data_3QZ7
# 
_entry.id   3QZ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3QZ7         
NDB   NA1012       
RCSB  RCSB064288   
WWPDB D_1000064288 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3QZ8 
_pdbx_database_related.details        'TT-4 ternary complex of Dpo4' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3QZ7 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pata, J.D.'   1 
'Wu, Y.'       2 
'Wilson, R.C.' 3 
# 
_citation.id                        primary 
_citation.title                     
'The y-family DNA polymerase dpo4 uses a template slippage mechanism to create single-base deletions.' 
_citation.journal_abbrev            J.Bacteriol. 
_citation.journal_volume            193 
_citation.page_first                2630 
_citation.page_last                 2636 
_citation.year                      2011 
_citation.journal_id_ASTM           JOBAAY 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9193 
_citation.journal_id_CSD            0767 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21421759 
_citation.pdbx_database_id_DOI      10.1128/JB.00012-11 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, Y.'       1 
primary 'Wilson, R.C.' 2 
primary 'Pata, J.D.'   3 
# 
_cell.entry_id           3QZ7 
_cell.length_a           98.708 
_cell.length_b           102.461 
_cell.length_c           52.743 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3QZ7 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                 41200.852 1  2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*GP*GP*CP*AP*CP*TP*GP*AP*TP*CP*GP*GP*G)-3'"                   4032.622  1  ?       ? ? 'Primer DNA strand' 
3 polymer     syn "5'-D(*TP*TP*AP*CP*GP*CP*CP*TP*CP*GP*AP*TP*CP*AP*GP*TP*GP*CP*C)-3'" 5756.723  1  ?       ? ? 
'Template DNA strand' 
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                  467.157   1  ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                       40.078    3  ?       ? ? ? 
6 water       nat water                                                               18.015    70 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dpo4, Y-family DNA polymerase, Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDTGGHHHHHH
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDTGGHHHHHH
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DA)(DT)(DC)(DG)(DG)(DG)' GGCACTGATCGGG P ? 
3 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DC)(DG)(DC)(DC)(DT)(DC)(DG)(DA)(DT)(DC)(DA)(DG)(DT)(DG)(DC)(DC)' TTACGCCTCGATCAGTGCC 
T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
1 342 GLU n 
1 343 ALA n 
1 344 ILE n 
1 345 GLY n 
1 346 LEU n 
1 347 ASP n 
1 348 LYS n 
1 349 PHE n 
1 350 PHE n 
1 351 ASP n 
1 352 THR n 
1 353 GLY n 
1 354 GLY n 
1 355 HIS n 
1 356 HIS n 
1 357 HIS n 
1 358 HIS n 
1 359 HIS n 
1 360 HIS n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DA  n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
2 12  DG  n 
2 13  DG  n 
3 1   DT  n 
3 2   DT  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DC  n 
3 7   DC  n 
3 8   DT  n 
3 9   DC  n 
3 10  DG  n 
3 11  DA  n 
3 12  DT  n 
3 13  DC  n 
3 14  DA  n 
3 15  DG  n 
3 16  DT  n 
3 17  DG  n 
3 18  DC  n 
3 19  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BLR(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pKKT7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 1 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
1 ? 
2 PDB 3QZ7        3QZ7   2 GGCACTGATCGGG ? ? 
3 PDB 3QZ7        3QZ7   3 TTACGCCTCGATCAGTGCC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3QZ7 A 1 ? 352 ? Q97W02 1 ? 352 ? 1 352 
2 2 3QZ7 P 1 ? 13  ? 3QZ7   1 ? 13  ? 1 13  
3 3 3QZ7 T 1 ? 19  ? 3QZ7   1 ? 19  ? 1 19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3QZ7 GLY A 353 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 353 1 
1 3QZ7 GLY A 354 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 354 2 
1 3QZ7 HIS A 355 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 355 3 
1 3QZ7 HIS A 356 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 356 4 
1 3QZ7 HIS A 357 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 357 5 
1 3QZ7 HIS A 358 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 358 6 
1 3QZ7 HIS A 359 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 359 7 
1 3QZ7 HIS A 360 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 360 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3QZ7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   52.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.6 
_exptl_crystal_grow.pdbx_details    
'18% PEG3350, 100 mM HEPES, 100 mM calcium acetate, 2.5% glycerol, pH 6.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-08-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0809 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             1.0809 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3QZ7 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.998 
_reflns.number_obs                   33358 
_reflns.number_all                   37103 
_reflns.percent_possible_obs         89.9 
_reflns.pdbx_Rmerge_I_obs            0.050 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        32.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   31.9 
_reflns_shell.Rmerge_I_obs           0.346 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      586 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3QZ7 
_refine.ls_number_reflns_obs                     33327 
_refine.ls_number_reflns_all                     33327 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.14 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.539 
_refine.ls_d_res_high                            1.998 
_refine.ls_percent_reflns_obs                    90.04 
_refine.ls_R_factor_obs                          0.2290 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2270 
_refine.ls_R_factor_R_free                       0.2668 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.89 
_refine.ls_number_reflns_R_free                  1629 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            3.8382 
_refine.aniso_B[2][2]                            -0.1002 
_refine.aniso_B[3][3]                            -3.7380 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.440 
_refine.solvent_model_param_bsol                 48.986 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.89 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ANISOTROPIC 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 27.44 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2743 
_refine_hist.pdbx_number_atoms_nucleic_acid   572 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             70 
_refine_hist.number_atoms_total               3416 
_refine_hist.d_res_high                       1.998 
_refine_hist.d_res_low                        25.539 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 3461 'X-RAY DIFFRACTION' ? 
f_angle_d          1.461  ? ? 4783 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.165 ? ? 1373 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.156  ? ? 544  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 501  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.9981 2.0569  1101 0.3541 38.00  0.3237 . . 50  . . . . 'X-RAY DIFFRACTION' 
. 2.0569 2.1232  1898 0.3170 65.00  0.3333 . . 81  . . . . 'X-RAY DIFFRACTION' 
. 2.1232 2.1991  2657 0.2923 91.00  0.3082 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.1991 2.2871  2810 0.2647 99.00  0.3157 . . 165 . . . . 'X-RAY DIFFRACTION' 
. 2.2871 2.3911  2882 0.2507 99.00  0.3050 . . 153 . . . . 'X-RAY DIFFRACTION' 
. 2.3911 2.5170  2884 0.2453 100.00 0.2808 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 2.5170 2.6746  2919 0.2512 100.00 0.2927 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 2.6746 2.8808  2896 0.2563 100.00 0.3125 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 2.8808 3.1702  2917 0.2424 100.00 0.2709 . . 165 . . . . 'X-RAY DIFFRACTION' 
. 3.1702 3.6279  2967 0.2219 100.00 0.2573 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.6279 4.5665  2969 0.1962 100.00 0.2584 . . 153 . . . . 'X-RAY DIFFRACTION' 
. 4.5665 25.5412 2798 0.2166 89.00  0.2421 . . 151 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3QZ7 
_struct.title                     'T-3 ternary complex of Dpo4' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3QZ7 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'lesion bypass, single-base deletion, -1 frameshift, REPLICATION-DNA complex, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? LYS A 52  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 60  ? LEU A 68  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? ARG A 93  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P6  6  GLU A 94  ? SER A 96  ? GLU A 94  SER A 96  5 ? 3  
HELX_P HELX_P7  7  SER A 112 ? VAL A 115 ? SER A 112 VAL A 115 5 ? 4  
HELX_P HELX_P8  8  ASP A 117 ? LYS A 137 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P9  9  ASN A 147 ? LYS A 159 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P10 10 ASP A 167 ? LEU A 178 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P11 11 ASP A 179 ? VAL A 183 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P12 12 GLY A 187 ? LYS A 196 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P13 13 LYS A 201 ? SER A 207 ? LYS A 201 SER A 207 5 ? 7  
HELX_P HELX_P14 14 GLU A 209 ? GLY A 218 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P15 15 GLY A 218 ? ARG A 230 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P16 16 ASN A 257 ? ASP A 277 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P17 17 SER A 307 ? GLU A 325 ? SER A 307 GLU A 325 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D DCP .   O2A ? ? ? 1_555 E CA  .  CA ? ? A DCP 361 A CA  362 1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc2  metalc ? ? F CA  .   CA  ? ? ? 1_555 H HOH .  O  ? ? A CA  363 A HOH 396 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc3  metalc ? ? A ASP 7   OD1 ? ? ? 1_555 E CA  .  CA ? ? A ASP 7   A CA  362 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc4  metalc ? ? A PHE 8   O   ? ? ? 1_555 E CA  .  CA ? ? A PHE 8   A CA  362 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc5  metalc ? ? D DCP .   O1B ? ? ? 1_555 E CA  .  CA ? ? A DCP 361 A CA  362 1_555 ? ? ? ? ? ? ?            2.262 ? 
metalc6  metalc ? ? A ASP 105 OD2 ? ? ? 1_555 E CA  .  CA ? ? A ASP 105 A CA  362 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc7  metalc ? ? D DCP .   O1G ? ? ? 1_555 E CA  .  CA ? ? A DCP 361 A CA  362 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc8  metalc ? ? A GLU 106 OE1 ? ? ? 1_555 F CA  .  CA ? ? A GLU 106 A CA  363 1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc9  metalc ? ? D DCP .   O2A ? ? ? 1_555 F CA  .  CA ? ? A DCP 361 A CA  363 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc10 metalc ? ? A ALA 181 O   ? ? ? 1_555 G CA  .  CA ? ? A ALA 181 A CA  364 1_555 ? ? ? ? ? ? ?            2.484 ? 
metalc11 metalc ? ? A ASP 105 OD1 ? ? ? 1_555 F CA  .  CA ? ? A ASP 105 A CA  363 1_555 ? ? ? ? ? ? ?            2.605 ? 
metalc12 metalc ? ? G CA  .   CA  ? ? ? 1_555 H HOH .  O  ? ? A CA  364 A HOH 404 1_555 ? ? ? ? ? ? ?            2.962 ? 
metalc13 metalc ? ? A ASP 7   OD2 ? ? ? 1_555 F CA  .  CA ? ? A ASP 7   A CA  363 1_555 ? ? ? ? ? ? ?            3.003 ? 
metalc14 metalc ? ? A ASP 105 OD2 ? ? ? 1_555 F CA  .  CA ? ? A ASP 105 A CA  363 1_555 ? ? ? ? ? ? ?            3.111 ? 
hydrog1  hydrog ? ? B DG  1   N1  ? ? ? 1_555 C DC  19 N3 ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1   N2  ? ? ? 1_555 C DC  19 O2 ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1   O6  ? ? ? 1_555 C DC  19 N4 ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1  ? ? ? 1_555 C DC  18 N3 ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2  ? ? ? 1_555 C DC  18 O2 ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6  ? ? ? 1_555 C DC  18 N4 ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  3   N3  ? ? ? 1_555 C DG  17 N1 ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG  17 O6 ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  3   O2  ? ? ? 1_555 C DG  17 N2 ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4   N1  ? ? ? 1_555 C DT  16 N3 ? ? P DA  4   T DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  4   N6  ? ? ? 1_555 C DT  16 O4 ? ? P DA  4   T DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5   N3  ? ? ? 1_555 C DG  15 N1 ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5   N4  ? ? ? 1_555 C DG  15 O6 ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  5   O2  ? ? ? 1_555 C DG  15 N2 ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  14 N1 ? ? P DT  6   T DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  14 N6 ? ? P DT  6   T DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC  13 N3 ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC  13 O2 ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC  13 N4 ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT  12 N3 ? ? P DA  8   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT  12 O4 ? ? P DA  8   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9   N3  ? ? ? 1_555 C DA  11 N1 ? ? P DT  9   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9   O4  ? ? ? 1_555 C DA  11 N6 ? ? P DT  9   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10  N3  ? ? ? 1_555 C DG  10 N1 ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10  N4  ? ? ? 1_555 C DG  10 O6 ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  10  O2  ? ? ? 1_555 C DG  10 N2 ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  11  N1  ? ? ? 1_555 C DC  9  N3 ? ? P DG  11  T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  11  N2  ? ? ? 1_555 C DC  9  O2 ? ? P DG  11  T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  11  O6  ? ? ? 1_555 C DC  9  N4 ? ? P DG  11  T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC  7  N3 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC  7  O2 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC  7  N4 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  13  N1  ? ? ? 1_555 C DC  6  N3 ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DG  13  N2  ? ? ? 1_555 C DC  6  O2 ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DG  13  O6  ? ? ? 1_555 C DC  6  N4 ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       12.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE A 99  SER A 103 
A 2 GLU A 106 ? ASP A 110 ? GLU A 106 ASP A 110 
A 3 VAL A 3   ? PHE A 8   ? VAL A 3   PHE A 8   
A 4 VAL A 140 ? SER A 145 ? VAL A 140 SER A 145 
A 5 ILE A 163 ? VAL A 165 ? ILE A 163 VAL A 165 
B 1 GLY A 41  ? ALA A 46  ? GLY A 41  ALA A 46  
B 2 VAL A 28  ? PHE A 33  ? VAL A 28  PHE A 33  
B 3 VAL A 72  ? PRO A 75  ? VAL A 72  PRO A 75  
C 1 SER A 244 ? SER A 255 ? SER A 244 SER A 255 
C 2 ILE A 330 ? PHE A 340 ? ILE A 330 PHE A 340 
C 3 PRO A 281 ? THR A 290 ? PRO A 281 THR A 290 
C 4 ILE A 295 ? THR A 301 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100 O TYR A 108 ? O TYR A 108 
A 2 3 O LEU A 109 ? O LEU A 109 N LEU A 4   ? N LEU A 4   
A 3 4 N PHE A 5   ? N PHE A 5   O GLY A 143 ? O GLY A 143 
A 4 5 N ILE A 144 ? N ILE A 144 O LYS A 164 ? O LYS A 164 
B 1 2 O ALA A 42  ? O ALA A 42  N VAL A 32  ? N VAL A 32  
B 2 3 N CYS A 31  ? N CYS A 31  O LEU A 74  ? O LEU A 74  
C 1 2 N ILE A 245 ? N ILE A 245 O PHE A 337 ? O PHE A 337 
C 2 3 O ARG A 331 ? O ARG A 331 N VAL A 289 ? N VAL A 289 
C 3 4 N ALA A 288 ? N ALA A 288 O VAL A 296 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DCP A 361' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 362'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 363'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 364'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 ASP A 7   ? ASP A 7   . ? 1_555 ? 
2  AC1 18 PHE A 8   ? PHE A 8   . ? 1_555 ? 
3  AC1 18 ASP A 9   ? ASP A 9   . ? 1_555 ? 
4  AC1 18 TYR A 10  ? TYR A 10  . ? 1_555 ? 
5  AC1 18 PHE A 11  ? PHE A 11  . ? 1_555 ? 
6  AC1 18 TYR A 12  ? TYR A 12  . ? 1_555 ? 
7  AC1 18 ALA A 44  ? ALA A 44  . ? 1_555 ? 
8  AC1 18 THR A 45  ? THR A 45  . ? 1_555 ? 
9  AC1 18 TYR A 48  ? TYR A 48  . ? 1_555 ? 
10 AC1 18 ARG A 51  ? ARG A 51  . ? 1_555 ? 
11 AC1 18 ASP A 105 ? ASP A 105 . ? 1_555 ? 
12 AC1 18 LYS A 159 ? LYS A 159 . ? 1_555 ? 
13 AC1 18 CA  E .   ? CA  A 362 . ? 1_555 ? 
14 AC1 18 CA  F .   ? CA  A 363 . ? 1_555 ? 
15 AC1 18 HOH H .   ? HOH A 387 . ? 1_555 ? 
16 AC1 18 HOH H .   ? HOH A 394 . ? 1_555 ? 
17 AC1 18 DG  B 13  ? DG  P 13  . ? 1_555 ? 
18 AC1 18 DG  C 5   ? DG  T 5   . ? 1_555 ? 
19 AC2 5  ASP A 7   ? ASP A 7   . ? 1_555 ? 
20 AC2 5  PHE A 8   ? PHE A 8   . ? 1_555 ? 
21 AC2 5  ASP A 105 ? ASP A 105 . ? 1_555 ? 
22 AC2 5  DCP D .   ? DCP A 361 . ? 1_555 ? 
23 AC2 5  CA  F .   ? CA  A 363 . ? 1_555 ? 
24 AC3 6  ASP A 7   ? ASP A 7   . ? 1_555 ? 
25 AC3 6  ASP A 105 ? ASP A 105 . ? 1_555 ? 
26 AC3 6  GLU A 106 ? GLU A 106 . ? 1_555 ? 
27 AC3 6  DCP D .   ? DCP A 361 . ? 1_555 ? 
28 AC3 6  CA  E .   ? CA  A 362 . ? 1_555 ? 
29 AC3 6  HOH H .   ? HOH A 396 . ? 1_555 ? 
30 AC4 2  ALA A 181 ? ALA A 181 . ? 1_555 ? 
31 AC4 2  HOH H .   ? HOH A 404 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3QZ7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3QZ7 
_atom_sites.fract_transf_matrix[1][1]   0.010131 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009760 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018960 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . MET A 1 1   ? 47.006  20.629  14.947  1.00 60.77  ? 1   MET A N      1 
ATOM   2    C  CA     . MET A 1 1   ? 47.207  19.155  15.009  1.00 71.64  ? 1   MET A CA     1 
ATOM   3    C  C      . MET A 1 1   ? 46.764  18.478  13.715  1.00 65.16  ? 1   MET A C      1 
ATOM   4    O  O      . MET A 1 1   ? 46.655  19.118  12.673  1.00 75.35  ? 1   MET A O      1 
ATOM   5    C  CB     . MET A 1 1   ? 46.406  18.584  16.172  1.00 71.19  ? 1   MET A CB     1 
ATOM   6    C  CG     . MET A 1 1   ? 44.911  18.720  16.028  1.00 67.62  ? 1   MET A CG     1 
ATOM   7    S  SD     . MET A 1 1   ? 44.233  20.064  17.019  1.00 91.09  ? 1   MET A SD     1 
ATOM   8    C  CE     . MET A 1 1   ? 42.582  19.428  17.286  1.00 60.55  ? 1   MET A CE     1 
ATOM   9    H  H1     . MET A 1 1   ? 47.178  21.012  15.811  1.00 72.92  ? 1   MET A H1     1 
ATOM   10   H  H2     . MET A 1 1   ? 47.610  21.007  14.304  1.00 72.92  ? 1   MET A H2     1 
ATOM   11   H  H3     . MET A 1 1   ? 46.102  20.818  14.687  1.00 72.92  ? 1   MET A H3     1 
ATOM   12   H  HA     . MET A 1 1   ? 48.155  18.964  15.165  1.00 85.97  ? 1   MET A HA     1 
ATOM   13   H  HB2    . MET A 1 1   ? 46.609  17.639  16.253  1.00 85.43  ? 1   MET A HB2    1 
ATOM   14   H  HB3    . MET A 1 1   ? 46.667  19.045  16.984  1.00 85.43  ? 1   MET A HB3    1 
ATOM   15   H  HG2    . MET A 1 1   ? 44.697  18.896  15.098  1.00 81.14  ? 1   MET A HG2    1 
ATOM   16   H  HG3    . MET A 1 1   ? 44.489  17.895  16.315  1.00 81.14  ? 1   MET A HG3    1 
ATOM   17   H  HE1    . MET A 1 1   ? 42.087  20.057  17.816  1.00 72.66  ? 1   MET A HE1    1 
ATOM   18   H  HE2    . MET A 1 1   ? 42.154  19.307  16.435  1.00 72.66  ? 1   MET A HE2    1 
ATOM   19   H  HE3    . MET A 1 1   ? 42.642  18.587  17.745  1.00 72.66  ? 1   MET A HE3    1 
ATOM   20   N  N      . ILE A 1 2   ? 46.515  17.175  13.804  1.00 68.23  ? 2   ILE A N      1 
ATOM   21   C  CA     . ILE A 1 2   ? 45.938  16.410  12.707  1.00 67.09  ? 2   ILE A CA     1 
ATOM   22   C  C      . ILE A 1 2   ? 44.637  15.773  13.198  1.00 58.08  ? 2   ILE A C      1 
ATOM   23   O  O      . ILE A 1 2   ? 44.637  15.009  14.167  1.00 57.67  ? 2   ILE A O      1 
ATOM   24   C  CB     . ILE A 1 2   ? 46.909  15.318  12.213  1.00 66.86  ? 2   ILE A CB     1 
ATOM   25   C  CG1    . ILE A 1 2   ? 48.137  15.956  11.560  1.00 72.69  ? 2   ILE A CG1    1 
ATOM   26   C  CG2    . ILE A 1 2   ? 46.226  14.385  11.215  1.00 60.24  ? 2   ILE A CG2    1 
ATOM   27   C  CD1    . ILE A 1 2   ? 49.259  14.974  11.305  1.00 73.25  ? 2   ILE A CD1    1 
ATOM   28   H  H      . ILE A 1 2   ? 46.677  16.703  14.504  1.00 81.88  ? 2   ILE A H      1 
ATOM   29   H  HA     . ILE A 1 2   ? 45.732  17.008  11.959  1.00 80.50  ? 2   ILE A HA     1 
ATOM   30   H  HB     . ILE A 1 2   ? 47.200  14.795  12.976  1.00 80.23  ? 2   ILE A HB     1 
ATOM   31   H  HG12   . ILE A 1 2   ? 47.876  16.339  10.708  1.00 87.23  ? 2   ILE A HG12   1 
ATOM   32   H  HG13   . ILE A 1 2   ? 48.477  16.652  12.144  1.00 87.23  ? 2   ILE A HG13   1 
ATOM   33   H  HG21   . ILE A 1 2   ? 46.855  13.720  10.929  1.00 72.29  ? 2   ILE A HG21   1 
ATOM   34   H  HG22   . ILE A 1 2   ? 45.476  13.965  11.644  1.00 72.29  ? 2   ILE A HG22   1 
ATOM   35   H  HG23   . ILE A 1 2   ? 45.927  14.900  10.462  1.00 72.29  ? 2   ILE A HG23   1 
ATOM   36   H  HD11   . ILE A 1 2   ? 49.993  15.438  10.897  1.00 87.89  ? 2   ILE A HD11   1 
ATOM   37   H  HD12   . ILE A 1 2   ? 49.536  14.592  12.142  1.00 87.89  ? 2   ILE A HD12   1 
ATOM   38   H  HD13   . ILE A 1 2   ? 48.941  14.283  10.719  1.00 87.89  ? 2   ILE A HD13   1 
ATOM   39   N  N      . VAL A 1 3   ? 43.532  16.099  12.531  1.00 53.68  ? 3   VAL A N      1 
ATOM   40   C  CA     . VAL A 1 3   ? 42.214  15.611  12.936  1.00 56.97  ? 3   VAL A CA     1 
ATOM   41   C  C      . VAL A 1 3   ? 41.618  14.705  11.862  1.00 52.83  ? 3   VAL A C      1 
ATOM   42   O  O      . VAL A 1 3   ? 41.604  15.056  10.684  1.00 46.77  ? 3   VAL A O      1 
ATOM   43   C  CB     . VAL A 1 3   ? 41.240  16.775  13.217  1.00 55.56  ? 3   VAL A CB     1 
ATOM   44   C  CG1    . VAL A 1 3   ? 39.880  16.252  13.699  1.00 44.56  ? 3   VAL A CG1    1 
ATOM   45   C  CG2    . VAL A 1 3   ? 41.835  17.716  14.257  1.00 59.85  ? 3   VAL A CG2    1 
ATOM   46   H  H      . VAL A 1 3   ? 43.518  16.605  11.836  1.00 64.42  ? 3   VAL A H      1 
ATOM   47   H  HA     . VAL A 1 3   ? 42.306  15.086  13.759  1.00 68.36  ? 3   VAL A HA     1 
ATOM   48   H  HB     . VAL A 1 3   ? 41.098  17.283  12.391  1.00 66.68  ? 3   VAL A HB     1 
ATOM   49   H  HG11   . VAL A 1 3   ? 39.299  16.998  13.865  1.00 53.48  ? 3   VAL A HG11   1 
ATOM   50   H  HG12   . VAL A 1 3   ? 39.503  15.689  13.019  1.00 53.48  ? 3   VAL A HG12   1 
ATOM   51   H  HG13   . VAL A 1 3   ? 40.007  15.750  14.508  1.00 53.48  ? 3   VAL A HG13   1 
ATOM   52   H  HG21   . VAL A 1 3   ? 41.217  18.433  14.419  1.00 71.82  ? 3   VAL A HG21   1 
ATOM   53   H  HG22   . VAL A 1 3   ? 41.990  17.227  15.069  1.00 71.82  ? 3   VAL A HG22   1 
ATOM   54   H  HG23   . VAL A 1 3   ? 42.664  18.067  13.923  1.00 71.82  ? 3   VAL A HG23   1 
ATOM   55   N  N      . LEU A 1 4   ? 41.145  13.536  12.290  1.00 47.55  ? 4   LEU A N      1 
ATOM   56   C  CA     . LEU A 1 4   ? 40.502  12.564  11.415  1.00 52.05  ? 4   LEU A CA     1 
ATOM   57   C  C      . LEU A 1 4   ? 39.029  12.402  11.804  1.00 51.06  ? 4   LEU A C      1 
ATOM   58   O  O      . LEU A 1 4   ? 38.715  11.909  12.881  1.00 50.51  ? 4   LEU A O      1 
ATOM   59   C  CB     . LEU A 1 4   ? 41.211  11.211  11.511  1.00 48.64  ? 4   LEU A CB     1 
ATOM   60   C  CG     . LEU A 1 4   ? 40.706  10.124  10.548  1.00 58.85  ? 4   LEU A CG     1 
ATOM   61   C  CD1    . LEU A 1 4   ? 41.832  9.194   10.131  1.00 61.42  ? 4   LEU A CD1    1 
ATOM   62   C  CD2    . LEU A 1 4   ? 39.574  9.334   11.184  1.00 52.18  ? 4   LEU A CD2    1 
ATOM   63   H  H      . LEU A 1 4   ? 41.187  13.278  13.110  1.00 57.06  ? 4   LEU A H      1 
ATOM   64   H  HA     . LEU A 1 4   ? 40.548  12.876  10.487  1.00 62.46  ? 4   LEU A HA     1 
ATOM   65   H  HB2    . LEU A 1 4   ? 42.154  11.347  11.328  1.00 58.36  ? 4   LEU A HB2    1 
ATOM   66   H  HB3    . LEU A 1 4   ? 41.103  10.872  12.413  1.00 58.36  ? 4   LEU A HB3    1 
ATOM   67   H  HG     . LEU A 1 4   ? 40.360  10.550  9.748   1.00 70.62  ? 4   LEU A HG     1 
ATOM   68   H  HD11   . LEU A 1 4   ? 41.483  8.531   9.532   1.00 73.71  ? 4   LEU A HD11   1 
ATOM   69   H  HD12   . LEU A 1 4   ? 42.513  9.708   9.690   1.00 73.71  ? 4   LEU A HD12   1 
ATOM   70   H  HD13   . LEU A 1 4   ? 42.194  8.772   10.913  1.00 73.71  ? 4   LEU A HD13   1 
ATOM   71   H  HD21   . LEU A 1 4   ? 39.276  8.663   10.566  1.00 62.62  ? 4   LEU A HD21   1 
ATOM   72   H  HD22   . LEU A 1 4   ? 39.896  8.920   11.988  1.00 62.62  ? 4   LEU A HD22   1 
ATOM   73   H  HD23   . LEU A 1 4   ? 38.853  9.934   11.390  1.00 62.62  ? 4   LEU A HD23   1 
ATOM   74   N  N      . PHE A 1 5   ? 38.146  12.824  10.906  1.00 43.90  ? 5   PHE A N      1 
ATOM   75   C  CA     . PHE A 1 5   ? 36.697  12.796  11.094  1.00 45.30  ? 5   PHE A CA     1 
ATOM   76   C  C      . PHE A 1 5   ? 36.101  11.665  10.255  1.00 51.85  ? 5   PHE A C      1 
ATOM   77   O  O      . PHE A 1 5   ? 36.481  11.460  9.098   1.00 48.86  ? 5   PHE A O      1 
ATOM   78   C  CB     . PHE A 1 5   ? 36.124  14.142  10.646  1.00 40.41  ? 5   PHE A CB     1 
ATOM   79   C  CG     . PHE A 1 5   ? 34.607  14.215  10.614  1.00 47.40  ? 5   PHE A CG     1 
ATOM   80   C  CD1    . PHE A 1 5   ? 33.868  14.316  11.789  1.00 45.62  ? 5   PHE A CD1    1 
ATOM   81   C  CD2    . PHE A 1 5   ? 33.931  14.262  9.402   1.00 45.52  ? 5   PHE A CD2    1 
ATOM   82   C  CE1    . PHE A 1 5   ? 32.479  14.421  11.747  1.00 45.48  ? 5   PHE A CE1    1 
ATOM   83   C  CE2    . PHE A 1 5   ? 32.546  14.365  9.354   1.00 48.70  ? 5   PHE A CE2    1 
ATOM   84   C  CZ     . PHE A 1 5   ? 31.821  14.446  10.529  1.00 47.86  ? 5   PHE A CZ     1 
ATOM   85   H  H      . PHE A 1 5   ? 38.375  13.147  10.142  1.00 52.68  ? 5   PHE A H      1 
ATOM   86   H  HA     . PHE A 1 5   ? 36.479  12.648  12.038  1.00 54.35  ? 5   PHE A HA     1 
ATOM   87   H  HB2    . PHE A 1 5   ? 36.438  14.829  11.256  1.00 48.49  ? 5   PHE A HB2    1 
ATOM   88   H  HB3    . PHE A 1 5   ? 36.446  14.332  9.751   1.00 48.49  ? 5   PHE A HB3    1 
ATOM   89   H  HD1    . PHE A 1 5   ? 34.304  14.301  12.610  1.00 54.74  ? 5   PHE A HD1    1 
ATOM   90   H  HD2    . PHE A 1 5   ? 34.413  14.209  8.608   1.00 54.62  ? 5   PHE A HD2    1 
ATOM   91   H  HE1    . PHE A 1 5   ? 31.993  14.473  12.539  1.00 54.57  ? 5   PHE A HE1    1 
ATOM   92   H  HE2    . PHE A 1 5   ? 32.108  14.381  8.534   1.00 58.44  ? 5   PHE A HE2    1 
ATOM   93   H  HZ     . PHE A 1 5   ? 30.894  14.511  10.501  1.00 57.43  ? 5   PHE A HZ     1 
ATOM   94   N  N      . VAL A 1 6   ? 35.159  10.948  10.852  1.00 43.87  ? 6   VAL A N      1 
ATOM   95   C  CA     . VAL A 1 6   ? 34.540  9.780   10.255  1.00 49.56  ? 6   VAL A CA     1 
ATOM   96   C  C      . VAL A 1 6   ? 33.027  9.962   10.284  1.00 44.45  ? 6   VAL A C      1 
ATOM   97   O  O      . VAL A 1 6   ? 32.462  10.268  11.321  1.00 45.86  ? 6   VAL A O      1 
ATOM   98   C  CB     . VAL A 1 6   ? 34.893  8.520   11.058  1.00 51.22  ? 6   VAL A CB     1 
ATOM   99   C  CG1    . VAL A 1 6   ? 34.215  7.286   10.459  1.00 48.92  ? 6   VAL A CG1    1 
ATOM   100  C  CG2    . VAL A 1 6   ? 36.405  8.340   11.105  1.00 46.80  ? 6   VAL A CG2    1 
ATOM   101  H  H      . VAL A 1 6   ? 34.852  11.128  11.635  1.00 52.65  ? 6   VAL A H      1 
ATOM   102  H  HA     . VAL A 1 6   ? 34.838  9.671   9.328   1.00 59.47  ? 6   VAL A HA     1 
ATOM   103  H  HB     . VAL A 1 6   ? 34.572  8.626   11.978  1.00 61.46  ? 6   VAL A HB     1 
ATOM   104  H  HG11   . VAL A 1 6   ? 34.453  6.515   10.980  1.00 58.71  ? 6   VAL A HG11   1 
ATOM   105  H  HG12   . VAL A 1 6   ? 33.263  7.412   10.478  1.00 58.71  ? 6   VAL A HG12   1 
ATOM   106  H  HG13   . VAL A 1 6   ? 34.513  7.174   9.553   1.00 58.71  ? 6   VAL A HG13   1 
ATOM   107  H  HG21   . VAL A 1 6   ? 36.610  7.549   11.609  1.00 56.16  ? 6   VAL A HG21   1 
ATOM   108  H  HG22   . VAL A 1 6   ? 36.737  8.252   10.208  1.00 56.16  ? 6   VAL A HG22   1 
ATOM   109  H  HG23   . VAL A 1 6   ? 36.798  9.108   11.526  1.00 56.16  ? 6   VAL A HG23   1 
ATOM   110  N  N      . ASP A 1 7   ? 32.379  9.758   9.144   1.00 44.83  ? 7   ASP A N      1 
ATOM   111  C  CA     . ASP A 1 7   ? 30.946  9.972   9.009   1.00 40.16  ? 7   ASP A CA     1 
ATOM   112  C  C      . ASP A 1 7   ? 30.321  8.790   8.248   1.00 46.16  ? 7   ASP A C      1 
ATOM   113  O  O      . ASP A 1 7   ? 30.650  8.576   7.088   1.00 48.71  ? 7   ASP A O      1 
ATOM   114  C  CB     . ASP A 1 7   ? 30.704  11.274  8.240   1.00 41.35  ? 7   ASP A CB     1 
ATOM   115  C  CG     . ASP A 1 7   ? 29.232  11.620  8.129   1.00 53.09  ? 7   ASP A CG     1 
ATOM   116  O  OD1    . ASP A 1 7   ? 28.403  10.686  8.116   1.00 47.34  ? 7   ASP A OD1    1 
ATOM   117  O  OD2    . ASP A 1 7   ? 28.910  12.824  8.063   1.00 48.97  ? 7   ASP A OD2    1 
ATOM   118  H  H      . ASP A 1 7   ? 32.757  9.489   8.419   1.00 53.80  ? 7   ASP A H      1 
ATOM   119  H  HA     . ASP A 1 7   ? 30.531  10.040  9.894   1.00 48.19  ? 7   ASP A HA     1 
ATOM   120  H  HB2    . ASP A 1 7   ? 31.150  12.002  8.702   1.00 49.62  ? 7   ASP A HB2    1 
ATOM   121  H  HB3    . ASP A 1 7   ? 31.060  11.182  7.342   1.00 49.62  ? 7   ASP A HB3    1 
ATOM   122  N  N      . PHE A 1 8   ? 29.434  8.026   8.894   1.00 41.31  ? 8   PHE A N      1 
ATOM   123  C  CA     . PHE A 1 8   ? 28.902  6.794   8.301   1.00 41.34  ? 8   PHE A CA     1 
ATOM   124  C  C      . PHE A 1 8   ? 27.977  7.130   7.121   1.00 40.84  ? 8   PHE A C      1 
ATOM   125  O  O      . PHE A 1 8   ? 27.243  8.113   7.167   1.00 39.82  ? 8   PHE A O      1 
ATOM   126  C  CB     . PHE A 1 8   ? 28.139  5.955   9.343   1.00 38.06  ? 8   PHE A CB     1 
ATOM   127  C  CG     . PHE A 1 8   ? 28.896  5.695   10.635  1.00 39.12  ? 8   PHE A CG     1 
ATOM   128  C  CD1    . PHE A 1 8   ? 30.264  5.867   10.723  1.00 42.94  ? 8   PHE A CD1    1 
ATOM   129  C  CD2    . PHE A 1 8   ? 28.212  5.255   11.763  1.00 44.28  ? 8   PHE A CD2    1 
ATOM   130  C  CE1    . PHE A 1 8   ? 30.946  5.605   11.918  1.00 45.21  ? 8   PHE A CE1    1 
ATOM   131  C  CE2    . PHE A 1 8   ? 28.880  4.990   12.964  1.00 39.59  ? 8   PHE A CE2    1 
ATOM   132  C  CZ     . PHE A 1 8   ? 30.249  5.170   13.041  1.00 38.87  ? 8   PHE A CZ     1 
ATOM   133  H  H      . PHE A 1 8   ? 29.124  8.200   9.677   1.00 49.58  ? 8   PHE A H      1 
ATOM   134  H  HA     . PHE A 1 8   ? 29.646  6.255   7.961   1.00 49.61  ? 8   PHE A HA     1 
ATOM   135  H  HB2    . PHE A 1 8   ? 27.319  6.419   9.573   1.00 45.68  ? 8   PHE A HB2    1 
ATOM   136  H  HB3    . PHE A 1 8   ? 27.926  5.094   8.950   1.00 45.68  ? 8   PHE A HB3    1 
ATOM   137  H  HD1    . PHE A 1 8   ? 30.740  6.156   9.978   1.00 51.53  ? 8   PHE A HD1    1 
ATOM   138  H  HD2    . PHE A 1 8   ? 27.291  5.130   11.718  1.00 53.14  ? 8   PHE A HD2    1 
ATOM   139  H  HE1    . PHE A 1 8   ? 31.867  5.729   11.964  1.00 54.25  ? 8   PHE A HE1    1 
ATOM   140  H  HE2    . PHE A 1 8   ? 28.404  4.700   13.709  1.00 47.51  ? 8   PHE A HE2    1 
ATOM   141  H  HZ     . PHE A 1 8   ? 30.700  5.000   13.836  1.00 46.65  ? 8   PHE A HZ     1 
ATOM   142  N  N      . ASP A 1 9   ? 27.996  6.314   6.066   1.00 44.79  ? 9   ASP A N      1 
ATOM   143  C  CA     . ASP A 1 9   ? 27.236  6.633   4.843   1.00 37.52  ? 9   ASP A CA     1 
ATOM   144  C  C      . ASP A 1 9   ? 25.765  6.212   4.958   1.00 40.75  ? 9   ASP A C      1 
ATOM   145  O  O      . ASP A 1 9   ? 25.465  5.149   5.510   1.00 38.85  ? 9   ASP A O      1 
ATOM   146  C  CB     . ASP A 1 9   ? 27.857  5.954   3.614   1.00 45.65  ? 9   ASP A CB     1 
ATOM   147  C  CG     . ASP A 1 9   ? 29.272  6.448   3.313   1.00 55.88  ? 9   ASP A CG     1 
ATOM   148  O  OD1    . ASP A 1 9   ? 29.518  7.671   3.380   1.00 53.82  ? 9   ASP A OD1    1 
ATOM   149  O  OD2    . ASP A 1 9   ? 30.144  5.603   3.007   1.00 62.18  ? 9   ASP A OD2    1 
ATOM   150  H  H      . ASP A 1 9   ? 28.435  5.575   6.028   1.00 53.75  ? 9   ASP A H      1 
ATOM   151  H  HA     . ASP A 1 9   ? 27.262  7.602   4.698   1.00 45.03  ? 9   ASP A HA     1 
ATOM   152  H  HB2    . ASP A 1 9   ? 27.900  4.998   3.770   1.00 54.78  ? 9   ASP A HB2    1 
ATOM   153  H  HB3    . ASP A 1 9   ? 27.304  6.139   2.839   1.00 54.78  ? 9   ASP A HB3    1 
ATOM   154  N  N      . TYR A 1 10  ? 24.869  7.041   4.414   1.00 31.99  ? 10  TYR A N      1 
ATOM   155  C  CA     . TYR A 1 10  ? 23.408  6.867   4.545   1.00 36.07  ? 10  TYR A CA     1 
ATOM   156  C  C      . TYR A 1 10  ? 23.058  5.933   5.696   1.00 42.23  ? 10  TYR A C      1 
ATOM   157  O  O      . TYR A 1 10  ? 22.446  4.894   5.505   1.00 31.87  ? 10  TYR A O      1 
ATOM   158  C  CB     . TYR A 1 10  ? 22.798  6.346   3.227   1.00 43.43  ? 10  TYR A CB     1 
ATOM   159  C  CG     . TYR A 1 10  ? 23.452  5.114   2.628   1.00 50.08  ? 10  TYR A CG     1 
ATOM   160  C  CD1    . TYR A 1 10  ? 22.723  3.929   2.444   1.00 51.36  ? 10  TYR A CD1    1 
ATOM   161  C  CD2    . TYR A 1 10  ? 24.782  5.135   2.206   1.00 53.33  ? 10  TYR A CD2    1 
ATOM   162  C  CE1    . TYR A 1 10  ? 23.310  2.794   1.876   1.00 47.76  ? 10  TYR A CE1    1 
ATOM   163  C  CE2    . TYR A 1 10  ? 25.380  4.004   1.645   1.00 50.76  ? 10  TYR A CE2    1 
ATOM   164  C  CZ     . TYR A 1 10  ? 24.642  2.841   1.482   1.00 59.58  ? 10  TYR A CZ     1 
ATOM   165  O  OH     . TYR A 1 10  ? 25.240  1.730   0.923   1.00 64.76  ? 10  TYR A OH     1 
ATOM   166  H  H      . TYR A 1 10  ? 25.086  7.732   3.950   1.00 38.39  ? 10  TYR A H      1 
ATOM   167  H  HA     . TYR A 1 10  ? 23.004  7.740   4.736   1.00 43.29  ? 10  TYR A HA     1 
ATOM   168  H  HB2    . TYR A 1 10  ? 21.867  6.128   3.388   1.00 52.12  ? 10  TYR A HB2    1 
ATOM   169  H  HB3    . TYR A 1 10  ? 22.854  7.052   2.565   1.00 52.12  ? 10  TYR A HB3    1 
ATOM   170  H  HD1    . TYR A 1 10  ? 21.832  3.896   2.710   1.00 61.63  ? 10  TYR A HD1    1 
ATOM   171  H  HD2    . TYR A 1 10  ? 25.284  5.910   2.315   1.00 63.99  ? 10  TYR A HD2    1 
ATOM   172  H  HE1    . TYR A 1 10  ? 22.817  2.013   1.769   1.00 57.31  ? 10  TYR A HE1    1 
ATOM   173  H  HE2    . TYR A 1 10  ? 26.269  4.032   1.376   1.00 60.91  ? 10  TYR A HE2    1 
ATOM   174  H  HH     . TYR A 1 10  ? 25.878  1.494   1.380   1.00 77.71  ? 10  TYR A HH     1 
ATOM   175  N  N      . PHE A 1 11  ? 23.440  6.321   6.904   1.00 31.35  ? 11  PHE A N      1 
ATOM   176  C  CA     . PHE A 1 11  ? 23.601  5.344   7.982   1.00 37.08  ? 11  PHE A CA     1 
ATOM   177  C  C      . PHE A 1 11  ? 22.390  4.438   8.266   1.00 34.21  ? 11  PHE A C      1 
ATOM   178  O  O      . PHE A 1 11  ? 22.516  3.211   8.225   1.00 36.34  ? 11  PHE A O      1 
ATOM   179  C  CB     . PHE A 1 11  ? 24.064  6.033   9.280   1.00 31.76  ? 11  PHE A CB     1 
ATOM   180  C  CG     . PHE A 1 11  ? 24.394  5.065   10.364  1.00 34.45  ? 11  PHE A CG     1 
ATOM   181  C  CD1    . PHE A 1 11  ? 25.257  4.012   10.115  1.00 33.14  ? 11  PHE A CD1    1 
ATOM   182  C  CD2    . PHE A 1 11  ? 23.835  5.181   11.616  1.00 37.83  ? 11  PHE A CD2    1 
ATOM   183  C  CE1    . PHE A 1 11  ? 25.560  3.093   11.107  1.00 37.87  ? 11  PHE A CE1    1 
ATOM   184  C  CE2    . PHE A 1 11  ? 24.148  4.258   12.623  1.00 40.12  ? 11  PHE A CE2    1 
ATOM   185  C  CZ     . PHE A 1 11  ? 25.009  3.225   12.361  1.00 37.73  ? 11  PHE A CZ     1 
ATOM   186  H  H      . PHE A 1 11  ? 23.611  7.133   7.129   1.00 37.62  ? 11  PHE A H      1 
ATOM   187  H  HA     . PHE A 1 11  ? 24.330  4.744   7.717   1.00 44.49  ? 11  PHE A HA     1 
ATOM   188  H  HB2    . PHE A 1 11  ? 24.859  6.556   9.093   1.00 38.11  ? 11  PHE A HB2    1 
ATOM   189  H  HB3    . PHE A 1 11  ? 23.355  6.611   9.601   1.00 38.11  ? 11  PHE A HB3    1 
ATOM   190  H  HD1    . PHE A 1 11  ? 25.635  3.918   9.271   1.00 39.77  ? 11  PHE A HD1    1 
ATOM   191  H  HD2    . PHE A 1 11  ? 23.253  5.883   11.798  1.00 45.40  ? 11  PHE A HD2    1 
ATOM   192  H  HE1    . PHE A 1 11  ? 26.147  2.394   10.929  1.00 45.44  ? 11  PHE A HE1    1 
ATOM   193  H  HE2    . PHE A 1 11  ? 23.770  4.346   13.468  1.00 48.15  ? 11  PHE A HE2    1 
ATOM   194  H  HZ     . PHE A 1 11  ? 25.214  2.610   13.028  1.00 45.27  ? 11  PHE A HZ     1 
ATOM   195  N  N      . TYR A 1 12  ? 21.234  5.014   8.586   1.00 31.26  ? 12  TYR A N      1 
ATOM   196  C  CA     . TYR A 1 12  ? 20.084  4.189   8.943   1.00 34.37  ? 12  TYR A CA     1 
ATOM   197  C  C      . TYR A 1 12  ? 19.745  3.242   7.782   1.00 39.53  ? 12  TYR A C      1 
ATOM   198  O  O      . TYR A 1 12  ? 19.633  2.036   7.966   1.00 35.29  ? 12  TYR A O      1 
ATOM   199  C  CB     . TYR A 1 12  ? 18.850  5.030   9.300   1.00 35.85  ? 12  TYR A CB     1 
ATOM   200  C  CG     . TYR A 1 12  ? 18.957  5.880   10.563  1.00 38.52  ? 12  TYR A CG     1 
ATOM   201  C  CD1    . TYR A 1 12  ? 20.137  5.948   11.290  1.00 37.73  ? 12  TYR A CD1    1 
ATOM   202  C  CD2    . TYR A 1 12  ? 17.857  6.608   11.029  1.00 41.31  ? 12  TYR A CD2    1 
ATOM   203  C  CE1    . TYR A 1 12  ? 20.236  6.750   12.438  1.00 41.96  ? 12  TYR A CE1    1 
ATOM   204  C  CE2    . TYR A 1 12  ? 17.940  7.408   12.176  1.00 34.71  ? 12  TYR A CE2    1 
ATOM   205  C  CZ     . TYR A 1 12  ? 19.136  7.473   12.870  1.00 44.68  ? 12  TYR A CZ     1 
ATOM   206  O  OH     . TYR A 1 12  ? 19.241  8.253   14.004  1.00 46.34  ? 12  TYR A OH     1 
ATOM   207  H  H      . TYR A 1 12  ? 21.091  5.862   8.604   1.00 37.52  ? 12  TYR A H      1 
ATOM   208  H  HA     . TYR A 1 12  ? 20.313  3.642   9.723   1.00 41.24  ? 12  TYR A HA     1 
ATOM   209  H  HB2    . TYR A 1 12  ? 18.668  5.632   8.561   1.00 43.02  ? 12  TYR A HB2    1 
ATOM   210  H  HB3    . TYR A 1 12  ? 18.097  4.430   9.419   1.00 43.02  ? 12  TYR A HB3    1 
ATOM   211  H  HD1    . TYR A 1 12  ? 20.883  5.477   10.996  1.00 45.28  ? 12  TYR A HD1    1 
ATOM   212  H  HD2    . TYR A 1 12  ? 17.057  6.576   10.555  1.00 49.57  ? 12  TYR A HD2    1 
ATOM   213  H  HE1    . TYR A 1 12  ? 21.037  6.792   12.910  1.00 50.35  ? 12  TYR A HE1    1 
ATOM   214  H  HE2    . TYR A 1 12  ? 17.201  7.893   12.466  1.00 41.66  ? 12  TYR A HE2    1 
ATOM   215  H  HH     . TYR A 1 12  ? 18.702  8.002   14.568  1.00 55.61  ? 12  TYR A HH     1 
ATOM   216  N  N      . ALA A 1 13  ? 19.588  3.786   6.583   1.00 30.48  ? 13  ALA A N      1 
ATOM   217  C  CA     . ALA A 1 13  ? 19.268  2.946   5.415   1.00 38.76  ? 13  ALA A CA     1 
ATOM   218  C  C      . ALA A 1 13  ? 20.352  1.886   5.202   1.00 36.46  ? 13  ALA A C      1 
ATOM   219  O  O      . ALA A 1 13  ? 20.056  0.729   4.872   1.00 37.43  ? 13  ALA A O      1 
ATOM   220  C  CB     . ALA A 1 13  ? 19.114  3.794   4.187   1.00 36.57  ? 13  ALA A CB     1 
ATOM   221  H  H      . ALA A 1 13  ? 19.659  4.626   6.411   1.00 36.57  ? 13  ALA A H      1 
ATOM   222  H  HA     . ALA A 1 13  ? 18.418  2.485   5.576   1.00 46.51  ? 13  ALA A HA     1 
ATOM   223  H  HB1    . ALA A 1 13  ? 18.906  3.227   3.441   1.00 43.88  ? 13  ALA A HB1    1 
ATOM   224  H  HB2    . ALA A 1 13  ? 18.403  4.423   4.329   1.00 43.88  ? 13  ALA A HB2    1 
ATOM   225  H  HB3    . ALA A 1 13  ? 19.937  4.261   4.025   1.00 43.88  ? 13  ALA A HB3    1 
ATOM   226  N  N      . GLN A 1 14  ? 21.613  2.245   5.413   1.00 37.85  ? 14  GLN A N      1 
ATOM   227  C  CA     . GLN A 1 14  ? 22.677  1.264   5.188   1.00 35.48  ? 14  GLN A CA     1 
ATOM   228  C  C      . GLN A 1 14  ? 22.629  0.121   6.225   1.00 42.66  ? 14  GLN A C      1 
ATOM   229  O  O      . GLN A 1 14  ? 22.885  -1.039  5.892   1.00 38.47  ? 14  GLN A O      1 
ATOM   230  C  CB     . GLN A 1 14  ? 24.063  1.914   5.158   1.00 41.22  ? 14  GLN A CB     1 
ATOM   231  C  CG     . GLN A 1 14  ? 25.143  0.905   4.773   1.00 44.54  ? 14  GLN A CG     1 
ATOM   232  C  CD     . GLN A 1 14  ? 26.573  1.448   4.758   1.00 51.40  ? 14  GLN A CD     1 
ATOM   233  O  OE1    . GLN A 1 14  ? 27.498  0.712   4.430   1.00 51.25  ? 14  GLN A OE1    1 
ATOM   234  N  NE2    . GLN A 1 14  ? 26.759  2.718   5.110   1.00 42.10  ? 14  GLN A NE2    1 
ATOM   235  H  H      . GLN A 1 14  ? 21.876  3.021   5.675   1.00 45.41  ? 14  GLN A H      1 
ATOM   236  H  HA     . GLN A 1 14  ? 22.532  0.857   4.308   1.00 42.58  ? 14  GLN A HA     1 
ATOM   237  H  HB2    . GLN A 1 14  ? 24.067  2.629   4.502   1.00 49.46  ? 14  GLN A HB2    1 
ATOM   238  H  HB3    . GLN A 1 14  ? 24.273  2.263   6.038   1.00 49.46  ? 14  GLN A HB3    1 
ATOM   239  H  HG2    . GLN A 1 14  ? 25.117  0.171   5.407   1.00 53.44  ? 14  GLN A HG2    1 
ATOM   240  H  HG3    . GLN A 1 14  ? 24.949  0.571   3.883   1.00 53.44  ? 14  GLN A HG3    1 
ATOM   241  H  HE21   . GLN A 1 14  ? 27.551  3.052   5.111   1.00 50.52  ? 14  GLN A HE21   1 
ATOM   242  H  HE22   . GLN A 1 14  ? 26.087  3.204   5.336   1.00 50.52  ? 14  GLN A HE22   1 
ATOM   243  N  N      . VAL A 1 15  ? 22.278  0.425   7.474   1.00 38.28  ? 15  VAL A N      1 
ATOM   244  C  CA     . VAL A 1 15  ? 22.150  -0.639  8.476   1.00 41.23  ? 15  VAL A CA     1 
ATOM   245  C  C      . VAL A 1 15  ? 21.029  -1.588  8.045   1.00 43.62  ? 15  VAL A C      1 
ATOM   246  O  O      . VAL A 1 15  ? 21.161  -2.808  8.137   1.00 38.42  ? 15  VAL A O      1 
ATOM   247  C  CB     . VAL A 1 15  ? 21.900  -0.083  9.905   1.00 39.93  ? 15  VAL A CB     1 
ATOM   248  C  CG1    . VAL A 1 15  ? 21.538  -1.201  10.869  1.00 39.10  ? 15  VAL A CG1    1 
ATOM   249  C  CG2    . VAL A 1 15  ? 23.151  0.683   10.415  1.00 35.53  ? 15  VAL A CG2    1 
ATOM   250  H  H      . VAL A 1 15  ? 22.111  1.217   7.763   1.00 45.93  ? 15  VAL A H      1 
ATOM   251  H  HA     . VAL A 1 15  ? 22.985  -1.152  8.498   1.00 49.47  ? 15  VAL A HA     1 
ATOM   252  H  HB     . VAL A 1 15  ? 21.150  0.547   9.876   1.00 47.91  ? 15  VAL A HB     1 
ATOM   253  H  HG11   . VAL A 1 15  ? 21.390  -0.827  11.740  1.00 46.91  ? 15  VAL A HG11   1 
ATOM   254  H  HG12   . VAL A 1 15  ? 20.739  -1.635  10.558  1.00 46.91  ? 15  VAL A HG12   1 
ATOM   255  H  HG13   . VAL A 1 15  ? 22.261  -1.832  10.901  1.00 46.91  ? 15  VAL A HG13   1 
ATOM   256  H  HG21   . VAL A 1 15  ? 22.974  1.017   11.297  1.00 42.64  ? 15  VAL A HG21   1 
ATOM   257  H  HG22   . VAL A 1 15  ? 23.898  0.081   10.435  1.00 42.64  ? 15  VAL A HG22   1 
ATOM   258  H  HG23   . VAL A 1 15  ? 23.334  1.413   9.818   1.00 42.64  ? 15  VAL A HG23   1 
ATOM   259  N  N      . GLU A 1 16  ? 19.927  -1.038  7.558   1.00 36.82  ? 16  GLU A N      1 
ATOM   260  C  CA     . GLU A 1 16  ? 18.823  -1.891  7.141   1.00 43.09  ? 16  GLU A CA     1 
ATOM   261  C  C      . GLU A 1 16  ? 19.283  -2.809  5.993   1.00 48.70  ? 16  GLU A C      1 
ATOM   262  O  O      . GLU A 1 16  ? 18.897  -3.976  5.944   1.00 44.41  ? 16  GLU A O      1 
ATOM   263  C  CB     . GLU A 1 16  ? 17.615  -1.054  6.710   1.00 43.08  ? 16  GLU A CB     1 
ATOM   264  C  CG     . GLU A 1 16  ? 16.971  -0.266  7.852   1.00 49.13  ? 16  GLU A CG     1 
ATOM   265  C  CD     . GLU A 1 16  ? 16.215  -1.150  8.829   1.00 54.13  ? 16  GLU A CD     1 
ATOM   266  O  OE1    . GLU A 1 16  ? 16.164  -2.384  8.608   1.00 49.29  ? 16  GLU A OE1    1 
ATOM   267  O  OE2    . GLU A 1 16  ? 15.672  -0.611  9.819   1.00 41.45  ? 16  GLU A OE2    1 
ATOM   268  H  H      . GLU A 1 16  ? 19.792  -0.194  7.460   1.00 44.19  ? 16  GLU A H      1 
ATOM   269  H  HA     . GLU A 1 16  ? 18.551  -2.456  7.894   1.00 51.71  ? 16  GLU A HA     1 
ATOM   270  H  HB2    . GLU A 1 16  ? 17.900  -0.419  6.034   1.00 51.70  ? 16  GLU A HB2    1 
ATOM   271  H  HB3    . GLU A 1 16  ? 16.941  -1.646  6.341   1.00 51.70  ? 16  GLU A HB3    1 
ATOM   272  H  HG2    . GLU A 1 16  ? 17.665  0.200   8.344   1.00 58.96  ? 16  GLU A HG2    1 
ATOM   273  H  HG3    . GLU A 1 16  ? 16.344  0.373   7.479   1.00 58.96  ? 16  GLU A HG3    1 
ATOM   274  N  N      . GLU A 1 17  ? 20.120  -2.292  5.090   1.00 42.95  ? 17  GLU A N      1 
ATOM   275  C  CA     . GLU A 1 17  ? 20.663  -3.109  3.998   1.00 53.94  ? 17  GLU A CA     1 
ATOM   276  C  C      . GLU A 1 17  ? 21.589  -4.203  4.519   1.00 56.53  ? 17  GLU A C      1 
ATOM   277  O  O      . GLU A 1 17  ? 21.576  -5.329  4.010   1.00 51.79  ? 17  GLU A O      1 
ATOM   278  C  CB     . GLU A 1 17  ? 21.434  -2.261  2.978   1.00 39.43  ? 17  GLU A CB     1 
ATOM   279  C  CG     . GLU A 1 17  ? 20.625  -1.146  2.347   1.00 55.07  ? 17  GLU A CG     1 
ATOM   280  C  CD     . GLU A 1 17  ? 21.439  -0.340  1.346   1.00 62.26  ? 17  GLU A CD     1 
