ASP ASP A . n 
A 1 39  LYS 39  29  29  LYS LYS A . n 
A 1 40  HIS 40  30  30  HIS HIS A . n 
A 1 41  HIS 41  31  31  HIS HIS A . n 
A 1 42  ASP 42  32  32  ASP ASP A . n 
A 1 43  ALA 43  33  33  ALA ALA A . n 
A 1 44  ALA 44  34  34  ALA ALA A . n 
A 1 45  HIS 45  35  35  HIS HIS A . n 
A 1 46  GLU 46  36  36  GLU GLU A . n 
A 1 47  ILE 47  37  37  ILE ILE A . n 
A 1 48  ILE 48  38  38  ILE ILE A . n 
A 1 49  GLU 49  39  39  GLU GLU A . n 
A 1 50  THR 50  40  40  THR THR A . n 
A 1 51  ILE 51  41  41  ILE ILE A . n 
A 1 52  ARG 52  42  42  ARG ARG A . n 
A 1 53  TRP 53  43  43  TRP TRP A . n 
A 1 54  VAL 54  44  44  VAL VAL A . n 
A 1 55  CYS 55  45  45  CYS CYS A . n 
A 1 56  GLU 56  46  46  GLU GLU A . n 
A 1 57  GLU 57  47  47  GLU GLU A . n 
A 1 58  ILE 58  48  48  ILE ILE A . n 
A 1 59  PRO 59  49  49  PRO PRO A . n 
A 1 60  ASP 60  50  50  ASP ASP A . n 
A 1 61  LEU 61  51  51  LEU LEU A . n 
A 1 62  LYS 62  52  52  LYS LYS A . n 
A 1 63  LEU 63  53  53  LEU LEU A . n 
A 1 64  ALA 64  54  54  ALA ALA A . n 
A 1 65  MET 65  55  55  MET MET A . n 
A 1 66  GLU 66  56  56  GLU GLU A . n 
A 1 67  ASN 67  57  57  ASN ASN A . n 
A 1 68  TYR 68  58  58  TYR TYR A . n 
A 1 69  VAL 69  59  ?   ?   ?   A . n 
A 1 70  LEU 70  60  60  LEU LEU A . n 
A 1 71  ILE 71  61  61  ILE ILE A . n 
A 1 72  ASP 72  62  62  ASP ASP A . n 
A 1 73  TYR 73  63  63  TYR TYR A . n 
A 1 74  ASP 74  64  64  ASP ASP A . n 
A 1 75  THR 75  65  65  THR THR A . n 
A 1 76  LYS 76  66  66  LYS LYS A . n 
A 1 77  SER 77  67  67  SER SER A . n 
A 1 78  PHE 78  68  68  PHE PHE A . n 
A 1 79  GLU 79  69  69  GLU GLU A . n 
A 1 80  SER 80  70  70  SER SER A . n 
A 1 81  MET 81  71  71  MET MET A . n 
A 1 82  GLN 82  72  72  GLN GLN A . n 
A 1 83  ARG 83  73  73  ARG ARG A . n 
A 1 84  LEU 84  74  74  LEU LEU A . n 
A 1 85  CYS 85  75  75  CYS CYS A . n 
A 1 86  ASP 86  76  76  ASP ASP A . n 
A 1 87  LYS 87  77  77  LYS LYS A . n 
A 1 88  TYR 88  78  78  TYR TYR A . n 
A 1 89  ASN 89  79  79  ASN ASN A . n 
A 1 90  ARG 90  80  80  ARG ARG A . n 
A 1 91  ALA 91  81  81  ALA ALA A . n 
A 1 92  ILE 92  82  82  ILE ILE A . n 
A 1 93  ASP 93  83  83  ASP ASP A . n 
A 1 94  SER 94  84  84  SER SER A . n 
A 1 95  ILE 95  85  85  ILE ILE A . n 
A 1 96  HIS 96  86  86  HIS HIS A . n 
A 1 97  GLN 97  87  87  GLN GLN A . n 
A 1 98  LEU 98  88  88  LEU LEU A . n 
A 1 99  TRP 99  89  89  TRP TRP A . n 
A 1 100 LYS 100 90  90  LYS LYS A . n 
A 1 101 GLY 101 91  91  GLY GLY A . n 
A 1 102 THR 102 92  92  THR THR A . n 
A 1 103 THR 103 93  93  THR THR A . n 
A 1 104 GLN 104 94  94  GLN GLN A . n 
A 1 105 PRO 105 95  95  PRO PRO A . n 
A 1 106 MET 106 96  96  MET MET A . n 
A 1 107 LYS 107 97  97  LYS LYS A . n 
A 1 108 LEU 108 98  98  LEU LEU A . n 
A 1 109 ASN 109 99  99  ASN ASN A . n 
A 1 110 THR 110 100 100 THR THR A . n 
A 1 111 ARG 111 101 101 ARG ARG A . n 
A 1 112 PRO 112 102 102 PRO PRO A . n 
A 1 113 SER 113 103 103 SER SER A . n 
A 1 114 THR 114 104 104 THR THR A . n 
A 1 115 GLY 115 105 105 GLY GLY A . n 
A 1 116 LEU 116 106 106 LEU LEU A . n 
A 1 117 LEU 117 107 107 LEU LEU A . n 
A 1 118 ARG 118 108 108 ARG ARG A . n 
A 1 119 HIS 119 109 109 HIS HIS A . n 
A 1 120 ILE 120 110 110 ILE ILE A . n 
