data_3QTE
# 
_entry.id   3QTE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QTE         
RCSB  RCSB064079   
WWPDB D_1000064079 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ZMQ 'Crystal structure of human alpha-defensin 6' unspecified 
PDB 1ZMP 'Crystal structure of human alpha-defensin 5' unspecified 
# 
_pdbx_database_status.entry_id                        3QTE 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pazgier, M.' 1 
'Lu, W.'      2 
# 
_citation.id                        primary 
_citation.title                     
'Human alpha-defensin 6 promotes mucosal innate immunity through self-assembled peptide nanonets.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            337 
_citation.page_first                477 
_citation.page_last                 481 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22722251 
_citation.pdbx_database_id_DOI      10.1126/science.1218831 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chu, H.'         1  
primary 'Pazgier, M.'     2  
primary 'Jung, G.'        3  
primary 'Nuccio, S.P.'    4  
primary 'Castillo, P.A.'  5  
primary 'de Jong, M.F.'   6  
primary 'Winter, M.G.'    7  
primary 'Winter, S.E.'    8  
primary 'Wehkamp, J.'     9  
primary 'Shen, B.'        10 
primary 'Salzman, N.H.'   11 
primary 'Underwood, M.A.' 12 
primary 'Tsolis, R.M.'    13 
primary 'Young, G.M.'     14 
primary 'Lu, W.'          15 
primary 'Lehrer, R.I.'    16 
primary 'Baumler, A.J.'   17 
primary 'Bevins, C.L.'    18 
# 
_cell.entry_id           3QTE 
_cell.length_a           33.774 
_cell.length_b           32.675 
_cell.length_c           54.005 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.35 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QTE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn Defensin-6     3767.367 4  ? H95W 'Processed peptide (UNP Residues 69-100)' ? 
2 non-polymer syn 'CHLORIDE ION' 35.453   2  ? ?    ?                                         ? 
3 non-polymer syn GLYCEROL       92.094   1  ? ?    ?                                         ? 
4 water       nat water          18.015   39 ? ?    ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Defensin, alpha 6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL 
_entity_poly.pdbx_seq_one_letter_code_can   AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL 
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  PHE n 
1 3  THR n 
1 4  CYS n 
1 5  HIS n 
1 6  CYS n 
1 7  ARG n 
1 8  ARG n 
1 9  SER n 
1 10 CYS n 
1 11 TYR n 
1 12 SER n 
1 13 THR n 
1 14 GLU n 
1 15 TYR n 
1 16 SER n 
1 17 TYR n 
1 18 GLY n 
1 19 THR n 
1 20 CYS n 
1 21 THR n 
1 22 VAL n 
1 23 MET n 
1 24 GLY n 
1 25 ILE n 
1 26 ASN n 
1 27 TRP n 
1 28 ARG n 
1 29 PHE n 
1 30 CYS n 
1 31 CYS n 
1 32 LEU n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DEF6_HUMAN 
_struct_ref.pdbx_db_accession          Q01524 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL 
_struct_ref.pdbx_align_begin           69 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QTE A 1 ? 32 ? Q01524 69 ? 100 ? 1 32 
2 1 3QTE B 1 ? 32 ? Q01524 69 ? 100 ? 1 32 
3 1 3QTE C 1 ? 32 ? Q01524 69 ? 100 ? 1 32 
4 1 3QTE D 1 ? 32 ? Q01524 69 ? 100 ? 1 32 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QTE TRP A 27 ? UNP Q01524 HIS 95 'ENGINEERED MUTATION' 27 1 
2 3QTE TRP B 27 ? UNP Q01524 HIS 95 'ENGINEERED MUTATION' 27 2 
3 3QTE TRP C 27 ? UNP Q01524 HIS 95 'ENGINEERED MUTATION' 27 3 
4 3QTE TRP D 27 ? UNP Q01524 HIS 95 'ENGINEERED MUTATION' 27 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
CL  non-polymer         . 'CHLORIDE ION'  ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3QTE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.88 
_exptl_crystal.density_percent_sol   34.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M imidazole, pH 6.5, 1M Na acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2009-04-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     3QTE 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.949 
_reflns.number_obs                   8258 
_reflns.number_all                   8330 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.105 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.949 
_reflns_shell.d_res_low              1.98 
_reflns_shell.percent_possible_all   92 
_reflns_shell.Rmerge_I_obs           0.579 
_reflns_shell.pdbx_Rsym_value        0.504 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3QTE 
_refine.ls_number_reflns_obs                     7856 
_refine.ls_number_reflns_all                     8330 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.949 
_refine.ls_percent_reflns_obs                    98.68 
_refine.ls_R_factor_obs                          0.19487 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19243 
_refine.ls_R_factor_R_free                       0.24665 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  384 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.000 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               37.237 
_refine.aniso_B[1][1]                            5.85 
_refine.aniso_B[2][2]                            -14.83 
_refine.aniso_B[3][3]                            8.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            33.81 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZMQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.045 
_refine.pdbx_overall_ESU_R_Free                  0.039 
_refine.overall_SU_ML                            0.101 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.611 
_refine.overall_SU_R_Cruickshank_DPI             0.0449 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1036 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               1083 
_refine_hist.d_res_high                       1.949 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.021  ? 1081 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.816  1.902  ? 1465 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.923  5.000  ? 124  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       25.097 19.167 ? 48   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.871 15.000 ? 160  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.844 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.121  0.200  ? 148  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 820  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.998  1.500  ? 632  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.839  2.000  ? 1016 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.838  3.000  ? 449  'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.352  4.500  ? 449  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.949 
_refine_ls_shell.d_res_low                        2.000 
_refine_ls_shell.number_reflns_R_work             494 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               85.60 
_refine_ls_shell.R_factor_R_free                  0.358 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             23 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3QTE 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3QTE 
_struct.title                     'Crystal structure of human alpha-defensin 6 (H27W mutant)' 
_struct.pdbx_descriptor           Defensin-6 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QTE 
_struct_keywords.pdbx_keywords   'ANTIMICROBIAL PROTEIN' 
_struct_keywords.text            'antimicrobial protein, Paneth cells defensin, HD6, human alpha defensin' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4  SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 4  A CYS 31 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2  disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 6  A CYS 20 1_555 ? ? ? ? ? ? ? 2.070 ? 
disulf3  disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 10 A CYS 30 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4  disulf ? ? B CYS 4  SG ? ? ? 1_555 B CYS 31 SG ? ? B CYS 4  B CYS 31 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5  disulf ? ? B CYS 6  SG ? ? ? 1_555 B CYS 20 SG ? ? B CYS 6  B CYS 20 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf6  disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 30 SG ? ? B CYS 10 B CYS 30 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf7  disulf ? ? C CYS 4  SG ? ? ? 1_555 C CYS 31 SG ? ? C CYS 4  C CYS 31 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf8  disulf ? ? C CYS 6  SG ? ? ? 1_555 C CYS 20 SG ? ? C CYS 6  C CYS 20 1_555 ? ? ? ? ? ? ? 2.000 ? 
disulf9  disulf ? ? C CYS 10 SG ? ? ? 1_555 C CYS 30 SG ? ? C CYS 10 C CYS 30 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf10 disulf ? ? D CYS 4  SG ? ? ? 1_555 D CYS 31 SG ? ? D CYS 4  D CYS 31 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf11 disulf ? ? D CYS 6  SG ? ? ? 1_555 D CYS 20 SG ? ? D CYS 6  D CYS 20 1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf12 disulf ? ? D CYS 10 SG ? ? ? 1_555 D CYS 30 SG ? ? D CYS 10 D CYS 30 1_555 ? ? ? ? ? ? ? 2.009 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 3  ? ARG A 7  ? THR A 3  ARG A 7  
A 2 ILE A 25 ? LEU A 32 ? ILE A 25 LEU A 32 
A 3 TYR A 15 ? VAL A 22 ? TYR A 15 VAL A 22 
A 4 TYR B 15 ? VAL B 22 ? TYR B 15 VAL B 22 
A 5 ILE B 25 ? ARG B 7  ? ILE B 25 ARG B 7  
A 6 PHE B 2  ? ARG B 7  ? PHE B 2  ARG B 7  
B 1 THR A 3  ? ARG A 7  ? THR A 3  ARG A 7  
B 2 ILE A 25 ? LEU A 32 ? ILE A 25 LEU A 32 
B 3 TYR A 15 ? VAL A 22 ? TYR A 15 VAL A 22 
B 4 TYR B 15 ? VAL B 22 ? TYR B 15 VAL B 22 
B 5 ILE B 25 ? ARG B 7  ? ILE B 25 ARG B 7  
B 6 ILE C 25 ? LEU C 32 ? ILE C 25 LEU C 32 
B 7 TYR C 15 ? VAL C 22 ? TYR C 15 VAL C 22 
C 1 THR D 3  ? ARG D 7  ? THR D 3  ARG D 7  
C 2 ILE D 25 ? LEU D 32 ? ILE D 25 LEU D 32 
C 3 TYR D 15 ? VAL D 22 ? TYR D 15 VAL D 22 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 7  ? N ARG A 7  O ARG A 28 ? O ARG A 28 
A 2 3 O PHE A 29 ? O PHE A 29 N TYR A 17 ? N TYR A 17 
A 3 4 N THR A 21 ? N THR A 21 O THR B 21 ? O THR B 21 
A 4 5 N CYS B 20 ? N CYS B 20 O TRP B 27 ? O TRP B 27 
A 5 6 O ARG B 28 ? O ARG B 28 N ARG B 7  ? N ARG B 7  
B 1 2 N ARG A 7  ? N ARG A 7  O ARG A 28 ? O ARG A 28 
B 2 3 O PHE A 29 ? O PHE A 29 N TYR A 17 ? N TYR A 17 
B 3 4 N THR A 21 ? N THR A 21 O THR B 21 ? O THR B 21 
B 4 5 N CYS B 20 ? N CYS B 20 O TRP B 27 ? O TRP B 27 
B 5 6 N HIS C 5  ? N HIS C 5  O CYS C 30 ? O CYS C 30 
B 6 7 O PHE C 29 ? O PHE C 29 N GLY C 18 ? N GLY C 18 
C 1 2 N ARG D 7  ? N ARG D 7  O ARG D 28 ? O ARG D 28 
C 2 3 O PHE D 29 ? O PHE D 29 N TYR D 17 ? N TYR D 17 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 33'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL C 33' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 HOH J .  ? HOH C 41 . ? 1_645 ? 
2 AC2 4 SER A 12 ? SER A 12 . ? 1_565 ? 
3 AC2 4 TYR B 17 ? TYR B 17 . ? 1_555 ? 
4 AC2 4 GLY C 18 ? GLY C 18 . ? 1_555 ? 
5 AC2 4 THR C 19 ? THR C 19 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3QTE 
_atom_sites.fract_transf_matrix[1][1]   0.029609 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009821 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.030604 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019509 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1  ? -6.550  -15.523 -17.345 1.00 44.26 ? 1  ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1  ? -7.096  -14.173 -17.161 1.00 42.11 ? 1  ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1  ? -7.527  -14.096 -15.697 1.00 41.14 ? 1  ALA A C   1 
ATOM   4    O  O   . ALA A 1 1  ? -7.835  -15.138 -15.117 1.00 42.66 ? 1  ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1  ? -8.297  -13.988 -18.092 1.00 42.71 ? 1  ALA A CB  1 
ATOM   6    N  N   . PHE A 1 2  ? -7.498  -12.905 -15.092 1.00 37.19 ? 2  PHE A N   1 
ATOM   7    C  CA  . PHE A 1 2  ? -8.235  -12.633 -13.873 1.00 35.48 ? 2  PHE A CA  1 
ATOM   8    C  C   . PHE A 1 2  ? -9.542  -12.075 -14.356 1.00 34.01 ? 2  PHE A C   1 
ATOM   9    O  O   . PHE A 1 2  ? -9.563  -11.324 -15.341 1.00 33.54 ? 2  PHE A O   1 
ATOM   10   C  CB  . PHE A 1 2  ? -7.581  -11.516 -13.024 1.00 33.88 ? 2  PHE A CB  1 
ATOM   11   C  CG  . PHE A 1 2  ? -6.358  -11.938 -12.319 1.00 35.85 ? 2  PHE A CG  1 
ATOM   12   C  CD1 . PHE A 1 2  ? -5.112  -11.773 -12.929 1.00 41.60 ? 2  PHE A CD1 1 
ATOM   13   C  CD2 . PHE A 1 2  ? -6.430  -12.534 -11.058 1.00 39.64 ? 2  PHE A CD2 1 
ATOM   14   C  CE1 . PHE A 1 2  ? -3.928  -12.185 -12.290 1.00 42.59 ? 2  PHE A CE1 1 
ATOM   15   C  CE2 . PHE A 1 2  ? -5.273  -12.948 -10.395 1.00 42.57 ? 2  PHE A CE2 1 
ATOM   16   C  CZ  . PHE A 1 2  ? -4.004  -12.777 -11.009 1.00 41.91 ? 2  PHE A CZ  1 
ATOM   17   N  N   . THR A 1 3  ? -10.616 -12.419 -13.663 1.00 32.95 ? 3  THR A N   1 
ATOM   18   C  CA  . THR A 1 3  ? -11.903 -11.787 -13.876 1.00 33.04 ? 3  THR A CA  1 
ATOM   19   C  C   . THR A 1 3  ? -12.246 -11.036 -12.611 1.00 32.28 ? 3  THR A C   1 
ATOM   20   O  O   . THR A 1 3  ? -12.247 -11.632 -11.541 1.00 32.64 ? 3  THR A O   1 
ATOM   21   C  CB  . THR A 1 3  ? -12.966 -12.864 -14.216 1.00 34.67 ? 3  THR A CB  1 
ATOM   22   O  OG1 . THR A 1 3  ? -12.478 -13.634 -15.334 1.00 37.02 ? 3  THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 3  ? -14.260 -12.196 -14.609 1.00 34.42 ? 3  THR A CG2 1 
ATOM   24   N  N   . CYS A 1 4  ? -12.459 -9.725  -12.713 1.00 32.48 ? 4  CYS A N   1 
ATOM   25   C  CA  . CYS A 1 4  ? -12.644 -8.865  -11.525 1.00 31.35 ? 4  CYS A CA  1 
ATOM   26   C  C   . CYS A 1 4  ? -13.931 -8.045  -11.545 1.00 31.89 ? 4  CYS A C   1 
ATOM   27   O  O   . CYS A 1 4  ? -14.400 -7.614  -12.616 1.00 32.64 ? 4  CYS A O   1 
ATOM   28   C  CB  . CYS A 1 4  ? -11.434 -7.940  -11.337 1.00 30.04 ? 4  CYS A CB  1 
ATOM   29   S  SG  . CYS A 1 4  ? -9.817  -8.773  -11.418 1.00 28.79 ? 4  CYS A SG  1 
ATOM   30   N  N   . HIS A 1 5  ? -14.559 -7.903  -10.375 1.00 30.56 ? 5  HIS A N   1 
ATOM   31   C  CA  . HIS A 1 5  ? -15.720 -7.042  -10.228 1.00 30.11 ? 5  HIS A CA  1 
ATOM   32   C  C   . HIS A 1 5  ? -15.483 -6.157  -9.033  1.00 29.71 ? 5  HIS A C   1 
ATOM   33   O  O   . HIS A 1 5  ? -14.827 -6.584  -8.064  1.00 30.02 ? 5  HIS A O   1 
ATOM   34   C  CB  . HIS A 1 5  ? -17.011 -7.865  -9.971  1.00 30.57 ? 5  HIS A CB  1 
ATOM   35   C  CG  . HIS A 1 5  ? -17.464 -8.648  -11.158 1.00 33.15 ? 5  HIS A CG  1 
ATOM   36   N  ND1 . HIS A 1 5  ? -16.941 -9.888  -11.475 1.00 34.52 ? 5  HIS A ND1 1 
ATOM   37   C  CD2 . HIS A 1 5  ? -18.342 -8.341  -12.135 1.00 32.99 ? 5  HIS A CD2 1 
ATOM   38   C  CE1 . HIS A 1 5  ? -17.491 -10.316 -12.592 1.00 34.76 ? 5  HIS A CE1 1 
ATOM   39   N  NE2 . HIS A 1 5  ? -18.347 -9.398  -13.009 1.00 36.91 ? 5  HIS A NE2 1 
ATOM   40   N  N   . CYS A 1 6  ? -16.020 -4.937  -9.059  1.00 28.24 ? 6  CYS A N   1 
ATOM   41   C  CA  . CYS A 1 6  ? -16.099 -4.136  -7.855  1.00 27.26 ? 6  CYS A CA  1 
ATOM   42   C  C   . CYS A 1 6  ? -17.321 -4.557  -7.045  1.00 27.61 ? 6  CYS A C   1 
ATOM   43   O  O   . CYS A 1 6  ? -18.403 -4.483  -7.583  1.00 26.69 ? 6  CYS A O   1 
ATOM   44   C  CB  . CYS A 1 6  ? -16.260 -2.660  -8.237  1.00 27.74 ? 6  CYS A CB  1 
ATOM   45   S  SG  . CYS A 1 6  ? -14.825 -1.935  -9.109  1.00 28.14 ? 6  CYS A SG  1 
ATOM   46   N  N   . ARG A 1 7  ? -17.149 -5.006  -5.784  1.00 27.66 ? 7  ARG A N   1 
ATOM   47   C  CA  . ARG A 1 7  ? -18.274 -5.523  -4.970  1.00 29.20 ? 7  ARG A CA  1 
ATOM   48   C  C   . ARG A 1 7  ? -18.255 -4.953  -3.565  1.00 30.05 ? 7  ARG A C   1 
ATOM   49   O  O   . ARG A 1 7  ? -17.157 -4.581  -3.085  1.00 30.30 ? 7  ARG A O   1 
ATOM   50   C  CB  . ARG A 1 7  ? -18.176 -7.040  -4.842  1.00 28.76 ? 7  ARG A CB  1 
ATOM   51   C  CG  . ARG A 1 7  ? -18.006 -7.830  -6.135  1.00 28.94 ? 7  ARG A CG  1 
ATOM   52   C  CD  . ARG A 1 7  ? -18.397 -9.259  -5.895  1.00 28.20 ? 7  ARG A CD  1 
ATOM   53   N  NE  . ARG A 1 7  ? -18.048 -10.156 -6.990  1.00 28.73 ? 7  ARG A NE  1 
ATOM   54   C  CZ  . ARG A 1 7  ? -18.801 -10.329 -8.080  1.00 27.85 ? 7  ARG A CZ  1 
ATOM   55   N  NH1 . ARG A 1 7  ? -19.930 -9.615  -8.211  1.00 26.24 ? 7  ARG A NH1 1 
ATOM   56   N  NH2 . ARG A 1 7  ? -18.422 -11.193 -9.022  1.00 28.65 ? 7  ARG A NH2 1 
ATOM   57   N  N   . ARG A 1 8  ? -19.394 -4.966  -2.849  1.00 30.37 ? 8  ARG A N   1 
ATOM   58   C  CA  . ARG A 1 8  ? -19.374 -4.633  -1.399  1.00 32.00 ? 8  ARG A CA  1 
ATOM   59   C  C   . ARG A 1 8  ? -18.549 -5.659  -0.645  1.00 31.36 ? 8  ARG A C   1 
ATOM   60   O  O   . ARG A 1 8  ? -17.740 -5.328  0.222   1.00 31.82 ? 8  ARG A O   1 
ATOM   61   C  CB  . ARG A 1 8  ? -20.792 -4.603  -0.772  1.00 32.73 ? 8  ARG A CB  1 
ATOM   62   C  CG  . ARG A 1 8  ? -21.116 -3.392  0.099   1.00 40.80 ? 8  ARG A CG  1 
ATOM   63   C  CD  . ARG A 1 8  ? -21.455 -2.150  -0.867  1.00 44.52 ? 8  ARG A CD  1 
ATOM   64   N  NE  . ARG A 1 8  ? -20.572 -0.966  -0.718  1.00 44.89 ? 8  ARG A NE  1 
ATOM   65   C  CZ  . ARG A 1 8  ? -20.802 0.018   0.146   1.00 44.06 ? 8  ARG A CZ  1 
ATOM   66   N  NH1 . ARG A 1 8  ? -21.897 -0.043  0.892   1.00 42.67 ? 8  ARG A NH1 1 
ATOM   67   N  NH2 . ARG A 1 8  ? -19.942 1.040   0.287   1.00 43.59 ? 8  ARG A NH2 1 
ATOM   68   N  N   . SER A 1 9  ? -18.796 -6.908  -0.996  1.00 30.57 ? 9  SER A N   1 
ATOM   69   C  CA  . SER A 1 9  ? -18.145 -8.088  -0.471  1.00 31.27 ? 9  SER A CA  1 
ATOM   70   C  C   . SER A 1 9  ? -17.667 -9.029  -1.568  1.00 28.42 ? 9  SER A C   1 
ATOM   71   O  O   . SER A 1 9  ? -18.444 -9.410  -2.433  1.00 28.76 ? 9  SER A O   1 
ATOM   72   C  CB  . SER A 1 9  ? -19.191 -8.879  0.303   1.00 31.13 ? 9  SER A CB  1 
ATOM   73   O  OG  . SER A 1 9  ? -18.811 -8.766  1.636   1.00 41.49 ? 9  SER A OG  1 
ATOM   74   N  N   . CYS A 1 10 ? -16.433 -9.502  -1.484  1.00 27.32 ? 10 CYS A N   1 
ATOM   75   C  CA  . CYS A 1 10 ? -15.977 -10.497 -2.472  1.00 26.21 ? 10 CYS A CA  1 
ATOM   76   C  C   . CYS A 1 10 ? -16.708 -11.799 -2.312  1.00 26.84 ? 10 CYS A C   1 
ATOM   77   O  O   . CYS A 1 10 ? -17.029 -12.235 -1.202  1.00 27.57 ? 10 CYS A O   1 
ATOM   78   C  CB  . CYS A 1 10 ? -14.468 -10.720 -2.407  1.00 26.00 ? 10 CYS A CB  1 
ATOM   79   S  SG  . CYS A 1 10 ? -13.500 -9.182  -2.729  1.00 23.79 ? 10 CYS A SG  1 
ATOM   80   N  N   . TYR A 1 11 ? -16.976 -12.427 -3.434  1.00 27.06 ? 11 TYR A N   1 
ATOM   81   C  CA  . TYR A 1 11 ? -17.590 -13.754 -3.431  1.00 28.81 ? 11 TYR A CA  1 
ATOM   82   C  C   . TYR A 1 11 ? -16.584 -14.775 -2.896  1.00 29.76 ? 11 TYR A C   1 
ATOM   83   O  O   . TYR A 1 11 ? -15.358 -14.526 -2.845  1.00 28.54 ? 11 TYR A O   1 
ATOM   84   C  CB  . TYR A 1 11 ? -18.033 -14.139 -4.824  1.00 27.59 ? 11 TYR A CB  1 
ATOM   85   C  CG  . TYR A 1 11 ? -19.326 -13.448 -5.232  1.00 31.02 ? 11 TYR A CG  1 
ATOM   86   C  CD1 . TYR A 1 11 ? -19.882 -12.437 -4.455  1.00 32.05 ? 11 TYR A CD1 1 
ATOM   87   C  CD2 . TYR A 1 11 ? -19.973 -13.815 -6.405  1.00 34.75 ? 11 TYR A CD2 1 
ATOM   88   C  CE1 . TYR A 1 11 ? -21.088 -11.818 -4.821  1.00 35.83 ? 11 TYR A CE1 1 
ATOM   89   C  CE2 . TYR A 1 11 ? -21.168 -13.215 -6.787  1.00 37.13 ? 11 TYR A CE2 1 
ATOM   90   C  CZ  . TYR A 1 11 ? -21.722 -12.223 -6.007  1.00 37.28 ? 11 TYR A CZ  1 
ATOM   91   O  OH  . TYR A 1 11 ? -22.897 -11.618 -6.436  1.00 39.95 ? 11 TYR A OH  1 
ATOM   92   N  N   . SER A 1 12 ? -17.129 -15.907 -2.485  1.00 31.33 ? 12 SER A N   1 
ATOM   93   C  CA  . SER A 1 12 ? -16.358 -16.963 -1.821  1.00 33.40 ? 12 SER A CA  1 
ATOM   94   C  C   . SER A 1 12 ? -15.262 -17.552 -2.717  1.00 33.57 ? 12 SER A C   1 
ATOM   95   O  O   . SER A 1 12 ? -14.318 -18.118 -2.216  1.00 35.52 ? 12 SER A O   1 
ATOM   96   C  CB  . SER A 1 12 ? -17.319 -18.013 -1.239  1.00 34.32 ? 12 SER A CB  1 
ATOM   97   O  OG  . SER A 1 12 ? -17.941 -18.754 -2.254  1.00 38.26 ? 12 SER A OG  1 
ATOM   98   N  N   . THR A 1 13 ? -15.363 -17.330 -4.036  1.00 33.14 ? 13 THR A N   1 
ATOM   99   C  CA  . THR A 1 13 ? -14.414 -17.764 -5.029  1.00 33.30 ? 13 THR A CA  1 
ATOM   100  C  C   . THR A 1 13 ? -13.351 -16.682 -5.325  1.00 31.91 ? 13 THR A C   1 
ATOM   101  O  O   . THR A 1 13 ? -12.384 -16.916 -6.061  1.00 30.81 ? 13 THR A O   1 
ATOM   102  C  CB  . THR A 1 13 ? -15.189 -18.132 -6.334  1.00 35.83 ? 13 THR A CB  1 
ATOM   103  O  OG1 . THR A 1 13 ? -16.215 -17.143 -6.610  1.00 39.14 ? 13 THR A OG1 1 
ATOM   104  C  CG2 . THR A 1 13 ? -15.911 -19.451 -6.086  1.00 33.83 ? 13 THR A CG2 1 
ATOM   105  N  N   . GLU A 1 14 ? -13.505 -15.514 -4.705  1.00 28.76 ? 14 GLU A N   1 
ATOM   106  C  CA  . GLU A 1 14 ? -12.623 -14.376 -5.039  1.00 27.46 ? 14 GLU A CA  1 
ATOM   107  C  C   . GLU A 1 14 ? -11.799 -13.938 -3.849  1.00 27.35 ? 14 GLU A C   1 
ATOM   108  O  O   . GLU A 1 14 ? -12.093 -14.364 -2.728  1.00 27.11 ? 14 GLU A O   1 
ATOM   109  C  CB  . GLU A 1 14 ? -13.478 -13.210 -5.500  1.00 25.33 ? 14 GLU A CB  1 
ATOM   110  C  CG  . GLU A 1 14 ? -14.402 -13.621 -6.653  1.00 28.14 ? 14 GLU A CG  1 
ATOM   111  C  CD  . GLU A 1 14 ? -15.487 -12.617 -6.940  1.00 30.38 ? 14 GLU A CD  1 
ATOM   112  O  OE1 . GLU A 1 14 ? -15.840 -11.814 -6.036  1.00 28.46 ? 14 GLU A OE1 1 
ATOM   113  O  OE2 . GLU A 1 14 ? -15.970 -12.587 -8.096  1.00 31.36 ? 14 GLU A OE2 1 
ATOM   114  N  N   . TYR A 1 15 ? -10.803 -13.062 -4.093  1.00 26.74 ? 15 TYR A N   1 
ATOM   115  C  CA  . TYR A 1 15 ? -10.173 -12.318 -3.029  1.00 27.91 ? 15 TYR A CA  1 
ATOM   116  C  C   . TYR A 1 15 ? -10.142 -10.851 -3.396  1.00 26.07 ? 15 TYR A C   1 
ATOM   117  O  O   . TYR A 1 15 ? -10.318 -10.476 -4.567  1.00 25.90 ? 15 TYR A O   1 
ATOM   118  C  CB  . TYR A 1 15 ? -8.701  -12.774 -2.825  1.00 28.40 ? 15 TYR A CB  1 
ATOM   119  C  CG  . TYR A 1 15 ? -8.614  -14.239 -2.524  1.00 31.59 ? 15 TYR A CG  1 
ATOM   120  C  CD1 . TYR A 1 15 ? -8.534  -14.675 -1.213  1.00 35.81 ? 15 TYR A CD1 1 
ATOM   121  C  CD2 . TYR A 1 15 ? -8.658  -15.203 -3.563  1.00 35.33 ? 15 TYR A CD2 1 
ATOM   122  C  CE1 . TYR A 1 15 ? -8.497  -16.038 -0.908  1.00 41.12 ? 15 TYR A CE1 1 
ATOM   123  C  CE2 . TYR A 1 15 ? -8.636  -16.596 -3.274  1.00 38.58 ? 15 TYR A CE2 1 
ATOM   124  C  CZ  . TYR A 1 15 ? -8.557  -17.000 -1.935  1.00 42.20 ? 15 TYR A CZ  1 
ATOM   125  O  OH  . TYR A 1 15 ? -8.515  -18.336 -1.573  1.00 43.09 ? 15 TYR A OH  1 
ATOM   126  N  N   . SER A 1 16 ? -9.898  -10.040 -2.390  1.00 26.98 ? 16 SER A N   1 
ATOM   127  C  CA  . SER A 1 16 ? -9.781  -8.571  -2.552  1.00 27.37 ? 16 SER A CA  1 
ATOM   128  C  C   . SER A 1 16 ? -8.406  -8.154  -2.937  1.00 27.88 ? 16 SER A C   1 
ATOM   129  O  O   . SER A 1 16 ? -7.441  -8.482  -2.252  1.00 30.84 ? 16 SER A O   1 
ATOM   130  C  CB  . SER A 1 16 ? -10.186 -7.839  -1.297  1.00 26.66 ? 16 SER A CB  1 
ATOM   131  O  OG  . SER A 1 16 ? -10.503 -6.474  -1.642  1.00 28.52 ? 16 SER A OG  1 
ATOM   132  N  N   . TYR A 1 17 ? -8.294  -7.386  -4.004  1.00 27.56 ? 17 TYR A N   1 
ATOM   133  C  CA  . TYR A 1 17 ? -7.002  -6.952  -4.511  1.00 28.20 ? 17 TYR A CA  1 
ATOM   134  C  C   . TYR A 1 17 ? -6.838  -5.484  -4.348  1.00 27.23 ? 17 TYR A C   1 
ATOM   135  O  O   . TYR A 1 17 ? -5.828  -4.960  -4.705  1.00 29.01 ? 17 TYR A O   1 
ATOM   136  C  CB  . TYR A 1 17 ? -6.901  -7.267  -6.008  1.00 28.20 ? 17 TYR A CB  1 
ATOM   137  C  CG  . TYR A 1 17 ? -6.581  -8.706  -6.244  1.00 31.52 ? 17 TYR A CG  1 
ATOM   138  C  CD1 . TYR A 1 17 ? -5.302  -9.096  -6.559  1.00 31.72 ? 17 TYR A CD1 1 
ATOM   139  C  CD2 . TYR A 1 17 ? -7.574  -9.682  -6.135  1.00 32.34 ? 17 TYR A CD2 1 
ATOM   140  C  CE1 . TYR A 1 17 ? -5.018  -10.405 -6.776  1.00 35.02 ? 17 TYR A CE1 1 
ATOM   141  C  CE2 . TYR A 1 17 ? -7.300  -10.999 -6.338  1.00 34.00 ? 17 TYR A CE2 1 
ATOM   142  C  CZ  . TYR A 1 17 ? -6.047  -11.360 -6.669  1.00 34.39 ? 17 TYR A CZ  1 
ATOM   143  O  OH  . TYR A 1 17 ? -5.852  -12.702 -6.877  1.00 33.87 ? 17 TYR A OH  1 
ATOM   144  N  N   . GLY A 1 18 ? -7.872  -4.805  -3.878  1.00 26.89 ? 18 GLY A N   1 
ATOM   145  C  CA  . GLY A 1 18 ? -7.838  -3.366  -3.798  1.00 26.78 ? 18 GLY A CA  1 
ATOM   146  C  C   . GLY A 1 18 ? -9.249  -2.803  -3.668  1.00 25.93 ? 18 GLY A C   1 
ATOM   147  O  O   . GLY A 1 18 ? -10.179 -3.505  -3.246  1.00 25.90 ? 18 GLY A O   1 
ATOM   148  N  N   . THR A 1 19 ? -9.379  -1.531  -4.013  1.00 24.24 ? 19 THR A N   1 
ATOM   149  C  CA  . THR A 1 19 ? -10.664 -0.854  -3.867  1.00 26.46 ? 19 THR A CA  1 
ATOM   150  C  C   . THR A 1 19 ? -11.160 -0.169  -5.118  1.00 25.89 ? 19 THR A C   1 
ATOM   151  O  O   . THR A 1 19 ? -10.382 0.320   -5.924  1.00 27.92 ? 19 THR A O   1 
ATOM   152  C  CB  . THR A 1 19 ? -10.680 0.222   -2.681  1.00 26.58 ? 19 THR A CB  1 
ATOM   153  O  OG1 . THR A 1 19 ? -10.102 1.447   -3.106  1.00 33.93 ? 19 THR A OG1 1 
ATOM   154  C  CG2 . THR A 1 19 ? -9.915  -0.229  -1.506  1.00 25.41 ? 19 THR A CG2 1 
ATOM   155  N  N   . CYS A 1 20 ? -12.468 -0.005  -5.218  1.00 26.50 ? 20 CYS A N   1 
ATOM   156  C  CA  . CYS A 1 20 ? -12.999 0.858   -6.226  1.00 24.49 ? 20 CYS A CA  1 
ATOM   157  C  C   . CYS A 1 20 ? -13.746 1.915   -5.496  1.00 25.04 ? 20 CYS A C   1 
ATOM   158  O  O   . CYS A 1 20 ? -14.228 1.648   -4.433  1.00 25.36 ? 20 CYS A O   1 
ATOM   159  C  CB  . CYS A 1 20 ? -13.996 0.126   -7.127  1.00 24.16 ? 20 CYS A CB  1 
ATOM   160  S  SG  . CYS A 1 20 ? -13.523 -1.512  -7.556  1.00 25.17 ? 20 CYS A SG  1 
ATOM   161  N  N   . THR A 1 21 ? -13.800 3.133   -6.019  1.00 24.67 ? 21 THR A N   1 
ATOM   162  C  CA  . THR A 1 21 ? -14.745 4.111   -5.470  1.00 26.87 ? 21 THR A CA  1 
ATOM   163  C  C   . THR A 1 21 ? -15.639 4.574   -6.569  1.00 27.74 ? 21 THR A C   1 
ATOM   164  O  O   . THR A 1 21 ? -15.156 5.131   -7.570  1.00 28.74 ? 21 THR A O   1 
ATOM   165  C  CB  . THR A 1 21 ? -14.070 5.343   -4.821  1.00 26.34 ? 21 THR A CB  1 