ATOM   281  O  OE1    . GLU A 1 17  ? 22.513  -0.819  0.911   1.00 59.46  ? 17  GLU A OE1    1 
ATOM   282  O  OE2    . GLU A 1 17  ? 21.007  0.778   1.007   1.00 64.67  ? 17  GLU A OE2    1 
ATOM   283  H  H      . GLU A 1 17  ? 20.389  -1.475  5.087   1.00 51.55  ? 17  GLU A H      1 
ATOM   284  H  HA     . GLU A 1 17  ? 19.920  -3.543  3.528   1.00 64.73  ? 17  GLU A HA     1 
ATOM   285  H  HB2    . GLU A 1 17  ? 22.195  -1.856  3.422   1.00 47.32  ? 17  GLU A HB2    1 
ATOM   286  H  HB3    . GLU A 1 17  ? 21.743  -2.840  2.263   1.00 47.32  ? 17  GLU A HB3    1 
ATOM   287  H  HG2    . GLU A 1 17  ? 19.866  -1.529  1.880   1.00 66.08  ? 17  GLU A HG2    1 
ATOM   288  H  HG3    . GLU A 1 17  ? 20.319  -0.543  3.043   1.00 66.08  ? 17  GLU A HG3    1 
ATOM   289  N  N      . VAL A 1 18  ? 22.412  -3.892  5.516   1.00 44.13  ? 18  VAL A N      1 
ATOM   290  C  CA     . VAL A 1 18  ? 23.299  -4.923  6.057   1.00 51.58  ? 18  VAL A CA     1 
ATOM   291  C  C      . VAL A 1 18  ? 22.477  -6.041  6.694   1.00 48.79  ? 18  VAL A C      1 
ATOM   292  O  O      . VAL A 1 18  ? 22.835  -7.215  6.592   1.00 55.23  ? 18  VAL A O      1 
ATOM   293  C  CB     . VAL A 1 18  ? 24.329  -4.362  7.057   1.00 47.76  ? 18  VAL A CB     1 
ATOM   294  C  CG1    . VAL A 1 18  ? 24.932  -5.486  7.906   1.00 52.25  ? 18  VAL A CG1    1 
ATOM   295  C  CG2    . VAL A 1 18  ? 25.423  -3.615  6.307   1.00 46.15  ? 18  VAL A CG2    1 
ATOM   296  H  H      . VAL A 1 18  ? 22.478  -3.119  5.887   1.00 52.96  ? 18  VAL A H      1 
ATOM   297  H  HA     . VAL A 1 18  ? 23.801  -5.318  5.313   1.00 61.90  ? 18  VAL A HA     1 
ATOM   298  H  HB     . VAL A 1 18  ? 23.883  -3.729  7.658   1.00 57.31  ? 18  VAL A HB     1 
ATOM   299  H  HG11   . VAL A 1 18  ? 25.568  -5.109  8.518   1.00 62.69  ? 18  VAL A HG11   1 
ATOM   300  H  HG12   . VAL A 1 18  ? 24.228  -5.922  8.392   1.00 62.69  ? 18  VAL A HG12   1 
ATOM   301  H  HG13   . VAL A 1 18  ? 25.368  -6.115  7.326   1.00 62.69  ? 18  VAL A HG13   1 
ATOM   302  H  HG21   . VAL A 1 18  ? 26.057  -3.271  6.940   1.00 55.38  ? 18  VAL A HG21   1 
ATOM   303  H  HG22   . VAL A 1 18  ? 25.858  -4.223  5.704   1.00 55.38  ? 18  VAL A HG22   1 
ATOM   304  H  HG23   . VAL A 1 18  ? 25.027  -2.893  5.814   1.00 55.38  ? 18  VAL A HG23   1 
ATOM   305  N  N      . LEU A 1 19  ? 21.362  -5.683  7.323   1.00 49.30  ? 19  LEU A N      1 
ATOM   306  C  CA     . LEU A 1 19  ? 20.511  -6.666  7.999   1.00 45.60  ? 19  LEU A CA     1 
ATOM   307  C  C      . LEU A 1 19  ? 19.611  -7.417  7.011   1.00 55.05  ? 19  LEU A C      1 
ATOM   308  O  O      . LEU A 1 19  ? 19.088  -8.492  7.318   1.00 52.66  ? 19  LEU A O      1 
ATOM   309  C  CB     . LEU A 1 19  ? 19.645  -5.984  9.057   1.00 54.28  ? 19  LEU A CB     1 
ATOM   310  C  CG     . LEU A 1 19  ? 20.170  -6.035  10.494  1.00 55.76  ? 19  LEU A CG     1 
ATOM   311  C  CD1    . LEU A 1 19  ? 21.548  -5.427  10.589  1.00 50.53  ? 19  LEU A CD1    1 
ATOM   312  C  CD2    . LEU A 1 19  ? 19.212  -5.325  11.411  1.00 56.28  ? 19  LEU A CD2    1 
ATOM   313  H  H      . LEU A 1 19  ? 21.073  -4.874  7.374   1.00 59.15  ? 19  LEU A H      1 
ATOM   314  H  HA     . LEU A 1 19  ? 21.081  -7.324  8.451   1.00 54.72  ? 19  LEU A HA     1 
ATOM   315  H  HB2    . LEU A 1 19  ? 19.551  -5.048  8.817   1.00 65.13  ? 19  LEU A HB2    1 
ATOM   316  H  HB3    . LEU A 1 19  ? 18.771  -6.406  9.054   1.00 65.13  ? 19  LEU A HB3    1 
ATOM   317  H  HG     . LEU A 1 19  ? 20.229  -6.961  10.778  1.00 66.91  ? 19  LEU A HG     1 
ATOM   318  H  HD11   . LEU A 1 19  ? 21.848  -5.475  11.499  1.00 60.63  ? 19  LEU A HD11   1 
ATOM   319  H  HD12   . LEU A 1 19  ? 22.146  -5.919  10.020  1.00 60.63  ? 19  LEU A HD12   1 
ATOM   320  H  HD13   . LEU A 1 19  ? 21.505  -4.511  10.305  1.00 60.63  ? 19  LEU A HD13   1 
ATOM   321  H  HD21   . LEU A 1 19  ? 19.552  -5.363  12.308  1.00 67.54  ? 19  LEU A HD21   1 
ATOM   322  H  HD22   . LEU A 1 19  ? 19.131  -4.410  11.130  1.00 67.54  ? 19  LEU A HD22   1 
ATOM   323  H  HD23   . LEU A 1 19  ? 18.357  -5.758  11.366  1.00 67.54  ? 19  LEU A HD23   1 
ATOM   324  N  N      . ASN A 1 20  ? 19.423  -6.833  5.833   1.00 51.10  ? 20  ASN A N      1 
ATOM   325  C  CA     . ASN A 1 20  ? 18.616  -7.440  4.787   1.00 53.58  ? 20  ASN A CA     1 
ATOM   326  C  C      . ASN A 1 20  ? 19.240  -7.066  3.452   1.00 49.24  ? 20  ASN A C      1 
ATOM   327  O  O      . ASN A 1 20  ? 18.848  -6.079  2.825   1.00 42.65  ? 20  ASN A O      1 
ATOM   328  C  CB     . ASN A 1 20  ? 17.164  -6.966  4.876   1.00 46.36  ? 20  ASN A CB     1 
ATOM   329  C  CG     . ASN A 1 20  ? 16.296  -7.535  3.754   1.00 62.71  ? 20  ASN A CG     1 
ATOM   330  O  OD1    . ASN A 1 20  ? 16.746  -8.386  2.986   1.00 55.46  ? 20  ASN A OD1    1 
ATOM   331  N  ND2    . ASN A 1 20  ? 15.051  -7.070  3.660   1.00 50.12  ? 20  ASN A ND2    1 
ATOM   332  H  H      . ASN A 1 20  ? 19.760  -6.073  5.613   1.00 61.32  ? 20  ASN A H      1 
ATOM   333  H  HA     . ASN A 1 20  ? 18.634  -8.416  4.879   1.00 64.29  ? 20  ASN A HA     1 
ATOM   334  H  HB2    . ASN A 1 20  ? 16.788  -7.254  5.723   1.00 55.63  ? 20  ASN A HB2    1 
ATOM   335  H  HB3    . ASN A 1 20  ? 17.142  -5.999  4.814   1.00 55.63  ? 20  ASN A HB3    1 
ATOM   336  H  HD21   . ASN A 1 20  ? 14.529  -7.363  3.043   1.00 60.14  ? 20  ASN A HD21   1 
ATOM   337  H  HD22   . ASN A 1 20  ? 14.770  -6.477  4.216   1.00 60.14  ? 20  ASN A HD22   1 
ATOM   338  N  N      . PRO A 1 21  ? 20.249  -7.836  3.029   1.00 45.57  ? 21  PRO A N      1 
ATOM   339  C  CA     . PRO A 1 21  ? 21.039  -7.471  1.845   1.00 46.91  ? 21  PRO A CA     1 
ATOM   340  C  C      . PRO A 1 21  ? 20.238  -7.520  0.543   1.00 55.75  ? 21  PRO A C      1 
ATOM   341  O  O      . PRO A 1 21  ? 20.722  -7.015  -0.469  1.00 50.04  ? 21  PRO A O      1 
ATOM   342  C  CB     . PRO A 1 21  ? 22.170  -8.512  1.830   1.00 52.70  ? 21  PRO A CB     1 
ATOM   343  C  CG     . PRO A 1 21  ? 22.210  -9.088  3.213   1.00 56.04  ? 21  PRO A CG     1 
ATOM   344  C  CD     . PRO A 1 21  ? 20.798  -9.011  3.727   1.00 54.85  ? 21  PRO A CD     1 
ATOM   345  H  HA     . PRO A 1 21  ? 21.424  -6.576  1.956   1.00 56.29  ? 21  PRO A HA     1 
ATOM   346  H  HB2    . PRO A 1 21  ? 21.968  -9.202  1.179   1.00 63.24  ? 21  PRO A HB2    1 
ATOM   347  H  HB3    . PRO A 1 21  ? 23.010  -8.077  1.617   1.00 63.24  ? 21  PRO A HB3    1 
ATOM   348  H  HG2    . PRO A 1 21  ? 22.509  -10.010 3.172   1.00 67.25  ? 21  PRO A HG2    1 
ATOM   349  H  HG3    . PRO A 1 21  ? 22.805  -8.560  3.768   1.00 67.25  ? 21  PRO A HG3    1 
ATOM   350  H  HD2    . PRO A 1 21  ? 20.305  -9.810  3.485   1.00 65.82  ? 21  PRO A HD2    1 
ATOM   351  H  HD3    . PRO A 1 21  ? 20.795  -8.867  4.686   1.00 65.82  ? 21  PRO A HD3    1 
ATOM   352  N  N      . SER A 1 22  ? 19.044  -8.115  0.576   1.00 49.45  ? 22  SER A N      1 
ATOM   353  C  CA     . SER A 1 22  ? 18.133  -8.087  -0.567  1.00 55.46  ? 22  SER A CA     1 
ATOM   354  C  C      . SER A 1 22  ? 17.760  -6.648  -0.943  1.00 60.72  ? 22  SER A C      1 
ATOM   355  O  O      . SER A 1 22  ? 17.362  -6.382  -2.079  1.00 61.45  ? 22  SER A O      1 
ATOM   356  C  CB     . SER A 1 22  ? 16.863  -8.873  -0.246  1.00 60.14  ? 22  SER A CB     1 
ATOM   357  O  OG     . SER A 1 22  ? 15.845  -8.022  0.256   1.00 65.52  ? 22  SER A OG     1 
ATOM   358  H  H      . SER A 1 22  ? 18.737  -8.546  1.255   1.00 59.34  ? 22  SER A H      1 
ATOM   359  H  HA     . SER A 1 22  ? 18.568  -8.504  -1.340  1.00 66.56  ? 22  SER A HA     1 
ATOM   360  H  HB2    . SER A 1 22  ? 16.544  -9.301  -1.056  1.00 72.17  ? 22  SER A HB2    1 
ATOM   361  H  HB3    . SER A 1 22  ? 17.069  -9.545  0.423   1.00 72.17  ? 22  SER A HB3    1 
ATOM   362  H  HG     . SER A 1 22  ? 15.171  -8.459  0.423   1.00 78.63  ? 22  SER A HG     1 
ATOM   363  N  N      . LEU A 1 23  ? 17.885  -5.729  0.021   1.00 51.21  ? 23  LEU A N      1 
ATOM   364  C  CA     . LEU A 1 23  ? 17.597  -4.305  -0.190  1.00 53.86  ? 23  LEU A CA     1 
ATOM   365  C  C      . LEU A 1 23  ? 18.633  -3.615  -1.082  1.00 47.49  ? 23  LEU A C      1 
ATOM   366  O  O      . LEU A 1 23  ? 18.366  -2.562  -1.656  1.00 46.11  ? 23  LEU A O      1 
ATOM   367  C  CB     . LEU A 1 23  ? 17.530  -3.574  1.158   1.00 49.52  ? 23  LEU A CB     1 
ATOM   368  C  CG     . LEU A 1 23  ? 16.351  -3.948  2.064   1.00 48.55  ? 23  LEU A CG     1 
ATOM   369  C  CD1    . LEU A 1 23  ? 16.386  -3.180  3.399   1.00 51.26  ? 23  LEU A CD1    1 
ATOM   370  C  CD2    . LEU A 1 23  ? 15.053  -3.679  1.339   1.00 50.80  ? 23  LEU A CD2    1 
ATOM   371  H  H      . LEU A 1 23  ? 18.140  -5.911  0.822   1.00 61.45  ? 23  LEU A H      1 
ATOM   372  H  HA     . LEU A 1 23  ? 16.723  -4.219  -0.624  1.00 64.63  ? 23  LEU A HA     1 
ATOM   373  H  HB2    . LEU A 1 23  ? 18.344  -3.764  1.649   1.00 59.43  ? 23  LEU A HB2    1 
ATOM   374  H  HB3    . LEU A 1 23  ? 17.472  -2.621  0.986   1.00 59.43  ? 23  LEU A HB3    1 
ATOM   375  H  HG     . LEU A 1 23  ? 16.394  -4.896  2.262   1.00 58.26  ? 23  LEU A HG     1 
ATOM   376  H  HD11   . LEU A 1 23  ? 15.632  -3.445  3.931   1.00 61.51  ? 23  LEU A HD11   1 
ATOM   377  H  HD12   . LEU A 1 23  ? 17.202  -3.390  3.858   1.00 61.51  ? 23  LEU A HD12   1 
ATOM   378  H  HD13   . LEU A 1 23  ? 16.344  -2.238  3.218   1.00 61.51  ? 23  LEU A HD13   1 
ATOM   379  H  HD21   . LEU A 1 23  ? 14.320  -3.915  1.912   1.00 60.95  ? 23  LEU A HD21   1 
ATOM   380  H  HD22   . LEU A 1 23  ? 15.007  -2.746  1.116   1.00 60.95  ? 23  LEU A HD22   1 
ATOM   381  H  HD23   . LEU A 1 23  ? 15.026  -4.208  0.538   1.00 60.95  ? 23  LEU A HD23   1 
ATOM   382  N  N      . LYS A 1 24  ? 19.823  -4.192  -1.173  1.00 53.53  ? 24  LYS A N      1 
ATOM   383  C  CA     . LYS A 1 24  ? 20.897  -3.596  -1.965  1.00 60.99  ? 24  LYS A CA     1 
ATOM   384  C  C      . LYS A 1 24  ? 20.413  -3.305  -3.381  1.00 64.99  ? 24  LYS A C      1 
ATOM   385  O  O      . LYS A 1 24  ? 19.743  -4.141  -3.996  1.00 59.34  ? 24  LYS A O      1 
ATOM   386  C  CB     . LYS A 1 24  ? 22.110  -4.535  -2.019  1.00 70.80  ? 24  LYS A CB     1 
ATOM   387  C  CG     . LYS A 1 24  ? 23.356  -3.998  -1.317  1.00 81.87  ? 24  LYS A CG     1 
ATOM   388  C  CD     . LYS A 1 24  ? 24.565  -4.898  -1.551  1.00 89.21  ? 24  LYS A CD     1 
ATOM   389  C  CE     . LYS A 1 24  ? 24.682  -5.968  -0.475  1.00 83.75  ? 24  LYS A CE     1 
ATOM   390  N  NZ     . LYS A 1 24  ? 25.778  -6.947  -0.729  1.00 85.67  ? 24  LYS A NZ     1 
ATOM   391  H  H      . LYS A 1 24  ? 20.037  -4.930  -0.788  1.00 64.24  ? 24  LYS A H      1 
ATOM   392  H  HA     . LYS A 1 24  ? 21.176  -2.752  -1.552  1.00 73.18  ? 24  LYS A HA     1 
ATOM   393  H  HB2    . LYS A 1 24  ? 21.872  -5.375  -1.595  1.00 84.97  ? 24  LYS A HB2    1 
ATOM   394  H  HB3    . LYS A 1 24  ? 22.340  -4.692  -2.948  1.00 84.97  ? 24  LYS A HB3    1 
ATOM   395  H  HG2    . LYS A 1 24  ? 23.562  -3.116  -1.663  1.00 98.25  ? 24  LYS A HG2    1 
ATOM   396  H  HG3    . LYS A 1 24  ? 23.191  -3.953  -0.362  1.00 98.25  ? 24  LYS A HG3    1 
ATOM   397  H  HD2    . LYS A 1 24  ? 24.474  -5.339  -2.410  1.00 107.05 ? 24  LYS A HD2    1 
ATOM   398  H  HD3    . LYS A 1 24  ? 25.373  -4.360  -1.533  1.00 107.05 ? 24  LYS A HD3    1 
ATOM   399  H  HE2    . LYS A 1 24  ? 24.858  -5.538  0.377   1.00 100.50 ? 24  LYS A HE2    1 
ATOM   400  H  HE3    . LYS A 1 24  ? 23.847  -6.460  -0.431  1.00 100.50 ? 24  LYS A HE3    1 
ATOM   401  H  HZ1    . LYS A 1 24  ? 25.805  -7.550  -0.075  1.00 102.81 ? 24  LYS A HZ1    1 
ATOM   402  H  HZ2    . LYS A 1 24  ? 25.639  -7.366  -1.502  1.00 102.81 ? 24  LYS A HZ2    1 
ATOM   403  H  HZ3    . LYS A 1 24  ? 26.561  -6.525  -0.766  1.00 102.81 ? 24  LYS A HZ3    1 
ATOM   404  N  N      . GLY A 1 25  ? 20.739  -2.117  -3.885  1.00 57.51  ? 25  GLY A N      1 
ATOM   405  C  CA     . GLY A 1 25  ? 20.406  -1.741  -5.250  1.00 56.16  ? 25  GLY A CA     1 
ATOM   406  C  C      . GLY A 1 25  ? 19.007  -1.187  -5.437  1.00 63.28  ? 25  GLY A C      1 
ATOM   407  O  O      . GLY A 1 25  ? 18.706  -0.605  -6.476  1.00 71.17  ? 25  GLY A O      1 
ATOM   408  H  H      . GLY A 1 25  ? 21.158  -1.506  -3.449  1.00 69.01  ? 25  GLY A H      1 
ATOM   409  H  HA2    . GLY A 1 25  ? 21.037  -1.069  -5.553  1.00 67.39  ? 25  GLY A HA2    1 
ATOM   410  H  HA3    . GLY A 1 25  ? 20.499  -2.519  -5.822  1.00 67.39  ? 25  GLY A HA3    1 
ATOM   411  N  N      . LYS A 1 26  ? 18.147  -1.368  -4.439  1.00 53.61  ? 26  LYS A N      1 
ATOM   412  C  CA     . LYS A 1 26  ? 16.805  -0.801  -4.473  1.00 56.15  ? 26  LYS A CA     1 
ATOM   413  C  C      . LYS A 1 26  ? 16.792  0.531   -3.734  1.00 54.44  ? 26  LYS A C      1 
ATOM   414  O  O      . LYS A 1 26  ? 17.604  0.766   -2.847  1.00 52.33  ? 26  LYS A O      1 
ATOM   415  C  CB     . LYS A 1 26  ? 15.798  -1.742  -3.814  1.00 58.22  ? 26  LYS A CB     1 
ATOM   416  C  CG     . LYS A 1 26  ? 15.823  -3.167  -4.322  1.00 63.44  ? 26  LYS A CG     1 
ATOM   417  C  CD     . LYS A 1 26  ? 14.798  -3.997  -3.568  1.00 67.35  ? 26  LYS A CD     1 
ATOM   418  C  CE     . LYS A 1 26  ? 14.968  -5.489  -3.819  1.00 70.36  ? 26  LYS A CE     1 
ATOM   419  N  NZ     . LYS A 1 26  ? 14.357  -6.279  -2.706  1.00 77.37  ? 26  LYS A NZ     1 
ATOM   420  H  H      . LYS A 1 26  ? 18.318  -1.819  -3.728  1.00 64.33  ? 26  LYS A H      1 
ATOM   421  H  HA     . LYS A 1 26  ? 16.533  -0.649  -5.402  1.00 67.38  ? 26  LYS A HA     1 
ATOM   422  H  HB2    . LYS A 1 26  ? 15.979  -1.768  -2.861  1.00 69.86  ? 26  LYS A HB2    1 
ATOM   423  H  HB3    . LYS A 1 26  ? 14.905  -1.394  -3.965  1.00 69.86  ? 26  LYS A HB3    1 
ATOM   424  H  HG2    . LYS A 1 26  ? 15.599  -3.181  -5.265  1.00 76.13  ? 26  LYS A HG2    1 
ATOM   425  H  HG3    . LYS A 1 26  ? 16.702  -3.551  -4.173  1.00 76.13  ? 26  LYS A HG3    1 
ATOM   426  H  HD2    . LYS A 1 26  ? 14.898  -3.837  -2.617  1.00 80.82  ? 26  LYS A HD2    1 
ATOM   427  H  HD3    . LYS A 1 26  ? 13.908  -3.741  -3.857  1.00 80.82  ? 26  LYS A HD3    1 
ATOM   428  H  HE2    . LYS A 1 26  ? 14.524  -5.731  -4.647  1.00 84.43  ? 26  LYS A HE2    1 
ATOM   429  H  HE3    . LYS A 1 26  ? 15.913  -5.704  -3.866  1.00 84.43  ? 26  LYS A HE3    1 
ATOM   430  H  HZ1    . LYS A 1 26  ? 14.750  -6.072  -1.935  1.00 92.84  ? 26  LYS A HZ1    1 
ATOM   431  H  HZ2    . LYS A 1 26  ? 13.488  -6.096  -2.646  1.00 92.84  ? 26  LYS A HZ2    1 
ATOM   432  H  HZ3    . LYS A 1 26  ? 14.459  -7.150  -2.859  1.00 92.84  ? 26  LYS A HZ3    1 
ATOM   433  N  N      . PRO A 1 27  ? 15.867  1.415   -4.094  1.00 53.69  ? 27  PRO A N      1 
ATOM   434  C  CA     . PRO A 1 27  ? 15.809  2.642   -3.299  1.00 53.21  ? 27  PRO A CA     1 
ATOM   435  C  C      . PRO A 1 27  ? 15.147  2.344   -1.952  1.00 55.18  ? 27  PRO A C      1 
ATOM   436  O  O      . PRO A 1 27  ? 14.078  1.726   -1.924  1.00 49.75  ? 27  PRO A O      1 
ATOM   437  C  CB     . PRO A 1 27  ? 14.979  3.588   -4.166  1.00 50.02  ? 27  PRO A CB     1 
ATOM   438  C  CG     . PRO A 1 27  ? 14.152  2.685   -5.049  1.00 53.97  ? 27  PRO A CG     1 
ATOM   439  C  CD     . PRO A 1 27  ? 14.929  1.414   -5.231  1.00 55.58  ? 27  PRO A CD     1 
ATOM   440  H  HA     . PRO A 1 27  ? 16.705  3.013   -3.159  1.00 63.85  ? 27  PRO A HA     1 
ATOM   441  H  HB2    . PRO A 1 27  ? 14.408  4.133   -3.602  1.00 60.03  ? 27  PRO A HB2    1 
ATOM   442  H  HB3    . PRO A 1 27  ? 15.568  4.145   -4.699  1.00 60.03  ? 27  PRO A HB3    1 
ATOM   443  H  HG2    . PRO A 1 27  ? 13.304  2.502   -4.616  1.00 64.76  ? 27  PRO A HG2    1 
ATOM   444  H  HG3    . PRO A 1 27  ? 14.008  3.118   -5.905  1.00 64.76  ? 27  PRO A HG3    1 
ATOM   445  H  HD2    . PRO A 1 27  ? 14.338  0.647   -5.181  1.00 66.69  ? 27  PRO A HD2    1 
ATOM   446  H  HD3    . PRO A 1 27  ? 15.416  1.434   -6.070  1.00 66.69  ? 27  PRO A HD3    1 
ATOM   447  N  N      . VAL A 1 28  ? 15.800  2.738   -0.856  1.00 44.01  ? 28  VAL A N      1 
ATOM   448  C  CA     . VAL A 1 28  ? 15.330  2.436   0.499   1.00 44.27  ? 28  VAL A CA     1 
ATOM   449  C  C      . VAL A 1 28  ? 15.093  3.747   1.231   1.00 43.33  ? 28  VAL A C      1 
ATOM   450  O  O      . VAL A 1 28  ? 15.957  4.618   1.208   1.00 39.50  ? 28  VAL A O      1 
ATOM   451  C  CB     . VAL A 1 28  ? 16.383  1.605   1.289   1.00 47.24  ? 28  VAL A CB     1 
ATOM   452  C  CG1    . VAL A 1 28  ? 15.969  1.429   2.761   1.00 41.43  ? 28  VAL A CG1    1 
ATOM   453  C  CG2    . VAL A 1 28  ? 16.615  0.249   0.635   1.00 45.19  ? 28  VAL A CG2    1 
ATOM   454  H  H      . VAL A 1 28  ? 16.531  3.191   -0.872  1.00 52.81  ? 28  VAL A H      1 
ATOM   455  H  HA     . VAL A 1 28  ? 14.489  1.934   0.460   1.00 53.13  ? 28  VAL A HA     1 
ATOM   456  H  HB     . VAL A 1 28  ? 17.235  2.089   1.278   1.00 56.69  ? 28  VAL A HB     1 
ATOM   457  H  HG11   . VAL A 1 28  ? 16.640  0.913   3.214   1.00 49.72  ? 28  VAL A HG11   1 
ATOM   458  H  HG12   . VAL A 1 28  ? 15.889  2.294   3.168   1.00 49.72  ? 28  VAL A HG12   1 
ATOM   459  H  HG13   . VAL A 1 28  ? 15.126  0.971   2.795   1.00 49.72  ? 28  VAL A HG13   1 
ATOM   460  H  HG21   . VAL A 1 28  ? 17.267  -0.236  1.145   1.00 54.23  ? 28  VAL A HG21   1 
ATOM   461  H  HG22   . VAL A 1 28  ? 15.786  -0.235  0.617   1.00 54.23  ? 28  VAL A HG22   1 
ATOM   462  H  HG23   . VAL A 1 28  ? 16.934  0.385   -0.260  1.00 54.23  ? 28  VAL A HG23   1 
ATOM   463  N  N      . VAL A 1 29  ? 13.933  3.880   1.881   1.00 35.36  ? 29  VAL A N      1 
ATOM   464  C  CA     . VAL A 1 29  ? 13.548  5.096   2.579   1.00 39.14  ? 29  VAL A CA     1 
ATOM   465  C  C      . VAL A 1 29  ? 13.153  4.758   4.033   1.00 43.86  ? 29  VAL A C      1 
ATOM   466  O  O      . VAL A 1 29  ? 12.191  4.039   4.277   1.00 38.40  ? 29  VAL A O      1 
ATOM   467  C  CB     . VAL A 1 29  ? 12.376  5.787   1.880   1.00 40.60  ? 29  VAL A CB     1 
ATOM   468  C  CG1    . VAL A 1 29  ? 12.173  7.186   2.423   1.00 38.59  ? 29  VAL A CG1    1 
ATOM   469  C  CG2    . VAL A 1 29  ? 12.623  5.834   0.365   1.00 43.88  ? 29  VAL A CG2    1 
ATOM   470  H  H      . VAL A 1 29  ? 13.340  3.259   1.929   1.00 42.43  ? 29  VAL A H      1 
ATOM   471  H  HA     . VAL A 1 29  ? 14.307  5.716   2.599   1.00 46.97  ? 29  VAL A HA     1 
ATOM   472  H  HB     . VAL A 1 29  ? 11.556  5.274   2.041   1.00 48.73  ? 29  VAL A HB     1 
ATOM   473  H  HG11   . VAL A 1 29  ? 11.433  7.594   1.967   1.00 46.30  ? 29  VAL A HG11   1 
ATOM   474  H  HG12   . VAL A 1 29  ? 11.990  7.133   3.363   1.00 46.30  ? 29  VAL A HG12   1 
ATOM   475  H  HG13   . VAL A 1 29  ? 12.972  7.697   2.273   1.00 46.30  ? 29  VAL A HG13   1 
ATOM   476  H  HG21   . VAL A 1 29  ? 11.881  6.270   -0.059  1.00 52.66  ? 29  VAL A HG21   1 
ATOM   477  H  HG22   . VAL A 1 29  ? 13.431  6.325   0.197   1.00 52.66  ? 29  VAL A HG22   1 
ATOM   478  H  HG23   . VAL A 1 29  ? 12.710  4.937   0.035   1.00 52.66  ? 29  VAL A HG23   1 
ATOM   479  N  N      . VAL A 1 30  ? 13.917  5.277   4.982   1.00 37.16  ? 30  VAL A N      1 
ATOM   480  C  CA     . VAL A 1 30  ? 13.634  5.104   6.406   1.00 40.18  ? 30  VAL A CA     1 
ATOM   481  C  C      . VAL A 1 30  ? 12.714  6.208   6.928   1.00 41.38  ? 30  VAL A C      1 
ATOM   482  O  O      . VAL A 1 30  ? 12.997  7.393   6.774   1.00 37.38  ? 30  VAL A O      1 
ATOM   483  C  CB     . VAL A 1 30  ? 14.945  5.069   7.198   1.00 46.48  ? 30  VAL A CB     1 
ATOM   484  C  CG1    . VAL A 1 30  ? 14.679  4.898   8.714   1.00 39.75  ? 30  VAL A CG1    1 
ATOM   485  C  CG2    . VAL A 1 30  ? 15.828  3.929   6.654   1.00 37.02  ? 30  VAL A CG2    1 
ATOM   486  H  H      . VAL A 1 30  ? 14.622  5.745   4.827   1.00 44.59  ? 30  VAL A H      1 
ATOM   487  H  HA     . VAL A 1 30  ? 13.179  4.245   6.538   1.00 48.22  ? 30  VAL A HA     1 
ATOM   488  H  HB     . VAL A 1 30  ? 15.423  5.915   7.066   1.00 55.78  ? 30  VAL A HB     1 
ATOM   489  H  HG11   . VAL A 1 30  ? 15.519  4.880   9.178   1.00 47.70  ? 30  VAL A HG11   1 
ATOM   490  H  HG12   . VAL A 1 30  ? 14.149  5.636   9.023   1.00 47.70  ? 30  VAL A HG12   1 
ATOM   491  H  HG13   . VAL A 1 30  ? 14.208  4.074   8.856   1.00 47.70  ? 30  VAL A HG13   1 
ATOM   492  H  HG21   . VAL A 1 30  ? 16.650  3.907   7.150   1.00 44.42  ? 30  VAL A HG21   1 
ATOM   493  H  HG22   . VAL A 1 30  ? 15.361  3.097   6.756   1.00 44.42  ? 30  VAL A HG22   1 
ATOM   494  H  HG23   . VAL A 1 30  ? 16.010  4.092   5.725   1.00 44.42  ? 30  VAL A HG23   1 
ATOM   495  N  N      . CYS A 1 31  ? 11.612  5.810   7.558   1.00 35.38  ? 31  CYS A N      1 
ATOM   496  C  CA     . CYS A 1 31  ? 10.537  6.750   7.881   1.00 44.17  ? 31  CYS A CA     1 
ATOM   497  C  C      . CYS A 1 31  ? 10.212  6.814   9.377   1.00 45.80  ? 31  CYS A C      1 
ATOM   498  O  O      . CYS A 1 31  ? 10.359  5.843   10.116  1.00 43.39  ? 31  CYS A O      1 
ATOM   499  C  CB     . CYS A 1 31  ? 9.260   6.362   7.129   1.00 49.37  ? 31  CYS A CB     1 
ATOM   500  S  SG     . CYS A 1 31  ? 9.491   6.020   5.336   1.00 51.96  ? 31  CYS A SG     1 
ATOM   501  H  H      . CYS A 1 31  ? 11.460  5.002   7.809   1.00 42.45  ? 31  CYS A H      1 
ATOM   502  H  HA     . CYS A 1 31  ? 10.801  7.648   7.589   1.00 53.01  ? 31  CYS A HA     1 
ATOM   503  H  HB2    . CYS A 1 31  ? 8.894   5.561   7.535   1.00 59.24  ? 31  CYS A HB2    1 
ATOM   504  H  HB3    . CYS A 1 31  ? 8.621   7.088   7.209   1.00 59.24  ? 31  CYS A HB3    1 
ATOM   505  H  HG     . CYS A 1 31  ? 10.263  5.111   5.208   1.00 62.36  ? 31  CYS A HG     1 
ATOM   506  N  N      . VAL A 1 32  ? 9.744   7.983   9.787   1.00 38.73  ? 32  VAL A N      1 
ATOM   507  C  CA     . VAL A 1 32  ? 9.264   8.222   11.126  1.00 52.04  ? 32  VAL A CA     1 
ATOM   508  C  C      . VAL A 1 32  ? 7.773   8.491   11.034  1.00 50.77  ? 32  VAL A C      1 
ATOM   509  O  O      . VAL A 1 32  ? 7.360   9.620   10.761  1.00 49.77  ? 32  VAL A O      1 
ATOM   510  C  CB     . VAL A 1 32  ? 9.977   9.432   11.740  1.00 44.15  ? 32  VAL A CB     1 
ATOM   511  C  CG1    . VAL A 1 32  ? 9.532   9.631   13.187  1.00 60.45  ? 32  VAL A CG1    1 
ATOM   512  C  CG2    . VAL A 1 32  ? 11.485  9.225   11.666  1.00 44.90  ? 32  VAL A CG2    1 
ATOM   513  H  H      . VAL A 1 32  ? 9.696   8.677   9.282   1.00 46.48  ? 32  VAL A H      1 
ATOM   514  H  HA     . VAL A 1 32  ? 9.417   7.435   11.689  1.00 62.45  ? 32  VAL A HA     1 
ATOM   515  H  HB     . VAL A 1 32  ? 9.749   10.239  11.232  1.00 52.98  ? 32  VAL A HB     1 
ATOM   516  H  HG11   . VAL A 1 32  ? 9.990   10.392  13.553  1.00 72.53  ? 32  VAL A HG11   1 
ATOM   517  H  HG12   . VAL A 1 32  ? 8.584   9.779   13.205  1.00 72.53  ? 32  VAL A HG12   1 
ATOM   518  H  HG13   . VAL A 1 32  ? 9.751   8.844   13.692  1.00 72.53  ? 32  VAL A HG13   1 
ATOM   519  H  HG21   . VAL A 1 32  ? 11.924  9.986   12.053  1.00 53.88  ? 32  VAL A HG21   1 
ATOM   520  H  HG22   . VAL A 1 32  ? 11.715  8.431   12.155  1.00 53.88  ? 32  VAL A HG22   1 
ATOM   521  H  HG23   . VAL A 1 32  ? 11.742  9.130   10.746  1.00 53.88  ? 32  VAL A HG23   1 
ATOM   522  N  N      . PHE A 1 33  ? 6.980   7.438   11.226  1.00 53.13  ? 33  PHE A N      1 
ATOM   523  C  CA     . PHE A 1 33  ? 5.517   7.528   11.194  1.00 64.29  ? 33  PHE A CA     1 
ATOM   524  C  C      . PHE A 1 33  ? 4.981   8.068   12.514  1.00 63.34  ? 33  PHE A C      1 
ATOM   525  O  O      . PHE A 1 33  ? 5.268   7.526   13.585  1.00 59.86  ? 33  PHE A O      1 
ATOM   526  C  CB     . PHE A 1 33  ? 4.899   6.157   10.939  1.00 62.18  ? 33  PHE A CB     1 
ATOM   527  C  CG     . PHE A 1 33  ? 5.249   5.572   9.605   1.00 66.16  ? 33  PHE A CG     1 
ATOM   528  C  CD1    . PHE A 1 33  ? 4.627   6.021   8.454   1.00 63.15  ? 33  PHE A CD1    1 
ATOM   529  C  CD2    . PHE A 1 33  ? 6.191   4.563   9.502   1.00 58.27  ? 33  PHE A CD2    1 
ATOM   530  C  CE1    . PHE A 1 33  ? 4.945   5.482   7.218   1.00 59.78  ? 33  PHE A CE1    1 
ATOM   531  C  CE2    . PHE A 1 33  ? 6.514   4.023   8.263   1.00 61.71  ? 33  PHE A CE2    1 
ATOM   532  C  CZ     . PHE A 1 33  ? 5.887   4.486   7.123   1.00 57.87  ? 33  PHE A CZ     1 
ATOM   533  H  H      . PHE A 1 33  ? 7.270   6.644   11.380  1.00 63.76  ? 33  PHE A H      1 
ATOM   534  H  HA     . PHE A 1 33  ? 5.241   8.133   10.475  1.00 77.15  ? 33  PHE A HA     1 
ATOM   535  H  HB2    . PHE A 1 33  ? 5.209   5.543   11.623  1.00 74.62  ? 33  PHE A HB2    1 
ATOM   536  H  HB3    . PHE A 1 33  ? 3.933   6.237   10.983  1.00 74.62  ? 33  PHE A HB3    1 
ATOM   537  H  HD1    . PHE A 1 33  ? 3.990   6.697   8.509   1.00 75.77  ? 33  PHE A HD1    1 
ATOM   538  H  HD2    . PHE A 1 33  ? 6.618   4.250   10.267  1.00 69.92  ? 33  PHE A HD2    1 
ATOM   539  H  HE1    . PHE A 1 33  ? 4.522   5.796   6.452   1.00 71.74  ? 33  PHE A HE1    1 
ATOM   540  H  HE2    . PHE A 1 33  ? 7.150   3.347   8.201   1.00 74.05  ? 33  PHE A HE2    1 
ATOM   541  H  HZ     . PHE A 1 33  ? 6.100   4.123   6.294   1.00 69.45  ? 33  PHE A HZ     1 
ATOM   542  N  N      . SER A 1 34  ? 4.197   9.135   12.429  1.00 61.52  ? 34  SER A N      1 
ATOM   543  C  CA     . SER A 1 34  ? 3.711   9.829   13.617  1.00 67.99  ? 34  SER A CA     1 
ATOM   544  C  C      . SER A 1 34  ? 2.463   9.175   14.222  1.00 73.88  ? 34  SER A C      1 
ATOM   545  O  O      . SER A 1 34  ? 2.317   9.114   15.446  1.00 66.89  ? 34  SER A O      1 
ATOM   546  C  CB     . SER A 1 34  ? 3.431   11.291  13.283  1.00 61.09  ? 34  SER A CB     1 
ATOM   547  O  OG     . SER A 1 34  ? 2.763   11.400  12.040  1.00 69.12  ? 34  SER A OG     1 
ATOM   548  H  H      . SER A 1 34  ? 3.929   9.482   11.689  1.00 73.82  ? 34  SER A H      1 
ATOM   549  H  HA     . SER A 1 34  ? 4.415   9.810   14.299  1.00 81.59  ? 34  SER A HA     1 
ATOM   550  H  HB2    . SER A 1 34  ? 2.871   11.672  13.977  1.00 73.31  ? 34  SER A HB2    1 
ATOM   551  H  HB3    . SER A 1 34  ? 4.272   11.771  13.233  1.00 73.31  ? 34  SER A HB3    1 
ATOM   552  H  HG     . SER A 1 34  ? 2.617   12.189  11.869  1.00 82.94  ? 34  SER A HG     1 
ATOM   553  N  N      . GLY A 1 35  ? 1.560   8.698   13.372  1.00 72.81  ? 35  GLY A N      1 
ATOM   554  C  CA     . GLY A 1 35  ? 0.430   7.921   13.849  1.00 81.33  ? 35  GLY A CA     1 
ATOM   555  C  C      . GLY A 1 35  ? -0.918  8.581   13.651  1.00 82.07  ? 35  GLY A C      1 
ATOM   556  O  O      . GLY A 1 35  ? -1.951  7.955   13.879  1.00 85.10  ? 35  GLY A O      1 
ATOM   557  H  H      . GLY A 1 35  ? 1.580   8.811   12.519  1.00 87.38  ? 35  GLY A H      1 
ATOM   558  H  HA2    . GLY A 1 35  ? 0.417   7.068   13.389  1.00 97.59  ? 35  GLY A HA2    1 
ATOM   559  H  HA3    . GLY A 1 35  ? 0.543   7.750   14.797  1.00 97.59  ? 35  GLY A HA3    1 
ATOM   560  N  N      . ARG A 1 36  ? -0.919  9.840   13.225  1.00 75.60  ? 36  ARG A N      1 
ATOM   561  C  CA     . ARG A 1 36  ? -2.172  10.539  12.959  1.00 80.28  ? 36  ARG A CA     1 
ATOM   562  C  C      . ARG A 1 36  ? -3.010  9.813   11.914  1.00 84.90  ? 36  ARG A C      1 
ATOM   563  O  O      . ARG A 1 36  ? -4.227  9.689   12.062  1.00 84.20  ? 36  ARG A O      1 
ATOM   564  C  CB     . ARG A 1 36  ? -1.911  11.978  12.515  1.00 75.34  ? 36  ARG A CB     1 
ATOM   565  C  CG     . ARG A 1 36  ? -1.658  12.908  13.681  1.00 82.33  ? 36  ARG A CG     1 
ATOM   566  C  CD     . ARG A 1 36  ? -1.957  14.359  13.342  1.00 82.85  ? 36  ARG A CD     1 
ATOM   567  N  NE     . ARG A 1 36  ? -2.037  15.157  14.561  1.00 85.92  ? 36  ARG A NE     1 
ATOM   568  C  CZ     . ARG A 1 36  ? -2.036  16.483  14.597  1.00 84.87  ? 36  ARG A CZ     1 
ATOM   569  N  NH1    . ARG A 1 36  ? -1.952  17.189  13.479  1.00 94.27  ? 36  ARG A NH1    1 
ATOM   570  N  NH2    . ARG A 1 36  ? -2.107  17.102  15.761  1.00 78.94  ? 36  ARG A NH2    1 
ATOM   571  H  H      . ARG A 1 36  ? -0.213  10.310  13.084  1.00 90.73  ? 36  ARG A H      1 
ATOM   572  H  HA     . ARG A 1 36  ? -2.694  10.574  13.788  1.00 96.33  ? 36  ARG A HA     1 
ATOM   573  H  HB2    . ARG A 1 36  ? -1.130  11.995  11.941  1.00 90.41  ? 36  ARG A HB2    1 
ATOM   574  H  HB3    . ARG A 1 36  ? -2.686  12.305  12.032  1.00 90.41  ? 36  ARG A HB3    1 
ATOM   575  H  HG2    . ARG A 1 36  ? -2.227  12.649  14.423  1.00 98.79  ? 36  ARG A HG2    1 
ATOM   576  H  HG3    . ARG A 1 36  ? -0.725  12.845  13.940  1.00 98.79  ? 36  ARG A HG3    1 
ATOM   577  H  HD2    . ARG A 1 36  ? -1.246  14.715  12.787  1.00 99.43  ? 36  ARG A HD2    1 
ATOM   578  H  HD3    . ARG A 1 36  ? -2.809  14.415  12.881  1.00 99.43  ? 36  ARG A HD3    1 
ATOM   579  H  HE     . ARG A 1 36  ? -2.089  14.737  15.310  1.00 103.11 ? 36  ARG A HE     1 
ATOM   580  H  HH11   . ARG A 1 36  ? -1.903  16.789  12.720  1.00 113.12 ? 36  ARG A HH11   1 
ATOM   581  H  HH12   . ARG A 1 36  ? -1.950  18.049  13.513  1.00 113.12 ? 36  ARG A HH12   1 
ATOM   582  H  HH21   . ARG A 1 36  ? -2.161  16.646  16.489  1.00 94.73  ? 36  ARG A HH21   1 
ATOM   583  H  HH22   . ARG A 1 36  ? -2.106  17.962  15.792  1.00 94.73  ? 36  ARG A HH22   1 
ATOM   584  N  N      . PHE A 1 37  ? -2.358  9.330   10.862  1.00 79.16  ? 37  PHE A N      1 
ATOM   585  C  CA     . PHE A 1 37  ? -3.049  8.594   9.810   1.00 79.78  ? 37  PHE A CA     1 
ATOM   586  C  C      . PHE A 1 37  ? -2.047  7.912   8.893   1.00 84.55  ? 37  PHE A C      1 
ATOM   587  O  O      . PHE A 1 37  ? -0.852  8.202   8.943   1.00 85.17  ? 37  PHE A O      1 
ATOM   588  C  CB     . PHE A 1 37  ? -3.913  9.545   8.988   1.00 85.11  ? 37  PHE A CB     1 
ATOM   589  C  CG     . PHE A 1 37  ? -3.137  10.658  8.350   1.00 83.02  ? 37  PHE A CG     1 
ATOM   590  C  CD1    . PHE A 1 37  ? -2.462  10.452  7.157   1.00 87.22  ? 37  PHE A CD1    1 
ATOM   591  C  CD2    . PHE A 1 37  ? -3.070  11.907  8.947   1.00 81.59  ? 37  PHE A CD2    1 
ATOM   592  C  CE1    . PHE A 1 37  ? -1.737  11.472  6.564   1.00 84.99  ? 37  PHE A CE1    1 
ATOM   593  C  CE2    . PHE A 1 37  ? -2.348  12.932  8.362   1.00 86.08  ? 37  PHE A CE2    1 
ATOM   594  C  CZ     . PHE A 1 37  ? -1.681  12.714  7.166   1.00 86.40  ? 37  PHE A CZ     1 
ATOM   595  H  H      . PHE A 1 37  ? -1.512  9.415   10.734  1.00 95.00  ? 37  PHE A H      1 
ATOM   596  H  HA     . PHE A 1 37  ? -3.626  7.910   10.209  1.00 95.74  ? 37  PHE A HA     1 
ATOM   597  H  HB2    . PHE A 1 37  ? -4.348  9.043   8.281   1.00 102.13 ? 37  PHE A HB2    1 
ATOM   598  H  HB3    . PHE A 1 37  ? -4.581  9.943   9.568   1.00 102.13 ? 37  PHE A HB3    1 
ATOM   599  H  HD1    . PHE A 1 37  ? -2.498  9.618   6.748   1.00 104.66 ? 37  PHE A HD1    1 
ATOM   600  H  HD2    . PHE A 1 37  ? -3.516  12.058  9.749   1.00 97.91  ? 37  PHE A HD2    1 
ATOM   601  H  HE1    . PHE A 1 37  ? -1.291  11.323  5.762   1.00 101.99 ? 37  PHE A HE1    1 
ATOM   602  H  HE2    . PHE A 1 37  ? -2.312  13.767  8.769   1.00 103.30 ? 37  PHE A HE2    1 
ATOM   603  H  HZ     . PHE A 1 37  ? -1.196  13.402  6.771   1.00 103.68 ? 37  PHE A HZ     1 
ATOM   604  N  N      . GLU A 1 38  ? -2.539  7.008   8.053   1.00 83.60  ? 38  GLU A N      1 
ATOM   605  C  CA     . GLU A 1 38  ? -1.705  6.342   7.060   1.00 83.63  ? 38  GLU A CA     1 
ATOM   606  C  C      . GLU A 1 38  ? -0.680  7.298   6.433   1.00 83.90  ? 38  GLU A C      1 
ATOM   607  O  O      . GLU A 1 38  ? -1.044  8.288   5.786   1.00 78.64  ? 38  GLU A O      1 
ATOM   608  C  CB     . GLU A 1 38  ? -2.584  5.748   5.959   1.00 89.09  ? 38  GLU A CB     1 
ATOM   609  C  CG     . GLU A 1 38  ? -2.521  4.230   5.850   1.00 91.62  ? 38  GLU A CG     1 
ATOM   610  C  CD     . GLU A 1 38  ? -3.145  3.714   4.564   1.00 89.97  ? 38  GLU A CD     1 
ATOM   611  O  OE1    . GLU A 1 38  ? -3.722  2.605   4.577   1.00 93.93  ? 38  GLU A OE1    1 
ATOM   612  O  OE2    . GLU A 1 38  ? -3.057  4.419   3.534   1.00 91.36  ? 38  GLU A OE2    1 
ATOM   613  H  H      . GLU A 1 38  ? -3.363  6.760   8.038   1.00 100.32 ? 38  GLU A H      1 
ATOM   614  H  HA     . GLU A 1 38  ? -1.216  5.610   7.490   1.00 100.35 ? 38  GLU A HA     1 
ATOM   615  H  HB2    . GLU A 1 38  ? -3.507  5.992   6.132   1.00 106.91 ? 38  GLU A HB2    1 
ATOM   616  H  HB3    . GLU A 1 38  ? -2.304  6.116   5.106   1.00 106.91 ? 38  GLU A HB3    1 
ATOM   617  H  HG2    . GLU A 1 38  ? -1.592  3.949   5.868   1.00 109.94 ? 38  GLU A HG2    1 
ATOM   618  H  HG3    . GLU A 1 38  ? -3.001  3.838   6.596   1.00 109.94 ? 38  GLU A HG3    1 
ATOM   619  N  N      . ASP A 1 39  ? 0.598   6.993   6.648   1.00 76.46  ? 39  ASP A N      1 
ATOM   620  C  CA     . ASP A 1 39  ? 1.707   7.691   5.989   1.00 74.82  ? 39  ASP A CA     1 
ATOM   621  C  C      . ASP A 1 39  ? 1.988   9.112   6.491   1.00 68.10  ? 39  ASP A C      1 
ATOM   622  O  O      . ASP A 1 39  ? 2.697   9.868   5.829   1.00 70.55  ? 39  ASP A O      1 
ATOM   623  C  CB     . ASP A 1 39  ? 1.507   7.714   4.469   1.00 65.31  ? 39  ASP A CB     1 
ATOM   624  C  CG     . ASP A 1 39  ? 1.552   6.328   3.855   1.00 75.51  ? 39  ASP A CG     1 
ATOM   625  O  OD1    . ASP A 1 39  ? 1.981   5.381   4.545   1.00 76.10  ? 39  ASP A OD1    1 
ATOM   626  O  OD2    . ASP A 1 39  ? 1.167   6.182   2.676   1.00 84.37  ? 39  ASP A OD2    1 
ATOM   627  H  H      . ASP A 1 39  ? 0.856   6.371   7.182   1.00 91.75  ? 39  ASP A H      1 
ATOM   628  H  HA     . ASP A 1 39  ? 2.521   7.172   6.156   1.00 89.79  ? 39  ASP A HA     1 
ATOM   629  H  HB2    . ASP A 1 39  ? 0.641   8.103   4.270   1.00 78.38  ? 39  ASP A HB2    1 
ATOM   630  H  HB3    . ASP A 1 39  ? 2.211   8.245   4.065   1.00 78.38  ? 39  ASP A HB3    1 
ATOM   631  N  N      . SER A 1 40  ? 1.456   9.486   7.647   1.00 65.74  ? 40  SER A N      1 
ATOM   632  C  CA     . SER A 1 40  ? 1.843   10.764  8.236   1.00 67.96  ? 40  SER A CA     1 
ATOM   633  C  C      . SER A 1 40  ? 3.215   10.581  8.872   1.00 59.96  ? 40  SER A C      1 
ATOM   634  O  O      . SER A 1 40  ? 3.518   9.524   9.435   1.00 67.50  ? 40  SER A O      1 
ATOM   635  C  CB     . SER A 1 40  ? 0.837   11.241  9.284   1.00 69.20  ? 40  SER A CB     1 
ATOM   636  O  OG     . SER A 1 40  ? 0.915   10.455  10.461  1.00 67.37  ? 40  SER A OG     1 
ATOM   637  H  H      . SER A 1 40  ? 0.883   9.034   8.101   1.00 78.89  ? 40  SER A H      1 
ATOM   638  H  HA     . SER A 1 40  ? 1.911   11.444  7.534   1.00 81.55  ? 40  SER A HA     1 
ATOM   639  H  HB2    . SER A 1 40  ? 1.029   12.164  9.508   1.00 83.04  ? 40  SER A HB2    1 
ATOM   640  H  HB3    . SER A 1 40  ? -0.058  11.169  8.916   1.00 83.04  ? 40  SER A HB3    1 
ATOM   641  H  HG     . SER A 1 40  ? 0.370   10.722  11.013  1.00 80.84  ? 40  SER A HG     1 
ATOM   642  N  N      . GLY A 1 41  ? 4.049   11.605  8.776   1.00 61.77  ? 41  GLY A N      1 
ATOM   643  C  CA     . GLY A 1 41  ? 5.388   11.518  9.318   1.00 65.15  ? 41  GLY A CA     1 
ATOM   644  C  C      . GLY A 1 41  ? 6.420   11.991  8.320   1.00 63.61  ? 41  GLY A C      1 
ATOM   645  O  O      . GLY A 1 41  ? 6.070   12.511  7.252   1.00 50.62  ? 41  GLY A O      1 
ATOM   646  H  H      . GLY A 1 41  ? 3.863   12.358  8.404   1.00 74.13  ? 41  GLY A H      1 
ATOM   647  H  HA2    . GLY A 1 41  ? 5.454   12.066  10.115  1.00 78.18  ? 41  GLY A HA2    1 
ATOM   648  H  HA3    . GLY A 1 41  ? 5.584   10.599  9.555   1.00 78.18  ? 41  GLY A HA3    1 
ATOM   649  N  N      . ALA A 1 42  ? 7.690   11.796  8.672   1.00 48.05  ? 42  ALA A N      1 
ATOM   650  C  CA     . ALA A 1 42  ? 8.803   12.332  7.897   1.00 49.87  ? 42  ALA A CA     1 
ATOM   651  C  C      . ALA A 1 42  ? 9.862   11.271  7.602   1.00 44.77  ? 42  ALA A C      1 
ATOM   652  O  O      . ALA A 1 42  ? 9.974   10.260  8.302   1.00 43.47  ? 42  ALA A O      1 
ATOM   653  C  CB     . ALA A 1 42  ? 9.432   13.513  8.634   1.00 51.34  ? 42  ALA A CB     1 
ATOM   654  H  H      . ALA A 1 42  ? 7.934   11.350  9.366   1.00 57.66  ? 42  ALA A H      1 
ATOM   655  H  HA     . ALA A 1 42  ? 8.462   12.661  7.039   1.00 59.84  ? 42  ALA A HA     1 
ATOM   656  H  HB1    . ALA A 1 42  ? 10.162  13.854  8.112   1.00 61.60  ? 42  ALA A HB1    1 
ATOM   657  H  HB2    . ALA A 1 42  ? 8.768   14.196  8.754   1.00 61.60  ? 42  ALA A HB2    1 
ATOM   658  H  HB3    . ALA A 1 42  ? 9.752   13.213  9.489   1.00 61.60  ? 42  ALA A HB3    1 
ATOM   659  N  N      . VAL A 1 43  ? 10.630  11.514  6.552   1.00 43.51  ? 43  VAL A N      1 
ATOM   660  C  CA     . VAL A 1 43  ? 11.749  10.665  6.189   1.00 42.82  ? 43  VAL A CA     1 
ATOM   661  C  C      . VAL A 1 43  ? 12.937  11.009  7.087   1.00 36.36  ? 43  VAL A C      1 
ATOM   662  O  O      . VAL A 1 43  ? 13.322  12.179  7.189   1.00 40.46  ? 43  VAL A O      1 
ATOM   663  C  CB     . VAL A 1 43  ? 12.158  10.896  4.713   1.00 45.04  ? 43  VAL A CB     1 
ATOM   664  C  CG1    . VAL A 1 43  ? 13.456  10.169  4.406   1.00 37.07  ? 43  VAL A CG1    1 
ATOM   665  C  CG2    . VAL A 1 43  ? 11.041  10.435  3.770   1.00 46.57  ? 43  VAL A CG2    1 
ATOM   666  H  H      . VAL A 1 43  ? 10.520  12.182  6.022   1.00 52.21  ? 43  VAL A H      1 
ATOM   667  H  HA     . VAL A 1 43  ? 11.513  9.722   6.314   1.00 51.39  ? 43  VAL A HA     1 
ATOM   668  H  HB     . VAL A 1 43  ? 12.304  11.854  4.567   1.00 54.05  ? 43  VAL A HB     1 
ATOM   669  H  HG11   . VAL A 1 43  ? 13.691  10.326  3.488   1.00 44.48  ? 43  VAL A HG11   1 
ATOM   670  H  HG12   . VAL A 1 43  ? 14.146  10.505  4.983   1.00 44.48  ? 43  VAL A HG12   1 
ATOM   671  H  HG13   . VAL A 1 43  ? 13.331  9.229   4.556   1.00 44.48  ? 43  VAL A HG13   1 
ATOM   672  H  HG21   . VAL A 1 43  ? 11.316  10.587  2.863   1.00 55.89  ? 43  VAL A HG21   1 
ATOM   673  H  HG22   . VAL A 1 43  ? 10.881  9.499   3.910   1.00 55.89  ? 43  VAL A HG22   1 
ATOM   674  H  HG23   . VAL A 1 43  ? 10.245  10.936  3.960   1.00 55.89  ? 43  VAL A HG23   1 
ATOM   675  N  N      . ALA A 1 44  ? 13.505  9.997   7.740   1.00 40.83  ? 44  ALA A N      1 
ATOM   676  C  CA     . ALA A 1 44  ? 14.711  10.180  8.537   1.00 40.78  ? 44  ALA A CA     1 
ATOM   677  C  C      . ALA A 1 44  ? 15.919  10.231  7.605   1.00 41.50  ? 44  ALA A C      1 
ATOM   678  O  O      . ALA A 1 44  ? 16.785  11.100  7.739   1.00 42.08  ? 44  ALA A O      1 
ATOM   679  C  CB     . ALA A 1 44  ? 14.858  9.050   9.567   1.00 36.91  ? 44  ALA A CB     1 
ATOM   680  H  H      . ALA A 1 44  ? 13.208  9.190   7.736   1.00 49.00  ? 44  ALA A H      1 
ATOM   681  H  HA     . ALA A 1 44  ? 14.656  11.032  9.019   1.00 48.93  ? 44  ALA A HA     1 
ATOM   682  H  HB1    . ALA A 1 44  ? 15.658  9.194   10.077  1.00 44.29  ? 44  ALA A HB1    1 
ATOM   683  H  HB2    . ALA A 1 44  ? 14.093  9.055   10.147  1.00 44.29  ? 44  ALA A HB2    1 
ATOM   684  H  HB3    . ALA A 1 44  ? 14.912  8.211   9.103   1.00 44.29  ? 44  ALA A HB3    1 
ATOM   685  N  N      . THR A 1 45  ? 15.977  9.299   6.664   1.00 34.21  ? 45  THR A N      1 
ATOM   686  C  CA     . THR A 1 45  ? 17.007  9.315   5.622   1.00 38.68  ? 45  THR A CA     1 
ATOM   687  C  C      . THR A 1 45  ? 16.672  8.301   4.535   1.00 43.86  ? 45  THR A C      1 
ATOM   688  O  O      . THR A 1 45  ? 15.788  7.474   4.703   1.00 36.21  ? 45  THR A O      1 
ATOM   689  C  CB     . THR A 1 45  ? 18.403  8.948   6.167   1.00 44.65  ? 45  THR A CB     1 
ATOM   690  O  OG1    . THR A 1 45  ? 19.406  9.423   5.259   1.00 46.87  ? 45  THR A OG1    1 
ATOM   691  C  CG2    . THR A 1 45  ? 18.555  7.437   6.320   1.00 34.32  ? 45  THR A CG2    1 
ATOM   692  H  H      . THR A 1 45  ? 15.429  8.638   6.603   1.00 41.05  ? 45  THR A H      1 
ATOM   693  H  HA     . THR A 1 45  ? 17.053  10.206  5.218   1.00 46.42  ? 45  THR A HA     1 
ATOM   694  H  HB     . THR A 1 45  ? 18.531  9.360   7.036   1.00 53.58  ? 45  THR A HB     1 
ATOM   695  H  HG1    . THR A 1 45  ? 20.152  9.232   5.540   1.00 56.24  ? 45  THR A HG1    1 
ATOM   696  H  HG21   . THR A 1 45  ? 19.428  7.227   6.659   1.00 41.18  ? 45  THR A HG21   1 
ATOM   697  H  HG22   . THR A 1 45  ? 17.894  7.101   6.930   1.00 41.18  ? 45  THR A HG22   1 
ATOM   698  H  HG23   . THR A 1 45  ? 18.440  7.008   5.468   1.00 41.18  ? 45  THR A HG23   1 
ATOM   699  N  N      . ALA A 1 46  ? 17.408  8.343   3.434   1.00 34.36  ? 46  ALA A N      1 
ATOM   700  C  CA     . ALA A 1 46  ? 17.176  7.426   2.313   1.00 38.77  ? 46  ALA A CA     1 
ATOM   701  C  C      . ALA A 1 46  ? 18.527  7.091   1.720   1.00 36.11  ? 46  ALA A C      1 
ATOM   702  O  O      . ALA A 1 46  ? 19.449  7.901   1.825   1.00 32.50  ? 46  ALA A O      1 
ATOM   703  C  CB     . ALA A 1 46  ? 16.295  8.091   1.268   1.00 37.33  ? 46  ALA A CB     1 
ATOM   704  H  H      . ALA A 1 46  ? 18.054  8.896   3.304   1.00 41.23  ? 46  ALA A H      1 
ATOM   705  H  HA     . ALA A 1 46  ? 16.746  6.604   2.628   1.00 46.53  ? 46  ALA A HA     1 
ATOM   706  H  HB1    . ALA A 1 46  ? 16.154  7.477   0.543   1.00 44.80  ? 46  ALA A HB1    1 
ATOM   707  H  HB2    . ALA A 1 46  ? 15.455  8.322   1.670   1.00 44.80  ? 46  ALA A HB2    1 
ATOM   708  H  HB3    . ALA A 1 46  ? 16.734  8.882   0.947   1.00 44.80  ? 46  ALA A HB3    1 
ATOM   709  N  N      . ASN A 1 47  ? 18.662  5.917   1.102   1.00 32.22  ? 47  ASN A N      1 
ATOM   710  C  CA     . ASN A 1 47  ? 19.934  5.558   0.501   1.00 37.52  ? 47  ASN A CA     1 
ATOM   711  C  C      . ASN A 1 47  ? 20.110  6.383   -0.769  1.00 44.36  ? 47  ASN A C      1 
ATOM   712  O  O      . ASN A 1 47  ? 19.253  7.208   -1.107  1.00 36.07  ? 47  ASN A O      1 
ATOM   713  C  CB     . ASN A 1 47  ? 20.079  4.035   0.264   1.00 38.57  ? 47  ASN A CB     1 
ATOM   714  C  CG     . ASN A 1 47  ? 19.080  3.469   -0.739  1.00 45.59  ? 47  ASN A CG     1 
ATOM   715  O  OD1    . ASN A 1 47  ? 18.276  4.185   -1.326  1.00 42.10  ? 47  ASN A OD1    1 
ATOM   716  N  ND2    . ASN A 1 47  ? 19.136  2.156   -0.927  1.00 41.87  ? 47  ASN A ND2    1 
ATOM   717  H  H      . ASN A 1 47  ? 18.043  5.326   1.021   1.00 38.66  ? 47  ASN A H      1 
ATOM   718  H  HA     . ASN A 1 47  ? 20.648  5.821   1.117   1.00 45.03  ? 47  ASN A HA     1 
ATOM   719  H  HB2    . ASN A 1 47  ? 20.971  3.854   -0.072  1.00 46.28  ? 47  ASN A HB2    1 
ATOM   720  H  HB3    . ASN A 1 47  ? 19.946  3.574   1.107   1.00 46.28  ? 47  ASN A HB3    1 
ATOM   721  H  HD21   . ASN A 1 47  ? 18.598  1.778   -1.481  1.00 50.24  ? 47  ASN A HD21   1 
ATOM   722  H  HD22   . ASN A 1 47  ? 19.711  1.684   -0.495  1.00 50.24  ? 47  ASN A HD22   1 
ATOM   723  N  N      . TYR A 1 48  ? 21.234  6.221   -1.447  1.00 41.72  ? 48  TYR A N      1 
ATOM   724  C  CA     . TYR A 1 48  ? 21.514  7.103   -2.571  1.00 51.22  ? 48  TYR A CA     1 
ATOM   725  C  C      . TYR A 1 48  ? 20.584  6.838   -3.772  1.00 45.93  ? 48  TYR A C      1 
ATOM   726  O  O      . TYR A 1 48  ? 20.233  7.762   -4.495  1.00 49.66  ? 48  TYR A O      1 
ATOM   727  C  CB     . TYR A 1 48  ? 22.998  7.041   -2.934  1.00 58.12  ? 48  TYR A CB     1 
ATOM   728  C  CG     . TYR A 1 48  ? 23.832  7.937   -2.029  1.00 73.55  ? 48  TYR A CG     1 
ATOM   729  C  CD1    . TYR A 1 48  ? 24.208  7.524   -0.752  1.00 68.10  ? 48  TYR A CD1    1 
ATOM   730  C  CD2    . TYR A 1 48  ? 24.211  9.210   -2.445  1.00 75.75  ? 48  TYR A CD2    1 
ATOM   731  C  CE1    . TYR A 1 48  ? 24.952  8.343   0.075   1.00 65.03  ? 48  TYR A CE1    1 
ATOM   732  C  CE2    . TYR A 1 48  ? 24.957  10.039  -1.629  1.00 79.66  ? 48  TYR A CE2    1 
ATOM   733  C  CZ     . TYR A 1 48  ? 25.329  9.603   -0.368  1.00 85.54  ? 48  TYR A CZ     1 
ATOM   734  O  OH     . TYR A 1 48  ? 26.076  10.442  0.442   1.00 73.63  ? 48  TYR A OH     1 
ATOM   735  H  H      . TYR A 1 48  ? 21.836  5.629   -1.285  1.00 50.06  ? 48  TYR A H      1 
ATOM   736  H  HA     . TYR A 1 48  ? 21.337  8.021   -2.278  1.00 61.46  ? 48  TYR A HA     1 
ATOM   737  H  HB2    . TYR A 1 48  ? 23.314  6.129   -2.834  1.00 69.74  ? 48  TYR A HB2    1 
ATOM   738  H  HB3    . TYR A 1 48  ? 23.116  7.339   -3.850  1.00 69.74  ? 48  TYR A HB3    1 
ATOM   739  H  HD1    . TYR A 1 48  ? 23.959  6.679   -0.454  1.00 81.72  ? 48  TYR A HD1    1 
ATOM   740  H  HD2    . TYR A 1 48  ? 23.965  9.505   -3.292  1.00 90.90  ? 48  TYR A HD2    1 
ATOM   741  H  HE1    . TYR A 1 48  ? 25.202  8.050   0.922   1.00 78.03  ? 48  TYR A HE1    1 
ATOM   742  H  HE2    . TYR A 1 48  ? 25.208  10.884  -1.925  1.00 95.59  ? 48  TYR A HE2    1 
ATOM   743  H  HH     . TYR A 1 48  ? 25.664  11.137  0.582   1.00 88.36  ? 48  TYR A HH     1 