A 1 121 LEU 121 111 111 LEU LEU A . n 
A 1 122 GLN 122 112 112 GLN GLN A . n 
A 1 123 GLN 123 113 113 GLN GLN A . n 
A 1 124 VAL 124 114 114 VAL VAL A . n 
A 1 125 TYR 125 115 115 TYR TYR A . n 
A 1 126 ASN 126 116 116 ASN ASN A . n 
A 1 127 HIS 127 117 117 HIS HIS A . n 
A 1 128 SER 128 118 118 SER SER A . n 
A 1 129 VAL 129 119 119 VAL VAL A . n 
A 1 130 THR 130 120 120 THR THR A . n 
A 1 131 ASP 131 121 121 ASP ASP A . n 
A 1 132 PRO 132 122 122 PRO PRO A . n 
A 1 133 GLU 133 123 123 GLU GLU A . n 
A 1 134 LYS 134 124 124 LYS LYS A . n 
A 1 135 LEU 135 125 125 LEU LEU A . n 
A 1 136 ASN 136 126 126 ASN ASN A . n 
A 1 137 ASN 137 127 127 ASN ASN A . n 
A 1 138 TYR 138 128 128 TYR TYR A . n 
A 1 139 GLU 139 129 129 GLU GLU A . n 
A 1 140 PRO 140 130 130 PRO PRO A . n 
A 1 141 PHE 141 131 131 PHE PHE A . n 
A 1 142 SER 142 132 132 SER SER A . n 
A 1 143 PRO 143 133 133 PRO PRO A . n 
A 1 144 GLU 144 134 134 GLU GLU A . n 
A 1 145 VAL 145 135 135 VAL VAL A . n 
A 1 146 TYR 146 136 136 TYR TYR A . n 
A 1 147 GLY 147 137 137 GLY GLY A . n 
A 1 148 GLU 148 138 138 GLU GLU A . n 
A 1 149 THR 149 139 139 THR THR A . n 
A 1 150 SER 150 140 140 SER SER A . n 
A 1 151 PHE 151 141 141 PHE PHE A . n 
A 1 152 ASP 152 142 142 ASP ASP A . n 
A 1 153 LEU 153 143 143 LEU LEU A . n 
A 1 154 VAL 154 144 144 VAL VAL A . n 
A 1 155 ALA 155 145 145 ALA ALA A . n 
A 1 156 GLN 156 146 146 GLN GLN A . n 
A 1 157 MET 157 147 147 MET MET A . n 
A 1 158 ILE 158 148 148 ILE ILE A . n 
A 1 159 ASP 159 149 149 ASP ASP A . n 
A 1 160 GLU 160 150 150 GLU GLU A . n 
A 1 161 ILE 161 151 151 ILE ILE A . n 
A 1 162 LYS 162 152 152 LYS LYS A . n 
A 1 163 MET 163 153 153 MET MET A . n 
A 1 164 THR 164 154 154 THR THR A . n 
A 1 165 ASP 165 155 155 ASP ASP A . n 
A 1 166 ASP 166 156 156 ASP ASP A . n 
A 1 167 ASP 167 157 157 ASP ASP A . n 
A 1 168 LEU 168 158 158 LEU LEU A . n 
A 1 169 PHE 169 159 159 PHE PHE A . n 
A 1 170 VAL 170 160 160 VAL VAL A . n 
A 1 171 ASP 171 161 161 ASP ASP A . n 
A 1 172 LEU 172 162 162 LEU LEU A . n 
A 1 173 GLY 173 163 163 GLY GLY A . n 
A 1 174 SER 174 164 164 SER SER A . n 
A 1 175 GLY 175 165 165 GLY GLY A . n 
A 1 176 VAL 176 166 166 VAL VAL A . n 
A 1 177 GLY 177 167 167 GLY GLY A . n 
A 1 178 GLN 178 168 168 GLN GLN A . n 
A 1 179 VAL 179 169 169 VAL VAL A . n 
A 1 180 VAL 180 170 170 VAL VAL A . n 
A 1 181 LEU 181 171 171 LEU LEU A . n 
A 1 182 GLN 182 172 172 GLN GLN A . n 
A 1 183 VAL 183 173 173 VAL VAL A . n 
A 1 184 ALA 184 174 174 ALA ALA A . n 
A 1 185 ALA 185 175 175 ALA ALA A . n 
A 1 186 ALA 186 176 176 ALA ALA A . n 
A 1 187 THR 187 177 177 THR THR A . n 
A 1 188 ASN 188 178 178 ASN ASN A . n 
A 1 189 CYS 189 179 179 CYS CYS A . n 
A 1 190 LYS 190 180 180 LYS LYS A . n 
A 1 191 HIS 191 181 181 HIS HIS A . n 
A 1 192 HIS 192 182 182 HIS HIS A . n 
A 1 193 TYR 193 183 183 TYR TYR A . n 
A 1 194 GLY 194 184 184 GLY GLY A . n 
A 1 195 VAL 195 185 185 VAL VAL A . n 
A 1 196 GLU 196 186 186 GLU GLU A . n 
A 1 197 LYS 197 187 187 LYS LYS A . n 
A 1 198 ALA 198 188 188 ALA ALA A . n 
A 1 199 ASP 199 189 189 ASP ASP A . n 
A 1 200 ILE 200 190 190 ILE ILE A . n 
A 1 201 PRO 201 191 191 PRO PRO A . n 
A 1 202 ALA 202 192 192 ALA ALA A . n 