ATOM   166  O  OG1 . THR A 1 21 ? -13.223 4.920   -3.743  1.00 29.99 ? 21 THR A OG1 1 
ATOM   167  C  CG2 . THR A 1 21 ? -15.116 6.342   -4.193  1.00 25.89 ? 21 THR A CG2 1 
ATOM   168  N  N   . VAL A 1 22 ? -16.939 4.350   -6.378  1.00 28.14 ? 22 VAL A N   1 
ATOM   169  C  CA  . VAL A 1 22 ? -17.967 4.783   -7.343  1.00 30.31 ? 22 VAL A CA  1 
ATOM   170  C  C   . VAL A 1 22 ? -19.223 5.131   -6.579  1.00 31.49 ? 22 VAL A C   1 
ATOM   171  O  O   . VAL A 1 22 ? -19.525 4.503   -5.568  1.00 31.30 ? 22 VAL A O   1 
ATOM   172  C  CB  . VAL A 1 22 ? -18.305 3.685   -8.384  1.00 31.18 ? 22 VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 22 ? -18.892 4.346   -9.616  1.00 33.29 ? 22 VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 22 ? -17.033 2.863   -8.778  1.00 31.08 ? 22 VAL A CG2 1 
ATOM   175  N  N   . MET A 1 23 ? -19.983 6.098   -7.065  1.00 31.80 ? 23 MET A N   1 
ATOM   176  C  CA  . MET A 1 23 ? -21.185 6.550   -6.349  1.00 32.88 ? 23 MET A CA  1 
ATOM   177  C  C   . MET A 1 23 ? -20.827 7.073   -4.941  1.00 31.67 ? 23 MET A C   1 
ATOM   178  O  O   . MET A 1 23 ? -21.648 7.076   -4.053  1.00 31.28 ? 23 MET A O   1 
ATOM   179  C  CB  . MET A 1 23 ? -22.217 5.398   -6.303  1.00 34.13 ? 23 MET A CB  1 
ATOM   180  C  CG  . MET A 1 23 ? -23.537 5.710   -6.881  1.00 42.15 ? 23 MET A CG  1 
ATOM   181  S  SD  . MET A 1 23 ? -24.119 4.389   -7.986  1.00 50.78 ? 23 MET A SD  1 
ATOM   182  C  CE  . MET A 1 23 ? -23.370 5.242   -9.374  1.00 54.22 ? 23 MET A CE  1 
ATOM   183  N  N   . GLY A 1 24 ? -19.583 7.497   -4.752  1.00 29.83 ? 24 GLY A N   1 
ATOM   184  C  CA  . GLY A 1 24 ? -19.153 8.139   -3.493  1.00 29.53 ? 24 GLY A CA  1 
ATOM   185  C  C   . GLY A 1 24 ? -18.811 7.159   -2.414  1.00 29.08 ? 24 GLY A C   1 
ATOM   186  O  O   . GLY A 1 24 ? -18.611 7.539   -1.218  1.00 29.20 ? 24 GLY A O   1 
ATOM   187  N  N   . ILE A 1 25 ? -18.879 5.870   -2.796  1.00 26.72 ? 25 ILE A N   1 
ATOM   188  C  CA  . ILE A 1 25 ? -18.580 4.844   -1.841  1.00 26.48 ? 25 ILE A CA  1 
ATOM   189  C  C   . ILE A 1 25 ? -17.554 3.883   -2.338  1.00 24.94 ? 25 ILE A C   1 
ATOM   190  O  O   . ILE A 1 25 ? -17.314 3.787   -3.543  1.00 24.41 ? 25 ILE A O   1 
ATOM   191  C  CB  . ILE A 1 25 ? -19.827 4.104   -1.308  1.00 25.81 ? 25 ILE A CB  1 
ATOM   192  C  CG1 . ILE A 1 25 ? -20.512 3.289   -2.393  1.00 23.23 ? 25 ILE A CG1 1 
ATOM   193  C  CG2 . ILE A 1 25 ? -20.797 5.097   -0.573  1.00 29.79 ? 25 ILE A CG2 1 
ATOM   194  C  CD1 . ILE A 1 25 ? -21.891 2.746   -1.882  1.00 27.60 ? 25 ILE A CD1 1 
ATOM   195  N  N   . ASN A 1 26 ? -16.899 3.262   -1.366  1.00 26.19 ? 26 ASN A N   1 
ATOM   196  C  CA  . ASN A 1 26 ? -15.900 2.234   -1.602  1.00 25.99 ? 26 ASN A CA  1 
ATOM   197  C  C   . ASN A 1 26 ? -16.532 0.866   -1.903  1.00 24.97 ? 26 ASN A C   1 
ATOM   198  O  O   . ASN A 1 26 ? -17.609 0.550   -1.440  1.00 25.62 ? 26 ASN A O   1 
ATOM   199  C  CB  . ASN A 1 26 ? -14.884 2.141   -0.432  1.00 26.29 ? 26 ASN A CB  1 
ATOM   200  C  CG  . ASN A 1 26 ? -13.957 3.394   -0.338  1.00 27.42 ? 26 ASN A CG  1 
ATOM   201  O  OD1 . ASN A 1 26 ? -13.998 4.288   -1.209  1.00 28.52 ? 26 ASN A OD1 1 
ATOM   202  N  ND2 . ASN A 1 26 ? -13.229 3.516   0.794   1.00 28.63 ? 26 ASN A ND2 1 
ATOM   203  N  N   . TRP A 1 27 ? -15.855 0.102   -2.749  1.00 25.19 ? 27 TRP A N   1 
ATOM   204  C  CA  . TRP A 1 27 ? -16.225 -1.236  -3.076  1.00 25.33 ? 27 TRP A CA  1 
ATOM   205  C  C   . TRP A 1 27 ? -14.900 -1.939  -3.028  1.00 25.54 ? 27 TRP A C   1 
ATOM   206  O  O   . TRP A 1 27 ? -13.876 -1.245  -3.073  1.00 28.05 ? 27 TRP A O   1 
ATOM   207  C  CB  . TRP A 1 27 ? -16.681 -1.210  -4.559  1.00 25.50 ? 27 TRP A CB  1 
ATOM   208  C  CG  . TRP A 1 27 ? -17.813 -0.283  -4.776  1.00 28.39 ? 27 TRP A CG  1 
ATOM   209  C  CD1 . TRP A 1 27 ? -17.758 1.042   -5.094  1.00 29.77 ? 27 TRP A CD1 1 
ATOM   210  C  CD2 . TRP A 1 27 ? -19.181 -0.617  -4.655  1.00 29.90 ? 27 TRP A CD2 1 
ATOM   211  N  NE1 . TRP A 1 27 ? -19.028 1.554   -5.207  1.00 29.89 ? 27 TRP A NE1 1 
ATOM   212  C  CE2 . TRP A 1 27 ? -19.919 0.548   -4.926  1.00 31.91 ? 27 TRP A CE2 1 
ATOM   213  C  CE3 . TRP A 1 27 ? -19.858 -1.809  -4.393  1.00 32.47 ? 27 TRP A CE3 1 
ATOM   214  C  CZ2 . TRP A 1 27 ? -21.287 0.564   -4.937  1.00 30.96 ? 27 TRP A CZ2 1 
ATOM   215  C  CZ3 . TRP A 1 27 ? -21.229 -1.789  -4.380  1.00 36.79 ? 27 TRP A CZ3 1 
ATOM   216  C  CH2 . TRP A 1 27 ? -21.930 -0.599  -4.648  1.00 34.28 ? 27 TRP A CH2 1 
ATOM   217  N  N   . ARG A 1 28 ? -14.878 -3.282  -2.975  1.00 25.95 ? 28 ARG A N   1 
ATOM   218  C  CA  . ARG A 1 28 ? -13.616 -4.006  -3.096  1.00 26.52 ? 28 ARG A CA  1 
ATOM   219  C  C   . ARG A 1 28 ? -13.404 -4.475  -4.532  1.00 25.94 ? 28 ARG A C   1 
ATOM   220  O  O   . ARG A 1 28 ? -14.361 -4.837  -5.198  1.00 26.93 ? 28 ARG A O   1 
ATOM   221  C  CB  . ARG A 1 28 ? -13.577 -5.216  -2.150  1.00 26.37 ? 28 ARG A CB  1 
ATOM   222  C  CG  . ARG A 1 28 ? -13.957 -4.869  -0.738  1.00 27.44 ? 28 ARG A CG  1 
ATOM   223  C  CD  . ARG A 1 28 ? -13.871 -6.071  0.209   1.00 34.68 ? 28 ARG A CD  1 
ATOM   224  N  NE  . ARG A 1 28 ? -13.145 -5.597  1.392   1.00 39.15 ? 28 ARG A NE  1 
ATOM   225  C  CZ  . ARG A 1 28 ? -13.718 -5.069  2.455   1.00 40.69 ? 28 ARG A CZ  1 
ATOM   226  N  NH1 . ARG A 1 28 ? -15.051 -4.996  2.553   1.00 46.64 ? 28 ARG A NH1 1 
ATOM   227  N  NH2 . ARG A 1 28 ? -12.954 -4.618  3.423   1.00 40.96 ? 28 ARG A NH2 1 
ATOM   228  N  N   . PHE A 1 29 ? -12.148 -4.490  -4.980  1.00 25.28 ? 29 PHE A N   1 
ATOM   229  C  CA  . PHE A 1 29 ? -11.805 -4.987  -6.269  1.00 25.07 ? 29 PHE A CA  1 
ATOM   230  C  C   . PHE A 1 29 ? -11.499 -6.480  -6.157  1.00 25.31 ? 29 PHE A C   1 
ATOM   231  O  O   . PHE A 1 29 ? -10.400 -6.874  -5.743  1.00 26.76 ? 29 PHE A O   1 
ATOM   232  C  CB  . PHE A 1 29 ? -10.641 -4.176  -6.830  1.00 26.69 ? 29 PHE A CB  1 
ATOM   233  C  CG  . PHE A 1 29 ? -10.322 -4.486  -8.259  1.00 26.83 ? 29 PHE A CG  1 
ATOM   234  C  CD1 . PHE A 1 29 ? -11.052 -3.914  -9.277  1.00 28.00 ? 29 PHE A CD1 1 
ATOM   235  C  CD2 . PHE A 1 29 ? -9.308  -5.382  -8.581  1.00 28.95 ? 29 PHE A CD2 1 
ATOM   236  C  CE1 . PHE A 1 29 ? -10.770 -4.177  -10.581 1.00 29.51 ? 29 PHE A CE1 1 
ATOM   237  C  CE2 . PHE A 1 29 ? -8.996  -5.640  -9.880  1.00 31.27 ? 29 PHE A CE2 1 
ATOM   238  C  CZ  . PHE A 1 29 ? -9.740  -5.044  -10.905 1.00 28.27 ? 29 PHE A CZ  1 
ATOM   239  N  N   . CYS A 1 30 ? -12.492 -7.299  -6.520  1.00 24.21 ? 30 CYS A N   1 
ATOM   240  C  CA  . CYS A 1 30 ? -12.545 -8.739  -6.263  1.00 25.14 ? 30 CYS A CA  1 
ATOM   241  C  C   . CYS A 1 30 ? -12.240 -9.498  -7.562  1.00 26.96 ? 30 CYS A C   1 
ATOM   242  O  O   . CYS A 1 30 ? -12.877 -9.236  -8.584  1.00 27.96 ? 30 CYS A O   1 
ATOM   243  C  CB  . CYS A 1 30 ? -13.977 -9.093  -5.758  1.00 23.69 ? 30 CYS A CB  1 
ATOM   244  S  SG  . CYS A 1 30 ? -14.484 -8.238  -4.237  1.00 24.11 ? 30 CYS A SG  1 
ATOM   245  N  N   . CYS A 1 31 ? -11.296 -10.431 -7.520  1.00 27.82 ? 31 CYS A N   1 
ATOM   246  C  CA  . CYS A 1 31 ? -10.886 -11.162 -8.709  1.00 28.90 ? 31 CYS A CA  1 
ATOM   247  C  C   . CYS A 1 31 ? -10.826 -12.630 -8.403  1.00 31.59 ? 31 CYS A C   1 
ATOM   248  O  O   . CYS A 1 31 ? -10.570 -13.023 -7.274  1.00 32.49 ? 31 CYS A O   1 
ATOM   249  C  CB  . CYS A 1 31 ? -9.487  -10.736 -9.178  1.00 27.69 ? 31 CYS A CB  1 
ATOM   250  S  SG  . CYS A 1 31 ? -9.205  -9.016  -9.485  1.00 25.71 ? 31 CYS A SG  1 
ATOM   251  N  N   . LEU A 1 32 ? -11.054 -13.440 -9.426  1.00 34.05 ? 32 LEU A N   1 
ATOM   252  C  CA  . LEU A 1 32 ? -10.716 -14.845 -9.381  1.00 35.07 ? 32 LEU A CA  1 
ATOM   253  C  C   . LEU A 1 32 ? -9.902  -15.142 -10.609 1.00 35.45 ? 32 LEU A C   1 
ATOM   254  O  O   . LEU A 1 32 ? -9.693  -14.297 -11.477 1.00 35.63 ? 32 LEU A O   1 
ATOM   255  C  CB  . LEU A 1 32 ? -11.974 -15.730 -9.287  1.00 35.97 ? 32 LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 32 ? -13.018 -15.878 -10.414 1.00 38.21 ? 32 LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 32 ? -14.097 -16.882 -9.982  1.00 37.30 ? 32 LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 32 ? -13.669 -14.541 -10.754 1.00 40.57 ? 32 LEU A CD2 1 
ATOM   259  O  OXT . LEU A 1 32 ? -9.399  -16.248 -10.779 1.00 36.44 ? 32 LEU A OXT 1 
ATOM   260  N  N   . ALA B 1 1  ? -34.383 11.970  -15.347 1.00 50.69 ? 1  ALA B N   1 
ATOM   261  C  CA  . ALA B 1 1  ? -33.587 10.699  -15.357 1.00 49.53 ? 1  ALA B CA  1 
ATOM   262  C  C   . ALA B 1 1  ? -32.279 10.887  -16.103 1.00 47.88 ? 1  ALA B C   1 
ATOM   263  O  O   . ALA B 1 1  ? -32.246 11.321  -17.251 1.00 48.81 ? 1  ALA B O   1 
ATOM   264  C  CB  . ALA B 1 1  ? -34.375 9.543   -15.951 1.00 50.84 ? 1  ALA B CB  1 
ATOM   265  N  N   . PHE B 1 2  ? -31.197 10.559  -15.425 1.00 45.32 ? 2  PHE B N   1 
ATOM   266  C  CA  . PHE B 1 2  ? -29.866 10.778  -15.934 1.00 44.38 ? 2  PHE B CA  1 
ATOM   267  C  C   . PHE B 1 2  ? -29.251 9.412   -16.111 1.00 43.60 ? 2  PHE B C   1 
ATOM   268  O  O   . PHE B 1 2  ? -29.621 8.453   -15.429 1.00 44.03 ? 2  PHE B O   1 
ATOM   269  C  CB  . PHE B 1 2  ? -29.049 11.590  -14.934 1.00 43.47 ? 2  PHE B CB  1 
ATOM   270  C  CG  . PHE B 1 2  ? -29.605 12.947  -14.673 1.00 44.27 ? 2  PHE B CG  1 
ATOM   271  C  CD1 . PHE B 1 2  ? -30.619 13.133  -13.733 1.00 42.91 ? 2  PHE B CD1 1 
ATOM   272  C  CD2 . PHE B 1 2  ? -29.138 14.039  -15.363 1.00 44.49 ? 2  PHE B CD2 1 
ATOM   273  C  CE1 . PHE B 1 2  ? -31.152 14.376  -13.486 1.00 45.55 ? 2  PHE B CE1 1 
ATOM   274  C  CE2 . PHE B 1 2  ? -29.688 15.303  -15.115 1.00 44.88 ? 2  PHE B CE2 1 
ATOM   275  C  CZ  . PHE B 1 2  ? -30.683 15.460  -14.172 1.00 44.94 ? 2  PHE B CZ  1 
ATOM   276  N  N   . THR B 1 3  ? -28.355 9.319   -17.073 1.00 43.61 ? 3  THR B N   1 
ATOM   277  C  CA  . THR B 1 3  ? -27.667 8.080   -17.346 1.00 43.71 ? 3  THR B CA  1 
ATOM   278  C  C   . THR B 1 3  ? -26.177 8.383   -17.356 1.00 42.83 ? 3  THR B C   1 
ATOM   279  O  O   . THR B 1 3  ? -25.720 9.243   -18.098 1.00 43.34 ? 3  THR B O   1 
ATOM   280  C  CB  . THR B 1 3  ? -28.129 7.479   -18.657 1.00 43.88 ? 3  THR B CB  1 
ATOM   281  O  OG1 . THR B 1 3  ? -29.415 6.894   -18.450 1.00 45.58 ? 3  THR B OG1 1 
ATOM   282  C  CG2 . THR B 1 3  ? -27.177 6.382   -19.084 1.00 45.27 ? 3  THR B CG2 1 
ATOM   283  N  N   . CYS B 1 4  ? -25.458 7.698   -16.478 1.00 42.10 ? 4  CYS B N   1 
ATOM   284  C  CA  . CYS B 1 4  ? -24.062 7.998   -16.200 1.00 40.65 ? 4  CYS B CA  1 
ATOM   285  C  C   . CYS B 1 4  ? -23.187 6.766   -16.458 1.00 40.30 ? 4  CYS B C   1 
ATOM   286  O  O   . CYS B 1 4  ? -23.643 5.646   -16.265 1.00 40.37 ? 4  CYS B O   1 
ATOM   287  C  CB  . CYS B 1 4  ? -23.892 8.452   -14.754 1.00 39.72 ? 4  CYS B CB  1 
ATOM   288  S  SG  . CYS B 1 4  ? -24.924 9.821   -14.205 1.00 40.48 ? 4  CYS B SG  1 
ATOM   289  N  N   . HIS B 1 5  ? -21.953 7.018   -16.904 1.00 39.00 ? 5  HIS B N   1 
ATOM   290  C  CA  . HIS B 1 5  ? -20.911 6.008   -17.143 1.00 39.05 ? 5  HIS B CA  1 
ATOM   291  C  C   . HIS B 1 5  ? -19.567 6.502   -16.589 1.00 38.78 ? 5  HIS B C   1 
ATOM   292  O  O   . HIS B 1 5  ? -19.306 7.710   -16.595 1.00 38.56 ? 5  HIS B O   1 
ATOM   293  C  CB  . HIS B 1 5  ? -20.701 5.798   -18.649 1.00 38.99 ? 5  HIS B CB  1 
ATOM   294  C  CG  . HIS B 1 5  ? -21.824 5.088   -19.332 1.00 40.39 ? 5  HIS B CG  1 
ATOM   295  N  ND1 . HIS B 1 5  ? -22.976 5.735   -19.725 1.00 40.70 ? 5  HIS B ND1 1 
ATOM   296  C  CD2 . HIS B 1 5  ? -21.971 3.789   -19.694 1.00 41.68 ? 5  HIS B CD2 1 
ATOM   297  C  CE1 . HIS B 1 5  ? -23.798 4.855   -20.275 1.00 43.17 ? 5  HIS B CE1 1 
ATOM   298  N  NE2 . HIS B 1 5  ? -23.215 3.670   -20.267 1.00 42.90 ? 5  HIS B NE2 1 
ATOM   299  N  N   . CYS B 1 6  ? -18.715 5.576   -16.149 1.00 38.44 ? 6  CYS B N   1 
ATOM   300  C  CA  . CYS B 1 6  ? -17.338 5.882   -15.815 1.00 38.70 ? 6  CYS B CA  1 
ATOM   301  C  C   . CYS B 1 6  ? -16.562 5.871   -17.110 1.00 39.30 ? 6  CYS B C   1 
ATOM   302  O  O   . CYS B 1 6  ? -16.598 4.864   -17.835 1.00 40.27 ? 6  CYS B O   1 
ATOM   303  C  CB  . CYS B 1 6  ? -16.809 4.836   -14.846 1.00 37.36 ? 6  CYS B CB  1 
ATOM   304  S  SG  . CYS B 1 6  ? -17.686 4.825   -13.262 1.00 40.57 ? 6  CYS B SG  1 
ATOM   305  N  N   . ARG B 1 7  ? -15.919 6.989   -17.450 1.00 39.53 ? 7  ARG B N   1 
ATOM   306  C  CA  . ARG B 1 7  ? -15.129 7.075   -18.672 1.00 40.39 ? 7  ARG B CA  1 
ATOM   307  C  C   . ARG B 1 7  ? -13.855 7.801   -18.318 1.00 41.78 ? 7  ARG B C   1 
ATOM   308  O  O   . ARG B 1 7  ? -13.863 8.646   -17.429 1.00 42.69 ? 7  ARG B O   1 
ATOM   309  C  CB  . ARG B 1 7  ? -15.836 7.871   -19.794 1.00 40.37 ? 7  ARG B CB  1 
ATOM   310  C  CG  . ARG B 1 7  ? -17.274 7.488   -20.144 1.00 38.75 ? 7  ARG B CG  1 
ATOM   311  C  CD  . ARG B 1 7  ? -17.745 8.177   -21.390 1.00 40.43 ? 7  ARG B CD  1 
ATOM   312  N  NE  . ARG B 1 7  ? -19.205 8.122   -21.474 1.00 38.80 ? 7  ARG B NE  1 
ATOM   313  C  CZ  . ARG B 1 7  ? -19.873 7.029   -21.845 1.00 38.27 ? 7  ARG B CZ  1 
ATOM   314  N  NH1 . ARG B 1 7  ? -19.203 5.949   -22.204 1.00 39.02 ? 7  ARG B NH1 1 
ATOM   315  N  NH2 . ARG B 1 7  ? -21.197 7.016   -21.894 1.00 35.50 ? 7  ARG B NH2 1 
ATOM   316  N  N   . ARG B 1 8  ? -12.767 7.504   -19.030 1.00 43.18 ? 8  ARG B N   1 
ATOM   317  C  CA  . ARG B 1 8  ? -11.547 8.297   -18.904 1.00 44.53 ? 8  ARG B CA  1 
ATOM   318  C  C   . ARG B 1 8  ? -11.761 9.770   -19.263 1.00 43.01 ? 8  ARG B C   1 
ATOM   319  O  O   . ARG B 1 8  ? -11.273 10.658  -18.568 1.00 43.60 ? 8  ARG B O   1 
ATOM   320  C  CB  . ARG B 1 8  ? -10.406 7.698   -19.737 1.00 46.89 ? 8  ARG B CB  1 
ATOM   321  C  CG  . ARG B 1 8  ? -9.053  8.231   -19.310 1.00 51.41 ? 8  ARG B CG  1 
ATOM   322  C  CD  . ARG B 1 8  ? -8.344  8.978   -20.432 1.00 59.18 ? 8  ARG B CD  1 
ATOM   323  N  NE  . ARG B 1 8  ? -6.890  8.929   -20.202 1.00 65.18 ? 8  ARG B NE  1 
ATOM   324  C  CZ  . ARG B 1 8  ? -6.092  7.886   -20.473 1.00 68.48 ? 8  ARG B CZ  1 
ATOM   325  N  NH1 . ARG B 1 8  ? -6.564  6.765   -21.012 1.00 69.79 ? 8  ARG B NH1 1 
ATOM   326  N  NH2 . ARG B 1 8  ? -4.794  7.974   -20.206 1.00 70.07 ? 8  ARG B NH2 1 
ATOM   327  N  N   . SER B 1 9  ? -12.499 10.019  -20.338 1.00 41.49 ? 9  SER B N   1 
ATOM   328  C  CA  . SER B 1 9  ? -13.000 11.350  -20.628 1.00 41.29 ? 9  SER B CA  1 
ATOM   329  C  C   . SER B 1 9  ? -14.472 11.219  -20.986 1.00 40.90 ? 9  SER B C   1 
ATOM   330  O  O   . SER B 1 9  ? -14.914 10.159  -21.410 1.00 42.40 ? 9  SER B O   1 
ATOM   331  C  CB  . SER B 1 9  ? -12.263 12.051  -21.775 1.00 41.38 ? 9  SER B CB  1 
ATOM   332  O  OG  . SER B 1 9  ? -11.029 11.436  -22.103 1.00 46.99 ? 9  SER B OG  1 
ATOM   333  N  N   . CYS B 1 10 ? -15.229 12.299  -20.832 1.00 40.03 ? 10 CYS B N   1 
ATOM   334  C  CA  . CYS B 1 10 ? -16.643 12.242  -21.097 1.00 39.20 ? 10 CYS B CA  1 
ATOM   335  C  C   . CYS B 1 10 ? -16.840 12.595  -22.554 1.00 39.93 ? 10 CYS B C   1 
ATOM   336  O  O   . CYS B 1 10 ? -16.017 13.289  -23.159 1.00 39.71 ? 10 CYS B O   1 
ATOM   337  C  CB  . CYS B 1 10 ? -17.416 13.216  -20.197 1.00 38.10 ? 10 CYS B CB  1 
ATOM   338  S  SG  . CYS B 1 10 ? -17.248 12.894  -18.443 1.00 37.35 ? 10 CYS B SG  1 
ATOM   339  N  N   . TYR B 1 11 ? -17.950 12.108  -23.103 1.00 41.20 ? 11 TYR B N   1 
ATOM   340  C  CA  . TYR B 1 11 ? -18.397 12.523  -24.411 1.00 41.52 ? 11 TYR B CA  1 
ATOM   341  C  C   . TYR B 1 11 ? -18.710 13.988  -24.319 1.00 42.36 ? 11 TYR B C   1 
ATOM   342  O  O   . TYR B 1 11 ? -19.148 14.479  -23.264 1.00 42.52 ? 11 TYR B O   1 
ATOM   343  C  CB  . TYR B 1 11 ? -19.634 11.751  -24.839 1.00 41.41 ? 11 TYR B CB  1 
ATOM   344  C  CG  . TYR B 1 11 ? -19.338 10.318  -25.234 1.00 41.72 ? 11 TYR B CG  1 
ATOM   345  C  CD1 . TYR B 1 11 ? -18.404 10.023  -26.218 1.00 42.64 ? 11 TYR B CD1 1 
ATOM   346  C  CD2 . TYR B 1 11 ? -19.988 9.267   -24.624 1.00 43.37 ? 11 TYR B CD2 1 
ATOM   347  C  CE1 . TYR B 1 11 ? -18.121 8.745   -26.569 1.00 43.74 ? 11 TYR B CE1 1 
ATOM   348  C  CE2 . TYR B 1 11 ? -19.711 7.952   -24.983 1.00 43.49 ? 11 TYR B CE2 1 
ATOM   349  C  CZ  . TYR B 1 11 ? -18.781 7.715   -25.936 1.00 45.19 ? 11 TYR B CZ  1 
ATOM   350  O  OH  . TYR B 1 11 ? -18.520 6.431   -26.278 1.00 48.04 ? 11 TYR B OH  1 
ATOM   351  N  N   . SER B 1 12 ? -18.489 14.689  -25.420 1.00 42.92 ? 12 SER B N   1 
ATOM   352  C  CA  . SER B 1 12 ? -18.699 16.141  -25.464 1.00 44.38 ? 12 SER B CA  1 
ATOM   353  C  C   . SER B 1 12 ? -20.115 16.486  -25.069 1.00 44.39 ? 12 SER B C   1 
ATOM   354  O  O   . SER B 1 12 ? -20.357 17.581  -24.577 1.00 44.93 ? 12 SER B O   1 
ATOM   355  C  CB  . SER B 1 12 ? -18.427 16.660  -26.848 1.00 45.45 ? 12 SER B CB  1 
ATOM   356  O  OG  . SER B 1 12 ? -19.146 15.877  -27.775 1.00 48.39 ? 12 SER B OG  1 
ATOM   357  N  N   . THR B 1 13 ? -21.042 15.539  -25.242 1.00 44.89 ? 13 THR B N   1 
ATOM   358  C  CA  . THR B 1 13 ? -22.440 15.748  -24.857 1.00 44.76 ? 13 THR B CA  1 
ATOM   359  C  C   . THR B 1 13 ? -22.713 15.509  -23.357 1.00 44.09 ? 13 THR B C   1 
ATOM   360  O  O   . THR B 1 13 ? -23.792 15.850  -22.845 1.00 43.62 ? 13 THR B O   1 
ATOM   361  C  CB  . THR B 1 13 ? -23.424 14.895  -25.711 1.00 45.91 ? 13 THR B CB  1 
ATOM   362  O  OG1 . THR B 1 13 ? -23.179 13.497  -25.522 1.00 46.69 ? 13 THR B OG1 1 
ATOM   363  C  CG2 . THR B 1 13 ? -23.282 15.217  -27.200 1.00 47.92 ? 13 THR B CG2 1 
ATOM   364  N  N   . GLU B 1 14 ? -21.728 14.944  -22.650 1.00 42.80 ? 14 GLU B N   1 
ATOM   365  C  CA  . GLU B 1 14 ? -21.900 14.590  -21.236 1.00 40.88 ? 14 GLU B CA  1 
ATOM   366  C  C   . GLU B 1 14 ? -21.287 15.605  -20.271 1.00 41.13 ? 14 GLU B C   1 
ATOM   367  O  O   . GLU B 1 14 ? -20.537 16.481  -20.708 1.00 40.70 ? 14 GLU B O   1 
ATOM   368  C  CB  . GLU B 1 14 ? -21.318 13.221  -20.985 1.00 40.62 ? 14 GLU B CB  1 
ATOM   369  C  CG  . GLU B 1 14 ? -22.080 12.115  -21.638 1.00 37.53 ? 14 GLU B CG  1 
ATOM   370  C  CD  . GLU B 1 14 ? -21.309 10.831  -21.558 1.00 37.40 ? 14 GLU B CD  1 
ATOM   371  O  OE1 . GLU B 1 14 ? -20.083 10.913  -21.449 1.00 40.25 ? 14 GLU B OE1 1 
ATOM   372  O  OE2 . GLU B 1 14 ? -21.916 9.756   -21.597 1.00 36.50 ? 14 GLU B OE2 1 
ATOM   373  N  N   . TYR B 1 15 ? -21.637 15.500  -18.975 1.00 40.69 ? 15 TYR B N   1 
ATOM   374  C  CA  . TYR B 1 15 ? -21.083 16.352  -17.912 1.00 40.07 ? 15 TYR B CA  1 
ATOM   375  C  C   . TYR B 1 15 ? -20.291 15.531  -16.922 1.00 39.80 ? 15 TYR B C   1 
ATOM   376  O  O   . TYR B 1 15 ? -20.704 14.439  -16.530 1.00 39.21 ? 15 TYR B O   1 
ATOM   377  C  CB  . TYR B 1 15 ? -22.204 17.115  -17.167 1.00 41.33 ? 15 TYR B CB  1 
ATOM   378  C  CG  . TYR B 1 15 ? -23.067 17.967  -18.095 1.00 44.86 ? 15 TYR B CG  1 
ATOM   379  C  CD1 . TYR B 1 15 ? -22.701 19.283  -18.419 1.00 48.64 ? 15 TYR B CD1 1 
ATOM   380  C  CD2 . TYR B 1 15 ? -24.220 17.445  -18.683 1.00 48.10 ? 15 TYR B CD2 1 
ATOM   381  C  CE1 . TYR B 1 15 ? -23.507 20.088  -19.294 1.00 51.10 ? 15 TYR B CE1 1 
ATOM   382  C  CE2 . TYR B 1 15 ? -25.005 18.220  -19.560 1.00 50.51 ? 15 TYR B CE2 1 
ATOM   383  C  CZ  . TYR B 1 15 ? -24.643 19.530  -19.850 1.00 52.25 ? 15 TYR B CZ  1 
ATOM   384  O  OH  . TYR B 1 15 ? -25.437 20.257  -20.705 1.00 56.15 ? 15 TYR B OH  1 
ATOM   385  N  N   . SER B 1 16 ? -19.177 16.088  -16.471 1.00 39.59 ? 16 SER B N   1 
ATOM   386  C  CA  . SER B 1 16 ? -18.330 15.427  -15.505 1.00 40.55 ? 16 SER B CA  1 
ATOM   387  C  C   . SER B 1 16 ? -18.943 15.713  -14.167 1.00 39.81 ? 16 SER B C   1 
ATOM   388  O  O   . SER B 1 16 ? -19.116 16.864  -13.797 1.00 39.38 ? 16 SER B O   1 
ATOM   389  C  CB  . SER B 1 16 ? -16.896 15.970  -15.559 1.00 40.77 ? 16 SER B CB  1 
ATOM   390  O  OG  . SER B 1 16 ? -16.041 15.211  -14.716 1.00 45.01 ? 16 SER B OG  1 
ATOM   391  N  N   . TYR B 1 17 ? -19.296 14.651  -13.441 1.00 39.11 ? 17 TYR B N   1 
ATOM   392  C  CA  . TYR B 1 17 ? -19.909 14.813  -12.150 1.00 38.42 ? 17 TYR B CA  1 
ATOM   393  C  C   . TYR B 1 17 ? -19.197 13.925  -11.134 1.00 37.79 ? 17 TYR B C   1 
ATOM   394  O  O   . TYR B 1 17 ? -19.752 12.958  -10.630 1.00 37.88 ? 17 TYR B O   1 
ATOM   395  C  CB  . TYR B 1 17 ? -21.409 14.535  -12.257 1.00 38.78 ? 17 TYR B CB  1 
ATOM   396  C  CG  . TYR B 1 17 ? -22.156 14.739  -10.990 1.00 40.69 ? 17 TYR B CG  1 
ATOM   397  C  CD1 . TYR B 1 17 ? -21.830 15.775  -10.109 1.00 42.15 ? 17 TYR B CD1 1 
ATOM   398  C  CD2 . TYR B 1 17 ? -23.218 13.911  -10.651 1.00 43.11 ? 17 TYR B CD2 1 
ATOM   399  C  CE1 . TYR B 1 17 ? -22.552 15.969  -8.904  1.00 42.57 ? 17 TYR B CE1 1 
ATOM   400  C  CE2 . TYR B 1 17 ? -23.936 14.103  -9.437  1.00 45.83 ? 17 TYR B CE2 1 
ATOM   401  C  CZ  . TYR B 1 17 ? -23.598 15.119  -8.590  1.00 45.29 ? 17 TYR B CZ  1 
ATOM   402  O  OH  . TYR B 1 17 ? -24.301 15.290  -7.434  1.00 46.72 ? 17 TYR B OH  1 
ATOM   403  N  N   . GLY B 1 18 ? -17.947 14.254  -10.829 1.00 37.81 ? 18 GLY B N   1 
ATOM   404  C  CA  . GLY B 1 18 ? -17.173 13.459  -9.871  1.00 36.37 ? 18 GLY B CA  1 
ATOM   405  C  C   . GLY B 1 18 ? -16.431 12.331  -10.572 1.00 35.61 ? 18 GLY B C   1 
ATOM   406  O  O   . GLY B 1 18 ? -16.202 12.382  -11.771 1.00 33.88 ? 18 GLY B O   1 
ATOM   407  N  N   . THR B 1 19 ? -16.049 11.312  -9.822  1.00 35.82 ? 19 THR B N   1 
ATOM   408  C  CA  . THR B 1 19 ? -15.081 10.366  -10.325 1.00 37.32 ? 19 THR B CA  1 
ATOM   409  C  C   . THR B 1 19 ? -15.509 8.931   -10.047 1.00 36.93 ? 19 THR B C   1 
ATOM   410  O  O   . THR B 1 19 ? -16.424 8.696   -9.271  1.00 36.78 ? 19 THR B O   1 
ATOM   411  C  CB  . THR B 1 19 ? -13.688 10.614  -9.667  1.00 38.38 ? 19 THR B CB  1 
ATOM   412  O  OG1 . THR B 1 19 ? -13.851 10.749  -8.250  1.00 42.09 ? 19 THR B OG1 1 
ATOM   413  C  CG2 . THR B 1 19 ? -13.063 11.909  -10.174 1.00 37.67 ? 19 THR B CG2 1 
ATOM   414  N  N   . CYS B 1 20 ? -14.842 8.001   -10.725 1.00 36.72 ? 20 CYS B N   1 
ATOM   415  C  CA  . CYS B 1 20 ? -14.854 6.604   -10.415 1.00 37.71 ? 20 CYS B CA  1 
ATOM   416  C  C   . CYS B 1 20 ? -13.389 6.202   -10.349 1.00 38.07 ? 20 CYS B C   1 
ATOM   417  O  O   . CYS B 1 20 ? -12.637 6.464   -11.305 1.00 38.98 ? 20 CYS B O   1 
ATOM   418  C  CB  . CYS B 1 20 ? -15.473 5.824   -11.559 1.00 38.02 ? 20 CYS B CB  1 
ATOM   419  S  SG  . CYS B 1 20 ? -16.941 6.508   -12.308 1.00 39.89 ? 20 CYS B SG  1 
ATOM   420  N  N   . THR B 1 21 ? -12.980 5.556   -9.262  1.00 36.85 ? 21 THR B N   1 
ATOM   421  C  CA  . THR B 1 21 ? -11.604 5.113   -9.081  1.00 37.25 ? 21 THR B CA  1 
ATOM   422  C  C   . THR B 1 21 ? -11.572 3.592   -8.973  1.00 37.03 ? 21 THR B C   1 
ATOM   423  O  O   . THR B 1 21 ? -12.350 3.002   -8.239  1.00 36.11 ? 21 THR B O   1 
ATOM   424  C  CB  . THR B 1 21 ? -11.075 5.706   -7.779  1.00 38.15 ? 21 THR B CB  1 
ATOM   425  O  OG1 . THR B 1 21 ? -11.161 7.138   -7.879  1.00 40.23 ? 21 THR B OG1 1 
ATOM   426  C  CG2 . THR B 1 21 ? -9.660  5.322   -7.518  1.00 39.10 ? 21 THR B CG2 1 
ATOM   427  N  N   . VAL B 1 22 ? -10.696 2.955   -9.733  1.00 36.49 ? 22 VAL B N   1 
ATOM   428  C  CA  . VAL B 1 22 ? -10.509 1.524   -9.626  1.00 38.37 ? 22 VAL B CA  1 
ATOM   429  C  C   . VAL B 1 22 ? -9.011  1.322   -9.486  1.00 39.94 ? 22 VAL B C   1 
ATOM   430  O  O   . VAL B 1 22 ? -8.259  1.706   -10.383 1.00 40.60 ? 22 VAL B O   1 
ATOM   431  C  CB  . VAL B 1 22 ? -11.127 0.775   -10.853 1.00 38.18 ? 22 VAL B CB  1 
ATOM   432  C  CG1 . VAL B 1 22 ? -10.915 -0.704  -10.763 1.00 37.51 ? 22 VAL B CG1 1 
ATOM   433  C  CG2 . VAL B 1 22 ? -12.621 1.068   -10.950 1.00 35.68 ? 22 VAL B CG2 1 
ATOM   434  N  N   . MET B 1 23 ? -8.579  0.804   -8.338  1.00 42.21 ? 23 MET B N   1 
ATOM   435  C  CA  . MET B 1 23 ? -7.177  0.502   -8.095  1.00 46.81 ? 23 MET B CA  1 
ATOM   436  C  C   . MET B 1 23 ? -6.338  1.748   -8.225  1.00 47.84 ? 23 MET B C   1 
ATOM   437  O  O   . MET B 1 23 ? -5.212  1.660   -8.718  1.00 49.57 ? 23 MET B O   1 
ATOM   438  C  CB  . MET B 1 23 ? -6.623  -0.486  -9.130  1.00 48.47 ? 23 MET B CB  1 
ATOM   439  C  CG  . MET B 1 23 ? -7.165  -1.888  -9.142  1.00 52.68 ? 23 MET B CG  1 
ATOM   440  S  SD  . MET B 1 23 ? -6.610  -2.816  -7.726  1.00 61.62 ? 23 MET B SD  1 
ATOM   441  C  CE  . MET B 1 23 ? -7.827  -2.318  -6.555  1.00 54.70 ? 23 MET B CE  1 
ATOM   442  N  N   . GLY B 1 24 ? -6.893  2.895   -7.846  1.00 47.50 ? 24 GLY B N   1 
ATOM   443  C  CA  . GLY B 1 24 ? -6.200  4.200   -7.974  1.00 49.08 ? 24 GLY B CA  1 
ATOM   444  C  C   . GLY B 1 24 ? -5.964  4.835   -9.360  1.00 49.37 ? 24 GLY B C   1 
ATOM   445  O  O   . GLY B 1 24 ? -5.190  5.798   -9.474  1.00 50.05 ? 24 GLY B O   1 
ATOM   446  N  N   . ILE B 1 25 ? -6.571  4.275   -10.407 1.00 49.09 ? 25 ILE B N   1 
ATOM   447  C  CA  . ILE B 1 25 ? -6.704  4.967   -11.681 1.00 48.63 ? 25 ILE B CA  1 
ATOM   448  C  C   . ILE B 1 25 ? -8.034  5.685   -11.688 1.00 46.95 ? 25 ILE B C   1 
ATOM   449  O  O   . ILE B 1 25 ? -9.109  5.087   -11.554 1.00 44.41 ? 25 ILE B O   1 
ATOM   450  C  CB  . ILE B 1 25 ? -6.608  4.018   -12.877 1.00 49.60 ? 25 ILE B CB  1 
ATOM   451  C  CG1 . ILE B 1 25 ? -5.166  3.578   -13.047 1.00 53.38 ? 25 ILE B CG1 1 
ATOM   452  C  CG2 . ILE B 1 25 ? -7.076  4.744   -14.165 1.00 50.17 ? 25 ILE B CG2 1 
ATOM   453  C  CD1 . ILE B 1 25 ? -5.018  2.347   -13.917 1.00 58.10 ? 25 ILE B CD1 1 
ATOM   454  N  N   . ASN B 1 26 ? -7.942  6.987   -11.829 1.00 46.42 ? 26 ASN B N   1 
ATOM   455  C  CA  . ASN B 1 26 ? -9.060  7.841   -11.626 1.00 46.65 ? 26 ASN B CA  1 
ATOM   456  C  C   . ASN B 1 26 ? -9.795  8.190   -12.931 1.00 45.59 ? 26 ASN B C   1 
ATOM   457  O  O   . ASN B 1 26 ? -9.202  8.768   -13.851 1.00 46.76 ? 26 ASN B O   1 
ATOM   458  C  CB  . ASN B 1 26 ? -8.534  9.113   -10.972 1.00 47.02 ? 26 ASN B CB  1 
ATOM   459  C  CG  . ASN B 1 26 ? -9.396  9.569   -9.859  1.00 50.05 ? 26 ASN B CG  1 