ATOM   744  N  N      . GLU A 1 49  ? 20.152  5.595   -3.953  1.00 46.37  ? 49  GLU A N      1 
ATOM   745  C  CA     . GLU A 1 49  ? 19.229  5.271   -5.043  1.00 51.16  ? 49  GLU A CA     1 
ATOM   746  C  C      . GLU A 1 49  ? 17.927  6.066   -4.919  1.00 55.11  ? 49  GLU A C      1 
ATOM   747  O  O      . GLU A 1 49  ? 17.390  6.524   -5.926  1.00 55.45  ? 49  GLU A O      1 
ATOM   748  C  CB     . GLU A 1 49  ? 18.924  3.773   -5.091  1.00 48.63  ? 49  GLU A CB     1 
ATOM   749  C  CG     . GLU A 1 49  ? 20.149  2.879   -5.257  1.00 64.01  ? 49  GLU A CG     1 
ATOM   750  C  CD     . GLU A 1 49  ? 20.677  2.327   -3.927  1.00 76.10  ? 49  GLU A CD     1 
ATOM   751  O  OE1    . GLU A 1 49  ? 20.440  1.125   -3.644  1.00 76.01  ? 49  GLU A OE1    1 
ATOM   752  O  OE2    . GLU A 1 49  ? 21.332  3.086   -3.167  1.00 57.28  ? 49  GLU A OE2    1 
ATOM   753  H  H      . GLU A 1 49  ? 20.375  4.923   -3.465  1.00 55.65  ? 49  GLU A H      1 
ATOM   754  H  HA     . GLU A 1 49  ? 19.649  5.517   -5.893  1.00 61.39  ? 49  GLU A HA     1 
ATOM   755  H  HB2    . GLU A 1 49  ? 18.485  3.519   -4.264  1.00 58.36  ? 49  GLU A HB2    1 
ATOM   756  H  HB3    . GLU A 1 49  ? 18.332  3.602   -5.840  1.00 58.36  ? 49  GLU A HB3    1 
ATOM   757  H  HG2    . GLU A 1 49  ? 19.915  2.126   -5.822  1.00 76.81  ? 49  GLU A HG2    1 
ATOM   758  H  HG3    . GLU A 1 49  ? 20.860  3.393   -5.670  1.00 76.81  ? 49  GLU A HG3    1 
ATOM   759  N  N      . ALA A 1 50  ? 17.419  6.245   -3.696  1.00 40.72  ? 50  ALA A N      1 
ATOM   760  C  CA     . ALA A 1 50  ? 16.246  7.099   -3.486  1.00 39.71  ? 50  ALA A CA     1 
ATOM   761  C  C      . ALA A 1 50  ? 16.607  8.581   -3.466  1.00 43.48  ? 50  ALA A C      1 
ATOM   762  O  O      . ALA A 1 50  ? 15.873  9.416   -3.984  1.00 38.70  ? 50  ALA A O      1 
ATOM   763  C  CB     . ALA A 1 50  ? 15.516  6.712   -2.198  1.00 41.32  ? 50  ALA A CB     1 
ATOM   764  H  H      . ALA A 1 50  ? 17.731  5.887   -2.978  1.00 48.86  ? 50  ALA A H      1 
ATOM   765  H  HA     . ALA A 1 50  ? 15.624  6.959   -4.231  1.00 47.65  ? 50  ALA A HA     1 
ATOM   766  H  HB1    . ALA A 1 50  ? 14.754  7.286   -2.086  1.00 49.58  ? 50  ALA A HB1    1 
ATOM   767  H  HB2    . ALA A 1 50  ? 15.230  5.798   -2.263  1.00 49.58  ? 50  ALA A HB2    1 
ATOM   768  H  HB3    . ALA A 1 50  ? 16.116  6.816   -1.456  1.00 49.58  ? 50  ALA A HB3    1 
ATOM   769  N  N      . ARG A 1 51  ? 17.735  8.913   -2.852  1.00 40.23  ? 51  ARG A N      1 
ATOM   770  C  CA     . ARG A 1 51  ? 18.130  10.303  -2.703  1.00 46.15  ? 51  ARG A CA     1 
ATOM   771  C  C      . ARG A 1 51  ? 18.384  10.942  -4.069  1.00 42.99  ? 51  ARG A C      1 
ATOM   772  O  O      . ARG A 1 51  ? 18.161  12.138  -4.252  1.00 50.04  ? 51  ARG A O      1 
ATOM   773  C  CB     . ARG A 1 51  ? 19.385  10.408  -1.826  1.00 49.33  ? 51  ARG A CB     1 
ATOM   774  C  CG     . ARG A 1 51  ? 19.444  11.697  -1.027  1.00 57.96  ? 51  ARG A CG     1 
ATOM   775  C  CD     . ARG A 1 51  ? 20.697  11.787  -0.171  1.00 53.53  ? 51  ARG A CD     1 
ATOM   776  N  NE     . ARG A 1 51  ? 20.619  10.905  0.986   1.00 47.00  ? 51  ARG A NE     1 
ATOM   777  C  CZ     . ARG A 1 51  ? 21.568  10.799  1.909   1.00 56.82  ? 51  ARG A CZ     1 
ATOM   778  N  NH1    . ARG A 1 51  ? 22.681  11.518  1.812   1.00 42.05  ? 51  ARG A NH1    1 
ATOM   779  N  NH2    . ARG A 1 51  ? 21.403  9.967   2.933   1.00 47.20  ? 51  ARG A NH2    1 
ATOM   780  H  H      . ARG A 1 51  ? 18.290  8.350   -2.513  1.00 48.28  ? 51  ARG A H      1 
ATOM   781  H  HA     . ARG A 1 51  ? 17.407  10.798  -2.263  1.00 55.38  ? 51  ARG A HA     1 
ATOM   782  H  HB2    . ARG A 1 51  ? 19.394  9.667   -1.199  1.00 59.20  ? 51  ARG A HB2    1 
ATOM   783  H  HB3    . ARG A 1 51  ? 20.170  10.372  -2.394  1.00 59.20  ? 51  ARG A HB3    1 
ATOM   784  H  HG2    . ARG A 1 51  ? 19.443  12.450  -1.638  1.00 69.55  ? 51  ARG A HG2    1 
ATOM   785  H  HG3    . ARG A 1 51  ? 18.674  11.743  -0.439  1.00 69.55  ? 51  ARG A HG3    1 
ATOM   786  H  HD2    . ARG A 1 51  ? 21.466  11.525  -0.701  1.00 64.24  ? 51  ARG A HD2    1 
ATOM   787  H  HD3    . ARG A 1 51  ? 20.802  12.697  0.147   1.00 64.24  ? 51  ARG A HD3    1 
ATOM   788  H  HE     . ARG A 1 51  ? 19.913  10.423  1.077   1.00 56.39  ? 51  ARG A HE     1 
ATOM   789  H  HH11   . ARG A 1 51  ? 22.788  12.057  1.150   1.00 50.46  ? 51  ARG A HH11   1 
ATOM   790  H  HH12   . ARG A 1 51  ? 23.293  11.445  2.411   1.00 50.46  ? 51  ARG A HH12   1 
ATOM   791  H  HH21   . ARG A 1 51  ? 20.684  9.500   2.996   1.00 56.64  ? 51  ARG A HH21   1 
ATOM   792  H  HH22   . ARG A 1 51  ? 22.017  9.894   3.531   1.00 56.64  ? 51  ARG A HH22   1 
ATOM   793  N  N      . LYS A 1 52  ? 18.865  10.140  -5.017  1.00 44.42  ? 52  LYS A N      1 
ATOM   794  C  CA     . LYS A 1 52  ? 19.065  10.581  -6.411  1.00 48.22  ? 52  LYS A CA     1 
ATOM   795  C  C      . LYS A 1 52  ? 17.845  11.331  -6.918  1.00 55.35  ? 52  LYS A C      1 
ATOM   796  O  O      . LYS A 1 52  ? 17.968  12.293  -7.672  1.00 45.33  ? 52  LYS A O      1 
ATOM   797  C  CB     . LYS A 1 52  ? 19.237  9.375   -7.352  1.00 46.49  ? 52  LYS A CB     1 
ATOM   798  C  CG     . LYS A 1 52  ? 20.650  9.009   -7.710  1.00 52.60  ? 52  LYS A CG     1 
ATOM   799  C  CD     . LYS A 1 52  ? 20.675  7.974   -8.844  1.00 61.18  ? 52  LYS A CD     1 
ATOM   800  C  CE     . LYS A 1 52  ? 19.662  6.852   -8.628  1.00 60.76  ? 52  LYS A CE     1 
ATOM   801  N  NZ     . LYS A 1 52  ? 19.810  5.739   -9.619  1.00 73.03  ? 52  LYS A NZ     1 
ATOM   802  H  H      . LYS A 1 52  ? 19.088  9.320   -4.881  1.00 53.30  ? 52  LYS A H      1 
ATOM   803  H  HA     . LYS A 1 52  ? 19.853  11.159  -6.476  1.00 57.86  ? 52  LYS A HA     1 
ATOM   804  H  HB2    . LYS A 1 52  ? 18.837  8.600   -6.929  1.00 55.79  ? 52  LYS A HB2    1 
ATOM   805  H  HB3    . LYS A 1 52  ? 18.770  9.567   -8.180  1.00 55.79  ? 52  LYS A HB3    1 
ATOM   806  H  HG2    . LYS A 1 52  ? 21.123  9.802   -8.009  1.00 63.12  ? 52  LYS A HG2    1 
ATOM   807  H  HG3    . LYS A 1 52  ? 21.090  8.626   -6.935  1.00 63.12  ? 52  LYS A HG3    1 
ATOM   808  H  HD2    . LYS A 1 52  ? 20.463  8.415   -9.681  1.00 73.41  ? 52  LYS A HD2    1 
ATOM   809  H  HD3    . LYS A 1 52  ? 21.559  7.577   -8.891  1.00 73.41  ? 52  LYS A HD3    1 
ATOM   810  H  HE2    . LYS A 1 52  ? 19.784  6.481   -7.740  1.00 72.91  ? 52  LYS A HE2    1 
ATOM   811  H  HE3    . LYS A 1 52  ? 18.766  7.214   -8.716  1.00 72.91  ? 52  LYS A HE3    1 
ATOM   812  H  HZ1    . LYS A 1 52  ? 19.204  5.107   -9.460  1.00 87.63  ? 52  LYS A HZ1    1 
ATOM   813  H  HZ2    . LYS A 1 52  ? 19.695  6.050   -10.445 1.00 87.63  ? 52  LYS A HZ2    1 
ATOM   814  H  HZ3    . LYS A 1 52  ? 20.623  5.382   -9.556  1.00 87.63  ? 52  LYS A HZ3    1 
ATOM   815  N  N      . PHE A 1 53  ? 16.655  10.872  -6.539  1.00 35.09  ? 53  PHE A N      1 
ATOM   816  C  CA     . PHE A 1 53  ? 15.453  11.456  -7.128  1.00 42.35  ? 53  PHE A CA     1 
ATOM   817  C  C      . PHE A 1 53  ? 14.775  12.492  -6.260  1.00 46.19  ? 53  PHE A C      1 
ATOM   818  O  O      . PHE A 1 53  ? 13.658  12.907  -6.563  1.00 43.16  ? 53  PHE A O      1 
ATOM   819  C  CB     . PHE A 1 53  ? 14.461  10.366  -7.510  1.00 45.38  ? 53  PHE A CB     1 
ATOM   820  C  CG     . PHE A 1 53  ? 14.996  9.380   -8.514  1.00 46.46  ? 53  PHE A CG     1 
ATOM   821  C  CD1    . PHE A 1 53  ? 15.129  9.730   -9.852  1.00 48.57  ? 53  PHE A CD1    1 
ATOM   822  C  CD2    . PHE A 1 53  ? 15.350  8.097   -8.121  1.00 47.16  ? 53  PHE A CD2    1 
ATOM   823  C  CE1    . PHE A 1 53  ? 15.615  8.811   -10.778 1.00 48.46  ? 53  PHE A CE1    1 
ATOM   824  C  CE2    . PHE A 1 53  ? 15.830  7.179   -9.028  1.00 49.35  ? 53  PHE A CE2    1 
ATOM   825  C  CZ     . PHE A 1 53  ? 15.968  7.541   -10.370 1.00 55.66  ? 53  PHE A CZ     1 
ATOM   826  H  H      . PHE A 1 53  ? 16.518  10.246  -5.964  1.00 42.11  ? 53  PHE A H      1 
ATOM   827  H  HA     . PHE A 1 53  ? 15.715  11.907  -7.957  1.00 50.82  ? 53  PHE A HA     1 
ATOM   828  H  HB2    . PHE A 1 53  ? 14.216  9.873   -6.711  1.00 54.46  ? 53  PHE A HB2    1 
ATOM   829  H  HB3    . PHE A 1 53  ? 13.673  10.782  -7.893  1.00 54.46  ? 53  PHE A HB3    1 
ATOM   830  H  HD1    . PHE A 1 53  ? 14.893  10.586  -10.131 1.00 58.29  ? 53  PHE A HD1    1 
ATOM   831  H  HD2    . PHE A 1 53  ? 15.261  7.853   -7.228  1.00 56.60  ? 53  PHE A HD2    1 
ATOM   832  H  HE1    . PHE A 1 53  ? 15.704  9.054   -11.671 1.00 58.16  ? 53  PHE A HE1    1 
ATOM   833  H  HE2    . PHE A 1 53  ? 16.067  6.325   -8.747  1.00 59.22  ? 53  PHE A HE2    1 
ATOM   834  H  HZ     . PHE A 1 53  ? 16.293  6.927   -10.988 1.00 66.80  ? 53  PHE A HZ     1 
ATOM   835  N  N      . GLY A 1 54  ? 15.439  12.913  -5.183  1.00 41.79  ? 54  GLY A N      1 
ATOM   836  C  CA     . GLY A 1 54  ? 14.939  14.009  -4.371  1.00 39.51  ? 54  GLY A CA     1 
ATOM   837  C  C      . GLY A 1 54  ? 14.253  13.562  -3.086  1.00 43.64  ? 54  GLY A C      1 
ATOM   838  O  O      . GLY A 1 54  ? 13.602  14.368  -2.421  1.00 45.59  ? 54  GLY A O      1 
ATOM   839  H  H      . GLY A 1 54  ? 16.181  12.577  -4.905  1.00 50.15  ? 54  GLY A H      1 
ATOM   840  H  HA2    . GLY A 1 54  ? 15.678  14.591  -4.133  1.00 47.42  ? 54  GLY A HA2    1 
ATOM   841  H  HA3    . GLY A 1 54  ? 14.303  14.525  -4.890  1.00 47.42  ? 54  GLY A HA3    1 
ATOM   842  N  N      . VAL A 1 55  ? 14.376  12.283  -2.746  1.00 41.10  ? 55  VAL A N      1 
ATOM   843  C  CA     . VAL A 1 55  ? 13.830  11.764  -1.487  1.00 42.74  ? 55  VAL A CA     1 
ATOM   844  C  C      . VAL A 1 55  ? 14.885  11.935  -0.399  1.00 51.11  ? 55  VAL A C      1 
ATOM   845  O  O      . VAL A 1 55  ? 15.787  11.121  -0.271  1.00 50.82  ? 55  VAL A O      1 
ATOM   846  C  CB     . VAL A 1 55  ? 13.427  10.280  -1.589  1.00 46.29  ? 55  VAL A CB     1 
ATOM   847  C  CG1    . VAL A 1 55  ? 13.096  9.715   -0.203  1.00 44.18  ? 55  VAL A CG1    1 
ATOM   848  C  CG2    . VAL A 1 55  ? 12.228  10.107  -2.524  1.00 39.58  ? 55  VAL A CG2    1 
ATOM   849  H  H      . VAL A 1 55  ? 14.772  11.689  -3.226  1.00 49.32  ? 55  VAL A H      1 
ATOM   850  H  HA     . VAL A 1 55  ? 13.038  12.285  -1.236  1.00 51.29  ? 55  VAL A HA     1 
ATOM   851  H  HB     . VAL A 1 55  ? 14.177  9.767   -1.956  1.00 55.54  ? 55  VAL A HB     1 
ATOM   852  H  HG11   . VAL A 1 55  ? 12.848  8.792   -0.294  1.00 53.01  ? 55  VAL A HG11   1 
ATOM   853  H  HG12   . VAL A 1 55  ? 13.870  9.793   0.359   1.00 53.01  ? 55  VAL A HG12   1 
ATOM   854  H  HG13   . VAL A 1 55  ? 12.367  10.215  0.171   1.00 53.01  ? 55  VAL A HG13   1 
ATOM   855  H  HG21   . VAL A 1 55  ? 11.998  9.176   -2.569  1.00 47.49  ? 55  VAL A HG21   1 
ATOM   856  H  HG22   . VAL A 1 55  ? 11.487  10.611  -2.178  1.00 47.49  ? 55  VAL A HG22   1 
ATOM   857  H  HG23   . VAL A 1 55  ? 12.464  10.429  -3.397  1.00 47.49  ? 55  VAL A HG23   1 
ATOM   858  N  N      . LYS A 1 56  ? 14.774  13.005  0.373   1.00 47.99  ? 56  LYS A N      1 
ATOM   859  C  CA     . LYS A 1 56  ? 15.802  13.328  1.366   1.00 59.82  ? 56  LYS A CA     1 
ATOM   860  C  C      . LYS A 1 56  ? 15.255  13.496  2.799   1.00 49.78  ? 56  LYS A C      1 
ATOM   861  O  O      . LYS A 1 56  ? 14.058  13.745  3.007   1.00 43.48  ? 56  LYS A O      1 
ATOM   862  C  CB     . LYS A 1 56  ? 16.511  14.611  0.946   1.00 55.59  ? 56  LYS A CB     1 
ATOM   863  C  CG     . LYS A 1 56  ? 15.583  15.803  0.896   1.00 61.16  ? 56  LYS A CG     1 
ATOM   864  C  CD     . LYS A 1 56  ? 16.270  17.037  0.330   1.00 72.99  ? 56  LYS A CD     1 
ATOM   865  C  CE     . LYS A 1 56  ? 15.354  18.255  0.413   1.00 76.94  ? 56  LYS A CE     1 
ATOM   866  N  NZ     . LYS A 1 56  ? 16.048  19.515  0.016   1.00 92.95  ? 56  LYS A NZ     1 
ATOM   867  H  H      . LYS A 1 56  ? 14.119  13.562  0.346   1.00 57.58  ? 56  LYS A H      1 
ATOM   868  H  HA     . LYS A 1 56  ? 16.466  12.607  1.380   1.00 71.78  ? 56  LYS A HA     1 
ATOM   869  H  HB2    . LYS A 1 56  ? 17.215  14.805  1.584   1.00 66.70  ? 56  LYS A HB2    1 
ATOM   870  H  HB3    . LYS A 1 56  ? 16.889  14.488  0.062   1.00 66.70  ? 56  LYS A HB3    1 
ATOM   871  H  HG2    . LYS A 1 56  ? 14.824  15.592  0.330   1.00 73.39  ? 56  LYS A HG2    1 
ATOM   872  H  HG3    . LYS A 1 56  ? 15.283  16.010  1.795   1.00 73.39  ? 56  LYS A HG3    1 
ATOM   873  H  HD2    . LYS A 1 56  ? 17.073  17.222  0.841   1.00 87.58  ? 56  LYS A HD2    1 
ATOM   874  H  HD3    . LYS A 1 56  ? 16.491  16.883  -0.602  1.00 87.58  ? 56  LYS A HD3    1 
ATOM   875  H  HE2    . LYS A 1 56  ? 14.600  18.127  -0.182  1.00 92.33  ? 56  LYS A HE2    1 
ATOM   876  H  HE3    . LYS A 1 56  ? 15.044  18.357  1.327   1.00 92.33  ? 56  LYS A HE3    1 
ATOM   877  H  HZ1    . LYS A 1 56  ? 15.486  20.203  0.077   1.00 111.54 ? 56  LYS A HZ1    1 
ATOM   878  H  HZ2    . LYS A 1 56  ? 16.743  19.661  0.553   1.00 111.54 ? 56  LYS A HZ2    1 
ATOM   879  H  HZ3    . LYS A 1 56  ? 16.338  19.451  -0.823  1.00 111.54 ? 56  LYS A HZ3    1 
ATOM   880  N  N      . ALA A 1 57  ? 16.151  13.372  3.775   1.00 42.59  ? 57  ALA A N      1 
ATOM   881  C  CA     . ALA A 1 57  ? 15.830  13.624  5.179   1.00 46.60  ? 57  ALA A CA     1 
ATOM   882  C  C      . ALA A 1 57  ? 14.894  14.817  5.368   1.00 46.82  ? 57  ALA A C      1 
ATOM   883  O  O      . ALA A 1 57  ? 15.095  15.867  4.790   1.00 47.22  ? 57  ALA A O      1 
ATOM   884  C  CB     . ALA A 1 57  ? 17.132  13.856  5.971   1.00 41.78  ? 57  ALA A CB     1 
ATOM   885  H  H      . ALA A 1 57  ? 16.969  13.138  3.647   1.00 51.11  ? 57  ALA A H      1 
ATOM   886  H  HA     . ALA A 1 57  ? 15.388  12.832  5.551   1.00 55.92  ? 57  ALA A HA     1 
ATOM   887  H  HB1    . ALA A 1 57  ? 16.912  14.020  6.891   1.00 50.13  ? 57  ALA A HB1    1 
ATOM   888  H  HB2    . ALA A 1 57  ? 17.684  13.073  5.901   1.00 50.13  ? 57  ALA A HB2    1 
ATOM   889  H  HB3    . ALA A 1 57  ? 17.590  14.614  5.603   1.00 50.13  ? 57  ALA A HB3    1 
ATOM   890  N  N      . GLY A 1 58  ? 13.865  14.648  6.185   1.00 50.45  ? 58  GLY A N      1 
ATOM   891  C  CA     . GLY A 1 58  ? 12.990  15.753  6.527   1.00 48.28  ? 58  GLY A CA     1 
ATOM   892  C  C      . GLY A 1 58  ? 11.712  15.875  5.709   1.00 57.15  ? 58  GLY A C      1 
ATOM   893  O  O      . GLY A 1 58  ? 10.753  16.470  6.182   1.00 57.75  ? 58  GLY A O      1 
ATOM   894  H  H      . GLY A 1 58  ? 13.653  13.901  6.555   1.00 60.54  ? 58  GLY A H      1 
ATOM   895  H  HA2    . GLY A 1 58  ? 12.737  15.670  7.459   1.00 57.94  ? 58  GLY A HA2    1 
ATOM   896  H  HA3    . GLY A 1 58  ? 13.484  16.581  6.426   1.00 57.94  ? 58  GLY A HA3    1 
ATOM   897  N  N      . ILE A 1 59  ? 11.661  15.343  4.492   1.00 47.68  ? 59  ILE A N      1 
ATOM   898  C  CA     . ILE A 1 59  ? 10.443  15.546  3.708   1.00 53.90  ? 59  ILE A CA     1 
ATOM   899  C  C      . ILE A 1 59  ? 9.310   14.646  4.195   1.00 50.68  ? 59  ILE A C      1 
ATOM   900  O  O      . ILE A 1 59  ? 9.549   13.610  4.819   1.00 48.30  ? 59  ILE A O      1 
ATOM   901  C  CB     . ILE A 1 59  ? 10.656  15.394  2.181   1.00 55.89  ? 59  ILE A CB     1 
ATOM   902  C  CG1    . ILE A 1 59  ? 11.007  13.955  1.801   1.00 52.91  ? 59  ILE A CG1    1 
ATOM   903  C  CG2    . ILE A 1 59  ? 11.716  16.375  1.705   1.00 56.43  ? 59  ILE A CG2    1 
ATOM   904  C  CD1    . ILE A 1 59  ? 11.029  13.721  0.287   1.00 52.46  ? 59  ILE A CD1    1 
ATOM   905  H  H      . ILE A 1 59  ? 12.281  14.884  4.112   1.00 57.22  ? 59  ILE A H      1 
ATOM   906  H  HA     . ILE A 1 59  ? 10.149  16.469  3.856   1.00 64.68  ? 59  ILE A HA     1 
ATOM   907  H  HB     . ILE A 1 59  ? 9.822   15.621  1.741   1.00 67.07  ? 59  ILE A HB     1 
ATOM   908  H  HG12   . ILE A 1 59  ? 11.888  13.744  2.148   1.00 63.49  ? 59  ILE A HG12   1 
ATOM   909  H  HG13   . ILE A 1 59  ? 10.348  13.357  2.187   1.00 63.49  ? 59  ILE A HG13   1 
ATOM   910  H  HG21   . ILE A 1 59  ? 11.837  16.269  0.758   1.00 67.71  ? 59  ILE A HG21   1 
ATOM   911  H  HG22   . ILE A 1 59  ? 11.425  17.268  1.900   1.00 67.71  ? 59  ILE A HG22   1 
ATOM   912  H  HG23   . ILE A 1 59  ? 12.540  16.190  2.163   1.00 67.71  ? 59  ILE A HG23   1 
ATOM   913  H  HD11   . ILE A 1 59  ? 11.254  12.804  0.116   1.00 62.96  ? 59  ILE A HD11   1 
ATOM   914  H  HD12   . ILE A 1 59  ? 10.160  13.917  -0.071  1.00 62.96  ? 59  ILE A HD12   1 
ATOM   915  H  HD13   . ILE A 1 59  ? 11.684  14.299  -0.109  1.00 62.96  ? 59  ILE A HD13   1 
ATOM   916  N  N      . PRO A 1 60  ? 8.061   15.065  3.941   1.00 50.80  ? 60  PRO A N      1 
ATOM   917  C  CA     . PRO A 1 60  ? 6.913   14.251  4.349   1.00 49.76  ? 60  PRO A CA     1 
ATOM   918  C  C      . PRO A 1 60  ? 6.935   12.919  3.626   1.00 52.32  ? 60  PRO A C      1 
ATOM   919  O  O      . PRO A 1 60  ? 7.350   12.858  2.469   1.00 43.90  ? 60  PRO A O      1 
ATOM   920  C  CB     . PRO A 1 60  ? 5.711   15.087  3.908   1.00 51.48  ? 60  PRO A CB     1 
ATOM   921  C  CG     . PRO A 1 60  ? 6.227   16.494  3.830   1.00 53.39  ? 60  PRO A CG     1 
ATOM   922  C  CD     . PRO A 1 60  ? 7.656   16.371  3.394   1.00 50.40  ? 60  PRO A CD     1 
ATOM   923  H  HA     . PRO A 1 60  ? 6.897   14.115  5.319   1.00 59.71  ? 60  PRO A HA     1 
ATOM   924  H  HB2    . PRO A 1 60  ? 5.403   14.785  3.039   1.00 61.77  ? 60  PRO A HB2    1 
ATOM   925  H  HB3    . PRO A 1 60  ? 5.003   15.016  4.568   1.00 61.77  ? 60  PRO A HB3    1 
ATOM   926  H  HG2    . PRO A 1 60  ? 5.712   16.994  3.178   1.00 64.07  ? 60  PRO A HG2    1 
ATOM   927  H  HG3    . PRO A 1 60  ? 6.171   16.911  4.704   1.00 64.07  ? 60  PRO A HG3    1 
ATOM   928  H  HD2    . PRO A 1 60  ? 7.716   16.366  2.426   1.00 60.48  ? 60  PRO A HD2    1 
ATOM   929  H  HD3    . PRO A 1 60  ? 8.191   17.081  3.781   1.00 60.48  ? 60  PRO A HD3    1 
ATOM   930  N  N      . ILE A 1 61  ? 6.511   11.861  4.306   1.00 47.41  ? 61  ILE A N      1 
ATOM   931  C  CA     . ILE A 1 61  ? 6.488   10.535  3.707   1.00 55.45  ? 61  ILE A CA     1 
ATOM   932  C  C      . ILE A 1 61  ? 5.581   10.526  2.488   1.00 54.95  ? 61  ILE A C      1 
ATOM   933  O  O      . ILE A 1 61  ? 5.849   9.843   1.494   1.00 50.84  ? 61  ILE A O      1 
ATOM   934  C  CB     . ILE A 1 61  ? 6.000   9.477   4.703   1.00 52.88  ? 61  ILE A CB     1 
ATOM   935  C  CG1    . ILE A 1 61  ? 7.001   9.340   5.848   1.00 50.92  ? 61  ILE A CG1    1 
ATOM   936  C  CG2    . ILE A 1 61  ? 5.786   8.136   3.990   1.00 51.51  ? 61  ILE A CG2    1 
ATOM   937  C  CD1    . ILE A 1 61  ? 6.516   8.444   6.985   1.00 53.97  ? 61  ILE A CD1    1 
ATOM   938  H  H      . ILE A 1 61  ? 6.230   11.885  5.119   1.00 56.89  ? 61  ILE A H      1 
ATOM   939  H  HA     . ILE A 1 61  ? 7.394   10.293  3.420   1.00 66.54  ? 61  ILE A HA     1 
ATOM   940  H  HB     . ILE A 1 61  ? 5.151   9.769   5.071   1.00 63.46  ? 61  ILE A HB     1 
ATOM   941  H  HG12   . ILE A 1 61  ? 7.823   8.958   5.500   1.00 61.10  ? 61  ILE A HG12   1 
ATOM   942  H  HG13   . ILE A 1 61  ? 7.177   10.219  6.217   1.00 61.10  ? 61  ILE A HG13   1 
ATOM   943  H  HG21   . ILE A 1 61  ? 5.481   7.488   4.628   1.00 61.81  ? 61  ILE A HG21   1 
ATOM   944  H  HG22   . ILE A 1 61  ? 5.129   8.251   3.299   1.00 61.81  ? 61  ILE A HG22   1 
ATOM   945  H  HG23   . ILE A 1 61  ? 6.619   7.851   3.606   1.00 61.81  ? 61  ILE A HG23   1 
ATOM   946  H  HD11   . ILE A 1 61  ? 7.194   8.406   7.663   1.00 64.76  ? 61  ILE A HD11   1 
ATOM   947  H  HD12   . ILE A 1 61  ? 5.708   8.813   7.349   1.00 64.76  ? 61  ILE A HD12   1 
ATOM   948  H  HD13   . ILE A 1 61  ? 6.347   7.565   6.639   1.00 64.76  ? 61  ILE A HD13   1 
ATOM   949  N  N      . VAL A 1 62  ? 4.503   11.291  2.570   1.00 54.88  ? 62  VAL A N      1 
ATOM   950  C  CA     . VAL A 1 62  ? 3.559   11.395  1.464   1.00 63.39  ? 62  VAL A CA     1 
ATOM   951  C  C      . VAL A 1 62  ? 4.224   11.997  0.222   1.00 56.57  ? 62  VAL A C      1 
ATOM   952  O  O      . VAL A 1 62  ? 3.916   11.604  -0.898  1.00 53.09  ? 62  VAL A O      1 
ATOM   953  C  CB     . VAL A 1 62  ? 2.327   12.231  1.872   1.00 59.91  ? 62  VAL A CB     1 
ATOM   954  C  CG1    . VAL A 1 62  ? 1.592   12.742  0.647   1.00 71.87  ? 62  VAL A CG1    1 
ATOM   955  C  CG2    . VAL A 1 62  ? 1.401   11.397  2.753   1.00 66.87  ? 62  VAL A CG2    1 
ATOM   956  H  H      . VAL A 1 62  ? 4.294   11.764  3.257   1.00 65.86  ? 62  VAL A H      1 
ATOM   957  H  HA     . VAL A 1 62  ? 3.246   10.496  1.231   1.00 76.07  ? 62  VAL A HA     1 
ATOM   958  H  HB     . VAL A 1 62  ? 2.625   13.007  2.393   1.00 71.89  ? 62  VAL A HB     1 
ATOM   959  H  HG11   . VAL A 1 62  ? 0.833   13.257  0.931   1.00 86.25  ? 62  VAL A HG11   1 
ATOM   960  H  HG12   . VAL A 1 62  ? 2.187   13.291  0.132   1.00 86.25  ? 62  VAL A HG12   1 
ATOM   961  H  HG13   . VAL A 1 62  ? 1.301   11.992  0.123   1.00 86.25  ? 62  VAL A HG13   1 
ATOM   962  H  HG21   . VAL A 1 62  ? 0.641   11.929  2.998   1.00 80.25  ? 62  VAL A HG21   1 
ATOM   963  H  HG22   . VAL A 1 62  ? 1.115   10.624  2.260   1.00 80.25  ? 62  VAL A HG22   1 
ATOM   964  H  HG23   . VAL A 1 62  ? 1.879   11.125  3.540   1.00 80.25  ? 62  VAL A HG23   1 
ATOM   965  N  N      . GLU A 1 63  ? 5.137   12.944  0.415   1.00 55.69  ? 63  GLU A N      1 
ATOM   966  C  CA     . GLU A 1 63  ? 5.815   13.564  -0.722  1.00 59.01  ? 63  GLU A CA     1 
ATOM   967  C  C      . GLU A 1 63  ? 6.809   12.586  -1.343  1.00 57.21  ? 63  GLU A C      1 
ATOM   968  O  O      . GLU A 1 63  ? 6.945   12.506  -2.554  1.00 56.08  ? 63  GLU A O      1 
ATOM   969  C  CB     . GLU A 1 63  ? 6.519   14.850  -0.292  1.00 56.43  ? 63  GLU A CB     1 
ATOM   970  C  CG     . GLU A 1 63  ? 5.564   15.917  0.213   1.00 69.39  ? 63  GLU A CG     1 
ATOM   971  C  CD     . GLU A 1 63  ? 4.443   16.216  -0.777  1.00 75.65  ? 63  GLU A CD     1 
ATOM   972  O  OE1    . GLU A 1 63  ? 4.739   16.380  -1.983  1.00 75.73  ? 63  GLU A OE1    1 
ATOM   973  O  OE2    . GLU A 1 63  ? 3.266   16.281  -0.350  1.00 69.20  ? 63  GLU A OE2    1 
ATOM   974  H  H      . GLU A 1 63  ? 5.380   13.243  1.183   1.00 66.82  ? 63  GLU A H      1 
ATOM   975  H  HA     . GLU A 1 63  ? 5.150   13.795  -1.404  1.00 70.82  ? 63  GLU A HA     1 
ATOM   976  H  HB2    . GLU A 1 63  ? 7.141   14.643  0.423   1.00 67.72  ? 63  GLU A HB2    1 
ATOM   977  H  HB3    . GLU A 1 63  ? 6.999   15.214  -1.052  1.00 67.72  ? 63  GLU A HB3    1 
ATOM   978  H  HG2    . GLU A 1 63  ? 5.161   15.614  1.042   1.00 83.27  ? 63  GLU A HG2    1 
ATOM   979  H  HG3    . GLU A 1 63  ? 6.058   16.738  0.364   1.00 83.27  ? 63  GLU A HG3    1 
ATOM   980  N  N      . ALA A 1 64  ? 7.496   11.832  -0.497  1.00 46.92  ? 64  ALA A N      1 
ATOM   981  C  CA     . ALA A 1 64  ? 8.391   10.791  -0.955  1.00 47.33  ? 64  ALA A CA     1 
ATOM   982  C  C      . ALA A 1 64  ? 7.658   9.777   -1.830  1.00 54.73  ? 64  ALA A C      1 
ATOM   983  O  O      . ALA A 1 64  ? 8.179   9.365   -2.862  1.00 44.84  ? 64  ALA A O      1 
ATOM   984  C  CB     . ALA A 1 64  ? 9.023   10.090  0.238   1.00 46.54  ? 64  ALA A CB     1 
ATOM   985  H  H      . ALA A 1 64  ? 7.458   11.909  0.359   1.00 56.30  ? 64  ALA A H      1 
ATOM   986  H  HA     . ALA A 1 64  ? 9.108   11.194  -1.488  1.00 56.80  ? 64  ALA A HA     1 
ATOM   987  H  HB1    . ALA A 1 64  ? 9.613   9.403   -0.080  1.00 55.85  ? 64  ALA A HB1    1 
ATOM   988  H  HB2    . ALA A 1 64  ? 9.516   10.733  0.753   1.00 55.85  ? 64  ALA A HB2    1 
ATOM   989  H  HB3    . ALA A 1 64  ? 8.328   9.703   0.776   1.00 55.85  ? 64  ALA A HB3    1 
ATOM   990  N  N      . LYS A 1 65  ? 6.461   9.368   -1.416  1.00 46.86  ? 65  LYS A N      1 
ATOM   991  C  CA     . LYS A 1 65  ? 5.725   8.329   -2.134  1.00 53.94  ? 65  LYS A CA     1 
ATOM   992  C  C      . LYS A 1 65  ? 5.258   8.855   -3.488  1.00 55.07  ? 65  LYS A C      1 
ATOM   993  O  O      . LYS A 1 65  ? 5.235   8.126   -4.479  1.00 48.88  ? 65  LYS A O      1 
ATOM   994  C  CB     . LYS A 1 65  ? 4.532   7.826   -1.315  1.00 52.97  ? 65  LYS A CB     1 
ATOM   995  C  CG     . LYS A 1 65  ? 4.909   7.276   0.050   1.00 61.29  ? 65  LYS A CG     1 
ATOM   996  C  CD     . LYS A 1 65  ? 4.211   5.962   0.349   1.00 60.90  ? 65  LYS A CD     1 
ATOM   997  C  CE     . LYS A 1 65  ? 4.471   5.521   1.781   1.00 62.81  ? 65  LYS A CE     1 
ATOM   998  N  NZ     . LYS A 1 65  ? 4.075   4.104   2.024   1.00 66.06  ? 65  LYS A NZ     1 
ATOM   999  H  H      . LYS A 1 65  ? 6.053   9.675   -0.724  1.00 56.23  ? 65  LYS A H      1 
ATOM   1000 H  HA     . LYS A 1 65  ? 6.323   7.569   -2.295  1.00 64.73  ? 65  LYS A HA     1 
ATOM   1001 H  HB2    . LYS A 1 65  ? 3.915   8.561   -1.178  1.00 63.57  ? 65  LYS A HB2    1 
ATOM   1002 H  HB3    . LYS A 1 65  ? 4.092   7.116   -1.809  1.00 63.57  ? 65  LYS A HB3    1 
ATOM   1003 H  HG2    . LYS A 1 65  ? 5.867   7.122   0.078   1.00 73.55  ? 65  LYS A HG2    1 
ATOM   1004 H  HG3    . LYS A 1 65  ? 4.654   7.916   0.733   1.00 73.55  ? 65  LYS A HG3    1 
ATOM   1005 H  HD2    . LYS A 1 65  ? 3.254   6.073   0.233   1.00 73.08  ? 65  LYS A HD2    1 
ATOM   1006 H  HD3    . LYS A 1 65  ? 4.546   5.276   -0.248  1.00 73.08  ? 65  LYS A HD3    1 
ATOM   1007 H  HE2    . LYS A 1 65  ? 5.419   5.605   1.970   1.00 75.37  ? 65  LYS A HE2    1 
ATOM   1008 H  HE3    . LYS A 1 65  ? 3.961   6.084   2.384   1.00 75.37  ? 65  LYS A HE3    1 
ATOM   1009 H  HZ1    . LYS A 1 65  ? 4.242   3.882   2.870   1.00 79.28  ? 65  LYS A HZ1    1 
ATOM   1010 H  HZ2    . LYS A 1 65  ? 3.206   4.000   1.864   1.00 79.28  ? 65  LYS A HZ2    1 
ATOM   1011 H  HZ3    . LYS A 1 65  ? 4.535   3.563   1.487   1.00 79.28  ? 65  LYS A HZ3    1 
ATOM   1012 N  N      . LYS A 1 66  ? 4.889   10.128  -3.515  1.00 57.17  ? 66  LYS A N      1 
ATOM   1013 C  CA     . LYS A 1 66  ? 4.588   10.821  -4.757  1.00 58.17  ? 66  LYS A CA     1 
ATOM   1014 C  C      . LYS A 1 66  ? 5.736   10.590  -5.749  1.00 60.61  ? 66  LYS A C      1 
ATOM   1015 O  O      . LYS A 1 66  ? 5.514   10.180  -6.886  1.00 53.57  ? 66  LYS A O      1 
ATOM   1016 C  CB     . LYS A 1 66  ? 4.406   12.315  -4.462  1.00 63.13  ? 66  LYS A CB     1 
ATOM   1017 C  CG     . LYS A 1 66  ? 3.970   13.167  -5.638  1.00 74.32  ? 66  LYS A CG     1 
ATOM   1018 C  CD     . LYS A 1 66  ? 2.453   13.158  -5.821  1.00 86.06  ? 66  LYS A CD     1 
ATOM   1019 C  CE     . LYS A 1 66  ? 2.018   13.969  -7.053  1.00 77.26  ? 66  LYS A CE     1 
ATOM   1020 N  NZ     . LYS A 1 66  ? 2.117   13.197  -8.329  1.00 76.54  ? 66  LYS A NZ     1 
ATOM   1021 H  H      . LYS A 1 66  ? 4.805   10.620  -2.814  1.00 68.61  ? 66  LYS A H      1 
ATOM   1022 H  HA     . LYS A 1 66  ? 3.758   10.469  -5.143  1.00 69.80  ? 66  LYS A HA     1 
ATOM   1023 H  HB2    . LYS A 1 66  ? 3.734   12.411  -3.769  1.00 75.75  ? 66  LYS A HB2    1 
ATOM   1024 H  HB3    . LYS A 1 66  ? 5.251   12.669  -4.144  1.00 75.75  ? 66  LYS A HB3    1 
ATOM   1025 H  HG2    . LYS A 1 66  ? 4.251   14.084  -5.488  1.00 89.18  ? 66  LYS A HG2    1 
ATOM   1026 H  HG3    . LYS A 1 66  ? 4.374   12.822  -6.449  1.00 89.18  ? 66  LYS A HG3    1 
ATOM   1027 H  HD2    . LYS A 1 66  ? 2.151   12.244  -5.938  1.00 103.27 ? 66  LYS A HD2    1 
ATOM   1028 H  HD3    . LYS A 1 66  ? 2.035   13.551  -5.038  1.00 103.27 ? 66  LYS A HD3    1 
ATOM   1029 H  HE2    . LYS A 1 66  ? 1.094   14.242  -6.941  1.00 92.71  ? 66  LYS A HE2    1 
ATOM   1030 H  HE3    . LYS A 1 66  ? 2.587   14.750  -7.133  1.00 92.71  ? 66  LYS A HE3    1 
ATOM   1031 H  HZ1    . LYS A 1 66  ? 1.856   13.704  -9.012  1.00 91.85  ? 66  LYS A HZ1    1 
ATOM   1032 H  HZ2    . LYS A 1 66  ? 2.958   12.940  -8.464  1.00 91.85  ? 66  LYS A HZ2    1 
ATOM   1033 H  HZ3    . LYS A 1 66  ? 1.597   12.476  -8.289  1.00 91.85  ? 66  LYS A HZ3    1 
ATOM   1034 N  N      . ILE A 1 67  ? 6.966   10.805  -5.285  1.00 53.72  ? 67  ILE A N      1 
ATOM   1035 C  CA     . ILE A 1 67  ? 8.157   10.721  -6.124  1.00 49.12  ? 67  ILE A CA     1 
ATOM   1036 C  C      . ILE A 1 67  ? 8.569   9.291   -6.478  1.00 49.37  ? 67  ILE A C      1 
ATOM   1037 O  O      . ILE A 1 67  ? 8.865   9.009   -7.630  1.00 50.03  ? 67  ILE A O      1 
ATOM   1038 C  CB     . ILE A 1 67  ? 9.351   11.428  -5.436  1.00 51.24  ? 67  ILE A CB     1 
ATOM   1039 C  CG1    . ILE A 1 67  ? 9.109   12.940  -5.383  1.00 46.40  ? 67  ILE A CG1    1 
ATOM   1040 C  CG2    . ILE A 1 67  ? 10.638  11.135  -6.176  1.00 48.71  ? 67  ILE A CG2    1 
ATOM   1041 C  CD1    . ILE A 1 67  ? 9.952   13.675  -4.338  1.00 51.47  ? 67  ILE A CD1    1 
ATOM   1042 H  H      . ILE A 1 67  ? 7.138   11.006  -4.466  1.00 64.46  ? 67  ILE A H      1 
ATOM   1043 H  HA     . ILE A 1 67  ? 7.979   11.193  -6.964  1.00 58.95  ? 67  ILE A HA     1 
ATOM   1044 H  HB     . ILE A 1 67  ? 9.430   11.093  -4.529  1.00 61.48  ? 67  ILE A HB     1 
ATOM   1045 H  HG12   . ILE A 1 67  ? 9.318   13.319  -6.251  1.00 55.68  ? 67  ILE A HG12   1 
ATOM   1046 H  HG13   . ILE A 1 67  ? 8.175   13.098  -5.173  1.00 55.68  ? 67  ILE A HG13   1 
ATOM   1047 H  HG21   . ILE A 1 67  ? 11.362  11.582  -5.732  1.00 58.46  ? 67  ILE A HG21   1 
ATOM   1048 H  HG22   . ILE A 1 67  ? 10.789  10.187  -6.176  1.00 58.46  ? 67  ILE A HG22   1 
ATOM   1049 H  HG23   . ILE A 1 67  ? 10.559  11.454  -7.078  1.00 58.46  ? 67  ILE A HG23   1 
ATOM   1050 H  HD11   . ILE A 1 67  ? 9.741   14.611  -4.370  1.00 61.76  ? 67  ILE A HD11   1 
ATOM   1051 H  HD12   . ILE A 1 67  ? 9.748   13.323  -3.468  1.00 61.76  ? 67  ILE A HD12   1 
ATOM   1052 H  HD13   . ILE A 1 67  ? 10.881  13.541  -4.536  1.00 61.76  ? 67  ILE A HD13   1 
ATOM   1053 N  N      . LEU A 1 68  ? 8.612   8.389   -5.497  1.00 41.21  ? 68  LEU A N      1 
ATOM   1054 C  CA     . LEU A 1 68  ? 9.002   6.999   -5.748  1.00 46.49  ? 68  LEU A CA     1 
ATOM   1055 C  C      . LEU A 1 68  ? 8.010   6.059   -5.087  1.00 55.26  ? 68  LEU A C      1 
ATOM   1056 O  O      . LEU A 1 68  ? 8.304   5.488   -4.034  1.00 47.86  ? 68  LEU A O      1 
ATOM   1057 C  CB     . LEU A 1 68  ? 10.388  6.692   -5.182  1.00 47.06  ? 68  LEU A CB     1 
ATOM   1058 C  CG     . LEU A 1 68  ? 11.612  7.433   -5.705  1.00 58.74  ? 68  LEU A CG     1 
ATOM   1059 C  CD1    . LEU A 1 68  ? 12.784  7.130   -4.786  1.00 52.48  ? 68  LEU A CD1    1 
ATOM   1060 C  CD2    . LEU A 1 68  ? 11.936  7.029   -7.156  1.00 53.82  ? 68  LEU A CD2    1 
ATOM   1061 H  H      . LEU A 1 68  ? 8.419   8.557   -4.676  1.00 49.45  ? 68  LEU A H      1 
ATOM   1062 H  HA     . LEU A 1 68  ? 9.008   6.824   -6.713  1.00 55.79  ? 68  LEU A HA     1 
ATOM   1063 H  HB2    . LEU A 1 68  ? 10.354  6.858   -4.227  1.00 56.47  ? 68  LEU A HB2    1 
ATOM   1064 H  HB3    . LEU A 1 68  ? 10.557  5.747   -5.326  1.00 56.47  ? 68  LEU A HB3    1 
ATOM   1065 H  HG     . LEU A 1 68  ? 11.444  8.388   -5.683  1.00 70.49  ? 68  LEU A HG     1 
ATOM   1066 H  HD11   . LEU A 1 68  ? 13.561  7.594   -5.108  1.00 62.97  ? 68  LEU A HD11   1 
ATOM   1067 H  HD12   . LEU A 1 68  ? 12.569  7.428   -3.898  1.00 62.97  ? 68  LEU A HD12   1 
ATOM   1068 H  HD13   . LEU A 1 68  ? 12.944  6.184   -4.785  1.00 62.97  ? 68  LEU A HD13   1 
ATOM   1069 H  HD21   . LEU A 1 68  ? 12.711  7.515   -7.449  1.00 64.59  ? 68  LEU A HD21   1 
ATOM   1070 H  HD22   . LEU A 1 68  ? 12.110  6.086   -7.186  1.00 64.59  ? 68  LEU A HD22   1 
ATOM   1071 H  HD23   . LEU A 1 68  ? 11.185  7.242   -7.714  1.00 64.59  ? 68  LEU A HD23   1 
ATOM   1072 N  N      . PRO A 1 69  ? 6.831   5.882   -5.697  1.00 57.25  ? 69  PRO A N      1 
ATOM   1073 C  CA     . PRO A 1 69  ? 5.814   5.067   -5.020  1.00 48.68  ? 69  PRO A CA     1 
ATOM   1074 C  C      . PRO A 1 69  ? 6.189   3.579   -4.887  1.00 50.02  ? 69  PRO A C      1 
ATOM   1075 O  O      . PRO A 1 69  ? 5.542   2.867   -4.126  1.00 53.32  ? 69  PRO A O      1 
ATOM   1076 C  CB     . PRO A 1 69  ? 4.565   5.271   -5.886  1.00 54.86  ? 69  PRO A CB     1 
ATOM   1077 C  CG     . PRO A 1 69  ? 5.097   5.638   -7.246  1.00 62.65  ? 69  PRO A CG     1 
ATOM   1078 C  CD     . PRO A 1 69  ? 6.370   6.403   -6.996  1.00 58.41  ? 69  PRO A CD     1 
ATOM   1079 H  HA     . PRO A 1 69  ? 5.640   5.429   -4.126  1.00 58.41  ? 69  PRO A HA     1 
ATOM   1080 H  HB2    . PRO A 1 69  ? 4.056   4.446   -5.927  1.00 65.84  ? 69  PRO A HB2    1 
ATOM   1081 H  HB3    . PRO A 1 69  ? 4.027   5.990   -5.522  1.00 65.84  ? 69  PRO A HB3    1 
ATOM   1082 H  HG2    . PRO A 1 69  ? 5.278   4.831   -7.753  1.00 75.17  ? 69  PRO A HG2    1 
ATOM   1083 H  HG3    . PRO A 1 69  ? 4.450   6.194   -7.708  1.00 75.17  ? 69  PRO A HG3    1 
ATOM   1084 H  HD2    . PRO A 1 69  ? 7.022   6.210   -7.688  1.00 70.09  ? 69  PRO A HD2    1 
ATOM   1085 H  HD3    . PRO A 1 69  ? 6.187   7.353   -6.934  1.00 70.09  ? 69  PRO A HD3    1 
ATOM   1086 N  N      . ASN A 1 70  ? 7.230   3.118   -5.571  1.00 47.32  ? 70  ASN A N      1 
ATOM   1087 C  CA     . ASN A 1 70  ? 7.621   1.706   -5.495  1.00 51.75  ? 70  ASN A CA     1 
ATOM   1088 C  C      . ASN A 1 70  ? 8.883   1.444   -4.669  1.00 50.69  ? 70  ASN A C      1 
ATOM   1089 O  O      . ASN A 1 70  ? 9.436   0.336   -4.702  1.00 47.34  ? 70  ASN A O      1 
ATOM   1090 C  CB     . ASN A 1 70  ? 7.829   1.132   -6.900  1.00 50.51  ? 70  ASN A CB     1 
ATOM   1091 C  CG     . ASN A 1 70  ? 6.581   1.240   -7.767  1.00 68.76  ? 70  ASN A CG     1 
ATOM   1092 O  OD1    . ASN A 1 70  ? 5.458   1.061   -7.290  1.00 61.30  ? 70  ASN A OD1    1 
ATOM   1093 N  ND2    . ASN A 1 70  ? 6.776   1.542   -9.050  1.00 63.31  ? 70  ASN A ND2    1 
ATOM   1094 H  H      . ASN A 1 70  ? 7.727   3.596   -6.085  1.00 56.79  ? 70  ASN A H      1 
ATOM   1095 H  HA     . ASN A 1 70  ? 6.889   1.205   -5.078  1.00 62.10  ? 70  ASN A HA     1 
ATOM   1096 H  HB2    . ASN A 1 70  ? 8.543   1.619   -7.339  1.00 60.61  ? 70  ASN A HB2    1 
ATOM   1097 H  HB3    . ASN A 1 70  ? 8.063   0.193   -6.827  1.00 60.61  ? 70  ASN A HB3    1 
ATOM   1098 H  HD21   . ASN A 1 70  ? 6.104   1.615   -9.581  1.00 75.97  ? 70  ASN A HD21   1 
ATOM   1099 H  HD22   . ASN A 1 70  ? 7.574   1.664   -9.347  1.00 75.97  ? 70  ASN A HD22   1 
ATOM   1100 N  N      . ALA A 1 71  ? 9.347   2.451   -3.936  1.00 51.21  ? 71  ALA A N      1 
ATOM   1101 C  CA     . ALA A 1 71  ? 10.534  2.283   -3.105  1.00 58.36  ? 71  ALA A CA     1 
ATOM   1102 C  C      . ALA A 1 71  ? 10.200  1.405   -1.898  1.00 49.82  ? 71  ALA A C      1 
ATOM   1103 O  O      . ALA A 1 71  ? 9.036   1.117   -1.634  1.00 46.52  ? 71  ALA A O      1 
ATOM   1104 C  CB     . ALA A 1 71  ? 11.067  3.636   -2.656  1.00 48.52  ? 71  ALA A CB     1 
ATOM   1105 H  H      . ALA A 1 71  ? 8.996   3.235   -3.903  1.00 61.45  ? 71  ALA A H      1 
ATOM   1106 H  HA     . ALA A 1 71  ? 11.233  1.836   -3.626  1.00 70.03  ? 71  ALA A HA     1 
ATOM   1107 H  HB1    . ALA A 1 71  ? 11.846  3.499   -2.112  1.00 58.22  ? 71  ALA A HB1    1 
ATOM   1108 H  HB2    . ALA A 1 71  ? 11.295  4.154   -3.431  1.00 58.22  ? 71  ALA A HB2    1 
ATOM   1109 H  HB3    . ALA A 1 71  ? 10.388  4.086   -2.149  1.00 58.22  ? 71  ALA A HB3    1 
ATOM   1110 N  N      . VAL A 1 72  ? 11.221  0.963   -1.178  1.00 43.37  ? 72  VAL A N      1 
ATOM   1111 C  CA     . VAL A 1 72  ? 10.994  0.245   0.073   1.00 41.62  ? 72  VAL A CA     1 
ATOM   1112 C  C      . VAL A 1 72  ? 10.933  1.265   1.202   1.00 49.02  ? 72  VAL A C      1 
ATOM   1113 O  O      . VAL A 1 72  ? 11.911  1.970   1.448   1.00 45.07  ? 72  VAL A O      1 
ATOM   1114 C  CB     . VAL A 1 72  ? 12.113  -0.762  0.341   1.00 48.31  ? 72  VAL A CB     1 
ATOM   1115 C  CG1    . VAL A 1 72  ? 11.795  -1.617  1.590   1.00 45.51  ? 72  VAL A CG1    1 
ATOM   1116 C  CG2    . VAL A 1 72  ? 12.327  -1.649  -0.892  1.00 49.73  ? 72  VAL A CG2    1 
ATOM   1117 H  H      . VAL A 1 72  ? 12.049  1.064   -1.386  1.00 52.04  ? 72  VAL A H      1 
ATOM   1118 H  HA     . VAL A 1 72  ? 10.139  -0.234  0.032   1.00 49.95  ? 72  VAL A HA     1 
ATOM   1119 H  HB     . VAL A 1 72  ? 12.946  -0.275  0.512   1.00 57.97  ? 72  VAL A HB     1 
ATOM   1120 H  HG11   . VAL A 1 72  ? 12.513  -2.238  1.733   1.00 54.61  ? 72  VAL A HG11   1 
ATOM   1121 H  HG12   . VAL A 1 72  ? 11.706  -1.038  2.350   1.00 54.61  ? 72  VAL A HG12   1 
ATOM   1122 H  HG13   . VAL A 1 72  ? 10.975  -2.093  1.442   1.00 54.61  ? 72  VAL A HG13   1 
ATOM   1123 H  HG21   . VAL A 1 72  ? 13.031  -2.274  -0.708  1.00 59.68  ? 72  VAL A HG21   1 
ATOM   1124 H  HG22   . VAL A 1 72  ? 11.512  -2.120  -1.083  1.00 59.68  ? 72  VAL A HG22   1 
ATOM   1125 H  HG23   . VAL A 1 72  ? 12.567  -1.094  -1.638  1.00 59.68  ? 72  VAL A HG23   1 
ATOM   1126 N  N      . TYR A 1 73  ? 9.779   1.375   1.853   1.00 43.08  ? 73  TYR A N      1 
ATOM   1127 C  CA     . TYR A 1 73  ? 9.605   2.290   2.988   1.00 44.81  ? 73  TYR A CA     1 
ATOM   1128 C  C      . TYR A 1 73  ? 9.636   1.514   4.300   1.00 55.71  ? 73  TYR A C      1 
ATOM   1129 O  O      . TYR A 1 73  ? 8.776   0.684   4.533   1.00 40.90  ? 73  TYR A O      1 
ATOM   1130 C  CB     . TYR A 1 73  ? 8.283   3.044   2.855   1.00 47.24  ? 73  TYR A CB     1 
ATOM   1131 C  CG     . TYR A 1 73  ? 8.313   4.021   1.709   1.00 46.43  ? 73  TYR A CG     1 
ATOM   1132 C  CD1    . TYR A 1 73  ? 8.586   5.364   1.929   1.00 40.31  ? 73  TYR A CD1    1 
ATOM   1133 C  CD2    . TYR A 1 73  ? 8.118   3.592   0.394   1.00 48.27  ? 73  TYR A CD2    1 
ATOM   1134 C  CE1    . TYR A 1 73  ? 8.647   6.266   0.886   1.00 44.01  ? 73  TYR A CE1    1 
ATOM   1135 C  CE2    . TYR A 1 73  ? 8.171   4.500   -0.674  1.00 43.69  ? 73  TYR A CE2    1 
ATOM   1136 C  CZ     . TYR A 1 73  ? 8.439   5.825   -0.420  1.00 44.46  ? 73  TYR A CZ     1 
ATOM   1137 O  OH     . TYR A 1 73  ? 8.498   6.730   -1.454  1.00 48.94  ? 73  TYR A OH     1 
ATOM   1138 H  H      . TYR A 1 73  ? 9.072   0.927   1.658   1.00 51.70  ? 73  TYR A H      1 
ATOM   1139 H  HA     . TYR A 1 73  ? 10.336  2.943   2.996   1.00 53.77  ? 73  TYR A HA     1 
ATOM   1140 H  HB2    . TYR A 1 73  ? 7.567   2.409   2.694   1.00 56.69  ? 73  TYR A HB2    1 
ATOM   1141 H  HB3    . TYR A 1 73  ? 8.114   3.539   3.672   1.00 56.69  ? 73  TYR A HB3    1 
ATOM   1142 H  HD1    . TYR A 1 73  ? 8.730   5.662   2.798   1.00 48.37  ? 73  TYR A HD1    1 
ATOM   1143 H  HD2    . TYR A 1 73  ? 7.941   2.695   0.226   1.00 57.92  ? 73  TYR A HD2    1 
ATOM   1144 H  HE1    . TYR A 1 73  ? 8.824   7.163   1.054   1.00 52.81  ? 73  TYR A HE1    1 
ATOM   1145 H  HE2    . TYR A 1 73  ? 8.034   4.208   -1.546  1.00 52.43  ? 73  TYR A HE2    1 
ATOM   1146 H  HH     . TYR A 1 73  ? 7.781   6.748   -1.852  1.00 58.73  ? 73  TYR A HH     1 
ATOM   1147 N  N      . LEU A 1 74  ? 10.626  1.789   5.147   1.00 42.72  ? 74  LEU A N      1 
ATOM   1148 C  CA     . LEU A 1 74  ? 10.830  1.030   6.372   1.00 42.47  ? 74  LEU A CA     1 
ATOM   1149 C  C      . LEU A 1 74  ? 10.676  1.943   7.587   1.00 49.91  ? 74  LEU A C      1 
ATOM   1150 O  O      . LEU A 1 74  ? 11.114  3.084   7.562   1.00 44.63  ? 74  LEU A O      1 
ATOM   1151 C  CB     . LEU A 1 74  ? 12.230  0.423   6.390   1.00 43.20  ? 74  LEU A CB     1 
ATOM   1152 C  CG     . LEU A 1 74  ? 12.613  -0.515  5.251   1.00 52.23  ? 74  LEU A CG     1 
ATOM   1153 C  CD1    . LEU A 1 74  ? 14.040  -0.948  5.431   1.00 47.83  ? 74  LEU A CD1    1 
ATOM   1154 C  CD2    . LEU A 1 74  ? 11.689  -1.733  5.187   1.00 54.17  ? 74  LEU A CD2    1 
ATOM   1155 H  H      . LEU A 1 74  ? 11.199  2.419   5.030   1.00 51.27  ? 74  LEU A H      1 
ATOM   1156 H  HA     . LEU A 1 74  ? 10.170  0.309   6.431   1.00 50.97  ? 74  LEU A HA     1 
ATOM   1157 H  HB2    . LEU A 1 74  ? 12.872  1.150   6.385   1.00 51.84  ? 74  LEU A HB2    1 
ATOM   1158 H  HB3    . LEU A 1 74  ? 12.327  -0.080  7.215   1.00 51.84  ? 74  LEU A HB3    1 
ATOM   1159 H  HG     . LEU A 1 74  ? 12.545  -0.039  4.408   1.00 62.67  ? 74  LEU A HG     1 
ATOM   1160 H  HD11   . LEU A 1 74  ? 14.280  -1.539  4.714   1.00 57.39  ? 74  LEU A HD11   1 
ATOM   1161 H  HD12   . LEU A 1 74  ? 14.605  -0.172  5.421   1.00 57.39  ? 74  LEU A HD12   1 
ATOM   1162 H  HD13   . LEU A 1 74  ? 14.124  -1.403  6.273   1.00 57.39  ? 74  LEU A HD13   1 
ATOM   1163 H  HD21   . LEU A 1 74  ? 11.963  -2.295  4.459   1.00 65.00  ? 74  LEU A HD21   1 
ATOM   1164 H  HD22   . LEU A 1 74  ? 11.751  -2.215  6.015   1.00 65.00  ? 74  LEU A HD22   1 
ATOM   1165 H  HD23   . LEU A 1 74  ? 10.787  -1.434  5.049   1.00 65.00  ? 74  LEU A HD23   1 
ATOM   1166 N  N      . PRO A 1 75  ? 10.045  1.443   8.660   1.00 52.33  ? 75  PRO A N      1 
ATOM   1167 C  CA     . PRO A 1 75  ? 10.001  2.250   9.885   1.00 50.51  ? 75  PRO A CA     1 
ATOM   1168 C  C      . PRO A 1 75  ? 11.372  2.319   10.554  1.00 47.64  ? 75  PRO A C      1 
ATOM   1169 O  O      . PRO A 1 75  ? 12.098  1.334   10.584  1.00 47.32  ? 75  PRO A O      1 
ATOM   1170 C  CB     . PRO A 1 75  ? 8.994   1.501   10.767  1.00 50.45  ? 75  PRO A CB     1 
ATOM   1171 C  CG     . PRO A 1 75  ? 9.039   0.085   10.282  1.00 49.46  ? 75  PRO A CG     1 
ATOM   1172 C  CD     . PRO A 1 75  ? 9.312   0.172   8.800   1.00 53.95  ? 75  PRO A CD     1 
ATOM   1173 H  HA     . PRO A 1 75  ? 9.674   3.154   9.697   1.00 60.62  ? 75  PRO A HA     1 
ATOM   1174 H  HB2    . PRO A 1 75  ? 9.268   1.555   11.696  1.00 60.54  ? 75  PRO A HB2    1 
ATOM   1175 H  HB3    . PRO A 1 75  ? 8.108   1.878   10.647  1.00 60.54  ? 75  PRO A HB3    1 
ATOM   1176 H  HG2    . PRO A 1 75  ? 9.753   -0.392  10.733  1.00 59.35  ? 75  PRO A HG2    1 
ATOM   1177 H  HG3    . PRO A 1 75  ? 8.184   -0.343  10.447  1.00 59.35  ? 75  PRO A HG3    1 
ATOM   1178 H  HD2    . PRO A 1 75  ? 9.866   -0.571  8.514   1.00 64.74  ? 75  PRO A HD2    1 
ATOM   1179 H  HD3    . PRO A 1 75  ? 8.479   0.206   8.304   1.00 64.74  ? 75  PRO A HD3    1 
ATOM   1180 N  N      . MET A 1 76  ? 11.708  3.490   11.082  1.00 43.69  ? 76  MET A N      1 
ATOM   1181 C  CA     . MET A 1 76  ? 12.966  3.714   11.784  1.00 45.74  ? 76  MET A CA     1 
ATOM   1182 C  C      . MET A 1 76  ? 13.102  2.740   12.957  1.00 48.66  ? 76  MET A C      1 
ATOM   1183 O  O      . MET A 1 76  ? 12.200  2.618   13.773  1.00 43.71  ? 76  MET A O      1 
ATOM   1184 C  CB     . MET A 1 76  ? 13.005  5.158   12.305  1.00 48.32  ? 76  MET A CB     1 
ATOM   1185 C  CG     . MET A 1 76  ? 14.411  5.706   12.494  1.00 50.44  ? 76  MET A CG     1 
ATOM   1186 S  SD     . MET A 1 76  ? 14.484  7.302   13.342  1.00 61.75  ? 76  MET A SD     1 
ATOM   1187 C  CE     . MET A 1 76  ? 13.379  7.055   14.742  1.00 72.23  ? 76  MET A CE     1 
ATOM   1188 H  H      . MET A 1 76  ? 11.209  4.189   11.046  1.00 52.43  ? 76  MET A H      1 
ATOM   1189 H  HA     . MET A 1 76  ? 13.714  3.587   11.164  1.00 54.89  ? 76  MET A HA     1 
ATOM   1190 H  HB2    . MET A 1 76  ? 12.546  5.731   11.671  1.00 57.98  ? 76  MET A HB2    1 
ATOM   1191 H  HB3    . MET A 1 76  ? 12.556  5.192   13.164  1.00 57.98  ? 76  MET A HB3    1 
ATOM   1192 H  HG2    . MET A 1 76  ? 14.925  5.071   13.018  1.00 60.53  ? 76  MET A HG2    1 
ATOM   1193 H  HG3    . MET A 1 76  ? 14.821  5.817   11.622  1.00 60.53  ? 76  MET A HG3    1 
ATOM   1194 H  HE1    . MET A 1 76  ? 13.350  7.861   15.262  1.00 86.68  ? 76  MET A HE1    1 
ATOM   1195 H  HE2    . MET A 1 76  ? 12.502  6.844   14.414  1.00 86.68  ? 76  MET A HE2    1 
ATOM   1196 H  HE3    . MET A 1 76  ? 13.711  6.331   15.277  1.00 86.68  ? 76  MET A HE3    1 
ATOM   1197 N  N      . ARG A 1 77  ? 14.224  2.029   13.018  1.00 41.53  ? 77  ARG A N      1 
ATOM   1198 C  CA     . ARG A 1 77  ? 14.531  1.163   14.164  1.00 51.80  ? 77  ARG A CA     1 
ATOM   1199 C  C      . ARG A 1 77  ? 15.744  1.737   14.883  1.00 43.53  ? 77  ARG A C      1 
ATOM   1200 O  O      . ARG A 1 77  ? 16.863  1.225   14.782  1.00 40.99  ? 77  ARG A O      1 
ATOM   1201 C  CB     . ARG A 1 77  ? 14.776  -0.276  13.697  1.00 46.39  ? 77  ARG A CB     1 
ATOM   1202 C  CG     . ARG A 1 77  ? 13.510  -0.919  13.110  1.00 48.95  ? 77  ARG A CG     1 
ATOM   1203 C  CD     . ARG A 1 77  ? 13.649  -2.422  12.889  1.00 44.42  ? 77  ARG A CD     1 
ATOM   1204 N  NE     . ARG A 1 77  ? 14.659  -2.749  11.890  1.00 47.65  ? 77  ARG A NE     1 
ATOM   1205 C  CZ     . ARG A 1 77  ? 15.141  -3.973  11.702  1.00 65.75  ? 77  ARG A CZ     1 
ATOM   1206 N  NH1    . ARG A 1 77  ? 14.713  -4.973  12.462  1.00 54.39  ? 77  ARG A NH1    1 