A 1 203 LYS 203 193 193 LYS LYS A . n 
A 1 204 TYR 204 194 194 TYR TYR A . n 
A 1 205 ALA 205 195 195 ALA ALA A . n 
A 1 206 GLU 206 196 196 GLU GLU A . n 
A 1 207 THR 207 197 197 THR THR A . n 
A 1 208 MET 208 198 198 MET MET A . n 
A 1 209 ASP 209 199 199 ASP ASP A . n 
A 1 210 ARG 210 200 200 ARG ARG A . n 
A 1 211 GLU 211 201 201 GLU GLU A . n 
A 1 212 PHE 212 202 202 PHE PHE A . n 
A 1 213 ARG 213 203 203 ARG ARG A . n 
A 1 214 LYS 214 204 204 LYS LYS A . n 
A 1 215 TRP 215 205 205 TRP TRP A . n 
A 1 216 MET 216 206 206 MET MET A . n 
A 1 217 LYS 217 207 207 LYS LYS A . n 
A 1 218 TRP 218 208 208 TRP TRP A . n 
A 1 219 TYR 219 209 209 TYR TYR A . n 
A 1 220 GLY 220 210 210 GLY GLY A . n 
A 1 221 LYS 221 211 211 LYS LYS A . n 
A 1 222 LYS 222 212 212 LYS LYS A . n 
A 1 223 HIS 223 213 213 HIS HIS A . n 
A 1 224 ALA 224 214 214 ALA ALA A . n 
A 1 225 GLU 225 215 215 GLU GLU A . n 
A 1 226 TYR 226 216 216 TYR TYR A . n 
A 1 227 THR 227 217 217 THR THR A . n 
A 1 228 LEU 228 218 218 LEU LEU A . n 
A 1 229 GLU 229 219 219 GLU GLU A . n 
A 1 230 ARG 230 220 220 ARG ARG A . n 
A 1 231 GLY 231 221 221 GLY GLY A . n 
A 1 232 ASP 232 222 222 ASP ASP A . n 
A 1 233 PHE 233 223 223 PHE PHE A . n 
A 1 234 LEU 234 224 224 LEU LEU A . n 
A 1 235 SER 235 225 225 SER SER A . n 
A 1 236 GLU 236 226 226 GLU GLU A . n 
A 1 237 GLU 237 227 227 GLU GLU A . n 
A 1 238 TRP 238 228 228 TRP TRP A . n 
A 1 239 ARG 239 229 229 ARG ARG A . n 
A 1 240 GLU 240 230 230 GLU GLU A . n 
A 1 241 ARG 241 231 231 ARG ARG A . n 
A 1 242 ILE 242 232 232 ILE ILE A . n 
A 1 243 ALA 243 233 233 ALA ALA A . n 
A 1 244 ASN 244 234 234 ASN ASN A . n 
A 1 245 THR 245 235 235 THR THR A . n 
A 1 246 SER 246 236 236 SER SER A . n 
A 1 247 VAL 247 237 237 VAL VAL A . n 
A 1 248 ILE 248 238 238 ILE ILE A . n 
A 1 249 PHE 249 239 239 PHE PHE A . n 
A 1 250 VAL 250 240 240 VAL VAL A . n 
A 1 251 ASN 251 241 241 ASN ASN A . n 
A 1 252 ASN 252 242 242 ASN ASN A . n 
A 1 253 PHE 253 243 243 PHE PHE A . n 
A 1 254 ALA 254 244 244 ALA ALA A . n 
A 1 255 PHE 255 245 245 PHE PHE A . n 
A 1 256 GLY 256 246 246 GLY GLY A . n 
A 1 257 PRO 257 247 247 PRO PRO A . n 
A 1 258 GLU 258 248 248 GLU GLU A . n 
A 1 259 VAL 259 249 249 VAL VAL A . n 
A 1 260 ASP 260 250 250 ASP ASP A . n 
A 1 261 HIS 261 251 251 HIS HIS A . n 
A 1 262 GLN 262 252 252 GLN GLN A . n 
A 1 263 LEU 263 253 253 LEU LEU A . n 
A 1 264 LYS 264 254 254 LYS LYS A . n 
A 1 265 GLU 265 255 255 GLU GLU A . n 
A 1 266 ARG 266 256 256 ARG ARG A . n 
A 1 267 PHE 267 257 257 PHE PHE A . n 
A 1 268 ALA 268 258 258 ALA ALA A . n 
A 1 269 ASN 269 259 259 ASN ASN A . n 
A 1 270 MET 270 260 260 MET MET A . n 
A 1 271 LYS 271 261 261 LYS LYS A . n 
A 1 272 GLU 272 262 262 GLU GLU A . n 
A 1 273 GLY 273 263 263 GLY GLY A . n 
A 1 274 GLY 274 264 264 GLY GLY A . n 
A 1 275 ARG 275 265 265 ARG ARG A . n 
A 1 276 ILE 276 266 266 ILE ILE A . n 
A 1 277 VAL 277 267 267 VAL VAL A . n 
A 1 278 SER 278 268 268 SER SER A . n 
A 1 279 SER 279 269 269 SER SER A . n 
A 1 280 LYS 280 270 270 LYS LYS A . n 
A 1 281 PRO 281 271 271 PRO PRO A . n 
A 1 282 PHE 282 272 272 PHE PHE A . n 
A 1 283 ALA 283 273 273 ALA ALA A . n 
A 1 284 PRO 284 274 274 PRO PRO A . n 