ATOM   460  O  OD1 . ASN B 1 26 ? -9.781  8.766   -8.993  1.00 53.05 ? 26 ASN B OD1 1 
ATOM   461  N  ND2 . ASN B 1 26 ? -9.700  10.869  -9.837  1.00 51.53 ? 26 ASN B ND2 1 
ATOM   462  N  N   . TRP B 1 27 ? -11.068 7.847   -13.024 1.00 43.22 ? 27 TRP B N   1 
ATOM   463  C  CA  . TRP B 1 27 ? -11.835 8.072   -14.249 1.00 41.96 ? 27 TRP B CA  1 
ATOM   464  C  C   . TRP B 1 27 ? -12.915 9.113   -13.968 1.00 40.61 ? 27 TRP B C   1 
ATOM   465  O  O   . TRP B 1 27 ? -13.060 9.501   -12.829 1.00 38.59 ? 27 TRP B O   1 
ATOM   466  C  CB  . TRP B 1 27 ? -12.463 6.760   -14.715 1.00 43.27 ? 27 TRP B CB  1 
ATOM   467  C  CG  . TRP B 1 27 ? -11.563 5.922   -15.658 1.00 47.05 ? 27 TRP B CG  1 
ATOM   468  C  CD1 . TRP B 1 27 ? -10.205 6.064   -15.864 1.00 49.21 ? 27 TRP B CD1 1 
ATOM   469  C  CD2 . TRP B 1 27 ? -11.980 4.829   -16.485 1.00 47.86 ? 27 TRP B CD2 1 
ATOM   470  N  NE1 . TRP B 1 27 ? -9.768  5.135   -16.781 1.00 51.33 ? 27 TRP B NE1 1 
ATOM   471  C  CE2 . TRP B 1 27 ? -10.839 4.367   -17.176 1.00 52.22 ? 27 TRP B CE2 1 
ATOM   472  C  CE3 . TRP B 1 27 ? -13.214 4.221   -16.735 1.00 49.12 ? 27 TRP B CE3 1 
ATOM   473  C  CZ2 . TRP B 1 27 ? -10.901 3.299   -18.089 1.00 53.78 ? 27 TRP B CZ2 1 
ATOM   474  C  CZ3 . TRP B 1 27 ? -13.281 3.177   -17.635 1.00 50.86 ? 27 TRP B CZ3 1 
ATOM   475  C  CH2 . TRP B 1 27 ? -12.134 2.724   -18.307 1.00 53.53 ? 27 TRP B CH2 1 
ATOM   476  N  N   . ARG B 1 28 ? -13.661 9.541   -14.988 1.00 38.91 ? 28 ARG B N   1 
ATOM   477  C  CA  . ARG B 1 28 ? -14.749 10.509  -14.763 1.00 39.08 ? 28 ARG B CA  1 
ATOM   478  C  C   . ARG B 1 28 ? -16.115 9.828   -14.700 1.00 37.16 ? 28 ARG B C   1 
ATOM   479  O  O   . ARG B 1 28 ? -16.348 8.810   -15.358 1.00 37.91 ? 28 ARG B O   1 
ATOM   480  C  CB  . ARG B 1 28 ? -14.715 11.652  -15.808 1.00 39.39 ? 28 ARG B CB  1 
ATOM   481  C  CG  . ARG B 1 28 ? -13.416 12.547  -15.759 1.00 45.29 ? 28 ARG B CG  1 
ATOM   482  C  CD  . ARG B 1 28 ? -13.085 13.070  -14.318 1.00 54.89 ? 28 ARG B CD  1 
ATOM   483  N  NE  . ARG B 1 28 ? -11.755 13.712  -14.150 1.00 62.21 ? 28 ARG B NE  1 
ATOM   484  C  CZ  . ARG B 1 28 ? -10.663 13.112  -13.640 1.00 64.47 ? 28 ARG B CZ  1 
ATOM   485  N  NH1 . ARG B 1 28 ? -10.701 11.837  -13.250 1.00 64.36 ? 28 ARG B NH1 1 
ATOM   486  N  NH2 . ARG B 1 28 ? -9.519  13.791  -13.525 1.00 65.79 ? 28 ARG B NH2 1 
ATOM   487  N  N   . PHE B 1 29 ? -16.991 10.360  -13.858 1.00 36.60 ? 29 PHE B N   1 
ATOM   488  C  CA  . PHE B 1 29 ? -18.379 9.932   -13.840 1.00 35.30 ? 29 PHE B CA  1 
ATOM   489  C  C   . PHE B 1 29 ? -19.112 10.862  -14.763 1.00 35.11 ? 29 PHE B C   1 
ATOM   490  O  O   . PHE B 1 29 ? -19.329 11.991  -14.390 1.00 35.23 ? 29 PHE B O   1 
ATOM   491  C  CB  . PHE B 1 29 ? -18.921 10.084  -12.432 1.00 35.31 ? 29 PHE B CB  1 
ATOM   492  C  CG  . PHE B 1 29 ? -20.169 9.343   -12.175 1.00 31.40 ? 29 PHE B CG  1 
ATOM   493  C  CD1 . PHE B 1 29 ? -20.168 7.946   -12.176 1.00 33.68 ? 29 PHE B CD1 1 
ATOM   494  C  CD2 . PHE B 1 29 ? -21.336 10.032  -11.880 1.00 33.56 ? 29 PHE B CD2 1 
ATOM   495  C  CE1 . PHE B 1 29 ? -21.317 7.244   -11.905 1.00 32.72 ? 29 PHE B CE1 1 
ATOM   496  C  CE2 . PHE B 1 29 ? -22.501 9.367   -11.577 1.00 34.11 ? 29 PHE B CE2 1 
ATOM   497  C  CZ  . PHE B 1 29 ? -22.503 7.953   -11.609 1.00 35.28 ? 29 PHE B CZ  1 
ATOM   498  N  N   . CYS B 1 30 ? -19.502 10.375  -15.942 1.00 35.61 ? 30 CYS B N   1 
ATOM   499  C  CA  . CYS B 1 30 ? -20.063 11.191  -17.024 1.00 35.95 ? 30 CYS B CA  1 
ATOM   500  C  C   . CYS B 1 30 ? -21.586 11.052  -17.170 1.00 37.77 ? 30 CYS B C   1 
ATOM   501  O  O   . CYS B 1 30 ? -22.078 9.979   -17.456 1.00 38.36 ? 30 CYS B O   1 
ATOM   502  C  CB  . CYS B 1 30 ? -19.382 10.780  -18.335 1.00 36.26 ? 30 CYS B CB  1 
ATOM   503  S  SG  . CYS B 1 30 ? -17.586 10.902  -18.233 1.00 35.81 ? 30 CYS B SG  1 
ATOM   504  N  N   . CYS B 1 31 ? -22.342 12.125  -16.948 1.00 38.41 ? 31 CYS B N   1 
ATOM   505  C  CA  . CYS B 1 31 ? -23.799 12.018  -17.003 1.00 40.67 ? 31 CYS B CA  1 
ATOM   506  C  C   . CYS B 1 31 ? -24.412 12.854  -18.106 1.00 42.00 ? 31 CYS B C   1 
ATOM   507  O  O   . CYS B 1 31 ? -23.867 13.878  -18.511 1.00 42.40 ? 31 CYS B O   1 
ATOM   508  C  CB  . CYS B 1 31 ? -24.448 12.390  -15.647 1.00 40.45 ? 31 CYS B CB  1 
ATOM   509  S  SG  . CYS B 1 31 ? -23.718 11.453  -14.315 1.00 39.15 ? 31 CYS B SG  1 
ATOM   510  N  N   . LEU B 1 32 ? -25.562 12.397  -18.591 1.00 44.05 ? 32 LEU B N   1 
ATOM   511  C  CA  . LEU B 1 32 ? -26.364 13.184  -19.495 1.00 45.87 ? 32 LEU B CA  1 
ATOM   512  C  C   . LEU B 1 32 ? -27.840 12.906  -19.235 1.00 46.33 ? 32 LEU B C   1 
ATOM   513  O  O   . LEU B 1 32 ? -28.253 11.916  -18.640 1.00 44.81 ? 32 LEU B O   1 
ATOM   514  C  CB  . LEU B 1 32 ? -25.969 12.902  -20.959 1.00 47.09 ? 32 LEU B CB  1 
ATOM   515  C  CG  . LEU B 1 32 ? -26.502 11.667  -21.703 1.00 49.30 ? 32 LEU B CG  1 
ATOM   516  C  CD1 . LEU B 1 32 ? -26.857 12.079  -23.152 1.00 53.07 ? 32 LEU B CD1 1 
ATOM   517  C  CD2 . LEU B 1 32 ? -25.546 10.465  -21.671 1.00 51.21 ? 32 LEU B CD2 1 
ATOM   518  O  OXT . LEU B 1 32 ? -28.671 13.701  -19.630 1.00 46.76 ? 32 LEU B OXT 1 
ATOM   519  N  N   . ALA C 1 1  ? -23.865 0.951   -17.147 1.00 46.30 ? 1  ALA C N   1 
ATOM   520  C  CA  . ALA C 1 1  ? -24.524 2.261   -17.046 1.00 45.05 ? 1  ALA C CA  1 
ATOM   521  C  C   . ALA C 1 1  ? -25.209 2.404   -15.690 1.00 43.56 ? 1  ALA C C   1 
ATOM   522  O  O   . ALA C 1 1  ? -25.787 1.441   -15.174 1.00 43.91 ? 1  ALA C O   1 
ATOM   523  C  CB  . ALA C 1 1  ? -25.543 2.444   -18.173 1.00 45.76 ? 1  ALA C CB  1 
ATOM   524  N  N   . PHE C 1 2  ? -25.160 3.617   -15.134 1.00 41.72 ? 2  PHE C N   1 
ATOM   525  C  CA  . PHE C 1 2  ? -25.869 3.934   -13.900 1.00 40.60 ? 2  PHE C CA  1 
ATOM   526  C  C   . PHE C 1 2  ? -27.069 4.785   -14.269 1.00 39.46 ? 2  PHE C C   1 
ATOM   527  O  O   . PHE C 1 2  ? -26.991 5.628   -15.188 1.00 39.69 ? 2  PHE C O   1 
ATOM   528  C  CB  . PHE C 1 2  ? -24.936 4.661   -12.899 1.00 40.55 ? 2  PHE C CB  1 
ATOM   529  C  CG  . PHE C 1 2  ? -23.688 3.902   -12.584 1.00 42.41 ? 2  PHE C CG  1 
ATOM   530  C  CD1 . PHE C 1 2  ? -22.511 4.160   -13.267 1.00 45.90 ? 2  PHE C CD1 1 
ATOM   531  C  CD2 . PHE C 1 2  ? -23.695 2.882   -11.640 1.00 45.74 ? 2  PHE C CD2 1 
ATOM   532  C  CE1 . PHE C 1 2  ? -21.346 3.407   -12.997 1.00 48.96 ? 2  PHE C CE1 1 
ATOM   533  C  CE2 . PHE C 1 2  ? -22.535 2.139   -11.361 1.00 47.56 ? 2  PHE C CE2 1 
ATOM   534  C  CZ  . PHE C 1 2  ? -21.367 2.403   -12.040 1.00 48.46 ? 2  PHE C CZ  1 
ATOM   535  N  N   . THR C 1 3  ? -28.207 4.522   -13.618 1.00 38.47 ? 3  THR C N   1 
ATOM   536  C  CA  . THR C 1 3  ? -29.399 5.370   -13.764 1.00 36.94 ? 3  THR C CA  1 
ATOM   537  C  C   . THR C 1 3  ? -29.629 6.218   -12.519 1.00 35.02 ? 3  THR C C   1 
ATOM   538  O  O   . THR C 1 3  ? -29.723 5.677   -11.437 1.00 35.19 ? 3  THR C O   1 
ATOM   539  C  CB  . THR C 1 3  ? -30.652 4.537   -14.116 1.00 38.51 ? 3  THR C CB  1 
ATOM   540  O  OG1 . THR C 1 3  ? -30.431 3.914   -15.371 1.00 39.46 ? 3  THR C OG1 1 
ATOM   541  C  CG2 . THR C 1 3  ? -31.872 5.413   -14.292 1.00 36.97 ? 3  THR C CG2 1 
ATOM   542  N  N   . CYS C 1 4  ? -29.753 7.544   -12.690 1.00 33.89 ? 4  CYS C N   1 
ATOM   543  C  CA  . CYS C 1 4  ? -29.940 8.455   -11.572 1.00 31.63 ? 4  CYS C CA  1 
ATOM   544  C  C   . CYS C 1 4  ? -31.182 9.306   -11.726 1.00 32.38 ? 4  CYS C C   1 
ATOM   545  O  O   . CYS C 1 4  ? -31.564 9.667   -12.839 1.00 33.38 ? 4  CYS C O   1 
ATOM   546  C  CB  . CYS C 1 4  ? -28.696 9.339   -11.394 1.00 30.56 ? 4  CYS C CB  1 
ATOM   547  S  SG  . CYS C 1 4  ? -27.103 8.395   -11.328 1.00 28.57 ? 4  CYS C SG  1 
ATOM   548  N  N   . HIS C 1 5  ? -31.821 9.566   -10.595 1.00 32.50 ? 5  HIS C N   1 
ATOM   549  C  CA  . HIS C 1 5  ? -33.022 10.397  -10.458 1.00 32.34 ? 5  HIS C CA  1 
ATOM   550  C  C   . HIS C 1 5  ? -32.771 11.337  -9.307  1.00 31.89 ? 5  HIS C C   1 
ATOM   551  O  O   . HIS C 1 5  ? -32.132 10.954  -8.325  1.00 29.76 ? 5  HIS C O   1 
ATOM   552  C  CB  . HIS C 1 5  ? -34.267 9.516   -10.121 1.00 33.84 ? 5  HIS C CB  1 
ATOM   553  C  CG  . HIS C 1 5  ? -34.625 8.539   -11.209 1.00 35.45 ? 5  HIS C CG  1 
ATOM   554  N  ND1 . HIS C 1 5  ? -34.093 7.258   -11.281 1.00 35.33 ? 5  HIS C ND1 1 
ATOM   555  C  CD2 . HIS C 1 5  ? -35.447 8.668   -12.273 1.00 36.22 ? 5  HIS C CD2 1 
ATOM   556  C  CE1 . HIS C 1 5  ? -34.548 6.662   -12.365 1.00 36.01 ? 5  HIS C CE1 1 
ATOM   557  N  NE2 . HIS C 1 5  ? -35.372 7.490   -12.979 1.00 40.41 ? 5  HIS C NE2 1 
ATOM   558  N  N   . CYS C 1 6  ? -33.287 12.556  -9.433  1.00 32.05 ? 6  CYS C N   1 
ATOM   559  C  CA  . CYS C 1 6  ? -33.466 13.496  -8.337  1.00 32.74 ? 6  CYS C CA  1 
ATOM   560  C  C   . CYS C 1 6  ? -34.749 13.121  -7.588  1.00 33.51 ? 6  CYS C C   1 
ATOM   561  O  O   . CYS C 1 6  ? -35.807 13.133  -8.173  1.00 34.80 ? 6  CYS C O   1 
ATOM   562  C  CB  . CYS C 1 6  ? -33.584 14.936  -8.890  1.00 31.72 ? 6  CYS C CB  1 
ATOM   563  S  SG  . CYS C 1 6  ? -32.062 15.428  -9.781  1.00 32.91 ? 6  CYS C SG  1 
ATOM   564  N  N   . ARG C 1 7  ? -34.649 12.811  -6.301  1.00 33.34 ? 7  ARG C N   1 
ATOM   565  C  CA  . ARG C 1 7  ? -35.793 12.412  -5.485  1.00 34.66 ? 7  ARG C CA  1 
ATOM   566  C  C   . ARG C 1 7  ? -35.687 13.043  -4.122  1.00 34.90 ? 7  ARG C C   1 
ATOM   567  O  O   . ARG C 1 7  ? -34.600 13.359  -3.703  1.00 34.47 ? 7  ARG C O   1 
ATOM   568  C  CB  . ARG C 1 7  ? -35.776 10.913  -5.216  1.00 34.66 ? 7  ARG C CB  1 
ATOM   569  C  CG  . ARG C 1 7  ? -35.503 9.989   -6.361  1.00 34.33 ? 7  ARG C CG  1 
ATOM   570  C  CD  . ARG C 1 7  ? -35.695 8.548   -5.824  1.00 33.92 ? 7  ARG C CD  1 
ATOM   571  N  NE  . ARG C 1 7  ? -35.500 7.567   -6.875  1.00 33.32 ? 7  ARG C NE  1 
ATOM   572  C  CZ  . ARG C 1 7  ? -36.365 7.346   -7.849  1.00 36.49 ? 7  ARG C CZ  1 
ATOM   573  N  NH1 . ARG C 1 7  ? -37.530 8.013   -7.889  1.00 38.31 ? 7  ARG C NH1 1 
ATOM   574  N  NH2 . ARG C 1 7  ? -36.076 6.426   -8.754  1.00 38.52 ? 7  ARG C NH2 1 
ATOM   575  N  N   . ARG C 1 8  ? -36.791 13.127  -3.385  1.00 34.78 ? 8  ARG C N   1 
ATOM   576  C  CA  . ARG C 1 8  ? -36.728 13.489  -1.973  1.00 34.54 ? 8  ARG C CA  1 
ATOM   577  C  C   . ARG C 1 8  ? -36.034 12.413  -1.107  1.00 33.30 ? 8  ARG C C   1 
ATOM   578  O  O   . ARG C 1 8  ? -35.254 12.758  -0.229  1.00 33.71 ? 8  ARG C O   1 
ATOM   579  C  CB  . ARG C 1 8  ? -38.136 13.886  -1.475  1.00 35.92 ? 8  ARG C CB  1 
ATOM   580  C  CG  . ARG C 1 8  ? -38.499 13.631  -0.025  1.00 40.03 ? 8  ARG C CG  1 
ATOM   581  C  CD  . ARG C 1 8  ? -39.693 14.518  0.382   1.00 41.89 ? 8  ARG C CD  1 
ATOM   582  N  NE  . ARG C 1 8  ? -39.526 14.956  1.756   1.00 44.69 ? 8  ARG C NE  1 
ATOM   583  C  CZ  . ARG C 1 8  ? -39.056 16.150  2.125   1.00 42.80 ? 8  ARG C CZ  1 
ATOM   584  N  NH1 . ARG C 1 8  ? -38.755 17.072  1.217   1.00 39.49 ? 8  ARG C NH1 1 
ATOM   585  N  NH2 . ARG C 1 8  ? -38.918 16.439  3.425   1.00 44.27 ? 8  ARG C NH2 1 
ATOM   586  N  N   . SER C 1 9  ? -36.307 11.130  -1.390  1.00 32.10 ? 9  SER C N   1 
ATOM   587  C  CA  . SER C 1 9  ? -35.797 9.916   -0.690  1.00 30.74 ? 9  SER C CA  1 
ATOM   588  C  C   . SER C 1 9  ? -35.149 8.938   -1.652  1.00 29.19 ? 9  SER C C   1 
ATOM   589  O  O   . SER C 1 9  ? -35.657 8.732   -2.768  1.00 29.57 ? 9  SER C O   1 
ATOM   590  C  CB  . SER C 1 9  ? -36.950 9.145   -0.078  1.00 32.49 ? 9  SER C CB  1 
ATOM   591  O  OG  . SER C 1 9  ? -37.093 9.539   1.261   1.00 39.62 ? 9  SER C OG  1 
ATOM   592  N  N   . CYS C 1 10 ? -34.064 8.283   -1.256  1.00 24.65 ? 10 CYS C N   1 
ATOM   593  C  CA  . CYS C 1 10 ? -33.558 7.229   -2.166  1.00 25.46 ? 10 CYS C CA  1 
ATOM   594  C  C   . CYS C 1 10 ? -34.204 5.909   -1.831  1.00 25.88 ? 10 CYS C C   1 
ATOM   595  O  O   . CYS C 1 10 ? -34.557 5.651   -0.685  1.00 26.56 ? 10 CYS C O   1 
ATOM   596  C  CB  . CYS C 1 10 ? -32.038 7.134   -2.253  1.00 23.05 ? 10 CYS C CB  1 
ATOM   597  S  SG  . CYS C 1 10 ? -31.127 8.678   -2.811  1.00 21.97 ? 10 CYS C SG  1 
ATOM   598  N  N   . TYR C 1 11 ? -34.443 5.132   -2.871  1.00 27.62 ? 11 TYR C N   1 
ATOM   599  C  CA  . TYR C 1 11 ? -35.034 3.832   -2.750  1.00 31.23 ? 11 TYR C CA  1 
ATOM   600  C  C   . TYR C 1 11 ? -33.987 2.884   -2.234  1.00 31.07 ? 11 TYR C C   1 
ATOM   601  O  O   . TYR C 1 11 ? -32.768 3.176   -2.386  1.00 29.30 ? 11 TYR C O   1 
ATOM   602  C  CB  . TYR C 1 11 ? -35.529 3.406   -4.127  1.00 32.51 ? 11 TYR C CB  1 
ATOM   603  C  CG  . TYR C 1 11 ? -36.851 4.044   -4.385  1.00 38.78 ? 11 TYR C CG  1 
ATOM   604  C  CD1 . TYR C 1 11 ? -37.996 3.582   -3.727  1.00 43.70 ? 11 TYR C CD1 1 
ATOM   605  C  CD2 . TYR C 1 11 ? -36.984 5.136   -5.238  1.00 41.75 ? 11 TYR C CD2 1 
ATOM   606  C  CE1 . TYR C 1 11 ? -39.239 4.180   -3.926  1.00 45.49 ? 11 TYR C CE1 1 
ATOM   607  C  CE2 . TYR C 1 11 ? -38.233 5.740   -5.455  1.00 43.39 ? 11 TYR C CE2 1 
ATOM   608  C  CZ  . TYR C 1 11 ? -39.370 5.254   -4.793  1.00 48.32 ? 11 TYR C CZ  1 
ATOM   609  O  OH  . TYR C 1 11 ? -40.659 5.805   -4.993  1.00 50.73 ? 11 TYR C OH  1 
ATOM   610  N  N   . SER C 1 12 ? -34.449 1.788   -1.607  1.00 31.34 ? 12 SER C N   1 
ATOM   611  C  CA  . SER C 1 12 ? -33.567 0.789   -0.979  1.00 32.23 ? 12 SER C CA  1 
ATOM   612  C  C   . SER C 1 12 ? -32.552 0.185   -1.951  1.00 32.87 ? 12 SER C C   1 
ATOM   613  O  O   . SER C 1 12 ? -31.541 -0.355  -1.524  1.00 34.06 ? 12 SER C O   1 
ATOM   614  C  CB  . SER C 1 12 ? -34.401 -0.364  -0.369  1.00 33.02 ? 12 SER C CB  1 
ATOM   615  O  OG  . SER C 1 12 ? -34.965 -1.164  -1.390  1.00 33.97 ? 12 SER C OG  1 
ATOM   616  N  N   . THR C 1 13 ? -32.851 0.276   -3.241  1.00 32.35 ? 13 THR C N   1 
ATOM   617  C  CA  . THR C 1 13 ? -32.004 -0.190  -4.333  1.00 35.37 ? 13 THR C CA  1 
ATOM   618  C  C   . THR C 1 13 ? -30.939 0.862   -4.800  1.00 33.65 ? 13 THR C C   1 
ATOM   619  O  O   . THR C 1 13 ? -30.112 0.562   -5.691  1.00 35.02 ? 13 THR C O   1 
ATOM   620  C  CB  . THR C 1 13 ? -32.908 -0.467  -5.595  1.00 35.10 ? 13 THR C CB  1 
ATOM   621  O  OG1 . THR C 1 13 ? -33.812 0.630   -5.761  1.00 37.71 ? 13 THR C OG1 1 
ATOM   622  C  CG2 . THR C 1 13 ? -33.734 -1.717  -5.438  1.00 39.68 ? 13 THR C CG2 1 
ATOM   623  N  N   . GLU C 1 14 ? -30.985 2.089   -4.259  1.00 31.66 ? 14 GLU C N   1 
ATOM   624  C  CA  . GLU C 1 14 ? -30.210 3.184   -4.853  1.00 28.67 ? 14 GLU C CA  1 
ATOM   625  C  C   . GLU C 1 14 ? -29.133 3.688   -3.904  1.00 28.54 ? 14 GLU C C   1 
ATOM   626  O  O   . GLU C 1 14 ? -29.161 3.359   -2.706  1.00 28.81 ? 14 GLU C O   1 
ATOM   627  C  CB  . GLU C 1 14 ? -31.160 4.299   -5.219  1.00 29.37 ? 14 GLU C CB  1 
ATOM   628  C  CG  . GLU C 1 14 ? -32.077 3.968   -6.395  1.00 27.41 ? 14 GLU C CG  1 
ATOM   629  C  CD  . GLU C 1 14 ? -33.112 5.012   -6.589  1.00 28.51 ? 14 GLU C CD  1 
ATOM   630  O  OE1 . GLU C 1 14 ? -33.443 5.728   -5.628  1.00 29.85 ? 14 GLU C OE1 1 
ATOM   631  O  OE2 . GLU C 1 14 ? -33.611 5.167   -7.683  1.00 32.75 ? 14 GLU C OE2 1 
ATOM   632  N  N   . TYR C 1 15 ? -28.226 4.538   -4.391  1.00 26.53 ? 15 TYR C N   1 
ATOM   633  C  CA  . TYR C 1 15 ? -27.221 5.165   -3.508  1.00 25.91 ? 15 TYR C CA  1 
ATOM   634  C  C   . TYR C 1 15 ? -27.374 6.656   -3.621  1.00 24.30 ? 15 TYR C C   1 
ATOM   635  O  O   . TYR C 1 15 ? -27.559 7.211   -4.725  1.00 23.06 ? 15 TYR C O   1 
ATOM   636  C  CB  . TYR C 1 15 ? -25.795 4.762   -3.921  1.00 26.56 ? 15 TYR C CB  1 
ATOM   637  C  CG  . TYR C 1 15 ? -25.601 3.247   -3.860  1.00 30.84 ? 15 TYR C CG  1 
ATOM   638  C  CD1 . TYR C 1 15 ? -25.932 2.433   -4.968  1.00 32.65 ? 15 TYR C CD1 1 
ATOM   639  C  CD2 . TYR C 1 15 ? -25.138 2.634   -2.689  1.00 29.52 ? 15 TYR C CD2 1 
ATOM   640  C  CE1 . TYR C 1 15 ? -25.797 1.038   -4.921  1.00 34.04 ? 15 TYR C CE1 1 
ATOM   641  C  CE2 . TYR C 1 15 ? -25.001 1.242   -2.631  1.00 33.44 ? 15 TYR C CE2 1 
ATOM   642  C  CZ  . TYR C 1 15 ? -25.354 0.454   -3.748  1.00 37.21 ? 15 TYR C CZ  1 
ATOM   643  O  OH  . TYR C 1 15 ? -25.213 -0.923  -3.667  1.00 38.06 ? 15 TYR C OH  1 
ATOM   644  N  N   . SER C 1 16 ? -27.293 7.298   -2.472  1.00 23.21 ? 16 SER C N   1 
ATOM   645  C  CA  . SER C 1 16 ? -27.319 8.756   -2.442  1.00 22.81 ? 16 SER C CA  1 
ATOM   646  C  C   . SER C 1 16 ? -25.971 9.322   -2.852  1.00 22.98 ? 16 SER C C   1 
ATOM   647  O  O   . SER C 1 16 ? -25.004 9.378   -2.066  1.00 23.82 ? 16 SER C O   1 
ATOM   648  C  CB  . SER C 1 16 ? -27.782 9.308   -1.095  1.00 23.10 ? 16 SER C CB  1 
ATOM   649  O  OG  . SER C 1 16 ? -28.194 10.697  -1.199  1.00 22.57 ? 16 SER C OG  1 
ATOM   650  N  N   . TYR C 1 17 ? -25.919 9.824   -4.067  1.00 22.83 ? 17 TYR C N   1 
ATOM   651  C  CA  . TYR C 1 17 ? -24.652 10.326  -4.604  1.00 25.70 ? 17 TYR C CA  1 
ATOM   652  C  C   . TYR C 1 17 ? -24.390 11.833  -4.498  1.00 26.75 ? 17 TYR C C   1 
ATOM   653  O  O   . TYR C 1 17 ? -23.276 12.238  -4.140  1.00 31.15 ? 17 TYR C O   1 
ATOM   654  C  CB  . TYR C 1 17 ? -24.481 9.786   -6.050  1.00 25.50 ? 17 TYR C CB  1 
ATOM   655  C  CG  . TYR C 1 17 ? -23.165 10.146  -6.722  1.00 26.11 ? 17 TYR C CG  1 
ATOM   656  C  CD1 . TYR C 1 17 ? -21.960 9.735   -6.202  1.00 31.18 ? 17 TYR C CD1 1 
ATOM   657  C  CD2 . TYR C 1 17 ? -23.137 10.953  -7.862  1.00 33.07 ? 17 TYR C CD2 1 
ATOM   658  C  CE1 . TYR C 1 17 ? -20.730 10.060  -6.800  1.00 31.59 ? 17 TYR C CE1 1 
ATOM   659  C  CE2 . TYR C 1 17 ? -21.888 11.316  -8.474  1.00 33.24 ? 17 TYR C CE2 1 
ATOM   660  C  CZ  . TYR C 1 17 ? -20.693 10.825  -7.937  1.00 34.37 ? 17 TYR C CZ  1 
ATOM   661  O  OH  . TYR C 1 17 ? -19.448 11.144  -8.507  1.00 34.57 ? 17 TYR C OH  1 
ATOM   662  N  N   . GLY C 1 18 ? -25.353 12.672  -4.806  1.00 27.23 ? 18 GLY C N   1 
ATOM   663  C  CA  . GLY C 1 18 ? -25.282 14.095  -4.527  1.00 26.64 ? 18 GLY C CA  1 
ATOM   664  C  C   . GLY C 1 18 ? -26.656 14.715  -4.390  1.00 26.81 ? 18 GLY C C   1 
ATOM   665  O  O   . GLY C 1 18 ? -27.591 14.041  -3.919  1.00 27.37 ? 18 GLY C O   1 
ATOM   666  N  N   . THR C 1 19 ? -26.779 15.997  -4.781  1.00 28.14 ? 19 THR C N   1 
ATOM   667  C  CA  . THR C 1 19 ? -28.024 16.775  -4.622  1.00 29.08 ? 19 THR C CA  1 
ATOM   668  C  C   . THR C 1 19 ? -28.428 17.438  -5.929  1.00 29.19 ? 19 THR C C   1 
ATOM   669  O  O   . THR C 1 19 ? -27.576 17.651  -6.813  1.00 30.60 ? 19 THR C O   1 
ATOM   670  C  CB  . THR C 1 19 ? -27.939 17.872  -3.448  1.00 28.86 ? 19 THR C CB  1 
ATOM   671  O  OG1 . THR C 1 19 ? -27.045 18.932  -3.805  1.00 32.69 ? 19 THR C OG1 1 
ATOM   672  C  CG2 . THR C 1 19 ? -27.410 17.244  -2.154  1.00 29.58 ? 19 THR C CG2 1 
ATOM   673  N  N   . CYS C 1 20 ? -29.733 17.622  -6.107  1.00 29.02 ? 20 CYS C N   1 
ATOM   674  C  CA  . CYS C 1 20 ? -30.250 18.378  -7.220  1.00 28.96 ? 20 CYS C CA  1 
ATOM   675  C  C   . CYS C 1 20 ? -30.903 19.545  -6.532  1.00 28.97 ? 20 CYS C C   1 
ATOM   676  O  O   . CYS C 1 20 ? -31.885 19.353  -5.827  1.00 31.65 ? 20 CYS C O   1 
ATOM   677  C  CB  . CYS C 1 20 ? -31.298 17.591  -7.989  1.00 28.37 ? 20 CYS C CB  1 
ATOM   678  S  SG  . CYS C 1 20 ? -30.900 15.883  -8.218  1.00 28.06 ? 20 CYS C SG  1 
ATOM   679  N  N   . THR C 1 21 ? -30.378 20.747  -6.723  1.00 28.24 ? 21 THR C N   1 
ATOM   680  C  CA  . THR C 1 21 ? -30.960 21.907  -6.094  1.00 27.74 ? 21 THR C CA  1 
ATOM   681  C  C   . THR C 1 21 ? -31.834 22.617  -7.142  1.00 28.80 ? 21 THR C C   1 
ATOM   682  O  O   . THR C 1 21 ? -31.361 22.957  -8.232  1.00 28.68 ? 21 THR C O   1 
ATOM   683  C  CB  . THR C 1 21 ? -29.864 22.828  -5.560  1.00 28.36 ? 21 THR C CB  1 
ATOM   684  O  OG1 . THR C 1 21 ? -28.921 22.064  -4.781  1.00 27.99 ? 21 THR C OG1 1 
ATOM   685  C  CG2 . THR C 1 21 ? -30.434 23.930  -4.671  1.00 29.82 ? 21 THR C CG2 1 
ATOM   686  N  N   . VAL C 1 22 ? -33.097 22.860  -6.812  1.00 28.40 ? 22 VAL C N   1 
ATOM   687  C  CA  . VAL C 1 22 ? -33.970 23.607  -7.699  1.00 30.40 ? 22 VAL C CA  1 
ATOM   688  C  C   . VAL C 1 22 ? -34.570 24.777  -6.941  1.00 31.40 ? 22 VAL C C   1 
ATOM   689  O  O   . VAL C 1 22 ? -35.402 24.603  -6.047  1.00 31.99 ? 22 VAL C O   1 
ATOM   690  C  CB  . VAL C 1 22 ? -35.087 22.722  -8.364  1.00 30.66 ? 22 VAL C CB  1 
ATOM   691  C  CG1 . VAL C 1 22 ? -36.032 23.569  -9.188  1.00 32.00 ? 22 VAL C CG1 1 
ATOM   692  C  CG2 . VAL C 1 22 ? -34.473 21.663  -9.226  1.00 34.41 ? 22 VAL C CG2 1 
ATOM   693  N  N   . MET C 1 23 ? -34.140 25.968  -7.339  1.00 32.61 ? 23 MET C N   1 
ATOM   694  C  CA  . MET C 1 23 ? -34.495 27.215  -6.667  1.00 34.87 ? 23 MET C CA  1 
ATOM   695  C  C   . MET C 1 23 ? -34.361 27.134  -5.117  1.00 33.73 ? 23 MET C C   1 
ATOM   696  O  O   . MET C 1 23 ? -35.204 27.633  -4.365  1.00 34.88 ? 23 MET C O   1 
ATOM   697  C  CB  . MET C 1 23 ? -35.848 27.699  -7.162  1.00 35.88 ? 23 MET C CB  1 
ATOM   698  C  CG  . MET C 1 23 ? -35.708 28.094  -8.610  1.00 39.36 ? 23 MET C CG  1 
ATOM   699  S  SD  . MET C 1 23 ? -37.196 28.791  -9.203  1.00 47.16 ? 23 MET C SD  1 
ATOM   700  C  CE  . MET C 1 23 ? -38.327 27.472  -8.735  1.00 48.51 ? 23 MET C CE  1 
ATOM   701  N  N   . GLY C 1 24 ? -33.265 26.533  -4.669  1.00 31.92 ? 24 GLY C N   1 
ATOM   702  C  CA  . GLY C 1 24 ? -33.053 26.366  -3.217  1.00 32.94 ? 24 GLY C CA  1 
ATOM   703  C  C   . GLY C 1 24 ? -33.928 25.291  -2.563  1.00 33.20 ? 24 GLY C C   1 
ATOM   704  O  O   . GLY C 1 24 ? -34.090 25.256  -1.333  1.00 34.43 ? 24 GLY C O   1 
ATOM   705  N  N   . ILE C 1 25 ? -34.478 24.385  -3.367  1.00 32.77 ? 25 ILE C N   1 
ATOM   706  C  CA  . ILE C 1 25 ? -35.130 23.192  -2.812  1.00 32.03 ? 25 ILE C CA  1 
ATOM   707  C  C   . ILE C 1 25 ? -34.200 22.052  -3.199  1.00 32.08 ? 25 ILE C C   1 
ATOM   708  O  O   . ILE C 1 25 ? -34.015 21.791  -4.399  1.00 31.67 ? 25 ILE C O   1 
ATOM   709  C  CB  . ILE C 1 25 ? -36.528 23.009  -3.401  1.00 32.98 ? 25 ILE C CB  1 
ATOM   710  C  CG1 . ILE C 1 25 ? -37.465 24.156  -2.982  1.00 33.99 ? 25 ILE C CG1 1 
ATOM   711  C  CG2 . ILE C 1 25 ? -37.118 21.688  -3.044  1.00 35.60 ? 25 ILE C CG2 1 
ATOM   712  C  CD1 . ILE C 1 25 ? -37.754 24.319  -1.493  1.00 33.39 ? 25 ILE C CD1 1 
ATOM   713  N  N   . ASN C 1 26 ? -33.596 21.407  -2.207  1.00 30.41 ? 26 ASN C N   1 
ATOM   714  C  CA  . ASN C 1 26 ? -32.682 20.269  -2.474  1.00 31.06 ? 26 ASN C CA  1 
ATOM   715  C  C   . ASN C 1 26 ? -33.345 18.893  -2.540  1.00 30.75 ? 26 ASN C C   1 
ATOM   716  O  O   . ASN C 1 26 ? -34.274 18.588  -1.781  1.00 30.56 ? 26 ASN C O   1 
ATOM   717  C  CB  . ASN C 1 26 ? -31.499 20.226  -1.475  1.00 30.86 ? 26 ASN C CB  1 
ATOM   718  C  CG  . ASN C 1 26 ? -30.612 21.426  -1.592  1.00 33.84 ? 26 ASN C CG  1 
ATOM   719  O  OD1 . ASN C 1 26 ? -29.931 21.593  -2.575  1.00 41.95 ? 26 ASN C OD1 1 
ATOM   720  N  ND2 . ASN C 1 26 ? -30.595 22.264  -0.573  1.00 42.00 ? 26 ASN C ND2 1 
ATOM   721  N  N   . TRP C 1 27 ? -32.909 18.077  -3.491  1.00 29.14 ? 27 TRP C N   1 
ATOM   722  C  CA  . TRP C 1 27 ? -33.295 16.675  -3.492  1.00 29.63 ? 27 TRP C CA  1 
ATOM   723  C  C   . TRP C 1 27 ? -32.025 15.864  -3.481  1.00 27.68 ? 27 TRP C C   1 
ATOM   724  O  O   . TRP C 1 27 ? -30.934 16.429  -3.629  1.00 27.31 ? 27 TRP C O   1 
ATOM   725  C  CB  . TRP C 1 27 ? -34.035 16.267  -4.769  1.00 31.06 ? 27 TRP C CB  1 
ATOM   726  C  CG  . TRP C 1 27 ? -35.327 16.840  -4.820  1.00 40.40 ? 27 TRP C CG  1 
ATOM   727  C  CD1 . TRP C 1 27 ? -36.485 16.420  -4.181  1.00 44.01 ? 27 TRP C CD1 1 
ATOM   728  C  CD2 . TRP C 1 27 ? -35.636 18.003  -5.490  1.00 47.37 ? 27 TRP C CD2 1 
ATOM   729  N  NE1 . TRP C 1 27 ? -37.494 17.281  -4.443  1.00 49.02 ? 27 TRP C NE1 1 
ATOM   730  C  CE2 . TRP C 1 27 ? -36.994 18.269  -5.255  1.00 50.82 ? 27 TRP C CE2 1 
ATOM   731  C  CE3 . TRP C 1 27 ? -34.895 18.861  -6.304  1.00 50.07 ? 27 TRP C CE3 1 
ATOM   732  C  CZ2 . TRP C 1 27 ? -37.612 19.358  -5.798  1.00 54.97 ? 27 TRP C CZ2 1 
ATOM   733  C  CZ3 . TRP C 1 27 ? -35.503 19.912  -6.838  1.00 54.16 ? 27 TRP C CZ3 1 
ATOM   734  C  CH2 . TRP C 1 27 ? -36.845 20.177  -6.587  1.00 54.66 ? 27 TRP C CH2 1 
ATOM   735  N  N   . ARG C 1 28 ? -32.190 14.535  -3.398  1.00 24.59 ? 28 ARG C N   1 
ATOM   736  C  CA  . ARG C 1 28 ? -31.047 13.657  -3.514  1.00 25.28 ? 28 ARG C CA  1 
ATOM   737  C  C   . ARG C 1 28 ? -30.886 13.221  -4.935  1.00 24.42 ? 28 ARG C C   1 
ATOM   738  O  O   . ARG C 1 28 ? -31.885 13.061  -5.622  1.00 24.85 ? 28 ARG C O   1 
ATOM   739  C  CB  . ARG C 1 28 ? -31.277 12.455  -2.665  1.00 22.90 ? 28 ARG C CB  1 
ATOM   740  C  CG  . ARG C 1 28 ? -31.150 12.793  -1.171  1.00 26.24 ? 28 ARG C CG  1 
ATOM   741  C  CD  . ARG C 1 28 ? -31.530 11.609  -0.349  1.00 28.80 ? 28 ARG C CD  1 
ATOM   742  N  NE  . ARG C 1 28 ? -31.486 11.961  1.067   1.00 31.51 ? 28 ARG C NE  1 
ATOM   743  C  CZ  . ARG C 1 28 ? -30.372 12.043  1.817   1.00 35.18 ? 28 ARG C CZ  1 
ATOM   744  N  NH1 . ARG C 1 28 ? -29.160 11.752  1.328   1.00 32.75 ? 28 ARG C NH1 1 
ATOM   745  N  NH2 . ARG C 1 28 ? -30.481 12.387  3.097   1.00 29.87 ? 28 ARG C NH2 1 
ATOM   746  N  N   . PHE C 1 29 ? -29.632 13.062  -5.373  1.00 23.44 ? 29 PHE C N   1 
ATOM   747  C  CA  . PHE C 1 29 ? -29.296 12.535  -6.698  1.00 22.77 ? 29 PHE C CA  1 
ATOM   748  C  C   . PHE C 1 29 ? -29.073 11.062  -6.425  1.00 23.96 ? 29 PHE C C   1 
ATOM   749  O  O   . PHE C 1 29 ? -27.997 10.673  -5.885  1.00 23.64 ? 29 PHE C O   1 
ATOM   750  C  CB  . PHE C 1 29 ? -28.007 13.229  -7.238  1.00 22.87 ? 29 PHE C CB  1 
ATOM   751  C  CG  . PHE C 1 29 ? -27.728 12.966  -8.699  1.00 22.96 ? 29 PHE C CG  1 
ATOM   752  C  CD1 . PHE C 1 29 ? -28.432 13.636  -9.679  1.00 28.01 ? 29 PHE C CD1 1 
ATOM   753  C  CD2 . PHE C 1 29 ? -26.794 12.043  -9.090  1.00 27.38 ? 29 PHE C CD2 1 
ATOM   754  C  CE1 . PHE C 1 29 ? -28.193 13.396  -11.019 1.00 30.80 ? 29 PHE C CE1 1 