ATOM   1207 N  NH2    . ARG A 1 77  ? 16.063  -4.197  10.773  1.00 51.75  ? 77  ARG A NH2    1 
ATOM   1208 H  H      . ARG A 1 77  ? 14.830  2.028   12.408  1.00 49.84  ? 77  ARG A H      1 
ATOM   1209 H  HA     . ARG A 1 77  ? 13.773  1.163   14.786  1.00 62.17  ? 77  ARG A HA     1 
ATOM   1210 H  HB2    . ARG A 1 77  ? 15.460  -0.275  13.010  1.00 55.67  ? 77  ARG A HB2    1 
ATOM   1211 H  HB3    . ARG A 1 77  ? 15.063  -0.811  14.453  1.00 55.67  ? 77  ARG A HB3    1 
ATOM   1212 H  HG2    . ARG A 1 77  ? 12.771  -0.774  13.721  1.00 58.74  ? 77  ARG A HG2    1 
ATOM   1213 H  HG3    . ARG A 1 77  ? 13.317  -0.507  12.253  1.00 58.74  ? 77  ARG A HG3    1 
ATOM   1214 H  HD2    . ARG A 1 77  ? 13.905  -2.843  13.724  1.00 53.30  ? 77  ARG A HD2    1 
ATOM   1215 H  HD3    . ARG A 1 77  ? 12.799  -2.777  12.584  1.00 53.30  ? 77  ARG A HD3    1 
ATOM   1216 H  HE     . ARG A 1 77  ? 14.878  -2.139  11.325  1.00 57.18  ? 77  ARG A HE     1 
ATOM   1217 H  HH11   . ARG A 1 77  ? 14.118  -4.830  13.066  1.00 65.27  ? 77  ARG A HH11   1 
ATOM   1218 H  HH12   . ARG A 1 77  ? 15.026  -5.766  12.345  1.00 65.27  ? 77  ARG A HH12   1 
ATOM   1219 H  HH21   . ARG A 1 77  ? 16.345  -3.550  10.282  1.00 62.10  ? 77  ARG A HH21   1 
ATOM   1220 H  HH22   . ARG A 1 77  ? 16.375  -4.990  10.659  1.00 62.10  ? 77  ARG A HH22   1 
ATOM   1221 N  N      . LYS A 1 78  ? 15.524  2.832   15.597  1.00 41.87  ? 78  LYS A N      1 
ATOM   1222 C  CA     . LYS A 1 78  ? 16.634  3.627   16.108  1.00 44.18  ? 78  LYS A CA     1 
ATOM   1223 C  C      . LYS A 1 78  ? 17.530  2.820   17.048  1.00 45.78  ? 78  LYS A C      1 
ATOM   1224 O  O      . LYS A 1 78  ? 18.758  2.927   17.015  1.00 39.58  ? 78  LYS A O      1 
ATOM   1225 C  CB     . LYS A 1 78  ? 16.091  4.874   16.814  1.00 55.96  ? 78  LYS A CB     1 
ATOM   1226 C  CG     . LYS A 1 78  ? 17.130  5.679   17.546  1.00 58.99  ? 78  LYS A CG     1 
ATOM   1227 C  CD     . LYS A 1 78  ? 17.834  6.646   16.636  1.00 55.60  ? 78  LYS A CD     1 
ATOM   1228 C  CE     . LYS A 1 78  ? 18.183  7.903   17.398  1.00 56.63  ? 78  LYS A CE     1 
ATOM   1229 N  NZ     . LYS A 1 78  ? 16.935  8.537   17.903  1.00 67.95  ? 78  LYS A NZ     1 
ATOM   1230 H  H      . LYS A 1 78  ? 14.745  3.137   15.800  1.00 50.24  ? 78  LYS A H      1 
ATOM   1231 H  HA     . LYS A 1 78  ? 17.184  3.924   15.353  1.00 53.02  ? 78  LYS A HA     1 
ATOM   1232 H  HB2    . LYS A 1 78  ? 15.684  5.453   16.151  1.00 67.15  ? 78  LYS A HB2    1 
ATOM   1233 H  HB3    . LYS A 1 78  ? 15.423  4.598   17.461  1.00 67.15  ? 78  LYS A HB3    1 
ATOM   1234 H  HG2    . LYS A 1 78  ? 16.700  6.186   18.253  1.00 70.79  ? 78  LYS A HG2    1 
ATOM   1235 H  HG3    . LYS A 1 78  ? 17.793  5.078   17.920  1.00 70.79  ? 78  LYS A HG3    1 
ATOM   1236 H  HD2    . LYS A 1 78  ? 18.654  6.246   16.308  1.00 66.72  ? 78  LYS A HD2    1 
ATOM   1237 H  HD3    . LYS A 1 78  ? 17.251  6.883   15.899  1.00 66.72  ? 78  LYS A HD3    1 
ATOM   1238 H  HE2    . LYS A 1 78  ? 18.747  7.681   18.155  1.00 67.96  ? 78  LYS A HE2    1 
ATOM   1239 H  HE3    . LYS A 1 78  ? 18.632  8.529   16.808  1.00 67.96  ? 78  LYS A HE3    1 
ATOM   1240 H  HZ1    . LYS A 1 78  ? 16.506  7.975   18.444  1.00 81.54  ? 78  LYS A HZ1    1 
ATOM   1241 H  HZ2    . LYS A 1 78  ? 17.131  9.279   18.353  1.00 81.54  ? 78  LYS A HZ2    1 
ATOM   1242 H  HZ3    . LYS A 1 78  ? 16.402  8.745   17.221  1.00 81.54  ? 78  LYS A HZ3    1 
ATOM   1243 N  N      . GLU A 1 79  ? 16.915  2.011   17.894  1.00 38.78  ? 79  GLU A N      1 
ATOM   1244 C  CA     . GLU A 1 79  ? 17.680  1.219   18.851  1.00 49.49  ? 79  GLU A CA     1 
ATOM   1245 C  C      . GLU A 1 79  ? 18.620  0.226   18.144  1.00 46.10  ? 79  GLU A C      1 
ATOM   1246 O  O      . GLU A 1 79  ? 19.706  -0.064  18.633  1.00 45.66  ? 79  GLU A O      1 
ATOM   1247 C  CB     . GLU A 1 79  ? 16.743  0.539   19.863  1.00 52.14  ? 79  GLU A CB     1 
ATOM   1248 C  CG     . GLU A 1 79  ? 15.726  -0.464  19.275  1.00 71.94  ? 79  GLU A CG     1 
ATOM   1249 C  CD     . GLU A 1 79  ? 14.796  0.105   18.179  1.00 72.18  ? 79  GLU A CD     1 
ATOM   1250 O  OE1    . GLU A 1 79  ? 14.348  1.276   18.276  1.00 68.06  ? 79  GLU A OE1    1 
ATOM   1251 O  OE2    . GLU A 1 79  ? 14.497  -0.645  17.218  1.00 68.77  ? 79  GLU A OE2    1 
ATOM   1252 H  H      . GLU A 1 79  ? 16.063  1.900   17.937  1.00 46.53  ? 79  GLU A H      1 
ATOM   1253 H  HA     . GLU A 1 79  ? 18.250  1.833   19.361  1.00 59.39  ? 79  GLU A HA     1 
ATOM   1254 H  HB2    . GLU A 1 79  ? 17.286  0.057   20.506  1.00 62.56  ? 79  GLU A HB2    1 
ATOM   1255 H  HB3    . GLU A 1 79  ? 16.237  1.228   20.321  1.00 62.56  ? 79  GLU A HB3    1 
ATOM   1256 H  HG2    . GLU A 1 79  ? 16.215  -1.206  18.887  1.00 86.33  ? 79  GLU A HG2    1 
ATOM   1257 H  HG3    . GLU A 1 79  ? 15.163  -0.789  19.996  1.00 86.33  ? 79  GLU A HG3    1 
ATOM   1258 N  N      . VAL A 1 80  ? 18.226  -0.269  16.978  1.00 44.15  ? 80  VAL A N      1 
ATOM   1259 C  CA     . VAL A 1 80  ? 19.129  -1.096  16.171  1.00 41.22  ? 80  VAL A CA     1 
ATOM   1260 C  C      . VAL A 1 80  ? 20.302  -0.275  15.650  1.00 40.66  ? 80  VAL A C      1 
ATOM   1261 O  O      . VAL A 1 80  ? 21.450  -0.681  15.777  1.00 39.06  ? 80  VAL A O      1 
ATOM   1262 C  CB     . VAL A 1 80  ? 18.434  -1.684  14.930  1.00 49.64  ? 80  VAL A CB     1 
ATOM   1263 C  CG1    . VAL A 1 80  ? 19.406  -2.584  14.171  1.00 43.84  ? 80  VAL A CG1    1 
ATOM   1264 C  CG2    . VAL A 1 80  ? 17.156  -2.424  15.316  1.00 48.68  ? 80  VAL A CG2    1 
ATOM   1265 H  H      . VAL A 1 80  ? 17.449  -0.146  16.629  1.00 52.97  ? 80  VAL A H      1 
ATOM   1266 H  HA     . VAL A 1 80  ? 19.477  -1.832  16.716  1.00 49.47  ? 80  VAL A HA     1 
ATOM   1267 H  HB     . VAL A 1 80  ? 18.183  -0.948  14.334  1.00 59.57  ? 80  VAL A HB     1 
ATOM   1268 H  HG11   . VAL A 1 80  ? 18.960  -2.943  13.400  1.00 52.61  ? 80  VAL A HG11   1 
ATOM   1269 H  HG12   . VAL A 1 80  ? 20.165  -2.063  13.898  1.00 52.61  ? 80  VAL A HG12   1 
ATOM   1270 H  HG13   . VAL A 1 80  ? 19.687  -3.296  14.749  1.00 52.61  ? 80  VAL A HG13   1 
ATOM   1271 H  HG21   . VAL A 1 80  ? 16.748  -2.778  14.522  1.00 58.41  ? 80  VAL A HG21   1 
ATOM   1272 H  HG22   . VAL A 1 80  ? 17.379  -3.139  15.917  1.00 58.41  ? 80  VAL A HG22   1 
ATOM   1273 H  HG23   . VAL A 1 80  ? 16.557  -1.809  15.746  1.00 58.41  ? 80  VAL A HG23   1 
ATOM   1274 N  N      . TYR A 1 81  ? 20.024  0.885   15.052  1.00 32.68  ? 81  TYR A N      1 
ATOM   1275 C  CA     . TYR A 1 81  ? 21.122  1.707   14.530  1.00 41.48  ? 81  TYR A CA     1 
ATOM   1276 C  C      . TYR A 1 81  ? 22.049  2.130   15.661  1.00 37.08  ? 81  TYR A C      1 
ATOM   1277 O  O      . TYR A 1 81  ? 23.258  2.211   15.485  1.00 35.94  ? 81  TYR A O      1 
ATOM   1278 C  CB     . TYR A 1 81  ? 20.594  2.941   13.790  1.00 34.43  ? 81  TYR A CB     1 
ATOM   1279 C  CG     . TYR A 1 81  ? 19.402  2.635   12.924  1.00 35.81  ? 81  TYR A CG     1 
ATOM   1280 C  CD1    . TYR A 1 81  ? 19.337  1.446   12.197  1.00 35.65  ? 81  TYR A CD1    1 
ATOM   1281 C  CD2    . TYR A 1 81  ? 18.330  3.509   12.858  1.00 39.80  ? 81  TYR A CD2    1 
ATOM   1282 C  CE1    . TYR A 1 81  ? 18.240  1.155   11.413  1.00 42.76  ? 81  TYR A CE1    1 
ATOM   1283 C  CE2    . TYR A 1 81  ? 17.228  3.228   12.082  1.00 43.00  ? 81  TYR A CE2    1 
ATOM   1284 C  CZ     . TYR A 1 81  ? 17.188  2.052   11.360  1.00 45.04  ? 81  TYR A CZ     1 
ATOM   1285 O  OH     . TYR A 1 81  ? 16.089  1.781   10.589  1.00 42.51  ? 81  TYR A OH     1 
ATOM   1286 H  H      . TYR A 1 81  ? 19.237  1.211   14.939  1.00 39.22  ? 81  TYR A H      1 
ATOM   1287 H  HA     . TYR A 1 81  ? 21.643  1.174   13.894  1.00 49.78  ? 81  TYR A HA     1 
ATOM   1288 H  HB2    . TYR A 1 81  ? 20.329  3.610   14.441  1.00 41.32  ? 81  TYR A HB2    1 
ATOM   1289 H  HB3    . TYR A 1 81  ? 21.297  3.293   13.220  1.00 41.32  ? 81  TYR A HB3    1 
ATOM   1290 H  HD1    . TYR A 1 81  ? 20.047  0.846   12.234  1.00 42.78  ? 81  TYR A HD1    1 
ATOM   1291 H  HD2    . TYR A 1 81  ? 18.358  4.301   13.344  1.00 47.76  ? 81  TYR A HD2    1 
ATOM   1292 H  HE1    . TYR A 1 81  ? 18.207  0.364   10.926  1.00 51.32  ? 81  TYR A HE1    1 
ATOM   1293 H  HE2    . TYR A 1 81  ? 16.518  3.828   12.042  1.00 51.61  ? 81  TYR A HE2    1 
ATOM   1294 H  HH     . TYR A 1 81  ? 15.735  1.085   10.840  1.00 51.01  ? 81  TYR A HH     1 
ATOM   1295 N  N      . GLN A 1 82  ? 21.477  2.386   16.827  1.00 38.76  ? 82  GLN A N      1 
ATOM   1296 C  CA     . GLN A 1 82  ? 22.268  2.844   17.965  1.00 43.13  ? 82  GLN A CA     1 
ATOM   1297 C  C      . GLN A 1 82  ? 23.235  1.737   18.391  1.00 45.23  ? 82  GLN A C      1 
ATOM   1298 O  O      . GLN A 1 82  ? 24.397  1.992   18.691  1.00 42.72  ? 82  GLN A O      1 
ATOM   1299 C  CB     . GLN A 1 82  ? 21.352  3.247   19.131  1.00 46.17  ? 82  GLN A CB     1 
ATOM   1300 C  CG     . GLN A 1 82  ? 22.110  3.715   20.357  1.00 54.34  ? 82  GLN A CG     1 
ATOM   1301 C  CD     . GLN A 1 82  ? 22.993  4.911   20.056  1.00 57.67  ? 82  GLN A CD     1 
ATOM   1302 O  OE1    . GLN A 1 82  ? 22.496  6.017   19.829  1.00 56.47  ? 82  GLN A OE1    1 
ATOM   1303 N  NE2    . GLN A 1 82  ? 24.310  4.691   20.027  1.00 47.50  ? 82  GLN A NE2    1 
ATOM   1304 H  H      . GLN A 1 82  ? 20.636  2.305   16.988  1.00 46.51  ? 82  GLN A H      1 
ATOM   1305 H  HA     . GLN A 1 82  ? 22.794  3.628   17.701  1.00 51.75  ? 82  GLN A HA     1 
ATOM   1306 H  HB2    . GLN A 1 82  ? 20.776  3.972   18.842  1.00 55.41  ? 82  GLN A HB2    1 
ATOM   1307 H  HB3    . GLN A 1 82  ? 20.815  2.481   19.388  1.00 55.41  ? 82  GLN A HB3    1 
ATOM   1308 H  HG2    . GLN A 1 82  ? 21.476  3.973   21.045  1.00 65.21  ? 82  GLN A HG2    1 
ATOM   1309 H  HG3    . GLN A 1 82  ? 22.675  2.995   20.677  1.00 65.21  ? 82  GLN A HG3    1 
ATOM   1310 H  HE21   . GLN A 1 82  ? 24.850  5.339   19.860  1.00 57.00  ? 82  GLN A HE21   1 
ATOM   1311 H  HE22   . GLN A 1 82  ? 24.617  3.902   20.175  1.00 57.00  ? 82  GLN A HE22   1 
ATOM   1312 N  N      . GLN A 1 83  ? 22.765  0.494   18.392  1.00 42.32  ? 83  GLN A N      1 
ATOM   1313 C  CA     . GLN A 1 83  ? 23.641  -0.622  18.741  1.00 48.17  ? 83  GLN A CA     1 
ATOM   1314 C  C      . GLN A 1 83  ? 24.767  -0.796  17.714  1.00 49.17  ? 83  GLN A C      1 
ATOM   1315 O  O      . GLN A 1 83  ? 25.933  -0.915  18.095  1.00 40.82  ? 83  GLN A O      1 
ATOM   1316 C  CB     . GLN A 1 83  ? 22.835  -1.911  18.945  1.00 49.36  ? 83  GLN A CB     1 
ATOM   1317 C  CG     . GLN A 1 83  ? 21.889  -1.812  20.144  1.00 66.28  ? 83  GLN A CG     1 
ATOM   1318 C  CD     . GLN A 1 83  ? 21.483  -3.158  20.731  1.00 74.97  ? 83  GLN A CD     1 
ATOM   1319 O  OE1    . GLN A 1 83  ? 21.163  -4.099  20.008  1.00 66.16  ? 83  GLN A OE1    1 
ATOM   1320 N  NE2    . GLN A 1 83  ? 21.482  -3.243  22.055  1.00 73.80  ? 83  GLN A NE2    1 
ATOM   1321 H  H      . GLN A 1 83  ? 21.957  0.271   18.198  1.00 50.78  ? 83  GLN A H      1 
ATOM   1322 H  HA     . GLN A 1 83  ? 24.067  -0.414  19.598  1.00 57.80  ? 83  GLN A HA     1 
ATOM   1323 H  HB2    . GLN A 1 83  ? 22.302  -2.082  18.153  1.00 59.24  ? 83  GLN A HB2    1 
ATOM   1324 H  HB3    . GLN A 1 83  ? 23.447  -2.647  19.102  1.00 59.24  ? 83  GLN A HB3    1 
ATOM   1325 H  HG2    . GLN A 1 83  ? 22.327  -1.305  20.845  1.00 79.54  ? 83  GLN A HG2    1 
ATOM   1326 H  HG3    . GLN A 1 83  ? 21.080  -1.355  19.866  1.00 79.54  ? 83  GLN A HG3    1 
ATOM   1327 H  HE21   . GLN A 1 83  ? 21.261  -3.981  22.438  1.00 88.55  ? 83  GLN A HE21   1 
ATOM   1328 H  HE22   . GLN A 1 83  ? 21.703  -2.561  22.531  1.00 88.55  ? 83  GLN A HE22   1 
ATOM   1329 N  N      . VAL A 1 84  ? 24.432  -0.798  16.423  1.00 39.86  ? 84  VAL A N      1 
ATOM   1330 C  CA     . VAL A 1 84  ? 25.456  -0.899  15.384  1.00 42.53  ? 84  VAL A CA     1 
ATOM   1331 C  C      . VAL A 1 84  ? 26.458  0.235   15.530  1.00 42.19  ? 84  VAL A C      1 
ATOM   1332 O  O      . VAL A 1 84  ? 27.679  0.035   15.427  1.00 43.04  ? 84  VAL A O      1 
ATOM   1333 C  CB     . VAL A 1 84  ? 24.838  -0.863  13.971  1.00 39.24  ? 84  VAL A CB     1 
ATOM   1334 C  CG1    . VAL A 1 84  ? 25.938  -0.771  12.899  1.00 34.71  ? 84  VAL A CG1    1 
ATOM   1335 C  CG2    . VAL A 1 84  ? 23.984  -2.097  13.766  1.00 41.00  ? 84  VAL A CG2    1 
ATOM   1336 H  H      . VAL A 1 84  ? 23.628  -0.742  16.125  1.00 47.84  ? 84  VAL A H      1 
ATOM   1337 H  HA     . VAL A 1 84  ? 25.936  -1.747  15.486  1.00 51.04  ? 84  VAL A HA     1 
ATOM   1338 H  HB     . VAL A 1 84  ? 24.263  -0.074  13.890  1.00 47.09  ? 84  VAL A HB     1 
ATOM   1339 H  HG11   . VAL A 1 84  ? 25.527  -0.750  12.032  1.00 41.66  ? 84  VAL A HG11   1 
ATOM   1340 H  HG12   . VAL A 1 84  ? 26.445  0.032   13.041  1.00 41.66  ? 84  VAL A HG12   1 
ATOM   1341 H  HG13   . VAL A 1 84  ? 26.511  -1.538  12.973  1.00 41.66  ? 84  VAL A HG13   1 
ATOM   1342 H  HG21   . VAL A 1 84  ? 23.602  -2.069  12.885  1.00 49.20  ? 84  VAL A HG21   1 
ATOM   1343 H  HG22   . VAL A 1 84  ? 24.535  -2.877  13.859  1.00 49.20  ? 84  VAL A HG22   1 
ATOM   1344 H  HG23   . VAL A 1 84  ? 23.286  -2.107  14.425  1.00 49.20  ? 84  VAL A HG23   1 
ATOM   1345 N  N      . SER A 1 85  ? 25.943  1.435   15.781  1.00 39.72  ? 85  SER A N      1 
ATOM   1346 C  CA     . SER A 1 85  ? 26.797  2.601   15.915  1.00 38.57  ? 85  SER A CA     1 
ATOM   1347 C  C      . SER A 1 85  ? 27.774  2.427   17.086  1.00 33.54  ? 85  SER A C      1 
ATOM   1348 O  O      . SER A 1 85  ? 28.977  2.668   16.949  1.00 37.46  ? 85  SER A O      1 
ATOM   1349 C  CB     . SER A 1 85  ? 25.950  3.852   16.158  1.00 41.00  ? 85  SER A CB     1 
ATOM   1350 O  OG     . SER A 1 85  ? 26.784  4.944   16.517  1.00 38.04  ? 85  SER A OG     1 
ATOM   1351 H  H      . SER A 1 85  ? 25.104  1.597   15.878  1.00 47.67  ? 85  SER A H      1 
ATOM   1352 H  HA     . SER A 1 85  ? 27.314  2.727   15.092  1.00 46.29  ? 85  SER A HA     1 
ATOM   1353 H  HB2    . SER A 1 85  ? 25.469  4.073   15.345  1.00 49.21  ? 85  SER A HB2    1 
ATOM   1354 H  HB3    . SER A 1 85  ? 25.325  3.678   16.879  1.00 49.21  ? 85  SER A HB3    1 
ATOM   1355 H  HG     . SER A 1 85  ? 26.329  5.614   16.647  1.00 45.65  ? 85  SER A HG     1 
ATOM   1356 N  N      . SER A 1 86  ? 27.250  2.026   18.240  1.00 39.84  ? 86  SER A N      1 
ATOM   1357 C  CA     . SER A 1 86  ? 28.090  1.828   19.425  1.00 40.91  ? 86  SER A CA     1 
ATOM   1358 C  C      . SER A 1 86  ? 29.237  0.873   19.142  1.00 49.18  ? 86  SER A C      1 
ATOM   1359 O  O      . SER A 1 86  ? 30.329  1.036   19.679  1.00 38.34  ? 86  SER A O      1 
ATOM   1360 C  CB     . SER A 1 86  ? 27.265  1.293   20.587  1.00 43.44  ? 86  SER A CB     1 
ATOM   1361 O  OG     . SER A 1 86  ? 26.519  2.338   21.178  1.00 57.38  ? 86  SER A OG     1 
ATOM   1362 H  H      . SER A 1 86  ? 26.416  1.862   18.366  1.00 47.80  ? 86  SER A H      1 
ATOM   1363 H  HA     . SER A 1 86  ? 28.472  2.689   19.695  1.00 49.09  ? 86  SER A HA     1 
ATOM   1364 H  HB2    . SER A 1 86  ? 26.655  0.614   20.258  1.00 52.13  ? 86  SER A HB2    1 
ATOM   1365 H  HB3    . SER A 1 86  ? 27.860  0.912   21.251  1.00 52.13  ? 86  SER A HB3    1 
ATOM   1366 H  HG     . SER A 1 86  ? 26.075  2.047   21.804  1.00 68.86  ? 86  SER A HG     1 
ATOM   1367 N  N      . ARG A 1 87  ? 28.997  -0.127  18.301  1.00 44.56  ? 87  ARG A N      1 
ATOM   1368 C  CA     . ARG A 1 87  ? 30.035  -1.105  18.004  1.00 47.51  ? 87  ARG A CA     1 
ATOM   1369 C  C      . ARG A 1 87  ? 31.131  -0.497  17.126  1.00 50.36  ? 87  ARG A C      1 
ATOM   1370 O  O      . ARG A 1 87  ? 32.321  -0.746  17.341  1.00 49.22  ? 87  ARG A O      1 
ATOM   1371 C  CB     . ARG A 1 87  ? 29.437  -2.361  17.355  1.00 43.82  ? 87  ARG A CB     1 
ATOM   1372 C  CG     . ARG A 1 87  ? 28.520  -3.174  18.281  1.00 44.12  ? 87  ARG A CG     1 
ATOM   1373 C  CD     . ARG A 1 87  ? 28.407  -4.631  17.792  1.00 56.17  ? 87  ARG A CD     1 
ATOM   1374 N  NE     . ARG A 1 87  ? 27.947  -4.717  16.403  1.00 45.01  ? 87  ARG A NE     1 
ATOM   1375 C  CZ     . ARG A 1 87  ? 26.683  -4.904  16.037  1.00 53.15  ? 87  ARG A CZ     1 
ATOM   1376 N  NH1    . ARG A 1 87  ? 25.730  -5.033  16.955  1.00 45.35  ? 87  ARG A NH1    1 
ATOM   1377 N  NH2    . ARG A 1 87  ? 26.370  -4.966  14.744  1.00 43.26  ? 87  ARG A NH2    1 
ATOM   1378 H  H      . ARG A 1 87  ? 28.251  -0.261  17.894  1.00 53.47  ? 87  ARG A H      1 
ATOM   1379 H  HA     . ARG A 1 87  ? 30.453  -1.380  18.847  1.00 57.01  ? 87  ARG A HA     1 
ATOM   1380 H  HB2    . ARG A 1 87  ? 28.914  -2.093  16.583  1.00 52.58  ? 87  ARG A HB2    1 
ATOM   1381 H  HB3    . ARG A 1 87  ? 30.162  -2.941  17.074  1.00 52.58  ? 87  ARG A HB3    1 
ATOM   1382 H  HG2    . ARG A 1 87  ? 28.889  -3.179  19.178  1.00 52.94  ? 87  ARG A HG2    1 
ATOM   1383 H  HG3    . ARG A 1 87  ? 27.633  -2.781  18.283  1.00 52.94  ? 87  ARG A HG3    1 
ATOM   1384 H  HD2    . ARG A 1 87  ? 29.278  -5.053  17.848  1.00 67.41  ? 87  ARG A HD2    1 
ATOM   1385 H  HD3    . ARG A 1 87  ? 27.770  -5.104  18.350  1.00 67.41  ? 87  ARG A HD3    1 
ATOM   1386 H  HE     . ARG A 1 87  ? 28.537  -4.642  15.782  1.00 54.01  ? 87  ARG A HE     1 
ATOM   1387 H  HH11   . ARG A 1 87  ? 25.930  -4.993  17.790  1.00 54.42  ? 87  ARG A HH11   1 
ATOM   1388 H  HH12   . ARG A 1 87  ? 24.914  -5.154  16.713  1.00 54.42  ? 87  ARG A HH12   1 
ATOM   1389 H  HH21   . ARG A 1 87  ? 26.985  -4.884  14.148  1.00 51.91  ? 87  ARG A HH21   1 
ATOM   1390 H  HH22   . ARG A 1 87  ? 25.553  -5.088  14.505  1.00 51.91  ? 87  ARG A HH22   1 
ATOM   1391 N  N      . ILE A 1 88  ? 30.741  0.313   16.149  1.00 38.21  ? 88  ILE A N      1 
ATOM   1392 C  CA     . ILE A 1 88  ? 31.718  0.963   15.279  1.00 42.25  ? 88  ILE A CA     1 
ATOM   1393 C  C      . ILE A 1 88  ? 32.555  1.999   16.054  1.00 49.25  ? 88  ILE A C      1 
ATOM   1394 O  O      . ILE A 1 88  ? 33.749  2.168   15.808  1.00 48.82  ? 88  ILE A O      1 
ATOM   1395 C  CB     . ILE A 1 88  ? 31.026  1.642   14.080  1.00 41.07  ? 88  ILE A CB     1 
ATOM   1396 C  CG1    . ILE A 1 88  ? 30.418  0.583   13.148  1.00 41.85  ? 88  ILE A CG1    1 
ATOM   1397 C  CG2    . ILE A 1 88  ? 32.012  2.523   13.317  1.00 43.98  ? 88  ILE A CG2    1 
ATOM   1398 C  CD1    . ILE A 1 88  ? 29.351  1.131   12.235  1.00 52.38  ? 88  ILE A CD1    1 
ATOM   1399 H  H      . ILE A 1 88  ? 29.922  0.503   15.968  1.00 45.86  ? 88  ILE A H      1 
ATOM   1400 H  HA     . ILE A 1 88  ? 32.331  0.284   14.927  1.00 50.70  ? 88  ILE A HA     1 
ATOM   1401 H  HB     . ILE A 1 88  ? 30.310  2.203   14.416  1.00 49.28  ? 88  ILE A HB     1 
ATOM   1402 H  HG12   . ILE A 1 88  ? 31.122  0.212   12.593  1.00 50.22  ? 88  ILE A HG12   1 
ATOM   1403 H  HG13   . ILE A 1 88  ? 30.018  -0.117  13.687  1.00 50.22  ? 88  ILE A HG13   1 
ATOM   1404 H  HG21   . ILE A 1 88  ? 31.557  2.933   12.578  1.00 52.78  ? 88  ILE A HG21   1 
ATOM   1405 H  HG22   . ILE A 1 88  ? 32.350  3.199   13.910  1.00 52.78  ? 88  ILE A HG22   1 
ATOM   1406 H  HG23   . ILE A 1 88  ? 32.734  1.978   12.996  1.00 52.78  ? 88  ILE A HG23   1 
ATOM   1407 H  HD11   . ILE A 1 88  ? 29.017  0.419   11.683  1.00 62.85  ? 88  ILE A HD11   1 
ATOM   1408 H  HD12   . ILE A 1 88  ? 28.640  1.494   12.768  1.00 62.85  ? 88  ILE A HD12   1 
ATOM   1409 H  HD13   . ILE A 1 88  ? 29.733  1.819   11.686  1.00 62.85  ? 88  ILE A HD13   1 
ATOM   1410 N  N      . MET A 1 89  ? 31.925  2.699   16.989  1.00 41.10  ? 89  MET A N      1 
ATOM   1411 C  CA     . MET A 1 89  ? 32.646  3.674   17.804  1.00 50.30  ? 89  MET A CA     1 
ATOM   1412 C  C      . MET A 1 89  ? 33.703  2.944   18.632  1.00 54.06  ? 89  MET A C      1 
ATOM   1413 O  O      . MET A 1 89  ? 34.814  3.442   18.791  1.00 52.29  ? 89  MET A O      1 
ATOM   1414 C  CB     . MET A 1 89  ? 31.700  4.467   18.717  1.00 40.62  ? 89  MET A CB     1 
ATOM   1415 C  CG     . MET A 1 89  ? 30.653  5.342   17.963  1.00 43.03  ? 89  MET A CG     1 
ATOM   1416 S  SD     . MET A 1 89  ? 31.378  6.461   16.761  1.00 48.90  ? 89  MET A SD     1 
ATOM   1417 C  CE     . MET A 1 89  ? 29.922  7.205   16.007  1.00 44.65  ? 89  MET A CE     1 
ATOM   1418 H  H      . MET A 1 89  ? 31.087  2.632   17.172  1.00 49.32  ? 89  MET A H      1 
ATOM   1419 H  HA     . MET A 1 89  ? 33.095  4.312   17.211  1.00 60.36  ? 89  MET A HA     1 
ATOM   1420 H  HB2    . MET A 1 89  ? 31.213  3.842   19.276  1.00 48.74  ? 89  MET A HB2    1 
ATOM   1421 H  HB3    . MET A 1 89  ? 32.231  5.058   19.274  1.00 48.74  ? 89  MET A HB3    1 
ATOM   1422 H  HG2    . MET A 1 89  ? 30.039  4.758   17.492  1.00 51.63  ? 89  MET A HG2    1 
ATOM   1423 H  HG3    . MET A 1 89  ? 30.168  5.876   18.611  1.00 51.63  ? 89  MET A HG3    1 
ATOM   1424 H  HE1    . MET A 1 89  ? 30.204  7.831   15.337  1.00 53.59  ? 89  MET A HE1    1 
ATOM   1425 H  HE2    . MET A 1 89  ? 29.390  6.513   15.607  1.00 53.59  ? 89  MET A HE2    1 
ATOM   1426 H  HE3    . MET A 1 89  ? 29.416  7.656   16.686  1.00 53.59  ? 89  MET A HE3    1 
ATOM   1427 N  N      . ASN A 1 90  ? 33.364  1.761   19.143  1.00 53.96  ? 90  ASN A N      1 
ATOM   1428 C  CA     . ASN A 1 90  ? 34.349  0.937   19.860  1.00 57.32  ? 90  ASN A CA     1 
ATOM   1429 C  C      . ASN A 1 90  ? 35.540  0.572   18.972  1.00 62.92  ? 90  ASN A C      1 
ATOM   1430 O  O      . ASN A 1 90  ? 36.678  0.492   19.448  1.00 63.79  ? 90  ASN A O      1 
ATOM   1431 C  CB     . ASN A 1 90  ? 33.701  -0.319  20.441  1.00 53.48  ? 90  ASN A CB     1 
ATOM   1432 C  CG     . ASN A 1 90  ? 32.823  -0.009  21.643  1.00 62.90  ? 90  ASN A CG     1 
ATOM   1433 O  OD1    . ASN A 1 90  ? 33.037  0.986   22.333  1.00 59.07  ? 90  ASN A OD1    1 
ATOM   1434 N  ND2    . ASN A 1 90  ? 31.832  -0.854  21.896  1.00 61.05  ? 90  ASN A ND2    1 
ATOM   1435 H  H      . ASN A 1 90  ? 32.580  1.411   19.091  1.00 64.75  ? 90  ASN A H      1 
ATOM   1436 H  HA     . ASN A 1 90  ? 34.696  1.460   20.613  1.00 68.79  ? 90  ASN A HA     1 
ATOM   1437 H  HB2    . ASN A 1 90  ? 33.147  -0.734  19.761  1.00 64.18  ? 90  ASN A HB2    1 
ATOM   1438 H  HB3    . ASN A 1 90  ? 34.396  -0.933  20.725  1.00 64.18  ? 90  ASN A HB3    1 
ATOM   1439 H  HD21   . ASN A 1 90  ? 31.311  -0.716  22.567  1.00 73.25  ? 90  ASN A HD21   1 
ATOM   1440 H  HD22   . ASN A 1 90  ? 31.711  -1.538  21.391  1.00 73.25  ? 90  ASN A HD22   1 
ATOM   1441 N  N      . LEU A 1 91  ? 35.295  0.381   17.677  1.00 54.41  ? 91  LEU A N      1 
ATOM   1442 C  CA     . LEU A 1 91  ? 36.394  0.118   16.765  1.00 51.96  ? 91  LEU A CA     1 
ATOM   1443 C  C      . LEU A 1 91  ? 37.312  1.339   16.695  1.00 59.01  ? 91  LEU A C      1 
ATOM   1444 O  O      . LEU A 1 91  ? 38.528  1.203   16.755  1.00 60.67  ? 91  LEU A O      1 
ATOM   1445 C  CB     . LEU A 1 91  ? 35.888  -0.255  15.372  1.00 53.10  ? 91  LEU A CB     1 
ATOM   1446 C  CG     . LEU A 1 91  ? 35.067  -1.546  15.280  1.00 62.69  ? 91  LEU A CG     1 
ATOM   1447 C  CD1    . LEU A 1 91  ? 34.750  -1.879  13.826  1.00 49.50  ? 91  LEU A CD1    1 
ATOM   1448 C  CD2    . LEU A 1 91  ? 35.797  -2.714  15.951  1.00 60.40  ? 91  LEU A CD2    1 
ATOM   1449 H  H      . LEU A 1 91  ? 34.517  0.398   17.312  1.00 65.29  ? 91  LEU A H      1 
ATOM   1450 H  HA     . LEU A 1 91  ? 36.919  -0.636  17.107  1.00 62.35  ? 91  LEU A HA     1 
ATOM   1451 H  HB2    . LEU A 1 91  ? 35.328  0.468   15.047  1.00 63.72  ? 91  LEU A HB2    1 
ATOM   1452 H  HB3    . LEU A 1 91  ? 36.654  -0.357  14.786  1.00 63.72  ? 91  LEU A HB3    1 
ATOM   1453 H  HG     . LEU A 1 91  ? 34.226  -1.416  15.745  1.00 75.23  ? 91  LEU A HG     1 
ATOM   1454 H  HD11   . LEU A 1 91  ? 34.236  -2.689  13.796  1.00 59.40  ? 91  LEU A HD11   1 
ATOM   1455 H  HD12   . LEU A 1 91  ? 34.245  -1.157  13.443  1.00 59.40  ? 91  LEU A HD12   1 
ATOM   1456 H  HD13   . LEU A 1 91  ? 35.573  -1.994  13.345  1.00 59.40  ? 91  LEU A HD13   1 
ATOM   1457 H  HD21   . LEU A 1 91  ? 35.257  -3.504  15.876  1.00 72.47  ? 91  LEU A HD21   1 
ATOM   1458 H  HD22   . LEU A 1 91  ? 36.639  -2.850  15.511  1.00 72.47  ? 91  LEU A HD22   1 
ATOM   1459 H  HD23   . LEU A 1 91  ? 35.941  -2.502  16.876  1.00 72.47  ? 91  LEU A HD23   1 
ATOM   1460 N  N      . LEU A 1 92  ? 36.729  2.530   16.583  1.00 54.61  ? 92  LEU A N      1 
ATOM   1461 C  CA     . LEU A 1 92  ? 37.514  3.750   16.407  1.00 62.13  ? 92  LEU A CA     1 
ATOM   1462 C  C      . LEU A 1 92  ? 38.358  4.062   17.640  1.00 58.16  ? 92  LEU A C      1 
ATOM   1463 O  O      . LEU A 1 92  ? 39.403  4.688   17.542  1.00 54.72  ? 92  LEU A O      1 
ATOM   1464 C  CB     . LEU A 1 92  ? 36.603  4.938   16.081  1.00 54.78  ? 92  LEU A CB     1 
ATOM   1465 C  CG     . LEU A 1 92  ? 35.909  4.867   14.716  1.00 52.86  ? 92  LEU A CG     1 
ATOM   1466 C  CD1    . LEU A 1 92  ? 34.825  5.929   14.567  1.00 51.52  ? 92  LEU A CD1    1 
ATOM   1467 C  CD2    . LEU A 1 92  ? 36.932  4.999   13.617  1.00 50.68  ? 92  LEU A CD2    1 
ATOM   1468 H  H      . LEU A 1 92  ? 35.879  2.659   16.607  1.00 65.53  ? 92  LEU A H      1 
ATOM   1469 H  HA     . LEU A 1 92  ? 38.125  3.625   15.651  1.00 74.56  ? 92  LEU A HA     1 
ATOM   1470 H  HB2    . LEU A 1 92  ? 35.911  4.991   16.759  1.00 65.73  ? 92  LEU A HB2    1 
ATOM   1471 H  HB3    . LEU A 1 92  ? 37.136  5.749   16.097  1.00 65.73  ? 92  LEU A HB3    1 
ATOM   1472 H  HG     . LEU A 1 92  ? 35.487  3.999   14.625  1.00 63.44  ? 92  LEU A HG     1 
ATOM   1473 H  HD11   . LEU A 1 92  ? 34.422  5.843   13.700  1.00 61.82  ? 92  LEU A HD11   1 
ATOM   1474 H  HD12   . LEU A 1 92  ? 34.164  5.797   15.250  1.00 61.82  ? 92  LEU A HD12   1 
ATOM   1475 H  HD13   . LEU A 1 92  ? 35.224  6.797   14.659  1.00 61.82  ? 92  LEU A HD13   1 
ATOM   1476 H  HD21   . LEU A 1 92  ? 36.486  4.953   12.768  1.00 60.82  ? 92  LEU A HD21   1 
ATOM   1477 H  HD22   . LEU A 1 92  ? 37.380  5.844   13.707  1.00 60.82  ? 92  LEU A HD22   1 
ATOM   1478 H  HD23   . LEU A 1 92  ? 37.566  4.282   13.693  1.00 60.82  ? 92  LEU A HD23   1 
ATOM   1479 N  N      . ARG A 1 93  ? 37.904  3.621   18.802  1.00 53.94  ? 93  ARG A N      1 
ATOM   1480 C  CA     . ARG A 1 93  ? 38.632  3.870   20.039  1.00 64.27  ? 93  ARG A CA     1 
ATOM   1481 C  C      . ARG A 1 93  ? 40.057  3.306   20.001  1.00 70.49  ? 93  ARG A C      1 
ATOM   1482 O  O      . ARG A 1 93  ? 40.925  3.769   20.729  1.00 68.27  ? 93  ARG A O      1 
ATOM   1483 C  CB     . ARG A 1 93  ? 37.862  3.294   21.226  1.00 65.05  ? 93  ARG A CB     1 
ATOM   1484 C  CG     . ARG A 1 93  ? 36.615  4.078   21.562  1.00 64.88  ? 93  ARG A CG     1 
ATOM   1485 C  CD     . ARG A 1 93  ? 35.938  3.552   22.811  1.00 70.98  ? 93  ARG A CD     1 
ATOM   1486 N  NE     . ARG A 1 93  ? 34.494  3.749   22.747  1.00 76.79  ? 93  ARG A NE     1 
ATOM   1487 C  CZ     . ARG A 1 93  ? 33.864  4.851   23.140  1.00 77.18  ? 93  ARG A CZ     1 
ATOM   1488 N  NH1    . ARG A 1 93  ? 34.544  5.875   23.644  1.00 68.82  ? 93  ARG A NH1    1 
ATOM   1489 N  NH2    . ARG A 1 93  ? 32.544  4.925   23.033  1.00 66.79  ? 93  ARG A NH2    1 
ATOM   1490 H  H      . ARG A 1 93  ? 37.176  3.175   18.903  1.00 64.72  ? 93  ARG A H      1 
ATOM   1491 H  HA     . ARG A 1 93  ? 38.700  4.839   20.172  1.00 77.13  ? 93  ARG A HA     1 
ATOM   1492 H  HB2    . ARG A 1 93  ? 37.597  2.385   21.018  1.00 78.06  ? 93  ARG A HB2    1 
ATOM   1493 H  HB3    . ARG A 1 93  ? 38.438  3.300   22.007  1.00 78.06  ? 93  ARG A HB3    1 
ATOM   1494 H  HG2    . ARG A 1 93  ? 36.852  5.006   21.714  1.00 77.85  ? 93  ARG A HG2    1 
ATOM   1495 H  HG3    . ARG A 1 93  ? 35.987  4.010   20.825  1.00 77.85  ? 93  ARG A HG3    1 
ATOM   1496 H  HD2    . ARG A 1 93  ? 36.113  2.601   22.895  1.00 85.17  ? 93  ARG A HD2    1 
ATOM   1497 H  HD3    . ARG A 1 93  ? 36.278  4.027   23.585  1.00 85.17  ? 93  ARG A HD3    1 
ATOM   1498 H  HE     . ARG A 1 93  ? 34.016  3.107   22.433  1.00 92.15  ? 93  ARG A HE     1 
ATOM   1499 H  HH11   . ARG A 1 93  ? 35.400  5.830   23.714  1.00 82.59  ? 93  ARG A HH11   1 
ATOM   1500 H  HH12   . ARG A 1 93  ? 34.129  6.584   23.898  1.00 82.59  ? 93  ARG A HH12   1 
ATOM   1501 H  HH21   . ARG A 1 93  ? 32.101  4.263   22.709  1.00 80.15  ? 93  ARG A HH21   1 
ATOM   1502 H  HH22   . ARG A 1 93  ? 32.131  5.635   23.289  1.00 80.15  ? 93  ARG A HH22   1 
ATOM   1503 N  N      . GLU A 1 94  ? 40.297  2.325   19.136  1.00 68.58  ? 94  GLU A N      1 
ATOM   1504 C  CA     . GLU A 1 94  ? 41.591  1.656   19.078  1.00 69.69  ? 94  GLU A CA     1 
ATOM   1505 C  C      . GLU A 1 94  ? 42.617  2.457   18.275  1.00 75.83  ? 94  GLU A C      1 
ATOM   1506 O  O      . GLU A 1 94  ? 43.794  2.104   18.237  1.00 78.98  ? 94  GLU A O      1 
ATOM   1507 C  CB     . GLU A 1 94  ? 41.439  0.259   18.459  1.00 75.38  ? 94  GLU A CB     1 
ATOM   1508 C  CG     . GLU A 1 94  ? 40.217  -0.521  18.941  1.00 78.66  ? 94  GLU A CG     1 
ATOM   1509 C  CD     . GLU A 1 94  ? 40.236  -0.803  20.436  1.00 93.34  ? 94  GLU A CD     1 
ATOM   1510 O  OE1    . GLU A 1 94  ? 41.225  -1.394  20.924  1.00 93.89  ? 94  GLU A OE1    1 
ATOM   1511 O  OE2    . GLU A 1 94  ? 39.253  -0.436  21.121  1.00 86.59  ? 94  GLU A OE2    1 
ATOM   1512 H  H      . GLU A 1 94  ? 39.724  2.028   18.569  1.00 82.29  ? 94  GLU A H      1 
ATOM   1513 H  HA     . GLU A 1 94  ? 41.936  1.549   19.989  1.00 83.63  ? 94  GLU A HA     1 
ATOM   1514 H  HB2    . GLU A 1 94  ? 41.366  0.353   17.497  1.00 90.46  ? 94  GLU A HB2    1 
ATOM   1515 H  HB3    . GLU A 1 94  ? 42.226  -0.263  18.678  1.00 90.46  ? 94  GLU A HB3    1 
ATOM   1516 H  HG2    . GLU A 1 94  ? 39.418  -0.008  18.744  1.00 94.40  ? 94  GLU A HG2    1 
ATOM   1517 H  HG3    . GLU A 1 94  ? 40.185  -1.373  18.477  1.00 94.40  ? 94  GLU A HG3    1 
ATOM   1518 N  N      . TYR A 1 95  ? 42.176  3.533   17.633  1.00 67.75  ? 95  TYR A N      1 
ATOM   1519 C  CA     . TYR A 1 95  ? 43.059  4.303   16.762  1.00 68.78  ? 95  TYR A CA     1 
ATOM   1520 C  C      . TYR A 1 95  ? 43.459  5.648   17.367  1.00 71.72  ? 95  TYR A C      1 
ATOM   1521 O  O      . TYR A 1 95  ? 44.245  6.385   16.772  1.00 73.66  ? 95  TYR A O      1 
ATOM   1522 C  CB     . TYR A 1 95  ? 42.404  4.519   15.401  1.00 68.25  ? 95  TYR A CB     1 
ATOM   1523 C  CG     . TYR A 1 95  ? 42.226  3.251   14.594  1.00 73.58  ? 95  TYR A CG     1 
ATOM   1524 C  CD1    . TYR A 1 95  ? 43.196  2.843   13.687  1.00 73.10  ? 95  TYR A CD1    1 
ATOM   1525 C  CD2    . TYR A 1 95  ? 41.088  2.467   14.736  1.00 73.04  ? 95  TYR A CD2    1 
ATOM   1526 C  CE1    . TYR A 1 95  ? 43.043  1.691   12.944  1.00 74.90  ? 95  TYR A CE1    1 
ATOM   1527 C  CE2    . TYR A 1 95  ? 40.922  1.306   13.995  1.00 70.69  ? 95  TYR A CE2    1 
ATOM   1528 C  CZ     . TYR A 1 95  ? 41.905  0.924   13.100  1.00 79.34  ? 95  TYR A CZ     1 
ATOM   1529 O  OH     . TYR A 1 95  ? 41.753  -0.229  12.363  1.00 76.61  ? 95  TYR A OH     1 
ATOM   1530 H  H      . TYR A 1 95  ? 41.374  3.839   17.684  1.00 81.30  ? 95  TYR A H      1 
ATOM   1531 H  HA     . TYR A 1 95  ? 43.880  3.788   16.618  1.00 82.54  ? 95  TYR A HA     1 
ATOM   1532 H  HB2    . TYR A 1 95  ? 41.527  4.910   15.536  1.00 81.90  ? 95  TYR A HB2    1 
ATOM   1533 H  HB3    . TYR A 1 95  ? 42.957  5.125   14.882  1.00 81.90  ? 95  TYR A HB3    1 
ATOM   1534 H  HD1    . TYR A 1 95  ? 43.964  3.356   13.578  1.00 87.73  ? 95  TYR A HD1    1 
ATOM   1535 H  HD2    . TYR A 1 95  ? 40.427  2.724   15.337  1.00 87.65  ? 95  TYR A HD2    1 
ATOM   1536 H  HE1    . TYR A 1 95  ? 43.703  1.431   12.343  1.00 89.88  ? 95  TYR A HE1    1 
ATOM   1537 H  HE2    . TYR A 1 95  ? 40.157  0.789   14.100  1.00 84.83  ? 95  TYR A HE2    1 
ATOM   1538 H  HH     . TYR A 1 95  ? 42.365  -0.750  12.527  1.00 91.93  ? 95  TYR A HH     1 
ATOM   1539 N  N      . SER A 1 96  ? 42.924  5.964   18.545  1.00 64.08  ? 96  SER A N      1 
ATOM   1540 C  CA     . SER A 1 96  ? 43.274  7.202   19.221  1.00 68.35  ? 96  SER A CA     1 
ATOM   1541 C  C      . SER A 1 96  ? 42.597  7.302   20.577  1.00 72.55  ? 96  SER A C      1 
ATOM   1542 O  O      . SER A 1 96  ? 41.406  7.037   20.715  1.00 72.37  ? 96  SER A O      1 
ATOM   1543 C  CB     . SER A 1 96  ? 42.893  8.411   18.366  1.00 66.19  ? 96  SER A CB     1 
ATOM   1544 O  OG     . SER A 1 96  ? 43.056  9.619   19.090  1.00 68.18  ? 96  SER A OG     1 
ATOM   1545 H  H      . SER A 1 96  ? 42.357  5.477   18.970  1.00 76.89  ? 96  SER A H      1 
ATOM   1546 H  HA     . SER A 1 96  ? 44.244  7.225   19.364  1.00 82.02  ? 96  SER A HA     1 
ATOM   1547 H  HB2    . SER A 1 96  ? 43.463  8.435   17.581  1.00 79.43  ? 96  SER A HB2    1 
ATOM   1548 H  HB3    . SER A 1 96  ? 41.964  8.328   18.098  1.00 79.43  ? 96  SER A HB3    1 
ATOM   1549 H  HG     . SER A 1 96  ? 42.848  10.258  18.620  1.00 81.82  ? 96  SER A HG     1 
ATOM   1550 N  N      . GLU A 1 97  ? 43.376  7.694   21.576  1.00 71.98  ? 97  GLU A N      1 
ATOM   1551 C  CA     . GLU A 1 97  ? 42.874  7.866   22.927  1.00 82.73  ? 97  GLU A CA     1 
ATOM   1552 C  C      . GLU A 1 97  ? 41.966  9.096   23.004  1.00 79.10  ? 97  GLU A C      1 
ATOM   1553 O  O      . GLU A 1 97  ? 41.120  9.195   23.890  1.00 71.85  ? 97  GLU A O      1 
ATOM   1554 C  CB     . GLU A 1 97  ? 44.049  8.001   23.903  1.00 86.78  ? 97  GLU A CB     1 
ATOM   1555 C  CG     . GLU A 1 97  ? 43.813  7.347   25.260  1.00 93.93  ? 97  GLU A CG     1 
ATOM   1556 C  CD     . GLU A 1 97  ? 45.078  7.259   26.105  1.00 103.72 ? 97  GLU A CD     1 
ATOM   1557 O  OE1    . GLU A 1 97  ? 46.023  8.040   25.854  1.00 101.67 ? 97  GLU A OE1    1 
ATOM   1558 O  OE2    . GLU A 1 97  ? 45.128  6.402   27.017  1.00 97.48  ? 97  GLU A OE2    1 
ATOM   1559 H  H      . GLU A 1 97  ? 44.214  7.869   21.493  1.00 86.38  ? 97  GLU A H      1 
ATOM   1560 H  HA     . GLU A 1 97  ? 42.349  7.079   23.182  1.00 99.27  ? 97  GLU A HA     1 
ATOM   1561 H  HB2    . GLU A 1 97  ? 44.832  7.586   23.507  1.00 104.14 ? 97  GLU A HB2    1 
ATOM   1562 H  HB3    . GLU A 1 97  ? 44.221  8.944   24.056  1.00 104.14 ? 97  GLU A HB3    1 
ATOM   1563 H  HG2    . GLU A 1 97  ? 43.160  7.868   25.752  1.00 112.71 ? 97  GLU A HG2    1 
ATOM   1564 H  HG3    . GLU A 1 97  ? 43.482  6.445   25.122  1.00 112.71 ? 97  GLU A HG3    1 
ATOM   1565 N  N      . LYS A 1 98  ? 42.148  10.028  22.069  1.00 70.94  ? 98  LYS A N      1 
ATOM   1566 C  CA     . LYS A 1 98  ? 41.337  11.241  22.023  1.00 69.73  ? 98  LYS A CA     1 
ATOM   1567 C  C      . LYS A 1 98  ? 40.300  11.131  20.900  1.00 68.02  ? 98  LYS A C      1 
ATOM   1568 O  O      . LYS A 1 98  ? 40.608  11.318  19.718  1.00 59.87  ? 98  LYS A O      1 
ATOM   1569 C  CB     . LYS A 1 98  ? 42.215  12.476  21.794  1.00 74.21  ? 98  LYS A CB     1 
ATOM   1570 C  CG     . LYS A 1 98  ? 43.520  12.490  22.573  1.00 77.13  ? 98  LYS A CG     1 
ATOM   1571 C  CD     . LYS A 1 98  ? 44.490  13.494  21.971  1.00 77.11  ? 98  LYS A CD     1 
ATOM   1572 C  CE     . LYS A 1 98  ? 45.907  13.287  22.479  1.00 82.67  ? 98  LYS A CE     1 
ATOM   1573 N  NZ     . LYS A 1 98  ? 46.886  14.107  21.711  1.00 78.03  ? 98  LYS A NZ     1 
ATOM   1574 H  H      . LYS A 1 98  ? 42.739  9.979   21.446  1.00 85.12  ? 98  LYS A H      1 
ATOM   1575 H  HA     . LYS A 1 98  ? 40.863  11.350  22.874  1.00 83.67  ? 98  LYS A HA     1 
ATOM   1576 H  HB2    . LYS A 1 98  ? 42.436  12.527  20.851  1.00 89.05  ? 98  LYS A HB2    1 
ATOM   1577 H  HB3    . LYS A 1 98  ? 41.712  13.264  22.053  1.00 89.05  ? 98  LYS A HB3    1 
ATOM   1578 H  HG2    . LYS A 1 98  ? 43.345  12.745  23.492  1.00 92.56  ? 98  LYS A HG2    1 
ATOM   1579 H  HG3    . LYS A 1 98  ? 43.927  11.610  22.537  1.00 92.56  ? 98  LYS A HG3    1 
ATOM   1580 H  HD2    . LYS A 1 98  ? 44.496  13.393  21.006  1.00 92.53  ? 98  LYS A HD2    1 
ATOM   1581 H  HD3    . LYS A 1 98  ? 44.210  14.392  22.211  1.00 92.53  ? 98  LYS A HD3    1 
ATOM   1582 H  HE2    . LYS A 1 98  ? 45.955  13.551  23.411  1.00 99.21  ? 98  LYS A HE2    1 
ATOM   1583 H  HE3    . LYS A 1 98  ? 46.149  12.353  22.380  1.00 99.21  ? 98  LYS A HE3    1 
ATOM   1584 H  HZ1    . LYS A 1 98  ? 46.687  14.971  21.789  1.00 93.64  ? 98  LYS A HZ1    1 
ATOM   1585 H  HZ2    . LYS A 1 98  ? 47.708  13.971  22.024  1.00 93.64  ? 98  LYS A HZ2    1 
ATOM   1586 H  HZ3    . LYS A 1 98  ? 46.864  13.881  20.851  1.00 93.64  ? 98  LYS A HZ3    1 
ATOM   1587 N  N      . ILE A 1 99  ? 39.068  10.822  21.278  1.00 56.86  ? 99  ILE A N      1 
ATOM   1588 C  CA     . ILE A 1 99  ? 37.992  10.669  20.315  1.00 56.61  ? 99  ILE A CA     1 
ATOM   1589 C  C      . ILE A 1 99  ? 36.784  11.443  20.812  1.00 60.47  ? 99  ILE A C      1 
ATOM   1590 O  O      . ILE A 1 99  ? 36.488  11.430  22.008  1.00 59.51  ? 99  ILE A O      1 
ATOM   1591 C  CB     . ILE A 1 99  ? 37.611  9.195   20.140  1.00 54.93  ? 99  ILE A CB     1 
ATOM   1592 C  CG1    . ILE A 1 99  ? 36.488  9.057   19.117  1.00 57.90  ? 99  ILE A CG1    1 
ATOM   1593 C  CG2    . ILE A 1 99  ? 37.179  8.592   21.484  1.00 63.79  ? 99  ILE A CG2    1 
ATOM   1594 C  CD1    . ILE A 1 99  ? 36.009  7.643   18.938  1.00 62.89  ? 99  ILE A CD1    1 
ATOM   1595 H  H      . ILE A 1 99  ? 38.828  10.695  22.094  1.00 68.23  ? 99  ILE A H      1 
ATOM   1596 H  HA     . ILE A 1 99  ? 38.267  11.032  19.447  1.00 67.94  ? 99  ILE A HA     1 
ATOM   1597 H  HB     . ILE A 1 99  ? 38.386  8.710   19.817  1.00 65.92  ? 99  ILE A HB     1 
ATOM   1598 H  HG12   . ILE A 1 99  ? 35.732  9.592   19.407  1.00 69.48  ? 99  ILE A HG12   1 
ATOM   1599 H  HG13   . ILE A 1 99  ? 36.806  9.374   18.257  1.00 69.48  ? 99  ILE A HG13   1 
ATOM   1600 H  HG21   . ILE A 1 99  ? 36.945  7.670   21.352  1.00 76.55  ? 99  ILE A HG21   1 
ATOM   1601 H  HG22   . ILE A 1 99  ? 37.907  8.659   22.106  1.00 76.55  ? 99  ILE A HG22   1 
ATOM   1602 H  HG23   . ILE A 1 99  ? 36.420  9.078   21.815  1.00 76.55  ? 99  ILE A HG23   1 
ATOM   1603 H  HD11   . ILE A 1 99  ? 35.306  7.631   18.285  1.00 75.47  ? 99  ILE A HD11   1 
ATOM   1604 H  HD12   . ILE A 1 99  ? 36.743  7.100   18.640  1.00 75.47  ? 99  ILE A HD12   1 
ATOM   1605 H  HD13   . ILE A 1 99  ? 35.680  7.316   19.779  1.00 75.47  ? 99  ILE A HD13   1 
ATOM   1606 N  N      . GLU A 1 100 ? 36.105  12.129  19.894  1.00 47.65  ? 100 GLU A N      1 
ATOM   1607 C  CA     . GLU A 1 100 ? 34.892  12.875  20.207  1.00 50.06  ? 100 GLU A CA     1 
ATOM   1608 C  C      . GLU A 1 100 ? 33.739  12.310  19.396  1.00 56.72  ? 100 GLU A C      1 
ATOM   1609 O  O      . GLU A 1 100 ? 33.683  12.481  18.182  1.00 44.91  ? 100 GLU A O      1 
ATOM   1610 C  CB     . GLU A 1 100 ? 35.088  14.353  19.858  1.00 49.90  ? 100 GLU A CB     1 
ATOM   1611 C  CG     . GLU A 1 100 ? 33.890  15.250  20.140  1.00 51.91  ? 100 GLU A CG     1 
ATOM   1612 C  CD     . GLU A 1 100 ? 34.220  16.738  19.963  1.00 66.36  ? 100 GLU A CD     1 
ATOM   1613 O  OE1    . GLU A 1 100 ? 35.411  17.119  20.045  1.00 57.40  ? 100 GLU A OE1    1 
ATOM   1614 O  OE2    . GLU A 1 100 ? 33.286  17.531  19.736  1.00 67.11  ? 100 GLU A OE2    1 
ATOM   1615 H  H      . GLU A 1 100 ? 36.333  12.177  19.066  1.00 57.19  ? 100 GLU A H      1 
ATOM   1616 H  HA     . GLU A 1 100 ? 34.683  12.795  21.162  1.00 60.07  ? 100 GLU A HA     1 
ATOM   1617 H  HB2    . GLU A 1 100 ? 35.836  14.694  20.373  1.00 59.88  ? 100 GLU A HB2    1 
ATOM   1618 H  HB3    . GLU A 1 100 ? 35.287  14.421  18.911  1.00 59.88  ? 100 GLU A HB3    1 
ATOM   1619 H  HG2    . GLU A 1 100 ? 33.174  15.026  19.527  1.00 62.30  ? 100 GLU A HG2    1 
ATOM   1620 H  HG3    . GLU A 1 100 ? 33.600  15.113  21.056  1.00 62.30  ? 100 GLU A HG3    1 
ATOM   1621 N  N      . ILE A 1 101 ? 32.821  11.629  20.061  1.00 49.86  ? 101 ILE A N      1 
ATOM   1622 C  CA     . ILE A 1 101 ? 31.665  11.074  19.379  1.00 43.90  ? 101 ILE A CA     1 
ATOM   1623 C  C      . ILE A 1 101 ? 30.611  12.163  19.244  1.00 53.72  ? 101 ILE A C      1 
ATOM   1624 O  O      . ILE A 1 101 ? 29.981  12.556  20.225  1.00 51.94  ? 101 ILE A O      1 
ATOM   1625 C  CB     . ILE A 1 101 ? 31.144  9.851   20.142  1.00 52.65  ? 101 ILE A CB     1 
ATOM   1626 C  CG1    . ILE A 1 101 ? 32.177  8.722   20.039  1.00 46.89  ? 101 ILE A CG1    1 
ATOM   1627 C  CG2    . ILE A 1 101 ? 29.793  9.395   19.599  1.00 50.71  ? 101 ILE A CG2    1 
ATOM   1628 C  CD1    . ILE A 1 101 ? 31.971  7.603   21.032  1.00 51.26  ? 101 ILE A CD1    1 
ATOM   1629 H  H      . ILE A 1 101 ? 32.844  11.473  20.906  1.00 59.83  ? 101 ILE A H      1 
ATOM   1630 H  HA     . ILE A 1 101 ? 31.927  10.786  18.479  1.00 52.68  ? 101 ILE A HA     1 
ATOM   1631 H  HB     . ILE A 1 101 ? 31.038  10.090  21.076  1.00 63.18  ? 101 ILE A HB     1 
ATOM   1632 H  HG12   . ILE A 1 101 ? 32.132  8.340   19.149  1.00 56.27  ? 101 ILE A HG12   1 
ATOM   1633 H  HG13   . ILE A 1 101 ? 33.060  9.094   20.192  1.00 56.27  ? 101 ILE A HG13   1 
ATOM   1634 H  HG21   . ILE A 1 101 ? 29.498  8.630   20.099  1.00 60.86  ? 101 ILE A HG21   1 
ATOM   1635 H  HG22   . ILE A 1 101 ? 29.161  10.111  19.693  1.00 60.86  ? 101 ILE A HG22   1 
ATOM   1636 H  HG23   . ILE A 1 101 ? 29.891  9.163   18.673  1.00 60.86  ? 101 ILE A HG23   1 
ATOM   1637 H  HD11   . ILE A 1 101 ? 32.654  6.942   20.902  1.00 61.51  ? 101 ILE A HD11   1 
ATOM   1638 H  HD12   . ILE A 1 101 ? 32.025  7.961   21.921  1.00 61.51  ? 101 ILE A HD12   1 
ATOM   1639 H  HD13   . ILE A 1 101 ? 31.106  7.213   20.887  1.00 61.51  ? 101 ILE A HD13   1 
ATOM   1640 N  N      . ALA A 1 102 ? 30.440  12.666  18.022  1.00 41.86  ? 102 ALA A N      1 
ATOM   1641 C  CA     . ALA A 1 102 ? 29.641  13.871  17.801  1.00 47.41  ? 102 ALA A CA     1 
ATOM   1642 C  C      . ALA A 1 102 ? 28.153  13.594  17.645  1.00 50.65  ? 102 ALA A C      1 
ATOM   1643 O  O      . ALA A 1 102 ? 27.318  14.473  17.857  1.00 50.01  ? 102 ALA A O      1 
ATOM   1644 C  CB     . ALA A 1 102 ? 30.158  14.615  16.578  1.00 47.77  ? 102 ALA A CB     1 
ATOM   1645 H  H      . ALA A 1 102 ? 30.775  12.329  17.305  1.00 50.23  ? 102 ALA A H      1 
ATOM   1646 H  HA     . ALA A 1 102 ? 29.751  14.463  18.575  1.00 56.90  ? 102 ALA A HA     1 
ATOM   1647 H  HB1    . ALA A 1 102 ? 29.626  15.403  16.444  1.00 57.32  ? 102 ALA A HB1    1 
ATOM   1648 H  HB2    . ALA A 1 102 ? 31.075  14.859  16.726  1.00 57.32  ? 102 ALA A HB2    1 
ATOM   1649 H  HB3    . ALA A 1 102 ? 30.092  14.040  15.812  1.00 57.32  ? 102 ALA A HB3    1 
ATOM   1650 N  N      . SER A 1 103 ? 27.824  12.382  17.224  1.00 43.01  ? 103 SER A N      1 
ATOM   1651 C  CA     . SER A 1 103 ? 26.435  12.018  17.001  1.00 41.19  ? 103 SER A CA     1 
ATOM   1652 C  C      . SER A 1 103 ? 26.370  10.532  16.723  1.00 44.05  ? 103 SER A C      1 
ATOM   1653 O  O      . SER A 1 103 ? 27.370  9.824   16.836  1.00 36.24  ? 103 SER A O      1 
ATOM   1654 C  CB     . SER A 1 103 ? 25.867  12.772  15.812  1.00 41.28  ? 103 SER A CB     1 
ATOM   1655 O  OG     . SER A 1 103 ? 26.343  12.191  14.606  1.00 48.07  ? 103 SER A OG     1 
ATOM   1656 H  H      . SER A 1 103 ? 28.386  11.752  17.060  1.00 51.61  ? 103 SER A H      1 
ATOM   1657 H  HA     . SER A 1 103 ? 25.900  12.221  17.796  1.00 49.42  ? 103 SER A HA     1 
ATOM   1658 H  HB2    . SER A 1 103 ? 24.898  12.718  15.832  1.00 49.53  ? 103 SER A HB2    1 
ATOM   1659 H  HB3    . SER A 1 103 ? 26.152  13.698  15.854  1.00 49.53  ? 103 SER A HB3    1 
ATOM   1660 H  HG     . SER A 1 103 ? 26.038  12.595  13.961  1.00 57.68  ? 103 SER A HG     1 
ATOM   1661 N  N      . ILE A 1 104 ? 25.203  10.056  16.324  1.00 37.69  ? 104 ILE A N      1 
ATOM   1662 C  CA     . ILE A 1 104 ? 25.023  8.623   16.168  1.00 42.93  ? 104 ILE A CA     1 
ATOM   1663 C  C      . ILE A 1 104 ? 25.894  8.066   15.041  1.00 38.92  ? 104 ILE A C      1 
ATOM   1664 O  O      . ILE A 1 104 ? 26.217  6.890   15.047  1.00 39.18  ? 104 ILE A O      1 
ATOM   1665 C  CB     . ILE A 1 104 ? 23.557  8.251   15.909  1.00 39.20  ? 104 ILE A CB     1 
ATOM   1666 C  CG1    . ILE A 1 104 ? 23.391  6.729   15.989  1.00 39.37  ? 104 ILE A CG1    1 
ATOM   1667 C  CG2    . ILE A 1 104 ? 23.111  8.785   14.544  1.00 36.24  ? 104 ILE A CG2    1 
ATOM   1668 C  CD1    . ILE A 1 104 ? 21.942  6.295   16.140  1.00 37.80  ? 104 ILE A CD1    1 
ATOM   1669 H  H      . ILE A 1 104 ? 24.510  10.531  16.140  1.00 45.23  ? 104 ILE A H      1 