A 1 285 LEU 285 275 275 LEU LEU A . n 
A 1 286 ASN 286 276 276 ASN ASN A . n 
A 1 287 PHE 287 277 277 PHE PHE A . n 
A 1 288 ARG 288 278 278 ARG ARG A . n 
A 1 289 ILE 289 279 279 ILE ILE A . n 
A 1 290 ASN 290 280 280 ASN ASN A . n 
A 1 291 SER 291 281 281 SER SER A . n 
A 1 292 ARG 292 282 282 ARG ARG A . n 
A 1 293 ASN 293 283 283 ASN ASN A . n 
A 1 294 LEU 294 284 284 LEU LEU A . n 
A 1 295 SER 295 285 285 SER SER A . n 
A 1 296 ASP 296 286 286 ASP ASP A . n 
A 1 297 ILE 297 287 287 ILE ILE A . n 
A 1 298 GLY 298 288 288 GLY GLY A . n 
A 1 299 THR 299 289 289 THR THR A . n 
A 1 300 ILE 300 290 290 ILE ILE A . n 
A 1 301 MET 301 291 291 MET MET A . n 
A 1 302 ARG 302 292 292 ARG ARG A . n 
A 1 303 VAL 303 293 293 VAL VAL A . n 
A 1 304 VAL 304 294 294 VAL VAL A . n 
A 1 305 GLU 305 295 295 GLU GLU A . n 
A 1 306 LEU 306 296 296 LEU LEU A . n 
A 1 307 SER 307 297 297 SER SER A . n 
A 1 308 PRO 308 298 298 PRO PRO A . n 
A 1 309 LEU 309 299 299 LEU LEU A . n 
A 1 310 LYS 310 300 300 LYS LYS A . n 
A 1 311 GLY 311 301 ?   ?   ?   A . n 
A 1 312 SER 312 302 ?   ?   ?   A . n 
A 1 313 VAL 313 303 ?   ?   ?   A . n 
A 1 314 SER 314 304 ?   ?   ?   A . n 
A 1 315 TRP 315 305 305 TRP TRP A . n 
A 1 316 THR 316 306 306 THR THR A . n 
A 1 317 GLY 317 307 307 GLY GLY A . n 
A 1 318 LYS 318 308 308 LYS ALA A . n 
A 1 319 PRO 319 309 309 PRO PRO A . n 
A 1 320 VAL 320 310 310 VAL VAL A . n 
A 1 321 SER 321 311 311 SER SER A . n 
A 1 322 TYR 322 312 312 TYR TYR A . n 
A 1 323 TYR 323 313 313 TYR TYR A . n 
A 1 324 LEU 324 314 314 LEU LEU A . n 
A 1 325 HIS 325 315 315 HIS HIS A . n 
A 1 326 THR 326 316 316 THR THR A . n 
A 1 327 ILE 327 317 317 ILE ILE A . n 
A 1 328 ASP 328 318 318 ASP ASP A . n 
A 1 329 ARG 329 319 319 ARG ARG A . n 
A 1 330 THR 330 320 320 THR THR A . n 
A 1 331 ILE 331 321 321 ILE ILE A . n 
A 1 332 LEU 332 322 322 LEU LEU A . n 
A 1 333 GLU 333 323 323 GLU GLU A . n 
A 1 334 ASN 334 324 324 ASN ASN A . n 
A 1 335 TYR 335 325 325 TYR TYR A . n 
A 1 336 PHE 336 326 326 PHE PHE A . n 
A 1 337 SER 337 327 327 SER SER A . n 
A 1 338 SER 338 328 328 SER SER A . n 
A 1 339 LEU 339 329 329 LEU LEU A . n 
A 1 340 LYS 340 330 330 LYS LYS A . n 
A 1 341 ASN 341 331 ?   ?   ?   A . n 
A 1 342 PRO 342 332 ?   ?   ?   A . n 
A 1 343 LYS 343 333 ?   ?   ?   A . n 
A 1 344 LEU 344 334 ?   ?   ?   A . n 
A 1 345 ARG 345 335 ?   ?   ?   A . n 
A 1 346 GLU 346 336 ?   ?   ?   A . n 
A 1 347 GLU 347 337 ?   ?   ?   A . n 
A 1 348 GLN 348 338 ?   ?   ?   A . n 
A 1 349 GLU 349 339 ?   ?   ?   A . n 
A 1 350 ALA 350 340 ?   ?   ?   A . n 
A 1 351 ALA 351 341 ?   ?   ?   A . n 
A 1 352 ARG 352 342 ?   ?   ?   A . n 
A 1 353 ARG 353 343 ?   ?   ?   A . n 
A 1 354 ARG 354 344 ?   ?   ?   A . n 
A 1 355 GLN 355 345 ?   ?   ?   A . n 
A 1 356 GLN 356 346 ?   ?   ?   A . n 
A 1 357 ARG 357 347 ?   ?   ?   A . n 
A 1 358 GLU 358 348 ?   ?   ?   A . n 
A 1 359 SER 359 349 ?   ?   ?   A . n 
A 1 360 LYS 360 350 ?   ?   ?   A . n 
A 1 361 SER 361 351 ?   ?   ?   A . n 
A 1 362 ASN 362 352 ?   ?   ?   A . n 
A 1 363 ALA 363 353 ?   ?   ?   A . n 
A 1 364 ALA 364 354 ?   ?   ?   A . n 
A 1 365 THR 365 355 ?   ?   ?   A . n 
A 1 366 PRO 366 356 ?   ?   ?   A . n 