ATOM   755  C  CE2 . PHE C 1 29 ? -26.557 11.792  -10.441 1.00 25.17 ? 29 PHE C CE2 1 
ATOM   756  C  CZ  . PHE C 1 29 ? -27.261 12.458  -11.398 1.00 29.23 ? 29 PHE C CZ  1 
ATOM   757  N  N   . CYS C 1 30 ? -30.080 10.227  -6.739  1.00 23.56 ? 30 CYS C N   1 
ATOM   758  C  CA  . CYS C 1 30 ? -30.043 8.806   -6.360  1.00 23.73 ? 30 CYS C CA  1 
ATOM   759  C  C   . CYS C 1 30 ? -29.740 7.912   -7.549  1.00 25.46 ? 30 CYS C C   1 
ATOM   760  O  O   . CYS C 1 30 ? -30.495 7.891   -8.517  1.00 26.39 ? 30 CYS C O   1 
ATOM   761  C  CB  . CYS C 1 30 ? -31.388 8.379   -5.728  1.00 22.22 ? 30 CYS C CB  1 
ATOM   762  S  SG  . CYS C 1 30 ? -32.108 9.344   -4.438  1.00 24.48 ? 30 CYS C SG  1 
ATOM   763  N  N   . CYS C 1 31 ? -28.700 7.095   -7.451  1.00 25.64 ? 31 CYS C N   1 
ATOM   764  C  CA  . CYS C 1 31 ? -28.265 6.276   -8.569  1.00 28.39 ? 31 CYS C CA  1 
ATOM   765  C  C   . CYS C 1 31 ? -28.349 4.774   -8.292  1.00 29.63 ? 31 CYS C C   1 
ATOM   766  O  O   . CYS C 1 31 ? -28.254 4.340   -7.158  1.00 29.54 ? 31 CYS C O   1 
ATOM   767  C  CB  . CYS C 1 31 ? -26.780 6.614   -8.930  1.00 26.79 ? 31 CYS C CB  1 
ATOM   768  S  SG  . CYS C 1 31 ? -26.527 8.353   -9.389  1.00 27.69 ? 31 CYS C SG  1 
ATOM   769  N  N   . LEU C 1 32 ? -28.445 3.967   -9.345  1.00 32.48 ? 32 LEU C N   1 
ATOM   770  C  CA  . LEU C 1 32 ? -28.225 2.511   -9.221  1.00 34.84 ? 32 LEU C CA  1 
ATOM   771  C  C   . LEU C 1 32 ? -27.717 1.973   -10.544 1.00 37.12 ? 32 LEU C C   1 
ATOM   772  O  O   . LEU C 1 32 ? -27.855 2.670   -11.582 1.00 38.24 ? 32 LEU C O   1 
ATOM   773  C  CB  . LEU C 1 32 ? -29.477 1.755   -8.760  1.00 36.05 ? 32 LEU C CB  1 
ATOM   774  C  CG  . LEU C 1 32 ? -30.585 1.330   -9.751  1.00 37.74 ? 32 LEU C CG  1 
ATOM   775  C  CD1 . LEU C 1 32 ? -31.589 0.412   -9.033  1.00 39.74 ? 32 LEU C CD1 1 
ATOM   776  C  CD2 . LEU C 1 32 ? -31.336 2.478   -10.344 1.00 39.49 ? 32 LEU C CD2 1 
ATOM   777  O  OXT . LEU C 1 32 ? -27.175 0.863   -10.580 1.00 37.73 ? 32 LEU C OXT 1 
ATOM   778  N  N   . ALA D 1 1  ? -51.049 -5.547  -15.057 1.00 44.91 ? 1  ALA D N   1 
ATOM   779  C  CA  . ALA D 1 1  ? -50.232 -6.780  -15.384 1.00 43.24 ? 1  ALA D CA  1 
ATOM   780  C  C   . ALA D 1 1  ? -48.865 -6.410  -15.976 1.00 41.15 ? 1  ALA D C   1 
ATOM   781  O  O   . ALA D 1 1  ? -48.802 -5.892  -17.101 1.00 40.74 ? 1  ALA D O   1 
ATOM   782  C  CB  . ALA D 1 1  ? -50.994 -7.669  -16.388 1.00 44.56 ? 1  ALA D CB  1 
ATOM   783  N  N   . PHE D 1 2  ? -47.773 -6.705  -15.255 1.00 38.67 ? 2  PHE D N   1 
ATOM   784  C  CA  . PHE D 1 2  ? -46.449 -6.417  -15.756 1.00 37.11 ? 2  PHE D CA  1 
ATOM   785  C  C   . PHE D 1 2  ? -45.806 -7.751  -16.065 1.00 36.49 ? 2  PHE D C   1 
ATOM   786  O  O   . PHE D 1 2  ? -45.975 -8.696  -15.318 1.00 36.44 ? 2  PHE D O   1 
ATOM   787  C  CB  . PHE D 1 2  ? -45.611 -5.673  -14.715 1.00 37.81 ? 2  PHE D CB  1 
ATOM   788  C  CG  . PHE D 1 2  ? -46.135 -4.301  -14.407 1.00 39.32 ? 2  PHE D CG  1 
ATOM   789  C  CD1 . PHE D 1 2  ? -47.157 -4.136  -13.473 1.00 42.04 ? 2  PHE D CD1 1 
ATOM   790  C  CD2 . PHE D 1 2  ? -45.652 -3.185  -15.098 1.00 40.95 ? 2  PHE D CD2 1 
ATOM   791  C  CE1 . PHE D 1 2  ? -47.697 -2.861  -13.218 1.00 45.44 ? 2  PHE D CE1 1 
ATOM   792  C  CE2 . PHE D 1 2  ? -46.166 -1.909  -14.832 1.00 41.57 ? 2  PHE D CE2 1 
ATOM   793  C  CZ  . PHE D 1 2  ? -47.196 -1.751  -13.899 1.00 43.98 ? 2  PHE D CZ  1 
ATOM   794  N  N   . THR D 1 3  ? -45.106 -7.807  -17.182 1.00 34.79 ? 3  THR D N   1 
ATOM   795  C  CA  . THR D 1 3  ? -44.247 -8.925  -17.515 1.00 34.77 ? 3  THR D CA  1 
ATOM   796  C  C   . THR D 1 3  ? -42.841 -8.408  -17.468 1.00 33.56 ? 3  THR D C   1 
ATOM   797  O  O   . THR D 1 3  ? -42.549 -7.410  -18.100 1.00 33.74 ? 3  THR D O   1 
ATOM   798  C  CB  . THR D 1 3  ? -44.504 -9.439  -18.952 1.00 35.80 ? 3  THR D CB  1 
ATOM   799  O  OG1 . THR D 1 3  ? -45.886 -9.744  -19.070 1.00 36.75 ? 3  THR D OG1 1 
ATOM   800  C  CG2 . THR D 1 3  ? -43.655 -10.713 -19.218 1.00 34.98 ? 3  THR D CG2 1 
ATOM   801  N  N   . CYS D 1 4  ? -41.986 -9.097  -16.720 1.00 33.04 ? 4  CYS D N   1 
ATOM   802  C  CA  . CYS D 1 4  ? -40.658 -8.591  -16.407 1.00 31.54 ? 4  CYS D CA  1 
ATOM   803  C  C   . CYS D 1 4  ? -39.617 -9.677  -16.562 1.00 31.27 ? 4  CYS D C   1 
ATOM   804  O  O   . CYS D 1 4  ? -39.880 -10.825 -16.282 1.00 32.77 ? 4  CYS D O   1 
ATOM   805  C  CB  . CYS D 1 4  ? -40.602 -8.081  -14.951 1.00 32.01 ? 4  CYS D CB  1 
ATOM   806  S  SG  . CYS D 1 4  ? -41.805 -6.867  -14.428 1.00 31.53 ? 4  CYS D SG  1 
ATOM   807  N  N   . HIS D 1 5  ? -38.440 -9.316  -17.032 1.00 31.04 ? 5  HIS D N   1 
ATOM   808  C  CA  . HIS D 1 5  ? -37.278 -10.213 -17.114 1.00 31.69 ? 5  HIS D CA  1 
ATOM   809  C  C   . HIS D 1 5  ? -36.019 -9.432  -16.622 1.00 31.56 ? 5  HIS D C   1 
ATOM   810  O  O   . HIS D 1 5  ? -35.981 -8.188  -16.661 1.00 29.79 ? 5  HIS D O   1 
ATOM   811  C  CB  . HIS D 1 5  ? -37.032 -10.651 -18.572 1.00 32.62 ? 5  HIS D CB  1 
ATOM   812  C  CG  . HIS D 1 5  ? -38.178 -11.365 -19.218 1.00 35.80 ? 5  HIS D CG  1 
ATOM   813  N  ND1 . HIS D 1 5  ? -39.289 -10.703 -19.712 1.00 35.81 ? 5  HIS D ND1 1 
ATOM   814  C  CD2 . HIS D 1 5  ? -38.361 -12.681 -19.505 1.00 35.82 ? 5  HIS D CD2 1 
ATOM   815  C  CE1 . HIS D 1 5  ? -40.119 -11.585 -20.245 1.00 36.65 ? 5  HIS D CE1 1 
ATOM   816  N  NE2 . HIS D 1 5  ? -39.589 -12.790 -20.114 1.00 38.43 ? 5  HIS D NE2 1 
ATOM   817  N  N   . CYS D 1 6  ? -35.022 -10.151 -16.110 1.00 32.45 ? 6  CYS D N   1 
ATOM   818  C  CA  . CYS D 1 6  ? -33.696 -9.595  -15.802 1.00 32.81 ? 6  CYS D CA  1 
ATOM   819  C  C   . CYS D 1 6  ? -32.927 -9.687  -17.104 1.00 33.97 ? 6  CYS D C   1 
ATOM   820  O  O   . CYS D 1 6  ? -32.845 -10.755 -17.646 1.00 35.72 ? 6  CYS D O   1 
ATOM   821  C  CB  . CYS D 1 6  ? -33.002 -10.411 -14.676 1.00 33.10 ? 6  CYS D CB  1 
ATOM   822  S  SG  . CYS D 1 6  ? -33.835 -10.246 -13.044 1.00 33.85 ? 6  CYS D SG  1 
ATOM   823  N  N   . ARG D 1 7  ? -32.425 -8.573  -17.636 1.00 35.15 ? 7  ARG D N   1 
ATOM   824  C  CA  . ARG D 1 7  ? -31.688 -8.549  -18.899 1.00 36.63 ? 7  ARG D CA  1 
ATOM   825  C  C   . ARG D 1 7  ? -30.507 -7.607  -18.778 1.00 38.40 ? 7  ARG D C   1 
ATOM   826  O  O   . ARG D 1 7  ? -30.567 -6.649  -17.991 1.00 38.16 ? 7  ARG D O   1 
ATOM   827  C  CB  . ARG D 1 7  ? -32.559 -7.959  -20.024 1.00 36.58 ? 7  ARG D CB  1 
ATOM   828  C  CG  . ARG D 1 7  ? -33.967 -8.499  -20.192 1.00 34.45 ? 7  ARG D CG  1 
ATOM   829  C  CD  . ARG D 1 7  ? -34.619 -7.796  -21.419 1.00 36.61 ? 7  ARG D CD  1 
ATOM   830  N  NE  . ARG D 1 7  ? -36.002 -8.224  -21.609 1.00 34.88 ? 7  ARG D NE  1 
ATOM   831  C  CZ  . ARG D 1 7  ? -36.357 -9.480  -21.879 1.00 40.05 ? 7  ARG D CZ  1 
ATOM   832  N  NH1 . ARG D 1 7  ? -35.434 -10.449 -21.991 1.00 39.95 ? 7  ARG D NH1 1 
ATOM   833  N  NH2 . ARG D 1 7  ? -37.634 -9.775  -22.046 1.00 41.52 ? 7  ARG D NH2 1 
ATOM   834  N  N   . ARG D 1 8  ? -29.461 -7.854  -19.586 1.00 40.79 ? 8  ARG D N   1 
ATOM   835  C  CA  . ARG D 1 8  ? -28.347 -6.932  -19.782 1.00 42.51 ? 8  ARG D CA  1 
ATOM   836  C  C   . ARG D 1 8  ? -28.852 -5.546  -20.094 1.00 43.00 ? 8  ARG D C   1 
ATOM   837  O  O   . ARG D 1 8  ? -28.419 -4.585  -19.466 1.00 43.69 ? 8  ARG D O   1 
ATOM   838  C  CB  . ARG D 1 8  ? -27.440 -7.374  -20.945 1.00 45.40 ? 8  ARG D CB  1 
ATOM   839  C  CG  . ARG D 1 8  ? -27.208 -8.872  -21.100 1.00 50.79 ? 8  ARG D CG  1 
ATOM   840  C  CD  . ARG D 1 8  ? -26.191 -9.157  -22.278 1.00 60.43 ? 8  ARG D CD  1 
ATOM   841  N  NE  . ARG D 1 8  ? -26.761 -9.798  -23.477 1.00 66.41 ? 8  ARG D NE  1 
ATOM   842  C  CZ  . ARG D 1 8  ? -26.967 -9.196  -24.654 1.00 70.36 ? 8  ARG D CZ  1 
ATOM   843  N  NH1 . ARG D 1 8  ? -26.670 -7.902  -24.820 1.00 71.55 ? 8  ARG D NH1 1 
ATOM   844  N  NH2 . ARG D 1 8  ? -27.470 -9.895  -25.679 1.00 71.57 ? 8  ARG D NH2 1 
ATOM   845  N  N   . SER D 1 9  ? -29.756 -5.425  -21.071 1.00 42.08 ? 9  SER D N   1 
ATOM   846  C  CA  . SER D 1 9  ? -30.408 -4.152  -21.376 1.00 41.99 ? 9  SER D CA  1 
ATOM   847  C  C   . SER D 1 9  ? -31.852 -4.454  -21.665 1.00 40.14 ? 9  SER D C   1 
ATOM   848  O  O   . SER D 1 9  ? -32.173 -5.538  -22.176 1.00 40.44 ? 9  SER D O   1 
ATOM   849  C  CB  . SER D 1 9  ? -29.827 -3.489  -22.625 1.00 42.66 ? 9  SER D CB  1 
ATOM   850  O  OG  . SER D 1 9  ? -28.521 -3.976  -22.843 1.00 50.03 ? 9  SER D OG  1 
ATOM   851  N  N   . CYS D 1 10 ? -32.717 -3.497  -21.368 1.00 38.13 ? 10 CYS D N   1 
ATOM   852  C  CA  . CYS D 1 10 ? -34.129 -3.649  -21.710 1.00 37.99 ? 10 CYS D CA  1 
ATOM   853  C  C   . CYS D 1 10 ? -34.373 -3.485  -23.212 1.00 38.03 ? 10 CYS D C   1 
ATOM   854  O  O   . CYS D 1 10 ? -33.645 -2.782  -23.912 1.00 37.78 ? 10 CYS D O   1 
ATOM   855  C  CB  . CYS D 1 10 ? -35.002 -2.658  -20.909 1.00 36.95 ? 10 CYS D CB  1 
ATOM   856  S  SG  . CYS D 1 10 ? -34.711 -2.801  -19.111 1.00 36.08 ? 10 CYS D SG  1 
ATOM   857  N  N   . TYR D 1 11 ? -35.409 -4.147  -23.694 1.00 38.35 ? 11 TYR D N   1 
ATOM   858  C  CA  . TYR D 1 11 ? -35.890 -3.882  -25.017 1.00 40.43 ? 11 TYR D CA  1 
ATOM   859  C  C   . TYR D 1 11 ? -36.337 -2.437  -25.007 1.00 40.70 ? 11 TYR D C   1 
ATOM   860  O  O   . TYR D 1 11 ? -36.802 -1.907  -23.977 1.00 39.78 ? 11 TYR D O   1 
ATOM   861  C  CB  . TYR D 1 11 ? -37.070 -4.806  -25.380 1.00 40.25 ? 11 TYR D CB  1 
ATOM   862  C  CG  . TYR D 1 11 ? -36.636 -6.239  -25.635 1.00 42.61 ? 11 TYR D CG  1 
ATOM   863  C  CD1 . TYR D 1 11 ? -35.701 -6.546  -26.620 1.00 43.50 ? 11 TYR D CD1 1 
ATOM   864  C  CD2 . TYR D 1 11 ? -37.165 -7.286  -24.878 1.00 43.82 ? 11 TYR D CD2 1 
ATOM   865  C  CE1 . TYR D 1 11 ? -35.300 -7.849  -26.841 1.00 46.92 ? 11 TYR D CE1 1 
ATOM   866  C  CE2 . TYR D 1 11 ? -36.755 -8.602  -25.079 1.00 44.42 ? 11 TYR D CE2 1 
ATOM   867  C  CZ  . TYR D 1 11 ? -35.830 -8.877  -26.052 1.00 48.34 ? 11 TYR D CZ  1 
ATOM   868  O  OH  . TYR D 1 11 ? -35.455 -10.183 -26.236 1.00 49.54 ? 11 TYR D OH  1 
ATOM   869  N  N   . SER D 1 12 ? -36.196 -1.787  -26.147 1.00 42.23 ? 12 SER D N   1 
ATOM   870  C  CA  . SER D 1 12 ? -36.752 -0.444  -26.315 1.00 42.92 ? 12 SER D CA  1 
ATOM   871  C  C   . SER D 1 12 ? -38.232 -0.321  -25.875 1.00 42.92 ? 12 SER D C   1 
ATOM   872  O  O   . SER D 1 12 ? -38.645 0.768   -25.486 1.00 44.20 ? 12 SER D O   1 
ATOM   873  C  CB  . SER D 1 12 ? -36.578 -0.001  -27.765 1.00 43.47 ? 12 SER D CB  1 
ATOM   874  O  OG  . SER D 1 12 ? -37.229 -0.955  -28.571 1.00 44.12 ? 12 SER D OG  1 
ATOM   875  N  N   . THR D 1 13 ? -39.024 -1.407  -25.937 1.00 42.64 ? 13 THR D N   1 
ATOM   876  C  CA  . THR D 1 13 ? -40.452 -1.406  -25.541 1.00 42.26 ? 13 THR D CA  1 
ATOM   877  C  C   . THR D 1 13 ? -40.657 -1.593  -24.005 1.00 41.79 ? 13 THR D C   1 
ATOM   878  O  O   . THR D 1 13 ? -41.797 -1.562  -23.493 1.00 41.68 ? 13 THR D O   1 
ATOM   879  C  CB  . THR D 1 13 ? -41.286 -2.484  -26.301 1.00 43.18 ? 13 THR D CB  1 
ATOM   880  O  OG1 . THR D 1 13 ? -40.746 -3.780  -26.058 1.00 43.61 ? 13 THR D OG1 1 
ATOM   881  C  CG2 . THR D 1 13 ? -41.261 -2.246  -27.798 1.00 43.19 ? 13 THR D CG2 1 
ATOM   882  N  N   . GLU D 1 14 ? -39.538 -1.796  -23.299 1.00 40.72 ? 14 GLU D N   1 
ATOM   883  C  CA  . GLU D 1 14 ? -39.519 -2.032  -21.880 1.00 39.24 ? 14 GLU D CA  1 
ATOM   884  C  C   . GLU D 1 14 ? -39.043 -0.819  -21.104 1.00 39.31 ? 14 GLU D C   1 
ATOM   885  O  O   . GLU D 1 14 ? -38.502 0.107   -21.668 1.00 39.80 ? 14 GLU D O   1 
ATOM   886  C  CB  . GLU D 1 14 ? -38.648 -3.265  -21.579 1.00 38.79 ? 14 GLU D CB  1 
ATOM   887  C  CG  . GLU D 1 14 ? -39.367 -4.617  -21.916 1.00 37.13 ? 14 GLU D CG  1 
ATOM   888  C  CD  . GLU D 1 14 ? -38.463 -5.830  -21.813 1.00 35.94 ? 14 GLU D CD  1 
ATOM   889  O  OE1 . GLU D 1 14 ? -37.214 -5.670  -21.883 1.00 36.82 ? 14 GLU D OE1 1 
ATOM   890  O  OE2 . GLU D 1 14 ? -39.006 -6.952  -21.701 1.00 35.02 ? 14 GLU D OE2 1 
ATOM   891  N  N   . TYR D 1 15 ? -39.288 -0.836  -19.796 1.00 39.90 ? 15 TYR D N   1 
ATOM   892  C  CA  . TYR D 1 15 ? -38.787 0.161   -18.862 1.00 41.24 ? 15 TYR D CA  1 
ATOM   893  C  C   . TYR D 1 15 ? -37.941 -0.541  -17.810 1.00 39.72 ? 15 TYR D C   1 
ATOM   894  O  O   . TYR D 1 15 ? -38.213 -1.663  -17.448 1.00 38.81 ? 15 TYR D O   1 
ATOM   895  C  CB  . TYR D 1 15 ? -39.971 0.917   -18.214 1.00 42.14 ? 15 TYR D CB  1 
ATOM   896  C  CG  . TYR D 1 15 ? -40.817 1.661   -19.238 1.00 49.36 ? 15 TYR D CG  1 
ATOM   897  C  CD1 . TYR D 1 15 ? -42.044 1.137   -19.690 1.00 53.75 ? 15 TYR D CD1 1 
ATOM   898  C  CD2 . TYR D 1 15 ? -40.374 2.869   -19.794 1.00 54.49 ? 15 TYR D CD2 1 
ATOM   899  C  CE1 . TYR D 1 15 ? -42.802 1.810   -20.653 1.00 55.95 ? 15 TYR D CE1 1 
ATOM   900  C  CE2 . TYR D 1 15 ? -41.133 3.539   -20.753 1.00 57.05 ? 15 TYR D CE2 1 
ATOM   901  C  CZ  . TYR D 1 15 ? -42.326 3.000   -21.165 1.00 57.24 ? 15 TYR D CZ  1 
ATOM   902  O  OH  . TYR D 1 15 ? -43.057 3.682   -22.087 1.00 64.17 ? 15 TYR D OH  1 
ATOM   903  N  N   . SER D 1 16 ? -36.890 0.100   -17.347 1.00 40.03 ? 16 SER D N   1 
ATOM   904  C  CA  . SER D 1 16 ? -36.046 -0.527  -16.336 1.00 40.37 ? 16 SER D CA  1 
ATOM   905  C  C   . SER D 1 16 ? -36.541 -0.175  -14.941 1.00 40.75 ? 16 SER D C   1 
ATOM   906  O  O   . SER D 1 16 ? -36.646 0.996   -14.620 1.00 41.99 ? 16 SER D O   1 
ATOM   907  C  CB  . SER D 1 16 ? -34.583 -0.069  -16.523 1.00 41.37 ? 16 SER D CB  1 
ATOM   908  O  OG  . SER D 1 16 ? -33.765 -0.532  -15.459 1.00 41.55 ? 16 SER D OG  1 
ATOM   909  N  N   . TYR D 1 17 ? -36.823 -1.152  -14.090 1.00 41.00 ? 17 TYR D N   1 
ATOM   910  C  CA  . TYR D 1 17 ? -37.389 -0.823  -12.784 1.00 40.38 ? 17 TYR D CA  1 
ATOM   911  C  C   . TYR D 1 17 ? -36.378 -0.895  -11.664 1.00 40.88 ? 17 TYR D C   1 
ATOM   912  O  O   . TYR D 1 17 ? -36.681 -0.559  -10.513 1.00 41.78 ? 17 TYR D O   1 
ATOM   913  C  CB  . TYR D 1 17 ? -38.634 -1.658  -12.478 1.00 40.99 ? 17 TYR D CB  1 
ATOM   914  C  CG  . TYR D 1 17 ? -39.814 -1.122  -13.250 1.00 41.61 ? 17 TYR D CG  1 
ATOM   915  C  CD1 . TYR D 1 17 ? -40.703 -0.244  -12.669 1.00 40.92 ? 17 TYR D CD1 1 
ATOM   916  C  CD2 . TYR D 1 17 ? -39.985 -1.444  -14.593 1.00 40.09 ? 17 TYR D CD2 1 
ATOM   917  C  CE1 . TYR D 1 17 ? -41.773 0.272   -13.400 1.00 43.69 ? 17 TYR D CE1 1 
ATOM   918  C  CE2 . TYR D 1 17 ? -41.027 -0.947  -15.326 1.00 40.83 ? 17 TYR D CE2 1 
ATOM   919  C  CZ  . TYR D 1 17 ? -41.927 -0.096  -14.730 1.00 42.81 ? 17 TYR D CZ  1 
ATOM   920  O  OH  . TYR D 1 17 ? -42.961 0.387   -15.471 1.00 44.89 ? 17 TYR D OH  1 
ATOM   921  N  N   . GLY D 1 18 ? -35.166 -1.331  -11.984 1.00 39.76 ? 18 GLY D N   1 
ATOM   922  C  CA  . GLY D 1 18 ? -34.182 -1.534  -10.935 1.00 37.60 ? 18 GLY D CA  1 
ATOM   923  C  C   . GLY D 1 18 ? -33.138 -2.481  -11.462 1.00 36.63 ? 18 GLY D C   1 
ATOM   924  O  O   . GLY D 1 18 ? -32.909 -2.532  -12.683 1.00 36.87 ? 18 GLY D O   1 
ATOM   925  N  N   . THR D 1 19 ? -32.535 -3.242  -10.545 1.00 34.63 ? 19 THR D N   1 
ATOM   926  C  CA  . THR D 1 19 ? -31.409 -4.142  -10.869 1.00 34.09 ? 19 THR D CA  1 
ATOM   927  C  C   . THR D 1 19 ? -31.689 -5.565  -10.387 1.00 32.85 ? 19 THR D C   1 
ATOM   928  O  O   . THR D 1 19 ? -32.432 -5.766  -9.446  1.00 34.95 ? 19 THR D O   1 
ATOM   929  C  CB  . THR D 1 19 ? -30.052 -3.659  -10.237 1.00 33.43 ? 19 THR D CB  1 
ATOM   930  O  OG1 . THR D 1 19 ? -30.274 -3.303  -8.870  1.00 36.80 ? 19 THR D OG1 1 
ATOM   931  C  CG2 . THR D 1 19 ? -29.541 -2.454  -10.914 1.00 35.61 ? 19 THR D CG2 1 
ATOM   932  N  N   . CYS D 1 20 ? -31.109 -6.547  -11.059 1.00 32.69 ? 20 CYS D N   1 
ATOM   933  C  CA  . CYS D 1 20 ? -31.021 -7.913  -10.554 1.00 33.13 ? 20 CYS D CA  1 
ATOM   934  C  C   . CYS D 1 20 ? -29.553 -8.190  -10.477 1.00 33.82 ? 20 CYS D C   1 
ATOM   935  O  O   . CYS D 1 20 ? -28.781 -7.566  -11.191 1.00 34.03 ? 20 CYS D O   1 
ATOM   936  C  CB  . CYS D 1 20 ? -31.593 -8.920  -11.539 1.00 32.46 ? 20 CYS D CB  1 
ATOM   937  S  SG  . CYS D 1 20 ? -33.154 -8.427  -12.292 1.00 33.08 ? 20 CYS D SG  1 
ATOM   938  N  N   . THR D 1 21 ? -29.170 -9.117  -9.601  1.00 32.79 ? 21 THR D N   1 
ATOM   939  C  CA  . THR D 1 21 ? -27.811 -9.619  -9.536  1.00 33.38 ? 21 THR D CA  1 
ATOM   940  C  C   . THR D 1 21 ? -27.965 -11.127 -9.528  1.00 33.61 ? 21 THR D C   1 
ATOM   941  O  O   . THR D 1 21 ? -28.570 -11.697 -8.641  1.00 31.23 ? 21 THR D O   1 
ATOM   942  C  CB  . THR D 1 21 ? -27.006 -9.076  -8.289  1.00 33.47 ? 21 THR D CB  1 
ATOM   943  O  OG1 . THR D 1 21 ? -27.023 -7.646  -8.320  1.00 31.24 ? 21 THR D OG1 1 
ATOM   944  C  CG2 . THR D 1 21 ? -25.584 -9.528  -8.324  1.00 32.19 ? 21 THR D CG2 1 
ATOM   945  N  N   . VAL D 1 22 ? -27.452 -11.738 -10.584 1.00 35.19 ? 22 VAL D N   1 
ATOM   946  C  CA  . VAL D 1 22 ? -27.635 -13.142 -10.821 1.00 37.10 ? 22 VAL D CA  1 
ATOM   947  C  C   . VAL D 1 22 ? -26.338 -13.540 -11.463 1.00 38.45 ? 22 VAL D C   1 
ATOM   948  O  O   . VAL D 1 22 ? -25.881 -12.869 -12.401 1.00 38.95 ? 22 VAL D O   1 
ATOM   949  C  CB  . VAL D 1 22 ? -28.801 -13.414 -11.802 1.00 37.65 ? 22 VAL D CB  1 
ATOM   950  C  CG1 . VAL D 1 22 ? -29.098 -14.890 -11.841 1.00 39.00 ? 22 VAL D CG1 1 
ATOM   951  C  CG2 . VAL D 1 22 ? -30.084 -12.655 -11.362 1.00 39.06 ? 22 VAL D CG2 1 
ATOM   952  N  N   . MET D 1 23 ? -25.722 -14.576 -10.910 1.00 38.61 ? 23 MET D N   1 
ATOM   953  C  CA  . MET D 1 23 ? -24.472 -15.117 -11.404 1.00 40.85 ? 23 MET D CA  1 
ATOM   954  C  C   . MET D 1 23 ? -23.369 -14.076 -11.172 1.00 40.89 ? 23 MET D C   1 
ATOM   955  O  O   . MET D 1 23 ? -22.327 -14.099 -11.858 1.00 42.18 ? 23 MET D O   1 
ATOM   956  C  CB  . MET D 1 23 ? -24.548 -15.549 -12.889 1.00 41.33 ? 23 MET D CB  1 
ATOM   957  C  CG  . MET D 1 23 ? -25.391 -16.830 -13.202 1.00 44.74 ? 23 MET D CG  1 
ATOM   958  S  SD  . MET D 1 23 ? -25.702 -17.011 -14.975 1.00 46.03 ? 23 MET D SD  1 
ATOM   959  C  CE  . MET D 1 23 ? -24.006 -17.406 -15.408 1.00 55.51 ? 23 MET D CE  1 
ATOM   960  N  N   . GLY D 1 24 ? -23.581 -13.178 -10.205 1.00 39.27 ? 24 GLY D N   1 
ATOM   961  C  CA  . GLY D 1 24 ? -22.557 -12.223 -9.820  1.00 38.94 ? 24 GLY D CA  1 
ATOM   962  C  C   . GLY D 1 24 ? -22.448 -11.050 -10.758 1.00 39.28 ? 24 GLY D C   1 
ATOM   963  O  O   . GLY D 1 24 ? -21.590 -10.174 -10.535 1.00 39.12 ? 24 GLY D O   1 
ATOM   964  N  N   . ILE D 1 25 ? -23.272 -11.015 -11.821 1.00 39.22 ? 25 ILE D N   1 
ATOM   965  C  CA  . ILE D 1 25 ? -23.363 -9.779  -12.645 1.00 40.27 ? 25 ILE D CA  1 
ATOM   966  C  C   . ILE D 1 25 ? -24.674 -9.029  -12.451 1.00 38.91 ? 25 ILE D C   1 
ATOM   967  O  O   . ILE D 1 25 ? -25.694 -9.605  -12.034 1.00 36.90 ? 25 ILE D O   1 
ATOM   968  C  CB  . ILE D 1 25 ? -23.061 -9.916  -14.204 1.00 42.00 ? 25 ILE D CB  1 
ATOM   969  C  CG1 . ILE D 1 25 ? -22.651 -11.311 -14.625 1.00 45.54 ? 25 ILE D CG1 1 
ATOM   970  C  CG2 . ILE D 1 25 ? -21.993 -8.872  -14.684 1.00 45.20 ? 25 ILE D CG2 1 
ATOM   971  C  CD1 . ILE D 1 25 ? -23.819 -12.034 -15.093 1.00 48.98 ? 25 ILE D CD1 1 
ATOM   972  N  N   . ASN D 1 26 ? -24.634 -7.742  -12.767 1.00 38.90 ? 26 ASN D N   1 
ATOM   973  C  CA  . ASN D 1 26 ? -25.805 -6.908  -12.697 1.00 38.89 ? 26 ASN D CA  1 
ATOM   974  C  C   . ASN D 1 26 ? -26.602 -6.917  -13.998 1.00 38.33 ? 26 ASN D C   1 
ATOM   975  O  O   . ASN D 1 26 ? -26.032 -6.888  -15.111 1.00 37.95 ? 26 ASN D O   1 
ATOM   976  C  CB  . ASN D 1 26 ? -25.421 -5.463  -12.362 1.00 39.82 ? 26 ASN D CB  1 
ATOM   977  C  CG  . ASN D 1 26 ? -24.944 -5.317  -10.961 1.00 42.21 ? 26 ASN D CG  1 
ATOM   978  O  OD1 . ASN D 1 26 ? -25.288 -6.120  -10.081 1.00 41.27 ? 26 ASN D OD1 1 
ATOM   979  N  ND2 . ASN D 1 26 ? -24.100 -4.312  -10.733 1.00 43.53 ? 26 ASN D ND2 1 
ATOM   980  N  N   . TRP D 1 27 ? -27.915 -6.939  -13.835 1.00 37.14 ? 27 TRP D N   1 
ATOM   981  C  CA  . TRP D 1 27 ? -28.853 -6.892  -14.935 1.00 36.55 ? 27 TRP D CA  1 
ATOM   982  C  C   . TRP D 1 27 ? -29.793 -5.805  -14.591 1.00 35.99 ? 27 TRP D C   1 
ATOM   983  O  O   . TRP D 1 27 ? -29.845 -5.373  -13.436 1.00 35.81 ? 27 TRP D O   1 
ATOM   984  C  CB  . TRP D 1 27 ? -29.641 -8.208  -15.016 1.00 36.66 ? 27 TRP D CB  1 
ATOM   985  C  CG  . TRP D 1 27 ? -28.755 -9.405  -14.983 1.00 39.01 ? 27 TRP D CG  1 
ATOM   986  C  CD1 . TRP D 1 27 ? -28.080 -9.876  -13.895 1.00 39.25 ? 27 TRP D CD1 1 
ATOM   987  C  CD2 . TRP D 1 27 ? -28.438 -10.285 -16.063 1.00 41.41 ? 27 TRP D CD2 1 
ATOM   988  N  NE1 . TRP D 1 27 ? -27.374 -11.002 -14.228 1.00 40.96 ? 27 TRP D NE1 1 
ATOM   989  C  CE2 . TRP D 1 27 ? -27.559 -11.268 -15.557 1.00 42.82 ? 27 TRP D CE2 1 
ATOM   990  C  CE3 . TRP D 1 27 ? -28.826 -10.356 -17.405 1.00 45.77 ? 27 TRP D CE3 1 
ATOM   991  C  CZ2 . TRP D 1 27 ? -27.060 -12.305 -16.337 1.00 43.64 ? 27 TRP D CZ2 1 
ATOM   992  C  CZ3 . TRP D 1 27 ? -28.324 -11.396 -18.191 1.00 48.00 ? 27 TRP D CZ3 1 
ATOM   993  C  CH2 . TRP D 1 27 ? -27.442 -12.353 -17.648 1.00 48.66 ? 27 TRP D CH2 1 
ATOM   994  N  N   . ARG D 1 28 ? -30.545 -5.367  -15.595 1.00 35.71 ? 28 ARG D N   1 
ATOM   995  C  CA  . ARG D 1 28 ? -31.688 -4.516  -15.387 1.00 36.23 ? 28 ARG D CA  1 
ATOM   996  C  C   . ARG D 1 28 ? -32.914 -5.437  -15.155 1.00 34.16 ? 28 ARG D C   1 
ATOM   997  O  O   . ARG D 1 28 ? -33.047 -6.496  -15.786 1.00 34.15 ? 28 ARG D O   1 
ATOM   998  C  CB  . ARG D 1 28 ? -31.896 -3.605  -16.601 1.00 36.69 ? 28 ARG D CB  1 
ATOM   999  C  CG  . ARG D 1 28 ? -30.752 -2.600  -16.980 1.00 43.54 ? 28 ARG D CG  1 
ATOM   1000 C  CD  . ARG D 1 28 ? -30.672 -1.337  -16.077 1.00 53.46 ? 28 ARG D CD  1 
ATOM   1001 N  NE  . ARG D 1 28 ? -29.629 -1.459  -15.045 1.00 59.27 ? 28 ARG D NE  1 
ATOM   1002 C  CZ  . ARG D 1 28 ? -29.092 -0.444  -14.354 1.00 64.64 ? 28 ARG D CZ  1 
ATOM   1003 N  NH1 . ARG D 1 28 ? -29.476 0.825   -14.554 1.00 66.30 ? 28 ARG D NH1 1 
ATOM   1004 N  NH2 . ARG D 1 28 ? -28.133 -0.697  -13.457 1.00 67.09 ? 28 ARG D NH2 1 
ATOM   1005 N  N   . PHE D 1 29 ? -33.766 -5.063  -14.210 1.00 33.54 ? 29 PHE D N   1 
ATOM   1006 C  CA  . PHE D 1 29 ? -35.143 -5.590  -14.139 1.00 32.34 ? 29 PHE D CA  1 
ATOM   1007 C  C   . PHE D 1 29 ? -36.053 -4.821  -15.090 1.00 32.19 ? 29 PHE D C   1 
ATOM   1008 O  O   . PHE D 1 29 ? -36.414 -3.623  -14.821 1.00 33.68 ? 29 PHE D O   1 
ATOM   1009 C  CB  . PHE D 1 29 ? -35.654 -5.520  -12.697 1.00 31.35 ? 29 PHE D CB  1 
ATOM   1010 C  CG  . PHE D 1 29 ? -36.910 -6.300  -12.450 1.00 30.47 ? 29 PHE D CG  1 
ATOM   1011 C  CD1 . PHE D 1 29 ? -36.895 -7.688  -12.439 1.00 30.42 ? 29 PHE D CD1 1 
ATOM   1012 C  CD2 . PHE D 1 29 ? -38.093 -5.649  -12.178 1.00 30.33 ? 29 PHE D CD2 1 
ATOM   1013 C  CE1 . PHE D 1 29 ? -38.036 -8.417  -12.193 1.00 31.11 ? 29 PHE D CE1 1 
ATOM   1014 C  CE2 . PHE D 1 29 ? -39.243 -6.405  -11.915 1.00 31.09 ? 29 PHE D CE2 1 
ATOM   1015 C  CZ  . PHE D 1 29 ? -39.206 -7.759  -11.918 1.00 32.40 ? 29 PHE D CZ  1 
ATOM   1016 N  N   . CYS D 1 30 ? -36.426 -5.473  -16.205 1.00 31.58 ? 30 CYS D N   1 
ATOM   1017 C  CA  . CYS D 1 30 ? -37.126 -4.821  -17.324 1.00 32.15 ? 30 CYS D CA  1 
ATOM   1018 C  C   . CYS D 1 30 ? -38.559 -5.245  -17.409 1.00 33.00 ? 30 CYS D C   1 
ATOM   1019 O  O   . CYS D 1 30 ? -38.840 -6.437  -17.476 1.00 34.74 ? 30 CYS D O   1 
ATOM   1020 C  CB  . CYS D 1 30 ? -36.449 -5.162  -18.672 1.00 31.86 ? 30 CYS D CB  1 
ATOM   1021 S  SG  . CYS D 1 30 ? -34.654 -4.779  -18.762 1.00 32.30 ? 30 CYS D SG  1 
ATOM   1022 N  N   . CYS D 1 31 ? -39.483 -4.311  -17.409 1.00 32.81 ? 31 CYS D N   1 
ATOM   1023 C  CA  . CYS D 1 31 ? -40.899 -4.691  -17.444 1.00 34.01 ? 31 CYS D CA  1 
ATOM   1024 C  C   . CYS D 1 31 ? -41.636 -3.960  -18.549 1.00 35.23 ? 31 CYS D C   1 
ATOM   1025 O  O   . CYS D 1 31 ? -41.283 -2.854  -18.936 1.00 35.86 ? 31 CYS D O   1 
ATOM   1026 C  CB  . CYS D 1 31 ? -41.661 -4.396  -16.129 1.00 32.32 ? 31 CYS D CB  1 
ATOM   1027 S  SG  . CYS D 1 31 ? -40.937 -5.047  -14.657 1.00 29.99 ? 31 CYS D SG  1 
ATOM   1028 N  N   . LEU D 1 32 ? -42.697 -4.595  -19.013 1.00 37.20 ? 32 LEU D N   1 
ATOM   1029 C  CA  . LEU D 1 32 ? -43.699 -3.916  -19.819 1.00 39.51 ? 32 LEU D CA  1 
ATOM   1030 C  C   . LEU D 1 32 ? -45.124 -4.368  -19.454 1.00 40.09 ? 32 LEU D C   1 
ATOM   1031 O  O   . LEU D 1 32 ? -45.375 -5.464  -18.950 1.00 39.94 ? 32 LEU D O   1 
ATOM   1032 C  CB  . LEU D 1 32 ? -43.403 -4.099  -21.314 1.00 39.14 ? 32 LEU D CB  1 
ATOM   1033 C  CG  . LEU D 1 32 ? -43.819 -5.313  -22.134 1.00 41.40 ? 32 LEU D CG  1 
ATOM   1034 C  CD1 . LEU D 1 32 ? -43.574 -4.945  -23.603 1.00 43.53 ? 32 LEU D CD1 1 
ATOM   1035 C  CD2 . LEU D 1 32 ? -43.097 -6.628  -21.743 1.00 42.67 ? 32 LEU D CD2 1 
ATOM   1036 O  OXT . LEU D 1 32 ? -46.073 -3.627  -19.653 1.00 41.88 ? 32 LEU D OXT 1 
HETATM 1037 CL CL  . CL  E 2 .  ? 0.027   -14.062 -11.567 1.00 74.31 ? 33 CL  A CL  1 
HETATM 1038 CL CL  . CL  F 2 .  ? -16.670 0.841   -12.435 1.00 72.99 ? 33 CL  B CL  1 
HETATM 1039 C  C1  . GOL G 3 .  ? -21.467 16.784  -1.834  1.00 47.54 ? 33 GOL C C1  1 
HETATM 1040 O  O1  . GOL G 3 .  ? -20.117 16.457  -1.982  1.00 42.37 ? 33 GOL C O1  1 
HETATM 1041 C  C2  . GOL G 3 .  ? -22.297 16.031  -2.869  1.00 48.07 ? 33 GOL C C2  1 
HETATM 1042 O  O2  . GOL G 3 .  ? -23.582 15.879  -2.310  1.00 50.76 ? 33 GOL C O2  1 
HETATM 1043 C  C3  . GOL G 3 .  ? -22.322 16.747  -4.236  1.00 44.53 ? 33 GOL C C3  1 
HETATM 1044 O  O3  . GOL G 3 .  ? -23.570 17.401  -4.489  1.00 49.06 ? 33 GOL C O3  1 
HETATM 1045 O  O   . HOH H 4 .  ? -12.734 -16.626 -15.339 1.00 43.81 ? 34 HOH A O   1 
HETATM 1046 O  O   . HOH H 4 .  ? -18.985 -17.922 -5.626  1.00 44.63 ? 35 HOH A O   1 
HETATM 1047 O  O   . HOH H 4 .  ? -8.127  -14.269 -6.901  1.00 36.89 ? 36 HOH A O   1 
HETATM 1048 O  O   . HOH H 4 .  ? -19.100 7.728   -9.194  1.00 34.47 ? 37 HOH A O   1 
HETATM 1049 O  O   . HOH H 4 .  ? -17.222 8.110   -6.417  1.00 29.96 ? 38 HOH A O   1 