ATOM   1670 H  HA     . ILE A 1 104 ? 25.298  8.182   17.000  1.00 51.51  ? 104 ILE A HA     1 
ATOM   1671 H  HB     . ILE A 1 104 ? 23.008  8.660   16.597  1.00 47.04  ? 104 ILE A HB     1 
ATOM   1672 H  HG12   . ILE A 1 104 ? 23.739  6.331   15.175  1.00 47.25  ? 104 ILE A HG12   1 
ATOM   1673 H  HG13   . ILE A 1 104 ? 23.884  6.397   16.756  1.00 47.25  ? 104 ILE A HG13   1 
ATOM   1674 H  HG21   . ILE A 1 104 ? 22.193  8.543   14.399  1.00 43.48  ? 104 ILE A HG21   1 
ATOM   1675 H  HG22   . ILE A 1 104 ? 23.203  9.740   14.536  1.00 43.48  ? 104 ILE A HG22   1 
ATOM   1676 H  HG23   . ILE A 1 104 ? 23.663  8.396   13.861  1.00 43.48  ? 104 ILE A HG23   1 
ATOM   1677 H  HD11   . ILE A 1 104 ? 21.907  5.336   16.183  1.00 45.36  ? 104 ILE A HD11   1 
ATOM   1678 H  HD12   . ILE A 1 104 ? 21.586  6.673   16.947  1.00 45.36  ? 104 ILE A HD12   1 
ATOM   1679 H  HD13   . ILE A 1 104 ? 21.442  6.607   15.382  1.00 45.36  ? 104 ILE A HD13   1 
ATOM   1680 N  N      . ASP A 1 105 ? 26.278  8.898   14.074  1.00 36.19  ? 105 ASP A N      1 
ATOM   1681 C  CA     . ASP A 1 105 ? 27.102  8.400   12.976  1.00 42.88  ? 105 ASP A CA     1 
ATOM   1682 C  C      . ASP A 1 105 ? 28.370  9.221   12.661  1.00 44.61  ? 105 ASP A C      1 
ATOM   1683 O  O      . ASP A 1 105 ? 28.872  9.150   11.557  1.00 40.91  ? 105 ASP A O      1 
ATOM   1684 C  CB     . ASP A 1 105 ? 26.253  8.265   11.710  1.00 46.78  ? 105 ASP A CB     1 
ATOM   1685 C  CG     . ASP A 1 105 ? 26.112  9.573   10.964  1.00 45.40  ? 105 ASP A CG     1 
ATOM   1686 O  OD1    . ASP A 1 105 ? 26.131  10.621  11.634  1.00 39.62  ? 105 ASP A OD1    1 
ATOM   1687 O  OD2    . ASP A 1 105 ? 25.995  9.546   9.717   1.00 43.68  ? 105 ASP A OD2    1 
ATOM   1688 H  H      . ASP A 1 105 ? 26.081  9.734   14.030  1.00 43.43  ? 105 ASP A H      1 
ATOM   1689 H  HA     . ASP A 1 105 ? 27.403  7.498   13.215  1.00 51.46  ? 105 ASP A HA     1 
ATOM   1690 H  HB2    . ASP A 1 105 ? 26.672  7.623   11.115  1.00 56.13  ? 105 ASP A HB2    1 
ATOM   1691 H  HB3    . ASP A 1 105 ? 25.366  7.961   11.955  1.00 56.13  ? 105 ASP A HB3    1 
ATOM   1692 N  N      . GLU A 1 106 ? 28.900  9.982   13.616  1.00 37.74  ? 106 GLU A N      1 
ATOM   1693 C  CA     . GLU A 1 106 ? 30.087  10.799  13.355  1.00 41.71  ? 106 GLU A CA     1 
ATOM   1694 C  C      . GLU A 1 106 ? 31.009  10.784  14.548  1.00 41.50  ? 106 GLU A C      1 
ATOM   1695 O  O      . GLU A 1 106 ? 30.548  10.862  15.671  1.00 39.36  ? 106 GLU A O      1 
ATOM   1696 C  CB     . GLU A 1 106 ? 29.719  12.273  13.134  1.00 41.95  ? 106 GLU A CB     1 
ATOM   1697 C  CG     . GLU A 1 106 ? 28.698  12.562  12.049  1.00 57.66  ? 106 GLU A CG     1 
ATOM   1698 C  CD     . GLU A 1 106 ? 28.486  14.066  11.839  1.00 54.98  ? 106 GLU A CD     1 
ATOM   1699 O  OE1    . GLU A 1 106 ? 27.946  14.457  10.786  1.00 66.00  ? 106 GLU A OE1    1 
ATOM   1700 O  OE2    . GLU A 1 106 ? 28.868  14.862  12.723  1.00 59.01  ? 106 GLU A OE2    1 
ATOM   1701 H  H      . GLU A 1 106 ? 28.595  10.044  14.418  1.00 45.29  ? 106 GLU A H      1 
ATOM   1702 H  HA     . GLU A 1 106 ? 30.567  10.463  12.569  1.00 50.05  ? 106 GLU A HA     1 
ATOM   1703 H  HB2    . GLU A 1 106 ? 29.363  12.625  13.965  1.00 50.34  ? 106 GLU A HB2    1 
ATOM   1704 H  HB3    . GLU A 1 106 ? 30.528  12.756  12.903  1.00 50.34  ? 106 GLU A HB3    1 
ATOM   1705 H  HG2    . GLU A 1 106 ? 29.007  12.181  11.213  1.00 69.19  ? 106 GLU A HG2    1 
ATOM   1706 H  HG3    . GLU A 1 106 ? 27.848  12.170  12.301  1.00 69.19  ? 106 GLU A HG3    1 
ATOM   1707 N  N      . ALA A 1 107 ? 32.313  10.767  14.310  1.00 43.83  ? 107 ALA A N      1 
ATOM   1708 C  CA     . ALA A 1 107 ? 33.263  10.900  15.401  1.00 49.93  ? 107 ALA A CA     1 
ATOM   1709 C  C      . ALA A 1 107 ? 34.538  11.560  14.911  1.00 45.33  ? 107 ALA A C      1 
ATOM   1710 O  O      . ALA A 1 107 ? 34.962  11.333  13.786  1.00 41.97  ? 107 ALA A O      1 
ATOM   1711 C  CB     . ALA A 1 107 ? 33.565  9.532   16.004  1.00 47.86  ? 107 ALA A CB     1 
ATOM   1712 H  H      . ALA A 1 107 ? 32.670  10.680  13.533  1.00 52.60  ? 107 ALA A H      1 
ATOM   1713 H  HA     . ALA A 1 107 ? 32.875  11.465  16.101  1.00 59.92  ? 107 ALA A HA     1 
ATOM   1714 H  HB1    . ALA A 1 107 ? 34.193  9.639   16.722  1.00 57.43  ? 107 ALA A HB1    1 
ATOM   1715 H  HB2    . ALA A 1 107 ? 32.749  9.151   16.337  1.00 57.43  ? 107 ALA A HB2    1 
ATOM   1716 H  HB3    . ALA A 1 107 ? 33.937  8.966   15.324  1.00 57.43  ? 107 ALA A HB3    1 
ATOM   1717 N  N      . TYR A 1 108 ? 35.149  12.372  15.769  1.00 42.46  ? 108 TYR A N      1 
ATOM   1718 C  CA     . TYR A 1 108 ? 36.445  12.978  15.472  1.00 44.66  ? 108 TYR A CA     1 
ATOM   1719 C  C      . TYR A 1 108 ? 37.544  12.276  16.268  1.00 48.09  ? 108 TYR A C      1 
ATOM   1720 O  O      . TYR A 1 108 ? 37.352  11.949  17.432  1.00 47.54  ? 108 TYR A O      1 
ATOM   1721 C  CB     . TYR A 1 108 ? 36.460  14.458  15.871  1.00 42.85  ? 108 TYR A CB     1 
ATOM   1722 C  CG     . TYR A 1 108 ? 35.432  15.336  15.214  1.00 43.68  ? 108 TYR A CG     1 
ATOM   1723 C  CD1    . TYR A 1 108 ? 35.756  16.090  14.091  1.00 43.89  ? 108 TYR A CD1    1 
ATOM   1724 C  CD2    . TYR A 1 108 ? 34.144  15.439  15.732  1.00 43.17  ? 108 TYR A CD2    1 
ATOM   1725 C  CE1    . TYR A 1 108 ? 34.823  16.916  13.486  1.00 46.76  ? 108 TYR A CE1    1 
ATOM   1726 C  CE2    . TYR A 1 108 ? 33.201  16.265  15.140  1.00 45.97  ? 108 TYR A CE2    1 
ATOM   1727 C  CZ     . TYR A 1 108 ? 33.546  16.992  14.012  1.00 45.25  ? 108 TYR A CZ     1 
ATOM   1728 O  OH     . TYR A 1 108 ? 32.622  17.806  13.419  1.00 44.14  ? 108 TYR A OH     1 
ATOM   1729 H  H      . TYR A 1 108 ? 34.830  12.590  16.538  1.00 50.95  ? 108 TYR A H      1 
ATOM   1730 H  HA     . TYR A 1 108 ? 36.643  12.901  14.516  1.00 53.59  ? 108 TYR A HA     1 
ATOM   1731 H  HB2    . TYR A 1 108 ? 36.318  14.516  16.829  1.00 51.42  ? 108 TYR A HB2    1 
ATOM   1732 H  HB3    . TYR A 1 108 ? 37.331  14.823  15.653  1.00 51.42  ? 108 TYR A HB3    1 
ATOM   1733 H  HD1    . TYR A 1 108 ? 36.614  16.034  13.737  1.00 52.66  ? 108 TYR A HD1    1 
ATOM   1734 H  HD2    . TYR A 1 108 ? 33.914  14.947  16.487  1.00 51.80  ? 108 TYR A HD2    1 
ATOM   1735 H  HE1    . TYR A 1 108 ? 35.051  17.408  12.731  1.00 56.11  ? 108 TYR A HE1    1 
ATOM   1736 H  HE2    . TYR A 1 108 ? 32.340  16.319  15.489  1.00 55.16  ? 108 TYR A HE2    1 
ATOM   1737 H  HH     . TYR A 1 108 ? 32.363  18.372  13.952  1.00 52.97  ? 108 TYR A HH     1 
ATOM   1738 N  N      . LEU A 1 109 ? 38.707  12.086  15.654  1.00 48.93  ? 109 LEU A N      1 
ATOM   1739 C  CA     . LEU A 1 109 ? 39.866  11.544  16.358  1.00 54.30  ? 109 LEU A CA     1 
ATOM   1740 C  C      . LEU A 1 109 ? 41.026  12.499  16.196  1.00 56.87  ? 109 LEU A C      1 
ATOM   1741 O  O      . LEU A 1 109 ? 41.303  12.974  15.093  1.00 47.24  ? 109 LEU A O      1 
ATOM   1742 C  CB     . LEU A 1 109 ? 40.288  10.183  15.802  1.00 54.41  ? 109 LEU A CB     1 
ATOM   1743 C  CG     . LEU A 1 109 ? 39.354  8.989   15.983  1.00 60.48  ? 109 LEU A CG     1 
ATOM   1744 C  CD1    . LEU A 1 109 ? 37.958  9.287   15.454  1.00 52.53  ? 109 LEU A CD1    1 
ATOM   1745 C  CD2    . LEU A 1 109 ? 39.951  7.772   15.272  1.00 61.23  ? 109 LEU A CD2    1 
ATOM   1746 H  H      . LEU A 1 109 ? 38.853  12.263  14.825  1.00 58.71  ? 109 LEU A H      1 
ATOM   1747 H  HA     . LEU A 1 109 ? 39.662  11.449  17.312  1.00 65.16  ? 109 LEU A HA     1 
ATOM   1748 H  HB2    . LEU A 1 109 ? 40.428  10.285  14.848  1.00 65.29  ? 109 LEU A HB2    1 
ATOM   1749 H  HB3    . LEU A 1 109 ? 41.131  9.943   16.218  1.00 65.29  ? 109 LEU A HB3    1 
ATOM   1750 H  HG     . LEU A 1 109 ? 39.282  8.781   16.928  1.00 72.57  ? 109 LEU A HG     1 
ATOM   1751 H  HD11   . LEU A 1 109 ? 37.403  8.515   15.585  1.00 63.04  ? 109 LEU A HD11   1 
ATOM   1752 H  HD12   . LEU A 1 109 ? 37.596  10.037  15.933  1.00 63.04  ? 109 LEU A HD12   1 
ATOM   1753 H  HD13   . LEU A 1 109 ? 38.016  9.494   14.518  1.00 63.04  ? 109 LEU A HD13   1 
ATOM   1754 H  HD21   . LEU A 1 109 ? 39.362  7.023   15.388  1.00 73.48  ? 109 LEU A HD21   1 
ATOM   1755 H  HD22   . LEU A 1 109 ? 40.047  7.973   14.338  1.00 73.48  ? 109 LEU A HD22   1 
ATOM   1756 H  HD23   . LEU A 1 109 ? 40.809  7.577   15.656  1.00 73.48  ? 109 LEU A HD23   1 
ATOM   1757 N  N      . ASP A 1 110 ? 41.700  12.790  17.300  1.00 57.37  ? 110 ASP A N      1 
ATOM   1758 C  CA     . ASP A 1 110 ? 42.931  13.558  17.240  1.00 59.71  ? 110 ASP A CA     1 
ATOM   1759 C  C      . ASP A 1 110 ? 44.055  12.565  17.041  1.00 49.04  ? 110 ASP A C      1 
ATOM   1760 O  O      . ASP A 1 110 ? 44.357  11.804  17.939  1.00 55.02  ? 110 ASP A O      1 
ATOM   1761 C  CB     . ASP A 1 110 ? 43.129  14.341  18.534  1.00 61.75  ? 110 ASP A CB     1 
ATOM   1762 C  CG     . ASP A 1 110 ? 44.311  15.269  18.472  1.00 61.97  ? 110 ASP A CG     1 
ATOM   1763 O  OD1    . ASP A 1 110 ? 45.297  14.943  17.782  1.00 59.92  ? 110 ASP A OD1    1 
ATOM   1764 O  OD2    . ASP A 1 110 ? 44.250  16.333  19.110  1.00 66.99  ? 110 ASP A OD2    1 
ATOM   1765 H  H      . ASP A 1 110 ? 41.465  12.554  18.093  1.00 68.84  ? 110 ASP A H      1 
ATOM   1766 H  HA     . ASP A 1 110 ? 42.909  14.180  16.484  1.00 71.65  ? 110 ASP A HA     1 
ATOM   1767 H  HB2    . ASP A 1 110 ? 42.337  14.874  18.705  1.00 74.09  ? 110 ASP A HB2    1 
ATOM   1768 H  HB3    . ASP A 1 110 ? 43.274  13.717  19.262  1.00 74.09  ? 110 ASP A HB3    1 
ATOM   1769 N  N      . ILE A 1 111 ? 44.651  12.544  15.855  1.00 58.54  ? 111 ILE A N      1 
ATOM   1770 C  CA     . ILE A 1 111 ? 45.696  11.565  15.558  1.00 66.64  ? 111 ILE A CA     1 
ATOM   1771 C  C      . ILE A 1 111 ? 47.089  12.198  15.439  1.00 67.64  ? 111 ILE A C      1 
ATOM   1772 O  O      . ILE A 1 111 ? 47.950  11.703  14.712  1.00 64.94  ? 111 ILE A O      1 
ATOM   1773 C  CB     . ILE A 1 111 ? 45.366  10.764  14.274  1.00 58.60  ? 111 ILE A CB     1 
ATOM   1774 C  CG1    . ILE A 1 111 ? 45.188  11.696  13.077  1.00 56.57  ? 111 ILE A CG1    1 
ATOM   1775 C  CG2    . ILE A 1 111 ? 44.108  9.955   14.485  1.00 63.58  ? 111 ILE A CG2    1 
ATOM   1776 C  CD1    . ILE A 1 111 ? 45.109  10.966  11.743  1.00 56.51  ? 111 ILE A CD1    1 
ATOM   1777 H  H      . ILE A 1 111 ? 44.472  13.081  15.207  1.00 70.25  ? 111 ILE A H      1 
ATOM   1778 H  HA     . ILE A 1 111 ? 45.732  10.924  16.298  1.00 79.97  ? 111 ILE A HA     1 
ATOM   1779 H  HB     . ILE A 1 111 ? 46.100  10.156  14.089  1.00 70.33  ? 111 ILE A HB     1 
ATOM   1780 H  HG12   . ILE A 1 111 ? 44.366  12.198  13.191  1.00 67.89  ? 111 ILE A HG12   1 
ATOM   1781 H  HG13   . ILE A 1 111 ? 45.943  12.304  13.039  1.00 67.89  ? 111 ILE A HG13   1 
ATOM   1782 H  HG21   . ILE A 1 111 ? 43.915  9.463   13.683  1.00 76.30  ? 111 ILE A HG21   1 
ATOM   1783 H  HG22   . ILE A 1 111 ? 44.247  9.348   15.216  1.00 76.30  ? 111 ILE A HG22   1 
ATOM   1784 H  HG23   . ILE A 1 111 ? 43.384  10.551  14.687  1.00 76.30  ? 111 ILE A HG23   1 
ATOM   1785 H  HD11   . ILE A 1 111 ? 44.998  11.610  11.040  1.00 67.81  ? 111 ILE A HD11   1 
ATOM   1786 H  HD12   . ILE A 1 111 ? 45.921  10.471  11.609  1.00 67.81  ? 111 ILE A HD12   1 
ATOM   1787 H  HD13   . ILE A 1 111 ? 44.359  10.366  11.759  1.00 67.81  ? 111 ILE A HD13   1 
ATOM   1788 N  N      . SER A 1 112 ? 47.305  13.288  16.169  1.00 68.48  ? 112 SER A N      1 
ATOM   1789 C  CA     . SER A 1 112 ? 48.584  13.992  16.143  1.00 71.49  ? 112 SER A CA     1 
ATOM   1790 C  C      . SER A 1 112 ? 49.721  13.096  16.621  1.00 78.68  ? 112 SER A C      1 
ATOM   1791 O  O      . SER A 1 112 ? 50.795  13.081  16.017  1.00 78.52  ? 112 SER A O      1 
ATOM   1792 C  CB     . SER A 1 112 ? 48.517  15.243  17.017  1.00 63.74  ? 112 SER A CB     1 
ATOM   1793 O  OG     . SER A 1 112 ? 47.430  16.056  16.628  1.00 61.01  ? 112 SER A OG     1 
ATOM   1794 H  H      . SER A 1 112 ? 46.723  13.643  16.692  1.00 82.18  ? 112 SER A H      1 
ATOM   1795 H  HA     . SER A 1 112 ? 48.780  14.271  15.224  1.00 85.79  ? 112 SER A HA     1 
ATOM   1796 H  HB2    . SER A 1 112 ? 48.399  14.977  17.943  1.00 76.49  ? 112 SER A HB2    1 
ATOM   1797 H  HB3    . SER A 1 112 ? 49.341  15.745  16.917  1.00 76.49  ? 112 SER A HB3    1 
ATOM   1798 H  HG     . SER A 1 112 ? 47.030  15.709  16.002  1.00 73.21  ? 112 SER A HG     1 
ATOM   1799 N  N      . ASP A 1 113 ? 49.471  12.350  17.699  1.00 75.86  ? 113 ASP A N      1 
ATOM   1800 C  CA     . ASP A 1 113 ? 50.466  11.448  18.283  1.00 79.48  ? 113 ASP A CA     1 
ATOM   1801 C  C      . ASP A 1 113 ? 50.565  10.110  17.568  1.00 81.61  ? 113 ASP A C      1 
ATOM   1802 O  O      . ASP A 1 113 ? 51.176  9.182   18.094  1.00 83.95  ? 113 ASP A O      1 
ATOM   1803 C  CB     . ASP A 1 113 ? 50.121  11.143  19.743  1.00 77.68  ? 113 ASP A CB     1 
ATOM   1804 C  CG     . ASP A 1 113 ? 50.081  12.380  20.608  1.00 91.95  ? 113 ASP A CG     1 
ATOM   1805 O  OD1    . ASP A 1 113 ? 50.511  13.455  20.132  1.00 93.79  ? 113 ASP A OD1    1 
ATOM   1806 O  OD2    . ASP A 1 113 ? 49.624  12.268  21.769  1.00 92.00  ? 113 ASP A OD2    1 
ATOM   1807 H  H      . ASP A 1 113 ? 48.720  12.350  18.117  1.00 91.03  ? 113 ASP A H      1 
ATOM   1808 H  HA     . ASP A 1 113 ? 51.347  11.878  18.258  1.00 95.38  ? 113 ASP A HA     1 
ATOM   1809 H  HB2    . ASP A 1 113 ? 49.248  10.723  19.780  1.00 93.22  ? 113 ASP A HB2    1 
ATOM   1810 H  HB3    . ASP A 1 113 ? 50.792  10.545  20.108  1.00 93.22  ? 113 ASP A HB3    1 
ATOM   1811 N  N      . LYS A 1 114 ? 49.960  9.988   16.392  1.00 75.64  ? 114 LYS A N      1 
ATOM   1812 C  CA     . LYS A 1 114 ? 49.895  8.689   15.726  1.00 73.34  ? 114 LYS A CA     1 
ATOM   1813 C  C      . LYS A 1 114 ? 50.435  8.745   14.306  1.00 70.04  ? 114 LYS A C      1 
ATOM   1814 O  O      . LYS A 1 114 ? 50.558  7.715   13.651  1.00 76.56  ? 114 LYS A O      1 
ATOM   1815 C  CB     . LYS A 1 114 ? 48.452  8.167   15.706  1.00 73.88  ? 114 LYS A CB     1 
ATOM   1816 C  CG     . LYS A 1 114 ? 47.760  8.174   17.062  1.00 71.31  ? 114 LYS A CG     1 
ATOM   1817 C  CD     . LYS A 1 114 ? 48.171  6.999   17.932  1.00 73.43  ? 114 LYS A CD     1 
ATOM   1818 C  CE     . LYS A 1 114 ? 47.655  7.177   19.355  1.00 77.97  ? 114 LYS A CE     1 
ATOM   1819 N  NZ     . LYS A 1 114 ? 47.641  5.907   20.130  1.00 82.28  ? 114 LYS A NZ     1 
ATOM   1820 H  H      . LYS A 1 114 ? 49.584  10.631  15.962  1.00 90.77  ? 114 LYS A H      1 
ATOM   1821 H  HA     . LYS A 1 114 ? 50.439  8.048   16.229  1.00 88.01  ? 114 LYS A HA     1 
ATOM   1822 H  HB2    . LYS A 1 114 ? 47.930  8.722   15.106  1.00 88.66  ? 114 LYS A HB2    1 
ATOM   1823 H  HB3    . LYS A 1 114 ? 48.458  7.252   15.383  1.00 88.66  ? 114 LYS A HB3    1 
ATOM   1824 H  HG2    . LYS A 1 114 ? 47.992  8.991   17.531  1.00 85.58  ? 114 LYS A HG2    1 
ATOM   1825 H  HG3    . LYS A 1 114 ? 46.801  8.128   16.928  1.00 85.58  ? 114 LYS A HG3    1 
ATOM   1826 H  HD2    . LYS A 1 114 ? 47.795  6.182   17.569  1.00 88.12  ? 114 LYS A HD2    1 
ATOM   1827 H  HD3    . LYS A 1 114 ? 49.139  6.942   17.961  1.00 88.12  ? 114 LYS A HD3    1 
ATOM   1828 H  HE2    . LYS A 1 114 ? 48.228  7.806   19.821  1.00 93.56  ? 114 LYS A HE2    1 
ATOM   1829 H  HE3    . LYS A 1 114 ? 46.748  7.517   19.321  1.00 93.56  ? 114 LYS A HE3    1 
ATOM   1830 H  HZ1    . LYS A 1 114 ? 47.334  6.057   20.952  1.00 98.73  ? 114 LYS A HZ1    1 
ATOM   1831 H  HZ2    . LYS A 1 114 ? 47.115  5.312   19.729  1.00 98.73  ? 114 LYS A HZ2    1 
ATOM   1832 H  HZ3    . LYS A 1 114 ? 48.465  5.575   20.185  1.00 98.73  ? 114 LYS A HZ3    1 
ATOM   1833 N  N      . VAL A 1 115 ? 50.754  9.946   13.833  1.00 68.32  ? 115 VAL A N      1 
ATOM   1834 C  CA     . VAL A 1 115 ? 51.244  10.133  12.469  1.00 76.45  ? 115 VAL A CA     1 
ATOM   1835 C  C      . VAL A 1 115 ? 52.035  11.445  12.338  1.00 78.82  ? 115 VAL A C      1 
ATOM   1836 O  O      . VAL A 1 115 ? 51.804  12.393  13.092  1.00 77.36  ? 115 VAL A O      1 
ATOM   1837 C  CB     . VAL A 1 115 ? 50.079  10.137  11.451  1.00 76.72  ? 115 VAL A CB     1 
ATOM   1838 C  CG1    . VAL A 1 115 ? 49.314  8.809   11.489  1.00 74.34  ? 115 VAL A CG1    1 
ATOM   1839 C  CG2    . VAL A 1 115 ? 49.142  11.305  11.721  1.00 75.23  ? 115 VAL A CG2    1 
ATOM   1840 H  H      . VAL A 1 115 ? 50.695  10.675  14.285  1.00 81.98  ? 115 VAL A H      1 
ATOM   1841 H  HA     . VAL A 1 115 ? 51.844  9.393   12.241  1.00 91.74  ? 115 VAL A HA     1 
ATOM   1842 H  HB     . VAL A 1 115 ? 50.445  10.247  10.549  1.00 92.07  ? 115 VAL A HB     1 
ATOM   1843 H  HG11   . VAL A 1 115 ? 48.599  8.842   10.849  1.00 89.21  ? 115 VAL A HG11   1 
ATOM   1844 H  HG12   . VAL A 1 115 ? 49.917  8.095   11.271  1.00 89.21  ? 115 VAL A HG12   1 
ATOM   1845 H  HG13   . VAL A 1 115 ? 48.957  8.679   12.371  1.00 89.21  ? 115 VAL A HG13   1 
ATOM   1846 H  HG21   . VAL A 1 115 ? 48.428  11.287  11.079  1.00 90.28  ? 115 VAL A HG21   1 
ATOM   1847 H  HG22   . VAL A 1 115 ? 48.787  11.221  12.608  1.00 90.28  ? 115 VAL A HG22   1 
ATOM   1848 H  HG23   . VAL A 1 115 ? 49.635  12.125  11.640  1.00 90.28  ? 115 VAL A HG23   1 
ATOM   1849 N  N      . ARG A 1 116 ? 52.957  11.496  11.377  1.00 77.41  ? 116 ARG A N      1 
ATOM   1850 C  CA     . ARG A 1 116 ? 53.850  12.650  11.217  1.00 78.54  ? 116 ARG A CA     1 
ATOM   1851 C  C      . ARG A 1 116 ? 53.297  13.648  10.210  1.00 78.98  ? 116 ARG A C      1 
ATOM   1852 O  O      . ARG A 1 116 ? 53.448  14.857  10.378  1.00 84.13  ? 116 ARG A O      1 
ATOM   1853 C  CB     . ARG A 1 116 ? 55.250  12.200  10.770  1.00 83.99  ? 116 ARG A CB     1 
ATOM   1854 C  CG     . ARG A 1 116 ? 56.320  13.314  10.758  1.00 92.90  ? 116 ARG A CG     1 
ATOM   1855 C  CD     . ARG A 1 116 ? 57.605  12.871  10.026  1.00 100.67 ? 116 ARG A CD     1 
ATOM   1856 N  NE     . ARG A 1 116 ? 58.807  13.598  10.455  1.00 100.33 ? 116 ARG A NE     1 
ATOM   1857 C  CZ     . ARG A 1 116 ? 60.058  13.230  10.163  1.00 103.22 ? 116 ARG A CZ     1 
ATOM   1858 N  NH1    . ARG A 1 116 ? 60.283  12.135  9.440   1.00 93.46  ? 116 ARG A NH1    1 
ATOM   1859 N  NH2    . ARG A 1 116 ? 61.090  13.950  10.596  1.00 91.34  ? 116 ARG A NH2    1 
ATOM   1860 H  H      . ARG A 1 116 ? 53.088  10.873  10.799  1.00 92.89  ? 116 ARG A H      1 
ATOM   1861 H  HA     . ARG A 1 116 ? 53.939  13.107  12.080  1.00 94.25  ? 116 ARG A HA     1 
ATOM   1862 H  HB2    . ARG A 1 116 ? 55.558  11.505  11.372  1.00 100.79 ? 116 ARG A HB2    1 
ATOM   1863 H  HB3    . ARG A 1 116 ? 55.187  11.845  9.869   1.00 100.79 ? 116 ARG A HB3    1 
ATOM   1864 H  HG2    . ARG A 1 116 ? 55.964  14.093  10.301  1.00 111.48 ? 116 ARG A HG2    1 
ATOM   1865 H  HG3    . ARG A 1 116 ? 56.554  13.540  11.672  1.00 111.48 ? 116 ARG A HG3    1 
ATOM   1866 H  HD2    . ARG A 1 116 ? 57.753  11.927  10.195  1.00 120.81 ? 116 ARG A HD2    1 
ATOM   1867 H  HD3    . ARG A 1 116 ? 57.491  13.021  9.074   1.00 120.81 ? 116 ARG A HD3    1 
ATOM   1868 H  HE     . ARG A 1 116 ? 58.699  14.309  10.926  1.00 120.39 ? 116 ARG A HE     1 
ATOM   1869 H  HH11   . ARG A 1 116 ? 59.622  11.663  9.157   1.00 112.15 ? 116 ARG A HH11   1 
ATOM   1870 H  HH12   . ARG A 1 116 ? 61.089  11.901  9.255   1.00 112.15 ? 116 ARG A HH12   1 
ATOM   1871 H  HH21   . ARG A 1 116 ? 60.954  14.659  11.064  1.00 109.61 ? 116 ARG A HH21   1 
ATOM   1872 H  HH22   . ARG A 1 116 ? 61.894  13.709  10.406  1.00 109.61 ? 116 ARG A HH22   1 
ATOM   1873 N  N      . ASP A 1 117 ? 52.663  13.147  9.157   1.00 75.95  ? 117 ASP A N      1 
ATOM   1874 C  CA     . ASP A 1 117 ? 52.167  14.018  8.096   1.00 74.98  ? 117 ASP A CA     1 
ATOM   1875 C  C      . ASP A 1 117 ? 50.843  13.514  7.542   1.00 72.35  ? 117 ASP A C      1 
ATOM   1876 O  O      . ASP A 1 117 ? 50.307  12.507  8.009   1.00 67.96  ? 117 ASP A O      1 
ATOM   1877 C  CB     . ASP A 1 117 ? 53.195  14.113  6.965   1.00 83.08  ? 117 ASP A CB     1 
ATOM   1878 C  CG     . ASP A 1 117 ? 53.410  12.779  6.260   1.00 84.36  ? 117 ASP A CG     1 
ATOM   1879 O  OD1    . ASP A 1 117 ? 53.118  11.725  6.873   1.00 77.91  ? 117 ASP A OD1    1 
ATOM   1880 O  OD2    . ASP A 1 117 ? 53.872  12.784  5.094   1.00 89.80  ? 117 ASP A OD2    1 
ATOM   1881 H  H      . ASP A 1 117 ? 52.507  12.310  9.032   1.00 91.13  ? 117 ASP A H      1 
ATOM   1882 H  HA     . ASP A 1 117 ? 52.026  14.918  8.458   1.00 89.97  ? 117 ASP A HA     1 
ATOM   1883 H  HB2    . ASP A 1 117 ? 52.883  14.754  6.307   1.00 99.70  ? 117 ASP A HB2    1 
ATOM   1884 H  HB3    . ASP A 1 117 ? 54.045  14.400  7.332   1.00 99.70  ? 117 ASP A HB3    1 
ATOM   1885 N  N      . TYR A 1 118 ? 50.329  14.217  6.535   1.00 71.42  ? 118 TYR A N      1 
ATOM   1886 C  CA     . TYR A 1 118 ? 49.043  13.886  5.929   1.00 69.99  ? 118 TYR A CA     1 
ATOM   1887 C  C      . TYR A 1 118 ? 49.103  12.605  5.110   1.00 78.25  ? 118 TYR A C      1 
ATOM   1888 O  O      . TYR A 1 118 ? 48.141  11.844  5.081   1.00 73.88  ? 118 TYR A O      1 
ATOM   1889 C  CB     . TYR A 1 118 ? 48.552  15.042  5.056   1.00 71.04  ? 118 TYR A CB     1 
ATOM   1890 C  CG     . TYR A 1 118 ? 47.969  16.195  5.850   1.00 75.75  ? 118 TYR A CG     1 
ATOM   1891 C  CD1    . TYR A 1 118 ? 47.317  15.976  7.063   1.00 76.47  ? 118 TYR A CD1    1 
ATOM   1892 C  CD2    . TYR A 1 118 ? 48.073  17.500  5.391   1.00 68.69  ? 118 TYR A CD2    1 
ATOM   1893 C  CE1    . TYR A 1 118 ? 46.787  17.026  7.792   1.00 63.72  ? 118 TYR A CE1    1 
ATOM   1894 C  CE2    . TYR A 1 118 ? 47.545  18.557  6.116   1.00 71.73  ? 118 TYR A CE2    1 
ATOM   1895 C  CZ     . TYR A 1 118 ? 46.905  18.314  7.311   1.00 68.41  ? 118 TYR A CZ     1 
ATOM   1896 O  OH     . TYR A 1 118 ? 46.378  19.365  8.019   1.00 62.37  ? 118 TYR A OH     1 
ATOM   1897 H  H      . TYR A 1 118 ? 50.713  14.900  6.180   1.00 85.71  ? 118 TYR A H      1 
ATOM   1898 H  HA     . TYR A 1 118 ? 48.386  13.752  6.643   1.00 83.99  ? 118 TYR A HA     1 
ATOM   1899 H  HB2    . TYR A 1 118 ? 49.299  15.384  4.540   1.00 85.25  ? 118 TYR A HB2    1 
ATOM   1900 H  HB3    . TYR A 1 118 ? 47.862  14.713  4.460   1.00 85.25  ? 118 TYR A HB3    1 
ATOM   1901 H  HD1    . TYR A 1 118 ? 47.237  15.108  7.389   1.00 91.76  ? 118 TYR A HD1    1 
ATOM   1902 H  HD2    . TYR A 1 118 ? 48.505  17.669  4.585   1.00 82.43  ? 118 TYR A HD2    1 
ATOM   1903 H  HE1    . TYR A 1 118 ? 46.353  16.865  8.599   1.00 76.46  ? 118 TYR A HE1    1 
ATOM   1904 H  HE2    . TYR A 1 118 ? 47.620  19.427  5.795   1.00 86.07  ? 118 TYR A HE2    1 
ATOM   1905 H  HH     . TYR A 1 118 ? 45.816  19.755  7.566   1.00 74.84  ? 118 TYR A HH     1 
ATOM   1906 N  N      . ARG A 1 119 ? 50.226  12.369  4.440   1.00 72.58  ? 119 ARG A N      1 
ATOM   1907 C  CA     . ARG A 1 119 ? 50.436  11.109  3.741   1.00 73.29  ? 119 ARG A CA     1 
ATOM   1908 C  C      . ARG A 1 119 ? 50.135  9.946   4.692   1.00 75.06  ? 119 ARG A C      1 
ATOM   1909 O  O      . ARG A 1 119 ? 49.445  8.991   4.328   1.00 71.55  ? 119 ARG A O      1 
ATOM   1910 C  CB     . ARG A 1 119 ? 51.878  11.025  3.237   1.00 77.93  ? 119 ARG A CB     1 
ATOM   1911 C  CG     . ARG A 1 119 ? 52.129  9.972   2.162   1.00 90.40  ? 119 ARG A CG     1 
ATOM   1912 C  CD     . ARG A 1 119 ? 53.629  9.765   1.941   1.00 89.09  ? 119 ARG A CD     1 
ATOM   1913 N  NE     . ARG A 1 119 ? 54.290  9.298   3.162   1.00 89.86  ? 119 ARG A NE     1 
ATOM   1914 C  CZ     . ARG A 1 119 ? 54.796  8.077   3.336   1.00 95.86  ? 119 ARG A CZ     1 
ATOM   1915 N  NH1    . ARG A 1 119 ? 54.750  7.175   2.359   1.00 96.34  ? 119 ARG A NH1    1 
ATOM   1916 N  NH2    . ARG A 1 119 ? 55.365  7.757   4.495   1.00 79.72  ? 119 ARG A NH2    1 
ATOM   1917 H  H      . ARG A 1 119 ? 50.881  12.922  4.376   1.00 87.09  ? 119 ARG A H      1 
ATOM   1918 H  HA     . ARG A 1 119 ? 49.830  11.052  2.973   1.00 87.94  ? 119 ARG A HA     1 
ATOM   1919 H  HB2    . ARG A 1 119 ? 52.125  11.886  2.865   1.00 93.51  ? 119 ARG A HB2    1 
ATOM   1920 H  HB3    . ARG A 1 119 ? 52.455  10.818  3.988   1.00 93.51  ? 119 ARG A HB3    1 
ATOM   1921 H  HG2    . ARG A 1 119 ? 51.742  9.128   2.441   1.00 108.48 ? 119 ARG A HG2    1 
ATOM   1922 H  HG3    . ARG A 1 119 ? 51.734  10.265  1.326   1.00 108.48 ? 119 ARG A HG3    1 
ATOM   1923 H  HD2    . ARG A 1 119 ? 53.762  9.099   1.249   1.00 106.91 ? 119 ARG A HD2    1 
ATOM   1924 H  HD3    . ARG A 1 119 ? 54.033  10.607  1.678   1.00 106.91 ? 119 ARG A HD3    1 
ATOM   1925 H  HE     . ARG A 1 119 ? 54.357  9.853   3.815   1.00 107.83 ? 119 ARG A HE     1 
ATOM   1926 H  HH11   . ARG A 1 119 ? 54.381  7.373   1.608   1.00 115.60 ? 119 ARG A HH11   1 
ATOM   1927 H  HH12   . ARG A 1 119 ? 55.082  6.391   2.481   1.00 115.60 ? 119 ARG A HH12   1 
ATOM   1928 H  HH21   . ARG A 1 119 ? 55.404  8.337   5.129   1.00 95.66  ? 119 ARG A HH21   1 
ATOM   1929 H  HH22   . ARG A 1 119 ? 55.700  6.973   4.608   1.00 95.66  ? 119 ARG A HH22   1 
ATOM   1930 N  N      . GLU A 1 120 ? 50.640  10.041  5.920   1.00 69.92  ? 120 GLU A N      1 
ATOM   1931 C  CA     . GLU A 1 120 ? 50.470  8.974   6.905   1.00 73.20  ? 120 GLU A CA     1 
ATOM   1932 C  C      . GLU A 1 120 ? 49.057  8.949   7.487   1.00 73.38  ? 120 GLU A C      1 
ATOM   1933 O  O      . GLU A 1 120 ? 48.544  7.888   7.846   1.00 73.07  ? 120 GLU A O      1 
ATOM   1934 C  CB     . GLU A 1 120 ? 51.491  9.113   8.041   1.00 78.09  ? 120 GLU A CB     1 
ATOM   1935 C  CG     . GLU A 1 120 ? 52.578  8.037   8.031   1.00 86.56  ? 120 GLU A CG     1 
ATOM   1936 C  CD     . GLU A 1 120 ? 53.327  7.936   9.356   1.00 89.52  ? 120 GLU A CD     1 
ATOM   1937 O  OE1    . GLU A 1 120 ? 53.563  6.798   9.828   1.00 93.27  ? 120 GLU A OE1    1 
ATOM   1938 O  OE2    . GLU A 1 120 ? 53.682  8.993   9.922   1.00 86.13  ? 120 GLU A OE2    1 
ATOM   1939 H  H      . GLU A 1 120 ? 51.087  10.717  6.209   1.00 83.90  ? 120 GLU A H      1 
ATOM   1940 H  HA     . GLU A 1 120 ? 50.628  8.112   6.466   1.00 87.84  ? 120 GLU A HA     1 
ATOM   1941 H  HB2    . GLU A 1 120 ? 51.928  9.976   7.964   1.00 93.71  ? 120 GLU A HB2    1 
ATOM   1942 H  HB3    . GLU A 1 120 ? 51.025  9.056   8.889   1.00 93.71  ? 120 GLU A HB3    1 
ATOM   1943 H  HG2    . GLU A 1 120 ? 52.168  7.177   7.853   1.00 103.87 ? 120 GLU A HG2    1 
ATOM   1944 H  HG3    . GLU A 1 120 ? 53.223  8.247   7.338   1.00 103.87 ? 120 GLU A HG3    1 
ATOM   1945 N  N      . ALA A 1 121 ? 48.437  10.119  7.591   1.00 72.89  ? 121 ALA A N      1 
ATOM   1946 C  CA     . ALA A 1 121 ? 47.075  10.201  8.096   1.00 76.69  ? 121 ALA A CA     1 
ATOM   1947 C  C      . ALA A 1 121 ? 46.135  9.552   7.090   1.00 68.00  ? 121 ALA A C      1 
ATOM   1948 O  O      . ALA A 1 121 ? 45.268  8.775   7.464   1.00 58.75  ? 121 ALA A O      1 
ATOM   1949 C  CB     . ALA A 1 121 ? 46.678  11.643  8.345   1.00 74.33  ? 121 ALA A CB     1 
ATOM   1950 H  H      . ALA A 1 121 ? 48.782  10.876  7.377   1.00 87.47  ? 121 ALA A H      1 
ATOM   1951 H  HA     . ALA A 1 121 ? 47.010  9.711   8.942   1.00 92.02  ? 121 ALA A HA     1 
ATOM   1952 H  HB1    . ALA A 1 121 ? 45.777  11.666  8.676   1.00 89.19  ? 121 ALA A HB1    1 
ATOM   1953 H  HB2    . ALA A 1 121 ? 47.276  12.024  8.992   1.00 89.19  ? 121 ALA A HB2    1 
ATOM   1954 H  HB3    . ALA A 1 121 ? 46.736  12.129  7.519   1.00 89.19  ? 121 ALA A HB3    1 
ATOM   1955 N  N      . TYR A 1 122 ? 46.318  9.881   5.816   1.00 67.00  ? 122 TYR A N      1 
ATOM   1956 C  CA     . TYR A 1 122 ? 45.551  9.275   4.740   1.00 64.86  ? 122 TYR A CA     1 
ATOM   1957 C  C      . TYR A 1 122 ? 45.571  7.759   4.874   1.00 70.18  ? 122 TYR A C      1 
ATOM   1958 O  O      . TYR A 1 122 ? 44.526  7.117   4.820   1.00 69.67  ? 122 TYR A O      1 
ATOM   1959 C  CB     . TYR A 1 122 ? 46.128  9.676   3.387   1.00 66.04  ? 122 TYR A CB     1 
ATOM   1960 C  CG     . TYR A 1 122 ? 45.287  9.248   2.203   1.00 66.79  ? 122 TYR A CG     1 
ATOM   1961 C  CD1    . TYR A 1 122 ? 44.338  10.102  1.660   1.00 67.97  ? 122 TYR A CD1    1 
ATOM   1962 C  CD2    . TYR A 1 122 ? 45.447  7.994   1.624   1.00 68.54  ? 122 TYR A CD2    1 
ATOM   1963 C  CE1    . TYR A 1 122 ? 43.574  9.726   0.579   1.00 70.45  ? 122 TYR A CE1    1 
ATOM   1964 C  CE2    . TYR A 1 122 ? 44.685  7.610   0.537   1.00 70.28  ? 122 TYR A CE2    1 
ATOM   1965 C  CZ     . TYR A 1 122 ? 43.748  8.477   0.022   1.00 73.01  ? 122 TYR A CZ     1 
ATOM   1966 O  OH     . TYR A 1 122 ? 42.981  8.097   -1.059  1.00 76.02  ? 122 TYR A OH     1 
ATOM   1967 H  H      . TYR A 1 122 ? 46.891  10.464  5.547   1.00 80.40  ? 122 TYR A H      1 
ATOM   1968 H  HA     . TYR A 1 122 ? 44.621  9.581   4.786   1.00 77.83  ? 122 TYR A HA     1 
ATOM   1969 H  HB2    . TYR A 1 122 ? 46.209  10.642  3.358   1.00 79.25  ? 122 TYR A HB2    1 
ATOM   1970 H  HB3    . TYR A 1 122 ? 47.004  9.271   3.290   1.00 79.25  ? 122 TYR A HB3    1 
ATOM   1971 H  HD1    . TYR A 1 122 ? 44.218  10.945  2.033   1.00 81.57  ? 122 TYR A HD1    1 
ATOM   1972 H  HD2    . TYR A 1 122 ? 46.080  7.407   1.970   1.00 82.24  ? 122 TYR A HD2    1 
ATOM   1973 H  HE1    . TYR A 1 122 ? 42.941  10.310  0.229   1.00 84.54  ? 122 TYR A HE1    1 
ATOM   1974 H  HE2    . TYR A 1 122 ? 44.799  6.768   0.160   1.00 84.33  ? 122 TYR A HE2    1 
ATOM   1975 H  HH     . TYR A 1 122 ? 42.543  7.430   -0.871  1.00 91.22  ? 122 TYR A HH     1 
ATOM   1976 N  N      . ASN A 1 123 ? 46.760  7.191   5.057   1.00 73.27  ? 123 ASN A N      1 
ATOM   1977 C  CA     . ASN A 1 123 ? 46.905  5.743   5.183   1.00 70.42  ? 123 ASN A CA     1 
ATOM   1978 C  C      . ASN A 1 123 ? 46.178  5.212   6.401   1.00 68.89  ? 123 ASN A C      1 
ATOM   1979 O  O      . ASN A 1 123 ? 45.710  4.080   6.404   1.00 67.41  ? 123 ASN A O      1 
ATOM   1980 C  CB     . ASN A 1 123 ? 48.378  5.345   5.286   1.00 73.40  ? 123 ASN A CB     1 
ATOM   1981 C  CG     . ASN A 1 123 ? 49.154  5.627   4.017   1.00 78.29  ? 123 ASN A CG     1 
ATOM   1982 O  OD1    . ASN A 1 123 ? 48.578  5.779   2.937   1.00 67.02  ? 123 ASN A OD1    1 
ATOM   1983 N  ND2    . ASN A 1 123 ? 50.477  5.693   4.141   1.00 82.76  ? 123 ASN A ND2    1 
ATOM   1984 H  H      . ASN A 1 123 ? 47.501  7.623   5.112   1.00 87.93  ? 123 ASN A H      1 
ATOM   1985 H  HA     . ASN A 1 123 ? 46.526  5.312   4.389   1.00 84.50  ? 123 ASN A HA     1 
ATOM   1986 H  HB2    . ASN A 1 123 ? 48.790  5.846   6.007   1.00 88.07  ? 123 ASN A HB2    1 
ATOM   1987 H  HB3    . ASN A 1 123 ? 48.436  4.394   5.468   1.00 88.07  ? 123 ASN A HB3    1 
ATOM   1988 H  HD21   . ASN A 1 123 ? 50.967  5.850   3.451   1.00 99.31  ? 123 ASN A HD21   1 
ATOM   1989 H  HD22   . ASN A 1 123 ? 50.843  5.577   4.910   1.00 99.31  ? 123 ASN A HD22   1 
ATOM   1990 N  N      . LEU A 1 124 ? 46.107  6.025   7.448   1.00 65.35  ? 124 LEU A N      1 
ATOM   1991 C  CA     . LEU A 1 124 ? 45.445  5.619   8.682   1.00 65.49  ? 124 LEU A CA     1 
ATOM   1992 C  C      . LEU A 1 124 ? 43.931  5.630   8.512   1.00 63.61  ? 124 LEU A C      1 
ATOM   1993 O  O      . LEU A 1 124 ? 43.219  4.840   9.135   1.00 62.93  ? 124 LEU A O      1 
ATOM   1994 C  CB     . LEU A 1 124 ? 45.833  6.545   9.834   1.00 65.56  ? 124 LEU A CB     1 
ATOM   1995 C  CG     . LEU A 1 124 ? 45.139  6.192   11.148  1.00 68.94  ? 124 LEU A CG     1 
ATOM   1996 C  CD1    . LEU A 1 124 ? 45.410  4.740   11.497  1.00 69.55  ? 124 LEU A CD1    1 
ATOM   1997 C  CD2    . LEU A 1 124 ? 45.577  7.117   12.280  1.00 75.49  ? 124 LEU A CD2    1 
ATOM   1998 H  H      . LEU A 1 124 ? 46.435  6.820   7.470   1.00 78.42  ? 124 LEU A H      1 
ATOM   1999 H  HA     . LEU A 1 124 ? 45.722  4.707   8.913   1.00 78.59  ? 124 LEU A HA     1 
ATOM   2000 H  HB2    . LEU A 1 124 ? 46.791  6.485   9.976   1.00 78.67  ? 124 LEU A HB2    1 
ATOM   2001 H  HB3    . LEU A 1 124 ? 45.590  7.455   9.602   1.00 78.67  ? 124 LEU A HB3    1 
ATOM   2002 H  HG     . LEU A 1 124 ? 44.181  6.296   11.034  1.00 82.73  ? 124 LEU A HG     1 
ATOM   2003 H  HD11   . LEU A 1 124 ? 44.970  4.531   12.324  1.00 83.46  ? 124 LEU A HD11   1 
ATOM   2004 H  HD12   . LEU A 1 124 ? 45.072  4.182   10.794  1.00 83.46  ? 124 LEU A HD12   1 
ATOM   2005 H  HD13   . LEU A 1 124 ? 46.357  4.613   11.589  1.00 83.46  ? 124 LEU A HD13   1 
ATOM   2006 H  HD21   . LEU A 1 124 ? 45.120  6.863   13.085  1.00 90.58  ? 124 LEU A HD21   1 
ATOM   2007 H  HD22   . LEU A 1 124 ? 46.526  7.033   12.402  1.00 90.58  ? 124 LEU A HD22   1 
ATOM   2008 H  HD23   . LEU A 1 124 ? 45.355  8.021   12.048  1.00 90.58  ? 124 LEU A HD23   1 
ATOM   2009 N  N      . GLY A 1 125 ? 43.446  6.542   7.677   1.00 59.40  ? 125 GLY A N      1 
ATOM   2010 C  CA     . GLY A 1 125 ? 42.030  6.623   7.364   1.00 66.22  ? 125 GLY A CA     1 
ATOM   2011 C  C      . GLY A 1 125 ? 41.583  5.436   6.527   1.00 68.55  ? 125 GLY A C      1 
ATOM   2012 O  O      . GLY A 1 125 ? 40.544  4.840   6.796   1.00 63.01  ? 125 GLY A O      1 
ATOM   2013 H  H      . GLY A 1 125 ? 43.925  7.132   7.274   1.00 71.28  ? 125 GLY A H      1 
ATOM   2014 H  HA2    . GLY A 1 125 ? 41.514  6.637   8.186   1.00 79.47  ? 125 GLY A HA2    1 
ATOM   2015 H  HA3    . GLY A 1 125 ? 41.850  7.438   6.870   1.00 79.47  ? 125 GLY A HA3    1 
ATOM   2016 N  N      . LEU A 1 126 ? 42.371  5.091   5.511   1.00 65.37  ? 126 LEU A N      1 
ATOM   2017 C  CA     . LEU A 1 126 ? 42.087  3.917   4.692   1.00 69.69  ? 126 LEU A CA     1 
ATOM   2018 C  C      . LEU A 1 126 ? 42.018  2.686   5.585   1.00 67.76  ? 126 LEU A C      1 
ATOM   2019 O  O      . LEU A 1 126 ? 41.125  1.856   5.439   1.00 65.27  ? 126 LEU A O      1 
ATOM   2020 C  CB     . LEU A 1 126 ? 43.159  3.720   3.619   1.00 63.77  ? 126 LEU A CB     1 
ATOM   2021 C  CG     . LEU A 1 126 ? 43.431  4.891   2.672   1.00 72.17  ? 126 LEU A CG     1 
ATOM   2022 C  CD1    . LEU A 1 126 ? 44.649  4.577   1.817   1.00 78.48  ? 126 LEU A CD1    1 
ATOM   2023 C  CD2    . LEU A 1 126 ? 42.225  5.197   1.800   1.00 79.11  ? 126 LEU A CD2    1 
ATOM   2024 H  H      . LEU A 1 126 ? 43.077  5.521   5.275   1.00 78.44  ? 126 LEU A H      1 
ATOM   2025 H  HA     . LEU A 1 126 ? 41.220  4.029   4.249   1.00 83.63  ? 126 LEU A HA     1 
ATOM   2026 H  HB2    . LEU A 1 126 ? 43.995  3.514   4.065   1.00 76.52  ? 126 LEU A HB2    1 
ATOM   2027 H  HB3    . LEU A 1 126 ? 42.897  2.965   3.069   1.00 76.52  ? 126 LEU A HB3    1 
ATOM   2028 H  HG     . LEU A 1 126 ? 43.630  5.683   3.197   1.00 86.60  ? 126 LEU A HG     1 
ATOM   2029 H  HD11   . LEU A 1 126 ? 44.814  5.315   1.226   1.00 94.17  ? 126 LEU A HD11   1 
ATOM   2030 H  HD12   . LEU A 1 126 ? 45.406  4.440   2.390   1.00 94.17  ? 126 LEU A HD12   1 
ATOM   2031 H  HD13   . LEU A 1 126 ? 44.475  3.782   1.307   1.00 94.17  ? 126 LEU A HD13   1 
ATOM   2032 H  HD21   . LEU A 1 126 ? 42.435  5.934   1.223   1.00 94.93  ? 126 LEU A HD21   1 
ATOM   2033 H  HD22   . LEU A 1 126 ? 42.014  4.420   1.276   1.00 94.93  ? 126 LEU A HD22   1 
ATOM   2034 H  HD23   . LEU A 1 126 ? 41.481  5.423   2.364   1.00 94.93  ? 126 LEU A HD23   1 
ATOM   2035 N  N      . GLU A 1 127 ? 42.958  2.582   6.520   1.00 65.40  ? 127 GLU A N      1 
ATOM   2036 C  CA     . GLU A 1 127 ? 42.981  1.471   7.465   1.00 67.03  ? 127 GLU A CA     1 
ATOM   2037 C  C      . GLU A 1 127 ? 41.681  1.391   8.266   1.00 68.44  ? 127 GLU A C      1 
ATOM   2038 O  O      . GLU A 1 127 ? 41.129  0.309   8.474   1.00 67.26  ? 127 GLU A O      1 
ATOM   2039 C  CB     . GLU A 1 127 ? 44.155  1.610   8.438   1.00 64.97  ? 127 GLU A CB     1 
ATOM   2040 C  CG     . GLU A 1 127 ? 44.930  0.318   8.652   1.00 75.19  ? 127 GLU A CG     1 
ATOM   2041 C  CD     . GLU A 1 127 ? 45.335  0.097   10.097  1.00 90.41  ? 127 GLU A CD     1 
ATOM   2042 O  OE1    . GLU A 1 127 ? 44.758  -0.809  10.744  1.00 87.04  ? 127 GLU A OE1    1 
ATOM   2043 O  OE2    . GLU A 1 127 ? 46.235  0.821   10.582  1.00 85.05  ? 127 GLU A OE2    1 
ATOM   2044 H  H      . GLU A 1 127 ? 43.598  3.147   6.628   1.00 78.48  ? 127 GLU A H      1 
ATOM   2045 H  HA     . GLU A 1 127 ? 43.089  0.630   6.972   1.00 80.44  ? 127 GLU A HA     1 
ATOM   2046 H  HB2    . GLU A 1 127 ? 44.773  2.273   8.091   1.00 77.97  ? 127 GLU A HB2    1 
ATOM   2047 H  HB3    . GLU A 1 127 ? 43.815  1.898   9.300   1.00 77.97  ? 127 GLU A HB3    1 
ATOM   2048 H  HG2    . GLU A 1 127 ? 44.376  -0.430  8.379   1.00 90.22  ? 127 GLU A HG2    1 
ATOM   2049 H  HG3    . GLU A 1 127 ? 45.738  0.343   8.116   1.00 90.22  ? 127 GLU A HG3    1 
ATOM   2050 N  N      . ILE A 1 128 ? 41.204  2.541   8.730   1.00 63.43  ? 128 ILE A N      1 
ATOM   2051 C  CA     . ILE A 1 128 ? 39.995  2.582   9.541   1.00 63.54  ? 128 ILE A CA     1 
ATOM   2052 C  C      . ILE A 1 128 ? 38.781  2.175   8.712   1.00 57.20  ? 128 ILE A C      1 
ATOM   2053 O  O      . ILE A 1 128 ? 37.952  1.387   9.165   1.00 51.65  ? 128 ILE A O      1 
ATOM   2054 C  CB     . ILE A 1 128 ? 39.785  3.977   10.151  1.00 66.49  ? 128 ILE A CB     1 
ATOM   2055 C  CG1    . ILE A 1 128 ? 40.834  4.210   11.246  1.00 64.94  ? 128 ILE A CG1    1 
ATOM   2056 C  CG2    . ILE A 1 128 ? 38.362  4.107   10.707  1.00 55.62  ? 128 ILE A CG2    1 
ATOM   2057 C  CD1    . ILE A 1 128 ? 41.313  5.640   11.352  1.00 65.47  ? 128 ILE A CD1    1 
ATOM   2058 H  H      . ILE A 1 128 ? 41.561  3.310   8.588   1.00 76.12  ? 128 ILE A H      1 
ATOM   2059 H  HA     . ILE A 1 128 ? 40.086  1.942   10.278  1.00 76.24  ? 128 ILE A HA     1 
ATOM   2060 H  HB     . ILE A 1 128 ? 39.909  4.642   9.455   1.00 79.79  ? 128 ILE A HB     1 
ATOM   2061 H  HG12   . ILE A 1 128 ? 40.450  3.964   12.102  1.00 77.92  ? 128 ILE A HG12   1 
ATOM   2062 H  HG13   . ILE A 1 128 ? 41.606  3.653   11.061  1.00 77.92  ? 128 ILE A HG13   1 
ATOM   2063 H  HG21   . ILE A 1 128 ? 38.253  4.984   11.082  1.00 66.74  ? 128 ILE A HG21   1 
ATOM   2064 H  HG22   . ILE A 1 128 ? 37.735  3.976   9.993   1.00 66.74  ? 128 ILE A HG22   1 
ATOM   2065 H  HG23   . ILE A 1 128 ? 38.231  3.442   11.386  1.00 66.74  ? 128 ILE A HG23   1 
ATOM   2066 H  HD11   . ILE A 1 128 ? 41.963  5.699   12.056  1.00 78.56  ? 128 ILE A HD11   1 
ATOM   2067 H  HD12   . ILE A 1 128 ? 41.710  5.899   10.517  1.00 78.56  ? 128 ILE A HD12   1 
ATOM   2068 H  HD13   . ILE A 1 128 ? 40.564  6.207   11.549  1.00 78.56  ? 128 ILE A HD13   1 
ATOM   2069 N  N      . LYS A 1 129 ? 38.690  2.702   7.495   1.00 49.77  ? 129 LYS A N      1 
ATOM   2070 C  CA     . LYS A 1 129 ? 37.606  2.341   6.587   1.00 53.34  ? 129 LYS A CA     1 
ATOM   2071 C  C      . LYS A 1 129 ? 37.540  0.833   6.422   1.00 59.28  ? 129 LYS A C      1 
ATOM   2072 O  O      . LYS A 1 129 ? 36.478  0.230   6.545   1.00 55.43  ? 129 LYS A O      1 
ATOM   2073 C  CB     . LYS A 1 129 ? 37.806  2.990   5.225   1.00 56.05  ? 129 LYS A CB     1 
ATOM   2074 C  CG     . LYS A 1 129 ? 37.637  4.489   5.226   1.00 48.29  ? 129 LYS A CG     1 
ATOM   2075 C  CD     . LYS A 1 129 ? 37.880  5.039   3.843   1.00 58.37  ? 129 LYS A CD     1 
ATOM   2076 C  CE     . LYS A 1 129 ? 36.910  4.456   2.842   1.00 62.65  ? 129 LYS A CE     1 
ATOM   2077 N  NZ     . LYS A 1 129 ? 35.920  5.463   2.419   1.00 52.57  ? 129 LYS A NZ     1 
ATOM   2078 H  H      . LYS A 1 129 ? 39.245  3.272   7.170   1.00 59.73  ? 129 LYS A H      1 
ATOM   2079 H  HA     . LYS A 1 129 ? 36.753  2.651   6.957   1.00 64.01  ? 129 LYS A HA     1 
ATOM   2080 H  HB2    . LYS A 1 129 ? 38.704  2.794   4.916   1.00 67.26  ? 129 LYS A HB2    1 
ATOM   2081 H  HB3    . LYS A 1 129 ? 37.158  2.620   4.606   1.00 67.26  ? 129 LYS A HB3    1 
ATOM   2082 H  HG2    . LYS A 1 129 ? 36.731  4.713   5.492   1.00 57.95  ? 129 LYS A HG2    1 
ATOM   2083 H  HG3    . LYS A 1 129 ? 38.279  4.888   5.834   1.00 57.95  ? 129 LYS A HG3    1 
ATOM   2084 H  HD2    . LYS A 1 129 ? 37.763  6.002   3.856   1.00 70.05  ? 129 LYS A HD2    1 
ATOM   2085 H  HD3    . LYS A 1 129 ? 38.781  4.813   3.562   1.00 70.05  ? 129 LYS A HD3    1 
ATOM   2086 H  HE2    . LYS A 1 129 ? 37.397  4.158   2.058   1.00 75.18  ? 129 LYS A HE2    1 
ATOM   2087 H  HE3    . LYS A 1 129 ? 36.436  3.713   3.248   1.00 75.18  ? 129 LYS A HE3    1 
ATOM   2088 H  HZ1    . LYS A 1 129 ? 35.459  5.751   3.124   1.00 63.09  ? 129 LYS A HZ1    1 
ATOM   2089 H  HZ2    . LYS A 1 129 ? 36.333  6.155   2.041   1.00 63.09  ? 129 LYS A HZ2    1 
ATOM   2090 H  HZ3    . LYS A 1 129 ? 35.356  5.106   1.830   1.00 63.09  ? 129 LYS A HZ3    1 
ATOM   2091 N  N      . ASN A 1 130 ? 38.689  0.226   6.148   1.00 62.97  ? 130 ASN A N      1 
ATOM   2092 C  CA     . ASN A 1 130 ? 38.757  -1.209  5.912   1.00 62.25  ? 130 ASN A CA     1 
ATOM   2093 C  C      . ASN A 1 130 ? 38.419  -2.008  7.169   1.00 59.61  ? 130 ASN A C      1 
ATOM   2094 O  O      . ASN A 1 130 ? 37.805  -3.066  7.089   1.00 62.03  ? 130 ASN A O      1 
ATOM   2095 C  CB     . ASN A 1 130 ? 40.145  -1.588  5.374   1.00 66.81  ? 130 ASN A CB     1 
ATOM   2096 C  CG     . ASN A 1 130 ? 40.454  -0.925  4.030   1.00 74.14  ? 130 ASN A CG     1 
ATOM   2097 O  OD1    . ASN A 1 130 ? 39.635  -0.950  3.107   1.00 77.19  ? 130 ASN A OD1    1 
ATOM   2098 N  ND2    . ASN A 1 130 ? 41.635  -0.326  3.920   1.00 81.66  ? 130 ASN A ND2    1 
ATOM   2099 H  H      . ASN A 1 130 ? 39.448  0.627   6.093   1.00 75.57  ? 130 ASN A H      1 
ATOM   2100 H  HA     . ASN A 1 130 ? 38.099  -1.445  5.225   1.00 74.70  ? 130 ASN A HA     1 
ATOM   2101 H  HB2    . ASN A 1 130 ? 40.820  -1.304  6.011   1.00 80.17  ? 130 ASN A HB2    1 
ATOM   2102 H  HB3    . ASN A 1 130 ? 40.186  -2.549  5.252   1.00 80.17  ? 130 ASN A HB3    1 
ATOM   2103 H  HD21   . ASN A 1 130 ? 41.854  0.060   3.183   1.00 97.99  ? 130 ASN A HD21   1 
ATOM   2104 H  HD22   . ASN A 1 130 ? 42.181  -0.325  4.585   1.00 97.99  ? 130 ASN A HD22   1 
ATOM   2105 N  N      . LYS A 1 131 ? 38.808  -1.505  8.334   1.00 59.81  ? 131 LYS A N      1 
ATOM   2106 C  CA     . LYS A 1 131 ? 38.470  -2.184  9.579   1.00 61.20  ? 131 LYS A CA     1 
ATOM   2107 C  C      . LYS A 1 131 ? 36.957  -2.152  9.841   1.00 60.29  ? 131 LYS A C      1 
ATOM   2108 O  O      . LYS A 1 131 ? 36.388  -3.131  10.315  1.00 58.21  ? 131 LYS A O      1 
ATOM   2109 C  CB     . LYS A 1 131 ? 39.239  -1.583  10.760  1.00 59.98  ? 131 LYS A CB     1 
ATOM   2110 C  CG     . LYS A 1 131 ? 38.804  -2.111  12.125  1.00 63.89  ? 131 LYS A CG     1 
ATOM   2111 C  CD     . LYS A 1 131 ? 39.237  -3.555  12.374  1.00 76.16  ? 131 LYS A CD     1 
ATOM   2112 C  CE     . LYS A 1 131 ? 40.715  -3.660  12.752  1.00 84.72  ? 131 LYS A CE     1 
ATOM   2113 N  NZ     . LYS A 1 131 ? 40.951  -4.680  13.824  1.00 88.85  ? 131 LYS A NZ     1 
ATOM   2114 H  H      . LYS A 1 131 ? 39.262  -0.781  8.431   1.00 71.77  ? 131 LYS A H      1 
ATOM   2115 H  HA     . LYS A 1 131 ? 38.735  -3.124  9.502   1.00 73.45  ? 131 LYS A HA     1 
ATOM   2116 H  HB2    . LYS A 1 131 ? 40.181  -1.785  10.652  1.00 71.98  ? 131 LYS A HB2    1 
ATOM   2117 H  HB3    . LYS A 1 131 ? 39.108  -0.622  10.760  1.00 71.98  ? 131 LYS A HB3    1 
ATOM   2118 H  HG2    . LYS A 1 131 ? 39.199  -1.558  12.817  1.00 76.67  ? 131 LYS A HG2    1 
ATOM   2119 H  HG3    . LYS A 1 131 ? 37.837  -2.075  12.183  1.00 76.67  ? 131 LYS A HG3    1 
ATOM   2120 H  HD2    . LYS A 1 131 ? 38.713  -3.923  13.103  1.00 91.39  ? 131 LYS A HD2    1 
ATOM   2121 H  HD3    . LYS A 1 131 ? 39.095  -4.073  11.566  1.00 91.39  ? 131 LYS A HD3    1 
ATOM   2122 H  HE2    . LYS A 1 131 ? 41.226  -3.920  11.969  1.00 101.67 ? 131 LYS A HE2    1 
ATOM   2123 H  HE3    . LYS A 1 131 ? 41.021  -2.800  13.080  1.00 101.67 ? 131 LYS A HE3    1 
ATOM   2124 H  HZ1    . LYS A 1 131 ? 41.818  -4.718  14.022  1.00 106.62 ? 131 LYS A HZ1    1 
ATOM   2125 H  HZ2    . LYS A 1 131 ? 40.496  -4.462  14.557  1.00 106.62 ? 131 LYS A HZ2    1 
ATOM   2126 H  HZ3    . LYS A 1 131 ? 40.683  -5.482  13.545  1.00 106.62 ? 131 LYS A HZ3    1 
ATOM   2127 N  N      . ILE A 1 132 ? 36.302  -1.035  9.531   1.00 63.84  ? 132 ILE A N      1 
ATOM   2128 C  CA     . ILE A 1 132 ? 34.860  -0.925  9.760   1.00 62.27  ? 132 ILE A CA     1 
ATOM   2129 C  C      . ILE A 1 132 ? 34.092  -1.787  8.762   1.00 54.56  ? 132 ILE A C      1 
ATOM   2130 O  O      . ILE A 1 132 ? 33.097  -2.415  9.111   1.00 54.61  ? 132 ILE A O      1 
ATOM   2131 C  CB     . ILE A 1 132 ? 34.363  0.539   9.678   1.00 54.47  ? 132 ILE A CB     1 
ATOM   2132 C  CG1    . ILE A 1 132 ? 34.944  1.359   10.832  1.00 54.79  ? 132 ILE A CG1    1 