A 1 367 THR 367 357 ?   ?   ?   A . n 
A 1 368 LYS 368 358 ?   ?   ?   A . n 
A 1 369 GLY 369 359 ?   ?   ?   A . n 
A 1 370 PRO 370 360 ?   ?   ?   A . n 
A 1 371 GLU 371 361 ?   ?   ?   A . n 
A 1 372 GLY 372 362 ?   ?   ?   A . n 
A 1 373 LYS 373 363 ?   ?   ?   A . n 
A 1 374 VAL 374 364 ?   ?   ?   A . n 
A 1 375 ALA 375 365 ?   ?   ?   A . n 
A 1 376 GLY 376 366 ?   ?   ?   A . n 
A 1 377 PRO 377 367 ?   ?   ?   A . n 
A 1 378 ALA 378 368 ?   ?   ?   A . n 
A 1 379 ASP 379 369 ?   ?   ?   A . n 
A 1 380 ALA 380 370 ?   ?   ?   A . n 
A 1 381 PRO 381 371 ?   ?   ?   A . n 
A 1 382 MET 382 372 ?   ?   ?   A . n 
A 1 383 ASP 383 373 ?   ?   ?   A . n 
A 1 384 SER 384 374 ?   ?   ?   A . n 
A 1 385 GLY 385 375 ?   ?   ?   A . n 
A 1 386 ALA 386 376 ?   ?   ?   A . n 
A 1 387 GLU 387 377 ?   ?   ?   A . n 
A 1 388 GLU 388 378 ?   ?   ?   A . n 
A 1 389 GLU 389 379 ?   ?   ?   A . n 
A 1 390 LYS 390 380 ?   ?   ?   A . n 
A 1 391 ALA 391 381 ?   ?   ?   A . n 
A 1 392 GLY 392 382 ?   ?   ?   A . n 
A 1 393 ALA 393 383 ?   ?   ?   A . n 
A 1 394 ALA 394 384 ?   ?   ?   A . n 
A 1 395 THR 395 385 ?   ?   ?   A . n 
A 1 396 VAL 396 386 ?   ?   ?   A . n 
A 1 397 LYS 397 387 ?   ?   ?   A . n 
A 1 398 LYS 398 388 ?   ?   ?   A . n 
A 1 399 PRO 399 389 ?   ?   ?   A . n 
A 1 400 SER 400 390 ?   ?   ?   A . n 
A 1 401 PRO 401 391 ?   ?   ?   A . n 
A 1 402 SER 402 392 ?   ?   ?   A . n 
A 1 403 LYS 403 393 ?   ?   ?   A . n 
A 1 404 ALA 404 394 ?   ?   ?   A . n 
A 1 405 ARG 405 395 ?   ?   ?   A . n 
A 1 406 LYS 406 396 ?   ?   ?   A . n 
A 1 407 LYS 407 397 ?   ?   ?   A . n 
A 1 408 LYS 408 398 ?   ?   ?   A . n 
A 1 409 LEU 409 399 ?   ?   ?   A . n 
A 1 410 ASN 410 400 ?   ?   ?   A . n 
A 1 411 LYS 411 401 ?   ?   ?   A . n 
A 1 412 LYS 412 402 ?   ?   ?   A . n 
A 1 413 GLY 413 403 ?   ?   ?   A . n 
A 1 414 ARG 414 404 ?   ?   ?   A . n 
A 1 415 LYS 415 405 ?   ?   ?   A . n 
A 1 416 MET 416 406 ?   ?   ?   A . n 
A 1 417 ALA 417 407 ?   ?   ?   A . n 
A 1 418 GLY 418 408 ?   ?   ?   A . n 
A 1 419 ARG 419 409 ?   ?   ?   A . n 
A 1 420 LYS 420 410 ?   ?   ?   A . n 
A 1 421 ARG 421 411 ?   ?   ?   A . n 
A 1 422 GLY 422 412 ?   ?   ?   A . n 
A 1 423 ARG 423 413 ?   ?   ?   A . n 
A 1 424 PRO 424 414 ?   ?   ?   A . n 
A 1 425 LYS 425 415 ?   ?   ?   A . n 
A 1 426 LYS 426 416 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-05-25 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-08-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 62  ? ? -68.42 94.14 
2 1 ASN A 99  ? ? 36.77  45.21 
3 1 ASN A 276 ? ? -98.20 36.24 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 4   ? CG  ? A LYS 14  CG  
2  1 Y 1 A LYS 4   ? CD  ? A LYS 14  CD  
3  1 Y 1 A LYS 4   ? CE  ? A LYS 14  CE  
4  1 Y 1 A LYS 4   ? NZ  ? A LYS 14  NZ  
5  1 Y 1 A ASN 57  ? CG  ? A ASN 67  CG  
6  1 Y 1 A ASN 57  ? OD1 ? A ASN 67  OD1 
7  1 Y 1 A ASN 57  ? ND2 ? A ASN 67  ND2 
8  1 Y 1 A TYR 58  ? CG  ? A TYR 68  CG  
9  1 Y 1 A TYR 58  ? CD1 ? A TYR 68  CD1 
10 1 Y 1 A TYR 58  ? CD2 ? A TYR 68  CD2 
11 1 Y 1 A TYR 58  ? CE1 ? A TYR 68  CE1 
12 1 Y 1 A TYR 58  ? CE2 ? A TYR 68  CE2 
13 1 Y 1 A TYR 58  ? CZ  ? A TYR 68  CZ  
14 1 Y 1 A TYR 58  ? OH  ? A TYR 68  OH  