HETATM 1050 O  O   . HOH H 4 .  ? -8.652  -4.168  -0.011  1.00 46.45 ? 39 HOH A O   1 
HETATM 1051 O  O   . HOH H 4 .  ? -23.509 7.098   -2.264  1.00 37.63 ? 40 HOH A O   1 
HETATM 1052 O  O   . HOH H 4 .  ? -21.503 -7.863  -6.690  1.00 40.98 ? 41 HOH A O   1 
HETATM 1053 O  O   . HOH H 4 .  ? -6.682  -10.379 0.022   1.00 29.04 ? 42 HOH A O   1 
HETATM 1054 O  O   . HOH H 4 .  ? -9.524  -11.068 0.131   1.00 29.68 ? 43 HOH A O   1 
HETATM 1055 O  O   . HOH H 4 .  ? -20.947 -8.651  -2.579  1.00 36.98 ? 44 HOH A O   1 
HETATM 1056 O  O   . HOH H 4 .  ? -4.948  -1.875  -5.594  1.00 43.11 ? 45 HOH A O   1 
HETATM 1057 O  O   . HOH H 4 .  ? -15.049 -11.524 -10.540 1.00 45.94 ? 46 HOH A O   1 
HETATM 1058 O  O   . HOH H 4 .  ? -15.864 9.711   -4.717  1.00 48.90 ? 47 HOH A O   1 
HETATM 1059 O  O   . HOH H 4 .  ? -17.445 -4.290  -12.068 1.00 43.08 ? 48 HOH A O   1 
HETATM 1060 O  O   . HOH I 4 .  ? -19.925 2.640   -16.366 1.00 43.10 ? 34 HOH B O   1 
HETATM 1061 O  O   . HOH I 4 .  ? -23.935 8.508   -20.001 1.00 46.53 ? 37 HOH B O   1 
HETATM 1062 O  O   . HOH I 4 .  ? -21.793 4.512   -23.565 1.00 48.08 ? 38 HOH B O   1 
HETATM 1063 O  O   . HOH J 4 .  ? -34.632 12.948  -12.239 1.00 43.59 ? 34 HOH C O   1 
HETATM 1064 O  O   . HOH J 4 .  ? -26.574 12.370  -1.768  1.00 24.45 ? 35 HOH C O   1 
HETATM 1065 O  O   . HOH J 4 .  ? -17.363 10.959  -7.344  1.00 41.82 ? 36 HOH C O   1 
HETATM 1066 O  O   . HOH J 4 .  ? -23.797 -2.031  -1.511  1.00 39.61 ? 37 HOH C O   1 
HETATM 1067 O  O   . HOH J 4 .  ? -35.900 20.503  0.137   1.00 41.64 ? 38 HOH C O   1 
HETATM 1068 O  O   . HOH J 4 .  ? -25.671 0.190   -12.571 1.00 49.65 ? 39 HOH C O   1 
HETATM 1069 O  O   . HOH J 4 .  ? -31.187 29.319  -3.195  1.00 37.69 ? 40 HOH C O   1 
HETATM 1070 O  O   . HOH J 4 .  ? -34.613 16.733  -12.169 1.00 50.23 ? 41 HOH C O   1 
HETATM 1071 O  O   . HOH J 4 .  ? -21.335 13.813  -5.441  1.00 46.04 ? 42 HOH C O   1 
HETATM 1072 O  O   . HOH J 4 .  ? -38.484 20.604  0.173   1.00 28.60 ? 43 HOH C O   1 
HETATM 1073 O  O   . HOH K 4 .  ? -30.001 -9.987  -21.752 1.00 48.00 ? 33 HOH D O   1 
HETATM 1074 O  O   . HOH K 4 .  ? -26.912 -12.099 -5.865  1.00 29.87 ? 34 HOH D O   1 
HETATM 1075 O  O   . HOH K 4 .  ? -26.878 -16.122 -9.197  1.00 36.21 ? 35 HOH D O   1 
HETATM 1076 O  O   . HOH K 4 .  ? -37.978 -12.297 -23.967 1.00 57.07 ? 36 HOH D O   1 
HETATM 1077 O  O   . HOH K 4 .  ? -23.839 -2.072  -12.292 1.00 48.63 ? 37 HOH D O   1 
HETATM 1078 O  O   . HOH K 4 .  ? -21.342 -6.756  -10.298 1.00 54.09 ? 38 HOH D O   1 
HETATM 1079 O  O   . HOH K 4 .  ? -30.965 -5.903  -6.700  1.00 31.66 ? 39 HOH D O   1 
HETATM 1080 O  O   . HOH K 4 .  ? -25.080 -13.325 -7.630  1.00 41.26 ? 40 HOH D O   1 
HETATM 1081 O  O   . HOH K 4 .  ? -36.675 -1.554  -31.093 1.00 42.17 ? 42 HOH D O   1 
HETATM 1082 O  O   . HOH K 4 .  ? -35.783 -13.046 -15.999 1.00 36.91 ? 43 HOH D O   1 
HETATM 1083 O  O   . HOH K 4 .  ? -29.742 -12.055 -25.679 1.00 42.28 ? 44 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ALA A 1  ? 0.5799 0.4722 0.6294 -0.0351 0.0488  -0.0480 1  ALA A N   
2    C  CA  . ALA A 1  ? 0.5530 0.4560 0.5907 -0.0326 0.0343  -0.0447 1  ALA A CA  
3    C  C   . ALA A 1  ? 0.5289 0.4501 0.5837 -0.0264 0.0221  -0.0377 1  ALA A C   
4    O  O   . ALA A 1  ? 0.5435 0.4677 0.6096 -0.0265 0.0229  -0.0373 1  ALA A O   
5    C  CB  . ALA A 1  ? 0.5723 0.4704 0.5800 -0.0398 0.0279  -0.0500 1  ALA A CB  
6    N  N   . PHE A 2  ? 0.4751 0.4064 0.5313 -0.0213 0.0122  -0.0322 2  PHE A N   
7    C  CA  . PHE A 2  ? 0.4469 0.3922 0.5088 -0.0172 0.0001  -0.0270 2  PHE A CA  
8    C  C   . PHE A 2  ? 0.4338 0.3824 0.4758 -0.0199 -0.0080 -0.0295 2  PHE A C   
9    O  O   . PHE A 2  ? 0.4352 0.3783 0.4609 -0.0225 -0.0082 -0.0319 2  PHE A O   
10   C  CB  . PHE A 2  ? 0.4216 0.3736 0.4917 -0.0114 -0.0060 -0.0202 2  PHE A CB  
11   C  CG  . PHE A 2  ? 0.4392 0.3906 0.5322 -0.0086 -0.0021 -0.0152 2  PHE A CG  
12   C  CD1 . PHE A 2  ? 0.5114 0.4555 0.6134 -0.0085 0.0066  -0.0150 2  PHE A CD1 
13   C  CD2 . PHE A 2  ? 0.4806 0.4381 0.5875 -0.0065 -0.0070 -0.0099 2  PHE A CD2 
14   C  CE1 . PHE A 2  ? 0.5151 0.4594 0.6436 -0.0060 0.0097  -0.0088 2  PHE A CE1 
15   C  CE2 . PHE A 2  ? 0.5101 0.4671 0.6400 -0.0045 -0.0053 -0.0036 2  PHE A CE2 
16   C  CZ  . PHE A 2  ? 0.4994 0.4506 0.6422 -0.0042 0.0026  -0.0027 2  PHE A CZ  
17   N  N   . THR A 3  ? 0.4167 0.3739 0.4612 -0.0195 -0.0149 -0.0280 3  THR A N   
18   C  CA  . THR A 3  ? 0.4198 0.3832 0.4523 -0.0207 -0.0242 -0.0279 3  THR A CA  
19   C  C   . THR A 3  ? 0.4039 0.3780 0.4443 -0.0145 -0.0312 -0.0218 3  THR A C   
20   O  O   . THR A 3  ? 0.4033 0.3809 0.4556 -0.0120 -0.0308 -0.0192 3  THR A O   
21   C  CB  . THR A 3  ? 0.4414 0.4045 0.4711 -0.0264 -0.0250 -0.0316 3  THR A CB  
22   O  OG1 . THR A 3  ? 0.4789 0.4282 0.4992 -0.0330 -0.0164 -0.0379 3  THR A OG1 
23   C  CG2 . THR A 3  ? 0.4396 0.4087 0.4595 -0.0286 -0.0353 -0.0306 3  THR A CG2 
24   N  N   . CYS A 4  ? 0.4080 0.3852 0.4408 -0.0121 -0.0368 -0.0194 4  CYS A N   
25   C  CA  . CYS A 4  ? 0.3898 0.3737 0.4275 -0.0064 -0.0415 -0.0140 4  CYS A CA  
26   C  C   . CYS A 4  ? 0.3959 0.3866 0.4291 -0.0054 -0.0481 -0.0121 4  CYS A C   
27   O  O   . CYS A 4  ? 0.4084 0.3988 0.4327 -0.0083 -0.0513 -0.0134 4  CYS A O   
28   C  CB  . CYS A 4  ? 0.3744 0.3550 0.4119 -0.0032 -0.0406 -0.0116 4  CYS A CB  
29   S  SG  . CYS A 4  ? 0.3574 0.3305 0.4060 -0.0040 -0.0326 -0.0123 4  CYS A SG  
30   N  N   . HIS A 5  ? 0.3752 0.3709 0.4150 -0.0019 -0.0497 -0.0085 5  HIS A N   
31   C  CA  . HIS A 5  ? 0.3675 0.3691 0.4072 0.0000  -0.0539 -0.0056 5  HIS A CA  
32   C  C   . HIS A 5  ? 0.3630 0.3632 0.4026 0.0051  -0.0530 -0.0018 5  HIS A C   
33   O  O   . HIS A 5  ? 0.3678 0.3638 0.4090 0.0060  -0.0505 -0.0009 5  HIS A O   
34   C  CB  . HIS A 5  ? 0.3683 0.3758 0.4172 -0.0014 -0.0547 -0.0053 5  HIS A CB  
35   C  CG  . HIS A 5  ? 0.4013 0.4096 0.4486 -0.0076 -0.0573 -0.0087 5  HIS A CG  
36   N  ND1 . HIS A 5  ? 0.4205 0.4238 0.4671 -0.0118 -0.0534 -0.0131 5  HIS A ND1 
37   C  CD2 . HIS A 5  ? 0.3988 0.4107 0.4439 -0.0112 -0.0637 -0.0081 5  HIS A CD2 
38   C  CE1 . HIS A 5  ? 0.4257 0.4280 0.4669 -0.0181 -0.0568 -0.0159 5  HIS A CE1 
39   N  NE2 . HIS A 5  ? 0.4515 0.4592 0.4915 -0.0182 -0.0641 -0.0126 5  HIS A NE2 
40   N  N   . CYS A 6  ? 0.3444 0.3467 0.3816 0.0078  -0.0551 0.0007  6  CYS A N   
41   C  CA  . CYS A 6  ? 0.3336 0.3327 0.3694 0.0119  -0.0529 0.0039  6  CYS A CA  
42   C  C   . CYS A 6  ? 0.3343 0.3363 0.3783 0.0129  -0.0501 0.0057  6  CYS A C   
43   O  O   . CYS A 6  ? 0.3176 0.3266 0.3697 0.0127  -0.0517 0.0067  6  CYS A O   
44   C  CB  . CYS A 6  ? 0.3410 0.3405 0.3724 0.0146  -0.0547 0.0061  6  CYS A CB  
45   S  SG  . CYS A 6  ? 0.3509 0.3459 0.3723 0.0139  -0.0568 0.0046  6  CYS A SG  
46   N  N   . ARG A 7  ? 0.3376 0.3335 0.3799 0.0135  -0.0461 0.0065  7  ARG A N   
47   C  CA  . ARG A 7  ? 0.3544 0.3510 0.4040 0.0141  -0.0415 0.0078  7  ARG A CA  
48   C  C   . ARG A 7  ? 0.3719 0.3574 0.4122 0.0161  -0.0361 0.0101  7  ARG A C   
49   O  O   . ARG A 7  ? 0.3821 0.3590 0.4100 0.0155  -0.0376 0.0104  7  ARG A O   
50   C  CB  . ARG A 7  ? 0.3467 0.3443 0.4015 0.0110  -0.0410 0.0060  7  ARG A CB  
51   C  CG  . ARG A 7  ? 0.3451 0.3492 0.4050 0.0075  -0.0449 0.0027  7  ARG A CG  
52   C  CD  . ARG A 7  ? 0.3326 0.3383 0.4006 0.0050  -0.0427 0.0014  7  ARG A CD  
53   N  NE  . ARG A 7  ? 0.3379 0.3458 0.4079 0.0007  -0.0448 -0.0024 7  ARG A NE  
54   C  CZ  . ARG A 7  ? 0.3237 0.3373 0.3970 -0.0025 -0.0482 -0.0042 7  ARG A CZ  
55   N  NH1 . ARG A 7  ? 0.2994 0.3193 0.3783 -0.0013 -0.0511 -0.0014 7  ARG A NH1 
56   N  NH2 . ARG A 7  ? 0.3351 0.3469 0.4063 -0.0074 -0.0488 -0.0085 7  ARG A NH2 
57   N  N   . ARG A 8  ? 0.3747 0.3587 0.4203 0.0176  -0.0294 0.0118  8  ARG A N   
58   C  CA  . ARG A 8  ? 0.4048 0.3738 0.4373 0.0180  -0.0224 0.0133  8  ARG A CA  
59   C  C   . ARG A 8  ? 0.4022 0.3636 0.4257 0.0146  -0.0240 0.0131  8  ARG A C   
60   O  O   . ARG A 8  ? 0.4180 0.3663 0.4247 0.0130  -0.0247 0.0143  8  ARG A O   
61   C  CB  . ARG A 8  ? 0.4117 0.3790 0.4530 0.0201  -0.0124 0.0150  8  ARG A CB  
62   C  CG  . ARG A 8  ? 0.5219 0.4756 0.5526 0.0223  -0.0034 0.0166  8  ARG A CG  
63   C  CD  . ARG A 8  ? 0.5628 0.5252 0.6035 0.0260  -0.0052 0.0179  8  ARG A CD  
64   N  NE  . ARG A 8  ? 0.5766 0.5292 0.5999 0.0264  -0.0063 0.0175  8  ARG A NE  
65   C  CZ  . ARG A 8  ? 0.5747 0.5124 0.5869 0.0277  0.0030  0.0183  8  ARG A CZ  
66   N  NH1 . ARG A 8  ? 0.5574 0.4885 0.5753 0.0291  0.0153  0.0196  8  ARG A NH1 
67   N  NH2 . ARG A 8  ? 0.5777 0.5056 0.5728 0.0272  0.0012  0.0177  8  ARG A NH2 
68   N  N   . SER A 9  ? 0.3855 0.3549 0.4209 0.0131  -0.0252 0.0120  9  SER A N   
69   C  CA  . SER A 9  ? 0.3967 0.3617 0.4295 0.0102  -0.0268 0.0122  9  SER A CA  
70   C  C   . SER A 9  ? 0.3531 0.3288 0.3977 0.0085  -0.0320 0.0099  9  SER A C   
71   O  O   . SER A 9  ? 0.3499 0.3359 0.4069 0.0085  -0.0318 0.0078  9  SER A O   
72   C  CB  . SER A 9  ? 0.3944 0.3567 0.4317 0.0098  -0.0195 0.0130  9  SER A CB  
73   O  OG  . SER A 9  ? 0.5371 0.4828 0.5565 0.0082  -0.0167 0.0154  9  SER A OG  
74   N  N   . CYS A 10 ? 0.3414 0.3135 0.3831 0.0066  -0.0361 0.0105  10 CYS A N   
75   C  CA  . CYS A 10 ? 0.3209 0.3005 0.3742 0.0049  -0.0382 0.0079  10 CYS A CA  
76   C  C   . CYS A 10 ? 0.3249 0.3073 0.3877 0.0033  -0.0347 0.0070  10 CYS A C   
77   O  O   . CYS A 10 ? 0.3371 0.3132 0.3971 0.0030  -0.0316 0.0095  10 CYS A O   
78   C  CB  . CYS A 10 ? 0.3200 0.2952 0.3727 0.0036  -0.0421 0.0097  10 CYS A CB  
79   S  SG  . CYS A 10 ? 0.2959 0.2684 0.3396 0.0050  -0.0466 0.0107  10 CYS A SG  
80   N  N   . TYR A 11 ? 0.3217 0.3121 0.3942 0.0017  -0.0349 0.0033  11 TYR A N   
81   C  CA  . TYR A 11 ? 0.3398 0.3328 0.4221 -0.0004 -0.0318 0.0018  11 TYR A CA  
82   C  C   . TYR A 11 ? 0.3528 0.3400 0.4377 -0.0017 -0.0310 0.0034  11 TYR A C   
83   O  O   . TYR A 11 ? 0.3397 0.3227 0.4219 -0.0015 -0.0336 0.0053  11 TYR A O   
84   C  CB  . TYR A 11 ? 0.3196 0.3201 0.4085 -0.0033 -0.0330 -0.0027 11 TYR A CB  
85   C  CG  . TYR A 11 ? 0.3597 0.3673 0.4516 -0.0028 -0.0347 -0.0026 11 TYR A CG  
86   C  CD1 . TYR A 11 ? 0.3738 0.3806 0.4634 0.0008  -0.0333 0.0008  11 TYR A CD1 
87   C  CD2 . TYR A 11 ? 0.4031 0.4169 0.5002 -0.0067 -0.0378 -0.0057 11 TYR A CD2 
88   C  CE1 . TYR A 11 ? 0.4167 0.4307 0.5140 0.0017  -0.0343 0.0021  11 TYR A CE1 
89   C  CE2 . TYR A 11 ? 0.4287 0.4499 0.5321 -0.0068 -0.0411 -0.0041 11 TYR A CE2 
90   C  CZ  . TYR A 11 ? 0.4294 0.4516 0.5351 -0.0021 -0.0391 0.0001  11 TYR A CZ  
91   O  OH  . TYR A 11 ? 0.4571 0.4873 0.5733 -0.0019 -0.0422 0.0028  11 TYR A OH  
92   N  N   . SER A 12 ? 0.3704 0.3575 0.4624 -0.0032 -0.0274 0.0034  12 SER A N   
93   C  CA  . SER A 12 ? 0.3970 0.3783 0.4934 -0.0043 -0.0264 0.0063  12 SER A CA  
94   C  C   . SER A 12 ? 0.3961 0.3782 0.5010 -0.0058 -0.0265 0.0043  12 SER A C   
95   O  O   . SER A 12 ? 0.4207 0.3980 0.5309 -0.0060 -0.0269 0.0082  12 SER A O   
96   C  CB  . SER A 12 ? 0.4068 0.3879 0.5091 -0.0055 -0.0217 0.0065  12 SER A CB  
97   O  OG  . SER A 12 ? 0.4510 0.4391 0.5636 -0.0078 -0.0194 0.0013  12 SER A OG  
98   N  N   . THR A 13 ? 0.3889 0.3756 0.4944 -0.0070 -0.0261 -0.0010 13 THR A N   
99   C  CA  . THR A 13 ? 0.3897 0.3748 0.5007 -0.0089 -0.0237 -0.0040 13 THR A CA  
100  C  C   . THR A 13 ? 0.3743 0.3575 0.4806 -0.0070 -0.0266 -0.0025 13 THR A C   
101  O  O   . THR A 13 ? 0.3595 0.3398 0.4713 -0.0080 -0.0235 -0.0040 13 THR A O   
102  C  CB  . THR A 13 ? 0.4213 0.4091 0.5310 -0.0128 -0.0215 -0.0110 13 THR A CB  
103  O  OG1 . THR A 13 ? 0.4640 0.4575 0.5656 -0.0124 -0.0260 -0.0119 13 THR A OG1 
104  C  CG2 . THR A 13 ? 0.3930 0.3812 0.5110 -0.0153 -0.0177 -0.0124 13 THR A CG2 
105  N  N   . GLU A 14 ? 0.3373 0.3210 0.4342 -0.0045 -0.0315 0.0006  14 GLU A N   
106  C  CA  . GLU A 14 ? 0.3231 0.3054 0.4147 -0.0030 -0.0345 0.0017  14 GLU A CA  
107  C  C   . GLU A 14 ? 0.3239 0.3012 0.4140 -0.0015 -0.0391 0.0085  14 GLU A C   
108  O  O   . GLU A 14 ? 0.3224 0.2964 0.4111 -0.0017 -0.0403 0.0123  14 GLU A O   
109  C  CB  . GLU A 14 ? 0.2985 0.2848 0.3791 -0.0019 -0.0369 -0.0005 14 GLU A CB  
110  C  CG  . GLU A 14 ? 0.3324 0.3232 0.4134 -0.0047 -0.0350 -0.0061 14 GLU A CG  
111  C  CD  . GLU A 14 ? 0.3613 0.3572 0.4356 -0.0038 -0.0384 -0.0065 14 GLU A CD  
112  O  OE1 . GLU A 14 ? 0.3381 0.3341 0.4090 -0.0006 -0.0398 -0.0029 14 GLU A OE1 
113  O  OE2 . GLU A 14 ? 0.3735 0.3722 0.4455 -0.0066 -0.0396 -0.0101 14 GLU A OE2 
114  N  N   . TYR A 15 ? 0.3171 0.2927 0.4059 -0.0006 -0.0420 0.0102  15 TYR A N   
115  C  CA  . TYR A 15 ? 0.3357 0.3061 0.4186 -0.0001 -0.0484 0.0165  15 TYR A CA  
116  C  C   . TYR A 15 ? 0.3161 0.2867 0.3878 0.0013  -0.0507 0.0151  15 TYR A C   
117  O  O   . TYR A 15 ? 0.3126 0.2876 0.3839 0.0020  -0.0478 0.0103  15 TYR A O   
118  C  CB  . TYR A 15 ? 0.3379 0.3053 0.4357 -0.0011 -0.0510 0.0221  15 TYR A CB  
119  C  CG  . TYR A 15 ? 0.3738 0.3408 0.4857 -0.0023 -0.0483 0.0242  15 TYR A CG  
120  C  CD1 . TYR A 15 ? 0.4294 0.3911 0.5400 -0.0038 -0.0536 0.0310  15 TYR A CD1 
121  C  CD2 . TYR A 15 ? 0.4159 0.3862 0.5404 -0.0026 -0.0400 0.0191  15 TYR A CD2 
122  C  CE1 . TYR A 15 ? 0.4924 0.4535 0.6162 -0.0048 -0.0511 0.0335  15 TYR A CE1 
123  C  CE2 . TYR A 15 ? 0.4528 0.4221 0.5908 -0.0038 -0.0364 0.0208  15 TYR A CE2 
124  C  CZ  . TYR A 15 ? 0.4997 0.4652 0.6385 -0.0045 -0.0422 0.0283  15 TYR A CZ  
125  O  OH  . TYR A 15 ? 0.5069 0.4711 0.6592 -0.0055 -0.0394 0.0311  15 TYR A OH  
126  N  N   . SER A 16 ? 0.3332 0.2976 0.3943 0.0012  -0.0561 0.0196  16 SER A N   
127  C  CA  . SER A 16 ? 0.3424 0.3052 0.3921 0.0025  -0.0585 0.0191  16 SER A CA  
128  C  C   . SER A 16 ? 0.3466 0.3087 0.4039 0.0020  -0.0619 0.0216  16 SER A C   
129  O  O   . SER A 16 ? 0.3832 0.3410 0.4474 0.0000  -0.0671 0.0275  16 SER A O   
130  C  CB  . SER A 16 ? 0.3422 0.2959 0.3745 0.0017  -0.0614 0.0221  16 SER A CB  
131  O  OG  . SER A 16 ? 0.3694 0.3228 0.3912 0.0037  -0.0607 0.0198  16 SER A OG  
132  N  N   . TYR A 17 ? 0.3416 0.3073 0.3982 0.0037  -0.0597 0.0179  17 TYR A N   
133  C  CA  . TYR A 17 ? 0.3469 0.3120 0.4122 0.0035  -0.0611 0.0198  17 TYR A CA  
134  C  C   . TYR A 17 ? 0.3398 0.3017 0.3928 0.0042  -0.0650 0.0207  17 TYR A C   
135  O  O   . TYR A 17 ? 0.3606 0.3216 0.4198 0.0041  -0.0665 0.0224  17 TYR A O   
136  C  CB  . TYR A 17 ? 0.3429 0.3124 0.4159 0.0041  -0.0537 0.0143  17 TYR A CB  
137  C  CG  . TYR A 17 ? 0.3794 0.3497 0.4684 0.0028  -0.0489 0.0140  17 TYR A CG  
138  C  CD1 . TYR A 17 ? 0.3764 0.3450 0.4835 0.0023  -0.0462 0.0168  17 TYR A CD1 
139  C  CD2 . TYR A 17 ? 0.3895 0.3619 0.4772 0.0021  -0.0462 0.0114  17 TYR A CD2 
140  C  CE1 . TYR A 17 ? 0.4130 0.3813 0.5360 0.0013  -0.0403 0.0166  17 TYR A CE1 
141  C  CE2 . TYR A 17 ? 0.4059 0.3780 0.5078 0.0008  -0.0411 0.0109  17 TYR A CE2 
142  C  CZ  . TYR A 17 ? 0.4059 0.3757 0.5249 0.0005  -0.0377 0.0133  17 TYR A CZ  
143  O  OH  . TYR A 17 ? 0.3947 0.3634 0.5286 -0.0006 -0.0311 0.0127  17 TYR A OH  
144  N  N   . GLY A 18 ? 0.3417 0.3015 0.3785 0.0051  -0.0653 0.0193  18 GLY A N   
145  C  CA  . GLY A 18 ? 0.3456 0.3016 0.3700 0.0061  -0.0673 0.0195  18 GLY A CA  
146  C  C   . GLY A 18 ? 0.3391 0.2951 0.3509 0.0081  -0.0638 0.0166  18 GLY A C   
147  O  O   . GLY A 18 ? 0.3387 0.2955 0.3497 0.0082  -0.0611 0.0159  18 GLY A O   
148  N  N   . THR A 19 ? 0.3206 0.2756 0.3245 0.0100  -0.0633 0.0156  19 THR A N   
149  C  CA  . THR A 19 ? 0.3519 0.3064 0.3469 0.0123  -0.0594 0.0141  19 THR A CA  
150  C  C   . THR A 19 ? 0.3412 0.3033 0.3389 0.0151  -0.0574 0.0117  19 THR A C   
151  O  O   . THR A 19 ? 0.3660 0.3295 0.3652 0.0153  -0.0589 0.0112  19 THR A O   
152  C  CB  . THR A 19 ? 0.3633 0.3048 0.3417 0.0116  -0.0597 0.0163  19 THR A CB  
153  O  OG1 . THR A 19 ? 0.4584 0.3979 0.4326 0.0124  -0.0613 0.0164  19 THR A OG1 
154  C  CG2 . THR A 19 ? 0.3541 0.2853 0.3259 0.0072  -0.0645 0.0197  19 THR A CG2 
155  N  N   . CYS A 20 ? 0.3476 0.3134 0.3457 0.0173  -0.0540 0.0109  20 CYS A N   
156  C  CA  . CYS A 20 ? 0.3199 0.2911 0.3193 0.0196  -0.0536 0.0104  20 CYS A CA  
157  C  C   . CYS A 20 ? 0.3307 0.2965 0.3242 0.0222  -0.0500 0.0122  20 CYS A C   
158  O  O   . CYS A 20 ? 0.3376 0.2976 0.3280 0.0219  -0.0464 0.0129  20 CYS A O   
159  C  CB  . CYS A 20 ? 0.3093 0.2905 0.3181 0.0194  -0.0536 0.0091  20 CYS A CB  
160  S  SG  . CYS A 20 ? 0.3188 0.3033 0.3340 0.0157  -0.0545 0.0063  20 CYS A SG  
161  N  N   . THR A 21 ? 0.3268 0.2926 0.3179 0.0245  -0.0499 0.0130  21 THR A N   
162  C  CA  . THR A 21 ? 0.3566 0.3180 0.3460 0.0275  -0.0445 0.0150  21 THR A CA  
163  C  C   . THR A 21 ? 0.3607 0.3323 0.3609 0.0302  -0.0452 0.0167  21 THR A C   
164  O  O   . THR A 21 ? 0.3727 0.3474 0.3717 0.0304  -0.0493 0.0168  21 THR A O   
165  C  CB  . THR A 21 ? 0.3586 0.3075 0.3345 0.0277  -0.0427 0.0155  21 THR A CB  
166  O  OG1 . THR A 21 ? 0.4122 0.3503 0.3768 0.0239  -0.0440 0.0149  21 THR A OG1 
167  C  CG2 . THR A 21 ? 0.3558 0.2976 0.3299 0.0309  -0.0342 0.0171  21 THR A CG2 
168  N  N   . VAL A 22 ? 0.3605 0.3367 0.3718 0.0320  -0.0416 0.0186  22 VAL A N   
169  C  CA  . VAL A 22 ? 0.3800 0.3664 0.4053 0.0342  -0.0437 0.0221  22 VAL A CA  
170  C  C   . VAL A 22 ? 0.3915 0.3766 0.4282 0.0376  -0.0356 0.0254  22 VAL A C   
171  O  O   . VAL A 22 ? 0.3910 0.3710 0.4272 0.0371  -0.0295 0.0242  22 VAL A O   
172  C  CB  . VAL A 22 ? 0.3843 0.3822 0.4181 0.0311  -0.0508 0.0216  22 VAL A CB  
173  C  CG1 . VAL A 22 ? 0.4059 0.4116 0.4472 0.0315  -0.0569 0.0255  22 VAL A CG1 
174  C  CG2 . VAL A 22 ? 0.3874 0.3831 0.4102 0.0270  -0.0548 0.0170  22 VAL A CG2 
175  N  N   . MET A 23 ? 0.3901 0.3795 0.4385 0.0410  -0.0349 0.0300  23 MET A N   
176  C  CA  . MET A 23 ? 0.3996 0.3870 0.4627 0.0449  -0.0250 0.0339  23 MET A CA  
177  C  C   . MET A 23 ? 0.3956 0.3647 0.4429 0.0458  -0.0130 0.0312  23 MET A C   
178  O  O   . MET A 23 ? 0.3908 0.3534 0.4443 0.0475  -0.0020 0.0323  23 MET A O   
179  C  CB  . MET A 23 ? 0.4063 0.4030 0.4872 0.0438  -0.0251 0.0354  23 MET A CB  
180  C  CG  . MET A 23 ? 0.4949 0.5032 0.6031 0.0464  -0.0262 0.0425  23 MET A CG  
181  S  SD  . MET A 23 ? 0.5937 0.6190 0.7166 0.0416  -0.0397 0.0442  23 MET A SD  
182  C  CE  . MET A 23 ? 0.6400 0.6682 0.7518 0.0402  -0.0517 0.0454  23 MET A CE  
183  N  N   . GLY A 24 ? 0.3826 0.3420 0.4086 0.0439  -0.0152 0.0277  24 GLY A N   
184  C  CA  . GLY A 24 ? 0.3918 0.3314 0.3987 0.0432  -0.0059 0.0254  24 GLY A CA  
185  C  C   . GLY A 24 ? 0.3942 0.3238 0.3870 0.0391  -0.0038 0.0221  24 GLY A C   
186  O  O   . GLY A 24 ? 0.4082 0.3185 0.3825 0.0372  0.0043  0.0205  24 GLY A O   
187  N  N   . ILE A 25 ? 0.3575 0.2989 0.3589 0.0374  -0.0102 0.0216  25 ILE A N   
188  C  CA  . ILE A 25 ? 0.3608 0.2941 0.3512 0.0336  -0.0090 0.0193  25 ILE A CA  
189  C  C   . ILE A 25 ? 0.3397 0.2803 0.3274 0.0301  -0.0201 0.0174  25 ILE A C   
190  O  O   . ILE A 25 ? 0.3255 0.2792 0.3227 0.0307  -0.0276 0.0175  25 ILE A O   
191  C  CB  . ILE A 25 ? 0.3478 0.2823 0.3504 0.0346  -0.0006 0.0204  25 ILE A CB  
192  C  CG1 . ILE A 25 ? 0.3003 0.2553 0.3269 0.0358  -0.0068 0.0221  25 ILE A CG1 
193  C  CG2 . ILE A 25 ? 0.4016 0.3240 0.4059 0.0379  0.0143  0.0223  25 ILE A CG2 
194  C  CD1 . ILE A 25 ? 0.3494 0.3061 0.3928 0.0375  0.0025  0.0242  25 ILE A CD1 
195  N  N   . ASN A 26 ? 0.3641 0.2937 0.3373 0.0261  -0.0206 0.0161  26 ASN A N   
196  C  CA  . ASN A 26 ? 0.3601 0.2945 0.3327 0.0227  -0.0296 0.0151  26 ASN A CA  
197  C  C   . ASN A 26 ? 0.3387 0.2843 0.3258 0.0225  -0.0300 0.0147  26 ASN A C   
198  O  O   . ASN A 26 ? 0.3452 0.2902 0.3380 0.0236  -0.0231 0.0153  26 ASN A O   
199  C  CB  . ASN A 26 ? 0.3761 0.2941 0.3287 0.0178  -0.0319 0.0154  26 ASN A CB  
200  C  CG  . ASN A 26 ? 0.3982 0.3066 0.3371 0.0166  -0.0349 0.0156  26 ASN A CG  
201  O  OD1 . ASN A 26 ? 0.4078 0.3228 0.3529 0.0199  -0.0349 0.0154  26 ASN A OD1 
202  N  ND2 . ASN A 26 ? 0.4258 0.3169 0.3449 0.0115  -0.0371 0.0166  26 ASN A ND2 
203  N  N   . TRP A 27 ? 0.3359 0.2912 0.3298 0.0210  -0.0374 0.0136  27 TRP A N   
204  C  CA  . TRP A 27 ? 0.3309 0.2950 0.3364 0.0198  -0.0385 0.0126  27 TRP A CA  
205  C  C   . TRP A 27 ? 0.3355 0.2974 0.3373 0.0166  -0.0440 0.0120  27 TRP A C   
206  O  O   . TRP A 27 ? 0.3713 0.3285 0.3658 0.0160  -0.0476 0.0126  27 TRP A O   
207  C  CB  . TRP A 27 ? 0.3241 0.3023 0.3425 0.0210  -0.0419 0.0118  27 TRP A CB  
208  C  CG  . TRP A 27 ? 0.3572 0.3388 0.3823 0.0243  -0.0386 0.0139  27 TRP A CG  
209  C  CD1 . TRP A 27 ? 0.3763 0.3563 0.3982 0.0268  -0.0386 0.0154  27 TRP A CD1 
210  C  CD2 . TRP A 27 ? 0.3699 0.3571 0.4090 0.0256  -0.0346 0.0157  27 TRP A CD2 
211  N  NE1 . TRP A 27 ? 0.3722 0.3568 0.4066 0.0298  -0.0348 0.0184  27 TRP A NE1 
212  C  CE2 . TRP A 27 ? 0.3923 0.3816 0.4382 0.0291  -0.0323 0.0188  27 TRP A CE2 
213  C  CE3 . TRP A 27 ? 0.3979 0.3890 0.4465 0.0241  -0.0328 0.0154  27 TRP A CE3 
214  C  CZ2 . TRP A 27 ? 0.3722 0.3678 0.4362 0.0312  -0.0284 0.0222  27 TRP A CZ2 
215  C  CZ3 . TRP A 27 ? 0.4450 0.4422 0.5103 0.0260  -0.0287 0.0182  27 TRP A CZ3 
216  C  CH2 . TRP A 27 ? 0.4097 0.4093 0.4836 0.0295  -0.0266 0.0219  27 TRP A CH2 
217  N  N   . ARG A 28 ? 0.3371 0.3025 0.3460 0.0146  -0.0447 0.0114  28 ARG A N   
218  C  CA  . ARG A 28 ? 0.3440 0.3087 0.3548 0.0120  -0.0494 0.0116  28 ARG A CA  
219  C  C   . ARG A 28 ? 0.3297 0.3046 0.3513 0.0117  -0.0508 0.0087  28 ARG A C   
220  O  O   . ARG A 28 ? 0.3376 0.3199 0.3656 0.0120  -0.0492 0.0067  28 ARG A O   
221  C  CB  . ARG A 28 ? 0.3432 0.3036 0.3551 0.0095  -0.0488 0.0131  28 ARG A CB  
222  C  CG  . ARG A 28 ? 0.3657 0.3133 0.3633 0.0087  -0.0462 0.0156  28 ARG A CG  
223  C  CD  . ARG A 28 ? 0.4598 0.4015 0.4564 0.0057  -0.0463 0.0178  28 ARG A CD  
224  N  NE  . ARG A 28 ? 0.5276 0.4534 0.5062 0.0023  -0.0500 0.0216  28 ARG A NE  
225  C  CZ  . ARG A 28 ? 0.5580 0.4695 0.5183 0.0010  -0.0454 0.0224  28 ARG A CZ  
226  N  NH1 . ARG A 28 ? 0.6329 0.5448 0.5942 0.0036  -0.0356 0.0202  28 ARG A NH1 
227  N  NH2 . ARG A 28 ? 0.5731 0.4687 0.5144 -0.0033 -0.0503 0.0258  28 ARG A NH2 
228  N  N   . PHE A 29 ? 0.3210 0.2949 0.3444 0.0106  -0.0535 0.0087  29 PHE A N   
229  C  CA  . PHE A 29 ? 0.3141 0.2934 0.3448 0.0095  -0.0529 0.0057  29 PHE A CA  
230  C  C   . PHE A 29 ? 0.3138 0.2935 0.3543 0.0072  -0.0512 0.0051  29 PHE A C   
231  O  O   . PHE A 29 ? 0.3316 0.3075 0.3777 0.0062  -0.0522 0.0076  29 PHE A O   
232  C  CB  . PHE A 29 ? 0.3360 0.3128 0.3650 0.0097  -0.0543 0.0060  29 PHE A CB  
233  C  CG  . PHE A 29 ? 0.3359 0.3152 0.3683 0.0083  -0.0518 0.0024  29 PHE A CG  
234  C  CD1 . PHE A 29 ? 0.3519 0.3341 0.3778 0.0084  -0.0519 0.0000  29 PHE A CD1 
235  C  CD2 . PHE A 29 ? 0.3602 0.3373 0.4021 0.0064  -0.0488 0.0017  29 PHE A CD2 
236  C  CE1 . PHE A 29 ? 0.3718 0.3531 0.3960 0.0058  -0.0495 -0.0033 29 PHE A CE1 
237  C  CE2 . PHE A 29 ? 0.3900 0.3659 0.4322 0.0044  -0.0443 -0.0021 29 PHE A CE2 
238  C  CZ  . PHE A 29 ? 0.3553 0.3323 0.3862 0.0037  -0.0448 -0.0050 29 PHE A CZ  
239  N  N   . CYS A 30 ? 0.2970 0.2815 0.3413 0.0062  -0.0489 0.0024  30 CYS A N   
240  C  CA  . CYS A 30 ? 0.3057 0.2905 0.3588 0.0041  -0.0465 0.0018  30 CYS A CA  
241  C  C   . CYS A 30 ? 0.3267 0.3128 0.3848 0.0014  -0.0433 -0.0025 30 CYS A C   
242  O  O   . CYS A 30 ? 0.3401 0.3289 0.3932 0.0000  -0.0436 -0.0058 30 CYS A O   
243  C  CB  . CYS A 30 ? 0.2862 0.2743 0.3396 0.0044  -0.0454 0.0017  30 CYS A CB  
244  S  SG  . CYS A 30 ? 0.2962 0.2788 0.3407 0.0070  -0.0455 0.0061  30 CYS A SG  
245  N  N   . CYS A 31 ? 0.3355 0.3183 0.4030 0.0001  -0.0403 -0.0022 31 CYS A N   
246  C  CA  . CYS A 31 ? 0.3488 0.3293 0.4201 -0.0028 -0.0347 -0.0068 31 CYS A CA  
247  C  C   . CYS A 31 ? 0.3794 0.3586 0.4621 -0.0046 -0.0305 -0.0072 31 CYS A C   
248  O  O   . CYS A 31 ? 0.3883 0.3673 0.4787 -0.0032 -0.0322 -0.0024 31 CYS A O   
249  C  CB  . CYS A 31 ? 0.3337 0.3094 0.4088 -0.0023 -0.0321 -0.0060 31 CYS A CB  
250  S  SG  . CYS A 31 ? 0.3123 0.2881 0.3764 -0.0001 -0.0362 -0.0048 31 CYS A SG  
251  N  N   . LEU A 32 ? 0.4115 0.3882 0.4939 -0.0083 -0.0250 -0.0127 32 LEU A N   
252  C  CA  . LEU A 32 ? 0.4216 0.3947 0.5160 -0.0103 -0.0185 -0.0138 32 LEU A CA  
253  C  C   . LEU A 32 ? 0.4292 0.3940 0.5237 -0.0133 -0.0098 -0.0185 32 LEU A C   
254  O  O   . LEU A 32 ? 0.4362 0.3979 0.5197 -0.0142 -0.0094 -0.0209 32 LEU A O   
255  C  CB  . LEU A 32 ? 0.4324 0.4084 0.5256 -0.0129 -0.0187 -0.0165 32 LEU A CB  
256  C  CG  . LEU A 32 ? 0.4648 0.4405 0.5464 -0.0180 -0.0188 -0.0228 32 LEU A CG  
257  C  CD1 . LEU A 32 ? 0.4503 0.4296 0.5372 -0.0200 -0.0193 -0.0236 32 LEU A CD1 
258  C  CD2 . LEU A 32 ? 0.4972 0.4776 0.5665 -0.0171 -0.0262 -0.0222 32 LEU A CD2 
259  O  OXT . LEU A 32 ? 0.4398 0.3991 0.5453 -0.0150 -0.0017 -0.0199 32 LEU A OXT 
260  N  N   . ALA B 1  ? 0.5833 0.6955 0.6471 0.1015  0.0816  0.1882  1  ALA B N   
261  C  CA  . ALA B 1  ? 0.5830 0.6789 0.6198 0.0906  0.0691  0.1752  1  ALA B CA  
262  C  C   . ALA B 1  ? 0.5723 0.6520 0.5947 0.0912  0.0641  0.1637  1  ALA B C   
263  O  O   . ALA B 1  ? 0.5794 0.6677 0.6074 0.0903  0.0598  0.1695  1  ALA B O   
264  C  CB  . ALA B 1  ? 0.5951 0.7063 0.6303 0.0768  0.0557  0.1843  1  ALA B CB  
265  N  N   . PHE B 2  ? 0.5535 0.6104 0.5577 0.0920  0.0645  0.1482  2  PHE B N   
266  C  CA  . PHE B 2  ? 0.5505 0.5922 0.5433 0.0938  0.0620  0.1364  2  PHE B CA  
267  C  C   . PHE B 2  ? 0.5502 0.5805 0.5256 0.0850  0.0506  0.1272  2  PHE B C   
268  O  O   . PHE B 2  ? 0.5590 0.5859 0.5279 0.0796  0.0467  0.1269  2  PHE B O   
269  C  CB  . PHE B 2  ? 0.5462 0.5710 0.5344 0.1021  0.0722  0.1271  2  PHE B CB  