ATOM   2133 C  CG2    . ILE A 1 132 ? 32.844  0.589   9.743   1.00 48.31  ? 132 ILE A CG2    1 
ATOM   2134 C  CD1    . ILE A 1 132 ? 34.671  2.837   10.737  1.00 48.02  ? 132 ILE A CD1    1 
ATOM   2135 H  H      . ILE A 1 132 ? 36.664  -0.333  9.190   1.00 76.61  ? 132 ILE A H      1 
ATOM   2136 H  HA     . ILE A 1 132 ? 34.658  -1.258  10.660  1.00 74.72  ? 132 ILE A HA     1 
ATOM   2137 H  HB     . ILE A 1 132 ? 34.656  0.925   8.837   1.00 65.37  ? 132 ILE A HB     1 
ATOM   2138 H  HG12   . ILE A 1 132 ? 34.561  1.040   11.664  1.00 65.75  ? 132 ILE A HG12   1 
ATOM   2139 H  HG13   . ILE A 1 132 ? 35.906  1.237   10.847  1.00 65.75  ? 132 ILE A HG13   1 
ATOM   2140 H  HG21   . ILE A 1 132 ? 32.559  1.504   9.690   1.00 57.97  ? 132 ILE A HG21   1 
ATOM   2141 H  HG22   . ILE A 1 132 ? 32.483  0.091   9.006   1.00 57.97  ? 132 ILE A HG22   1 
ATOM   2142 H  HG23   . ILE A 1 132 ? 32.554  0.203   10.573  1.00 57.97  ? 132 ILE A HG23   1 
ATOM   2143 H  HD11   . ILE A 1 132 ? 35.066  3.277   11.494  1.00 57.62  ? 132 ILE A HD11   1 
ATOM   2144 H  HD12   . ILE A 1 132 ? 35.055  3.174   9.925   1.00 57.62  ? 132 ILE A HD12   1 
ATOM   2145 H  HD13   . ILE A 1 132 ? 33.721  2.979   10.735  1.00 57.62  ? 132 ILE A HD13   1 
ATOM   2146 N  N      . LEU A 1 133 ? 34.558  -1.826  7.521   1.00 57.72  ? 133 LEU A N      1 
ATOM   2147 C  CA     . LEU A 1 133 ? 33.925  -2.682  6.520   1.00 64.38  ? 133 LEU A CA     1 
ATOM   2148 C  C      . LEU A 1 133 ? 34.155  -4.146  6.885   1.00 64.19  ? 133 LEU A C      1 
ATOM   2149 O  O      . LEU A 1 133 ? 33.294  -4.988  6.673   1.00 60.37  ? 133 LEU A O      1 
ATOM   2150 C  CB     . LEU A 1 133 ? 34.459  -2.395  5.117   1.00 60.06  ? 133 LEU A CB     1 
ATOM   2151 C  CG     . LEU A 1 133 ? 33.630  -3.028  3.997   1.00 65.92  ? 133 LEU A CG     1 
ATOM   2152 C  CD1    . LEU A 1 133 ? 32.203  -2.482  3.999   1.00 58.64  ? 133 LEU A CD1    1 
ATOM   2153 C  CD2    . LEU A 1 133 ? 34.280  -2.806  2.644   1.00 68.50  ? 133 LEU A CD2    1 
ATOM   2154 H  H      . LEU A 1 133 ? 35.231  -1.374  7.233   1.00 69.26  ? 133 LEU A H      1 
ATOM   2155 H  HA     . LEU A 1 133 ? 32.959  -2.515  6.519   1.00 77.26  ? 133 LEU A HA     1 
ATOM   2156 H  HB2    . LEU A 1 133 ? 34.465  -1.435  4.975   1.00 72.07  ? 133 LEU A HB2    1 
ATOM   2157 H  HB3    . LEU A 1 133 ? 35.362  -2.743  5.049   1.00 72.07  ? 133 LEU A HB3    1 
ATOM   2158 H  HG     . LEU A 1 133 ? 33.580  -3.985  4.149   1.00 79.10  ? 133 LEU A HG     1 
ATOM   2159 H  HD11   . LEU A 1 133 ? 31.710  -2.897  3.288   1.00 70.37  ? 133 LEU A HD11   1 
ATOM   2160 H  HD12   . LEU A 1 133 ? 31.793  -2.683  4.843   1.00 70.37  ? 133 LEU A HD12   1 
ATOM   2161 H  HD13   . LEU A 1 133 ? 32.233  -1.532  3.866   1.00 70.37  ? 133 LEU A HD13   1 
ATOM   2162 H  HD21   . LEU A 1 133 ? 33.736  -3.214  1.966   1.00 82.21  ? 133 LEU A HD21   1 
ATOM   2163 H  HD22   . LEU A 1 133 ? 34.352  -1.862  2.483   1.00 82.21  ? 133 LEU A HD22   1 
ATOM   2164 H  HD23   . LEU A 1 133 ? 35.153  -3.205  2.648   1.00 82.21  ? 133 LEU A HD23   1 
ATOM   2165 N  N      . GLU A 1 134 ? 35.315  -4.438  7.463   1.00 61.09  ? 134 GLU A N      1 
ATOM   2166 C  CA     . GLU A 1 134 ? 35.658  -5.803  7.835   1.00 67.06  ? 134 GLU A CA     1 
ATOM   2167 C  C      . GLU A 1 134 ? 34.734  -6.311  8.939   1.00 68.13  ? 134 GLU A C      1 
ATOM   2168 O  O      . GLU A 1 134 ? 34.131  -7.378  8.829   1.00 53.68  ? 134 GLU A O      1 
ATOM   2169 C  CB     . GLU A 1 134 ? 37.115  -5.857  8.307   1.00 68.20  ? 134 GLU A CB     1 
ATOM   2170 C  CG     . GLU A 1 134 ? 37.562  -7.205  8.829   1.00 77.02  ? 134 GLU A CG     1 
ATOM   2171 C  CD     . GLU A 1 134 ? 38.725  -7.093  9.805   1.00 89.19  ? 134 GLU A CD     1 
ATOM   2172 O  OE1    . GLU A 1 134 ? 38.731  -7.829  10.818  1.00 89.37  ? 134 GLU A OE1    1 
ATOM   2173 O  OE2    . GLU A 1 134 ? 39.634  -6.269  9.561   1.00 87.92  ? 134 GLU A OE2    1 
ATOM   2174 H  H      . GLU A 1 134 ? 35.922  -3.860  7.652   1.00 73.31  ? 134 GLU A H      1 
ATOM   2175 H  HA     . GLU A 1 134 ? 35.561  -6.388  7.055   1.00 80.48  ? 134 GLU A HA     1 
ATOM   2176 H  HB2    . GLU A 1 134 ? 37.690  -5.626  7.561   1.00 81.84  ? 134 GLU A HB2    1 
ATOM   2177 H  HB3    . GLU A 1 134 ? 37.232  -5.212  9.022   1.00 81.84  ? 134 GLU A HB3    1 
ATOM   2178 H  HG2    . GLU A 1 134 ? 36.821  -7.628  9.291   1.00 92.42  ? 134 GLU A HG2    1 
ATOM   2179 H  HG3    . GLU A 1 134 ? 37.846  -7.756  8.082   1.00 92.42  ? 134 GLU A HG3    1 
ATOM   2180 N  N      . LYS A 1 135 ? 34.615  -5.536  10.008  1.00 59.23  ? 135 LYS A N      1 
ATOM   2181 C  CA     . LYS A 1 135 ? 33.931  -6.016  11.197  1.00 66.54  ? 135 LYS A CA     1 
ATOM   2182 C  C      . LYS A 1 135 ? 32.418  -5.864  11.110  1.00 59.49  ? 135 LYS A C      1 
ATOM   2183 O  O      . LYS A 1 135 ? 31.692  -6.670  11.674  1.00 59.39  ? 135 LYS A O      1 
ATOM   2184 C  CB     . LYS A 1 135 ? 34.463  -5.291  12.432  1.00 66.64  ? 135 LYS A CB     1 
ATOM   2185 C  CG     . LYS A 1 135 ? 35.925  -5.581  12.720  1.00 66.48  ? 135 LYS A CG     1 
ATOM   2186 C  CD     . LYS A 1 135 ? 36.094  -6.775  13.653  1.00 71.76  ? 135 LYS A CD     1 
ATOM   2187 C  CE     . LYS A 1 135 ? 37.568  -7.167  13.789  1.00 82.39  ? 135 LYS A CE     1 
ATOM   2188 N  NZ     . LYS A 1 135 ? 37.870  -7.946  15.032  1.00 84.63  ? 135 LYS A NZ     1 
ATOM   2189 H  H      . LYS A 1 135 ? 34.920  -4.735  10.070  1.00 71.07  ? 135 LYS A H      1 
ATOM   2190 H  HA     . LYS A 1 135 ? 34.126  -6.970  11.307  1.00 79.85  ? 135 LYS A HA     1 
ATOM   2191 H  HB2    . LYS A 1 135 ? 34.370  -4.334  12.298  1.00 79.96  ? 135 LYS A HB2    1 
ATOM   2192 H  HB3    . LYS A 1 135 ? 33.947  -5.567  13.205  1.00 79.96  ? 135 LYS A HB3    1 
ATOM   2193 H  HG2    . LYS A 1 135 ? 36.381  -5.780  11.887  1.00 79.77  ? 135 LYS A HG2    1 
ATOM   2194 H  HG3    . LYS A 1 135 ? 36.326  -4.806  13.144  1.00 79.77  ? 135 LYS A HG3    1 
ATOM   2195 H  HD2    . LYS A 1 135 ? 35.757  -6.545  14.533  1.00 86.11  ? 135 LYS A HD2    1 
ATOM   2196 H  HD3    . LYS A 1 135 ? 35.609  -7.534  13.294  1.00 86.11  ? 135 LYS A HD3    1 
ATOM   2197 H  HE2    . LYS A 1 135 ? 37.818  -7.715  13.028  1.00 98.87  ? 135 LYS A HE2    1 
ATOM   2198 H  HE3    . LYS A 1 135 ? 38.107  -6.361  13.805  1.00 98.87  ? 135 LYS A HE3    1 
ATOM   2199 H  HZ1    . LYS A 1 135 ? 38.736  -8.147  15.062  1.00 101.55 ? 135 LYS A HZ1    1 
ATOM   2200 H  HZ2    . LYS A 1 135 ? 37.660  -7.464  15.751  1.00 101.55 ? 135 LYS A HZ2    1 
ATOM   2201 H  HZ3    . LYS A 1 135 ? 37.397  -8.699  15.041  1.00 101.55 ? 135 LYS A HZ3    1 
ATOM   2202 N  N      . GLU A 1 136 ? 31.943  -4.847  10.395  1.00 56.24  ? 136 GLU A N      1 
ATOM   2203 C  CA     . GLU A 1 136 ? 30.515  -4.504  10.421  1.00 58.22  ? 136 GLU A CA     1 
ATOM   2204 C  C      . GLU A 1 136 ? 29.873  -4.385  9.038   1.00 55.21  ? 136 GLU A C      1 
ATOM   2205 O  O      . GLU A 1 136 ? 28.653  -4.287  8.929   1.00 45.98  ? 136 GLU A O      1 
ATOM   2206 C  CB     . GLU A 1 136 ? 30.308  -3.201  11.203  1.00 55.13  ? 136 GLU A CB     1 
ATOM   2207 C  CG     . GLU A 1 136 ? 30.774  -3.289  12.649  1.00 53.47  ? 136 GLU A CG     1 
ATOM   2208 C  CD     . GLU A 1 136 ? 29.848  -4.128  13.522  1.00 64.51  ? 136 GLU A CD     1 
ATOM   2209 O  OE1    . GLU A 1 136 ? 28.681  -4.379  13.124  1.00 53.33  ? 136 GLU A OE1    1 
ATOM   2210 O  OE2    . GLU A 1 136 ? 30.296  -4.538  14.614  1.00 63.11  ? 136 GLU A OE2    1 
ATOM   2211 H  H      . GLU A 1 136 ? 32.420  -4.341  9.889   1.00 67.49  ? 136 GLU A H      1 
ATOM   2212 H  HA     . GLU A 1 136 ? 30.039  -5.213  10.903  1.00 69.87  ? 136 GLU A HA     1 
ATOM   2213 H  HB2    . GLU A 1 136 ? 30.808  -2.491  10.771  1.00 66.16  ? 136 GLU A HB2    1 
ATOM   2214 H  HB3    . GLU A 1 136 ? 29.362  -2.983  11.207  1.00 66.16  ? 136 GLU A HB3    1 
ATOM   2215 H  HG2    . GLU A 1 136 ? 31.655  -3.693  12.672  1.00 64.16  ? 136 GLU A HG2    1 
ATOM   2216 H  HG3    . GLU A 1 136 ? 30.809  -2.395  13.024  1.00 64.16  ? 136 GLU A HG3    1 
ATOM   2217 N  N      . LYS A 1 137 ? 30.697  -4.384  7.994   1.00 55.85  ? 137 LYS A N      1 
ATOM   2218 C  CA     . LYS A 1 137 ? 30.214  -4.319  6.612   1.00 58.13  ? 137 LYS A CA     1 
ATOM   2219 C  C      . LYS A 1 137 ? 29.522  -2.981  6.302   1.00 59.96  ? 137 LYS A C      1 
ATOM   2220 O  O      . LYS A 1 137 ? 28.687  -2.882  5.402   1.00 52.12  ? 137 LYS A O      1 
ATOM   2221 C  CB     . LYS A 1 137 ? 29.296  -5.514  6.302   1.00 63.79  ? 137 LYS A CB     1 
ATOM   2222 C  CG     . LYS A 1 137 ? 29.994  -6.896  6.385   1.00 63.86  ? 137 LYS A CG     1 
ATOM   2223 C  CD     . LYS A 1 137 ? 31.290  -6.937  5.568   1.00 80.23  ? 137 LYS A CD     1 
ATOM   2224 C  CE     . LYS A 1 137 ? 32.050  -8.277  5.679   1.00 79.80  ? 137 LYS A CE     1 
ATOM   2225 N  NZ     . LYS A 1 137 ? 32.058  -8.912  7.047   1.00 67.47  ? 137 LYS A NZ     1 
ATOM   2226 H  H      . LYS A 1 137 ? 31.553  -4.421  8.058   1.00 67.02  ? 137 LYS A H      1 
ATOM   2227 H  HA     . LYS A 1 137 ? 30.988  -4.387  6.015   1.00 69.76  ? 137 LYS A HA     1 
ATOM   2228 H  HB2    . LYS A 1 137 ? 28.563  -5.516  6.938   1.00 76.55  ? 137 LYS A HB2    1 
ATOM   2229 H  HB3    . LYS A 1 137 ? 28.948  -5.414  5.402   1.00 76.55  ? 137 LYS A HB3    1 
ATOM   2230 H  HG2    . LYS A 1 137 ? 30.215  -7.086  7.311   1.00 76.63  ? 137 LYS A HG2    1 
ATOM   2231 H  HG3    . LYS A 1 137 ? 29.396  -7.576  6.038   1.00 76.63  ? 137 LYS A HG3    1 
ATOM   2232 H  HD2    . LYS A 1 137 ? 31.074  -6.795  4.633   1.00 96.28  ? 137 LYS A HD2    1 
ATOM   2233 H  HD3    . LYS A 1 137 ? 31.880  -6.234  5.880   1.00 96.28  ? 137 LYS A HD3    1 
ATOM   2234 H  HE2    . LYS A 1 137 ? 31.645  -8.911  5.067   1.00 95.77  ? 137 LYS A HE2    1 
ATOM   2235 H  HE3    . LYS A 1 137 ? 32.974  -8.126  5.424   1.00 95.77  ? 137 LYS A HE3    1 
ATOM   2236 H  HZ1    . LYS A 1 137 ? 32.515  -9.676  7.025   1.00 80.97  ? 137 LYS A HZ1    1 
ATOM   2237 H  HZ2    . LYS A 1 137 ? 32.440  -8.364  7.635   1.00 80.97  ? 137 LYS A HZ2    1 
ATOM   2238 H  HZ3    . LYS A 1 137 ? 31.224  -9.081  7.308   1.00 80.97  ? 137 LYS A HZ3    1 
ATOM   2239 N  N      . ILE A 1 138 ? 29.911  -1.951  7.046   1.00 56.52  ? 138 ILE A N      1 
ATOM   2240 C  CA     . ILE A 1 138 ? 29.394  -0.598  6.875   1.00 48.96  ? 138 ILE A CA     1 
ATOM   2241 C  C      . ILE A 1 138 ? 30.447  0.255   6.163   1.00 51.96  ? 138 ILE A C      1 
ATOM   2242 O  O      . ILE A 1 138 ? 31.617  0.263   6.571   1.00 54.74  ? 138 ILE A O      1 
ATOM   2243 C  CB     . ILE A 1 138 ? 29.092  0.034   8.279   1.00 57.10  ? 138 ILE A CB     1 
ATOM   2244 C  CG1    . ILE A 1 138 ? 27.822  -0.577  8.906   1.00 44.55  ? 138 ILE A CG1    1 
ATOM   2245 C  CG2    . ILE A 1 138 ? 29.010  1.568   8.213   1.00 38.65  ? 138 ILE A CG2    1 
ATOM   2246 C  CD1    . ILE A 1 138 ? 26.583  -0.396  8.065   1.00 44.58  ? 138 ILE A CD1    1 
ATOM   2247 H  H      . ILE A 1 138 ? 30.492  -2.014  7.677   1.00 67.82  ? 138 ILE A H      1 
ATOM   2248 H  HA     . ILE A 1 138 ? 28.572  -0.612  6.341   1.00 58.75  ? 138 ILE A HA     1 
ATOM   2249 H  HB     . ILE A 1 138 ? 29.835  -0.190  8.861   1.00 68.53  ? 138 ILE A HB     1 
ATOM   2250 H  HG12   . ILE A 1 138 ? 27.960  -1.529  9.029   1.00 53.46  ? 138 ILE A HG12   1 
ATOM   2251 H  HG13   . ILE A 1 138 ? 27.662  -0.155  9.764   1.00 53.46  ? 138 ILE A HG13   1 
ATOM   2252 H  HG21   . ILE A 1 138 ? 28.825  1.909   9.091   1.00 46.38  ? 138 ILE A HG21   1 
ATOM   2253 H  HG22   . ILE A 1 138 ? 29.850  1.912   7.899   1.00 46.38  ? 138 ILE A HG22   1 
ATOM   2254 H  HG23   . ILE A 1 138 ? 28.307  1.818   7.609   1.00 46.38  ? 138 ILE A HG23   1 
ATOM   2255 H  HD11   . ILE A 1 138 ? 25.838  -0.800  8.517   1.00 53.50  ? 138 ILE A HD11   1 
ATOM   2256 H  HD12   . ILE A 1 138 ? 26.424  0.542   7.943   1.00 53.50  ? 138 ILE A HD12   1 
ATOM   2257 H  HD13   . ILE A 1 138 ? 26.719  -0.819  7.214   1.00 53.50  ? 138 ILE A HD13   1 
ATOM   2258 N  N      . THR A 1 139 ? 30.053  0.976   5.114   1.00 38.95  ? 139 THR A N      1 
ATOM   2259 C  CA     . THR A 1 139 ? 30.957  1.953   4.503   1.00 50.33  ? 139 THR A CA     1 
ATOM   2260 C  C      . THR A 1 139 ? 30.841  3.326   5.180   1.00 55.60  ? 139 THR A C      1 
ATOM   2261 O  O      . THR A 1 139 ? 29.776  3.692   5.683   1.00 47.14  ? 139 THR A O      1 
ATOM   2262 C  CB     . THR A 1 139 ? 30.687  2.127   2.994   1.00 52.35  ? 139 THR A CB     1 
ATOM   2263 O  OG1    . THR A 1 139 ? 29.356  2.614   2.802   1.00 56.55  ? 139 THR A OG1    1 
ATOM   2264 C  CG2    . THR A 1 139 ? 30.881  0.793   2.223   1.00 50.85  ? 139 THR A CG2    1 
ATOM   2265 H  H      . THR A 1 139 ? 29.279  0.922   4.742   1.00 46.74  ? 139 THR A H      1 
ATOM   2266 H  HA     . THR A 1 139 ? 31.880  1.641   4.610   1.00 60.40  ? 139 THR A HA     1 
ATOM   2267 H  HB     . THR A 1 139 ? 31.314  2.774   2.634   1.00 62.82  ? 139 THR A HB     1 
ATOM   2268 H  HG1    . THR A 1 139 ? 29.264  3.337   3.178   1.00 67.86  ? 139 THR A HG1    1 
ATOM   2269 H  HG21   . THR A 1 139 ? 30.708  0.926   1.288   1.00 61.01  ? 139 THR A HG21   1 
ATOM   2270 H  HG22   . THR A 1 139 ? 31.781  0.479   2.332   1.00 61.01  ? 139 THR A HG22   1 
ATOM   2271 H  HG23   . THR A 1 139 ? 30.276  0.129   2.560   1.00 61.01  ? 139 THR A HG23   1 
ATOM   2272 N  N      . VAL A 1 140 ? 31.942  4.079   5.181   1.00 47.87  ? 140 VAL A N      1 
ATOM   2273 C  CA     . VAL A 1 140 ? 31.983  5.398   5.791   1.00 48.01  ? 140 VAL A CA     1 
ATOM   2274 C  C      . VAL A 1 140 ? 32.860  6.332   4.976   1.00 57.02  ? 140 VAL A C      1 
ATOM   2275 O  O      . VAL A 1 140 ? 33.523  5.911   4.031   1.00 56.49  ? 140 VAL A O      1 
ATOM   2276 C  CB     . VAL A 1 140 ? 32.532  5.335   7.233   1.00 50.75  ? 140 VAL A CB     1 
ATOM   2277 C  CG1    . VAL A 1 140 ? 31.789  4.289   8.036   1.00 44.46  ? 140 VAL A CG1    1 
ATOM   2278 C  CG2    . VAL A 1 140 ? 34.024  5.046   7.228   1.00 45.38  ? 140 VAL A CG2    1 
ATOM   2279 H  H      . VAL A 1 140 ? 32.688  3.840   4.826   1.00 57.44  ? 140 VAL A H      1 
ATOM   2280 H  HA     . VAL A 1 140 ? 31.077  5.771   5.821   1.00 57.62  ? 140 VAL A HA     1 
ATOM   2281 H  HB     . VAL A 1 140 ? 32.393  6.204   7.665   1.00 60.90  ? 140 VAL A HB     1 
ATOM   2282 H  HG11   . VAL A 1 140 ? 32.146  4.268   8.927   1.00 53.35  ? 140 VAL A HG11   1 
ATOM   2283 H  HG12   . VAL A 1 140 ? 30.857  4.519   8.062   1.00 53.35  ? 140 VAL A HG12   1 
ATOM   2284 H  HG13   . VAL A 1 140 ? 31.904  3.433   7.616   1.00 53.35  ? 140 VAL A HG13   1 
ATOM   2285 H  HG21   . VAL A 1 140 ? 34.338  5.012   8.135   1.00 54.46  ? 140 VAL A HG21   1 
ATOM   2286 H  HG22   . VAL A 1 140 ? 34.176  4.202   6.797   1.00 54.46  ? 140 VAL A HG22   1 
ATOM   2287 H  HG23   . VAL A 1 140 ? 34.476  5.745   6.750   1.00 54.46  ? 140 VAL A HG23   1 
ATOM   2288 N  N      . THR A 1 141 ? 32.860  7.606   5.349   1.00 48.63  ? 141 THR A N      1 
ATOM   2289 C  CA     . THR A 1 141 ? 33.672  8.610   4.681   1.00 54.11  ? 141 THR A CA     1 
ATOM   2290 C  C      . THR A 1 141 ? 34.600  9.275   5.685   1.00 56.29  ? 141 THR A C      1 
ATOM   2291 O  O      . THR A 1 141 ? 34.209  9.560   6.820   1.00 50.70  ? 141 THR A O      1 
ATOM   2292 C  CB     . THR A 1 141 ? 32.798  9.670   3.999   1.00 51.99  ? 141 THR A CB     1 
ATOM   2293 O  OG1    . THR A 1 141 ? 32.141  9.079   2.872   1.00 57.07  ? 141 THR A OG1    1 
ATOM   2294 C  CG2    . THR A 1 141 ? 33.632  10.855  3.522   1.00 47.46  ? 141 THR A CG2    1 
ATOM   2295 H  H      . THR A 1 141 ? 32.390  7.917   5.999   1.00 58.35  ? 141 THR A H      1 
ATOM   2296 H  HA     . THR A 1 141 ? 34.221  8.177   3.994   1.00 64.93  ? 141 THR A HA     1 
ATOM   2297 H  HB     . THR A 1 141 ? 32.134  9.994   4.627   1.00 62.39  ? 141 THR A HB     1 
ATOM   2298 H  HG1    . THR A 1 141 ? 31.670  8.454   3.118   1.00 68.48  ? 141 THR A HG1    1 
ATOM   2299 H  HG21   . THR A 1 141 ? 33.067  11.505  3.099   1.00 56.95  ? 141 THR A HG21   1 
ATOM   2300 H  HG22   . THR A 1 141 ? 34.075  11.265  4.268   1.00 56.95  ? 141 THR A HG22   1 
ATOM   2301 H  HG23   . THR A 1 141 ? 34.293  10.559  2.891   1.00 56.95  ? 141 THR A HG23   1 
ATOM   2302 N  N      . VAL A 1 142 ? 35.836  9.517   5.258   1.00 61.43  ? 142 VAL A N      1 
ATOM   2303 C  CA     . VAL A 1 142 ? 36.868  10.061  6.130   1.00 55.66  ? 142 VAL A CA     1 
ATOM   2304 C  C      . VAL A 1 142 ? 37.334  11.414  5.604   1.00 55.85  ? 142 VAL A C      1 
ATOM   2305 O  O      . VAL A 1 142 ? 37.602  11.576  4.416   1.00 51.95  ? 142 VAL A O      1 
ATOM   2306 C  CB     . VAL A 1 142 ? 38.054  9.088   6.245   1.00 57.54  ? 142 VAL A CB     1 
ATOM   2307 C  CG1    . VAL A 1 142 ? 39.176  9.684   7.102   1.00 54.81  ? 142 VAL A CG1    1 
ATOM   2308 C  CG2    . VAL A 1 142 ? 37.581  7.764   6.830   1.00 48.13  ? 142 VAL A CG2    1 
ATOM   2309 H  H      . VAL A 1 142 ? 36.105  9.371   4.454   1.00 73.72  ? 142 VAL A H      1 
ATOM   2310 H  HA     . VAL A 1 142 ? 36.494  10.194  7.026   1.00 66.79  ? 142 VAL A HA     1 
ATOM   2311 H  HB     . VAL A 1 142 ? 38.414  8.914   5.350   1.00 69.05  ? 142 VAL A HB     1 
ATOM   2312 H  HG11   . VAL A 1 142 ? 39.898  9.053   7.153   1.00 65.77  ? 142 VAL A HG11   1 
ATOM   2313 H  HG12   . VAL A 1 142 ? 39.480  10.498  6.695   1.00 65.77  ? 142 VAL A HG12   1 
ATOM   2314 H  HG13   . VAL A 1 142 ? 38.835  9.864   7.981   1.00 65.77  ? 142 VAL A HG13   1 
ATOM   2315 H  HG21   . VAL A 1 142 ? 38.329  7.166   6.897   1.00 57.75  ? 142 VAL A HG21   1 
ATOM   2316 H  HG22   . VAL A 1 142 ? 37.209  7.922   7.701   1.00 57.75  ? 142 VAL A HG22   1 
ATOM   2317 H  HG23   . VAL A 1 142 ? 36.912  7.388   6.252   1.00 57.75  ? 142 VAL A HG23   1 
ATOM   2318 N  N      . GLY A 1 143 ? 37.376  12.390  6.498   1.00 48.97  ? 143 GLY A N      1 
ATOM   2319 C  CA     . GLY A 1 143 ? 37.899  13.706  6.203   1.00 56.25  ? 143 GLY A CA     1 
ATOM   2320 C  C      . GLY A 1 143 ? 39.066  13.974  7.136   1.00 63.26  ? 143 GLY A C      1 
ATOM   2321 O  O      . GLY A 1 143 ? 39.002  13.652  8.326   1.00 51.63  ? 143 GLY A O      1 
ATOM   2322 H  H      . GLY A 1 143 ? 37.098  12.307  7.308   1.00 58.76  ? 143 GLY A H      1 
ATOM   2323 H  HA2    . GLY A 1 143 ? 38.207  13.748  5.284   1.00 67.50  ? 143 GLY A HA2    1 
ATOM   2324 H  HA3    . GLY A 1 143 ? 37.215  14.379  6.343   1.00 67.50  ? 143 GLY A HA3    1 
ATOM   2325 N  N      . ILE A 1 144 ? 40.136  14.550  6.593   1.00 64.55  ? 144 ILE A N      1 
ATOM   2326 C  CA     . ILE A 1 144 ? 41.341  14.835  7.368   1.00 58.73  ? 144 ILE A CA     1 
ATOM   2327 C  C      . ILE A 1 144 ? 41.840  16.251  7.088   1.00 59.07  ? 144 ILE A C      1 
ATOM   2328 O  O      . ILE A 1 144 ? 41.887  16.689  5.935   1.00 56.28  ? 144 ILE A O      1 
ATOM   2329 C  CB     . ILE A 1 144 ? 42.446  13.829  7.030   1.00 62.53  ? 144 ILE A CB     1 
ATOM   2330 C  CG1    . ILE A 1 144 ? 42.026  12.433  7.494   1.00 59.99  ? 144 ILE A CG1    1 
ATOM   2331 C  CG2    . ILE A 1 144 ? 43.769  14.237  7.681   1.00 58.40  ? 144 ILE A CG2    1 
ATOM   2332 C  CD1    . ILE A 1 144 ? 42.520  11.314  6.595   1.00 56.95  ? 144 ILE A CD1    1 
ATOM   2333 H  H      . ILE A 1 144 ? 40.190  14.787  5.768   1.00 77.46  ? 144 ILE A H      1 
ATOM   2334 H  HA     . ILE A 1 144 ? 41.138  14.762  8.323   1.00 70.48  ? 144 ILE A HA     1 
ATOM   2335 H  HB     . ILE A 1 144 ? 42.567  13.812  6.068   1.00 75.03  ? 144 ILE A HB     1 
ATOM   2336 H  HG12   . ILE A 1 144 ? 42.383  12.279  8.383   1.00 71.99  ? 144 ILE A HG12   1 
ATOM   2337 H  HG13   . ILE A 1 144 ? 41.057  12.390  7.516   1.00 71.99  ? 144 ILE A HG13   1 
ATOM   2338 H  HG21   . ILE A 1 144 ? 44.442  13.590  7.454   1.00 70.08  ? 144 ILE A HG21   1 
ATOM   2339 H  HG22   . ILE A 1 144 ? 44.024  15.103  7.355   1.00 70.08  ? 144 ILE A HG22   1 
ATOM   2340 H  HG23   . ILE A 1 144 ? 43.652  14.267  8.634   1.00 70.08  ? 144 ILE A HG23   1 
ATOM   2341 H  HD11   . ILE A 1 144 ? 42.219  10.474  6.948   1.00 68.33  ? 144 ILE A HD11   1 
ATOM   2342 H  HD12   . ILE A 1 144 ? 42.167  11.444  5.712   1.00 68.33  ? 144 ILE A HD12   1 
ATOM   2343 H  HD13   . ILE A 1 144 ? 43.480  11.334  6.570   1.00 68.33  ? 144 ILE A HD13   1 
ATOM   2344 N  N      . SER A 1 145 ? 42.195  16.963  8.152   1.00 59.06  ? 145 SER A N      1 
ATOM   2345 C  CA     . SER A 1 145 ? 42.747  18.314  8.039   1.00 63.16  ? 145 SER A CA     1 
ATOM   2346 C  C      . SER A 1 145 ? 43.302  18.777  9.390   1.00 54.07  ? 145 SER A C      1 
ATOM   2347 O  O      . SER A 1 145 ? 43.491  17.972  10.291  1.00 51.70  ? 145 SER A O      1 
ATOM   2348 C  CB     . SER A 1 145 ? 41.682  19.289  7.544   1.00 59.09  ? 145 SER A CB     1 
ATOM   2349 O  OG     . SER A 1 145 ? 42.270  20.522  7.166   1.00 63.75  ? 145 SER A OG     1 
ATOM   2350 H  H      . SER A 1 145 ? 42.126  16.685  8.962   1.00 70.88  ? 145 SER A H      1 
ATOM   2351 H  HA     . SER A 1 145 ? 43.483  18.309  7.391   1.00 75.79  ? 145 SER A HA     1 
ATOM   2352 H  HB2    . SER A 1 145 ? 41.233  18.904  6.776   1.00 70.90  ? 145 SER A HB2    1 
ATOM   2353 H  HB3    . SER A 1 145 ? 41.044  19.449  8.257   1.00 70.90  ? 145 SER A HB3    1 
ATOM   2354 H  HG     . SER A 1 145 ? 43.081  20.492  7.281   1.00 76.50  ? 145 SER A HG     1 
ATOM   2355 N  N      . LYS A 1 146 ? 43.535  20.077  9.535   1.00 54.97  ? 146 LYS A N      1 
ATOM   2356 C  CA     . LYS A 1 146 ? 44.245  20.602  10.697  1.00 60.52  ? 146 LYS A CA     1 
ATOM   2357 C  C      . LYS A 1 146 ? 43.330  20.918  11.888  1.00 56.62  ? 146 LYS A C      1 
ATOM   2358 O  O      . LYS A 1 146 ? 43.811  21.071  13.009  1.00 65.58  ? 146 LYS A O      1 
ATOM   2359 C  CB     . LYS A 1 146 ? 45.047  21.844  10.298  1.00 57.96  ? 146 LYS A CB     1 
ATOM   2360 C  CG     . LYS A 1 146 ? 44.189  23.027  9.893   1.00 60.39  ? 146 LYS A CG     1 
ATOM   2361 C  CD     . LYS A 1 146 ? 44.997  24.075  9.160   1.00 73.27  ? 146 LYS A CD     1 
ATOM   2362 C  CE     . LYS A 1 146 ? 45.900  24.853  10.099  1.00 70.89  ? 146 LYS A CE     1 
ATOM   2363 N  NZ     . LYS A 1 146 ? 46.789  25.764  9.330   1.00 74.78  ? 146 LYS A NZ     1 
ATOM   2364 H  H      . LYS A 1 146 ? 43.291  20.679  8.972   1.00 65.97  ? 146 LYS A H      1 
ATOM   2365 H  HA     . LYS A 1 146 ? 44.887  19.925  10.996  1.00 72.63  ? 146 LYS A HA     1 
ATOM   2366 H  HB2    . LYS A 1 146 ? 45.593  22.118  11.051  1.00 69.55  ? 146 LYS A HB2    1 
ATOM   2367 H  HB3    . LYS A 1 146 ? 45.615  21.619  9.545   1.00 69.55  ? 146 LYS A HB3    1 
ATOM   2368 H  HG2    . LYS A 1 146 ? 43.481  22.722  9.304   1.00 72.47  ? 146 LYS A HG2    1 
ATOM   2369 H  HG3    . LYS A 1 146 ? 43.812  23.435  10.688  1.00 72.47  ? 146 LYS A HG3    1 
ATOM   2370 H  HD2    . LYS A 1 146 ? 45.554  23.641  8.495   1.00 87.92  ? 146 LYS A HD2    1 
ATOM   2371 H  HD3    . LYS A 1 146 ? 44.393  24.702  8.732   1.00 87.92  ? 146 LYS A HD3    1 
ATOM   2372 H  HE2    . LYS A 1 146 ? 45.357  25.388  10.699  1.00 85.07  ? 146 LYS A HE2    1 
ATOM   2373 H  HE3    . LYS A 1 146 ? 46.453  24.235  10.601  1.00 85.07  ? 146 LYS A HE3    1 
ATOM   2374 H  HZ1    . LYS A 1 146 ? 46.300  26.341  8.860   1.00 89.74  ? 146 LYS A HZ1    1 
ATOM   2375 H  HZ2    . LYS A 1 146 ? 47.315  26.217  9.887   1.00 89.74  ? 146 LYS A HZ2    1 
ATOM   2376 H  HZ3    . LYS A 1 146 ? 47.296  25.293  8.770   1.00 89.74  ? 146 LYS A HZ3    1 
ATOM   2377 N  N      . ASN A 1 147 ? 42.022  21.006  11.655  1.00 51.86  ? 147 ASN A N      1 
ATOM   2378 C  CA     . ASN A 1 147 ? 41.060  21.167  12.750  1.00 51.64  ? 147 ASN A CA     1 
ATOM   2379 C  C      . ASN A 1 147 ? 39.726  20.458  12.502  1.00 50.84  ? 147 ASN A C      1 
ATOM   2380 O  O      . ASN A 1 147 ? 39.494  19.892  11.428  1.00 46.10  ? 147 ASN A O      1 
ATOM   2381 C  CB     . ASN A 1 147 ? 40.818  22.648  13.053  1.00 45.05  ? 147 ASN A CB     1 
ATOM   2382 C  CG     . ASN A 1 147 ? 40.215  23.399  11.880  1.00 60.38  ? 147 ASN A CG     1 
ATOM   2383 O  OD1    . ASN A 1 147 ? 39.317  22.894  11.195  1.00 49.19  ? 147 ASN A OD1    1 
ATOM   2384 N  ND2    . ASN A 1 147 ? 40.701  24.620  11.645  1.00 52.80  ? 147 ASN A ND2    1 
ATOM   2385 H  H      . ASN A 1 147 ? 41.664  20.975  10.873  1.00 62.24  ? 147 ASN A H      1 
ATOM   2386 H  HA     . ASN A 1 147 ? 41.450  20.769  13.557  1.00 61.97  ? 147 ASN A HA     1 
ATOM   2387 H  HB2    . ASN A 1 147 ? 40.205  22.722  13.801  1.00 54.05  ? 147 ASN A HB2    1 
ATOM   2388 H  HB3    . ASN A 1 147 ? 41.664  23.068  13.274  1.00 54.05  ? 147 ASN A HB3    1 
ATOM   2389 H  HD21   . ASN A 1 147 ? 40.393  25.087  10.991  1.00 63.36  ? 147 ASN A HD21   1 
ATOM   2390 H  HD22   . ASN A 1 147 ? 41.322  24.940  12.147  1.00 63.36  ? 147 ASN A HD22   1 
ATOM   2391 N  N      . LYS A 1 148 ? 38.854  20.496  13.505  1.00 45.42  ? 148 LYS A N      1 
ATOM   2392 C  CA     . LYS A 1 148 ? 37.572  19.813  13.421  1.00 50.72  ? 148 LYS A CA     1 
ATOM   2393 C  C      . LYS A 1 148 ? 36.731  20.305  12.246  1.00 48.33  ? 148 LYS A C      1 
ATOM   2394 O  O      . LYS A 1 148 ? 36.164  19.498  11.519  1.00 41.13  ? 148 LYS A O      1 
ATOM   2395 C  CB     . LYS A 1 148 ? 36.800  19.947  14.733  1.00 41.25  ? 148 LYS A CB     1 
ATOM   2396 C  CG     . LYS A 1 148 ? 37.327  18.994  15.804  1.00 51.64  ? 148 LYS A CG     1 
ATOM   2397 C  CD     . LYS A 1 148 ? 36.340  18.781  16.952  1.00 47.64  ? 148 LYS A CD     1 
ATOM   2398 C  CE     . LYS A 1 148 ? 36.066  20.075  17.686  1.00 45.72  ? 148 LYS A CE     1 
ATOM   2399 N  NZ     . LYS A 1 148 ? 35.343  19.874  18.967  1.00 53.11  ? 148 LYS A NZ     1 
ATOM   2400 H  H      . LYS A 1 148 ? 38.984  20.912  14.247  1.00 54.51  ? 148 LYS A H      1 
ATOM   2401 H  HA     . LYS A 1 148 ? 37.741  18.858  13.278  1.00 60.86  ? 148 LYS A HA     1 
ATOM   2402 H  HB2    . LYS A 1 148 ? 36.889  20.854  15.064  1.00 49.50  ? 148 LYS A HB2    1 
ATOM   2403 H  HB3    . LYS A 1 148 ? 35.866  19.739  14.575  1.00 49.50  ? 148 LYS A HB3    1 
ATOM   2404 H  HG2    . LYS A 1 148 ? 37.505  18.131  15.398  1.00 61.97  ? 148 LYS A HG2    1 
ATOM   2405 H  HG3    . LYS A 1 148 ? 38.145  19.360  16.176  1.00 61.97  ? 148 LYS A HG3    1 
ATOM   2406 H  HD2    . LYS A 1 148 ? 35.500  18.449  16.597  1.00 57.16  ? 148 LYS A HD2    1 
ATOM   2407 H  HD3    . LYS A 1 148 ? 36.713  18.146  17.583  1.00 57.16  ? 148 LYS A HD3    1 
ATOM   2408 H  HE2    . LYS A 1 148 ? 36.911  20.510  17.884  1.00 54.86  ? 148 LYS A HE2    1 
ATOM   2409 H  HE3    . LYS A 1 148 ? 35.523  20.648  17.122  1.00 54.86  ? 148 LYS A HE3    1 
ATOM   2410 H  HZ1    . LYS A 1 148 ? 34.558  19.483  18.815  1.00 63.73  ? 148 LYS A HZ1    1 
ATOM   2411 H  HZ2    . LYS A 1 148 ? 35.823  19.357  19.510  1.00 63.73  ? 148 LYS A HZ2    1 
ATOM   2412 H  HZ3    . LYS A 1 148 ? 35.203  20.658  19.364  1.00 63.73  ? 148 LYS A HZ3    1 
ATOM   2413 N  N      . VAL A 1 149 ? 36.684  21.620  12.042  1.00 45.60  ? 149 VAL A N      1 
ATOM   2414 C  CA     . VAL A 1 149 ? 35.823  22.206  11.016  1.00 38.20  ? 149 VAL A CA     1 
ATOM   2415 C  C      . VAL A 1 149 ? 36.221  21.758  9.621   1.00 50.65  ? 149 VAL A C      1 
ATOM   2416 O  O      . VAL A 1 149 ? 35.390  21.250  8.868   1.00 48.50  ? 149 VAL A O      1 
ATOM   2417 C  CB     . VAL A 1 149 ? 35.796  23.752  11.095  1.00 47.01  ? 149 VAL A CB     1 
ATOM   2418 C  CG1    . VAL A 1 149 ? 35.028  24.341  9.919   1.00 49.84  ? 149 VAL A CG1    1 
ATOM   2419 C  CG2    . VAL A 1 149 ? 35.157  24.203  12.399  1.00 48.20  ? 149 VAL A CG2    1 
ATOM   2420 H  H      . VAL A 1 149 ? 37.142  22.196  12.486  1.00 54.72  ? 149 VAL A H      1 
ATOM   2421 H  HA     . VAL A 1 149 ? 34.907  21.892  11.171  1.00 45.84  ? 149 VAL A HA     1 
ATOM   2422 H  HB     . VAL A 1 149 ? 36.714  24.095  11.067  1.00 56.41  ? 149 VAL A HB     1 
ATOM   2423 H  HG11   . VAL A 1 149 ? 35.028  25.299  9.994   1.00 59.80  ? 149 VAL A HG11   1 
ATOM   2424 H  HG12   . VAL A 1 149 ? 35.457  24.077  9.102   1.00 59.80  ? 149 VAL A HG12   1 
ATOM   2425 H  HG13   . VAL A 1 149 ? 34.127  24.011  9.938   1.00 59.80  ? 149 VAL A HG13   1 
ATOM   2426 H  HG21   . VAL A 1 149 ? 35.150  25.162  12.428  1.00 57.84  ? 149 VAL A HG21   1 
ATOM   2427 H  HG22   . VAL A 1 149 ? 34.258  23.867  12.438  1.00 57.84  ? 149 VAL A HG22   1 
ATOM   2428 H  HG23   . VAL A 1 149 ? 35.669  23.856  13.133  1.00 57.84  ? 149 VAL A HG23   1 
ATOM   2429 N  N      . PHE A 1 150 ? 37.488  21.921  9.270   1.00 49.06  ? 150 PHE A N      1 
ATOM   2430 C  CA     . PHE A 1 150 ? 37.941  21.555  7.933   1.00 51.16  ? 150 PHE A CA     1 
ATOM   2431 C  C      . PHE A 1 150 ? 37.995  20.047  7.722   1.00 46.15  ? 150 PHE A C      1 
ATOM   2432 O  O      . PHE A 1 150 ? 37.860  19.575  6.595   1.00 48.75  ? 150 PHE A O      1 
ATOM   2433 C  CB     . PHE A 1 150 ? 39.273  22.238  7.610   1.00 52.38  ? 150 PHE A CB     1 
ATOM   2434 C  CG     . PHE A 1 150 ? 39.116  23.690  7.287   1.00 48.81  ? 150 PHE A CG     1 
ATOM   2435 C  CD1    . PHE A 1 150 ? 38.821  24.089  5.997   1.00 54.81  ? 150 PHE A CD1    1 
ATOM   2436 C  CD2    . PHE A 1 150 ? 39.214  24.647  8.272   1.00 58.23  ? 150 PHE A CD2    1 
ATOM   2437 C  CE1    . PHE A 1 150 ? 38.647  25.418  5.693   1.00 53.69  ? 150 PHE A CE1    1 
ATOM   2438 C  CE2    . PHE A 1 150 ? 39.045  25.984  7.978   1.00 55.73  ? 150 PHE A CE2    1 
ATOM   2439 C  CZ     . PHE A 1 150 ? 38.757  26.370  6.685   1.00 60.27  ? 150 PHE A CZ     1 
ATOM   2440 H  H      . PHE A 1 150 ? 38.103  22.238  9.781   1.00 58.87  ? 150 PHE A H      1 
ATOM   2441 H  HA     . PHE A 1 150 ? 37.285  21.903  7.293   1.00 61.39  ? 150 PHE A HA     1 
ATOM   2442 H  HB2    . PHE A 1 150 ? 39.861  22.164  8.379   1.00 62.86  ? 150 PHE A HB2    1 
ATOM   2443 H  HB3    . PHE A 1 150 ? 39.674  21.801  6.842   1.00 62.86  ? 150 PHE A HB3    1 
ATOM   2444 H  HD1    . PHE A 1 150 ? 38.742  23.450  5.325   1.00 65.77  ? 150 PHE A HD1    1 
ATOM   2445 H  HD2    . PHE A 1 150 ? 39.404  24.389  9.145   1.00 69.88  ? 150 PHE A HD2    1 
ATOM   2446 H  HE1    . PHE A 1 150 ? 38.457  25.675  4.820   1.00 64.43  ? 150 PHE A HE1    1 
ATOM   2447 H  HE2    . PHE A 1 150 ? 39.121  26.622  8.650   1.00 66.88  ? 150 PHE A HE2    1 
ATOM   2448 H  HZ     . PHE A 1 150 ? 38.647  27.271  6.481   1.00 72.33  ? 150 PHE A HZ     1 
ATOM   2449 N  N      . ALA A 1 151 ? 38.146  19.282  8.798   1.00 47.64  ? 151 ALA A N      1 
ATOM   2450 C  CA     . ALA A 1 151 ? 38.043  17.832  8.689   1.00 48.33  ? 151 ALA A CA     1 
ATOM   2451 C  C      . ALA A 1 151 ? 36.627  17.434  8.278   1.00 47.55  ? 151 ALA A C      1 
ATOM   2452 O  O      . ALA A 1 151 ? 36.447  16.535  7.458   1.00 46.76  ? 151 ALA A O      1 
ATOM   2453 C  CB     . ALA A 1 151 ? 38.401  17.176  9.989   1.00 46.51  ? 151 ALA A CB     1 
ATOM   2454 H  H      . ALA A 1 151 ? 38.306  19.572  9.592   1.00 57.17  ? 151 ALA A H      1 
ATOM   2455 H  HA     . ALA A 1 151 ? 38.665  17.514  8.002   1.00 58.00  ? 151 ALA A HA     1 
ATOM   2456 H  HB1    . ALA A 1 151 ? 38.325  16.224  9.890   1.00 55.81  ? 151 ALA A HB1    1 
ATOM   2457 H  HB2    . ALA A 1 151 ? 39.303  17.411  10.219  1.00 55.81  ? 151 ALA A HB2    1 
ATOM   2458 H  HB3    . ALA A 1 151 ? 37.798  17.484  10.670  1.00 55.81  ? 151 ALA A HB3    1 
ATOM   2459 N  N      . LYS A 1 152 ? 35.623  18.081  8.867   1.00 42.07  ? 152 LYS A N      1 
ATOM   2460 C  CA     . LYS A 1 152 ? 34.233  17.798  8.508   1.00 49.73  ? 152 LYS A CA     1 
ATOM   2461 C  C      . LYS A 1 152 ? 33.951  18.243  7.076   1.00 50.65  ? 152 LYS A C      1 
ATOM   2462 O  O      . LYS A 1 152 ? 33.275  17.541  6.330   1.00 45.80  ? 152 LYS A O      1 
ATOM   2463 C  CB     . LYS A 1 152 ? 33.252  18.482  9.464   1.00 48.03  ? 152 LYS A CB     1 
ATOM   2464 C  CG     . LYS A 1 152 ? 31.790  18.346  9.037   1.00 51.33  ? 152 LYS A CG     1 
ATOM   2465 C  CD     . LYS A 1 152 ? 30.835  18.491  10.227  1.00 59.39  ? 152 LYS A CD     1 
ATOM   2466 C  CE     . LYS A 1 152 ? 29.441  17.999  9.886   1.00 67.27  ? 152 LYS A CE     1 
ATOM   2467 N  NZ     . LYS A 1 152 ? 28.581  17.925  11.091  1.00 67.11  ? 152 LYS A NZ     1 
ATOM   2468 H  H      . LYS A 1 152 ? 35.717  18.684  9.473   1.00 50.49  ? 152 LYS A H      1 
ATOM   2469 H  HA     . LYS A 1 152 ? 34.081  16.831  8.560   1.00 59.68  ? 152 LYS A HA     1 
ATOM   2470 H  HB2    . LYS A 1 152 ? 33.343  18.084  10.344  1.00 57.63  ? 152 LYS A HB2    1 
ATOM   2471 H  HB3    . LYS A 1 152 ? 33.463  19.428  9.506   1.00 57.63  ? 152 LYS A HB3    1 
ATOM   2472 H  HG2    . LYS A 1 152 ? 31.580  19.041  8.393   1.00 61.60  ? 152 LYS A HG2    1 
ATOM   2473 H  HG3    . LYS A 1 152 ? 31.653  17.471  8.643   1.00 61.60  ? 152 LYS A HG3    1 
ATOM   2474 H  HD2    . LYS A 1 152 ? 31.169  17.966  10.971  1.00 71.27  ? 152 LYS A HD2    1 
ATOM   2475 H  HD3    . LYS A 1 152 ? 30.774  19.426  10.477  1.00 71.27  ? 152 LYS A HD3    1 
ATOM   2476 H  HE2    . LYS A 1 152 ? 29.031  18.611  9.256   1.00 80.72  ? 152 LYS A HE2    1 
ATOM   2477 H  HE3    . LYS A 1 152 ? 29.501  17.111  9.500   1.00 80.72  ? 152 LYS A HE3    1 
ATOM   2478 H  HZ1    . LYS A 1 152 ? 28.937  17.364  11.684  1.00 80.53  ? 152 LYS A HZ1    1 
ATOM   2479 H  HZ2    . LYS A 1 152 ? 28.509  18.730  11.462  1.00 80.53  ? 152 LYS A HZ2    1 
ATOM   2480 H  HZ3    . LYS A 1 152 ? 27.770  17.634  10.869  1.00 80.53  ? 152 LYS A HZ3    1 
ATOM   2481 N  N      . ILE A 1 153 ? 34.466  19.408  6.696   1.00 44.74  ? 153 ILE A N      1 
ATOM   2482 C  CA     . ILE A 1 153 ? 34.323  19.883  5.318   1.00 50.03  ? 153 ILE A CA     1 
ATOM   2483 C  C      . ILE A 1 153 ? 34.948  18.881  4.341   1.00 56.08  ? 153 ILE A C      1 
ATOM   2484 O  O      . ILE A 1 153 ? 34.418  18.640  3.260   1.00 59.18  ? 153 ILE A O      1 
ATOM   2485 C  CB     . ILE A 1 153 ? 34.937  21.280  5.143   1.00 54.65  ? 153 ILE A CB     1 
ATOM   2486 C  CG1    . ILE A 1 153 ? 34.087  22.309  5.885   1.00 46.86  ? 153 ILE A CG1    1 
ATOM   2487 C  CG2    . ILE A 1 153 ? 35.016  21.644  3.669   1.00 59.04  ? 153 ILE A CG2    1 
ATOM   2488 C  CD1    . ILE A 1 153 ? 34.775  23.633  6.136   1.00 48.69  ? 153 ILE A CD1    1 
ATOM   2489 H  H      . ILE A 1 153 ? 34.902  19.942  7.211   1.00 53.69  ? 153 ILE A H      1 
ATOM   2490 H  HA     . ILE A 1 153 ? 33.368  19.949  5.107   1.00 60.03  ? 153 ILE A HA     1 
ATOM   2491 H  HB     . ILE A 1 153 ? 35.832  21.281  5.516   1.00 65.58  ? 153 ILE A HB     1 
ATOM   2492 H  HG12   . ILE A 1 153 ? 33.289  22.487  5.362   1.00 56.23  ? 153 ILE A HG12   1 
ATOM   2493 H  HG13   . ILE A 1 153 ? 33.837  21.941  6.746   1.00 56.23  ? 153 ILE A HG13   1 
ATOM   2494 H  HG21   . ILE A 1 153 ? 35.402  22.519  3.584   1.00 70.84  ? 153 ILE A HG21   1 
ATOM   2495 H  HG22   . ILE A 1 153 ? 35.564  20.999  3.216   1.00 70.84  ? 153 ILE A HG22   1 
ATOM   2496 H  HG23   . ILE A 1 153 ? 34.130  21.639  3.298   1.00 70.84  ? 153 ILE A HG23   1 
ATOM   2497 H  HD11   . ILE A 1 153 ? 34.172  24.215  6.604   1.00 58.43  ? 153 ILE A HD11   1 
ATOM   2498 H  HD12   . ILE A 1 153 ? 35.561  23.481  6.665   1.00 58.43  ? 153 ILE A HD12   1 
ATOM   2499 H  HD13   . ILE A 1 153 ? 35.019  24.023  5.293   1.00 58.43  ? 153 ILE A HD13   1 
ATOM   2500 N  N      . ALA A 1 154 ? 36.054  18.264  4.738   1.00 53.24  ? 154 ALA A N      1 
ATOM   2501 C  CA     . ALA A 1 154 ? 36.720  17.292  3.884   1.00 54.97  ? 154 ALA A CA     1 
ATOM   2502 C  C      . ALA A 1 154 ? 35.803  16.107  3.625   1.00 59.83  ? 154 ALA A C      1 
ATOM   2503 O  O      . ALA A 1 154 ? 35.608  15.701  2.475   1.00 58.41  ? 154 ALA A O      1 
ATOM   2504 C  CB     . ALA A 1 154 ? 38.016  16.818  4.516   1.00 53.09  ? 154 ALA A CB     1 
ATOM   2505 H  H      . ALA A 1 154 ? 36.438  18.390  5.497   1.00 63.88  ? 154 ALA A H      1 
ATOM   2506 H  HA     . ALA A 1 154 ? 36.933  17.710  3.023   1.00 65.96  ? 154 ALA A HA     1 
ATOM   2507 H  HB1    . ALA A 1 154 ? 38.433  16.180  3.932   1.00 63.71  ? 154 ALA A HB1    1 
ATOM   2508 H  HB2    . ALA A 1 154 ? 38.595  17.572  4.645   1.00 63.71  ? 154 ALA A HB2    1 
ATOM   2509 H  HB3    . ALA A 1 154 ? 37.818  16.408  5.362   1.00 63.71  ? 154 ALA A HB3    1 
ATOM   2510 N  N      . ALA A 1 155 ? 35.246  15.550  4.699   1.00 56.55  ? 155 ALA A N      1 
ATOM   2511 C  CA     . ALA A 1 155 ? 34.376  14.385  4.583   1.00 50.71  ? 155 ALA A CA     1 
ATOM   2512 C  C      . ALA A 1 155 ? 33.165  14.741  3.736   1.00 54.12  ? 155 ALA A C      1 
ATOM   2513 O  O      . ALA A 1 155 ? 32.716  13.945  2.911   1.00 51.46  ? 155 ALA A O      1 
ATOM   2514 C  CB     . ALA A 1 155 ? 33.938  13.883  5.963   1.00 48.16  ? 155 ALA A CB     1 
ATOM   2515 H  H      . ALA A 1 155 ? 35.357  15.829  5.505   1.00 67.86  ? 155 ALA A H      1 
ATOM   2516 H  HA     . ALA A 1 155 ? 34.863  13.663  4.134   1.00 60.86  ? 155 ALA A HA     1 
ATOM   2517 H  HB1    . ALA A 1 155 ? 33.368  13.119  5.850   1.00 57.79  ? 155 ALA A HB1    1 
ATOM   2518 H  HB2    . ALA A 1 155 ? 34.717  13.640  6.468   1.00 57.79  ? 155 ALA A HB2    1 
ATOM   2519 H  HB3    . ALA A 1 155 ? 33.460  14.584  6.413   1.00 57.79  ? 155 ALA A HB3    1 
ATOM   2520 N  N      . ASP A 1 156 ? 32.635  15.939  3.943   1.00 47.55  ? 156 ASP A N      1 
ATOM   2521 C  CA     . ASP A 1 156 ? 31.527  16.415  3.135   1.00 57.14  ? 156 ASP A CA     1 
ATOM   2522 C  C      . ASP A 1 156 ? 31.880  16.328  1.655   1.00 66.02  ? 156 ASP A C      1 
ATOM   2523 O  O      . ASP A 1 156 ? 31.061  15.915  0.832   1.00 61.71  ? 156 ASP A O      1 
ATOM   2524 C  CB     . ASP A 1 156 ? 31.188  17.855  3.492   1.00 54.99  ? 156 ASP A CB     1 
ATOM   2525 C  CG     . ASP A 1 156 ? 30.467  17.979  4.826   1.00 63.49  ? 156 ASP A CG     1 
ATOM   2526 O  OD1    . ASP A 1 156 ? 30.328  16.968  5.555   1.00 57.91  ? 156 ASP A OD1    1 
ATOM   2527 O  OD2    . ASP A 1 156 ? 30.049  19.108  5.148   1.00 67.97  ? 156 ASP A OD2    1 
ATOM   2528 H  H      . ASP A 1 156 ? 32.900  16.494  4.544   1.00 57.06  ? 156 ASP A H      1 
ATOM   2529 H  HA     . ASP A 1 156 ? 30.737  15.858  3.301   1.00 68.57  ? 156 ASP A HA     1 
ATOM   2530 H  HB2    . ASP A 1 156 ? 32.009  18.368  3.545   1.00 65.98  ? 156 ASP A HB2    1 
ATOM   2531 H  HB3    . ASP A 1 156 ? 30.611  18.223  2.804   1.00 65.98  ? 156 ASP A HB3    1 
ATOM   2532 N  N      . MET A 1 157 ? 33.111  16.706  1.324   1.00 58.56  ? 157 MET A N      1 
ATOM   2533 C  CA     . MET A 1 157 ? 33.515  16.840  -0.067  1.00 63.44  ? 157 MET A CA     1 
ATOM   2534 C  C      . MET A 1 157 ? 33.702  15.487  -0.728  1.00 63.42  ? 157 MET A C      1 
ATOM   2535 O  O      . MET A 1 157 ? 33.593  15.375  -1.946  1.00 64.18  ? 157 MET A O      1 
ATOM   2536 C  CB     . MET A 1 157 ? 34.810  17.653  -0.162  1.00 65.73  ? 157 MET A CB     1 
ATOM   2537 C  CG     . MET A 1 157 ? 34.602  19.147  0.047   1.00 61.22  ? 157 MET A CG     1 
ATOM   2538 S  SD     . MET A 1 157 ? 36.125  20.115  -0.012  1.00 73.33  ? 157 MET A SD     1 
ATOM   2539 C  CE     . MET A 1 157 ? 35.419  21.759  -0.163  1.00 79.51  ? 157 MET A CE     1 
ATOM   2540 H  H      . MET A 1 157 ? 33.731  16.891  1.890   1.00 70.27  ? 157 MET A H      1 
ATOM   2541 H  HA     . MET A 1 157 ? 32.819  17.331  -0.550  1.00 76.13  ? 157 MET A HA     1 
ATOM   2542 H  HB2    . MET A 1 157 ? 35.428  17.341  0.517   1.00 78.88  ? 157 MET A HB2    1 
ATOM   2543 H  HB3    . MET A 1 157 ? 35.196  17.527  -1.043  1.00 78.88  ? 157 MET A HB3    1 
ATOM   2544 H  HG2    . MET A 1 157 ? 34.013  19.480  -0.648  1.00 73.47  ? 157 MET A HG2    1 
ATOM   2545 H  HG3    . MET A 1 157 ? 34.196  19.286  0.917   1.00 73.47  ? 157 MET A HG3    1 
ATOM   2546 H  HE1    . MET A 1 157 ? 34.892  21.800  -0.964  1.00 95.41  ? 157 MET A HE1    1 
ATOM   2547 H  HE2    . MET A 1 157 ? 34.867  21.934  0.603   1.00 95.41  ? 157 MET A HE2    1 
ATOM   2548 H  HE3    . MET A 1 157 ? 36.132  22.402  -0.206  1.00 95.41  ? 157 MET A HE3    1 
ATOM   2549 N  N      . ALA A 1 158 ? 33.957  14.464  0.082   1.00 62.91  ? 158 ALA A N      1 
ATOM   2550 C  CA     . ALA A 1 158 ? 34.341  13.149  -0.423  1.00 56.49  ? 158 ALA A CA     1 
ATOM   2551 C  C      . ALA A 1 158 ? 33.254  12.080  -0.329  1.00 59.31  ? 158 ALA A C      1 
ATOM   2552 O  O      . ALA A 1 158 ? 33.446  10.983  -0.839  1.00 59.23  ? 158 ALA A O      1 
ATOM   2553 C  CB     . ALA A 1 158 ? 35.575  12.662  0.312   1.00 49.60  ? 158 ALA A CB     1 
ATOM   2554 H  H      . ALA A 1 158 ? 33.915  14.506  0.940   1.00 75.49  ? 158 ALA A H      1 
ATOM   2555 H  HA     . ALA A 1 158 ? 34.579  13.241  -1.369  1.00 67.79  ? 158 ALA A HA     1 
ATOM   2556 H  HB1    . ALA A 1 158 ? 35.819  11.798  -0.028  1.00 59.52  ? 158 ALA A HB1    1 
ATOM   2557 H  HB2    . ALA A 1 158 ? 36.291  13.285  0.167   1.00 59.52  ? 158 ALA A HB2    1 
ATOM   2558 H  HB3    . ALA A 1 158 ? 35.377  12.602  1.249   1.00 59.52  ? 158 ALA A HB3    1 
ATOM   2559 N  N      . LYS A 1 159 ? 32.135  12.347  0.342   1.00 63.16  ? 159 LYS A N      1 
ATOM   2560 C  CA     . LYS A 1 159 ? 31.118  11.296  0.445   1.00 67.96  ? 159 LYS A CA     1 
ATOM   2561 C  C      . LYS A 1 159 ? 30.406  11.142  -0.905  1.00 70.78  ? 159 LYS A C      1 
ATOM   2562 O  O      . LYS A 1 159 ? 30.210  12.119  -1.628  1.00 68.99  ? 159 LYS A O      1 
ATOM   2563 C  CB     . LYS A 1 159 ? 30.146  11.487  1.638   1.00 67.65  ? 159 LYS A CB     1 
ATOM   2564 C  CG     . LYS A 1 159 ? 29.467  12.845  1.799   1.00 67.32  ? 159 LYS A CG     1 
ATOM   2565 C  CD     . LYS A 1 159 ? 28.351  12.808  2.894   1.00 60.65  ? 159 LYS A CD     1 
ATOM   2566 C  CE     . LYS A 1 159 ? 28.888  12.765  4.336   1.00 60.82  ? 159 LYS A CE     1 
ATOM   2567 N  NZ     . LYS A 1 159 ? 27.914  13.322  5.368   1.00 50.10  ? 159 LYS A NZ     1 
ATOM   2568 H  H      . LYS A 1 159 ? 31.943  13.090  0.730   1.00 75.79  ? 159 LYS A H      1 
ATOM   2569 H  HA     . LYS A 1 159 ? 31.587  10.450  0.608   1.00 81.55  ? 159 LYS A HA     1 
ATOM   2570 H  HB2    . LYS A 1 159 ? 29.439  10.828  1.556   1.00 81.18  ? 159 LYS A HB2    1 
ATOM   2571 H  HB3    . LYS A 1 159 ? 30.640  11.321  2.456   1.00 81.18  ? 159 LYS A HB3    1 
ATOM   2572 H  HG2    . LYS A 1 159 ? 30.129  13.503  2.063   1.00 80.79  ? 159 LYS A HG2    1 
ATOM   2573 H  HG3    . LYS A 1 159 ? 29.058  13.099  0.957   1.00 80.79  ? 159 LYS A HG3    1 
ATOM   2574 H  HD2    . LYS A 1 159 ? 27.802  13.603  2.806   1.00 72.78  ? 159 LYS A HD2    1 
ATOM   2575 H  HD3    . LYS A 1 159 ? 27.807  12.017  2.758   1.00 72.78  ? 159 LYS A HD3    1 
ATOM   2576 H  HE2    . LYS A 1 159 ? 29.077  11.844  4.573   1.00 72.99  ? 159 LYS A HE2    1 
ATOM   2577 H  HE3    . LYS A 1 159 ? 29.702  13.291  4.382   1.00 72.99  ? 159 LYS A HE3    1 
ATOM   2578 H  HZ1    . LYS A 1 159 ? 27.729  14.173  5.184   1.00 60.12  ? 159 LYS A HZ1    1 
ATOM   2579 H  HZ2    . LYS A 1 159 ? 27.158  12.853  5.357   1.00 60.12  ? 159 LYS A HZ2    1 
ATOM   2580 H  HZ3    . LYS A 1 159 ? 28.272  13.274  6.182   1.00 60.12  ? 159 LYS A HZ3    1 
ATOM   2581 N  N      . PRO A 1 160 ? 30.024  9.910   -1.253  1.00 67.89  ? 160 PRO A N      1 
ATOM   2582 C  CA     . PRO A 1 160 ? 29.985  8.740   -0.382  1.00 67.25  ? 160 PRO A CA     1 
ATOM   2583 C  C      . PRO A 1 160 ? 31.251  7.905   -0.420  1.00 60.55  ? 160 PRO A C      1 
ATOM   2584 O  O      . PRO A 1 160 ? 32.096  8.114   -1.284  1.00 63.26  ? 160 PRO A O      1 
ATOM   2585 C  CB     . PRO A 1 160 ? 28.830  7.932   -0.977  1.00 65.62  ? 160 PRO A CB     1 
ATOM   2586 C  CG     . PRO A 1 160 ? 28.806  8.332   -2.466  1.00 70.74  ? 160 PRO A CG     1 
ATOM   2587 C  CD     . PRO A 1 160 ? 29.698  9.538   -2.638  1.00 73.06  ? 160 PRO A CD     1 
ATOM   2588 H  HA     . PRO A 1 160 ? 29.776  8.994   0.541   1.00 80.71  ? 160 PRO A HA     1 
ATOM   2589 H  HB2    . PRO A 1 160 ? 29.007  6.983   -0.877  1.00 78.74  ? 160 PRO A HB2    1 
ATOM   2590 H  HB3    . PRO A 1 160 ? 27.999  8.176   -0.541  1.00 78.74  ? 160 PRO A HB3    1 
ATOM   2591 H  HG2    . PRO A 1 160 ? 29.136  7.592   -3.000  1.00 84.89  ? 160 PRO A HG2    1 
ATOM   2592 H  HG3    . PRO A 1 160 ? 27.896  8.550   -2.722  1.00 84.89  ? 160 PRO A HG3    1 
ATOM   2593 H  HD2    . PRO A 1 160 ? 30.503  9.297   -3.123  1.00 87.67  ? 160 PRO A HD2    1 
ATOM   2594 H  HD3    . PRO A 1 160 ? 29.217  10.256  -3.078  1.00 87.67  ? 160 PRO A HD3    1 
ATOM   2595 N  N      . ASN A 1 161 ? 31.345  6.954   0.509   1.00 52.95  ? 161 ASN A N      1 