15 1 Y 1 A LEU 60  ? CG  ? A LEU 70  CG  
16 1 Y 1 A LEU 60  ? CD1 ? A LEU 70  CD1 
17 1 Y 1 A LEU 60  ? CD2 ? A LEU 70  CD2 
18 1 Y 1 A ILE 61  ? CG1 ? A ILE 71  CG1 
19 1 Y 1 A ILE 61  ? CG2 ? A ILE 71  CG2 
20 1 Y 1 A ILE 61  ? CD1 ? A ILE 71  CD1 
21 1 Y 1 A ASP 62  ? CG  ? A ASP 72  CG  
22 1 Y 1 A ASP 62  ? OD1 ? A ASP 72  OD1 
23 1 Y 1 A ASP 62  ? OD2 ? A ASP 72  OD2 
24 1 Y 1 A TYR 63  ? CG  ? A TYR 73  CG  
25 1 Y 1 A TYR 63  ? CD1 ? A TYR 73  CD1 
26 1 Y 1 A TYR 63  ? CD2 ? A TYR 73  CD2 
27 1 Y 1 A TYR 63  ? CE1 ? A TYR 73  CE1 
28 1 Y 1 A TYR 63  ? CE2 ? A TYR 73  CE2 
29 1 Y 1 A TYR 63  ? CZ  ? A TYR 73  CZ  
30 1 Y 1 A TYR 63  ? OH  ? A TYR 73  OH  
31 1 Y 1 A LYS 300 ? CG  ? A LYS 310 CG  
32 1 Y 1 A LYS 300 ? CD  ? A LYS 310 CD  
33 1 Y 1 A LYS 300 ? CE  ? A LYS 310 CE  
34 1 Y 1 A LYS 300 ? NZ  ? A LYS 310 NZ  
35 1 Y 1 A LYS 308 ? CG  ? A LYS 318 CG  
36 1 Y 1 A LYS 308 ? CD  ? A LYS 318 CD  
37 1 Y 1 A LYS 308 ? CE  ? A LYS 318 CE  
38 1 Y 1 A LYS 308 ? NZ  ? A LYS 318 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -9  ? A MET 1   
2   1 Y 1 A HIS -8  ? A HIS 2   
3   1 Y 1 A HIS -7  ? A HIS 3   
4   1 Y 1 A HIS -6  ? A HIS 4   
5   1 Y 1 A HIS -5  ? A HIS 5   
6   1 Y 1 A HIS -4  ? A HIS 6   
7   1 Y 1 A HIS -3  ? A HIS 7   
8   1 Y 1 A SER -2  ? A SER 8   
9   1 Y 1 A SER -1  ? A SER 9   
10  1 Y 1 A GLY 0   ? A GLY 10  
11  1 Y 1 A MET 1   ? A MET 11  
12  1 Y 1 A GLY 2   ? A GLY 12  
13  1 Y 1 A GLU 3   ? A GLU 13  
14  1 Y 1 A VAL 59  ? A VAL 69  
15  1 Y 1 A GLY 301 ? A GLY 311 
16  1 Y 1 A SER 302 ? A SER 312 
17  1 Y 1 A VAL 303 ? A VAL 313 
18  1 Y 1 A SER 304 ? A SER 314 
19  1 Y 1 A ASN 331 ? A ASN 341 
20  1 Y 1 A PRO 332 ? A PRO 342 
21  1 Y 1 A LYS 333 ? A LYS 343 
22  1 Y 1 A LEU 334 ? A LEU 344 
23  1 Y 1 A ARG 335 ? A ARG 345 
24  1 Y 1 A GLU 336 ? A GLU 346 
25  1 Y 1 A GLU 337 ? A GLU 347 
26  1 Y 1 A GLN 338 ? A GLN 348 
27  1 Y 1 A GLU 339 ? A GLU 349 
28  1 Y 1 A ALA 340 ? A ALA 350 
29  1 Y 1 A ALA 341 ? A ALA 351 
30  1 Y 1 A ARG 342 ? A ARG 352 
31  1 Y 1 A ARG 343 ? A ARG 353 
32  1 Y 1 A ARG 344 ? A ARG 354 
33  1 Y 1 A GLN 345 ? A GLN 355 
34  1 Y 1 A GLN 346 ? A GLN 356 
35  1 Y 1 A ARG 347 ? A ARG 357 
36  1 Y 1 A GLU 348 ? A GLU 358 
37  1 Y 1 A SER 349 ? A SER 359 
38  1 Y 1 A LYS 350 ? A LYS 360 
39  1 Y 1 A SER 351 ? A SER 361 
40  1 Y 1 A ASN 352 ? A ASN 362 
41  1 Y 1 A ALA 353 ? A ALA 363 
42  1 Y 1 A ALA 354 ? A ALA 364 
43  1 Y 1 A THR 355 ? A THR 365 
44  1 Y 1 A PRO 356 ? A PRO 366 
45  1 Y 1 A THR 357 ? A THR 367 
46  1 Y 1 A LYS 358 ? A LYS 368 
47  1 Y 1 A GLY 359 ? A GLY 369 
48  1 Y 1 A PRO 360 ? A PRO 370 
49  1 Y 1 A GLU 361 ? A GLU 371 
50  1 Y 1 A GLY 362 ? A GLY 372 
51  1 Y 1 A LYS 363 ? A LYS 373 
52  1 Y 1 A VAL 364 ? A VAL 374 
53  1 Y 1 A ALA 365 ? A ALA 375 
54  1 Y 1 A GLY 366 ? A GLY 376 
55  1 Y 1 A PRO 367 ? A PRO 377 
56  1 Y 1 A ALA 368 ? A ALA 378 
57  1 Y 1 A ASP 369 ? A ASP 379 
58  1 Y 1 A ALA 370 ? A ALA 380 
59  1 Y 1 A PRO 371 ? A PRO 381 
60  1 Y 1 A MET 372 ? A MET 382 
61  1 Y 1 A ASP 373 ? A ASP 383 
62  1 Y 1 A SER 374 ? A SER 384 
63  1 Y 1 A GLY 375 ? A GLY 385 
64  1 Y 1 A ALA 376 ? A ALA 386 
65  1 Y 1 A GLU 377 ? A GLU 387 