270  C  CG  . PHE B 2  ? 0.5496 0.5800 0.5525 0.1113  0.0857  0.1345  2  PHE B CG  
271  C  CD1 . PHE B 2  ? 0.5275 0.5632 0.5395 0.1142  0.0957  0.1412  2  PHE B CD1 
272  C  CD2 . PHE B 2  ? 0.5512 0.5803 0.5587 0.1171  0.0896  0.1349  2  PHE B CD2 
273  C  CE1 . PHE B 2  ? 0.5550 0.5937 0.5818 0.1239  0.1106  0.1478  2  PHE B CE1 
274  C  CE2 . PHE B 2  ? 0.5506 0.5823 0.5721 0.1265  0.1031  0.1423  2  PHE B CE2 
275  C  CZ  . PHE B 2  ? 0.5467 0.5824 0.5782 0.1305  0.1141  0.1485  2  PHE B CZ  
276  N  N   . THR B 3  ? 0.5549 0.5789 0.5230 0.0832  0.0460  0.1201  3  THR B N   
277  C  CA  . THR B 3  ? 0.5657 0.5764 0.5186 0.0766  0.0375  0.1104  3  THR B CA  
278  C  C   . THR B 3  ? 0.5609 0.5570 0.5092 0.0825  0.0399  0.0973  3  THR B C   
279  O  O   . THR B 3  ? 0.5651 0.5646 0.5169 0.0854  0.0435  0.0962  3  THR B O   
280  C  CB  . THR B 3  ? 0.5674 0.5852 0.5147 0.0659  0.0300  0.1150  3  THR B CB  
281  O  OG1 . THR B 3  ? 0.5843 0.6138 0.5336 0.0583  0.0255  0.1265  3  THR B OG1 
282  C  CG2 . THR B 3  ? 0.5966 0.5958 0.5274 0.0609  0.0249  0.1021  3  THR B CG2 
283  N  N   . CYS B 4  ? 0.5588 0.5400 0.5006 0.0837  0.0376  0.0888  4  CYS B N   
284  C  CA  . CYS B 4  ? 0.5445 0.5143 0.4855 0.0895  0.0395  0.0785  4  CYS B CA  
285  C  C   . CYS B 4  ? 0.5466 0.5034 0.4811 0.0873  0.0328  0.0693  4  CYS B C   
286  O  O   . CYS B 4  ? 0.5516 0.5026 0.4796 0.0820  0.0267  0.0703  4  CYS B O   
287  C  CB  . CYS B 4  ? 0.5349 0.4981 0.4760 0.0934  0.0429  0.0783  4  CYS B CB  
288  S  SG  . CYS B 4  ? 0.5392 0.5118 0.4869 0.0972  0.0542  0.0876  4  CYS B SG  
289  N  N   . HIS B 5  ? 0.5306 0.4831 0.4679 0.0914  0.0349  0.0608  5  HIS B N   
290  C  CA  . HIS B 5  ? 0.5356 0.4760 0.4719 0.0922  0.0314  0.0514  5  HIS B CA  
291  C  C   . HIS B 5  ? 0.5302 0.4677 0.4753 0.0992  0.0330  0.0458  5  HIS B C   
292  O  O   . HIS B 5  ? 0.5238 0.4686 0.4726 0.1018  0.0383  0.0467  5  HIS B O   
293  C  CB  . HIS B 5  ? 0.5359 0.4771 0.4683 0.0887  0.0343  0.0463  5  HIS B CB  
294  C  CG  . HIS B 5  ? 0.5574 0.4988 0.4784 0.0790  0.0309  0.0509  5  HIS B CG  
295  N  ND1 . HIS B 5  ? 0.5569 0.5126 0.4767 0.0737  0.0310  0.0613  5  HIS B ND1 
296  C  CD2 . HIS B 5  ? 0.5817 0.5102 0.4916 0.0727  0.0271  0.0472  5  HIS B CD2 
297  C  CE1 . HIS B 5  ? 0.5927 0.5464 0.5012 0.0635  0.0263  0.0647  5  HIS B CE1 
298  N  NE2 . HIS B 5  ? 0.5979 0.5337 0.4983 0.0622  0.0242  0.0557  5  HIS B NE2 
299  N  N   . CYS B 6  ? 0.5282 0.4552 0.4771 0.1016  0.0281  0.0409  6  CYS B N   
300  C  CA  . CYS B 6  ? 0.5278 0.4544 0.4881 0.1073  0.0284  0.0365  6  CYS B CA  
301  C  C   . CYS B 6  ? 0.5325 0.4620 0.4986 0.1097  0.0345  0.0284  6  CYS B C   
302  O  O   . CYS B 6  ? 0.5483 0.4701 0.5116 0.1085  0.0351  0.0236  6  CYS B O   
303  C  CB  . CYS B 6  ? 0.5129 0.4284 0.4779 0.1090  0.0196  0.0369  6  CYS B CB  
304  S  SG  . CYS B 6  ? 0.5589 0.4693 0.5133 0.1035  0.0126  0.0459  6  CYS B SG  
305  N  N   . ARG B 7  ? 0.5305 0.4695 0.5019 0.1116  0.0402  0.0266  7  ARG B N   
306  C  CA  . ARG B 7  ? 0.5385 0.4812 0.5147 0.1127  0.0473  0.0186  7  ARG B CA  
307  C  C   . ARG B 7  ? 0.5492 0.4991 0.5389 0.1170  0.0488  0.0167  7  ARG B C   
308  O  O   . ARG B 7  ? 0.5601 0.5130 0.5489 0.1165  0.0463  0.0221  7  ARG B O   
309  C  CB  . ARG B 7  ? 0.5395 0.4891 0.5049 0.1070  0.0532  0.0195  7  ARG B CB  
310  C  CG  . ARG B 7  ? 0.5241 0.4719 0.4762 0.1004  0.0507  0.0253  7  ARG B CG  
311  C  CD  . ARG B 7  ? 0.5457 0.5009 0.4896 0.0940  0.0552  0.0267  7  ARG B CD  
312  N  NE  . ARG B 7  ? 0.5267 0.4854 0.4621 0.0878  0.0511  0.0367  7  ARG B NE  
313  C  CZ  . ARG B 7  ? 0.5254 0.4777 0.4509 0.0810  0.0474  0.0371  7  ARG B CZ  
314  N  NH1 . ARG B 7  ? 0.5406 0.4798 0.4620 0.0801  0.0487  0.0271  7  ARG B NH1 
315  N  NH2 . ARG B 7  ? 0.4900 0.4486 0.4099 0.0746  0.0430  0.0477  7  ARG B NH2 
316  N  N   . ARG B 8  ? 0.5622 0.5147 0.5636 0.1203  0.0539  0.0089  8  ARG B N   
317  C  CA  . ARG B 8  ? 0.5712 0.5343 0.5862 0.1229  0.0563  0.0075  8  ARG B CA  
318  C  C   . ARG B 8  ? 0.5526 0.5237 0.5578 0.1182  0.0608  0.0095  8  ARG B C   
319  O  O   . ARG B 8  ? 0.5576 0.5334 0.5654 0.1177  0.0589  0.0132  8  ARG B O   
320  C  CB  . ARG B 8  ? 0.5947 0.5609 0.6257 0.1274  0.0634  -0.0013 8  ARG B CB  
321  C  CG  . ARG B 8  ? 0.6410 0.6199 0.6922 0.1309  0.0629  -0.0005 8  ARG B CG  
322  C  CD  . ARG B 8  ? 0.7346 0.7248 0.7889 0.1288  0.0740  -0.0073 8  ARG B CD  
323  N  NE  . ARG B 8  ? 0.7975 0.8003 0.8784 0.1340  0.0749  -0.0081 8  ARG B NE  
324  C  CZ  . ARG B 8  ? 0.8317 0.8354 0.9347 0.1418  0.0793  -0.0131 8  ARG B CZ  
325  N  NH1 . ARG B 8  ? 0.8547 0.8437 0.9531 0.1448  0.0841  -0.0193 8  ARG B NH1 
326  N  NH2 . ARG B 8  ? 0.8375 0.8567 0.9681 0.1464  0.0795  -0.0115 8  ARG B NH2 
327  N  N   . SER B 9  ? 0.5376 0.5086 0.5301 0.1138  0.0663  0.0079  9  SER B N   
328  C  CA  . SER B 9  ? 0.5369 0.5129 0.5190 0.1095  0.0690  0.0124  9  SER B CA  
329  C  C   . SER B 9  ? 0.5375 0.5100 0.5064 0.1055  0.0677  0.0179  9  SER B C   
330  O  O   . SER B 9  ? 0.5594 0.5268 0.5246 0.1037  0.0665  0.0157  9  SER B O   
331  C  CB  . SER B 9  ? 0.5355 0.5191 0.5177 0.1062  0.0768  0.0068  9  SER B CB  
332  O  OG  . SER B 9  ? 0.6009 0.5878 0.5968 0.1091  0.0808  -0.0017 9  SER B OG  
333  N  N   . CYS B 10 ? 0.5278 0.5029 0.4902 0.1040  0.0682  0.0256  10 CYS B N   
334  C  CA  . CYS B 10 ? 0.5196 0.4952 0.4743 0.1008  0.0664  0.0333  10 CYS B CA  
335  C  C   . CYS B 10 ? 0.5296 0.5102 0.4773 0.0941  0.0696  0.0333  10 CYS B C   
336  O  O   . CYS B 10 ? 0.5258 0.5095 0.4734 0.0926  0.0742  0.0289  10 CYS B O   
337  C  CB  . CYS B 10 ? 0.5059 0.4817 0.4599 0.1034  0.0667  0.0426  10 CYS B CB  
338  S  SG  . CYS B 10 ? 0.4983 0.4658 0.4547 0.1077  0.0633  0.0431  10 CYS B SG  
339  N  N   . TYR B 11 ? 0.5476 0.5293 0.4884 0.0885  0.0665  0.0389  11 TYR B N   
340  C  CA  . TYR B 11 ? 0.5528 0.5397 0.4848 0.0798  0.0673  0.0426  11 TYR B CA  
341  C  C   . TYR B 11 ? 0.5602 0.5534 0.4958 0.0821  0.0688  0.0517  11 TYR B C   
342  O  O   . TYR B 11 ? 0.5599 0.5530 0.5024 0.0893  0.0688  0.0579  11 TYR B O   
343  C  CB  . TYR B 11 ? 0.5535 0.5416 0.4781 0.0721  0.0616  0.0499  11 TYR B CB  
344  C  CG  . TYR B 11 ? 0.5638 0.5418 0.4795 0.0669  0.0612  0.0402  11 TYR B CG  
345  C  CD1 . TYR B 11 ? 0.5801 0.5520 0.4878 0.0617  0.0671  0.0286  11 TYR B CD1 
346  C  CD2 . TYR B 11 ? 0.5868 0.5596 0.5012 0.0669  0.0561  0.0422  11 TYR B CD2 
347  C  CE1 . TYR B 11 ? 0.6011 0.5604 0.5003 0.0578  0.0691  0.0190  11 TYR B CE1 
348  C  CE2 . TYR B 11 ? 0.5960 0.5557 0.5007 0.0622  0.0564  0.0331  11 TYR B CE2 
349  C  CZ  . TYR B 11 ? 0.6223 0.5747 0.5199 0.0584  0.0634  0.0214  11 TYR B CZ  
350  O  OH  . TYR B 11 ? 0.6670 0.6035 0.5548 0.0545  0.0658  0.0119  11 TYR B OH  
351  N  N   . SER B 12 ? 0.5681 0.5649 0.4975 0.0756  0.0708  0.0524  12 SER B N   
352  C  CA  . SER B 12 ? 0.5845 0.5849 0.5165 0.0775  0.0725  0.0611  12 SER B CA  
353  C  C   . SER B 12 ? 0.5807 0.5863 0.5194 0.0806  0.0692  0.0763  12 SER B C   
354  O  O   . SER B 12 ? 0.5858 0.5907 0.5306 0.0870  0.0724  0.0832  12 SER B O   
355  C  CB  . SER B 12 ? 0.6005 0.6038 0.5226 0.0673  0.0733  0.0613  12 SER B CB  
356  O  OG  . SER B 12 ? 0.6398 0.6459 0.5529 0.0566  0.0684  0.0649  12 SER B OG  
357  N  N   . THR B 13 ? 0.5858 0.5958 0.5239 0.0761  0.0637  0.0815  13 THR B N   
358  C  CA  . THR B 13 ? 0.5780 0.5965 0.5260 0.0789  0.0606  0.0969  13 THR B CA  
359  C  C   . THR B 13 ? 0.5679 0.5826 0.5245 0.0890  0.0633  0.0962  13 THR B C   
360  O  O   . THR B 13 ? 0.5563 0.5775 0.5236 0.0935  0.0640  0.1081  13 THR B O   
361  C  CB  . THR B 13 ? 0.5913 0.6184 0.5346 0.0672  0.0523  0.1052  13 THR B CB  
362  O  OG1 . THR B 13 ? 0.6065 0.6264 0.5410 0.0635  0.0502  0.0950  13 THR B OG1 
363  C  CG2 . THR B 13 ? 0.6195 0.6496 0.5514 0.0545  0.0491  0.1079  13 THR B CG2 
364  N  N   . GLU B 14 ? 0.5563 0.5608 0.5089 0.0921  0.0652  0.0831  14 GLU B N   
365  C  CA  . GLU B 14 ? 0.5325 0.5315 0.4893 0.0988  0.0664  0.0818  14 GLU B CA  
366  C  C   . GLU B 14 ? 0.5380 0.5286 0.4962 0.1061  0.0733  0.0789  14 GLU B C   
367  O  O   . GLU B 14 ? 0.5341 0.5224 0.4899 0.1062  0.0766  0.0759  14 GLU B O   
368  C  CB  . GLU B 14 ? 0.5331 0.5255 0.4847 0.0964  0.0621  0.0717  14 GLU B CB  
369  C  CG  . GLU B 14 ? 0.4942 0.4904 0.4412 0.0886  0.0560  0.0747  14 GLU B CG  
370  C  CD  . GLU B 14 ? 0.4980 0.4838 0.4390 0.0868  0.0533  0.0631  14 GLU B CD  
371  O  OE1 . GLU B 14 ? 0.5357 0.5154 0.4781 0.0906  0.0564  0.0532  14 GLU B OE1 
372  O  OE2 . GLU B 14 ? 0.4891 0.4726 0.4249 0.0817  0.0484  0.0645  14 GLU B OE2 
373  N  N   . TYR B 15 ? 0.5338 0.5187 0.4935 0.1105  0.0755  0.0799  15 TYR B N   
374  C  CA  . TYR B 15 ? 0.5310 0.5042 0.4873 0.1148  0.0820  0.0766  15 TYR B CA  
375  C  C   . TYR B 15 ? 0.5321 0.4967 0.4832 0.1135  0.0782  0.0682  15 TYR B C   
376  O  O   . TYR B 15 ? 0.5243 0.4896 0.4759 0.1120  0.0732  0.0684  15 TYR B O   
377  C  CB  . TYR B 15 ? 0.5462 0.5173 0.5065 0.1199  0.0902  0.0858  15 TYR B CB  
378  C  CG  . TYR B 15 ? 0.5845 0.5654 0.5546 0.1225  0.0934  0.0970  15 TYR B CG  
379  C  CD1 . TYR B 15 ? 0.6348 0.6096 0.6035 0.1253  0.0997  0.0984  15 TYR B CD1 
380  C  CD2 . TYR B 15 ? 0.6168 0.6132 0.5973 0.1211  0.0890  0.1075  15 TYR B CD2 
381  C  CE1 . TYR B 15 ? 0.6596 0.6431 0.6389 0.1280  0.1015  0.1108  15 TYR B CE1 
382  C  CE2 . TYR B 15 ? 0.6399 0.6473 0.6317 0.1227  0.0900  0.1204  15 TYR B CE2 
383  C  CZ  . TYR B 15 ? 0.6643 0.6649 0.6561 0.1267  0.0961  0.1221  15 TYR B CZ  
384  O  OH  . TYR B 15 ? 0.7058 0.7171 0.7102 0.1283  0.0958  0.1365  15 TYR B OH  
385  N  N   . SER B 16 ? 0.5339 0.4901 0.4799 0.1132  0.0800  0.0621  16 SER B N   
386  C  CA  . SER B 16 ? 0.5497 0.4986 0.4923 0.1112  0.0751  0.0562  16 SER B CA  
387  C  C   . SER B 16 ? 0.5464 0.4846 0.4813 0.1109  0.0792  0.0596  16 SER B C   
388  O  O   . SER B 16 ? 0.5457 0.4759 0.4743 0.1118  0.0878  0.0616  16 SER B O   
389  C  CB  . SER B 16 ? 0.5538 0.5004 0.4948 0.1093  0.0747  0.0501  16 SER B CB  
390  O  OG  . SER B 16 ? 0.6085 0.5513 0.5501 0.1069  0.0677  0.0464  16 SER B OG  
391  N  N   . TYR B 17 ? 0.5386 0.4747 0.4725 0.1089  0.0737  0.0601  17 TYR B N   
392  C  CA  . TYR B 17 ? 0.5366 0.4621 0.4612 0.1068  0.0781  0.0629  17 TYR B CA  
393  C  C   . TYR B 17 ? 0.5334 0.4507 0.4514 0.1011  0.0689  0.0597  17 TYR B C   
394  O  O   . TYR B 17 ? 0.5353 0.4516 0.4522 0.0988  0.0641  0.0617  17 TYR B O   
395  C  CB  . TYR B 17 ? 0.5368 0.4695 0.4668 0.1093  0.0820  0.0699  17 TYR B CB  
396  C  CG  . TYR B 17 ? 0.5673 0.4901 0.4887 0.1073  0.0894  0.0725  17 TYR B CG  
397  C  CD1 . TYR B 17 ? 0.5955 0.5021 0.5038 0.1055  0.0987  0.0701  17 TYR B CD1 
398  C  CD2 . TYR B 17 ? 0.5952 0.5234 0.5193 0.1059  0.0882  0.0772  17 TYR B CD2 
399  C  CE1 . TYR B 17 ? 0.6085 0.5032 0.5058 0.1024  0.1081  0.0714  17 TYR B CE1 
400  C  CE2 . TYR B 17 ? 0.6357 0.5545 0.5510 0.1032  0.0971  0.0791  17 TYR B CE2 
401  C  CZ  . TYR B 17 ? 0.6390 0.5408 0.5409 0.1016  0.1074  0.0758  17 TYR B CZ  
402  O  OH  . TYR B 17 ? 0.6644 0.5551 0.5554 0.0978  0.1179  0.0765  17 TYR B OH  
403  N  N   . GLY B 18 ? 0.5369 0.4487 0.4510 0.0978  0.0655  0.0558  18 GLY B N   
404  C  CA  . GLY B 18 ? 0.5221 0.4274 0.4323 0.0917  0.0549  0.0550  18 GLY B CA  
405  C  C   . GLY B 18 ? 0.5039 0.4192 0.4300 0.0949  0.0444  0.0526  18 GLY B C   
406  O  O   . GLY B 18 ? 0.4750 0.4004 0.4117 0.1001  0.0464  0.0498  18 GLY B O   
407  N  N   . THR B 19 ? 0.5077 0.4185 0.4346 0.0914  0.0337  0.0540  19 THR B N   
408  C  CA  . THR B 19 ? 0.5190 0.4364 0.4624 0.0950  0.0247  0.0518  19 THR B CA  
409  C  C   . THR B 19 ? 0.5147 0.4277 0.4605 0.0950  0.0163  0.0537  19 THR B C   
410  O  O   . THR B 19 ? 0.5196 0.4248 0.4529 0.0902  0.0156  0.0573  19 THR B O   
411  C  CB  . THR B 19 ? 0.5312 0.4483 0.4786 0.0907  0.0175  0.0531  19 THR B CB  
412  O  OG1 . THR B 19 ? 0.5881 0.4925 0.5186 0.0808  0.0130  0.0580  19 THR B OG1 
413  C  CG2 . THR B 19 ? 0.5205 0.4432 0.4676 0.0906  0.0249  0.0504  19 THR B CG2 
414  N  N   . CYS B 20 ? 0.5055 0.4226 0.4670 0.1004  0.0112  0.0509  20 CYS B N   
415  C  CA  . CYS B 20 ? 0.5188 0.4291 0.4848 0.1009  0.0016  0.0526  20 CYS B CA  
416  C  C   . CYS B 20 ? 0.5159 0.4294 0.5010 0.1045  -0.0056 0.0526  20 CYS B C   
417  O  O   . CYS B 20 ? 0.5195 0.4427 0.5187 0.1105  -0.0001 0.0475  20 CYS B O   
418  C  CB  . CYS B 20 ? 0.5215 0.4326 0.4903 0.1054  0.0053  0.0483  20 CYS B CB  
419  S  SG  . CYS B 20 ? 0.5475 0.4642 0.5037 0.1036  0.0159  0.0483  20 CYS B SG  
420  N  N   . THR B 21 ? 0.5022 0.4086 0.4892 0.1006  -0.0178 0.0590  21 THR B N   
421  C  CA  . THR B 21 ? 0.4983 0.4094 0.5075 0.1041  -0.0267 0.0620  21 THR B CA  
422  C  C   . THR B 21 ? 0.4952 0.3970 0.5148 0.1085  -0.0355 0.0643  21 THR B C   
423  O  O   . THR B 21 ? 0.4925 0.3819 0.4974 0.1026  -0.0421 0.0685  21 THR B O   
424  C  CB  . THR B 21 ? 0.5124 0.4223 0.5146 0.0937  -0.0360 0.0704  21 THR B CB  
425  O  OG1 . THR B 21 ? 0.5415 0.4561 0.5308 0.0891  -0.0264 0.0675  21 THR B OG1 
426  C  CG2 . THR B 21 ? 0.5132 0.4314 0.5407 0.0959  -0.0469 0.0764  21 THR B CG2 
427  N  N   . VAL B 22 ? 0.4785 0.3850 0.5228 0.1188  -0.0344 0.0612  22 VAL B N   
428  C  CA  . VAL B 22 ? 0.5018 0.3972 0.5586 0.1243  -0.0421 0.0636  22 VAL B CA  
429  C  C   . VAL B 22 ? 0.5075 0.4132 0.5967 0.1312  -0.0482 0.0687  22 VAL B C   
430  O  O   . VAL B 22 ? 0.5054 0.4243 0.6127 0.1387  -0.0385 0.0628  22 VAL B O   
431  C  CB  . VAL B 22 ? 0.5033 0.3903 0.5569 0.1309  -0.0315 0.0536  22 VAL B CB  
432  C  CG1 . VAL B 22 ? 0.4963 0.3677 0.5610 0.1368  -0.0381 0.0554  22 VAL B CG1 
433  C  CG2 . VAL B 22 ? 0.4834 0.3647 0.5074 0.1227  -0.0270 0.0513  22 VAL B CG2 
434  N  N   . MET B 23 ? 0.5353 0.4367 0.6318 0.1273  -0.0645 0.0806  23 MET B N   
435  C  CA  . MET B 23 ? 0.5782 0.4908 0.7096 0.1336  -0.0731 0.0889  23 MET B CA  
436  C  C   . MET B 23 ? 0.5809 0.5150 0.7218 0.1311  -0.0694 0.0893  23 MET B C   
437  O  O   . MET B 23 ? 0.5867 0.5360 0.7605 0.1406  -0.0670 0.0901  23 MET B O   
438  C  CB  . MET B 23 ? 0.5898 0.5012 0.7503 0.1504  -0.0648 0.0827  23 MET B CB  
439  C  CG  . MET B 23 ? 0.6516 0.5402 0.8094 0.1553  -0.0679 0.0822  23 MET B CG  
440  S  SD  . MET B 23 ? 0.7620 0.6431 0.9362 0.1531  -0.0918 0.1011  23 MET B SD  
441  C  CE  . MET B 23 ? 0.6926 0.5635 0.8221 0.1324  -0.1024 0.1062  23 MET B CE  
442  N  N   . GLY B 24 ? 0.5858 0.5205 0.6982 0.1189  -0.0672 0.0883  24 GLY B N   
443  C  CA  . GLY B 24 ? 0.5993 0.5512 0.7141 0.1143  -0.0629 0.0880  24 GLY B CA  
444  C  C   . GLY B 24 ? 0.5960 0.5605 0.7192 0.1227  -0.0453 0.0760  24 GLY B C   
445  O  O   . GLY B 24 ? 0.5973 0.5771 0.7273 0.1194  -0.0431 0.0770  24 GLY B O   
446  N  N   . ILE B 25 ? 0.5951 0.5528 0.7171 0.1318  -0.0336 0.0654  25 ILE B N   
447  C  CA  . ILE B 25 ? 0.5881 0.5530 0.7063 0.1354  -0.0169 0.0538  25 ILE B CA  
448  C  C   . ILE B 25 ? 0.5815 0.5368 0.6652 0.1276  -0.0116 0.0501  25 ILE B C   
449  O  O   . ILE B 25 ? 0.5596 0.5007 0.6271 0.1264  -0.0126 0.0494  25 ILE B O   
450  C  CB  . ILE B 25 ? 0.5963 0.5583 0.7296 0.1474  -0.0062 0.0443  25 ILE B CB  
451  C  CG1 . ILE B 25 ? 0.6266 0.6025 0.7988 0.1569  -0.0067 0.0467  25 ILE B CG1 
452  C  CG2 . ILE B 25 ? 0.6073 0.5725 0.7262 0.1469  0.0099  0.0325  25 ILE B CG2 
453  C  CD1 . ILE B 25 ? 0.6838 0.6507 0.8727 0.1693  0.0022  0.0390  25 ILE B CD1 
454  N  N   . ASN B 26 ? 0.5754 0.5389 0.6492 0.1221  -0.0059 0.0487  26 ASN B N   
455  C  CA  . ASN B 26 ? 0.5907 0.5461 0.6355 0.1148  -0.0015 0.0478  26 ASN B CA  
456  C  C   . ASN B 26 ? 0.5797 0.5363 0.6160 0.1183  0.0121  0.0389  26 ASN B C   
457  O  O   . ASN B 26 ? 0.5883 0.5556 0.6326 0.1207  0.0202  0.0338  26 ASN B O   
458  C  CB  . ASN B 26 ? 0.5965 0.5567 0.6331 0.1058  -0.0032 0.0521  26 ASN B CB  
459  C  CG  . ASN B 26 ? 0.6487 0.5947 0.6583 0.0958  -0.0063 0.0568  26 ASN B CG  
460  O  OD1 . ASN B 26 ? 0.6916 0.6276 0.6962 0.0928  -0.0154 0.0619  26 ASN B OD1 
461  N  ND2 . ASN B 26 ? 0.6744 0.6179 0.6656 0.0900  0.0016  0.0552  26 ASN B ND2 
462  N  N   . TRP B 27 ? 0.5585 0.5050 0.5787 0.1174  0.0141  0.0381  27 TRP B N   
463  C  CA  . TRP B 27 ? 0.5447 0.4926 0.5570 0.1191  0.0247  0.0320  27 TRP B CA  
464  C  C   . TRP B 27 ? 0.5350 0.4804 0.5274 0.1137  0.0287  0.0353  27 TRP B C   
465  O  O   . TRP B 27 ? 0.5142 0.4542 0.4979 0.1090  0.0245  0.0405  27 TRP B O   
466  C  CB  . TRP B 27 ? 0.5643 0.5037 0.5760 0.1219  0.0239  0.0293  27 TRP B CB  
467  C  CG  . TRP B 27 ? 0.6058 0.5467 0.6351 0.1287  0.0278  0.0220  27 TRP B CG  
468  C  CD1 . TRP B 27 ? 0.6228 0.5737 0.6732 0.1336  0.0299  0.0196  27 TRP B CD1 
469  C  CD2 . TRP B 27 ? 0.6202 0.5514 0.6467 0.1307  0.0315  0.0163  27 TRP B CD2 
470  N  NE1 . TRP B 27 ? 0.6467 0.5945 0.7089 0.1397  0.0363  0.0120  27 TRP B NE1 
471  C  CE2 . TRP B 27 ? 0.6683 0.6019 0.7140 0.1375  0.0374  0.0095  27 TRP B CE2 
472  C  CE3 . TRP B 27 ? 0.6457 0.5661 0.6545 0.1263  0.0309  0.0165  27 TRP B CE3 
473  C  CZ2 . TRP B 27 ? 0.6920 0.6140 0.7371 0.1402  0.0441  0.0015  27 TRP B CZ2 
474  C  CZ3 . TRP B 27 ? 0.6720 0.5817 0.6787 0.1274  0.0355  0.0096  27 TRP B CZ3 
475  C  CH2 . TRP B 27 ? 0.7006 0.6093 0.7239 0.1343  0.0427  0.0015  27 TRP B CH2 
476  N  N   . ARG B 28 ? 0.5147 0.4633 0.5001 0.1139  0.0369  0.0327  28 ARG B N   
477  C  CA  . ARG B 28 ? 0.5223 0.4693 0.4931 0.1107  0.0415  0.0372  28 ARG B CA  
478  C  C   . ARG B 28 ? 0.5020 0.4447 0.4651 0.1094  0.0403  0.0408  28 ARG B C   
479  O  O   . ARG B 28 ? 0.5108 0.4530 0.4763 0.1101  0.0383  0.0384  28 ARG B O   
480  C  CB  . ARG B 28 ? 0.5243 0.4788 0.4934 0.1108  0.0503  0.0353  28 ARG B CB  
481  C  CG  . ARG B 28 ? 0.5960 0.5548 0.5699 0.1101  0.0520  0.0327  28 ARG B CG  
482  C  CD  . ARG B 28 ? 0.7222 0.6736 0.6896 0.1061  0.0481  0.0369  28 ARG B CD  
483  N  NE  . ARG B 28 ? 0.8116 0.7677 0.7841 0.1032  0.0469  0.0357  28 ARG B NE  
484  C  CZ  . ARG B 28 ? 0.8346 0.7950 0.8199 0.1026  0.0388  0.0364  28 ARG B CZ  
485  N  NH1 . ARG B 28 ? 0.8309 0.7892 0.8252 0.1054  0.0312  0.0377  28 ARG B NH1 
486  N  NH2 . ARG B 28 ? 0.8475 0.8145 0.8377 0.0987  0.0377  0.0367  28 ARG B NH2 
487  N  N   . PHE B 29 ? 0.4995 0.4383 0.4528 0.1068  0.0420  0.0464  29 PHE B N   
488  C  CA  . PHE B 29 ? 0.4849 0.4237 0.4327 0.1052  0.0425  0.0512  29 PHE B CA  
489  C  C   . PHE B 29 ? 0.4795 0.4271 0.4273 0.1064  0.0505  0.0541  29 PHE B C   
490  O  O   . PHE B 29 ? 0.4823 0.4291 0.4270 0.1073  0.0571  0.0570  29 PHE B O   
491  C  CB  . PHE B 29 ? 0.4907 0.4214 0.4294 0.1018  0.0422  0.0559  29 PHE B CB  
492  C  CG  . PHE B 29 ? 0.4427 0.3732 0.3772 0.0992  0.0406  0.0607  29 PHE B CG  
493  C  CD1 . PHE B 29 ? 0.4727 0.3992 0.4075 0.0971  0.0314  0.0598  29 PHE B CD1 
494  C  CD2 . PHE B 29 ? 0.4701 0.4039 0.4010 0.0987  0.0486  0.0664  29 PHE B CD2 
495  C  CE1 . PHE B 29 ? 0.4626 0.3888 0.3919 0.0929  0.0293  0.0646  29 PHE B CE1 
496  C  CE2 . PHE B 29 ? 0.4771 0.4131 0.4057 0.0954  0.0475  0.0718  29 PHE B CE2 
497  C  CZ  . PHE B 29 ? 0.4936 0.4262 0.4203 0.0917  0.0371  0.0709  29 PHE B CZ  
498  N  N   . CYS B 30 ? 0.4830 0.4371 0.4330 0.1056  0.0498  0.0538  30 CYS B N   
499  C  CA  . CYS B 30 ? 0.4837 0.4473 0.4346 0.1052  0.0551  0.0575  30 CYS B CA  
500  C  C   . CYS B 30 ? 0.5044 0.4753 0.4551 0.1028  0.0550  0.0672  30 CYS B C   
501  O  O   . CYS B 30 ? 0.5126 0.4841 0.4606 0.0984  0.0495  0.0681  30 CYS B O   
502  C  CB  . CYS B 30 ? 0.4866 0.4527 0.4382 0.1032  0.0543  0.0510  30 CYS B CB  
503  S  SG  . CYS B 30 ? 0.4803 0.4426 0.4376 0.1066  0.0553  0.0407  30 CYS B SG  
504  N  N   . CYS B 31 ? 0.5097 0.4858 0.4638 0.1054  0.0613  0.0750  31 CYS B N   
505  C  CA  . CYS B 31 ? 0.5334 0.5196 0.4921 0.1038  0.0616  0.0860  31 CYS B CA  
506  C  C   . CYS B 31 ? 0.5437 0.5426 0.5095 0.1038  0.0640  0.0948  31 CYS B C   
507  O  O   . CYS B 31 ? 0.5488 0.5465 0.5157 0.1069  0.0686  0.0935  31 CYS B O   
508  C  CB  . CYS B 31 ? 0.5314 0.5141 0.4914 0.1071  0.0678  0.0903  31 CYS B CB  
509  S  SG  . CYS B 31 ? 0.5238 0.4907 0.4731 0.1046  0.0630  0.0818  31 CYS B SG  
510  N  N   . LEU B 32 ? 0.5639 0.5754 0.5344 0.0992  0.0599  0.1048  32 LEU B N   
511  C  CA  . LEU B 32 ? 0.5788 0.6049 0.5591 0.0986  0.0608  0.1173  32 LEU B CA  
512  C  C   . LEU B 32 ? 0.5758 0.6168 0.5675 0.0971  0.0596  0.1313  32 LEU B C   
513  O  O   . LEU B 32 ? 0.5578 0.5984 0.5461 0.0934  0.0561  0.1308  32 LEU B O   
514  C  CB  . LEU B 32 ? 0.5959 0.6248 0.5684 0.0898  0.0541  0.1155  32 LEU B CB  
515  C  CG  . LEU B 32 ? 0.6250 0.6587 0.5892 0.0776  0.0446  0.1180  32 LEU B CG  
516  C  CD1 . LEU B 32 ? 0.6696 0.7142 0.6325 0.0686  0.0401  0.1271  32 LEU B CD1 
517  C  CD2 . LEU B 32 ? 0.6597 0.6773 0.6087 0.0737  0.0417  0.1027  32 LEU B CD2 
518  O  OXT . LEU B 32 ? 0.5717 0.6267 0.5780 0.0996  0.0620  0.1447  32 LEU B OXT 
519  N  N   . ALA C 1  ? 0.6722 0.4839 0.6029 -0.0335 0.0424  -0.0115 1  ALA C N   
520  C  CA  . ALA C 1  ? 0.6502 0.4798 0.5815 -0.0349 0.0244  -0.0121 1  ALA C CA  
521  C  C   . ALA C 1  ? 0.6157 0.4728 0.5664 -0.0314 0.0095  -0.0100 1  ALA C C   
522  O  O   . ALA C 1  ? 0.6206 0.4777 0.5700 -0.0333 0.0092  -0.0108 1  ALA C O   
523  C  CB  . ALA C 1  ? 0.6757 0.4892 0.5736 -0.0462 0.0181  -0.0175 1  ALA C CB  
524  N  N   . PHE C 2  ? 0.5805 0.4580 0.5464 -0.0270 -0.0015 -0.0076 2  PHE C N   
525  C  CA  . PHE C 2  ? 0.5537 0.4544 0.5343 -0.0246 -0.0150 -0.0061 2  PHE C CA  
526  C  C   . PHE C 2  ? 0.5413 0.4476 0.5102 -0.0295 -0.0282 -0.0092 2  PHE C C   
527  O  O   . PHE C 2  ? 0.5506 0.4495 0.5078 -0.0312 -0.0297 -0.0101 2  PHE C O   
528  C  CB  . PHE C 2  ? 0.5388 0.4572 0.5447 -0.0166 -0.0173 -0.0008 2  PHE C CB  
529  C  CG  . PHE C 2  ? 0.5579 0.4737 0.5796 -0.0108 -0.0059 0.0035  2  PHE C CG  
530  C  CD1 . PHE C 2  ? 0.6025 0.5112 0.6302 -0.0083 0.0048  0.0052  2  PHE C CD1 
531  C  CD2 . PHE C 2  ? 0.5960 0.5151 0.6266 -0.0078 -0.0049 0.0064  2  PHE C CD2 
532  C  CE1 . PHE C 2  ? 0.6352 0.5431 0.6820 -0.0019 0.0162  0.0102  2  PHE C CE1 
533  C  CE2 . PHE C 2  ? 0.6144 0.5311 0.6613 -0.0011 0.0051  0.0119  2  PHE C CE2 
534  C  CZ  . PHE C 2  ? 0.6239 0.5364 0.6808 0.0021  0.0155  0.0140  2  PHE C CZ  
535  N  N   . THR C 3  ? 0.5241 0.4418 0.4955 -0.0320 -0.0372 -0.0106 3  THR C N   
536  C  CA  . THR C 3  ? 0.5023 0.4307 0.4703 -0.0349 -0.0506 -0.0122 3  THR C CA  
537  C  C   . THR C 3  ? 0.4644 0.4139 0.4523 -0.0290 -0.0582 -0.0097 3  THR C C   
538  O  O   . THR C 3  ? 0.4602 0.4175 0.4592 -0.0275 -0.0573 -0.0090 3  THR C O   
539  C  CB  . THR C 3  ? 0.5270 0.4528 0.4833 -0.0436 -0.0550 -0.0163 3  THR C CB  
540  O  OG1 . THR C 3  ? 0.5546 0.4573 0.4873 -0.0505 -0.0484 -0.0189 3  THR C OG1 
541  C  CG2 . THR C 3  ? 0.5023 0.4420 0.4601 -0.0456 -0.0695 -0.0168 3  THR C CG2 
542  N  N   . CYS C 4  ? 0.4474 0.4033 0.4368 -0.0262 -0.0651 -0.0085 4  CYS C N   
543  C  CA  . CYS C 4  ? 0.4084 0.3802 0.4132 -0.0212 -0.0706 -0.0064 4  CYS C CA  
544  C  C   . CYS C 4  ? 0.4148 0.3957 0.4198 -0.0214 -0.0806 -0.0070 4  CYS C C   
545  O  O   . CYS C 4  ? 0.4336 0.4082 0.4263 -0.0234 -0.0851 -0.0075 4  CYS C O   
546  C  CB  . CYS C 4  ? 0.3934 0.3642 0.4034 -0.0166 -0.0670 -0.0035 4  CYS C CB  
547  S  SG  . CYS C 4  ? 0.3689 0.3316 0.3848 -0.0151 -0.0550 -0.0013 4  CYS C SG  
548  N  N   . HIS C 5  ? 0.4073 0.4017 0.4257 -0.0192 -0.0838 -0.0067 5  HIS C N   
549  C  CA  . HIS C 5  ? 0.3991 0.4050 0.4243 -0.0175 -0.0915 -0.0065 5  HIS C CA  
550  C  C   . HIS C 5  ? 0.3883 0.4000 0.4233 -0.0124 -0.0900 -0.0046 5  HIS C C   
551  O  O   . HIS C 5  ? 0.3602 0.3713 0.3990 -0.0124 -0.0852 -0.0043 5  HIS C O   
552  C  CB  . HIS C 5  ? 0.4123 0.4280 0.4451 -0.0220 -0.0940 -0.0091 5  HIS C CB  
553  C  CG  . HIS C 5  ? 0.4387 0.4480 0.4599 -0.0293 -0.0961 -0.0116 5  HIS C CG  
554  N  ND1 . HIS C 5  ? 0.4438 0.4420 0.4564 -0.0342 -0.0887 -0.0137 5  HIS C ND1 
555  C  CD2 . HIS C 5  ? 0.4501 0.4608 0.4651 -0.0331 -0.1048 -0.0119 5  HIS C CD2 
556  C  CE1 . HIS C 5  ? 0.4591 0.4503 0.4585 -0.0415 -0.0917 -0.0160 5  HIS C CE1 
557  N  NE2 . HIS C 5  ? 0.5119 0.5111 0.5123 -0.0415 -0.1024 -0.0149 5  HIS C NE2 
558  N  N   . CYS C 6  ? 0.3883 0.4037 0.4255 -0.0083 -0.0942 -0.0031 6  CYS C N   
559  C  CA  . CYS C 6  ? 0.3927 0.4128 0.4382 -0.0043 -0.0925 -0.0020 6  CYS C CA  
560  C  C   . CYS C 6  ? 0.3943 0.4259 0.4528 -0.0050 -0.0929 -0.0036 6  CYS C C   
561  O  O   . CYS C 6  ? 0.4058 0.4456 0.4707 -0.0047 -0.0982 -0.0036 6  CYS C O   
562  C  CB  . CYS C 6  ? 0.3821 0.3990 0.4239 0.0009  -0.0953 0.0003  6  CYS C CB  
563  S  SG  . CYS C 6  ? 0.4077 0.4093 0.4334 0.0006  -0.0927 0.0014  6  CYS C SG  
564  N  N   . ARG C 7  ? 0.3907 0.4227 0.4533 -0.0063 -0.0875 -0.0046 7  ARG C N   
565  C  CA  . ARG C 7  ? 0.4009 0.4411 0.4749 -0.0078 -0.0851 -0.0066 7  ARG C CA  
566  C  C   . ARG C 7  ? 0.4054 0.4410 0.4794 -0.0065 -0.0789 -0.0064 7  ARG C C   
567  O  O   . ARG C 7  ? 0.4062 0.4328 0.4705 -0.0067 -0.0775 -0.0050 7  ARG C O   
568  C  CB  . ARG C 7  ? 0.4017 0.4409 0.4741 -0.0138 -0.0827 -0.0091 7  ARG C CB  
569  C  CG  . ARG C 7  ? 0.4006 0.4374 0.4661 -0.0174 -0.0858 -0.0099 7  ARG C CG  
570  C  CD  . ARG C 7  ? 0.3965 0.4310 0.4611 -0.0232 -0.0811 -0.0126 7  ARG C CD  
571  N  NE  . ARG C 7  ? 0.3936 0.4227 0.4496 -0.0277 -0.0821 -0.0140 7  ARG C NE  
572  C  CZ  . ARG C 7  ? 0.4317 0.4662 0.4884 -0.0319 -0.0874 -0.0159 7  ARG C CZ  
573  N  NH1 . ARG C 7  ? 0.4454 0.4944 0.5156 -0.0310 -0.0929 -0.0160 7  ARG C NH1 
574  N  NH2 . ARG C 7  ? 0.4649 0.4898 0.5089 -0.0372 -0.0868 -0.0174 7  ARG C NH2 
575  N  N   . ARG C 8  ? 0.3986 0.4397 0.4832 -0.0064 -0.0746 -0.0080 8  ARG C N   