ATOM   2596 C  CA     . ASN A 1 161 ? 32.459  6.019   0.581   1.00 66.94  ? 161 ASN A CA     1 
ATOM   2597 C  C      . ASN A 1 161 ? 33.735  6.682   0.100   1.00 68.51  ? 161 ASN A C      1 
ATOM   2598 O  O      . ASN A 1 161 ? 34.327  6.265   -0.895  1.00 65.39  ? 161 ASN A O      1 
ATOM   2599 C  CB     . ASN A 1 161 ? 32.168  4.763   -0.251  1.00 64.13  ? 161 ASN A CB     1 
ATOM   2600 C  CG     . ASN A 1 161 ? 33.105  3.615   0.076   1.00 65.86  ? 161 ASN A CG     1 
ATOM   2601 O  OD1    . ASN A 1 161 ? 33.815  3.647   1.078   1.00 61.88  ? 161 ASN A OD1    1 
ATOM   2602 N  ND2    . ASN A 1 161 ? 33.099  2.584   -0.762  1.00 67.02  ? 161 ASN A ND2    1 
ATOM   2603 H  H      . ASN A 1 161 ? 30.757  6.831   1.124   1.00 63.54  ? 161 ASN A H      1 
ATOM   2604 H  HA     . ASN A 1 161 ? 32.589  5.744   1.513   1.00 80.32  ? 161 ASN A HA     1 
ATOM   2605 H  HB2    . ASN A 1 161 ? 31.260  4.470   -0.075  1.00 76.96  ? 161 ASN A HB2    1 
ATOM   2606 H  HB3    . ASN A 1 161 ? 32.271  4.976   -1.192  1.00 76.96  ? 161 ASN A HB3    1 
ATOM   2607 H  HD21   . ASN A 1 161 ? 33.614  1.910   -0.618  1.00 80.43  ? 161 ASN A HD21   1 
ATOM   2608 H  HD22   . ASN A 1 161 ? 32.582  2.591   -1.448  1.00 80.43  ? 161 ASN A HD22   1 
ATOM   2609 N  N      . GLY A 1 162 ? 34.149  7.723   0.814   1.00 62.60  ? 162 GLY A N      1 
ATOM   2610 C  CA     . GLY A 1 162 ? 35.285  8.519   0.400   1.00 64.72  ? 162 GLY A CA     1 
ATOM   2611 C  C      . GLY A 1 162 ? 36.356  8.709   1.460   1.00 69.90  ? 162 GLY A C      1 
ATOM   2612 O  O      . GLY A 1 162 ? 36.256  8.231   2.605   1.00 54.07  ? 162 GLY A O      1 
ATOM   2613 H  H      . GLY A 1 162 ? 33.782  7.987   1.546   1.00 75.13  ? 162 GLY A H      1 
ATOM   2614 H  HA2    . GLY A 1 162 ? 35.699  8.099   -0.370  1.00 77.67  ? 162 GLY A HA2    1 
ATOM   2615 H  HA3    . GLY A 1 162 ? 34.973  9.396   0.131   1.00 77.67  ? 162 GLY A HA3    1 
ATOM   2616 N  N      . ILE A 1 163 ? 37.402  9.415   1.043   1.00 62.97  ? 163 ILE A N      1 
ATOM   2617 C  CA     . ILE A 1 163 ? 38.466  9.861   1.924   1.00 58.88  ? 163 ILE A CA     1 
ATOM   2618 C  C      . ILE A 1 163 ? 39.145  11.049  1.250   1.00 64.03  ? 163 ILE A C      1 
ATOM   2619 O  O      . ILE A 1 163 ? 39.404  11.017  0.052   1.00 61.94  ? 163 ILE A O      1 
ATOM   2620 C  CB     . ILE A 1 163 ? 39.470  8.748   2.196   1.00 61.48  ? 163 ILE A CB     1 
ATOM   2621 C  CG1    . ILE A 1 163 ? 40.644  9.293   3.011   1.00 57.90  ? 163 ILE A CG1    1 
ATOM   2622 C  CG2    . ILE A 1 163 ? 39.942  8.126   0.886   1.00 62.52  ? 163 ILE A CG2    1 
ATOM   2623 C  CD1    . ILE A 1 163 ? 41.336  8.242   3.838   1.00 56.32  ? 163 ILE A CD1    1 
ATOM   2624 H  H      . ILE A 1 163 ? 37.517  9.654   0.225   1.00 75.56  ? 163 ILE A H      1 
ATOM   2625 H  HA     . ILE A 1 163 ? 38.087  10.158  2.777   1.00 70.65  ? 163 ILE A HA     1 
ATOM   2626 H  HB     . ILE A 1 163 ? 39.029  8.060   2.719   1.00 73.77  ? 163 ILE A HB     1 
ATOM   2627 H  HG12   . ILE A 1 163 ? 41.298  9.673   2.403   1.00 69.49  ? 163 ILE A HG12   1 
ATOM   2628 H  HG13   . ILE A 1 163 ? 40.316  9.979   3.613   1.00 69.49  ? 163 ILE A HG13   1 
ATOM   2629 H  HG21   . ILE A 1 163 ? 40.572  7.429   1.081   1.00 75.02  ? 163 ILE A HG21   1 
ATOM   2630 H  HG22   . ILE A 1 163 ? 39.184  7.763   0.422   1.00 75.02  ? 163 ILE A HG22   1 
ATOM   2631 H  HG23   . ILE A 1 163 ? 40.359  8.805   0.351   1.00 75.02  ? 163 ILE A HG23   1 
ATOM   2632 H  HD11   . ILE A 1 163 ? 42.058  8.651   4.320   1.00 67.58  ? 163 ILE A HD11   1 
ATOM   2633 H  HD12   . ILE A 1 163 ? 40.704  7.863   4.453   1.00 67.58  ? 163 ILE A HD12   1 
ATOM   2634 H  HD13   . ILE A 1 163 ? 41.676  7.560   3.254   1.00 67.58  ? 163 ILE A HD13   1 
ATOM   2635 N  N      . LYS A 1 164 ? 39.390  12.113  2.004   1.00 53.78  ? 164 LYS A N      1 
ATOM   2636 C  CA     . LYS A 1 164 ? 40.023  13.297  1.444   1.00 58.78  ? 164 LYS A CA     1 
ATOM   2637 C  C      . LYS A 1 164 ? 40.816  14.075  2.475   1.00 65.27  ? 164 LYS A C      1 
ATOM   2638 O  O      . LYS A 1 164 ? 40.396  14.204  3.625   1.00 66.02  ? 164 LYS A O      1 
ATOM   2639 C  CB     . LYS A 1 164 ? 38.991  14.234  0.821   1.00 58.44  ? 164 LYS A CB     1 
ATOM   2640 C  CG     . LYS A 1 164 ? 39.609  15.548  0.348   1.00 62.61  ? 164 LYS A CG     1 
ATOM   2641 C  CD     . LYS A 1 164 ? 38.627  16.428  -0.412  1.00 75.15  ? 164 LYS A CD     1 
ATOM   2642 C  CE     . LYS A 1 164 ? 39.214  17.812  -0.648  1.00 74.82  ? 164 LYS A CE     1 
ATOM   2643 N  NZ     . LYS A 1 164 ? 40.595  17.748  -1.219  1.00 78.05  ? 164 LYS A NZ     1 
ATOM   2644 H  H      . LYS A 1 164 ? 39.199  12.175  2.841   1.00 64.54  ? 164 LYS A H      1 
ATOM   2645 H  HA     . LYS A 1 164 ? 40.642  13.019  0.737   1.00 70.53  ? 164 LYS A HA     1 
ATOM   2646 H  HB2    . LYS A 1 164 ? 38.588  13.797  0.054   1.00 70.13  ? 164 LYS A HB2    1 
ATOM   2647 H  HB3    . LYS A 1 164 ? 38.311  14.441  1.481   1.00 70.13  ? 164 LYS A HB3    1 
ATOM   2648 H  HG2    . LYS A 1 164 ? 39.921  16.046  1.120   1.00 75.13  ? 164 LYS A HG2    1 
ATOM   2649 H  HG3    . LYS A 1 164 ? 40.354  15.352  -0.242  1.00 75.13  ? 164 LYS A HG3    1 
ATOM   2650 H  HD2    . LYS A 1 164 ? 38.433  16.026  -1.273  1.00 90.18  ? 164 LYS A HD2    1 
ATOM   2651 H  HD3    . LYS A 1 164 ? 37.813  16.525  0.107   1.00 90.18  ? 164 LYS A HD3    1 
ATOM   2652 H  HE2    . LYS A 1 164 ? 38.651  18.294  -1.274  1.00 89.78  ? 164 LYS A HE2    1 
ATOM   2653 H  HE3    . LYS A 1 164 ? 39.259  18.288  0.196   1.00 89.78  ? 164 LYS A HE3    1 
ATOM   2654 H  HZ1    . LYS A 1 164 ? 41.135  17.314  -0.661  1.00 93.65  ? 164 LYS A HZ1    1 
ATOM   2655 H  HZ2    . LYS A 1 164 ? 40.581  17.321  -2.000  1.00 93.65  ? 164 LYS A HZ2    1 
ATOM   2656 H  HZ3    . LYS A 1 164 ? 40.910  18.571  -1.346  1.00 93.65  ? 164 LYS A HZ3    1 
ATOM   2657 N  N      . VAL A 1 165 ? 41.961  14.598  2.045   1.00 65.31  ? 165 VAL A N      1 
ATOM   2658 C  CA     . VAL A 1 165 ? 42.752  15.505  2.860   1.00 58.04  ? 165 VAL A CA     1 
ATOM   2659 C  C      . VAL A 1 165 ? 42.571  16.937  2.366   1.00 69.42  ? 165 VAL A C      1 
ATOM   2660 O  O      . VAL A 1 165 ? 42.553  17.198  1.157   1.00 58.55  ? 165 VAL A O      1 
ATOM   2661 C  CB     . VAL A 1 165 ? 44.251  15.144  2.813   1.00 68.38  ? 165 VAL A CB     1 
ATOM   2662 C  CG1    . VAL A 1 165 ? 45.049  16.057  3.740   1.00 66.32  ? 165 VAL A CG1    1 
ATOM   2663 C  CG2    . VAL A 1 165 ? 44.462  13.677  3.188   1.00 61.81  ? 165 VAL A CG2    1 
ATOM   2664 H  H      . VAL A 1 165 ? 42.303  14.438  1.272   1.00 78.37  ? 165 VAL A H      1 
ATOM   2665 H  HA     . VAL A 1 165 ? 42.449  15.456  3.791   1.00 69.65  ? 165 VAL A HA     1 
ATOM   2666 H  HB     . VAL A 1 165 ? 44.583  15.275  1.901   1.00 82.06  ? 165 VAL A HB     1 
ATOM   2667 H  HG11   . VAL A 1 165 ? 45.977  15.814  3.695   1.00 79.59  ? 165 VAL A HG11   1 
ATOM   2668 H  HG12   . VAL A 1 165 ? 44.934  16.967  3.457   1.00 79.59  ? 165 VAL A HG12   1 
ATOM   2669 H  HG13   . VAL A 1 165 ? 44.726  15.949  4.638   1.00 79.59  ? 165 VAL A HG13   1 
ATOM   2670 H  HG21   . VAL A 1 165 ? 45.401  13.478  3.152   1.00 74.17  ? 165 VAL A HG21   1 
ATOM   2671 H  HG22   . VAL A 1 165 ? 44.130  13.531  4.077   1.00 74.17  ? 165 VAL A HG22   1 
ATOM   2672 H  HG23   . VAL A 1 165 ? 43.986  13.124  2.565   1.00 74.17  ? 165 VAL A HG23   1 
ATOM   2673 N  N      . ILE A 1 166 ? 42.403  17.856  3.313   1.00 58.85  ? 166 ILE A N      1 
ATOM   2674 C  CA     . ILE A 1 166 ? 42.477  19.279  3.040   1.00 62.05  ? 166 ILE A CA     1 
ATOM   2675 C  C      . ILE A 1 166 ? 43.750  19.800  3.691   1.00 66.85  ? 166 ILE A C      1 
ATOM   2676 O  O      . ILE A 1 166 ? 43.786  20.001  4.903   1.00 65.25  ? 166 ILE A O      1 
ATOM   2677 C  CB     . ILE A 1 166 ? 41.282  20.036  3.630   1.00 60.60  ? 166 ILE A CB     1 
ATOM   2678 C  CG1    . ILE A 1 166 ? 39.982  19.598  2.949   1.00 59.25  ? 166 ILE A CG1    1 
ATOM   2679 C  CG2    . ILE A 1 166 ? 41.478  21.538  3.480   1.00 62.44  ? 166 ILE A CG2    1 
ATOM   2680 C  CD1    . ILE A 1 166 ? 38.760  20.387  3.401   1.00 48.57  ? 166 ILE A CD1    1 
ATOM   2681 H  H      . ILE A 1 166 ? 42.243  17.672  4.138   1.00 70.62  ? 166 ILE A H      1 
ATOM   2682 H  HA     . ILE A 1 166 ? 42.518  19.438  2.074   1.00 74.46  ? 166 ILE A HA     1 
ATOM   2683 H  HB     . ILE A 1 166 ? 41.221  19.826  4.575   1.00 72.72  ? 166 ILE A HB     1 
ATOM   2684 H  HG12   . ILE A 1 166 ? 40.075  19.717  1.991   1.00 71.11  ? 166 ILE A HG12   1 
ATOM   2685 H  HG13   . ILE A 1 166 ? 39.823  18.662  3.151   1.00 71.11  ? 166 ILE A HG13   1 
ATOM   2686 H  HG21   . ILE A 1 166 ? 40.719  21.991  3.855   1.00 74.93  ? 166 ILE A HG21   1 
ATOM   2687 H  HG22   . ILE A 1 166 ? 42.277  21.797  3.945   1.00 74.93  ? 166 ILE A HG22   1 
ATOM   2688 H  HG23   . ILE A 1 166 ? 41.558  21.751  2.547   1.00 74.93  ? 166 ILE A HG23   1 
ATOM   2689 H  HD11   . ILE A 1 166 ? 37.987  20.059  2.935   1.00 58.29  ? 166 ILE A HD11   1 
ATOM   2690 H  HD12   . ILE A 1 166 ? 38.646  20.271  4.347   1.00 58.29  ? 166 ILE A HD12   1 
ATOM   2691 H  HD13   . ILE A 1 166 ? 38.896  21.315  3.198   1.00 58.29  ? 166 ILE A HD13   1 
ATOM   2692 N  N      . ASP A 1 167 ? 44.795  20.008  2.893   1.00 63.57  ? 167 ASP A N      1 
ATOM   2693 C  CA     . ASP A 1 167 ? 46.082  20.442  3.433   1.00 71.49  ? 167 ASP A CA     1 
ATOM   2694 C  C      . ASP A 1 167 ? 46.092  21.946  3.690   1.00 68.84  ? 167 ASP A C      1 
ATOM   2695 O  O      . ASP A 1 167 ? 45.103  22.637  3.425   1.00 67.66  ? 167 ASP A O      1 
ATOM   2696 C  CB     . ASP A 1 167 ? 47.247  20.036  2.513   1.00 67.70  ? 167 ASP A CB     1 
ATOM   2697 C  CG     . ASP A 1 167 ? 47.145  20.635  1.116   1.00 65.90  ? 167 ASP A CG     1 
ATOM   2698 O  OD1    . ASP A 1 167 ? 46.675  21.781  0.974   1.00 66.89  ? 167 ASP A OD1    1 
ATOM   2699 O  OD2    . ASP A 1 167 ? 47.542  19.948  0.150   1.00 78.02  ? 167 ASP A OD2    1 
ATOM   2700 H  H      . ASP A 1 167 ? 44.785  19.905  2.040   1.00 76.28  ? 167 ASP A H      1 
ATOM   2701 H  HA     . ASP A 1 167 ? 46.221  19.997  4.295   1.00 85.79  ? 167 ASP A HA     1 
ATOM   2702 H  HB2    . ASP A 1 167 ? 48.080  20.339  2.907   1.00 81.24  ? 167 ASP A HB2    1 
ATOM   2703 H  HB3    . ASP A 1 167 ? 47.255  19.070  2.424   1.00 81.24  ? 167 ASP A HB3    1 
ATOM   2704 N  N      . ASP A 1 168 ? 47.213  22.446  4.204   1.00 61.61  ? 168 ASP A N      1 
ATOM   2705 C  CA     . ASP A 1 168 ? 47.326  23.852  4.579   1.00 69.26  ? 168 ASP A CA     1 
ATOM   2706 C  C      . ASP A 1 168 ? 47.067  24.810  3.427   1.00 70.35  ? 168 ASP A C      1 
ATOM   2707 O  O      . ASP A 1 168 ? 46.315  25.771  3.578   1.00 64.57  ? 168 ASP A O      1 
ATOM   2708 C  CB     . ASP A 1 168 ? 48.695  24.129  5.179   1.00 75.59  ? 168 ASP A CB     1 
ATOM   2709 C  CG     . ASP A 1 168 ? 48.783  23.695  6.618   1.00 78.26  ? 168 ASP A CG     1 
ATOM   2710 O  OD1    . ASP A 1 168 ? 48.086  22.721  6.979   1.00 71.24  ? 168 ASP A OD1    1 
ATOM   2711 O  OD2    . ASP A 1 168 ? 49.532  24.334  7.388   1.00 81.91  ? 168 ASP A OD2    1 
ATOM   2712 H  H      . ASP A 1 168 ? 47.927  21.988  4.346   1.00 73.93  ? 168 ASP A H      1 
ATOM   2713 H  HA     . ASP A 1 168 ? 46.658  24.041  5.271   1.00 83.12  ? 168 ASP A HA     1 
ATOM   2714 H  HB2    . ASP A 1 168 ? 49.367  23.644  4.675   1.00 90.70  ? 168 ASP A HB2    1 
ATOM   2715 H  HB3    . ASP A 1 168 ? 48.872  25.082  5.140   1.00 90.70  ? 168 ASP A HB3    1 
ATOM   2716 N  N      . GLU A 1 169 ? 47.684  24.571  2.279   1.00 66.77  ? 169 GLU A N      1 
ATOM   2717 C  CA     . GLU A 1 169 ? 47.435  25.450  1.147   1.00 75.36  ? 169 GLU A CA     1 
ATOM   2718 C  C      . GLU A 1 169 ? 45.947  25.439  0.771   1.00 76.07  ? 169 GLU A C      1 
ATOM   2719 O  O      . GLU A 1 169 ? 45.369  26.485  0.467   1.00 67.25  ? 169 GLU A O      1 
ATOM   2720 C  CB     . GLU A 1 169 ? 48.295  25.068  -0.059  1.00 77.91  ? 169 GLU A CB     1 
ATOM   2721 C  CG     . GLU A 1 169 ? 48.076  25.989  -1.251  1.00 86.13  ? 169 GLU A CG     1 
ATOM   2722 C  CD     . GLU A 1 169 ? 47.865  27.443  -0.831  1.00 89.84  ? 169 GLU A CD     1 
ATOM   2723 O  OE1    . GLU A 1 169 ? 48.753  28.002  -0.142  1.00 81.78  ? 169 GLU A OE1    1 
ATOM   2724 O  OE2    . GLU A 1 169 ? 46.807  28.019  -1.181  1.00 83.33  ? 169 GLU A OE2    1 
ATOM   2725 H  H      . GLU A 1 169 ? 48.235  23.927  2.132   1.00 80.13  ? 169 GLU A H      1 
ATOM   2726 H  HA     . GLU A 1 169 ? 47.671  26.366  1.403   1.00 90.44  ? 169 GLU A HA     1 
ATOM   2727 H  HB2    . GLU A 1 169 ? 49.231  25.119  0.191   1.00 93.49  ? 169 GLU A HB2    1 
ATOM   2728 H  HB3    . GLU A 1 169 ? 48.073  24.165  -0.333  1.00 93.49  ? 169 GLU A HB3    1 
ATOM   2729 H  HG2    . GLU A 1 169 ? 48.854  25.952  -1.828  1.00 103.35 ? 169 GLU A HG2    1 
ATOM   2730 H  HG3    . GLU A 1 169 ? 47.287  25.699  -1.735  1.00 103.35 ? 169 GLU A HG3    1 
ATOM   2731 N  N      . GLU A 1 170 ? 45.321  24.265  0.809   1.00 71.88  ? 170 GLU A N      1 
ATOM   2732 C  CA     . GLU A 1 170 ? 43.919  24.163  0.419   1.00 69.35  ? 170 GLU A CA     1 
ATOM   2733 C  C      . GLU A 1 170 ? 43.029  24.807  1.471   1.00 64.35  ? 170 GLU A C      1 
ATOM   2734 O  O      . GLU A 1 170 ? 41.977  25.335  1.142   1.00 63.94  ? 170 GLU A O      1 
ATOM   2735 C  CB     . GLU A 1 170 ? 43.495  22.716  0.180   1.00 61.03  ? 170 GLU A CB     1 
ATOM   2736 C  CG     . GLU A 1 170 ? 42.116  22.609  -0.455  1.00 64.09  ? 170 GLU A CG     1 
ATOM   2737 C  CD     . GLU A 1 170 ? 41.798  21.203  -0.943  1.00 80.80  ? 170 GLU A CD     1 
ATOM   2738 O  OE1    . GLU A 1 170 ? 42.638  20.296  -0.757  1.00 78.51  ? 170 GLU A OE1    1 
ATOM   2739 O  OE2    . GLU A 1 170 ? 40.707  21.005  -1.518  1.00 83.22  ? 170 GLU A OE2    1 
ATOM   2740 H  H      . GLU A 1 170 ? 45.680  23.522  1.052   1.00 86.25  ? 170 GLU A H      1 
ATOM   2741 H  HA     . GLU A 1 170 ? 43.791  24.653  -0.420  1.00 83.22  ? 170 GLU A HA     1 
ATOM   2742 H  HB2    . GLU A 1 170 ? 44.133  22.293  -0.415  1.00 73.24  ? 170 GLU A HB2    1 
ATOM   2743 H  HB3    . GLU A 1 170 ? 43.471  22.248  1.029   1.00 73.24  ? 170 GLU A HB3    1 
ATOM   2744 H  HG2    . GLU A 1 170 ? 41.446  22.857  0.202   1.00 76.91  ? 170 GLU A HG2    1 
ATOM   2745 H  HG3    . GLU A 1 170 ? 42.072  23.208  -1.216  1.00 76.91  ? 170 GLU A HG3    1 
ATOM   2746 N  N      . VAL A 1 171 ? 43.452  24.776  2.730   1.00 57.39  ? 171 VAL A N      1 
ATOM   2747 C  CA     . VAL A 1 171 ? 42.724  25.478  3.779   1.00 58.88  ? 171 VAL A CA     1 
ATOM   2748 C  C      . VAL A 1 171 ? 42.755  26.968  3.473   1.00 65.14  ? 171 VAL A C      1 
ATOM   2749 O  O      . VAL A 1 171 ? 41.734  27.646  3.536   1.00 56.75  ? 171 VAL A O      1 
ATOM   2750 C  CB     . VAL A 1 171 ? 43.337  25.237  5.165   1.00 62.30  ? 171 VAL A CB     1 
ATOM   2751 C  CG1    . VAL A 1 171 ? 42.890  26.318  6.139   1.00 60.32  ? 171 VAL A CG1    1 
ATOM   2752 C  CG2    . VAL A 1 171 ? 42.967  23.853  5.677   1.00 62.90  ? 171 VAL A CG2    1 
ATOM   2753 H  H      . VAL A 1 171 ? 44.153  24.358  3.001   1.00 68.86  ? 171 VAL A H      1 
ATOM   2754 H  HA     . VAL A 1 171 ? 41.791  25.179  3.791   1.00 70.65  ? 171 VAL A HA     1 
ATOM   2755 H  HB     . VAL A 1 171 ? 44.313  25.280  5.093   1.00 74.76  ? 171 VAL A HB     1 
ATOM   2756 H  HG11   . VAL A 1 171 ? 43.285  26.147  6.997   1.00 72.38  ? 171 VAL A HG11   1 
ATOM   2757 H  HG12   . VAL A 1 171 ? 43.178  27.172  5.810   1.00 72.38  ? 171 VAL A HG12   1 
ATOM   2758 H  HG13   . VAL A 1 171 ? 41.933  26.298  6.209   1.00 72.38  ? 171 VAL A HG13   1 
ATOM   2759 H  HG21   . VAL A 1 171 ? 43.360  23.726  6.543   1.00 75.48  ? 171 VAL A HG21   1 
ATOM   2760 H  HG22   . VAL A 1 171 ? 42.011  23.789  5.739   1.00 75.48  ? 171 VAL A HG22   1 
ATOM   2761 H  HG23   . VAL A 1 171 ? 43.301  23.194  5.064   1.00 75.48  ? 171 VAL A HG23   1 
ATOM   2762 N  N      . LYS A 1 172 ? 43.936  27.476  3.134   1.00 60.59  ? 172 LYS A N      1 
ATOM   2763 C  CA     . LYS A 1 172 ? 44.083  28.877  2.765   1.00 68.68  ? 172 LYS A CA     1 
ATOM   2764 C  C      . LYS A 1 172 ? 43.251  29.159  1.516   1.00 65.26  ? 172 LYS A C      1 
ATOM   2765 O  O      . LYS A 1 172 ? 42.675  30.231  1.368   1.00 59.38  ? 172 LYS A O      1 
ATOM   2766 C  CB     . LYS A 1 172 ? 45.563  29.219  2.554   1.00 67.53  ? 172 LYS A CB     1 
ATOM   2767 C  CG     . LYS A 1 172 ? 46.356  29.273  3.859   1.00 70.19  ? 172 LYS A CG     1 
ATOM   2768 C  CD     . LYS A 1 172 ? 47.818  28.903  3.678   1.00 77.12  ? 172 LYS A CD     1 
ATOM   2769 C  CE     . LYS A 1 172 ? 48.519  29.814  2.684   1.00 89.63  ? 172 LYS A CE     1 
ATOM   2770 N  NZ     . LYS A 1 172 ? 49.880  29.309  2.339   1.00 88.01  ? 172 LYS A NZ     1 
ATOM   2771 H  H      . LYS A 1 172 ? 44.670  27.027  3.111   1.00 72.71  ? 172 LYS A H      1 
ATOM   2772 H  HA     . LYS A 1 172 ? 43.741  29.439  3.492   1.00 82.41  ? 172 LYS A HA     1 
ATOM   2773 H  HB2    . LYS A 1 172 ? 45.965  28.541  1.988   1.00 81.04  ? 172 LYS A HB2    1 
ATOM   2774 H  HB3    . LYS A 1 172 ? 45.629  30.088  2.128   1.00 81.04  ? 172 LYS A HB3    1 
ATOM   2775 H  HG2    . LYS A 1 172 ? 46.317  30.174  4.215   1.00 84.23  ? 172 LYS A HG2    1 
ATOM   2776 H  HG3    . LYS A 1 172 ? 45.965  28.650  4.492   1.00 84.23  ? 172 LYS A HG3    1 
ATOM   2777 H  HD2    . LYS A 1 172 ? 48.274  28.979  4.531   1.00 92.54  ? 172 LYS A HD2    1 
ATOM   2778 H  HD3    . LYS A 1 172 ? 47.878  27.993  3.348   1.00 92.54  ? 172 LYS A HD3    1 
ATOM   2779 H  HE2    . LYS A 1 172 ? 47.996  29.859  1.868   1.00 107.55 ? 172 LYS A HE2    1 
ATOM   2780 H  HE3    . LYS A 1 172 ? 48.612  30.698  3.071   1.00 107.55 ? 172 LYS A HE3    1 
ATOM   2781 H  HZ1    . LYS A 1 172 ? 49.821  28.498  1.977   1.00 105.62 ? 172 LYS A HZ1    1 
ATOM   2782 H  HZ2    . LYS A 1 172 ? 50.269  29.858  1.757   1.00 105.62 ? 172 LYS A HZ2    1 
ATOM   2783 H  HZ3    . LYS A 1 172 ? 50.382  29.263  3.073   1.00 105.62 ? 172 LYS A HZ3    1 
ATOM   2784 N  N      . ARG A 1 173 ? 43.156  28.169  0.638   1.00 65.56  ? 173 ARG A N      1 
ATOM   2785 C  CA     . ARG A 1 173 ? 42.342  28.288  -0.564  1.00 72.36  ? 173 ARG A CA     1 
ATOM   2786 C  C      . ARG A 1 173 ? 40.860  28.421  -0.186  1.00 73.79  ? 173 ARG A C      1 
ATOM   2787 O  O      . ARG A 1 173 ? 40.163  29.318  -0.661  1.00 66.43  ? 173 ARG A O      1 
ATOM   2788 C  CB     . ARG A 1 173 ? 42.565  27.063  -1.455  1.00 74.57  ? 173 ARG A CB     1 
ATOM   2789 C  CG     . ARG A 1 173 ? 42.216  27.263  -2.917  1.00 82.85  ? 173 ARG A CG     1 
ATOM   2790 C  CD     . ARG A 1 173 ? 42.360  25.959  -3.692  1.00 79.46  ? 173 ARG A CD     1 
ATOM   2791 N  NE     . ARG A 1 173 ? 41.347  24.982  -3.304  1.00 85.02  ? 173 ARG A NE     1 
ATOM   2792 C  CZ     . ARG A 1 173 ? 40.096  24.984  -3.759  1.00 94.26  ? 173 ARG A CZ     1 
ATOM   2793 N  NH1    . ARG A 1 173 ? 39.702  25.916  -4.620  1.00 90.52  ? 173 ARG A NH1    1 
ATOM   2794 N  NH2    . ARG A 1 173 ? 39.236  24.056  -3.352  1.00 78.77  ? 173 ARG A NH2    1 
ATOM   2795 H  H      . ARG A 1 173 ? 43.557  27.412  0.716   1.00 78.68  ? 173 ARG A H      1 
ATOM   2796 H  HA     . ARG A 1 173 ? 42.609  29.088  -1.063  1.00 86.84  ? 173 ARG A HA     1 
ATOM   2797 H  HB2    . ARG A 1 173 ? 43.501  26.813  -1.409  1.00 89.49  ? 173 ARG A HB2    1 
ATOM   2798 H  HB3    . ARG A 1 173 ? 42.017  26.335  -1.121  1.00 89.49  ? 173 ARG A HB3    1 
ATOM   2799 H  HG2    . ARG A 1 173 ? 41.297  27.564  -2.991  1.00 99.42  ? 173 ARG A HG2    1 
ATOM   2800 H  HG3    . ARG A 1 173 ? 42.818  27.918  -3.305  1.00 99.42  ? 173 ARG A HG3    1 
ATOM   2801 H  HD2    . ARG A 1 173 ? 42.261  26.138  -4.640  1.00 95.35  ? 173 ARG A HD2    1 
ATOM   2802 H  HD3    . ARG A 1 173 ? 43.233  25.576  -3.514  1.00 95.35  ? 173 ARG A HD3    1 
ATOM   2803 H  HE     . ARG A 1 173 ? 41.586  24.337  -2.788  1.00 102.02 ? 173 ARG A HE     1 
ATOM   2804 H  HH11   . ARG A 1 173 ? 40.256  26.518  -4.885  1.00 108.63 ? 173 ARG A HH11   1 
ATOM   2805 H  HH12   . ARG A 1 173 ? 38.894  25.916  -4.913  1.00 108.63 ? 173 ARG A HH12   1 
ATOM   2806 H  HH21   . ARG A 1 173 ? 39.488  23.451  -2.795  1.00 94.53  ? 173 ARG A HH21   1 
ATOM   2807 H  HH22   . ARG A 1 173 ? 38.429  24.059  -3.647  1.00 94.53  ? 173 ARG A HH22   1 
ATOM   2808 N  N      . LEU A 1 174 ? 40.394  27.538  0.696   1.00 69.00  ? 174 LEU A N      1 
ATOM   2809 C  CA     . LEU A 1 174 ? 38.983  27.483  1.066   1.00 62.42  ? 174 LEU A CA     1 
ATOM   2810 C  C      . LEU A 1 174 ? 38.542  28.740  1.808   1.00 64.66  ? 174 LEU A C      1 
ATOM   2811 O  O      . LEU A 1 174 ? 37.417  29.210  1.635   1.00 62.30  ? 174 LEU A O      1 
ATOM   2812 C  CB     . LEU A 1 174 ? 38.703  26.239  1.909   1.00 63.85  ? 174 LEU A CB     1 
ATOM   2813 C  CG     . LEU A 1 174 ? 38.884  24.924  1.149   1.00 68.34  ? 174 LEU A CG     1 
ATOM   2814 C  CD1    . LEU A 1 174 ? 38.669  23.734  2.070   1.00 71.36  ? 174 LEU A CD1    1 
ATOM   2815 C  CD2    . LEU A 1 174 ? 37.944  24.859  -0.046  1.00 70.87  ? 174 LEU A CD2    1 
ATOM   2816 H  H      . LEU A 1 174 ? 40.881  26.954  1.098   1.00 82.81  ? 174 LEU A H      1 
ATOM   2817 H  HA     . LEU A 1 174 ? 38.447  27.416  0.249   1.00 74.90  ? 174 LEU A HA     1 
ATOM   2818 H  HB2    . LEU A 1 174 ? 39.311  26.230  2.665   1.00 76.62  ? 174 LEU A HB2    1 
ATOM   2819 H  HB3    . LEU A 1 174 ? 37.787  26.275  2.224   1.00 76.62  ? 174 LEU A HB3    1 
ATOM   2820 H  HG     . LEU A 1 174 ? 39.794  24.879  0.814   1.00 82.01  ? 174 LEU A HG     1 
ATOM   2821 H  HD11   . LEU A 1 174 ? 38.789  22.925  1.567   1.00 85.63  ? 174 LEU A HD11   1 
ATOM   2822 H  HD12   . LEU A 1 174 ? 39.309  23.774  2.785   1.00 85.63  ? 174 LEU A HD12   1 
ATOM   2823 H  HD13   . LEU A 1 174 ? 37.778  23.771  2.424   1.00 85.63  ? 174 LEU A HD13   1 
ATOM   2824 H  HD21   . LEU A 1 174 ? 38.079  24.026  -0.504  1.00 85.05  ? 174 LEU A HD21   1 
ATOM   2825 H  HD22   . LEU A 1 174 ? 37.039  24.920  0.265   1.00 85.05  ? 174 LEU A HD22   1 
ATOM   2826 H  HD23   . LEU A 1 174 ? 38.138  25.592  -0.636  1.00 85.05  ? 174 LEU A HD23   1 
ATOM   2827 N  N      . ILE A 1 175 ? 39.426  29.297  2.627   1.00 61.20  ? 175 ILE A N      1 
ATOM   2828 C  CA     . ILE A 1 175 ? 39.104  30.534  3.325   1.00 65.24  ? 175 ILE A CA     1 
ATOM   2829 C  C      . ILE A 1 175 ? 38.741  31.614  2.304   1.00 67.64  ? 175 ILE A C      1 
ATOM   2830 O  O      . ILE A 1 175 ? 37.879  32.456  2.556   1.00 62.81  ? 175 ILE A O      1 
ATOM   2831 C  CB     . ILE A 1 175 ? 40.270  30.996  4.219   1.00 63.02  ? 175 ILE A CB     1 
ATOM   2832 C  CG1    . ILE A 1 175 ? 40.318  30.141  5.493   1.00 63.57  ? 175 ILE A CG1    1 
ATOM   2833 C  CG2    . ILE A 1 175 ? 40.120  32.469  4.581   1.00 55.76  ? 175 ILE A CG2    1 
ATOM   2834 C  CD1    . ILE A 1 175 ? 41.548  30.372  6.341   1.00 63.27  ? 175 ILE A CD1    1 
ATOM   2835 H  H      . ILE A 1 175 ? 40.209  28.984  2.794   1.00 73.45  ? 175 ILE A H      1 
ATOM   2836 H  HA     . ILE A 1 175 ? 38.324  30.384  3.899   1.00 78.29  ? 175 ILE A HA     1 
ATOM   2837 H  HB     . ILE A 1 175 ? 41.101  30.878  3.733   1.00 75.63  ? 175 ILE A HB     1 
ATOM   2838 H  HG12   . ILE A 1 175 ? 39.541  30.347  6.036   1.00 76.29  ? 175 ILE A HG12   1 
ATOM   2839 H  HG13   . ILE A 1 175 ? 40.304  29.205  5.240   1.00 76.29  ? 175 ILE A HG13   1 
ATOM   2840 H  HG21   . ILE A 1 175 ? 40.857  32.730  5.137   1.00 66.92  ? 175 ILE A HG21   1 
ATOM   2841 H  HG22   . ILE A 1 175 ? 40.117  32.990  3.775   1.00 66.92  ? 175 ILE A HG22   1 
ATOM   2842 H  HG23   . ILE A 1 175 ? 39.293  32.592  5.054   1.00 66.92  ? 175 ILE A HG23   1 
ATOM   2843 H  HD11   . ILE A 1 175 ? 41.505  29.804  7.114   1.00 75.92  ? 175 ILE A HD11   1 
ATOM   2844 H  HD12   . ILE A 1 175 ? 42.329  30.161  5.823   1.00 75.92  ? 175 ILE A HD12   1 
ATOM   2845 H  HD13   . ILE A 1 175 ? 41.573  31.293  6.612   1.00 75.92  ? 175 ILE A HD13   1 
ATOM   2846 N  N      . ARG A 1 176 ? 39.396  31.565  1.145   1.00 71.58  ? 176 ARG A N      1 
ATOM   2847 C  CA     . ARG A 1 176 ? 39.148  32.514  0.062   1.00 71.43  ? 176 ARG A CA     1 
ATOM   2848 C  C      . ARG A 1 176 ? 37.907  32.135  -0.754  1.00 77.45  ? 176 ARG A C      1 
ATOM   2849 O  O      . ARG A 1 176 ? 37.035  32.971  -0.994  1.00 74.71  ? 176 ARG A O      1 
ATOM   2850 C  CB     . ARG A 1 176 ? 40.368  32.573  -0.874  1.00 74.81  ? 176 ARG A CB     1 
ATOM   2851 C  CG     . ARG A 1 176 ? 41.311  33.752  -0.649  1.00 78.40  ? 176 ARG A CG     1 
ATOM   2852 C  CD     . ARG A 1 176 ? 42.531  33.688  -1.578  1.00 75.66  ? 176 ARG A CD     1 
ATOM   2853 N  NE     . ARG A 1 176 ? 43.611  32.861  -1.027  1.00 82.94  ? 176 ARG A NE     1 
ATOM   2854 C  CZ     . ARG A 1 176 ? 44.097  31.759  -1.600  1.00 82.44  ? 176 ARG A CZ     1 
ATOM   2855 N  NH1    . ARG A 1 176 ? 43.613  31.328  -2.763  1.00 70.41  ? 176 ARG A NH1    1 
ATOM   2856 N  NH2    . ARG A 1 176 ? 45.082  31.086  -1.009  1.00 73.07  ? 176 ARG A NH2    1 
ATOM   2857 H  H      . ARG A 1 176 ? 39.998  30.980  0.959   1.00 85.90  ? 176 ARG A H      1 
ATOM   2858 H  HA     . ARG A 1 176 ? 39.007  33.407  0.440   1.00 85.71  ? 176 ARG A HA     1 
ATOM   2859 H  HB2    . ARG A 1 176 ? 40.885  31.761  -0.756  1.00 89.78  ? 176 ARG A HB2    1 
ATOM   2860 H  HB3    . ARG A 1 176 ? 40.051  32.625  -1.789  1.00 89.78  ? 176 ARG A HB3    1 
ATOM   2861 H  HG2    . ARG A 1 176 ? 40.837  34.579  -0.828  1.00 94.08  ? 176 ARG A HG2    1 
ATOM   2862 H  HG3    . ARG A 1 176 ? 41.626  33.739  0.268   1.00 94.08  ? 176 ARG A HG3    1 
ATOM   2863 H  HD2    . ARG A 1 176 ? 42.263  33.305  -2.427  1.00 90.79  ? 176 ARG A HD2    1 
ATOM   2864 H  HD3    . ARG A 1 176 ? 42.876  34.584  -1.711  1.00 90.79  ? 176 ARG A HD3    1 
ATOM   2865 H  HE     . ARG A 1 176 ? 43.956  33.106  -0.278  1.00 99.53  ? 176 ARG A HE     1 
ATOM   2866 H  HH11   . ARG A 1 176 ? 42.977  31.759  -3.150  1.00 84.49  ? 176 ARG A HH11   1 
ATOM   2867 H  HH12   . ARG A 1 176 ? 43.934  30.617  -3.125  1.00 84.49  ? 176 ARG A HH12   1 
ATOM   2868 H  HH21   . ARG A 1 176 ? 45.400  31.359  -0.258  1.00 87.69  ? 176 ARG A HH21   1 
ATOM   2869 H  HH22   . ARG A 1 176 ? 45.398  30.376  -1.376  1.00 87.69  ? 176 ARG A HH22   1 
ATOM   2870 N  N      . GLU A 1 177 ? 37.826  30.866  -1.154  1.00 71.71  ? 177 GLU A N      1 
ATOM   2871 C  CA     . GLU A 1 177 ? 36.897  30.431  -2.196  1.00 74.99  ? 177 GLU A CA     1 
ATOM   2872 C  C      . GLU A 1 177 ? 35.557  29.859  -1.709  1.00 79.05  ? 177 GLU A C      1 
ATOM   2873 O  O      . GLU A 1 177 ? 34.506  30.180  -2.272  1.00 72.18  ? 177 GLU A O      1 
ATOM   2874 C  CB     . GLU A 1 177 ? 37.589  29.400  -3.091  1.00 74.28  ? 177 GLU A CB     1 
ATOM   2875 C  CG     . GLU A 1 177 ? 38.665  29.997  -3.987  1.00 79.06  ? 177 GLU A CG     1 
ATOM   2876 C  CD     . GLU A 1 177 ? 39.227  28.988  -4.971  1.00 89.89  ? 177 GLU A CD     1 
ATOM   2877 O  OE1    . GLU A 1 177 ? 38.453  28.474  -5.810  1.00 88.49  ? 177 GLU A OE1    1 
ATOM   2878 O  OE2    . GLU A 1 177 ? 40.442  28.705  -4.901  1.00 95.57  ? 177 GLU A OE2    1 
ATOM   2879 H  H      . GLU A 1 177 ? 38.306  30.230  -0.831  1.00 86.05  ? 177 GLU A H      1 
ATOM   2880 H  HA     . GLU A 1 177 ? 36.689  31.207  -2.757  1.00 89.99  ? 177 GLU A HA     1 
ATOM   2881 H  HB2    . GLU A 1 177 ? 38.008  28.729  -2.529  1.00 89.14  ? 177 GLU A HB2    1 
ATOM   2882 H  HB3    . GLU A 1 177 ? 36.924  28.984  -3.661  1.00 89.14  ? 177 GLU A HB3    1 
ATOM   2883 H  HG2    . GLU A 1 177 ? 38.285  30.731  -4.494  1.00 94.87  ? 177 GLU A HG2    1 
ATOM   2884 H  HG3    . GLU A 1 177 ? 39.396  30.317  -3.435  1.00 94.87  ? 177 GLU A HG3    1 
ATOM   2885 N  N      . LEU A 1 178 ? 35.596  29.005  -0.689  1.00 72.63  ? 178 LEU A N      1 
ATOM   2886 C  CA     . LEU A 1 178 ? 34.399  28.306  -0.208  1.00 71.71  ? 178 LEU A CA     1 
ATOM   2887 C  C      . LEU A 1 178 ? 33.336  29.281  0.304   1.00 74.01  ? 178 LEU A C      1 
ATOM   2888 O  O      . LEU A 1 178 ? 33.650  30.200  1.066   1.00 74.56  ? 178 LEU A O      1 
ATOM   2889 C  CB     . LEU A 1 178 ? 34.788  27.322  0.903   1.00 72.82  ? 178 LEU A CB     1 
ATOM   2890 C  CG     . LEU A 1 178 ? 33.805  26.214  1.290   1.00 76.70  ? 178 LEU A CG     1 
ATOM   2891 C  CD1    . LEU A 1 178 ? 33.694  25.164  0.188   1.00 80.74  ? 178 LEU A CD1    1 
ATOM   2892 C  CD2    . LEU A 1 178 ? 34.238  25.566  2.597   1.00 72.11  ? 178 LEU A CD2    1 
ATOM   2893 H  H      . LEU A 1 178 ? 36.310  28.808  -0.253  1.00 87.15  ? 178 LEU A H      1 
ATOM   2894 H  HA     . LEU A 1 178 ? 34.009  27.793  -0.947  1.00 86.05  ? 178 LEU A HA     1 
ATOM   2895 H  HB2    . LEU A 1 178 ? 35.610  26.883  0.633   1.00 87.39  ? 178 LEU A HB2    1 
ATOM   2896 H  HB3    . LEU A 1 178 ? 34.957  27.838  1.707   1.00 87.39  ? 178 LEU A HB3    1 
ATOM   2897 H  HG     . LEU A 1 178 ? 32.926  26.603  1.423   1.00 92.04  ? 178 LEU A HG     1 
ATOM   2898 H  HD11   . LEU A 1 178 ? 33.071  24.487  0.464   1.00 96.89  ? 178 LEU A HD11   1 
ATOM   2899 H  HD12   . LEU A 1 178 ? 33.384  25.587  -0.616  1.00 96.89  ? 178 LEU A HD12   1 
ATOM   2900 H  HD13   . LEU A 1 178 ? 34.559  24.774  0.041   1.00 96.89  ? 178 LEU A HD13   1 
ATOM   2901 H  HD21   . LEU A 1 178 ? 33.612  24.874  2.825   1.00 86.53  ? 178 LEU A HD21   1 
ATOM   2902 H  HD22   . LEU A 1 178 ? 35.114  25.190  2.484   1.00 86.53  ? 178 LEU A HD22   1 
ATOM   2903 H  HD23   . LEU A 1 178 ? 34.254  26.234  3.286   1.00 86.53  ? 178 LEU A HD23   1 
ATOM   2904 N  N      . ASP A 1 179 ? 32.084  29.077  -0.112  1.00 65.18  ? 179 ASP A N      1 
ATOM   2905 C  CA     . ASP A 1 179 ? 30.961  29.914  0.334   1.00 77.22  ? 179 ASP A CA     1 
ATOM   2906 C  C      . ASP A 1 179 ? 30.670  29.730  1.837   1.00 74.62  ? 179 ASP A C      1 
ATOM   2907 O  O      . ASP A 1 179 ? 30.643  28.599  2.319   1.00 70.16  ? 179 ASP A O      1 
ATOM   2908 C  CB     . ASP A 1 179 ? 29.710  29.558  -0.472  1.00 83.69  ? 179 ASP A CB     1 
ATOM   2909 C  CG     . ASP A 1 179 ? 28.690  30.683  -0.500  1.00 92.93  ? 179 ASP A CG     1 
ATOM   2910 O  OD1    . ASP A 1 179 ? 28.706  31.473  -1.475  1.00 98.03  ? 179 ASP A OD1    1 
ATOM   2911 O  OD2    . ASP A 1 179 ? 27.875  30.775  0.449   1.00 83.40  ? 179 ASP A OD2    1 
ATOM   2912 H  H      . ASP A 1 179 ? 31.855  28.455  -0.660  1.00 78.21  ? 179 ASP A H      1 
ATOM   2913 H  HA     . ASP A 1 179 ? 31.174  30.857  0.174   1.00 92.66  ? 179 ASP A HA     1 
ATOM   2914 H  HB2    . ASP A 1 179 ? 29.968  29.364  -1.386  1.00 100.43 ? 179 ASP A HB2    1 
ATOM   2915 H  HB3    . ASP A 1 179 ? 29.289  28.781  -0.074  1.00 100.43 ? 179 ASP A HB3    1 
ATOM   2916 N  N      . ILE A 1 180 ? 30.448  30.827  2.571   1.00 69.91  ? 180 ILE A N      1 
ATOM   2917 C  CA     . ILE A 1 180 ? 30.215  30.738  4.021   1.00 74.82  ? 180 ILE A CA     1 
ATOM   2918 C  C      . ILE A 1 180 ? 29.079  29.788  4.379   1.00 82.35  ? 180 ILE A C      1 
ATOM   2919 O  O      . ILE A 1 180 ? 29.101  29.167  5.440   1.00 74.94  ? 180 ILE A O      1 
ATOM   2920 C  CB     . ILE A 1 180 ? 29.860  32.089  4.689   1.00 77.01  ? 180 ILE A CB     1 
ATOM   2921 C  CG1    . ILE A 1 180 ? 29.334  33.093  3.669   1.00 74.50  ? 180 ILE A CG1    1 
ATOM   2922 C  CG2    . ILE A 1 180 ? 31.055  32.646  5.470   1.00 73.48  ? 180 ILE A CG2    1 
ATOM   2923 C  CD1    . ILE A 1 180 ? 28.379  34.100  4.280   1.00 76.89  ? 180 ILE A CD1    1 
ATOM   2924 H  H      . ILE A 1 180 ? 30.428  31.627  2.258   1.00 83.90  ? 180 ILE A H      1 
ATOM   2925 H  HA     . ILE A 1 180 ? 31.030  30.401  4.447   1.00 89.78  ? 180 ILE A HA     1 
ATOM   2926 H  HB     . ILE A 1 180 ? 29.148  31.921  5.326   1.00 92.41  ? 180 ILE A HB     1 
ATOM   2927 H  HG12   . ILE A 1 180 ? 30.082  33.580  3.289   1.00 89.40  ? 180 ILE A HG12   1 
ATOM   2928 H  HG13   . ILE A 1 180 ? 28.859  32.615  2.971   1.00 89.40  ? 180 ILE A HG13   1 
ATOM   2929 H  HG21   . ILE A 1 180 ? 30.803  33.481  5.871   1.00 88.17  ? 180 ILE A HG21   1 
ATOM   2930 H  HG22   . ILE A 1 180 ? 31.303  32.016  6.151   1.00 88.17  ? 180 ILE A HG22   1 
ATOM   2931 H  HG23   . ILE A 1 180 ? 31.788  32.780  4.865   1.00 88.17  ? 180 ILE A HG23   1 
ATOM   2932 H  HD11   . ILE A 1 180 ? 28.082  34.703  3.595   1.00 92.27  ? 180 ILE A HD11   1 
ATOM   2933 H  HD12   . ILE A 1 180 ? 27.628  33.632  4.653   1.00 92.27  ? 180 ILE A HD12   1 
ATOM   2934 H  HD13   . ILE A 1 180 ? 28.838  34.587  4.968   1.00 92.27  ? 180 ILE A HD13   1 
ATOM   2935 N  N      . ALA A 1 181 ? 28.075  29.703  3.510   1.00 79.11  ? 181 ALA A N      1 
ATOM   2936 C  CA     . ALA A 1 181 ? 26.930  28.835  3.746   1.00 75.36  ? 181 ALA A CA     1 
ATOM   2937 C  C      . ALA A 1 181 ? 27.371  27.380  3.886   1.00 75.48  ? 181 ALA A C      1 
ATOM   2938 O  O      . ALA A 1 181 ? 26.694  26.577  4.534   1.00 79.77  ? 181 ALA A O      1 
ATOM   2939 C  CB     . ALA A 1 181 ? 25.921  28.979  2.616   1.00 78.78  ? 181 ALA A CB     1 
ATOM   2940 H  H      . ALA A 1 181 ? 28.035  30.142  2.772   1.00 94.93  ? 181 ALA A H      1 
ATOM   2941 H  HA     . ALA A 1 181 ? 26.492  29.102  4.582   1.00 90.43  ? 181 ALA A HA     1 
ATOM   2942 H  HB1    . ALA A 1 181 ? 25.174  28.401  2.789   1.00 94.54  ? 181 ALA A HB1    1 
ATOM   2943 H  HB2    . ALA A 1 181 ? 25.626  29.892  2.576   1.00 94.54  ? 181 ALA A HB2    1 
ATOM   2944 H  HB3    . ALA A 1 181 ? 26.341  28.734  1.789   1.00 94.54  ? 181 ALA A HB3    1 
ATOM   2945 N  N      . ASP A 1 182 ? 28.505  27.045  3.277   1.00 71.57  ? 182 ASP A N      1 
ATOM   2946 C  CA     . ASP A 1 182 ? 29.047  25.688  3.359   1.00 71.57  ? 182 ASP A CA     1 
ATOM   2947 C  C      . ASP A 1 182 ? 29.912  25.465  4.606   1.00 73.42  ? 182 ASP A C      1 
ATOM   2948 O  O      . ASP A 1 182 ? 30.374  24.352  4.854   1.00 60.13  ? 182 ASP A O      1 
ATOM   2949 C  CB     . ASP A 1 182 ? 29.862  25.357  2.108   1.00 75.92  ? 182 ASP A CB     1 
ATOM   2950 C  CG     . ASP A 1 182 ? 28.995  25.194  0.869   1.00 88.52  ? 182 ASP A CG     1 
ATOM   2951 O  OD1    . ASP A 1 182 ? 27.756  25.075  1.010   1.00 87.87  ? 182 ASP A OD1    1 
ATOM   2952 O  OD2    . ASP A 1 182 ? 29.556  25.175  -0.248  1.00 85.30  ? 182 ASP A OD2    1 
ATOM   2953 H  H      . ASP A 1 182 ? 28.982  27.585  2.809   1.00 85.88  ? 182 ASP A H      1 
ATOM   2954 H  HA     . ASP A 1 182 ? 28.299  25.056  3.402   1.00 85.88  ? 182 ASP A HA     1 
ATOM   2955 H  HB2    . ASP A 1 182 ? 30.492  26.075  1.941   1.00 91.10  ? 182 ASP A HB2    1 
ATOM   2956 H  HB3    . ASP A 1 182 ? 30.339  24.524  2.252   1.00 91.10  ? 182 ASP A HB3    1 
ATOM   2957 N  N      . VAL A 1 183 ? 30.139  26.517  5.383   1.00 65.24  ? 183 VAL A N      1 
ATOM   2958 C  CA     . VAL A 1 183 ? 30.900  26.383  6.621   1.00 69.72  ? 183 VAL A CA     1 
ATOM   2959 C  C      . VAL A 1 183 ? 30.014  25.864  7.744   1.00 63.81  ? 183 VAL A C      1 
ATOM   2960 O  O      . VAL A 1 183 ? 28.981  26.461  8.050   1.00 63.29  ? 183 VAL A O      1 
ATOM   2961 C  CB     . VAL A 1 183 ? 31.489  27.723  7.066   1.00 69.42  ? 183 VAL A CB     1 
ATOM   2962 C  CG1    . VAL A 1 183 ? 32.099  27.597  8.463   1.00 67.20  ? 183 VAL A CG1    1 
ATOM   2963 C  CG2    . VAL A 1 183 ? 32.520  28.204  6.057   1.00 70.26  ? 183 VAL A CG2    1 
ATOM   2964 H  H      . VAL A 1 183 ? 29.866  27.315  5.218   1.00 78.29  ? 183 VAL A H      1 
ATOM   2965 H  HA     . VAL A 1 183 ? 31.635  25.749  6.486   1.00 83.66  ? 183 VAL A HA     1 
ATOM   2966 H  HB     . VAL A 1 183 ? 30.771  28.389  7.107   1.00 83.31  ? 183 VAL A HB     1 
ATOM   2967 H  HG11   . VAL A 1 183 ? 32.462  28.447  8.723   1.00 80.64  ? 183 VAL A HG11   1 
ATOM   2968 H  HG12   . VAL A 1 183 ? 31.413  27.331  9.080   1.00 80.64  ? 183 VAL A HG12   1 
ATOM   2969 H  HG13   . VAL A 1 183 ? 32.795  26.936  8.442   1.00 80.64  ? 183 VAL A HG13   1 
ATOM   2970 H  HG21   . VAL A 1 183 ? 32.878  29.045  6.353   1.00 84.31  ? 183 VAL A HG21   1 
ATOM   2971 H  HG22   . VAL A 1 183 ? 33.223  27.553  5.994   1.00 84.31  ? 183 VAL A HG22   1 
ATOM   2972 H  HG23   . VAL A 1 183 ? 32.095  28.311  5.203   1.00 84.31  ? 183 VAL A HG23   1 
ATOM   2973 N  N      . PRO A 1 184 ? 30.421  24.753  8.373   1.00 59.53  ? 184 PRO A N      1 
ATOM   2974 C  CA     . PRO A 1 184 ? 29.672  24.214  9.514   1.00 63.20  ? 184 PRO A CA     1 
ATOM   2975 C  C      . PRO A 1 184 ? 29.261  25.291  10.510  1.00 62.56  ? 184 PRO A C      1 
ATOM   2976 O  O      . PRO A 1 184 ? 30.100  26.071  10.952  1.00 57.32  ? 184 PRO A O      1 
ATOM   2977 C  CB     . PRO A 1 184 ? 30.672  23.256  10.156  1.00 59.24  ? 184 PRO A CB     1 
ATOM   2978 C  CG     . PRO A 1 184 ? 31.479  22.759  9.009   1.00 60.87  ? 184 PRO A CG     1 
ATOM   2979 C  CD     . PRO A 1 184 ? 31.601  23.931  8.058   1.00 61.20  ? 184 PRO A CD     1 
ATOM   2980 H  HA     . PRO A 1 184 ? 28.883  23.718  9.212   1.00 75.84  ? 184 PRO A HA     1 
ATOM   2981 H  HB2    . PRO A 1 184 ? 31.228  23.735  10.789  1.00 71.09  ? 184 PRO A HB2    1 
ATOM   2982 H  HB3    . PRO A 1 184 ? 30.200  22.528  10.589  1.00 71.09  ? 184 PRO A HB3    1 
ATOM   2983 H  HG2    . PRO A 1 184 ? 32.354  22.482  9.323   1.00 73.04  ? 184 PRO A HG2    1 
ATOM   2984 H  HG3    . PRO A 1 184 ? 31.019  22.019  8.583   1.00 73.04  ? 184 PRO A HG3    1 
ATOM   2985 H  HD2    . PRO A 1 184 ? 32.416  24.427  8.235   1.00 73.44  ? 184 PRO A HD2    1 
ATOM   2986 H  HD3    . PRO A 1 184 ? 31.564  23.625  7.138   1.00 73.44  ? 184 PRO A HD3    1 
ATOM   2987 N  N      . GLY A 1 185 ? 27.973  25.339  10.834  1.00 54.08  ? 185 GLY A N      1 
ATOM   2988 C  CA     . GLY A 1 185 ? 27.463  26.285  11.807  1.00 57.20  ? 185 GLY A CA     1 
ATOM   2989 C  C      . GLY A 1 185 ? 26.805  27.520  11.218  1.00 60.65  ? 185 GLY A C      1 
ATOM   2990 O  O      . GLY A 1 185 ? 26.378  28.399  11.959  1.00 60.59  ? 185 GLY A O      1 
ATOM   2991 H  H      . GLY A 1 185 ? 27.370  24.826  10.497  1.00 64.89  ? 185 GLY A H      1 
ATOM   2992 H  HA2    . GLY A 1 185 ? 26.810  25.838  12.368  1.00 68.65  ? 185 GLY A HA2    1 
ATOM   2993 H  HA3    . GLY A 1 185 ? 28.194  26.578  12.373  1.00 68.65  ? 185 GLY A HA3    1 
ATOM   2994 N  N      . ILE A 1 186 ? 26.734  27.607  9.895   1.00 62.07  ? 186 ILE A N      1 
ATOM   2995 C  CA     . ILE A 1 186 ? 25.972  28.680  9.247   1.00 65.10  ? 186 ILE A CA     1 
ATOM   2996 C  C      . ILE A 1 186 ? 24.729  28.078  8.583   1.00 60.74  ? 186 ILE A C      1 
ATOM   2997 O  O      . ILE A 1 186 ? 24.838  27.322  7.618   1.00 53.14  ? 186 ILE A O      1 
ATOM   2998 C  CB     . ILE A 1 186 ? 26.803  29.432  8.185   1.00 65.72  ? 186 ILE A CB     1 
ATOM   2999 C  CG1    . ILE A 1 186 ? 28.196  29.771  8.718   1.00 60.26  ? 186 ILE A CG1    1 
ATOM   3000 C  CG2    . ILE A 1 186 ? 26.087  30.718  7.766   1.00 70.12  ? 186 ILE A CG2    1 
ATOM   3001 C  CD1    . ILE A 1 186 ? 28.199  30.908  9.723   1.00 62.60  ? 186 ILE A CD1    1 
ATOM   3002 H  H      . ILE A 1 186 ? 27.115  27.063  9.348   1.00 74.48  ? 186 ILE A H      1 
ATOM   3003 H  HA     . ILE A 1 186 ? 25.679  29.325  9.924   1.00 78.12  ? 186 ILE A HA     1 
ATOM   3004 H  HB     . ILE A 1 186 ? 26.899  28.862  7.406   1.00 78.87  ? 186 ILE A HB     1 
ATOM   3005 H  HG12   . ILE A 1 186 ? 28.564  28.987  9.155   1.00 72.32  ? 186 ILE A HG12   1 
ATOM   3006 H  HG13   . ILE A 1 186 ? 28.762  30.030  7.974   1.00 72.32  ? 186 ILE A HG13   1 
ATOM   3007 H  HG21   . ILE A 1 186 ? 26.618  31.170  7.106   1.00 84.14  ? 186 ILE A HG21   1 
ATOM   3008 H  HG22   . ILE A 1 186 ? 25.229  30.491  7.398   1.00 84.14  ? 186 ILE A HG22   1 
ATOM   3009 H  HG23   . ILE A 1 186 ? 25.975  31.278  8.537   1.00 84.14  ? 186 ILE A HG23   1 
ATOM   3010 H  HD11   . ILE A 1 186 ? 29.100  31.066  10.013  1.00 75.13  ? 186 ILE A HD11   1 
ATOM   3011 H  HD12   . ILE A 1 186 ? 27.847  31.697  9.303   1.00 75.13  ? 186 ILE A HD12   1 
ATOM   3012 H  HD13   . ILE A 1 186 ? 27.651  30.664  10.472  1.00 75.13  ? 186 ILE A HD13   1 
ATOM   3013 N  N      . GLY A 1 187 ? 23.557  28.384  9.132   1.00 63.15  ? 187 GLY A N      1 
ATOM   3014 C  CA     . GLY A 1 187 ? 22.302  27.858  8.613   1.00 72.34  ? 187 GLY A CA     1 
ATOM   3015 C  C      . GLY A 1 187 ? 21.573  28.912  7.798   1.00 76.46  ? 187 GLY A C      1 
ATOM   3016 O  O      . GLY A 1 187 ? 22.075  30.024  7.643   1.00 66.85  ? 187 GLY A O      1 
ATOM   3017 H  H      . GLY A 1 187 ? 23.463  28.899  9.814   1.00 75.78  ? 187 GLY A H      1 
ATOM   3018 H  HA2    . GLY A 1 187 ? 22.476  27.090  8.047   1.00 86.81  ? 187 GLY A HA2    1 
ATOM   3019 H  HA3    . GLY A 1 187 ? 21.732  27.582  9.348   1.00 86.81  ? 187 GLY A HA3    1 
ATOM   3020 N  N      . ASN A 1 188 ? 20.389  28.585  7.287   1.00 75.30  ? 188 ASN A N      1 
ATOM   3021 C  CA     . ASN A 1 188 ? 19.659  29.534  6.449   1.00 76.17  ? 188 ASN A CA     1 
ATOM   3022 C  C      . ASN A 1 188 ? 19.522  30.911  7.094   1.00 74.07  ? 188 ASN A C      1 
ATOM   3023 O  O      . ASN A 1 188 ? 19.750  31.934  6.440   1.00 71.34  ? 188 ASN A O      1 
ATOM   3024 C  CB     . ASN A 1 188 ? 18.283  28.984  6.071   1.00 86.70  ? 188 ASN A CB     1 
ATOM   3025 C  CG     . ASN A 1 188 ? 18.348  28.028  4.890   1.00 94.98  ? 188 ASN A CG     1 
ATOM   3026 O  OD1    . ASN A 1 188 ? 19.364  27.365  4.672   1.00 90.01  ? 188 ASN A OD1    1 
ATOM   3027 N  ND2    . ASN A 1 188 ? 17.269  27.965  4.113   1.00 96.97  ? 188 ASN A ND2    1 
ATOM   3028 H  H      . ASN A 1 188 ? 19.992  27.832  7.406   1.00 90.36  ? 188 ASN A H      1 
ATOM   3029 H  HA     . ASN A 1 188 ? 20.161  29.655  5.616   1.00 91.40  ? 188 ASN A HA     1 
ATOM   3030 H  HB2    . ASN A 1 188 ? 17.914  28.503  6.828   1.00 104.03 ? 188 ASN A HB2    1 
ATOM   3031 H  HB3    . ASN A 1 188 ? 17.702  29.722  5.829   1.00 104.03 ? 188 ASN A HB3    1 
ATOM   3032 H  HD21   . ASN A 1 188 ? 17.259  27.438  3.433   1.00 116.37 ? 188 ASN A HD21   1 
ATOM   3033 H  HD22   . ASN A 1 188 ? 16.582  28.451  4.290   1.00 116.37 ? 188 ASN A HD22   1 
ATOM   3034 N  N      . ILE A 1 189 ? 19.173  30.939  8.377   1.00 70.40  ? 189 ILE A N      1 
ATOM   3035 C  CA     . ILE A 1 189 ? 18.951  32.209  9.078   1.00 79.12  ? 189 ILE A CA     1 
ATOM   3036 C  C      . ILE A 1 189 ? 20.221  33.069  9.199   1.00 77.52  ? 189 ILE A C      1 
ATOM   3037 O  O      . ILE A 1 189 ? 20.155  34.285  8.996   1.00 78.24  ? 189 ILE A O      1 
ATOM   3038 C  CB     . ILE A 1 189 ? 18.304  31.996  10.481  1.00 71.34  ? 189 ILE A CB     1 
ATOM   3039 C  CG1    . ILE A 1 189 ? 16.867  31.479  10.328  1.00 70.72  ? 189 ILE A CG1    1 
ATOM   3040 C  CG2    . ILE A 1 189 ? 18.301  33.293  11.283  1.00 70.35  ? 189 ILE A CG2    1 
ATOM   3041 C  CD1    . ILE A 1 189 ? 16.262  30.944  11.615  1.00 73.20  ? 189 ILE A CD1    1 
ATOM   3042 H  H      . ILE A 1 189 ? 19.058  30.241  8.866   1.00 84.48  ? 189 ILE A H      1 
ATOM   3043 H  HA     . ILE A 1 189 ? 18.311  32.730  8.550   1.00 94.95  ? 189 ILE A HA     1 
ATOM   3044 H  HB     . ILE A 1 189 ? 18.822  31.334  10.964  1.00 85.61  ? 189 ILE A HB     1 
ATOM   3045 H  HG12   . ILE A 1 189 ? 16.306  32.206  10.017  1.00 84.86  ? 189 ILE A HG12   1 
ATOM   3046 H  HG13   . ILE A 1 189 ? 16.862  30.760  9.677   1.00 84.86  ? 189 ILE A HG13   1 
ATOM   3047 H  HG21   . ILE A 1 189 ? 17.897  33.129  12.139  1.00 84.42  ? 189 ILE A HG21   1 
ATOM   3048 H  HG22   . ILE A 1 189 ? 19.206  33.590  11.399  1.00 84.42  ? 189 ILE A HG22   1 
ATOM   3049 H  HG23   . ILE A 1 189 ? 17.797  33.955  10.804  1.00 84.42  ? 189 ILE A HG23   1 
ATOM   3050 H  HD11   . ILE A 1 189 ? 15.369  30.642  11.438  1.00 87.84  ? 189 ILE A HD11   1 
ATOM   3051 H  HD12   . ILE A 1 189 ? 16.799  30.214  11.932  1.00 87.84  ? 189 ILE A HD12   1 
ATOM   3052 H  HD13   . ILE A 1 189 ? 16.247  31.647  12.269  1.00 87.84  ? 189 ILE A HD13   1 
ATOM   3053 N  N      . THR A 1 190 ? 21.366  32.457  9.514   1.00 74.20  ? 190 THR A N      1 
ATOM   3054 C  CA     . THR A 1 190 ? 22.608  33.222  9.681   1.00 70.19  ? 190 THR A CA     1 
ATOM   3055 C  C      . THR A 1 190 ? 23.227  33.529  8.317   1.00 73.27  ? 190 THR A C      1 
ATOM   3056 O  O      . THR A 1 190 ? 23.818  34.589  8.123   1.00 64.45  ? 190 THR A O      1 
ATOM   3057 C  CB     . THR A 1 190 ? 23.677  32.496  10.552  1.00 69.45  ? 190 THR A CB     1 
ATOM   3058 O  OG1    . THR A 1 190 ? 23.137  32.159  11.838  1.00 70.33  ? 190 THR A OG1    1 