66  1 Y 1 A GLU 378 ? A GLU 388 
67  1 Y 1 A GLU 379 ? A GLU 389 
68  1 Y 1 A LYS 380 ? A LYS 390 
69  1 Y 1 A ALA 381 ? A ALA 391 
70  1 Y 1 A GLY 382 ? A GLY 392 
71  1 Y 1 A ALA 383 ? A ALA 393 
72  1 Y 1 A ALA 384 ? A ALA 394 
73  1 Y 1 A THR 385 ? A THR 395 
74  1 Y 1 A VAL 386 ? A VAL 396 
75  1 Y 1 A LYS 387 ? A LYS 397 
76  1 Y 1 A LYS 388 ? A LYS 398 
77  1 Y 1 A PRO 389 ? A PRO 399 
78  1 Y 1 A SER 390 ? A SER 400 
79  1 Y 1 A PRO 391 ? A PRO 401 
80  1 Y 1 A SER 392 ? A SER 402 
81  1 Y 1 A LYS 393 ? A LYS 403 
82  1 Y 1 A ALA 394 ? A ALA 404 
83  1 Y 1 A ARG 395 ? A ARG 405 
84  1 Y 1 A LYS 396 ? A LYS 406 
85  1 Y 1 A LYS 397 ? A LYS 407 
86  1 Y 1 A LYS 398 ? A LYS 408 
87  1 Y 1 A LEU 399 ? A LEU 409 
88  1 Y 1 A ASN 400 ? A ASN 410 
89  1 Y 1 A LYS 401 ? A LYS 411 
90  1 Y 1 A LYS 402 ? A LYS 412 
91  1 Y 1 A GLY 403 ? A GLY 413 
92  1 Y 1 A ARG 404 ? A ARG 414 
93  1 Y 1 A LYS 405 ? A LYS 415 
94  1 Y 1 A MET 406 ? A MET 416 
95  1 Y 1 A ALA 407 ? A ALA 417 
96  1 Y 1 A GLY 408 ? A GLY 418 
97  1 Y 1 A ARG 409 ? A ARG 419 
98  1 Y 1 A LYS 410 ? A LYS 420 
99  1 Y 1 A ARG 411 ? A ARG 421 
100 1 Y 1 A GLY 412 ? A GLY 422 
101 1 Y 1 A ARG 413 ? A ARG 423 
102 1 Y 1 A PRO 414 ? A PRO 424 
103 1 Y 1 A LYS 415 ? A LYS 425 
104 1 Y 1 A LYS 416 ? A LYS 426 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 S-ADENOSYLMETHIONINE SAM 
3 'SULFATE ION'        SO4 
4 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SAM 1   417 1   SAM SAM A . 
C 3 SO4 1   418 1   SO4 SO4 A . 
D 3 SO4 1   419 2   SO4 SO4 A . 
E 4 HOH 1   420 1   HOH HOH A . 
E 4 HOH 2   421 2   HOH HOH A . 
E 4 HOH 3   422 3   HOH HOH A . 
E 4 HOH 4   423 4   HOH HOH A . 
E 4 HOH 5   424 5   HOH HOH A . 
E 4 HOH 6   425 6   HOH HOH A . 
E 4 HOH 7   426 7   HOH HOH A . 
E 4 HOH 8   427 8   HOH HOH A . 
E 4 HOH 9   428 9   HOH HOH A . 
E 4 HOH 10  429 10  HOH HOH A . 
E 4 HOH 11  430 11  HOH HOH A . 
E 4 HOH 12  431 12  HOH HOH A . 
E 4 HOH 13  432 13  HOH HOH A . 
E 4 HOH 14  433 14  HOH HOH A . 
E 4 HOH 15  434 15  HOH HOH A . 
E 4 HOH 16  435 16  HOH HOH A . 
E 4 HOH 17  436 17  HOH HOH A . 
E 4 HOH 18  437 18  HOH HOH A . 
E 4 HOH 19  438 19  HOH HOH A . 
E 4 HOH 20  439 20  HOH HOH A . 
E 4 HOH 21  440 21  HOH HOH A . 
E 4 HOH 22  441 22  HOH HOH A . 
E 4 HOH 23  442 23  HOH HOH A . 
E 4 HOH 24  443 24  HOH HOH A . 
E 4 HOH 25  444 25  HOH HOH A . 
E 4 HOH 26  445 26  HOH HOH A . 
E 4 HOH 27  446 27  HOH HOH A . 
E 4 HOH 28  447 28  HOH HOH A . 
E 4 HOH 29  448 29  HOH HOH A . 
E 4 HOH 30  449 30  HOH HOH A . 
E 4 HOH 31  450 31  HOH HOH A . 
E 4 HOH 32  451 32  HOH HOH A . 
E 4 HOH 33  452 33  HOH HOH A . 
E 4 HOH 34  453 34  HOH HOH A . 
E 4 HOH 35  454 35  HOH HOH A . 
E 4 HOH 36  455 36  HOH HOH A . 
E 4 HOH 37  456 37  HOH HOH A . 
E 4 HOH 38  457 38  HOH HOH A . 
E 4 HOH 39  458 39  HOH HOH A . 
E 4 HOH 40  459 40  HOH HOH A . 
E 4 HOH 41  460 41  HOH HOH A . 
E 4 HOH 42  461 42  HOH HOH A . 
E 4 HOH 43  462 43  HOH HOH A . 
E 4 HOH 44  463 44  HOH HOH A . 
E 4 HOH 45  464 45  HOH HOH A . 
E 4 HOH 46  465 46  HOH HOH A . 
E 4 HOH 47  466 47  HOH HOH A . 
E 4 HOH 48  467 48  HOH HOH A . 
E 4 HOH 49  468 49  HOH HOH A . 
E 4 HOH 50  469 50  HOH HOH A . 