576  C  CA  . ARG C 8  ? 0.3998 0.4321 0.4801 -0.0073 -0.0667 -0.0087 8  ARG C CA  
577  C  C   . ARG C 8  ? 0.3907 0.4142 0.4601 -0.0132 -0.0643 -0.0096 8  ARG C C   
578  O  O   . ARG C 8  ? 0.4037 0.4159 0.4611 -0.0147 -0.0622 -0.0084 8  ARG C O   
579  C  CB  . ARG C 8  ? 0.4101 0.4491 0.5055 -0.0053 -0.0605 -0.0102 8  ARG C CB  
580  C  CG  . ARG C 8  ? 0.4661 0.4963 0.5583 -0.0093 -0.0500 -0.0129 8  ARG C CG  
581  C  CD  . ARG C 8  ? 0.4835 0.5173 0.5907 -0.0050 -0.0415 -0.0135 8  ARG C CD  
582  N  NE  . ARG C 8  ? 0.5299 0.5451 0.6229 -0.0078 -0.0304 -0.0148 8  ARG C NE  
583  C  CZ  . ARG C 8  ? 0.5145 0.5163 0.5954 -0.0054 -0.0269 -0.0133 8  ARG C CZ  
584  N  NH1 . ARG C 8  ? 0.4705 0.4761 0.5538 0.0007  -0.0326 -0.0103 8  ARG C NH1 
585  N  NH2 . ARG C 8  ? 0.5453 0.5272 0.6092 -0.0101 -0.0167 -0.0151 8  ARG C NH2 
586  N  N   . SER C 9  ? 0.3731 0.4008 0.4454 -0.0168 -0.0651 -0.0114 9  SER C N   
587  C  CA  . SER C 9  ? 0.3621 0.3811 0.4249 -0.0215 -0.0625 -0.0118 9  SER C CA  
588  C  C   . SER C 9  ? 0.3431 0.3626 0.4031 -0.0224 -0.0666 -0.0110 9  SER C C   
589  O  O   . SER C 9  ? 0.3432 0.3706 0.4094 -0.0227 -0.0697 -0.0124 9  SER C O   
590  C  CB  . SER C 9  ? 0.3820 0.4024 0.4502 -0.0258 -0.0560 -0.0156 9  SER C CB  
591  O  OG  . SER C 9  ? 0.4780 0.4879 0.5393 -0.0273 -0.0491 -0.0161 9  SER C OG  
592  N  N   . CYS C 10 ? 0.2919 0.3021 0.3424 -0.0232 -0.0665 -0.0085 10 CYS C N   
593  C  CA  . CYS C 10 ? 0.3034 0.3120 0.3519 -0.0239 -0.0673 -0.0081 10 CYS C CA  
594  C  C   . CYS C 10 ? 0.3109 0.3153 0.3570 -0.0286 -0.0624 -0.0109 10 CYS C C   
595  O  O   . CYS C 10 ? 0.3225 0.3215 0.3651 -0.0309 -0.0584 -0.0116 10 CYS C O   
596  C  CB  . CYS C 10 ? 0.2762 0.2790 0.3204 -0.0210 -0.0691 -0.0035 10 CYS C CB  
597  S  SG  . CYS C 10 ? 0.2604 0.2672 0.3071 -0.0169 -0.0738 -0.0008 10 CYS C SG  
598  N  N   . TYR C 11 ? 0.3327 0.3380 0.3787 -0.0311 -0.0622 -0.0130 11 TYR C N   
599  C  CA  . TYR C 11 ? 0.3815 0.3815 0.4236 -0.0367 -0.0569 -0.0161 11 TYR C CA  
600  C  C   . TYR C 11 ? 0.3877 0.3732 0.4196 -0.0353 -0.0529 -0.0127 11 TYR C C   
601  O  O   . TYR C 11 ? 0.3664 0.3493 0.3974 -0.0300 -0.0553 -0.0079 11 TYR C O   
602  C  CB  . TYR C 11 ? 0.3964 0.4000 0.4388 -0.0409 -0.0588 -0.0193 11 TYR C CB  
603  C  CG  . TYR C 11 ? 0.4665 0.4856 0.5214 -0.0435 -0.0629 -0.0224 11 TYR C CG  
604  C  CD1 . TYR C 11 ? 0.5247 0.5487 0.5867 -0.0490 -0.0587 -0.0263 11 TYR C CD1 
605  C  CD2 . TYR C 11 ? 0.4987 0.5277 0.5598 -0.0401 -0.0705 -0.0211 11 TYR C CD2 
606  C  CE1 . TYR C 11 ? 0.5361 0.5773 0.6150 -0.0507 -0.0622 -0.0286 11 TYR C CE1 
607  C  CE2 . TYR C 11 ? 0.5093 0.5541 0.5850 -0.0412 -0.0751 -0.0227 11 TYR C CE2 
608  C  CZ  . TYR C 11 ? 0.5655 0.6179 0.6523 -0.0463 -0.0710 -0.0263 11 TYR C CZ  
609  O  OH  . TYR C 11 ? 0.5832 0.6543 0.6900 -0.0471 -0.0751 -0.0275 11 TYR C OH  
610  N  N   . SER C 12 ? 0.3964 0.3727 0.4217 -0.0397 -0.0466 -0.0147 12 SER C N   
611  C  CA  . SER C 12 ? 0.4164 0.3770 0.4311 -0.0377 -0.0424 -0.0106 12 SER C CA  
612  C  C   . SER C 12 ? 0.4274 0.3817 0.4397 -0.0342 -0.0410 -0.0077 12 SER C C   
613  O  O   . SER C 12 ? 0.4469 0.3915 0.4556 -0.0295 -0.0393 -0.0021 12 SER C O   
614  C  CB  . SER C 12 ? 0.4330 0.3826 0.4388 -0.0441 -0.0344 -0.0143 12 SER C CB  
615  O  OG  . SER C 12 ? 0.4459 0.3944 0.4502 -0.0498 -0.0304 -0.0191 12 SER C OG  
616  N  N   . THR C 13 ? 0.4187 0.3776 0.4329 -0.0368 -0.0415 -0.0112 13 THR C N   
617  C  CA  . THR C 13 ? 0.4609 0.4118 0.4711 -0.0348 -0.0382 -0.0096 13 THR C CA  
618  C  C   . THR C 13 ? 0.4342 0.3918 0.4522 -0.0281 -0.0430 -0.0053 13 THR C C   
619  O  O   . THR C 13 ? 0.4547 0.4049 0.4707 -0.0258 -0.0387 -0.0037 13 THR C O   
620  C  CB  . THR C 13 ? 0.4595 0.4102 0.4639 -0.0429 -0.0374 -0.0160 13 THR C CB  
621  O  OG1 . THR C 13 ? 0.4840 0.4516 0.4972 -0.0450 -0.0459 -0.0186 13 THR C OG1 
622  C  CG2 . THR C 13 ? 0.5240 0.4647 0.5189 -0.0510 -0.0306 -0.0205 13 THR C CG2 
623  N  N   . GLU C 14 ? 0.4023 0.3721 0.4283 -0.0257 -0.0503 -0.0040 14 GLU C N   
624  C  CA  . GLU C 14 ? 0.3603 0.3366 0.3923 -0.0215 -0.0544 -0.0016 14 GLU C CA  
625  C  C   . GLU C 14 ? 0.3555 0.3346 0.3942 -0.0163 -0.0576 0.0043  14 GLU C C   
626  O  O   . GLU C 14 ? 0.3603 0.3369 0.3972 -0.0163 -0.0584 0.0065  14 GLU C O   
627  C  CB  . GLU C 14 ? 0.3648 0.3518 0.3993 -0.0237 -0.0603 -0.0051 14 GLU C CB  
628  C  CG  . GLU C 14 ? 0.3419 0.3282 0.3711 -0.0291 -0.0603 -0.0100 14 GLU C CG  
629  C  CD  . GLU C 14 ? 0.3498 0.3486 0.3847 -0.0301 -0.0673 -0.0121 14 GLU C CD  
630  O  OE1 . GLU C 14 ? 0.3617 0.3681 0.4041 -0.0279 -0.0692 -0.0114 14 GLU C OE1 
631  O  OE2 . GLU C 14 ? 0.4042 0.4044 0.4357 -0.0330 -0.0708 -0.0142 14 GLU C OE2 
632  N  N   . TYR C 15 ? 0.3265 0.3101 0.3714 -0.0129 -0.0599 0.0069  15 TYR C N   
633  C  CA  . TYR C 15 ? 0.3144 0.3032 0.3667 -0.0097 -0.0646 0.0124  15 TYR C CA  
634  C  C   . TYR C 15 ? 0.2911 0.2874 0.3447 -0.0106 -0.0696 0.0108  15 TYR C C   
635  O  O   . TYR C 15 ? 0.2753 0.2726 0.3280 -0.0107 -0.0686 0.0080  15 TYR C O   
636  C  CB  . TYR C 15 ? 0.3199 0.3074 0.3817 -0.0051 -0.0614 0.0177  15 TYR C CB  
637  C  CG  . TYR C 15 ? 0.3780 0.3554 0.4384 -0.0029 -0.0547 0.0200  15 TYR C CG  
638  C  CD1 . TYR C 15 ? 0.4067 0.3737 0.4601 -0.0042 -0.0457 0.0162  15 TYR C CD1 
639  C  CD2 . TYR C 15 ? 0.3610 0.3367 0.4239 -0.0002 -0.0574 0.0260  15 TYR C CD2 
640  C  CE1 . TYR C 15 ? 0.4298 0.3842 0.4793 -0.0026 -0.0377 0.0179  15 TYR C CE1 
641  C  CE2 . TYR C 15 ? 0.4154 0.3794 0.4755 0.0025  -0.0504 0.0285  15 TYR C CE2 
642  C  CZ  . TYR C 15 ? 0.4691 0.4222 0.5225 0.0012  -0.0398 0.0241  15 TYR C CZ  
643  O  OH  . TYR C 15 ? 0.4862 0.4249 0.5348 0.0037  -0.0313 0.0264  15 TYR C OH  
644  N  N   . SER C 16 ? 0.2765 0.2757 0.3297 -0.0115 -0.0746 0.0127  16 SER C N   
645  C  CA  . SER C 16 ? 0.2700 0.2737 0.3229 -0.0124 -0.0782 0.0117  16 SER C CA  
646  C  C   . SER C 16 ? 0.2684 0.2757 0.3290 -0.0108 -0.0796 0.0152  16 SER C C   
647  O  O   . SER C 16 ? 0.2765 0.2864 0.3420 -0.0112 -0.0837 0.0200  16 SER C O   
648  C  CB  . SER C 16 ? 0.2766 0.2784 0.3227 -0.0155 -0.0813 0.0115  16 SER C CB  
649  O  OG  . SER C 16 ? 0.2702 0.2735 0.3137 -0.0163 -0.0820 0.0090  16 SER C OG  
650  N  N   . TYR C 17 ? 0.2661 0.2736 0.3276 -0.0097 -0.0768 0.0130  17 TYR C N   
651  C  CA  . TYR C 17 ? 0.2990 0.3089 0.3684 -0.0087 -0.0757 0.0156  17 TYR C CA  
652  C  C   . TYR C 17 ? 0.3123 0.3241 0.3797 -0.0108 -0.0786 0.0150  17 TYR C C   
653  O  O   . TYR C 17 ? 0.3639 0.3803 0.4394 -0.0122 -0.0806 0.0183  17 TYR C O   
654  C  CB  . TYR C 17 ? 0.2985 0.3027 0.3678 -0.0068 -0.0684 0.0139  17 TYR C CB  
655  C  CG  . TYR C 17 ? 0.3029 0.3077 0.3815 -0.0057 -0.0640 0.0162  17 TYR C CG  
656  C  CD1 . TYR C 17 ? 0.3594 0.3709 0.4544 -0.0040 -0.0637 0.0215  17 TYR C CD1 
657  C  CD2 . TYR C 17 ? 0.3953 0.3941 0.4670 -0.0066 -0.0602 0.0132  17 TYR C CD2 
658  C  CE1 . TYR C 17 ? 0.3593 0.3735 0.4673 -0.0033 -0.0585 0.0237  17 TYR C CE1 
659  C  CE2 . TYR C 17 ? 0.3948 0.3929 0.4753 -0.0064 -0.0541 0.0147  17 TYR C CE2 
660  C  CZ  . TYR C 17 ? 0.3994 0.4063 0.5000 -0.0047 -0.0527 0.0198  17 TYR C CZ  
661  O  OH  . TYR C 17 ? 0.3969 0.4056 0.5110 -0.0047 -0.0457 0.0215  17 TYR C OH  
662  N  N   . GLY C 18 ? 0.3228 0.3313 0.3806 -0.0112 -0.0787 0.0113  18 GLY C N   
663  C  CA  . GLY C 18 ? 0.3174 0.3246 0.3702 -0.0131 -0.0804 0.0106  18 GLY C CA  
664  C  C   . GLY C 18 ? 0.3236 0.3274 0.3674 -0.0122 -0.0807 0.0075  18 GLY C C   
665  O  O   . GLY C 18 ? 0.3303 0.3355 0.3739 -0.0118 -0.0811 0.0064  18 GLY C O   
666  N  N   . THR C 19 ? 0.3441 0.3434 0.3817 -0.0116 -0.0797 0.0063  19 THR C N   
667  C  CA  . THR C 19 ? 0.3590 0.3550 0.3906 -0.0094 -0.0791 0.0044  19 THR C CA  
668  C  C   . THR C 19 ? 0.3632 0.3553 0.3904 -0.0054 -0.0784 0.0038  19 THR C C   
669  O  O   . THR C 19 ? 0.3833 0.3713 0.4077 -0.0058 -0.0771 0.0042  19 THR C O   
670  C  CB  . THR C 19 ? 0.3607 0.3506 0.3850 -0.0126 -0.0779 0.0044  19 THR C CB  
671  O  OG1 . THR C 19 ? 0.4130 0.3971 0.4319 -0.0145 -0.0766 0.0048  19 THR C OG1 
672  C  CG2 . THR C 19 ? 0.3694 0.3606 0.3939 -0.0179 -0.0803 0.0058  19 THR C CG2 
673  N  N   . CYS C 20 ? 0.3604 0.3540 0.3880 -0.0016 -0.0795 0.0030  20 CYS C N   
674  C  CA  . CYS C 20 ? 0.3628 0.3522 0.3853 0.0027  -0.0807 0.0035  20 CYS C CA  
675  C  C   . CYS C 20 ? 0.3646 0.3503 0.3856 0.0058  -0.0782 0.0039  20 CYS C C   
676  O  O   . CYS C 20 ? 0.3942 0.3855 0.4227 0.0072  -0.0775 0.0034  20 CYS C O   
677  C  CB  . CYS C 20 ? 0.3516 0.3477 0.3785 0.0047  -0.0853 0.0032  20 CYS C CB  
678  S  SG  . CYS C 20 ? 0.3453 0.3456 0.3752 0.0000  -0.0857 0.0017  20 CYS C SG  
679  N  N   . THR C 21 ? 0.3623 0.3370 0.3734 0.0065  -0.0752 0.0047  21 THR C N   
680  C  CA  . THR C 21 ? 0.3597 0.3271 0.3670 0.0096  -0.0708 0.0051  21 THR C CA  
681  C  C   . THR C 21 ? 0.3747 0.3390 0.3806 0.0178  -0.0726 0.0076  21 THR C C   
682  O  O   . THR C 21 ? 0.3788 0.3357 0.3752 0.0188  -0.0744 0.0087  21 THR C O   
683  C  CB  . THR C 21 ? 0.3756 0.3308 0.3709 0.0043  -0.0658 0.0044  21 THR C CB  
684  O  OG1 . THR C 21 ? 0.3683 0.3286 0.3663 -0.0034 -0.0672 0.0034  21 THR C OG1 
685  C  CG2 . THR C 21 ? 0.4001 0.3443 0.3887 0.0057  -0.0591 0.0041  21 THR C CG2 
686  N  N   . VAL C 22 ? 0.3648 0.3339 0.3802 0.0238  -0.0720 0.0088  22 VAL C N   
687  C  CA  . VAL C 22 ? 0.3903 0.3576 0.4068 0.0327  -0.0748 0.0126  22 VAL C CA  
688  C  C   . VAL C 22 ? 0.4057 0.3645 0.4229 0.0384  -0.0663 0.0140  22 VAL C C   
689  O  O   . VAL C 22 ? 0.4064 0.3721 0.4367 0.0400  -0.0621 0.0133  22 VAL C O   
690  C  CB  . VAL C 22 ? 0.3827 0.3672 0.4148 0.0360  -0.0841 0.0143  22 VAL C CB  
691  C  CG1 . VAL C 22 ? 0.3988 0.3829 0.4341 0.0458  -0.0887 0.0195  22 VAL C CG1 
692  C  CG2 . VAL C 22 ? 0.4312 0.4186 0.4575 0.0300  -0.0907 0.0128  22 VAL C CG2 
693  N  N   . MET C 23 ? 0.4318 0.3734 0.4337 0.0413  -0.0625 0.0157  23 MET C N   
694  C  CA  . MET C 23 ? 0.4670 0.3940 0.4638 0.0461  -0.0520 0.0169  23 MET C CA  
695  C  C   . MET C 23 ? 0.4540 0.3774 0.4502 0.0393  -0.0426 0.0128  23 MET C C   
696  O  O   . MET C 23 ? 0.4681 0.3871 0.4699 0.0439  -0.0339 0.0133  23 MET C O   
697  C  CB  . MET C 23 ? 0.4736 0.4055 0.4841 0.0591  -0.0538 0.0224  23 MET C CB  
698  C  CG  . MET C 23 ? 0.5229 0.4491 0.5234 0.0642  -0.0622 0.0267  23 MET C CG  
699  S  SD  . MET C 23 ? 0.6150 0.5459 0.6309 0.0801  -0.0662 0.0349  23 MET C SD  
700  C  CE  . MET C 23 ? 0.6106 0.5729 0.6596 0.0796  -0.0724 0.0340  23 MET C CE  
701  N  N   . GLY C 24 ? 0.4335 0.3572 0.4220 0.0283  -0.0441 0.0091  24 GLY C N   
702  C  CA  . GLY C 24 ? 0.4494 0.3683 0.4335 0.0202  -0.0377 0.0057  24 GLY C CA  
703  C  C   . GLY C 24 ? 0.4424 0.3759 0.4430 0.0204  -0.0385 0.0047  24 GLY C C   
704  O  O   . GLY C 24 ? 0.4618 0.3881 0.4580 0.0156  -0.0313 0.0023  24 GLY C O   
705  N  N   . ILE C 25 ? 0.4252 0.3771 0.4426 0.0247  -0.0470 0.0061  25 ILE C N   
706  C  CA  . ILE C 25 ? 0.4064 0.3724 0.4382 0.0226  -0.0483 0.0044  25 ILE C CA  
707  C  C   . ILE C 25 ? 0.4049 0.3791 0.4349 0.0160  -0.0571 0.0033  25 ILE C C   
708  O  O   . ILE C 25 ? 0.3969 0.3774 0.4291 0.0183  -0.0645 0.0048  25 ILE C O   
709  C  CB  . ILE C 25 ? 0.4061 0.3872 0.4597 0.0315  -0.0508 0.0067  25 ILE C CB  
710  C  CG1 . ILE C 25 ? 0.4196 0.3930 0.4789 0.0396  -0.0404 0.0087  25 ILE C CG1 
711  C  CG2 . ILE C 25 ? 0.4293 0.4258 0.4976 0.0279  -0.0531 0.0045  25 ILE C CG2 
712  C  CD1 . ILE C 25 ? 0.4169 0.3791 0.4728 0.0359  -0.0267 0.0055  25 ILE C CD1 
713  N  N   . ASN C 26 ? 0.3863 0.3582 0.4107 0.0079  -0.0559 0.0010  26 ASN C N   
714  C  CA  . ASN C 26 ? 0.3921 0.3713 0.4166 0.0026  -0.0630 0.0007  26 ASN C CA  
715  C  C   . ASN C 26 ? 0.3796 0.3720 0.4168 0.0025  -0.0662 -0.0001 26 ASN C C   
716  O  O   . ASN C 26 ? 0.3743 0.3688 0.4178 0.0024  -0.0619 -0.0015 26 ASN C O   
717  C  CB  . ASN C 26 ? 0.3965 0.3672 0.4088 -0.0058 -0.0626 0.0002  26 ASN C CB  
718  C  CG  . ASN C 26 ? 0.4422 0.4015 0.4420 -0.0080 -0.0609 0.0007  26 ASN C CG  
719  O  OD1 . ASN C 26 ? 0.5441 0.5053 0.5442 -0.0070 -0.0640 0.0017  26 ASN C OD1 
720  N  ND2 . ASN C 26 ? 0.5544 0.4997 0.5414 -0.0122 -0.0549 -0.0002 26 ASN C ND2 
721  N  N   . TRP C 27 ? 0.3558 0.3553 0.3959 0.0020  -0.0724 0.0003  27 TRP C N   
722  C  CA  . TRP C 27 ? 0.3563 0.3650 0.4044 -0.0001 -0.0747 -0.0008 27 TRP C CA  
723  C  C   . TRP C 27 ? 0.3340 0.3407 0.3770 -0.0045 -0.0769 -0.0002 27 TRP C C   
724  O  O   . TRP C 27 ? 0.3333 0.3345 0.3698 -0.0055 -0.0775 0.0011  27 TRP C O   
725  C  CB  . TRP C 27 ? 0.3686 0.3866 0.4247 0.0028  -0.0798 -0.0007 27 TRP C CB  
726  C  CG  . TRP C 27 ? 0.4814 0.5056 0.5479 0.0076  -0.0793 -0.0003 27 TRP C CG  
727  C  CD1 . TRP C 27 ? 0.5199 0.5526 0.5997 0.0075  -0.0762 -0.0019 27 TRP C CD1 
728  C  CD2 . TRP C 27 ? 0.5703 0.5926 0.6367 0.0139  -0.0809 0.0022  27 TRP C CD2 
729  N  NE1 . TRP C 27 ? 0.5775 0.6160 0.6688 0.0139  -0.0761 -0.0001 27 TRP C NE1 
730  C  CE2 . TRP C 27 ? 0.6056 0.6371 0.6879 0.0185  -0.0794 0.0028  27 TRP C CE2 
731  C  CE3 . TRP C 27 ? 0.6116 0.6245 0.6661 0.0164  -0.0830 0.0043  27 TRP C CE3 
732  C  CZ2 . TRP C 27 ? 0.6563 0.6884 0.7438 0.0264  -0.0808 0.0063  27 TRP C CZ2 
733  C  CZ3 . TRP C 27 ? 0.6634 0.6747 0.7194 0.0234  -0.0842 0.0072  27 TRP C CZ3 
734  C  CH2 . TRP C 27 ? 0.6610 0.6819 0.7336 0.0290  -0.0835 0.0086  27 TRP C CH2 
735  N  N   . ARG C 28 ? 0.2919 0.3033 0.3390 -0.0069 -0.0777 -0.0011 28 ARG C N   
736  C  CA  . ARG C 28 ? 0.3019 0.3118 0.3468 -0.0094 -0.0791 0.0002  28 ARG C CA  
737  C  C   . ARG C 28 ? 0.2901 0.3017 0.3359 -0.0080 -0.0809 0.0001  28 ARG C C   
738  O  O   . ARG C 28 ? 0.2935 0.3090 0.3417 -0.0071 -0.0825 -0.0014 28 ARG C O   
739  C  CB  . ARG C 28 ? 0.2713 0.2814 0.3173 -0.0123 -0.0777 -0.0003 28 ARG C CB  
740  C  CG  . ARG C 28 ? 0.3178 0.3215 0.3574 -0.0152 -0.0760 0.0003  28 ARG C CG  
741  C  CD  . ARG C 28 ? 0.3517 0.3528 0.3897 -0.0182 -0.0739 -0.0003 28 ARG C CD  
742  N  NE  . ARG C 28 ? 0.3926 0.3841 0.4203 -0.0218 -0.0722 0.0001  28 ARG C NE  
743  C  CZ  . ARG C 28 ? 0.4441 0.4293 0.4631 -0.0248 -0.0762 0.0037  28 ARG C CZ  
744  N  NH1 . ARG C 28 ? 0.4102 0.4000 0.4340 -0.0237 -0.0815 0.0074  28 ARG C NH1 
745  N  NH2 . ARG C 28 ? 0.3852 0.3587 0.3907 -0.0296 -0.0747 0.0036  28 ARG C NH2 
746  N  N   . PHE C 29 ? 0.2795 0.2876 0.3234 -0.0085 -0.0804 0.0019  29 PHE C N   
747  C  CA  . PHE C 29 ? 0.2727 0.2779 0.3144 -0.0082 -0.0796 0.0015  29 PHE C CA  
748  C  C   . PHE C 29 ? 0.2869 0.2919 0.3313 -0.0101 -0.0772 0.0017  29 PHE C C   
749  O  O   . PHE C 29 ? 0.2817 0.2860 0.3303 -0.0100 -0.0755 0.0045  29 PHE C O   
750  C  CB  . PHE C 29 ? 0.2763 0.2765 0.3159 -0.0077 -0.0776 0.0033  29 PHE C CB  
751  C  CG  . PHE C 29 ? 0.2821 0.2749 0.3153 -0.0077 -0.0749 0.0025  29 PHE C CG  
752  C  CD1 . PHE C 29 ? 0.3508 0.3389 0.3743 -0.0068 -0.0774 0.0013  29 PHE C CD1 
753  C  CD2 . PHE C 29 ? 0.3386 0.3274 0.3741 -0.0086 -0.0696 0.0033  29 PHE C CD2 
754  C  CE1 . PHE C 29 ? 0.3933 0.3708 0.4060 -0.0081 -0.0750 0.0005  29 PHE C CE1 
755  C  CE2 . PHE C 29 ? 0.3174 0.2954 0.3435 -0.0095 -0.0651 0.0020  29 PHE C CE2 
756  C  CZ  . PHE C 29 ? 0.3754 0.3467 0.3883 -0.0100 -0.0681 0.0004  29 PHE C CZ  
757  N  N   . CYS C 30 ? 0.2820 0.2878 0.3250 -0.0119 -0.0773 -0.0008 30 CYS C N   
758  C  CA  . CYS C 30 ? 0.2848 0.2882 0.3283 -0.0140 -0.0740 -0.0010 30 CYS C CA  
759  C  C   . CYS C 30 ? 0.3115 0.3067 0.3489 -0.0156 -0.0701 -0.0020 30 CYS C C   
760  O  O   . CYS C 30 ? 0.3261 0.3197 0.3569 -0.0183 -0.0719 -0.0048 30 CYS C O   
761  C  CB  . CYS C 30 ? 0.2636 0.2716 0.3089 -0.0167 -0.0748 -0.0039 30 CYS C CB  
762  S  SG  . CYS C 30 ? 0.2886 0.3026 0.3387 -0.0159 -0.0763 -0.0041 30 CYS C SG  
763  N  N   . CYS C 31 ? 0.3154 0.3046 0.3543 -0.0144 -0.0646 0.0003  31 CYS C N   
764  C  CA  . CYS C 31 ? 0.3562 0.3340 0.3882 -0.0157 -0.0579 -0.0005 31 CYS C CA  
765  C  C   . CYS C 31 ? 0.3753 0.3456 0.4047 -0.0173 -0.0520 -0.0008 31 CYS C C   
766  O  O   . CYS C 31 ? 0.3712 0.3445 0.4065 -0.0156 -0.0522 0.0015  31 CYS C O   
767  C  CB  . CYS C 31 ? 0.3353 0.3097 0.3729 -0.0119 -0.0530 0.0030  31 CYS C CB  
768  S  SG  . CYS C 31 ? 0.3453 0.3239 0.3826 -0.0109 -0.0575 0.0030  31 CYS C SG  
769  N  N   . LEU C 32 ? 0.4196 0.3770 0.4375 -0.0209 -0.0457 -0.0034 32 LEU C N   
770  C  CA  . LEU C 32 ? 0.4547 0.4001 0.4686 -0.0217 -0.0367 -0.0031 32 LEU C CA  
771  C  C   . LEU C 32 ? 0.4937 0.4212 0.4953 -0.0239 -0.0269 -0.0047 32 LEU C C   
772  O  O   . LEU C 32 ? 0.5121 0.4362 0.5045 -0.0269 -0.0289 -0.0071 32 LEU C O   
773  C  CB  . LEU C 32 ? 0.4721 0.4176 0.4797 -0.0276 -0.0384 -0.0070 32 LEU C CB  
774  C  CG  . LEU C 32 ? 0.5007 0.4398 0.4934 -0.0370 -0.0389 -0.0131 32 LEU C CG  
775  C  CD1 . LEU C 32 ? 0.5264 0.4661 0.5174 -0.0425 -0.0381 -0.0161 32 LEU C CD1 
776  C  CD2 . LEU C 32 ? 0.5192 0.4693 0.5119 -0.0394 -0.0493 -0.0151 32 LEU C CD2 
777  O  OXT . LEU C 32 ? 0.5067 0.4210 0.5059 -0.0226 -0.0163 -0.0034 32 LEU C OXT 
778  N  N   . ALA D 1  ? 0.4766 0.7293 0.5002 0.0589  -0.0173 0.1293  1  ALA D N   
779  C  CA  . ALA D 1  ? 0.4600 0.6926 0.4902 0.0407  -0.0250 0.1216  1  ALA D CA  
780  C  C   . ALA D 1  ? 0.4492 0.6468 0.4675 0.0406  -0.0238 0.1020  1  ALA D C   
781  O  O   . ALA D 1  ? 0.4484 0.6386 0.4607 0.0394  -0.0240 0.0963  1  ALA D O   
782  C  CB  . ALA D 1  ? 0.4696 0.7123 0.5109 0.0234  -0.0348 0.1295  1  ALA D CB  
783  N  N   . PHE D 2  ? 0.4245 0.6037 0.4408 0.0413  -0.0228 0.0937  2  PHE D N   
784  C  CA  . PHE D 2  ? 0.4169 0.5678 0.4250 0.0408  -0.0219 0.0786  2  PHE D CA  
785  C  C   . PHE D 2  ? 0.4112 0.5492 0.4260 0.0277  -0.0276 0.0735  2  PHE D C   
786  O  O   . PHE D 2  ? 0.4056 0.5491 0.4298 0.0224  -0.0310 0.0796  2  PHE D O   
787  C  CB  . PHE D 2  ? 0.4328 0.5711 0.4328 0.0521  -0.0176 0.0734  2  PHE D CB  
788  C  CG  . PHE D 2  ? 0.4537 0.5971 0.4428 0.0674  -0.0137 0.0757  2  PHE D CG  
789  C  CD1 . PHE D 2  ? 0.4810 0.6466 0.4694 0.0780  -0.0109 0.0860  2  PHE D CD1 
790  C  CD2 . PHE D 2  ? 0.4829 0.6101 0.4626 0.0720  -0.0132 0.0687  2  PHE D CD2 
791  C  CE1 . PHE D 2  ? 0.5273 0.6961 0.5029 0.0954  -0.0073 0.0872  2  PHE D CE1 
792  C  CE2 . PHE D 2  ? 0.4943 0.6220 0.4629 0.0870  -0.0113 0.0704  2  PHE D CE2 
793  C  CZ  . PHE D 2  ? 0.5195 0.6667 0.4847 0.0997  -0.0082 0.0786  2  PHE D CZ  
794  N  N   . THR D 3  ? 0.3968 0.5186 0.4063 0.0237  -0.0286 0.0633  3  THR D N   
795  C  CA  . THR D 3  ? 0.4018 0.5061 0.4130 0.0160  -0.0328 0.0552  3  THR D CA  
796  C  C   . THR D 3  ? 0.3936 0.4819 0.3995 0.0221  -0.0273 0.0463  3  THR D C   
797  O  O   . THR D 3  ? 0.3987 0.4855 0.3976 0.0271  -0.0235 0.0435  3  THR D O   
798  C  CB  . THR D 3  ? 0.4181 0.5176 0.4244 0.0088  -0.0385 0.0502  3  THR D CB  
799  O  OG1 . THR D 3  ? 0.4226 0.5391 0.4346 0.0019  -0.0450 0.0607  3  THR D OG1 
800  C  CG2 . THR D 3  ? 0.4150 0.4935 0.4205 0.0035  -0.0438 0.0408  3  THR D CG2 
801  N  N   . CYS D 4  ? 0.3889 0.4668 0.3996 0.0210  -0.0276 0.0438  4  CYS D N   
802  C  CA  . CYS D 4  ? 0.3745 0.4408 0.3830 0.0262  -0.0231 0.0389  4  CYS D CA  
803  C  C   . CYS D 4  ? 0.3744 0.4272 0.3865 0.0231  -0.0243 0.0330  4  CYS D C   
804  O  O   . CYS D 4  ? 0.3924 0.4424 0.4103 0.0176  -0.0292 0.0337  4  CYS D O   
805  C  CB  . CYS D 4  ? 0.3790 0.4480 0.3890 0.0313  -0.0216 0.0439  4  CYS D CB  
806  S  SG  . CYS D 4  ? 0.3703 0.4539 0.3736 0.0400  -0.0199 0.0507  4  CYS D SG  
807  N  N   . HIS D 5  ? 0.3749 0.4202 0.3841 0.0269  -0.0204 0.0283  5  HIS D N   
808  C  CA  . HIS D 5  ? 0.3856 0.4203 0.3981 0.0274  -0.0197 0.0237  5  HIS D CA  
809  C  C   . HIS D 5  ? 0.3832 0.4167 0.3990 0.0314  -0.0154 0.0264  5  HIS D C   
810  O  O   . HIS D 5  ? 0.3605 0.3979 0.3734 0.0334  -0.0141 0.0298  5  HIS D O   
811  C  CB  . HIS D 5  ? 0.4015 0.4322 0.4057 0.0296  -0.0191 0.0162  5  HIS D CB  
812  C  CG  . HIS D 5  ? 0.4443 0.4730 0.4429 0.0247  -0.0258 0.0128  5  HIS D CG  
813  N  ND1 . HIS D 5  ? 0.4422 0.4817 0.4365 0.0222  -0.0273 0.0159  5  HIS D ND1 
814  C  CD2 . HIS D 5  ? 0.4497 0.4653 0.4459 0.0216  -0.0330 0.0071  5  HIS D CD2 
815  C  CE1 . HIS D 5  ? 0.4556 0.4907 0.4461 0.0164  -0.0354 0.0132  5  HIS D CE1 
816  N  NE2 . HIS D 5  ? 0.4833 0.5022 0.4744 0.0156  -0.0399 0.0075  5  HIS D NE2 
817  N  N   . CYS D 6  ? 0.3943 0.4216 0.4170 0.0318  -0.0148 0.0262  6  CYS D N   
818  C  CA  . CYS D 6  ? 0.3971 0.4245 0.4248 0.0343  -0.0120 0.0302  6  CYS D CA  
819  C  C   . CYS D 6  ? 0.4115 0.4423 0.4367 0.0392  -0.0073 0.0279  6  CYS D C   
820  O  O   . CYS D 6  ? 0.4360 0.4623 0.4587 0.0421  -0.0066 0.0218  6  CYS D O   
821  C  CB  . CYS D 6  ? 0.3993 0.4215 0.4365 0.0330  -0.0132 0.0324  6  CYS D CB  
822  S  SG  . CYS D 6  ? 0.4081 0.4309 0.4468 0.0292  -0.0180 0.0369  6  CYS D SG  
823  N  N   . ARG D 7  ? 0.4239 0.4628 0.4488 0.0407  -0.0050 0.0332  7  ARG D N   
824  C  CA  . ARG D 7  ? 0.4401 0.4886 0.4630 0.0466  0.0003  0.0339  7  ARG D CA  
825  C  C   . ARG D 7  ? 0.4561 0.5140 0.4888 0.0461  0.0015  0.0459  7  ARG D C   
826  O  O   . ARG D 7  ? 0.4534 0.5070 0.4895 0.0405  -0.0038 0.0516  7  ARG D O   
827  C  CB  . ARG D 7  ? 0.4406 0.4955 0.4534 0.0473  0.0008  0.0317  7  ARG D CB  
828  C  CG  . ARG D 7  ? 0.4189 0.4673 0.4227 0.0447  -0.0027 0.0233  7  ARG D CG  
829  C  CD  . ARG D 7  ? 0.4460 0.5040 0.4407 0.0458  -0.0018 0.0232  7  ARG D CD  
830  N  NE  . ARG D 7  ? 0.4278 0.4821 0.4151 0.0421  -0.0064 0.0176  7  ARG D NE  
831  C  CZ  . ARG D 7  ? 0.4984 0.5436 0.4798 0.0416  -0.0100 0.0093  7  ARG D CZ  
832  N  NH1 . ARG D 7  ? 0.5003 0.5372 0.4803 0.0469  -0.0085 0.0038  7  ARG D NH1 
833  N  NH2 . ARG D 7  ? 0.5188 0.5627 0.4958 0.0361  -0.0161 0.0072  7  ARG D NH2 
834  N  N   . ARG D 8  ? 0.4808 0.5517 0.5170 0.0527  0.0075  0.0502  8  ARG D N   
835  C  CA  . ARG D 8  ? 0.4938 0.5803 0.5412 0.0518  0.0085  0.0653  8  ARG D CA  
836  C  C   . ARG D 8  ? 0.4996 0.5885 0.5455 0.0460  0.0038  0.0714  8  ARG D C   
837  O  O   . ARG D 8  ? 0.5064 0.5927 0.5607 0.0390  -0.0028 0.0817  8  ARG D O   
838  C  CB  . ARG D 8  ? 0.5232 0.6302 0.5714 0.0627  0.0175  0.0696  8  ARG D CB  
839  C  CG  . ARG D 8  ? 0.5953 0.6972 0.6372 0.0735  0.0230  0.0588  8  ARG D CG  
840  C  CD  . ARG D 8  ? 0.7098 0.8356 0.7505 0.0882  0.0330  0.0645  8  ARG D CD  
841  N  NE  . ARG D 8  ? 0.7929 0.9172 0.8129 0.0997  0.0372  0.0509  8  ARG D NE  
842  C  CZ  . ARG D 8  ? 0.8402 0.9814 0.8517 0.1039  0.0407  0.0536  8  ARG D CZ  
843  N  NH1 . ARG D 8  ? 0.8444 1.0056 0.8683 0.0968  0.0404  0.0707  8  ARG D NH1 
844  N  NH2 . ARG D 8  ? 0.8641 1.0010 0.8541 0.1149  0.0432  0.0395  8  ARG D NH2 
845  N  N   . SER D 9  ? 0.4906 0.5828 0.5253 0.0488  0.0060  0.0654  9  SER D N   
846  C  CA  . SER D 9  ? 0.4901 0.5828 0.5225 0.0441  0.0014  0.0703  9  SER D CA  
847  C  C   . SER D 9  ? 0.4736 0.5590 0.4925 0.0451  0.0013  0.0581  9  SER D C   
848  O  O   . SER D 9  ? 0.4800 0.5658 0.4908 0.0498  0.0053  0.0482  9  SER D O   
849  C  CB  . SER D 9  ? 0.4896 0.6049 0.5260 0.0465  0.0050  0.0822  9  SER D CB  
850  O  OG  . SER D 9  ? 0.5745 0.7060 0.6203 0.0513  0.0107  0.0904  9  SER D OG  
851  N  N   . CYS D 10 ? 0.4514 0.5297 0.4675 0.0411  -0.0041 0.0593  10 CYS D N   
852  C  CA  . CYS D 10 ? 0.4539 0.5302 0.4593 0.0418  -0.0043 0.0511  10 CYS D CA  
853  C  C   . CYS D 10 ? 0.4513 0.5429 0.4508 0.0446  -0.0005 0.0522  10 CYS D C   
854  O  O   . CYS D 10 ? 0.4422 0.5466 0.4466 0.0454  0.0011  0.0621  10 CYS D O   
855  C  CB  . CYS D 10 ? 0.4449 0.5107 0.4481 0.0397  -0.0104 0.0527  10 CYS D CB  
856  S  SG  . CYS D 10 ? 0.4386 0.4874 0.4448 0.0383  -0.0152 0.0511  10 CYS D SG  
857  N  N   . TYR D 11 ? 0.4587 0.5502 0.4482 0.0455  0.0000  0.0433  11 TYR D N   
858  C  CA  . TYR D 11 ? 0.4832 0.5878 0.4649 0.0474  0.0017  0.0438  11 TYR D CA  
859  C  C   . TYR D 11 ? 0.4843 0.5920 0.4700 0.0447  -0.0014 0.0534  11 TYR D C   
860  O  O   . TYR D 11 ? 0.4755 0.5715 0.4642 0.0425  -0.0058 0.0546  11 TYR D O   
861  C  CB  . TYR D 11 ? 0.4861 0.5868 0.4563 0.0465  -0.0006 0.0332  11 TYR D CB  
862  C  CG  . TYR D 11 ? 0.5207 0.6146 0.4836 0.0502  0.0003  0.0226  11 TYR D CG  
863  C  CD1 . TYR D 11 ? 0.5312 0.6341 0.4875 0.0585  0.0057  0.0211  11 TYR D CD1 
864  C  CD2 . TYR D 11 ? 0.5413 0.6200 0.5036 0.0466  -0.0045 0.0151  11 TYR D CD2 
865  C  CE1 . TYR D 11 ? 0.5809 0.6742 0.5276 0.0647  0.0061  0.0102  11 TYR D CE1 
866  C  CE2 . TYR D 11 ? 0.5549 0.6227 0.5100 0.0503  -0.0056 0.0052  11 TYR D CE2 
867  C  CZ  . TYR D 11 ? 0.6057 0.6789 0.5519 0.0601  -0.0003 0.0017  11 TYR D CZ  
868  O  OH  . TYR D 11 ? 0.6289 0.6878 0.5653 0.0663  -0.0020 -0.0094 11 TYR D OH  
869  N  N   . SER D 12 ? 0.4987 0.6222 0.4836 0.0461  0.0005  0.0606  12 SER D N   
870  C  CA  . SER D 12 ? 0.5056 0.6314 0.4935 0.0439  -0.0033 0.0699  12 SER D CA  
871  C  C   . SER D 12 ? 0.5102 0.6279 0.4924 0.0432  -0.0068 0.0648  12 SER D C   
872  O  O   . SER D 12 ? 0.5275 0.6392 0.5123 0.0433  -0.0110 0.0708  12 SER D O   
873  C  CB  . SER D 12 ? 0.5058 0.6535 0.4924 0.0455  -0.0001 0.0779  12 SER D CB  
874  O  OG  . SER D 12 ? 0.5162 0.6707 0.4895 0.0483  0.0028  0.0677  12 SER D OG  
875  N  N   . THR D 13 ? 0.5093 0.6269 0.4839 0.0428  -0.0060 0.0550  13 THR D N   
876  C  CA  . THR D 13 ? 0.5060 0.6220 0.4776 0.0418  -0.0091 0.0532  13 THR D CA  
877  C  C   . THR D 13 ? 0.5034 0.6059 0.4785 0.0423  -0.0112 0.0509  13 THR D C   
878  O  O   . THR D 13 ? 0.5017 0.6060 0.4758 0.0432  -0.0130 0.0517  13 THR D O   
879  C  CB  . THR D 13 ? 0.5180 0.6411 0.4813 0.0390  -0.0101 0.0466  13 THR D CB  
880  O  OG1 . THR D 13 ? 0.5273 0.6413 0.4882 0.0380  -0.0102 0.0375  13 THR D OG1 