E 4 HOH 51  470 51  HOH HOH A . 
E 4 HOH 52  471 52  HOH HOH A . 
E 4 HOH 53  472 53  HOH HOH A . 
E 4 HOH 54  473 54  HOH HOH A . 
E 4 HOH 55  474 55  HOH HOH A . 
E 4 HOH 56  475 56  HOH HOH A . 
E 4 HOH 57  476 57  HOH HOH A . 
E 4 HOH 58  477 58  HOH HOH A . 
E 4 HOH 59  478 59  HOH HOH A . 
E 4 HOH 60  479 60  HOH HOH A . 
E 4 HOH 61  480 61  HOH HOH A . 
E 4 HOH 62  481 62  HOH HOH A . 
E 4 HOH 63  482 63  HOH HOH A . 
E 4 HOH 64  483 64  HOH HOH A . 
E 4 HOH 65  484 65  HOH HOH A . 
E 4 HOH 66  485 66  HOH HOH A . 
E 4 HOH 67  486 67  HOH HOH A . 
E 4 HOH 68  487 68  HOH HOH A . 
E 4 HOH 69  488 69  HOH HOH A . 
E 4 HOH 70  489 70  HOH HOH A . 
E 4 HOH 71  490 71  HOH HOH A . 
E 4 HOH 72  491 72  HOH HOH A . 
E 4 HOH 73  492 73  HOH HOH A . 
E 4 HOH 74  493 74  HOH HOH A . 
E 4 HOH 75  494 75  HOH HOH A . 
E 4 HOH 76  495 76  HOH HOH A . 
E 4 HOH 77  496 77  HOH HOH A . 
E 4 HOH 78  497 78  HOH HOH A . 
E 4 HOH 79  498 79  HOH HOH A . 
E 4 HOH 80  499 80  HOH HOH A . 
E 4 HOH 81  500 81  HOH HOH A . 
E 4 HOH 82  501 82  HOH HOH A . 
E 4 HOH 83  502 83  HOH HOH A . 
E 4 HOH 84  503 84  HOH HOH A . 
E 4 HOH 85  504 85  HOH HOH A . 
E 4 HOH 86  505 86  HOH HOH A . 
E 4 HOH 87  506 87  HOH HOH A . 
E 4 HOH 88  507 88  HOH HOH A . 
E 4 HOH 89  508 89  HOH HOH A . 
E 4 HOH 90  509 90  HOH HOH A . 
E 4 HOH 91  510 91  HOH HOH A . 
E 4 HOH 92  511 92  HOH HOH A . 
E 4 HOH 93  512 93  HOH HOH A . 
E 4 HOH 94  513 94  HOH HOH A . 
E 4 HOH 95  514 95  HOH HOH A . 
E 4 HOH 96  515 96  HOH HOH A . 
E 4 HOH 97  516 97  HOH HOH A . 
E 4 HOH 98  517 98  HOH HOH A . 
E 4 HOH 99  518 99  HOH HOH A . 
E 4 HOH 100 519 100 HOH HOH A . 
E 4 HOH 101 520 101 HOH HOH A . 
E 4 HOH 102 521 102 HOH HOH A . 
E 4 HOH 103 522 103 HOH HOH A . 
E 4 HOH 104 523 104 HOH HOH A . 
E 4 HOH 105 524 105 HOH HOH A . 
E 4 HOH 106 525 106 HOH HOH A . 
E 4 HOH 107 526 107 HOH HOH A . 
E 4 HOH 108 527 108 HOH HOH A . 
E 4 HOH 109 528 109 HOH HOH A . 
E 4 HOH 110 529 110 HOH HOH A . 
E 4 HOH 111 530 111 HOH HOH A . 
E 4 HOH 112 531 112 HOH HOH A . 
E 4 HOH 113 532 113 HOH HOH A . 
E 4 HOH 114 533 114 HOH HOH A . 
E 4 HOH 115 534 115 HOH HOH A . 
E 4 HOH 116 535 116 HOH HOH A . 
E 4 HOH 117 536 117 HOH HOH A . 
E 4 HOH 118 537 118 HOH HOH A . 
E 4 HOH 119 538 119 HOH HOH A . 
E 4 HOH 120 539 120 HOH HOH A . 
E 4 HOH 121 540 121 HOH HOH A . 
E 4 HOH 122 541 122 HOH HOH A . 
E 4 HOH 123 542 123 HOH HOH A . 
E 4 HOH 124 543 124 HOH HOH A . 
E 4 HOH 125 544 125 HOH HOH A . 
E 4 HOH 126 545 126 HOH HOH A . 
E 4 HOH 127 546 127 HOH HOH A . 
E 4 HOH 128 547 128 HOH HOH A . 
E 4 HOH 129 548 129 HOH HOH A . 
E 4 HOH 130 549 130 HOH HOH A . 
E 4 HOH 131 550 131 HOH HOH A . 
E 4 HOH 132 551 132 HOH HOH A . 
E 4 HOH 133 552 133 HOH HOH A . 
E 4 HOH 134 553 134 HOH HOH A . 
E 4 HOH 135 554 135 HOH HOH A . 
E 4 HOH 136 555 136 HOH HOH A . 
E 4 HOH 137 556 137 HOH HOH A . 
E 4 HOH 138 557 138 HOH HOH A . 
E 4 HOH 139 558 139 HOH HOH A . 
E 4 HOH 140 559 140 HOH HOH A . 
E 4 HOH 141 560 141 HOH HOH A . 
E 4 HOH 142 561 142 HOH HOH A . 
E 4 HOH 143 562 143 HOH HOH A . 
E 4 HOH 144 563 144 HOH HOH A . 
#