881  C  CG2 . THR D 13 ? 0.5157 0.6532 0.4721 0.0398  -0.0086 0.0484  13 THR D CG2 
882  N  N   . GLU D 14 ? 0.4917 0.5839 0.4713 0.0424  -0.0107 0.0495  14 GLU D N   
883  C  CA  . GLU D 14 ? 0.4761 0.5564 0.4581 0.0431  -0.0126 0.0473  14 GLU D CA  
884  C  C   . GLU D 14 ? 0.4805 0.5491 0.4640 0.0460  -0.0160 0.0522  14 GLU D C   
885  O  O   . GLU D 14 ? 0.4860 0.5545 0.4716 0.0457  -0.0177 0.0583  14 GLU D O   
886  C  CB  . GLU D 14 ? 0.4710 0.5465 0.4561 0.0407  -0.0109 0.0416  14 GLU D CB  
887  C  CG  . GLU D 14 ? 0.4502 0.5288 0.4318 0.0378  -0.0114 0.0350  14 GLU D CG  
888  C  CD  . GLU D 14 ? 0.4369 0.5082 0.4202 0.0371  -0.0104 0.0289  14 GLU D CD  
889  O  OE1 . GLU D 14 ? 0.4475 0.5174 0.4340 0.0397  -0.0072 0.0302  14 GLU D OE1 
890  O  OE2 . GLU D 14 ? 0.4271 0.4944 0.4089 0.0340  -0.0136 0.0240  14 GLU D OE2 
891  N  N   . TYR D 15 ? 0.4919 0.5505 0.4736 0.0489  -0.0183 0.0501  15 TYR D N   
892  C  CA  . TYR D 15 ? 0.5153 0.5571 0.4945 0.0523  -0.0239 0.0522  15 TYR D CA  
893  C  C   . TYR D 15 ? 0.4977 0.5310 0.4801 0.0501  -0.0248 0.0491  15 TYR D C   
894  O  O   . TYR D 15 ? 0.4837 0.5229 0.4680 0.0489  -0.0214 0.0454  15 TYR D O   
895  C  CB  . TYR D 15 ? 0.5312 0.5689 0.5008 0.0615  -0.0261 0.0521  15 TYR D CB  
896  C  CG  . TYR D 15 ? 0.6203 0.6670 0.5879 0.0642  -0.0254 0.0564  15 TYR D CG  
897  C  CD1 . TYR D 15 ? 0.6698 0.7352 0.6371 0.0652  -0.0209 0.0571  15 TYR D CD1 
898  C  CD2 . TYR D 15 ? 0.6884 0.7259 0.6560 0.0643  -0.0305 0.0617  15 TYR D CD2 
899  C  CE1 . TYR D 15 ? 0.6947 0.7701 0.6610 0.0672  -0.0205 0.0621  15 TYR D CE1 
900  C  CE2 . TYR D 15 ? 0.7179 0.7648 0.6848 0.0666  -0.0300 0.0668  15 TYR D CE2 
901  C  CZ  . TYR D 15 ? 0.7144 0.7803 0.6802 0.0683  -0.0245 0.0665  15 TYR D CZ  
902  O  OH  . TYR D 15 ? 0.7988 0.8748 0.7644 0.0705  -0.0243 0.0724  15 TYR D OH  
903  N  N   . SER D 16 ? 0.5057 0.5252 0.4898 0.0485  -0.0305 0.0521  16 SER D N   
904  C  CA  . SER D 16 ? 0.5113 0.5236 0.4988 0.0460  -0.0320 0.0503  16 SER D CA  
905  C  C   . SER D 16 ? 0.5242 0.5232 0.5007 0.0527  -0.0368 0.0466  16 SER D C   
906  O  O   . SER D 16 ? 0.5482 0.5317 0.5153 0.0574  -0.0442 0.0472  16 SER D O   
907  C  CB  . SER D 16 ? 0.5228 0.5296 0.5191 0.0398  -0.0369 0.0576  16 SER D CB  
908  O  OG  . SER D 16 ? 0.5267 0.5258 0.5261 0.0374  -0.0398 0.0571  16 SER D OG  
909  N  N   . TYR D 17 ? 0.5257 0.5296 0.5022 0.0539  -0.0336 0.0431  17 TYR D N   
910  C  CA  . TYR D 17 ? 0.5247 0.5206 0.4888 0.0627  -0.0370 0.0403  17 TYR D CA  
911  C  C   . TYR D 17 ? 0.5360 0.5184 0.4988 0.0608  -0.0428 0.0395  17 TYR D C   
912  O  O   . TYR D 17 ? 0.5548 0.5283 0.5043 0.0690  -0.0468 0.0366  17 TYR D O   
913  C  CB  . TYR D 17 ? 0.5264 0.5408 0.4901 0.0671  -0.0304 0.0400  17 TYR D CB  
914  C  CG  . TYR D 17 ? 0.5324 0.5566 0.4917 0.0725  -0.0277 0.0417  17 TYR D CG  
915  C  CD1 . TYR D 17 ? 0.5291 0.5511 0.4744 0.0858  -0.0290 0.0416  17 TYR D CD1 
916  C  CD2 . TYR D 17 ? 0.5068 0.5418 0.4747 0.0656  -0.0242 0.0434  17 TYR D CD2 
917  C  CE1 . TYR D 17 ? 0.5615 0.5941 0.5042 0.0914  -0.0263 0.0445  17 TYR D CE1 
918  C  CE2 . TYR D 17 ? 0.5138 0.5587 0.4786 0.0696  -0.0224 0.0459  17 TYR D CE2 
919  C  CZ  . TYR D 17 ? 0.5428 0.5874 0.4964 0.0820  -0.0232 0.0472  17 TYR D CZ  
920  O  OH  . TYR D 17 ? 0.5657 0.6221 0.5177 0.0864  -0.0211 0.0511  17 TYR D OH  
921  N  N   . GLY D 18 ? 0.5176 0.4996 0.4932 0.0511  -0.0434 0.0427  18 GLY D N   
922  C  CA  . GLY D 18 ? 0.4930 0.4655 0.4700 0.0480  -0.0489 0.0436  18 GLY D CA  
923  C  C   . GLY D 18 ? 0.4713 0.4541 0.4663 0.0391  -0.0445 0.0479  18 GLY D C   
924  O  O   . GLY D 18 ? 0.4687 0.4602 0.4718 0.0359  -0.0403 0.0508  18 GLY D O   
925  N  N   . THR D 19 ? 0.4443 0.4271 0.4443 0.0366  -0.0451 0.0487  19 THR D N   
926  C  CA  . THR D 19 ? 0.4291 0.4204 0.4458 0.0301  -0.0415 0.0535  19 THR D CA  
927  C  C   . THR D 19 ? 0.4084 0.4085 0.4309 0.0306  -0.0355 0.0509  19 THR D C   
928  O  O   . THR D 19 ? 0.4375 0.4372 0.4530 0.0339  -0.0365 0.0484  19 THR D O   
929  C  CB  . THR D 19 ? 0.4221 0.4043 0.4439 0.0243  -0.0504 0.0607  19 THR D CB  
930  O  OG1 . THR D 19 ? 0.4735 0.4422 0.4825 0.0268  -0.0584 0.0575  19 THR D OG1 
931  C  CG2 . THR D 19 ? 0.4514 0.4274 0.4739 0.0207  -0.0573 0.0670  19 THR D CG2 
932  N  N   . CYS D 20 ? 0.3995 0.4080 0.4344 0.0283  -0.0297 0.0523  20 CYS D N   
933  C  CA  . CYS D 20 ? 0.4010 0.4135 0.4440 0.0276  -0.0267 0.0517  20 CYS D CA  
934  C  C   . CYS D 20 ? 0.4053 0.4191 0.4604 0.0250  -0.0268 0.0580  20 CYS D C   
935  O  O   . CYS D 20 ? 0.4059 0.4224 0.4647 0.0242  -0.0268 0.0627  20 CYS D O   
936  C  CB  . CYS D 20 ? 0.3899 0.4078 0.4355 0.0289  -0.0209 0.0470  20 CYS D CB  
937  S  SG  . CYS D 20 ? 0.4006 0.4216 0.4346 0.0309  -0.0201 0.0421  20 CYS D SG  
938  N  N   . THR D 21 ? 0.3895 0.4039 0.4524 0.0237  -0.0271 0.0600  21 THR D N   
939  C  CA  . THR D 21 ? 0.3910 0.4095 0.4676 0.0224  -0.0259 0.0669  21 THR D CA  
940  C  C   . THR D 21 ? 0.3912 0.4109 0.4748 0.0248  -0.0214 0.0639  21 THR D C   
941  O  O   . THR D 21 ? 0.3618 0.3794 0.4453 0.0231  -0.0238 0.0630  21 THR D O   
942  C  CB  . THR D 21 ? 0.3925 0.4077 0.4716 0.0175  -0.0340 0.0745  21 THR D CB  
943  O  OG1 . THR D 21 ? 0.3698 0.3777 0.4392 0.0152  -0.0411 0.0757  21 THR D OG1 
944  C  CG2 . THR D 21 ? 0.3681 0.3914 0.4636 0.0159  -0.0327 0.0842  21 THR D CG2 
945  N  N   . VAL D 22 ? 0.4084 0.4315 0.4970 0.0296  -0.0156 0.0627  22 VAL D N   
946  C  CA  . VAL D 22 ? 0.4329 0.4516 0.5249 0.0333  -0.0129 0.0578  22 VAL D CA  
947  C  C   . VAL D 22 ? 0.4452 0.4699 0.5455 0.0403  -0.0073 0.0617  22 VAL D C   
948  O  O   . VAL D 22 ? 0.4494 0.4829 0.5475 0.0440  -0.0033 0.0638  22 VAL D O   
949  C  CB  . VAL D 22 ? 0.4453 0.4587 0.5263 0.0353  -0.0121 0.0479  22 VAL D CB  
950  C  CG1 . VAL D 22 ? 0.4649 0.4682 0.5486 0.0369  -0.0137 0.0430  22 VAL D CG1 
951  C  CG2 . VAL D 22 ? 0.4659 0.4797 0.5384 0.0300  -0.0161 0.0466  22 VAL D CG2 
952  N  N   . MET D 23 ? 0.4446 0.4672 0.5552 0.0425  -0.0070 0.0646  23 MET D N   
953  C  CA  . MET D 23 ? 0.4677 0.4974 0.5869 0.0518  -0.0010 0.0693  23 MET D CA  
954  C  C   . MET D 23 ? 0.4593 0.5059 0.5882 0.0486  -0.0006 0.0832  23 MET D C   
955  O  O   . MET D 23 ? 0.4686 0.5294 0.6045 0.0566  0.0056  0.0904  23 MET D O   
956  C  CB  . MET D 23 ? 0.4779 0.5057 0.5867 0.0638  0.0051  0.0602  23 MET D CB  
957  C  CG  . MET D 23 ? 0.5310 0.5381 0.6308 0.0680  0.0022  0.0469  23 MET D CG  
958  S  SD  . MET D 23 ? 0.5554 0.5578 0.6357 0.0808  0.0067  0.0340  23 MET D SD  
959  C  CE  . MET D 23 ? 0.6682 0.6850 0.7557 0.0983  0.0168  0.0411  23 MET D CE  
960  N  N   . GLY D 24 ? 0.4392 0.4845 0.5681 0.0376  -0.0080 0.0878  24 GLY D N   
961  C  CA  . GLY D 24 ? 0.4283 0.4848 0.5664 0.0318  -0.0118 0.1017  24 GLY D CA  
962  C  C   . GLY D 24 ? 0.4313 0.4956 0.5656 0.0309  -0.0117 0.1055  24 GLY D C   
963  O  O   . GLY D 24 ? 0.4233 0.4965 0.5664 0.0244  -0.0171 0.1190  24 GLY D O   
964  N  N   . ILE D 25 ? 0.4352 0.4970 0.5578 0.0364  -0.0068 0.0954  25 ILE D N   
965  C  CA  . ILE D 25 ? 0.4479 0.5161 0.5660 0.0341  -0.0080 0.0992  25 ILE D CA  
966  C  C   . ILE D 25 ? 0.4408 0.4939 0.5437 0.0289  -0.0138 0.0895  25 ILE D C   
967  O  O   . ILE D 25 ? 0.4221 0.4636 0.5163 0.0296  -0.0140 0.0784  25 ILE D O   
968  C  CB  . ILE D 25 ? 0.4646 0.5491 0.5821 0.0446  0.0019  0.1002  25 ILE D CB  
969  C  CG1 . ILE D 25 ? 0.5075 0.5959 0.6266 0.0577  0.0111  0.0956  25 ILE D CG1 
970  C  CG2 . ILE D 25 ? 0.4937 0.5999 0.6236 0.0416  0.0009  0.1192  25 ILE D CG2 
971  C  CD1 . ILE D 25 ? 0.5618 0.6341 0.6648 0.0627  0.0128  0.0778  25 ILE D CD1 
972  N  N   . ASN D 26 ? 0.4408 0.4955 0.5416 0.0241  -0.0189 0.0955  26 ASN D N   
973  C  CA  . ASN D 26 ? 0.4500 0.4914 0.5361 0.0215  -0.0241 0.0876  26 ASN D CA  
974  C  C   . ASN D 26 ? 0.4439 0.4903 0.5219 0.0272  -0.0172 0.0806  26 ASN D C   
975  O  O   . ASN D 26 ? 0.4323 0.4940 0.5154 0.0311  -0.0113 0.0863  26 ASN D O   
976  C  CB  . ASN D 26 ? 0.4637 0.4992 0.5499 0.0135  -0.0356 0.0969  26 ASN D CB  
977  C  CG  . ASN D 26 ? 0.4972 0.5217 0.5848 0.0074  -0.0456 0.1005  26 ASN D CG  
978  O  OD1 . ASN D 26 ? 0.4882 0.5073 0.5724 0.0093  -0.0442 0.0936  26 ASN D OD1 
979  N  ND2 . ASN D 26 ? 0.5130 0.5346 0.6062 -0.0007 -0.0569 0.1128  26 ASN D ND2 
980  N  N   . TRP D 27 ? 0.4366 0.4725 0.5019 0.0279  -0.0180 0.0696  27 TRP D N   
981  C  CA  . TRP D 27 ? 0.4313 0.4700 0.4873 0.0318  -0.0136 0.0627  27 TRP D CA  
982  C  C   . TRP D 27 ? 0.4305 0.4601 0.4766 0.0292  -0.0199 0.0608  27 TRP D C   
983  O  O   . TRP D 27 ? 0.4327 0.4516 0.4761 0.0266  -0.0267 0.0615  27 TRP D O   
984  C  CB  . TRP D 27 ? 0.4352 0.4707 0.4868 0.0354  -0.0095 0.0521  27 TRP D CB  
985  C  CG  . TRP D 27 ? 0.4615 0.4992 0.5214 0.0391  -0.0054 0.0524  27 TRP D CG  
986  C  CD1 . TRP D 27 ? 0.4623 0.4972 0.5316 0.0369  -0.0075 0.0567  27 TRP D CD1 
987  C  CD2 . TRP D 27 ? 0.4908 0.5332 0.5490 0.0472  0.0010  0.0480  27 TRP D CD2 
988  N  NE1 . TRP D 27 ? 0.4811 0.5187 0.5563 0.0432  -0.0024 0.0559  27 TRP D NE1 
989  C  CE2 . TRP D 27 ? 0.5061 0.5473 0.5734 0.0505  0.0028  0.0500  27 TRP D CE2 
990  C  CE3 . TRP D 27 ? 0.5481 0.5948 0.5961 0.0531  0.0050  0.0421  27 TRP D CE3 
991  C  CZ2 . TRP D 27 ? 0.5168 0.5590 0.5823 0.0611  0.0084  0.0454  27 TRP D CZ2 
992  C  CZ3 . TRP D 27 ? 0.5772 0.6249 0.6215 0.0635  0.0104  0.0369  27 TRP D CZ3 
993  C  CH2 . TRP D 27 ? 0.5838 0.6283 0.6364 0.0682  0.0121  0.0383  27 TRP D CH2 
994  N  N   . ARG D 28 ? 0.4280 0.4615 0.4671 0.0313  -0.0176 0.0581  28 ARG D N   
995  C  CA  . ARG D 28 ? 0.4407 0.4666 0.4689 0.0317  -0.0218 0.0547  28 ARG D CA  
996  C  C   . ARG D 28 ? 0.4165 0.4425 0.4387 0.0340  -0.0188 0.0460  28 ARG D C   
997  O  O   . ARG D 28 ? 0.4140 0.4455 0.4380 0.0348  -0.0141 0.0418  28 ARG D O   
998  C  CB  . ARG D 28 ? 0.4452 0.4776 0.4710 0.0323  -0.0212 0.0582  28 ARG D CB  
999  C  CG  . ARG D 28 ? 0.5280 0.5637 0.5624 0.0284  -0.0256 0.0707  28 ARG D CG  
1000 C  CD  . ARG D 28 ? 0.6610 0.6784 0.6917 0.0246  -0.0379 0.0750  28 ARG D CD  
1001 N  NE  . ARG D 28 ? 0.7346 0.7450 0.7722 0.0200  -0.0440 0.0799  28 ARG D NE  
1002 C  CZ  . ARG D 28 ? 0.8081 0.8026 0.8451 0.0147  -0.0571 0.0863  28 ARG D CZ  
1003 N  NH1 . ARG D 28 ? 0.8360 0.8172 0.8656 0.0140  -0.0663 0.0886  28 ARG D NH1 
1004 N  NH2 . ARG D 28 ? 0.8383 0.8287 0.8820 0.0099  -0.0626 0.0911  28 ARG D NH2 
1005 N  N   . PHE D 29 ? 0.4131 0.4330 0.4281 0.0354  -0.0226 0.0442  29 PHE D N   
1006 C  CA  . PHE D 29 ? 0.3977 0.4231 0.4077 0.0374  -0.0207 0.0401  29 PHE D CA  
1007 C  C   . PHE D 29 ? 0.3966 0.4268 0.3996 0.0398  -0.0198 0.0397  29 PHE D C   
1008 O  O   . PHE D 29 ? 0.4198 0.4448 0.4150 0.0438  -0.0232 0.0413  29 PHE D O   
1009 C  CB  . PHE D 29 ? 0.3878 0.4102 0.3932 0.0402  -0.0238 0.0406  29 PHE D CB  
1010 C  CG  . PHE D 29 ? 0.3728 0.4064 0.3783 0.0410  -0.0219 0.0406  29 PHE D CG  
1011 C  CD1 . PHE D 29 ? 0.3675 0.4054 0.3826 0.0359  -0.0209 0.0407  29 PHE D CD1 
1012 C  CD2 . PHE D 29 ? 0.3718 0.4118 0.3685 0.0471  -0.0221 0.0421  29 PHE D CD2 
1013 C  CE1 . PHE D 29 ? 0.3719 0.4206 0.3896 0.0343  -0.0215 0.0437  29 PHE D CE1 
1014 C  CE2 . PHE D 29 ? 0.3753 0.4306 0.3753 0.0469  -0.0208 0.0459  29 PHE D CE2 
1015 C  CZ  . PHE D 29 ? 0.3867 0.4464 0.3979 0.0394  -0.0212 0.0474  29 PHE D CZ  
1016 N  N   . CYS D 30 ? 0.3858 0.4241 0.3900 0.0381  -0.0164 0.0373  30 CYS D N   
1017 C  CA  . CYS D 30 ? 0.3925 0.4376 0.3912 0.0393  -0.0154 0.0377  30 CYS D CA  
1018 C  C   . CYS D 30 ? 0.4016 0.4550 0.3972 0.0391  -0.0156 0.0368  30 CYS D C   
1019 O  O   . CYS D 30 ? 0.4219 0.4774 0.4206 0.0353  -0.0161 0.0343  30 CYS D O   
1020 C  CB  . CYS D 30 ? 0.3866 0.4369 0.3868 0.0382  -0.0119 0.0364  30 CYS D CB  
1021 S  SG  . CYS D 30 ? 0.3900 0.4390 0.3980 0.0383  -0.0107 0.0420  30 CYS D SG  
1022 N  N   . CYS D 31 ? 0.3994 0.4575 0.3897 0.0430  -0.0163 0.0399  31 CYS D N   
1023 C  CA  . CYS D 31 ? 0.4106 0.4814 0.4001 0.0428  -0.0167 0.0422  31 CYS D CA  
1024 C  C   . CYS D 31 ? 0.4246 0.5040 0.4097 0.0441  -0.0161 0.0444  31 CYS D C   
1025 O  O   . CYS D 31 ? 0.4352 0.5103 0.4167 0.0477  -0.0158 0.0455  31 CYS D O   
1026 C  CB  . CYS D 31 ? 0.3883 0.4637 0.3758 0.0491  -0.0171 0.0465  31 CYS D CB  
1027 S  SG  . CYS D 31 ? 0.3600 0.4282 0.3511 0.0490  -0.0181 0.0458  31 CYS D SG  
1028 N  N   . LEU D 32 ? 0.4450 0.5370 0.4314 0.0402  -0.0173 0.0465  32 LEU D N   
1029 C  CA  . LEU D 32 ? 0.4712 0.5755 0.4544 0.0419  -0.0173 0.0510  32 LEU D CA  
1030 C  C   . LEU D 32 ? 0.4713 0.5933 0.4585 0.0406  -0.0193 0.0587  32 LEU D C   
1031 O  O   . LEU D 32 ? 0.4662 0.5915 0.4596 0.0348  -0.0222 0.0604  32 LEU D O   
1032 C  CB  . LEU D 32 ? 0.4673 0.5724 0.4474 0.0370  -0.0177 0.0473  32 LEU D CB  
1033 C  CG  . LEU D 32 ? 0.4952 0.6037 0.4741 0.0288  -0.0219 0.0439  32 LEU D CG  
1034 C  CD1 . LEU D 32 ? 0.5236 0.6352 0.4950 0.0288  -0.0210 0.0412  32 LEU D CD1 
1035 C  CD2 . LEU D 32 ? 0.5149 0.6104 0.4960 0.0245  -0.0243 0.0371  32 LEU D CD2 
1036 O  OXT . LEU D 32 ? 0.4901 0.6253 0.4758 0.0455  -0.0183 0.0654  32 LEU D OXT 
1037 CL CL  . CL  E .  ? 0.8868 0.8239 1.1128 -0.0017 0.0312  0.0095  33 CL  A CL  
1038 CL CL  . CL  F .  ? 0.9795 0.8502 0.9433 0.1065  -0.0115 0.0448  33 CL  B CL  
1039 C  C1  . GOL G .  ? 0.5762 0.5927 0.6372 -0.0333 -0.0942 0.0194  33 GOL C C1  
1040 O  O1  . GOL G .  ? 0.5007 0.5286 0.5803 -0.0347 -0.0965 0.0236  33 GOL C O1  
1041 C  C2  . GOL G .  ? 0.5833 0.5978 0.6453 -0.0255 -0.0883 0.0172  33 GOL C C2  
1042 O  O2  . GOL G .  ? 0.6230 0.6318 0.6735 -0.0243 -0.0888 0.0150  33 GOL C O2  
1043 C  C3  . GOL G .  ? 0.5411 0.5503 0.6002 -0.0233 -0.0815 0.0141  33 GOL C C3  
1044 O  O3  . GOL G .  ? 0.6064 0.6066 0.6510 -0.0209 -0.0795 0.0106  33 GOL C O3  
1045 O  O   . HOH H .  ? 0.5646 0.5031 0.5967 -0.0413 -0.0026 -0.0457 34 HOH A O   
1046 O  O   . HOH H .  ? 0.5265 0.5297 0.6393 -0.0135 -0.0256 -0.0105 35 HOH A O   
1047 O  O   . HOH H .  ? 0.4360 0.4078 0.5577 -0.0031 -0.0266 0.0044  36 HOH A O   
1048 O  O   . HOH H .  ? 0.4242 0.4192 0.4660 0.0414  -0.0476 0.0333  37 HOH A O   
1049 O  O   . HOH H .  ? 0.3896 0.3529 0.3956 0.0404  -0.0328 0.0246  38 HOH A O   
1050 O  O   . HOH H .  ? 0.6133 0.5436 0.6077 -0.0012 -0.0746 0.0286  39 HOH A O   
1051 O  O   . HOH H .  ? 0.4708 0.4183 0.5405 0.0515  0.0243  0.0352  40 HOH A O   
1052 O  O   . HOH H .  ? 0.4809 0.5042 0.5717 0.0074  -0.0459 0.0071  41 HOH A O   
1053 O  O   . HOH H .  ? 0.3609 0.3076 0.4347 -0.0059 -0.0775 0.0415  42 HOH A O   
1054 O  O   . HOH H .  ? 0.3745 0.3237 0.4293 -0.0034 -0.0639 0.0311  43 HOH A O   
1055 O  O   . HOH H .  ? 0.4450 0.4406 0.5195 0.0119  -0.0250 0.0097  44 HOH A O   
1056 O  O   . HOH H .  ? 0.5455 0.5026 0.5896 0.0063  -0.0691 0.0216  45 HOH A O   
1057 O  O   . HOH H .  ? 0.5658 0.5592 0.6205 -0.0110 -0.0416 -0.0157 46 HOH A O   
1058 O  O   . HOH H .  ? 0.6499 0.5834 0.6244 0.0390  -0.0241 0.0216  47 HOH A O   
1059 O  O   . HOH H .  ? 0.5314 0.5421 0.5631 0.0008  -0.0673 0.0005  48 HOH A O   
1060 O  O   . HOH I .  ? 0.6015 0.5041 0.5320 0.0916  0.0164  0.0409  34 HOH B O   
1061 O  O   . HOH I .  ? 0.6149 0.6010 0.5520 0.0791  0.0398  0.0785  37 HOH B O   
1062 O  O   . HOH I .  ? 0.6688 0.6032 0.5546 0.0524  0.0386  0.0398  38 HOH B O   
1063 O  O   . HOH J .  ? 0.5418 0.5529 0.5614 -0.0103 -0.1105 -0.0017 34 HOH C O   
1064 O  O   . HOH J .  ? 0.2915 0.2983 0.3390 -0.0163 -0.0855 0.0120  35 HOH C O   
1065 O  O   . HOH J .  ? 0.4662 0.4997 0.6228 -0.0034 -0.0494 0.0318  36 HOH C O   
1066 O  O   . HOH J .  ? 0.5035 0.4383 0.5630 0.0157  -0.0378 0.0438  37 HOH C O   
1067 O  O   . HOH J .  ? 0.5227 0.4964 0.5630 0.0063  -0.0398 -0.0033 38 HOH C O   
1068 O  O   . HOH J .  ? 0.6737 0.5544 0.6581 -0.0224 0.0069  -0.0036 39 HOH C O   
1069 O  O   . HOH J .  ? 0.5431 0.4114 0.4775 0.0116  -0.0221 0.0042  40 HOH C O   
1070 O  O   . HOH J .  ? 0.6281 0.6330 0.6473 0.0083  -0.1130 0.0067  41 HOH C O   
1071 O  O   . HOH J .  ? 0.5474 0.5667 0.6350 -0.0146 -0.0749 0.0191  42 HOH C O   
1072 O  O   . HOH J .  ? 0.3400 0.3299 0.4167 0.0177  -0.0290 -0.0033 43 HOH C O   
1073 O  O   . HOH K .  ? 0.5819 0.6505 0.5911 0.0717  0.0158  0.0272  33 HOH D O   
1074 O  O   . HOH K .  ? 0.3381 0.3590 0.4376 0.0159  -0.0330 0.0794  34 HOH D O   
1075 O  O   . HOH K .  ? 0.4170 0.4248 0.5339 0.0341  -0.0162 0.0632  35 HOH D O   
1076 O  O   . HOH K .  ? 0.7345 0.7508 0.6828 0.0393  -0.0289 -0.0159 36 HOH D O   
1077 O  O   . HOH K .  ? 0.5759 0.5994 0.6724 -0.0089 -0.0686 0.1295  37 HOH D O   
1078 O  O   . HOH K .  ? 0.6180 0.6819 0.7553 0.0014  -0.0433 0.1366  38 HOH D O   
1079 O  O   . HOH K .  ? 0.4005 0.3880 0.4144 0.0309  -0.0490 0.0540  39 HOH D O   
1080 O  O   . HOH K .  ? 0.4723 0.5009 0.5946 0.0235  -0.0217 0.0842  40 HOH D O   
1081 O  O   . HOH K .  ? 0.4852 0.6763 0.4407 0.0585  0.0119  0.0679  42 HOH D O   
1082 O  O   . HOH K .  ? 0.4547 0.4651 0.4825 0.0252  -0.0248 0.0194  43 HOH D O   
1083 O  O   . HOH K .  ? 0.5261 0.6005 0.4796 0.1131  0.0274  -0.0018 44 HOH D O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  PHE 2  2  2  PHE PHE A . n 
A 1 3  THR 3  3  3  THR THR A . n 
A 1 4  CYS 4  4  4  CYS CYS A . n 
A 1 5  HIS 5  5  5  HIS HIS A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  ARG 7  7  7  ARG ARG A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 TYR 11 11 11 TYR TYR A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 THR 19 19 19 THR THR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 THR 21 21 21 THR THR A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 MET 23 23 23 MET MET A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 ILE 25 25 25 ILE ILE A . n 
A 1 26 ASN 26 26 26 ASN ASN A . n 
A 1 27 TRP 27 27 27 TRP TRP A . n 
A 1 28 ARG 28 28 28 ARG ARG A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 CYS 30 30 30 CYS CYS A . n 
A 1 31 CYS 31 31 31 CYS CYS A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
B 1 1  ALA 1  1  1  ALA ALA B . n 
B 1 2  PHE 2  2  2  PHE PHE B . n 
B 1 3  THR 3  3  3  THR THR B . n 
B 1 4  CYS 4  4  4  CYS CYS B . n 
B 1 5  HIS 5  5  5  HIS HIS B . n 
B 1 6  CYS 6  6  6  CYS CYS B . n 
B 1 7  ARG 7  7  7  ARG ARG B . n 
B 1 8  ARG 8  8  8  ARG ARG B . n 
B 1 9  SER 9  9  9  SER SER B . n 
B 1 10 CYS 10 10 10 CYS CYS B . n 
B 1 11 TYR 11 11 11 TYR TYR B . n 
B 1 12 SER 12 12 12 SER SER B . n 
B 1 13 THR 13 13 13 THR THR B . n 
B 1 14 GLU 14 14 14 GLU GLU B . n 
B 1 15 TYR 15 15 15 TYR TYR B . n 
B 1 16 SER 16 16 16 SER SER B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 GLY 18 18 18 GLY GLY B . n 
B 1 19 THR 19 19 19 THR THR B . n 
B 1 20 CYS 20 20 20 CYS CYS B . n 
B 1 21 THR 21 21 21 THR THR B . n 
B 1 22 VAL 22 22 22 VAL VAL B . n 
B 1 23 MET 23 23 23 MET MET B . n 
B 1 24 GLY 24 24 24 GLY GLY B . n 
B 1 25 ILE 25 25 25 ILE ILE B . n 
B 1 26 ASN 26 26 26 ASN ASN B . n 
B 1 27 TRP 27 27 27 TRP TRP B . n 
B 1 28 ARG 28 28 28 ARG ARG B . n 
B 1 29 PHE 29 29 29 PHE PHE B . n 
B 1 30 CYS 30 30 30 CYS CYS B . n 
B 1 31 CYS 31 31 31 CYS CYS B . n 
B 1 32 LEU 32 32 32 LEU LEU B . n 
C 1 1  ALA 1  1  1  ALA ALA C . n 
C 1 2  PHE 2  2  2  PHE PHE C . n 
C 1 3  THR 3  3  3  THR THR C . n 
C 1 4  CYS 4  4  4  CYS CYS C . n 
C 1 5  HIS 5  5  5  HIS HIS C . n 
C 1 6  CYS 6  6  6  CYS CYS C . n 
C 1 7  ARG 7  7  7  ARG ARG C . n 
C 1 8  ARG 8  8  8  ARG ARG C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 CYS 10 10 10 CYS CYS C . n 
C 1 11 TYR 11 11 11 TYR TYR C . n 
C 1 12 SER 12 12 12 SER SER C . n 
C 1 13 THR 13 13 13 THR THR C . n 
C 1 14 GLU 14 14 14 GLU GLU C . n 
C 1 15 TYR 15 15 15 TYR TYR C . n 
C 1 16 SER 16 16 16 SER SER C . n 
C 1 17 TYR 17 17 17 TYR TYR C . n 
C 1 18 GLY 18 18 18 GLY GLY C . n 
C 1 19 THR 19 19 19 THR THR C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 THR 21 21 21 THR THR C . n 
C 1 22 VAL 22 22 22 VAL VAL C . n 
C 1 23 MET 23 23 23 MET MET C . n 
C 1 24 GLY 24 24 24 GLY GLY C . n 
C 1 25 ILE 25 25 25 ILE ILE C . n 
C 1 26 ASN 26 26 26 ASN ASN C . n 
C 1 27 TRP 27 27 27 TRP TRP C . n 
C 1 28 ARG 28 28 28 ARG ARG C . n 
C 1 29 PHE 29 29 29 PHE PHE C . n 
C 1 30 CYS 30 30 30 CYS CYS C . n 
C 1 31 CYS 31 31 31 CYS CYS C . n 
C 1 32 LEU 32 32 32 LEU LEU C . n 
D 1 1  ALA 1  1  1  ALA ALA D . n 
D 1 2  PHE 2  2  2  PHE PHE D . n 
D 1 3  THR 3  3  3  THR THR D . n 
D 1 4  CYS 4  4  4  CYS CYS D . n 
D 1 5  HIS 5  5  5  HIS HIS D . n 
D 1 6  CYS 6  6  6  CYS CYS D . n 
D 1 7  ARG 7  7  7  ARG ARG D . n 
D 1 8  ARG 8  8  8  ARG ARG D . n 
D 1 9  SER 9  9  9  SER SER D . n 
D 1 10 CYS 10 10 10 CYS CYS D . n 
D 1 11 TYR 11 11 11 TYR TYR D . n 
D 1 12 SER 12 12 12 SER SER D . n 
D 1 13 THR 13 13 13 THR THR D . n 
D 1 14 GLU 14 14 14 GLU GLU D . n 
D 1 15 TYR 15 15 15 TYR TYR D . n 
D 1 16 SER 16 16 16 SER SER D . n 
D 1 17 TYR 17 17 17 TYR TYR D . n 
D 1 18 GLY 18 18 18 GLY GLY D . n 
D 1 19 THR 19 19 19 THR THR D . n 
D 1 20 CYS 20 20 20 CYS CYS D . n 
D 1 21 THR 21 21 21 THR THR D . n 
D 1 22 VAL 22 22 22 VAL VAL D . n 
D 1 23 MET 23 23 23 MET MET D . n 
D 1 24 GLY 24 24 24 GLY GLY D . n 
D 1 25 ILE 25 25 25 ILE ILE D . n 
D 1 26 ASN 26 26 26 ASN ASN D . n 
D 1 27 TRP 27 27 27 TRP TRP D . n 
D 1 28 ARG 28 28 28 ARG ARG D . n 
D 1 29 PHE 29 29 29 PHE PHE D . n 
D 1 30 CYS 30 30 30 CYS CYS D . n 
D 1 31 CYS 31 31 31 CYS CYS D . n 
D 1 32 LEU 32 32 32 LEU LEU D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 author_defined_assembly   ?    monomeric 1 
4 author_defined_assembly   ?    monomeric 1 
5 software_defined_assembly PISA dimeric   2 
6 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,H       
2 1 B,F,I       
3 1 C,G,J       
4 1 D,K         
5 1 A,B,E,F,H,I 
6 1 C,G,J       
6 2 D,K         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
5 'ABSA (A^2)' 770  ? 
5 MORE         -17  ? 
5 'SSA (A^2)'  5100 ? 
6 'ABSA (A^2)' 610  ? 
6 MORE         -16  ? 
6 'SSA (A^2)'  5100 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 1_565 x,y+1,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 32.6750000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-11 
2 'Structure model' 1 1 2012-09-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -14.2025 -6.5237 -5.8372  0.0918 0.0788 0.1305 0.0088  -0.0488 0.0039  0.6245 2.3162 0.3755 0.6643 
-0.3728 -0.5476 -0.0345 0.0566 -0.1277 0.0594  0.0080  0.0391  -0.0313 -0.0971 0.0264  
'X-RAY DIFFRACTION' 2 ? refined -17.8555 9.6511  -16.2589 0.1427 0.0926 0.0992 0.1075  0.0458  0.0437  1.0281 1.9313 1.7353 1.3610 
-0.2522 -0.7708 0.0793  0.0984 -0.1252 0.0298  0.0962  -0.1388 0.1070  -0.0340 -0.1756 
'X-RAY DIFFRACTION' 3 ? refined -31.0067 11.4145 -5.9499  0.0695 0.0815 0.1157 -0.0105 -0.0805 -0.0014 0.4538 2.4285 1.4974 0.6111 
-0.7211 -0.2257 -0.0183 0.0350 -0.0252 -0.0717 -0.0403 0.0518  0.0157  -0.1086 0.0586  
'X-RAY DIFFRACTION' 4 ? refined -34.6746 -6.2572 -16.9398 0.0865 0.1245 0.0996 0.0364  -0.0127 0.0370  1.9801 1.1509 2.2731 
-0.6285 1.1790  -1.5166 -0.0111 0.1973 -0.0566 -0.0518 -0.0589 -0.1373 -0.0007 -0.0300 0.0700  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 1  ? ? A 32 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 34 ? ? A 48 ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 B 1  ? ? B 32 ? ? ? ? 
'X-RAY DIFFRACTION' 4 2 B 34 ? ? B 38 ? ? ? ? 
'X-RAY DIFFRACTION' 5 3 C 1  ? ? C 32 ? ? ? ? 
'X-RAY DIFFRACTION' 6 3 C 34 ? ? C 43 ? ? ? ? 
'X-RAY DIFFRACTION' 7 4 D 1  ? ? D 32 ? ? ? ? 
'X-RAY DIFFRACTION' 8 4 D 33 ? ? D 42 ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.10 'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 HKL-2000    .    ?               ?       ?                    ?                        'data collection' ? ?          ? 
5 SCALEPACK   .    ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
6 PHASER      .    ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CL 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    CL 
_pdbx_validate_symm_contact.auth_seq_id_1     33 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     41 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_645 
_pdbx_validate_symm_contact.dist              2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                89.49 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            -10.71 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 GLYCEROL       GOL 
4 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 CL  1  33 33 CL  CL  A . 
F 2 CL  1  33 33 CL  CL  B . 
G 3 GOL 1  33 33 GOL GOL C . 
H 4 HOH 1  34 34 HOH HOH A . 
H 4 HOH 2  35 35 HOH HOH A . 
H 4 HOH 3  36 36 HOH HOH A . 
H 4 HOH 4  37 37 HOH HOH A . 
H 4 HOH 5  38 38 HOH HOH A . 
H 4 HOH 6  39 39 HOH HOH A . 
H 4 HOH 7  40 40 HOH HOH A . 
H 4 HOH 8  41 41 HOH HOH A . 
H 4 HOH 9  42 42 HOH HOH A . 
H 4 HOH 10 43 43 HOH HOH A . 
H 4 HOH 11 44 44 HOH HOH A . 
H 4 HOH 12 45 45 HOH HOH A . 
H 4 HOH 13 46 46 HOH HOH A . 
H 4 HOH 14 47 47 HOH HOH A . 
H 4 HOH 15 48 48 HOH HOH A . 
I 4 HOH 1  34 34 HOH HOH B . 
I 4 HOH 2  37 37 HOH HOH B . 
I 4 HOH 3  38 38 HOH HOH B . 
J 4 HOH 1  34 34 HOH HOH C . 
J 4 HOH 2  35 35 HOH HOH C . 
J 4 HOH 3  36 36 HOH HOH C . 
J 4 HOH 4  37 37 HOH HOH C . 
J 4 HOH 5  38 38 HOH HOH C . 
J 4 HOH 6  39 39 HOH HOH C . 
J 4 HOH 7  40 40 HOH HOH C . 
J 4 HOH 8  41 41 HOH HOH C . 
J 4 HOH 9  42 42 HOH HOH C . 
J 4 HOH 10 43 43 HOH HOH C . 
K 4 HOH 1  33 33 HOH HOH D . 
K 4 HOH 2  34 34 HOH HOH D . 
K 4 HOH 3  35 35 HOH HOH D . 
K 4 HOH 4  36 36 HOH HOH D . 
K 4 HOH 5  37 37 HOH HOH D . 
K 4 HOH 6  38 38 HOH HOH D . 
K 4 HOH 7  39 39 HOH HOH D . 
K 4 HOH 8  40 40 HOH HOH D . 
K 4 HOH 9  42 42 HOH HOH D . 
K 4 HOH 10 43 43 HOH HOH D . 
K 4 HOH 11 44 44 HOH HOH D . 
#