ATOM   3059 C  CG2    . THR A 1 190 ? 24.886  33.400  10.760  1.00 67.45  ? 190 THR A CG2    1 
ATOM   3060 H  H      . THR A 1 190 ? 21.452  31.610  9.636   1.00 89.04  ? 190 THR A H      1 
ATOM   3061 H  HA     . THR A 1 190 ? 22.397  34.075  10.115  1.00 84.23  ? 190 THR A HA     1 
ATOM   3062 H  HB     . THR A 1 190 ? 23.969  31.688  10.101  1.00 83.34  ? 190 THR A HB     1 
ATOM   3063 H  HG1    . THR A 1 190 ? 22.490  31.663  11.750  1.00 84.40  ? 190 THR A HG1    1 
ATOM   3064 H  HG21   . THR A 1 190 ? 25.543  32.950  11.296  1.00 80.94  ? 190 THR A HG21   1 
ATOM   3065 H  HG22   . THR A 1 190 ? 25.276  33.625  9.912   1.00 80.94  ? 190 THR A HG22   1 
ATOM   3066 H  HG23   . THR A 1 190 ? 24.618  34.207  11.205  1.00 80.94  ? 190 THR A HG23   1 
ATOM   3067 N  N      . ALA A 1 191 ? 23.089  32.591  7.383   1.00 72.02  ? 191 ALA A N      1 
ATOM   3068 C  CA     . ALA A 1 191 ? 23.611  32.746  6.028   1.00 73.67  ? 191 ALA A CA     1 
ATOM   3069 C  C      . ALA A 1 191 ? 23.041  33.996  5.358   1.00 79.27  ? 191 ALA A C      1 
ATOM   3070 O  O      . ALA A 1 191 ? 23.751  34.715  4.656   1.00 79.33  ? 191 ALA A O      1 
ATOM   3071 C  CB     . ALA A 1 191 ? 23.286  31.507  5.192   1.00 66.38  ? 191 ALA A CB     1 
ATOM   3072 H  H      . ALA A 1 191 ? 22.689  31.841  7.513   1.00 86.43  ? 191 ALA A H      1 
ATOM   3073 H  HA     . ALA A 1 191 ? 24.586  32.840  6.068   1.00 88.40  ? 191 ALA A HA     1 
ATOM   3074 H  HB1    . ALA A 1 191 ? 23.636  31.627  4.307   1.00 79.66  ? 191 ALA A HB1    1 
ATOM   3075 H  HB2    . ALA A 1 191 ? 23.690  30.739  5.603   1.00 79.66  ? 191 ALA A HB2    1 
ATOM   3076 H  HB3    . ALA A 1 191 ? 22.334  31.396  5.156   1.00 79.66  ? 191 ALA A HB3    1 
ATOM   3077 N  N      . GLU A 1 192 ? 21.756  34.252  5.576   1.00 79.18  ? 192 GLU A N      1 
ATOM   3078 C  CA     . GLU A 1 192 ? 21.095  35.373  4.919   1.00 80.31  ? 192 GLU A CA     1 
ATOM   3079 C  C      . GLU A 1 192 ? 21.240  36.668  5.714   1.00 83.05  ? 192 GLU A C      1 
ATOM   3080 O  O      . GLU A 1 192 ? 20.996  37.748  5.181   1.00 87.88  ? 192 GLU A O      1 
ATOM   3081 C  CB     . GLU A 1 192 ? 19.621  35.050  4.646   1.00 83.29  ? 192 GLU A CB     1 
ATOM   3082 C  CG     . GLU A 1 192 ? 19.404  34.207  3.381   1.00 88.82  ? 192 GLU A CG     1 
ATOM   3083 C  CD     . GLU A 1 192 ? 19.364  35.049  2.105   1.00 96.41  ? 192 GLU A CD     1 
ATOM   3084 O  OE1    . GLU A 1 192 ? 19.901  34.598  1.069   1.00 92.31  ? 192 GLU A OE1    1 
ATOM   3085 O  OE2    . GLU A 1 192 ? 18.788  36.159  2.136   1.00 91.38  ? 192 GLU A OE2    1 
ATOM   3086 H  H      . GLU A 1 192 ? 21.246  33.795  6.097   1.00 95.01  ? 192 GLU A H      1 
ATOM   3087 H  HA     . GLU A 1 192 ? 21.526  35.517  4.050   1.00 96.37  ? 192 GLU A HA     1 
ATOM   3088 H  HB2    . GLU A 1 192 ? 19.264  34.554  5.399   1.00 99.95  ? 192 GLU A HB2    1 
ATOM   3089 H  HB3    . GLU A 1 192 ? 19.132  35.881  4.537   1.00 99.95  ? 192 GLU A HB3    1 
ATOM   3090 H  HG2    . GLU A 1 192 ? 20.132  33.571  3.297   1.00 106.58 ? 192 GLU A HG2    1 
ATOM   3091 H  HG3    . GLU A 1 192 ? 18.559  33.736  3.456   1.00 106.58 ? 192 GLU A HG3    1 
ATOM   3092 N  N      . LYS A 1 193 ? 21.634  36.565  6.982   1.00 77.98  ? 193 LYS A N      1 
ATOM   3093 C  CA     . LYS A 1 193 ? 22.026  37.751  7.741   1.00 80.21  ? 193 LYS A CA     1 
ATOM   3094 C  C      . LYS A 1 193 ? 23.423  38.162  7.297   1.00 82.84  ? 193 LYS A C      1 
ATOM   3095 O  O      . LYS A 1 193 ? 23.818  39.319  7.445   1.00 85.99  ? 193 LYS A O      1 
ATOM   3096 C  CB     . LYS A 1 193 ? 22.033  37.498  9.254   1.00 84.57  ? 193 LYS A CB     1 
ATOM   3097 C  CG     . LYS A 1 193 ? 20.661  37.383  9.912   1.00 88.49  ? 193 LYS A CG     1 
ATOM   3098 C  CD     . LYS A 1 193 ? 20.716  37.860  11.365  1.00 93.25  ? 193 LYS A CD     1 
ATOM   3099 C  CE     . LYS A 1 193 ? 19.489  37.433  12.156  1.00 91.96  ? 193 LYS A CE     1 
ATOM   3100 N  NZ     . LYS A 1 193 ? 18.935  38.545  12.980  1.00 90.69  ? 193 LYS A NZ     1 
ATOM   3101 H  H      . LYS A 1 193 ? 21.683  35.828  7.423   1.00 93.58  ? 193 LYS A H      1 
ATOM   3102 H  HA     . LYS A 1 193 ? 21.407  38.486  7.548   1.00 96.25  ? 193 LYS A HA     1 
ATOM   3103 H  HB2    . LYS A 1 193 ? 22.507  36.669  9.423   1.00 101.48 ? 193 LYS A HB2    1 
ATOM   3104 H  HB3    . LYS A 1 193 ? 22.500  38.231  9.684   1.00 101.48 ? 193 LYS A HB3    1 
ATOM   3105 H  HG2    . LYS A 1 193 ? 20.025  37.935  9.432   1.00 106.18 ? 193 LYS A HG2    1 
ATOM   3106 H  HG3    . LYS A 1 193 ? 20.377  36.455  9.905   1.00 106.18 ? 193 LYS A HG3    1 
ATOM   3107 H  HD2    . LYS A 1 193 ? 21.499  37.482  11.794  1.00 111.91 ? 193 LYS A HD2    1 
ATOM   3108 H  HD3    . LYS A 1 193 ? 20.762  38.829  11.380  1.00 111.91 ? 193 LYS A HD3    1 
ATOM   3109 H  HE2    . LYS A 1 193 ? 18.799  37.141  11.540  1.00 110.35 ? 193 LYS A HE2    1 
ATOM   3110 H  HE3    . LYS A 1 193 ? 19.733  36.707  12.752  1.00 110.35 ? 193 LYS A HE3    1 
ATOM   3111 H  HZ1    . LYS A 1 193 ? 18.220  38.264  13.430  1.00 108.83 ? 193 LYS A HZ1    1 
ATOM   3112 H  HZ2    . LYS A 1 193 ? 19.548  38.829  13.560  1.00 108.83 ? 193 LYS A HZ2    1 
ATOM   3113 H  HZ3    . LYS A 1 193 ? 18.698  39.224  12.455  1.00 108.83 ? 193 LYS A HZ3    1 
ATOM   3114 N  N      . LEU A 1 194 ? 24.172  37.203  6.759   1.00 77.51  ? 194 LEU A N      1 
ATOM   3115 C  CA     . LEU A 1 194 ? 25.524  37.471  6.284   1.00 82.25  ? 194 LEU A CA     1 
ATOM   3116 C  C      . LEU A 1 194 ? 25.466  38.069  4.878   1.00 80.39  ? 194 LEU A C      1 
ATOM   3117 O  O      . LEU A 1 194 ? 26.123  39.074  4.604   1.00 74.78  ? 194 LEU A O      1 
ATOM   3118 C  CB     . LEU A 1 194 ? 26.384  36.197  6.301   1.00 77.89  ? 194 LEU A CB     1 
ATOM   3119 C  CG     . LEU A 1 194 ? 26.829  35.661  7.672   1.00 68.82  ? 194 LEU A CG     1 
ATOM   3120 C  CD1    . LEU A 1 194 ? 27.536  34.332  7.503   1.00 62.00  ? 194 LEU A CD1    1 
ATOM   3121 C  CD2    . LEU A 1 194 ? 27.724  36.651  8.430   1.00 60.86  ? 194 LEU A CD2    1 
ATOM   3122 H  H      . LEU A 1 194 ? 23.919  36.387  6.658   1.00 93.01  ? 194 LEU A H      1 
ATOM   3123 H  HA     . LEU A 1 194 ? 25.946  38.129  6.875   1.00 98.70  ? 194 LEU A HA     1 
ATOM   3124 H  HB2    . LEU A 1 194 ? 25.880  35.489  5.870   1.00 93.47  ? 194 LEU A HB2    1 
ATOM   3125 H  HB3    . LEU A 1 194 ? 27.189  36.372  5.789   1.00 93.47  ? 194 LEU A HB3    1 
ATOM   3126 H  HG     . LEU A 1 194 ? 26.040  35.506  8.215   1.00 82.59  ? 194 LEU A HG     1 
ATOM   3127 H  HD11   . LEU A 1 194 ? 27.808  34.010  8.366   1.00 74.40  ? 194 LEU A HD11   1 
ATOM   3128 H  HD12   . LEU A 1 194 ? 26.932  33.706  7.096   1.00 74.40  ? 194 LEU A HD12   1 
ATOM   3129 H  HD13   . LEU A 1 194 ? 28.306  34.457  6.943   1.00 74.40  ? 194 LEU A HD13   1 
ATOM   3130 H  HD21   . LEU A 1 194 ? 27.970  36.266  9.274   1.00 73.03  ? 194 LEU A HD21   1 
ATOM   3131 H  HD22   . LEU A 1 194 ? 28.510  36.825  7.907   1.00 73.03  ? 194 LEU A HD22   1 
ATOM   3132 H  HD23   . LEU A 1 194 ? 27.237  37.467  8.571   1.00 73.03  ? 194 LEU A HD23   1 
ATOM   3133 N  N      . LYS A 1 195 ? 24.675  37.451  4.000   1.00 80.63  ? 195 LYS A N      1 
ATOM   3134 C  CA     . LYS A 1 195 ? 24.447  37.975  2.656   1.00 79.54  ? 195 LYS A CA     1 
ATOM   3135 C  C      . LYS A 1 195 ? 24.023  39.436  2.747   1.00 81.65  ? 195 LYS A C      1 
ATOM   3136 O  O      . LYS A 1 195 ? 24.429  40.268  1.936   1.00 82.98  ? 195 LYS A O      1 
ATOM   3137 C  CB     . LYS A 1 195 ? 23.358  37.170  1.937   1.00 79.24  ? 195 LYS A CB     1 
ATOM   3138 C  CG     . LYS A 1 195 ? 23.840  36.437  0.690   1.00 81.04  ? 195 LYS A CG     1 
ATOM   3139 C  CD     . LYS A 1 195 ? 22.700  35.738  -0.062  1.00 81.71  ? 195 LYS A CD     1 
ATOM   3140 C  CE     . LYS A 1 195 ? 21.759  36.740  -0.726  1.00 89.60  ? 195 LYS A CE     1 
ATOM   3141 N  NZ     . LYS A 1 195 ? 21.167  36.221  -2.003  1.00 81.97  ? 195 LYS A NZ     1 
ATOM   3142 H  H      . LYS A 1 195 ? 24.255  36.718  4.163   1.00 96.76  ? 195 LYS A H      1 
ATOM   3143 H  HA     . LYS A 1 195 ? 25.275  37.919  2.134   1.00 95.45  ? 195 LYS A HA     1 
ATOM   3144 H  HB2    . LYS A 1 195 ? 23.004  36.507  2.550   1.00 95.09  ? 195 LYS A HB2    1 
ATOM   3145 H  HB3    . LYS A 1 195 ? 22.650  37.777  1.667   1.00 95.09  ? 195 LYS A HB3    1 
ATOM   3146 H  HG2    . LYS A 1 195 ? 24.251  37.076  0.086   1.00 97.24  ? 195 LYS A HG2    1 
ATOM   3147 H  HG3    . LYS A 1 195 ? 24.487  35.762  0.950   1.00 97.24  ? 195 LYS A HG3    1 
ATOM   3148 H  HD2    . LYS A 1 195 ? 23.074  35.171  -0.753  1.00 98.05  ? 195 LYS A HD2    1 
ATOM   3149 H  HD3    . LYS A 1 195 ? 22.184  35.207  0.564   1.00 98.05  ? 195 LYS A HD3    1 
ATOM   3150 H  HE2    . LYS A 1 195 ? 21.030  36.940  -0.117  1.00 107.51 ? 195 LYS A HE2    1 
ATOM   3151 H  HE3    . LYS A 1 195 ? 22.252  37.550  -0.931  1.00 107.51 ? 195 LYS A HE3    1 
ATOM   3152 H  HZ1    . LYS A 1 195 ? 20.626  36.832  -2.358  1.00 98.37  ? 195 LYS A HZ1    1 
ATOM   3153 H  HZ2    . LYS A 1 195 ? 21.815  36.035  -2.584  1.00 98.37  ? 195 LYS A HZ2    1 
ATOM   3154 H  HZ3    . LYS A 1 195 ? 20.701  35.480  -1.843  1.00 98.37  ? 195 LYS A HZ3    1 
ATOM   3155 N  N      . LYS A 1 196 ? 23.211  39.730  3.758   1.00 81.90  ? 196 LYS A N      1 
ATOM   3156 C  CA     . LYS A 1 196 ? 22.645  41.059  3.974   1.00 80.47  ? 196 LYS A CA     1 
ATOM   3157 C  C      . LYS A 1 196 ? 23.684  42.033  4.542   1.00 81.96  ? 196 LYS A C      1 
ATOM   3158 O  O      . LYS A 1 196 ? 23.467  43.242  4.568   1.00 83.99  ? 196 LYS A O      1 
ATOM   3159 C  CB     . LYS A 1 196 ? 21.427  40.926  4.900   1.00 83.17  ? 196 LYS A CB     1 
ATOM   3160 C  CG     . LYS A 1 196 ? 20.740  42.218  5.332   1.00 84.45  ? 196 LYS A CG     1 
ATOM   3161 C  CD     . LYS A 1 196 ? 19.370  41.891  5.947   1.00 87.88  ? 196 LYS A CD     1 
ATOM   3162 C  CE     . LYS A 1 196 ? 18.678  43.107  6.561   1.00 94.33  ? 196 LYS A CE     1 
ATOM   3163 N  NZ     . LYS A 1 196 ? 19.250  43.507  7.888   1.00 96.36  ? 196 LYS A NZ     1 
ATOM   3164 H  H      . LYS A 1 196 ? 22.965  39.158  4.350   1.00 98.27  ? 196 LYS A H      1 
ATOM   3165 H  HA     . LYS A 1 196 ? 22.334  41.416  3.116   1.00 96.56  ? 196 LYS A HA     1 
ATOM   3166 H  HB2    . LYS A 1 196 ? 20.760  40.387  4.446   1.00 99.81  ? 196 LYS A HB2    1 
ATOM   3167 H  HB3    . LYS A 1 196 ? 21.710  40.469  5.707   1.00 99.81  ? 196 LYS A HB3    1 
ATOM   3168 H  HG2    . LYS A 1 196 ? 21.281  42.668  6.000   1.00 101.34 ? 196 LYS A HG2    1 
ATOM   3169 H  HG3    . LYS A 1 196 ? 20.605  42.790  4.560   1.00 101.34 ? 196 LYS A HG3    1 
ATOM   3170 H  HD2    . LYS A 1 196 ? 18.791  41.536  5.255   1.00 105.46 ? 196 LYS A HD2    1 
ATOM   3171 H  HD3    . LYS A 1 196 ? 19.489  41.231  6.648   1.00 105.46 ? 196 LYS A HD3    1 
ATOM   3172 H  HE2    . LYS A 1 196 ? 18.772  43.860  5.957   1.00 113.20 ? 196 LYS A HE2    1 
ATOM   3173 H  HE3    . LYS A 1 196 ? 17.739  42.903  6.690   1.00 113.20 ? 196 LYS A HE3    1 
ATOM   3174 H  HZ1    . LYS A 1 196 ? 18.816  44.217  8.204   1.00 115.63 ? 196 LYS A HZ1    1 
ATOM   3175 H  HZ2    . LYS A 1 196 ? 19.169  42.836  8.468   1.00 115.63 ? 196 LYS A HZ2    1 
ATOM   3176 H  HZ3    . LYS A 1 196 ? 20.111  43.710  7.799   1.00 115.63 ? 196 LYS A HZ3    1 
ATOM   3177 N  N      . LEU A 1 197 ? 24.811  41.500  5.000   1.00 83.91  ? 197 LEU A N      1 
ATOM   3178 C  CA     . LEU A 1 197 ? 25.965  42.320  5.364   1.00 82.49  ? 197 LEU A CA     1 
ATOM   3179 C  C      . LEU A 1 197 ? 26.964  42.358  4.213   1.00 77.87  ? 197 LEU A C      1 
ATOM   3180 O  O      . LEU A 1 197 ? 27.917  43.137  4.230   1.00 76.71  ? 197 LEU A O      1 
ATOM   3181 C  CB     . LEU A 1 197 ? 26.658  41.761  6.607   1.00 80.84  ? 197 LEU A CB     1 
ATOM   3182 C  CG     . LEU A 1 197 ? 25.985  42.009  7.957   1.00 88.36  ? 197 LEU A CG     1 
ATOM   3183 C  CD1    . LEU A 1 197 ? 26.799  41.361  9.068   1.00 80.93  ? 197 LEU A CD1    1 
ATOM   3184 C  CD2    . LEU A 1 197 ? 25.816  43.499  8.212   1.00 80.55  ? 197 LEU A CD2    1 
ATOM   3185 H  H      . LEU A 1 197 ? 24.936  40.656  5.111   1.00 100.69 ? 197 LEU A H      1 
ATOM   3186 H  HA     . LEU A 1 197 ? 25.671  43.236  5.554   1.00 98.99  ? 197 LEU A HA     1 
ATOM   3187 H  HB2    . LEU A 1 197 ? 26.735  40.800  6.500   1.00 97.01  ? 197 LEU A HB2    1 
ATOM   3188 H  HB3    . LEU A 1 197 ? 27.546  42.148  6.656   1.00 97.01  ? 197 LEU A HB3    1 
ATOM   3189 H  HG     . LEU A 1 197 ? 25.105  41.603  7.952   1.00 106.03 ? 197 LEU A HG     1 
ATOM   3190 H  HD11   . LEU A 1 197 ? 26.365  41.525  9.908   1.00 97.12  ? 197 LEU A HD11   1 
ATOM   3191 H  HD12   . LEU A 1 197 ? 26.852  40.417  8.905   1.00 97.12  ? 197 LEU A HD12   1 
ATOM   3192 H  HD13   . LEU A 1 197 ? 27.679  41.743  9.073   1.00 97.12  ? 197 LEU A HD13   1 
ATOM   3193 H  HD21   . LEU A 1 197 ? 25.392  43.624  9.064   1.00 96.67  ? 197 LEU A HD21   1 
ATOM   3194 H  HD22   . LEU A 1 197 ? 26.681  43.916  8.212   1.00 96.67  ? 197 LEU A HD22   1 
ATOM   3195 H  HD23   . LEU A 1 197 ? 25.271  43.875  7.517   1.00 96.67  ? 197 LEU A HD23   1 
ATOM   3196 N  N      . GLY A 1 198 ? 26.746  41.499  3.223   1.00 75.01  ? 198 GLY A N      1 
ATOM   3197 C  CA     . GLY A 1 198 ? 27.620  41.413  2.070   1.00 69.19  ? 198 GLY A CA     1 
ATOM   3198 C  C      . GLY A 1 198 ? 28.595  40.260  2.190   1.00 74.09  ? 198 GLY A C      1 
ATOM   3199 O  O      . GLY A 1 198 ? 29.179  39.817  1.194   1.00 75.57  ? 198 GLY A O      1 
ATOM   3200 H  H      . GLY A 1 198 ? 26.086  40.947  3.200   1.00 90.01  ? 198 GLY A H      1 
ATOM   3201 H  HA2    . GLY A 1 198 ? 27.090  41.287  1.267   1.00 83.03  ? 198 GLY A HA2    1 
ATOM   3202 H  HA3    . GLY A 1 198 ? 28.125  42.237  1.982   1.00 83.03  ? 198 GLY A HA3    1 
ATOM   3203 N  N      . ILE A 1 199 ? 28.772  39.767  3.414   1.00 79.89  ? 199 ILE A N      1 
ATOM   3204 C  CA     . ILE A 1 199 ? 29.688  38.660  3.671   1.00 67.84  ? 199 ILE A CA     1 
ATOM   3205 C  C      . ILE A 1 199 ? 29.244  37.405  2.944   1.00 70.82  ? 199 ILE A C      1 
ATOM   3206 O  O      . ILE A 1 199 ? 28.088  36.989  3.046   1.00 78.14  ? 199 ILE A O      1 
ATOM   3207 C  CB     . ILE A 1 199 ? 29.797  38.356  5.175   1.00 72.01  ? 199 ILE A CB     1 
ATOM   3208 C  CG1    . ILE A 1 199 ? 30.654  39.418  5.864   1.00 70.53  ? 199 ILE A CG1    1 
ATOM   3209 C  CG2    . ILE A 1 199 ? 30.411  36.977  5.392   1.00 74.62  ? 199 ILE A CG2    1 
ATOM   3210 C  CD1    . ILE A 1 199 ? 29.984  40.073  7.042   1.00 78.21  ? 199 ILE A CD1    1 
ATOM   3211 H  H      . ILE A 1 199 ? 28.369  40.058  4.116   1.00 95.87  ? 199 ILE A H      1 
ATOM   3212 H  HA     . ILE A 1 199 ? 30.580  38.901  3.345   1.00 81.41  ? 199 ILE A HA     1 
ATOM   3213 H  HB     . ILE A 1 199 ? 28.908  38.369  5.564   1.00 86.41  ? 199 ILE A HB     1 
ATOM   3214 H  HG12   . ILE A 1 199 ? 31.471  39.002  6.182   1.00 84.63  ? 199 ILE A HG12   1 
ATOM   3215 H  HG13   . ILE A 1 199 ? 30.867  40.112  5.221   1.00 84.63  ? 199 ILE A HG13   1 
ATOM   3216 H  HG21   . ILE A 1 199 ? 30.471  36.807  6.334   1.00 89.55  ? 199 ILE A HG21   1 
ATOM   3217 H  HG22   . ILE A 1 199 ? 29.853  36.318  4.974   1.00 89.55  ? 199 ILE A HG22   1 
ATOM   3218 H  HG23   . ILE A 1 199 ? 31.287  36.961  5.000   1.00 89.55  ? 199 ILE A HG23   1 
ATOM   3219 H  HD11   . ILE A 1 199 ? 30.581  40.723  7.418   1.00 93.85  ? 199 ILE A HD11   1 
ATOM   3220 H  HD12   . ILE A 1 199 ? 29.178  40.501  6.744   1.00 93.85  ? 199 ILE A HD12   1 
ATOM   3221 H  HD13   . ILE A 1 199 ? 29.776  39.401  7.696   1.00 93.85  ? 199 ILE A HD13   1 
ATOM   3222 N  N      . ASN A 1 200 ? 30.180  36.795  2.227   1.00 66.26  ? 200 ASN A N      1 
ATOM   3223 C  CA     . ASN A 1 200 ? 29.877  35.653  1.379   1.00 67.91  ? 200 ASN A CA     1 
ATOM   3224 C  C      . ASN A 1 200 ? 31.038  34.655  1.292   1.00 75.34  ? 200 ASN A C      1 
ATOM   3225 O  O      . ASN A 1 200 ? 30.858  33.512  0.855   1.00 73.44  ? 200 ASN A O      1 
ATOM   3226 C  CB     . ASN A 1 200 ? 29.494  36.168  -0.015  1.00 86.55  ? 200 ASN A CB     1 
ATOM   3227 C  CG     . ASN A 1 200 ? 29.386  35.062  -1.042  1.00 91.68  ? 200 ASN A CG     1 
ATOM   3228 O  OD1    . ASN A 1 200 ? 30.324  34.816  -1.804  1.00 92.23  ? 200 ASN A OD1    1 
ATOM   3229 N  ND2    . ASN A 1 200 ? 28.238  34.390  -1.073  1.00 89.57  ? 200 ASN A ND2    1 
ATOM   3230 H  H      . ASN A 1 200 ? 31.008  37.028  2.215   1.00 79.51  ? 200 ASN A H      1 
ATOM   3231 H  HA     . ASN A 1 200 ? 29.102  35.181  1.749   1.00 81.49  ? 200 ASN A HA     1 
ATOM   3232 H  HB2    . ASN A 1 200 ? 28.634  36.612  0.038   1.00 103.86 ? 200 ASN A HB2    1 
ATOM   3233 H  HB3    . ASN A 1 200 ? 30.172  36.793  -0.318  1.00 103.86 ? 200 ASN A HB3    1 
ATOM   3234 H  HD21   . ASN A 1 200 ? 28.128  33.752  -1.640  1.00 107.48 ? 200 ASN A HD21   1 
ATOM   3235 H  HD22   . ASN A 1 200 ? 27.605  34.593  -0.527  1.00 107.48 ? 200 ASN A HD22   1 
ATOM   3236 N  N      . LYS A 1 201 ? 32.228  35.094  1.698   1.00 75.24  ? 201 LYS A N      1 
ATOM   3237 C  CA     . LYS A 1 201 ? 33.384  34.207  1.864   1.00 76.17  ? 201 LYS A CA     1 
ATOM   3238 C  C      . LYS A 1 201 ? 33.986  34.483  3.245   1.00 75.04  ? 201 LYS A C      1 
ATOM   3239 O  O      . LYS A 1 201 ? 33.816  35.581  3.784   1.00 68.51  ? 201 LYS A O      1 
ATOM   3240 C  CB     . LYS A 1 201 ? 34.433  34.462  0.778   1.00 78.94  ? 201 LYS A CB     1 
ATOM   3241 C  CG     . LYS A 1 201 ? 33.879  34.536  -0.643  1.00 74.51  ? 201 LYS A CG     1 
ATOM   3242 C  CD     . LYS A 1 201 ? 33.555  33.157  -1.203  1.00 76.42  ? 201 LYS A CD     1 
ATOM   3243 C  CE     . LYS A 1 201 ? 32.875  33.257  -2.565  1.00 79.44  ? 201 LYS A CE     1 
ATOM   3244 N  NZ     . LYS A 1 201 ? 33.494  32.369  -3.596  1.00 70.21  ? 201 LYS A NZ     1 
ATOM   3245 H  H      . LYS A 1 201 ? 32.396  35.916  1.887   1.00 90.28  ? 201 LYS A H      1 
ATOM   3246 H  HA     . LYS A 1 201 ? 33.098  33.271  1.820   1.00 91.41  ? 201 LYS A HA     1 
ATOM   3247 H  HB2    . LYS A 1 201 ? 34.873  35.306  0.965   1.00 94.73  ? 201 LYS A HB2    1 
ATOM   3248 H  HB3    . LYS A 1 201 ? 35.084  33.743  0.802   1.00 94.73  ? 201 LYS A HB3    1 
ATOM   3249 H  HG2    . LYS A 1 201 ? 33.062  35.059  -0.639  1.00 89.41  ? 201 LYS A HG2    1 
ATOM   3250 H  HG3    . LYS A 1 201 ? 34.538  34.950  -1.221  1.00 89.41  ? 201 LYS A HG3    1 
ATOM   3251 H  HD2    . LYS A 1 201 ? 34.377  32.653  -1.309  1.00 91.70  ? 201 LYS A HD2    1 
ATOM   3252 H  HD3    . LYS A 1 201 ? 32.955  32.697  -0.595  1.00 91.70  ? 201 LYS A HD3    1 
ATOM   3253 H  HE2    . LYS A 1 201 ? 31.944  33.002  -2.471  1.00 95.33  ? 201 LYS A HE2    1 
ATOM   3254 H  HE3    . LYS A 1 201 ? 32.938  34.171  -2.882  1.00 95.33  ? 201 LYS A HE3    1 
ATOM   3255 H  HZ1    . LYS A 1 201 ? 33.067  32.460  -4.371  1.00 84.25  ? 201 LYS A HZ1    1 
ATOM   3256 H  HZ2    . LYS A 1 201 ? 34.349  32.586  -3.710  1.00 84.25  ? 201 LYS A HZ2    1 
ATOM   3257 H  HZ3    . LYS A 1 201 ? 33.443  31.519  -3.336  1.00 84.25  ? 201 LYS A HZ3    1 
ATOM   3258 N  N      . LEU A 1 202 ? 34.684  33.505  3.819   1.00 66.61  ? 202 LEU A N      1 
ATOM   3259 C  CA     . LEU A 1 202 ? 35.238  33.672  5.165   1.00 74.11  ? 202 LEU A CA     1 
ATOM   3260 C  C      . LEU A 1 202 ? 36.112  34.919  5.322   1.00 65.92  ? 202 LEU A C      1 
ATOM   3261 O  O      . LEU A 1 202 ? 36.025  35.608  6.331   1.00 58.15  ? 202 LEU A O      1 
ATOM   3262 C  CB     . LEU A 1 202 ? 36.033  32.438  5.582   1.00 64.96  ? 202 LEU A CB     1 
ATOM   3263 C  CG     . LEU A 1 202 ? 35.178  31.354  6.226   1.00 63.03  ? 202 LEU A CG     1 
ATOM   3264 C  CD1    . LEU A 1 202 ? 35.935  30.038  6.260   1.00 55.95  ? 202 LEU A CD1    1 
ATOM   3265 C  CD2    . LEU A 1 202 ? 34.721  31.782  7.623   1.00 60.79  ? 202 LEU A CD2    1 
ATOM   3266 H  H      . LEU A 1 202 ? 34.850  32.743  3.457   1.00 79.93  ? 202 LEU A H      1 
ATOM   3267 H  HA     . LEU A 1 202 ? 34.491  33.762  5.793   1.00 88.93  ? 202 LEU A HA     1 
ATOM   3268 H  HB2    . LEU A 1 202 ? 36.455  32.057  4.797   1.00 77.95  ? 202 LEU A HB2    1 
ATOM   3269 H  HB3    . LEU A 1 202 ? 36.710  32.704  6.224   1.00 77.95  ? 202 LEU A HB3    1 
ATOM   3270 H  HG     . LEU A 1 202 ? 34.384  31.223  5.685   1.00 75.63  ? 202 LEU A HG     1 
ATOM   3271 H  HD11   . LEU A 1 202 ? 35.380  29.370  6.669   1.00 67.14  ? 202 LEU A HD11   1 
ATOM   3272 H  HD12   . LEU A 1 202 ? 36.152  29.780  5.361   1.00 67.14  ? 202 LEU A HD12   1 
ATOM   3273 H  HD13   . LEU A 1 202 ? 36.739  30.154  6.771   1.00 67.14  ? 202 LEU A HD13   1 
ATOM   3274 H  HD21   . LEU A 1 202 ? 34.186  31.082  8.005   1.00 72.95  ? 202 LEU A HD21   1 
ATOM   3275 H  HD22   . LEU A 1 202 ? 35.495  31.939  8.170   1.00 72.95  ? 202 LEU A HD22   1 
ATOM   3276 H  HD23   . LEU A 1 202 ? 34.204  32.587  7.549   1.00 72.95  ? 202 LEU A HD23   1 
ATOM   3277 N  N      . VAL A 1 203 ? 36.949  35.205  4.331   1.00 64.53  ? 203 VAL A N      1 
ATOM   3278 C  CA     . VAL A 1 203 ? 37.885  36.322  4.434   1.00 66.68  ? 203 VAL A CA     1 
ATOM   3279 C  C      . VAL A 1 203 ? 37.176  37.643  4.700   1.00 64.25  ? 203 VAL A C      1 
ATOM   3280 O  O      . VAL A 1 203 ? 37.743  38.552  5.311   1.00 62.87  ? 203 VAL A O      1 
ATOM   3281 C  CB     . VAL A 1 203 ? 38.733  36.468  3.159   1.00 70.02  ? 203 VAL A CB     1 
ATOM   3282 C  CG1    . VAL A 1 203 ? 37.841  36.743  1.943   1.00 69.30  ? 203 VAL A CG1    1 
ATOM   3283 C  CG2    . VAL A 1 203 ? 39.766  37.565  3.343   1.00 69.74  ? 203 VAL A CG2    1 
ATOM   3284 H  H      . VAL A 1 203 ? 36.996  34.771  3.590   1.00 77.44  ? 203 VAL A H      1 
ATOM   3285 H  HA     . VAL A 1 203 ? 38.495  36.153  5.182   1.00 80.02  ? 203 VAL A HA     1 
ATOM   3286 H  HB     . VAL A 1 203 ? 39.211  35.628  2.997   1.00 84.02  ? 203 VAL A HB     1 
ATOM   3287 H  HG11   . VAL A 1 203 ? 38.394  36.830  1.163   1.00 83.16  ? 203 VAL A HG11   1 
ATOM   3288 H  HG12   . VAL A 1 203 ? 37.230  36.011  1.832   1.00 83.16  ? 203 VAL A HG12   1 
ATOM   3289 H  HG13   . VAL A 1 203 ? 37.354  37.557  2.091   1.00 83.16  ? 203 VAL A HG13   1 
ATOM   3290 H  HG21   . VAL A 1 203 ? 40.286  37.643  2.540   1.00 83.68  ? 203 VAL A HG21   1 
ATOM   3291 H  HG22   . VAL A 1 203 ? 39.314  38.393  3.523   1.00 83.68  ? 203 VAL A HG22   1 
ATOM   3292 H  HG23   . VAL A 1 203 ? 40.336  37.336  4.081   1.00 83.68  ? 203 VAL A HG23   1 
ATOM   3293 N  N      . ASP A 1 204 ? 35.931  37.748  4.249   1.00 67.78  ? 204 ASP A N      1 
ATOM   3294 C  CA     . ASP A 1 204 ? 35.187  38.996  4.367   1.00 62.80  ? 204 ASP A CA     1 
ATOM   3295 C  C      . ASP A 1 204 ? 34.906  39.367  5.816   1.00 69.04  ? 204 ASP A C      1 
ATOM   3296 O  O      . ASP A 1 204 ? 34.765  40.548  6.140   1.00 63.07  ? 204 ASP A O      1 
ATOM   3297 C  CB     . ASP A 1 204 ? 33.880  38.912  3.568   1.00 76.63  ? 204 ASP A CB     1 
ATOM   3298 C  CG     . ASP A 1 204 ? 34.117  38.837  2.061   1.00 76.07  ? 204 ASP A CG     1 
ATOM   3299 O  OD1    . ASP A 1 204 ? 34.795  39.737  1.519   1.00 79.19  ? 204 ASP A OD1    1 
ATOM   3300 O  OD2    . ASP A 1 204 ? 33.638  37.875  1.421   1.00 78.61  ? 204 ASP A OD2    1 
ATOM   3301 H  H      . ASP A 1 204 ? 35.494  37.111  3.871   1.00 81.33  ? 204 ASP A H      1 
ATOM   3302 H  HA     . ASP A 1 204 ? 35.725  39.716  3.977   1.00 75.36  ? 204 ASP A HA     1 
ATOM   3303 H  HB2    . ASP A 1 204 ? 33.395  38.116  3.836   1.00 91.96  ? 204 ASP A HB2    1 
ATOM   3304 H  HB3    . ASP A 1 204 ? 33.347  39.703  3.749   1.00 91.96  ? 204 ASP A HB3    1 
ATOM   3305 N  N      . THR A 1 205 ? 34.826  38.366  6.691   1.00 67.81  ? 205 THR A N      1 
ATOM   3306 C  CA     . THR A 1 205 ? 34.573  38.619  8.109   1.00 66.91  ? 205 THR A CA     1 
ATOM   3307 C  C      . THR A 1 205 ? 35.712  39.420  8.724   1.00 56.50  ? 205 THR A C      1 
ATOM   3308 O  O      . THR A 1 205 ? 35.545  40.061  9.760   1.00 61.37  ? 205 THR A O      1 
ATOM   3309 C  CB     . THR A 1 205 ? 34.432  37.310  8.915   1.00 64.92  ? 205 THR A CB     1 
ATOM   3310 O  OG1    . THR A 1 205 ? 35.668  36.584  8.869   1.00 57.89  ? 205 THR A OG1    1 
ATOM   3311 C  CG2    . THR A 1 205 ? 33.310  36.446  8.359   1.00 55.52  ? 205 THR A CG2    1 
ATOM   3312 H  H      . THR A 1 205 ? 34.914  37.535  6.491   1.00 81.37  ? 205 THR A H      1 
ATOM   3313 H  HA     . THR A 1 205 ? 33.745  39.133  8.206   1.00 80.29  ? 205 THR A HA     1 
ATOM   3314 H  HB     . THR A 1 205 ? 34.221  37.524  9.837   1.00 77.90  ? 205 THR A HB     1 
ATOM   3315 H  HG1    . THR A 1 205 ? 35.859  36.403  8.093   1.00 69.47  ? 205 THR A HG1    1 
ATOM   3316 H  HG21   . THR A 1 205 ? 33.235  35.637  8.870   1.00 66.63  ? 205 THR A HG21   1 
ATOM   3317 H  HG22   . THR A 1 205 ? 32.477  36.921  8.403   1.00 66.63  ? 205 THR A HG22   1 
ATOM   3318 H  HG23   . THR A 1 205 ? 33.492  36.221  7.443   1.00 66.63  ? 205 THR A HG23   1 
ATOM   3319 N  N      . LEU A 1 206 ? 36.874  39.376  8.087   1.00 57.12  ? 206 LEU A N      1 
ATOM   3320 C  CA     . LEU A 1 206 ? 38.053  40.047  8.631   1.00 70.46  ? 206 LEU A CA     1 
ATOM   3321 C  C      . LEU A 1 206 ? 38.137  41.532  8.260   1.00 76.68  ? 206 LEU A C      1 
ATOM   3322 O  O      . LEU A 1 206 ? 38.887  42.285  8.886   1.00 66.64  ? 206 LEU A O      1 
ATOM   3323 C  CB     . LEU A 1 206 ? 39.322  39.327  8.181   1.00 64.85  ? 206 LEU A CB     1 
ATOM   3324 C  CG     . LEU A 1 206 ? 39.540  37.978  8.864   1.00 66.09  ? 206 LEU A CG     1 
ATOM   3325 C  CD1    . LEU A 1 206 ? 40.754  37.275  8.285   1.00 67.46  ? 206 LEU A CD1    1 
ATOM   3326 C  CD2    . LEU A 1 206 ? 39.691  38.178  10.368  1.00 67.73  ? 206 LEU A CD2    1 
ATOM   3327 H  H      . LEU A 1 206 ? 37.010  38.968  7.343   1.00 68.55  ? 206 LEU A H      1 
ATOM   3328 H  HA     . LEU A 1 206 ? 38.016  39.992  9.608   1.00 84.55  ? 206 LEU A HA     1 
ATOM   3329 H  HB2    . LEU A 1 206 ? 39.271  39.170  7.225   1.00 77.82  ? 206 LEU A HB2    1 
ATOM   3330 H  HB3    . LEU A 1 206 ? 40.088  39.888  8.381   1.00 77.82  ? 206 LEU A HB3    1 
ATOM   3331 H  HG     . LEU A 1 206 ? 38.764  37.415  8.711   1.00 79.31  ? 206 LEU A HG     1 
ATOM   3332 H  HD11   . LEU A 1 206 ? 40.869  36.432  8.730   1.00 80.96  ? 206 LEU A HD11   1 
ATOM   3333 H  HD12   . LEU A 1 206 ? 40.614  37.134  7.346   1.00 80.96  ? 206 LEU A HD12   1 
ATOM   3334 H  HD13   . LEU A 1 206 ? 41.528  37.826  8.422   1.00 80.96  ? 206 LEU A HD13   1 
ATOM   3335 H  HD21   . LEU A 1 206 ? 39.827  37.324  10.785  1.00 81.28  ? 206 LEU A HD21   1 
ATOM   3336 H  HD22   . LEU A 1 206 ? 40.447  38.747  10.532  1.00 81.28  ? 206 LEU A HD22   1 
ATOM   3337 H  HD23   . LEU A 1 206 ? 38.893  38.587  10.710  1.00 81.28  ? 206 LEU A HD23   1 
ATOM   3338 N  N      . SER A 1 207 ? 37.373  41.953  7.253   1.00 67.37  ? 207 SER A N      1 
ATOM   3339 C  CA     . SER A 1 207 ? 37.388  43.355  6.832   1.00 72.07  ? 207 SER A CA     1 
ATOM   3340 C  C      . SER A 1 207 ? 36.218  44.134  7.426   1.00 74.07  ? 207 SER A C      1 
ATOM   3341 O  O      . SER A 1 207 ? 36.344  45.324  7.715   1.00 73.54  ? 207 SER A O      1 
ATOM   3342 C  CB     . SER A 1 207 ? 37.383  43.469  5.305   1.00 67.69  ? 207 SER A CB     1 
ATOM   3343 O  OG     . SER A 1 207 ? 36.156  43.019  4.760   1.00 66.79  ? 207 SER A OG     1 
ATOM   3344 H  H      . SER A 1 207 ? 36.840  41.452  6.801   1.00 80.84  ? 207 SER A H      1 
ATOM   3345 H  HA     . SER A 1 207 ? 38.214  43.770  7.157   1.00 86.48  ? 207 SER A HA     1 
ATOM   3346 H  HB2    . SER A 1 207 ? 37.515  44.398  5.059   1.00 81.22  ? 207 SER A HB2    1 
ATOM   3347 H  HB3    . SER A 1 207 ? 38.104  42.927  4.948   1.00 81.22  ? 207 SER A HB3    1 
ATOM   3348 H  HG     . SER A 1 207 ? 35.656  42.773  5.361   1.00 80.15  ? 207 SER A HG     1 
ATOM   3349 N  N      . ILE A 1 208 ? 35.079  43.468  7.606   1.00 76.69  ? 208 ILE A N      1 
ATOM   3350 C  CA     . ILE A 1 208 ? 33.963  44.073  8.328   1.00 71.39  ? 208 ILE A CA     1 
ATOM   3351 C  C      . ILE A 1 208 ? 34.433  44.333  9.749   1.00 77.05  ? 208 ILE A C      1 
ATOM   3352 O  O      . ILE A 1 208 ? 35.219  43.563  10.297  1.00 73.65  ? 208 ILE A O      1 
ATOM   3353 C  CB     . ILE A 1 208 ? 32.716  43.163  8.355   1.00 75.68  ? 208 ILE A CB     1 
ATOM   3354 C  CG1    . ILE A 1 208 ? 31.469  43.979  8.696   1.00 82.30  ? 208 ILE A CG1    1 
ATOM   3355 C  CG2    . ILE A 1 208 ? 32.887  42.034  9.366   1.00 80.50  ? 208 ILE A CG2    1 
ATOM   3356 C  CD1    . ILE A 1 208 ? 30.166  43.215  8.504   1.00 81.37  ? 208 ILE A CD1    1 
ATOM   3357 H  H      . ILE A 1 208 ? 34.927  42.670  7.322   1.00 92.03  ? 208 ILE A H      1 
ATOM   3358 H  HA     . ILE A 1 208 ? 33.722  44.927  7.912   1.00 85.67  ? 208 ILE A HA     1 
ATOM   3359 H  HB     . ILE A 1 208 ? 32.598  42.774  7.474   1.00 90.82  ? 208 ILE A HB     1 
ATOM   3360 H  HG12   . ILE A 1 208 ? 31.518  44.252  9.625   1.00 98.76  ? 208 ILE A HG12   1 
ATOM   3361 H  HG13   . ILE A 1 208 ? 31.441  44.761  8.124   1.00 98.76  ? 208 ILE A HG13   1 
ATOM   3362 H  HG21   . ILE A 1 208 ? 32.098  41.488  9.360   1.00 96.60  ? 208 ILE A HG21   1 
ATOM   3363 H  HG22   . ILE A 1 208 ? 33.652  41.509  9.120   1.00 96.60  ? 208 ILE A HG22   1 
ATOM   3364 H  HG23   . ILE A 1 208 ? 33.016  42.414  10.238  1.00 96.60  ? 208 ILE A HG23   1 
ATOM   3365 H  HD11   . ILE A 1 208 ? 29.432  43.788  8.736   1.00 97.64  ? 208 ILE A HD11   1 
ATOM   3366 H  HD12   . ILE A 1 208 ? 30.095  42.946  7.585   1.00 97.64  ? 208 ILE A HD12   1 
ATOM   3367 H  HD13   . ILE A 1 208 ? 30.172  42.441  9.072   1.00 97.64  ? 208 ILE A HD13   1 
ATOM   3368 N  N      . GLU A 1 209 ? 33.987  45.428  10.346  1.00 80.76  ? 209 GLU A N      1 
ATOM   3369 C  CA     . GLU A 1 209 ? 34.410  45.715  11.706  1.00 87.20  ? 209 GLU A CA     1 
ATOM   3370 C  C      . GLU A 1 209 ? 33.544  44.921  12.674  1.00 85.90  ? 209 GLU A C      1 
ATOM   3371 O  O      . GLU A 1 209 ? 32.363  44.682  12.419  1.00 82.85  ? 209 GLU A O      1 
ATOM   3372 C  CB     . GLU A 1 209 ? 34.403  47.216  11.996  1.00 88.07  ? 209 GLU A CB     1 
ATOM   3373 C  CG     . GLU A 1 209 ? 35.710  47.887  11.562  1.00 89.98  ? 209 GLU A CG     1 
ATOM   3374 C  CD     . GLU A 1 209 ? 35.815  49.341  11.989  1.00 94.42  ? 209 GLU A CD     1 
ATOM   3375 O  OE1    . GLU A 1 209 ? 35.004  49.782  12.833  1.00 91.02  ? 209 GLU A OE1    1 
ATOM   3376 O  OE2    . GLU A 1 209 ? 36.713  50.045  11.477  1.00 87.50  ? 209 GLU A OE2    1 
ATOM   3377 H  H      . GLU A 1 209 ? 33.454  46.006  9.998   1.00 96.91  ? 209 GLU A H      1 
ATOM   3378 H  HA     . GLU A 1 209 ? 35.332  45.402  11.815  1.00 104.64 ? 209 GLU A HA     1 
ATOM   3379 H  HB2    . GLU A 1 209 ? 33.674  47.631  11.510  1.00 105.68 ? 209 GLU A HB2    1 
ATOM   3380 H  HB3    . GLU A 1 209 ? 34.293  47.356  12.949  1.00 105.68 ? 209 GLU A HB3    1 
ATOM   3381 H  HG2    . GLU A 1 209 ? 36.455  47.407  11.957  1.00 107.97 ? 209 GLU A HG2    1 
ATOM   3382 H  HG3    . GLU A 1 209 ? 35.773  47.855  10.595  1.00 107.97 ? 209 GLU A HG3    1 
ATOM   3383 N  N      . PHE A 1 210 ? 34.156  44.495  13.771  1.00 76.45  ? 210 PHE A N      1 
ATOM   3384 C  CA     . PHE A 1 210 ? 33.588  43.451  14.611  1.00 84.67  ? 210 PHE A CA     1 
ATOM   3385 C  C      . PHE A 1 210 ? 32.104  43.639  14.937  1.00 84.20  ? 210 PHE A C      1 
ATOM   3386 O  O      . PHE A 1 210 ? 31.330  42.693  14.846  1.00 74.79  ? 210 PHE A O      1 
ATOM   3387 C  CB     . PHE A 1 210 ? 34.395  43.325  15.904  1.00 77.34  ? 210 PHE A CB     1 
ATOM   3388 C  CG     . PHE A 1 210 ? 34.039  42.120  16.721  1.00 79.23  ? 210 PHE A CG     1 
ATOM   3389 C  CD1    . PHE A 1 210 ? 33.960  40.867  16.130  1.00 71.82  ? 210 PHE A CD1    1 
ATOM   3390 C  CD2    . PHE A 1 210 ? 33.792  42.234  18.081  1.00 83.04  ? 210 PHE A CD2    1 
ATOM   3391 C  CE1    . PHE A 1 210 ? 33.635  39.752  16.878  1.00 72.98  ? 210 PHE A CE1    1 
ATOM   3392 C  CE2    . PHE A 1 210 ? 33.467  41.118  18.839  1.00 80.39  ? 210 PHE A CE2    1 
ATOM   3393 C  CZ     . PHE A 1 210 ? 33.390  39.877  18.235  1.00 79.79  ? 210 PHE A CZ     1 
ATOM   3394 H  H      . PHE A 1 210 ? 34.910  44.799  14.053  1.00 91.74  ? 210 PHE A H      1 
ATOM   3395 H  HA     . PHE A 1 210 ? 33.671  42.599  14.135  1.00 101.61 ? 210 PHE A HA     1 
ATOM   3396 H  HB2    . PHE A 1 210 ? 35.337  43.265  15.681  1.00 92.81  ? 210 PHE A HB2    1 
ATOM   3397 H  HB3    . PHE A 1 210 ? 34.236  44.111  16.450  1.00 92.81  ? 210 PHE A HB3    1 
ATOM   3398 H  HD1    . PHE A 1 210 ? 34.125  40.778  15.219  1.00 86.19  ? 210 PHE A HD1    1 
ATOM   3399 H  HD2    . PHE A 1 210 ? 33.844  43.067  18.489  1.00 99.65  ? 210 PHE A HD2    1 
ATOM   3400 H  HE1    . PHE A 1 210 ? 33.584  38.918  16.471  1.00 87.57  ? 210 PHE A HE1    1 
ATOM   3401 H  HE2    . PHE A 1 210 ? 33.301  41.204  19.750  1.00 96.47  ? 210 PHE A HE2    1 
ATOM   3402 H  HZ     . PHE A 1 210 ? 33.171  39.127  18.739  1.00 95.74  ? 210 PHE A HZ     1 
ATOM   3403 N  N      . ASP A 1 211 ? 31.704  44.852  15.306  1.00 82.44  ? 211 ASP A N      1 
ATOM   3404 C  CA     . ASP A 1 211 ? 30.361  45.056  15.844  1.00 77.99  ? 211 ASP A CA     1 
ATOM   3405 C  C      . ASP A 1 211 ? 29.240  44.959  14.813  1.00 81.32  ? 211 ASP A C      1 
ATOM   3406 O  O      . ASP A 1 211 ? 28.105  44.657  15.167  1.00 81.22  ? 211 ASP A O      1 
ATOM   3407 C  CB     . ASP A 1 211 ? 30.280  46.380  16.590  1.00 81.63  ? 211 ASP A CB     1 
ATOM   3408 C  CG     . ASP A 1 211 ? 30.988  46.328  17.924  1.00 95.24  ? 211 ASP A CG     1 
ATOM   3409 O  OD1    . ASP A 1 211 ? 31.345  45.210  18.361  1.00 82.18  ? 211 ASP A OD1    1 
ATOM   3410 O  OD2    . ASP A 1 211 ? 31.178  47.401  18.538  1.00 98.45  ? 211 ASP A OD2    1 
ATOM   3411 H  H      . ASP A 1 211 ? 32.183  45.565  15.256  1.00 98.93  ? 211 ASP A H      1 
ATOM   3412 H  HA     . ASP A 1 211 ? 30.197  44.350  16.503  1.00 93.59  ? 211 ASP A HA     1 
ATOM   3413 H  HB2    . ASP A 1 211 ? 30.697  47.073  16.054  1.00 97.95  ? 211 ASP A HB2    1 
ATOM   3414 H  HB3    . ASP A 1 211 ? 29.349  46.597  16.751  1.00 97.95  ? 211 ASP A HB3    1 
ATOM   3415 N  N      . LYS A 1 212 ? 29.536  45.221  13.545  1.00 88.08  ? 212 LYS A N      1 
ATOM   3416 C  CA     . LYS A 1 212 ? 28.544  44.979  12.503  1.00 86.02  ? 212 LYS A CA     1 
ATOM   3417 C  C      . LYS A 1 212 ? 28.317  43.477  12.432  1.00 81.47  ? 212 LYS A C      1 
ATOM   3418 O  O      . LYS A 1 212 ? 27.203  43.012  12.186  1.00 86.31  ? 212 LYS A O      1 
ATOM   3419 C  CB     . LYS A 1 212 ? 28.999  45.531  11.144  1.00 85.08  ? 212 LYS A CB     1 
ATOM   3420 C  CG     . LYS A 1 212 ? 28.723  47.025  10.948  1.00 90.95  ? 212 LYS A CG     1 
ATOM   3421 C  CD     . LYS A 1 212 ? 29.202  47.544  9.581   1.00 87.62  ? 212 LYS A CD     1 
ATOM   3422 C  CE     . LYS A 1 212 ? 28.134  47.393  8.497   1.00 81.96  ? 212 LYS A CE     1 
ATOM   3423 N  NZ     . LYS A 1 212 ? 27.997  45.995  7.991   1.00 85.91  ? 212 LYS A NZ     1 
ATOM   3424 H  H      . LYS A 1 212 ? 30.288  45.532  13.266  1.00 105.69 ? 212 LYS A H      1 
ATOM   3425 H  HA     . LYS A 1 212 ? 27.699  45.412  12.747  1.00 103.23 ? 212 LYS A HA     1 
ATOM   3426 H  HB2    . LYS A 1 212 ? 29.956  45.394  11.057  1.00 102.09 ? 212 LYS A HB2    1 
ATOM   3427 H  HB3    . LYS A 1 212 ? 28.534  45.050  10.441  1.00 102.09 ? 212 LYS A HB3    1 
ATOM   3428 H  HG2    . LYS A 1 212 ? 27.768  47.181  11.010  1.00 109.14 ? 212 LYS A HG2    1 
ATOM   3429 H  HG3    . LYS A 1 212 ? 29.186  47.526  11.638  1.00 109.14 ? 212 LYS A HG3    1 
ATOM   3430 H  HD2    . LYS A 1 212 ? 29.422  48.486  9.658   1.00 105.15 ? 212 LYS A HD2    1 
ATOM   3431 H  HD3    . LYS A 1 212 ? 29.984  47.040  9.306   1.00 105.15 ? 212 LYS A HD3    1 
ATOM   3432 H  HE2    . LYS A 1 212 ? 27.277  47.664  8.862   1.00 98.35  ? 212 LYS A HE2    1 
ATOM   3433 H  HE3    . LYS A 1 212 ? 28.367  47.960  7.746   1.00 98.35  ? 212 LYS A HE3    1 
ATOM   3434 H  HZ1    . LYS A 1 212 ? 27.366  45.959  7.365   1.00 103.09 ? 212 LYS A HZ1    1 
ATOM   3435 H  HZ2    . LYS A 1 212 ? 28.768  45.721  7.641   1.00 103.09 ? 212 LYS A HZ2    1 
ATOM   3436 H  HZ3    . LYS A 1 212 ? 27.773  45.451  8.659   1.00 103.09 ? 212 LYS A HZ3    1 
ATOM   3437 N  N      . LEU A 1 213 ? 29.389  42.726  12.667  1.00 78.73  ? 213 LEU A N      1 
ATOM   3438 C  CA     . LEU A 1 213 ? 29.333  41.270  12.686  1.00 76.35  ? 213 LEU A CA     1 
ATOM   3439 C  C      . LEU A 1 213 ? 28.636  40.780  13.955  1.00 74.87  ? 213 LEU A C      1 
ATOM   3440 O  O      . LEU A 1 213 ? 27.568  40.176  13.895  1.00 72.58  ? 213 LEU A O      1 
ATOM   3441 C  CB     . LEU A 1 213 ? 30.750  40.704  12.607  1.00 76.12  ? 213 LEU A CB     1 
ATOM   3442 C  CG     . LEU A 1 213 ? 30.895  39.272  12.099  1.00 74.47  ? 213 LEU A CG     1 
ATOM   3443 C  CD1    . LEU A 1 213 ? 30.067  39.066  10.847  1.00 70.40  ? 213 LEU A CD1    1 
ATOM   3444 C  CD2    . LEU A 1 213 ? 32.370  38.939  11.845  1.00 63.96  ? 213 LEU A CD2    1 
ATOM   3445 H  H      . LEU A 1 213 ? 30.173  43.043  12.821  1.00 94.47  ? 213 LEU A H      1 
ATOM   3446 H  HA     . LEU A 1 213 ? 28.827  40.951  11.910  1.00 91.62  ? 213 LEU A HA     1 
ATOM   3447 H  HB2    . LEU A 1 213 ? 31.269  41.271  12.015  1.00 91.34  ? 213 LEU A HB2    1 
ATOM   3448 H  HB3    . LEU A 1 213 ? 31.137  40.732  13.496  1.00 91.34  ? 213 LEU A HB3    1 
ATOM   3449 H  HG     . LEU A 1 213 ? 30.564  38.663  12.778  1.00 89.36  ? 213 LEU A HG     1 
ATOM   3450 H  HD11   . LEU A 1 213 ? 30.174  38.160  10.548  1.00 84.48  ? 213 LEU A HD11   1 
ATOM   3451 H  HD12   . LEU A 1 213 ? 29.144  39.236  11.052  1.00 84.48  ? 213 LEU A HD12   1 
ATOM   3452 H  HD13   . LEU A 1 213 ? 30.370  39.673  10.169  1.00 84.48  ? 213 LEU A HD13   1 
ATOM   3453 H  HD21   . LEU A 1 213 ? 32.436  38.035  11.527  1.00 76.76  ? 213 LEU A HD21   1 
ATOM   3454 H  HD22   . LEU A 1 213 ? 32.718  39.544  11.186  1.00 76.76  ? 213 LEU A HD22   1 
ATOM   3455 H  HD23   . LEU A 1 213 ? 32.858  39.033  12.667  1.00 76.76  ? 213 LEU A HD23   1 
ATOM   3456 N  N      . LYS A 1 214 ? 29.250  41.048  15.101  1.00 73.46  ? 214 LYS A N      1 
ATOM   3457 C  CA     . LYS A 1 214 ? 28.686  40.680  16.391  1.00 75.72  ? 214 LYS A CA     1 
ATOM   3458 C  C      . LYS A 1 214 ? 27.232  41.115  16.484  1.00 82.83  ? 214 LYS A C      1 
ATOM   3459 O  O      . LYS A 1 214 ? 26.352  40.324  16.820  1.00 80.62  ? 214 LYS A O      1 
ATOM   3460 C  CB     . LYS A 1 214 ? 29.487  41.320  17.525  1.00 70.53  ? 214 LYS A CB     1 
ATOM   3461 C  CG     . LYS A 1 214 ? 28.707  41.428  18.820  1.00 74.04  ? 214 LYS A CG     1 
ATOM   3462 C  CD     . LYS A 1 214 ? 29.603  41.687  20.027  1.00 71.99  ? 214 LYS A CD     1 
ATOM   3463 C  CE     . LYS A 1 214 ? 28.758  41.975  21.271  1.00 77.46  ? 214 LYS A CE     1 
ATOM   3464 N  NZ     . LYS A 1 214 ? 29.567  42.206  22.508  1.00 82.44  ? 214 LYS A NZ     1 
ATOM   3465 H  H      . LYS A 1 214 ? 30.008  41.450  15.157  1.00 88.15  ? 214 LYS A H      1 
ATOM   3466 H  HA     . LYS A 1 214 ? 28.724  39.706  16.496  1.00 90.87  ? 214 LYS A HA     1 
ATOM   3467 H  HB2    . LYS A 1 214 ? 30.276  40.781  17.695  1.00 84.64  ? 214 LYS A HB2    1 
ATOM   3468 H  HB3    . LYS A 1 214 ? 29.749  42.215  17.259  1.00 84.64  ? 214 LYS A HB3    1 
ATOM   3469 H  HG2    . LYS A 1 214 ? 28.078  42.162  18.750  1.00 88.85  ? 214 LYS A HG2    1 
ATOM   3470 H  HG3    . LYS A 1 214 ? 28.231  40.596  18.973  1.00 88.85  ? 214 LYS A HG3    1 
ATOM   3471 H  HD2    . LYS A 1 214 ? 30.147  40.903  20.200  1.00 86.39  ? 214 LYS A HD2    1 
ATOM   3472 H  HD3    . LYS A 1 214 ? 30.165  42.458  19.852  1.00 86.39  ? 214 LYS A HD3    1 
ATOM   3473 H  HE2    . LYS A 1 214 ? 28.227  42.771  21.110  1.00 92.95  ? 214 LYS A HE2    1 
ATOM   3474 H  HE3    . LYS A 1 214 ? 28.174  41.218  21.434  1.00 92.95  ? 214 LYS A HE3    1 
ATOM   3475 H  HZ1    . LYS A 1 214 ? 29.028  42.368  23.198  1.00 98.92  ? 214 LYS A HZ1    1 
ATOM   3476 H  HZ2    . LYS A 1 214 ? 30.059  41.487  22.688  1.00 98.92  ? 214 LYS A HZ2    1 
ATOM   3477 H  HZ3    . LYS A 1 214 ? 30.107  42.904  22.393  1.00 98.92  ? 214 LYS A HZ3    1 
ATOM   3478 N  N      . GLY A 1 215 ? 26.988  42.385  16.187  1.00 82.16  ? 215 GLY A N      1 
ATOM   3479 C  CA     . GLY A 1 215 ? 25.651  42.943  16.242  1.00 79.35  ? 215 GLY A CA     1 
ATOM   3480 C  C      . GLY A 1 215 ? 24.624  42.100  15.509  1.00 88.08  ? 215 GLY A C      1 
ATOM   3481 O  O      . GLY A 1 215 ? 23.514  41.891  16.007  1.00 86.83  ? 215 GLY A O      1 
ATOM   3482 H  H      . GLY A 1 215 ? 27.591  42.949  15.947  1.00 98.59  ? 215 GLY A H      1 
ATOM   3483 H  HA2    . GLY A 1 215 ? 25.375  43.023  17.169  1.00 95.22  ? 215 GLY A HA2    1 
ATOM   3484 H  HA3    . GLY A 1 215 ? 25.657  43.829  15.847  1.00 95.22  ? 215 GLY A HA3    1 
ATOM   3485 N  N      . MET A 1 216 ? 24.992  41.600  14.332  1.00 84.76  ? 216 MET A N      1 
ATOM   3486 C  CA     . MET A 1 216 ? 24.024  40.959  13.448  1.00 80.57  ? 216 MET A CA     1 
ATOM   3487 C  C      . MET A 1 216 ? 23.929  39.443  13.633  1.00 88.87  ? 216 MET A C      1 
ATOM   3488 O  O      . MET A 1 216 ? 22.849  38.872  13.467  1.00 91.43  ? 216 MET A O      1 
ATOM   3489 C  CB     . MET A 1 216 ? 24.363  41.276  11.987  1.00 87.66  ? 216 MET A CB     1 
ATOM   3490 C  CG     . MET A 1 216 ? 23.147  41.379  11.062  1.00 95.52  ? 216 MET A CG     1 
ATOM   3491 S  SD     . MET A 1 216 ? 21.968  42.662  11.551  1.00 105.73 ? 216 MET A SD     1 
ATOM   3492 C  CE     . MET A 1 216 ? 23.066  44.034  11.926  1.00 90.34  ? 216 MET A CE     1 
ATOM   3493 H  H      . MET A 1 216 ? 25.794  41.620  14.023  1.00 101.71 ? 216 MET A H      1 
ATOM   3494 H  HA     . MET A 1 216 ? 23.142  41.344  13.631  1.00 96.69  ? 216 MET A HA     1 
ATOM   3495 H  HB2    . MET A 1 216 ? 24.831  42.125  11.954  1.00 105.19 ? 216 MET A HB2    1 
ATOM   3496 H  HB3    . MET A 1 216 ? 24.936  40.573  11.642  1.00 105.19 ? 216 MET A HB3    1 
ATOM   3497 H  HG2    . MET A 1 216 ? 23.454  41.584  10.165  1.00 114.62 ? 216 MET A HG2    1 
ATOM   3498 H  HG3    . MET A 1 216 ? 22.680  40.529  11.064  1.00 114.62 ? 216 MET A HG3    1 
ATOM   3499 H  HE1    . MET A 1 216 ? 23.662  43.773  12.632  1.00 108.40 ? 216 MET A HE1    1 
ATOM   3500 H  HE2    . MET A 1 216 ? 23.568  44.256  11.138  1.00 108.40 ? 216 MET A HE2    1 
ATOM   3501 H  HE3    . MET A 1 216 ? 22.540  44.788  12.202  1.00 108.40 ? 216 MET A HE3    1 
ATOM   3502 N  N      . ILE A 1 217 ? 25.044  38.788  13.962  1.00 83.54  ? 217 ILE A N      1 
ATOM   3503 C  CA     . ILE A 1 217 ? 25.056  37.323  14.072  1.00 83.17  ? 217 ILE A CA     1 
ATOM   3504 C  C      . ILE A 1 217 ? 25.404  36.830  15.476  1.00 78.87  ? 217 ILE A C      1 
ATOM   3505 O  O      . ILE A 1 217 ? 25.184  35.666  15.800  1.00 76.26  ? 217 ILE A O      1 
ATOM   3506 C  CB     . ILE A 1 217 ? 26.030  36.667  13.059  1.00 78.43  ? 217 ILE A CB     1 
ATOM   3507 C  CG1    . ILE A 1 217 ? 27.482  36.980  13.427  1.00 70.92  ? 217 ILE A CG1    1 
ATOM   3508 C  CG2    . ILE A 1 217 ? 25.714  37.121  11.638  1.00 77.50  ? 217 ILE A CG2    1 
ATOM   3509 C  CD1    . ILE A 1 217 ? 28.484  36.331  12.498  1.00 72.14  ? 217 ILE A CD1    1 
ATOM   3510 H  H      . ILE A 1 217 ? 25.800  39.163  14.127  1.00 100.25 ? 217 ILE A H      1 
ATOM   3511 H  HA     . ILE A 1 217 ? 24.156  36.994  13.864  1.00 99.80  ? 217 ILE A HA     1 
ATOM   3512 H  HB     . ILE A 1 217 ? 25.908  35.706  13.103  1.00 94.12  ? 217 ILE A HB     1 
ATOM   3513 H  HG12   . ILE A 1 217 ? 27.616  37.939  13.388  1.00 85.11  ? 217 ILE A HG12   1 
ATOM   3514 H  HG13   . ILE A 1 217 ? 27.655  36.657  14.325  1.00 85.11  ? 217 ILE A HG13   1 
ATOM   3515 H  HG21   . ILE A 1 217 ? 26.329  36.702  11.032  1.00 93.01  ? 217 ILE A HG21   1 
ATOM   3516 H  HG22   . ILE A 1 217 ? 24.814  36.865  11.421  1.00 93.01  ? 217 ILE A HG22   1 
ATOM   3517 H  HG23   . ILE A 1 217 ? 25.803  38.076  11.588  1.00 93.01  ? 217 ILE A HG23   1 
ATOM   3518 H  HD11   . ILE A 1 217 ? 29.370  36.566  12.782  1.00 86.56  ? 217 ILE A HD11   1 
ATOM   3519 H  HD12   . ILE A 1 217 ? 28.370  35.379  12.532  1.00 86.56  ? 217 ILE A HD12   1 
ATOM   3520 H  HD13   . ILE A 1 217 ? 28.332  36.648  11.604  1.00 86.56  ? 217 ILE A HD13   1 
ATOM   3521 N  N      . GLY A 1 218 ? 25.949  37.715  16.302  1.00 74.05  ? 218 GLY A N      1 
ATOM   3522 C  CA     . GLY A 1 218 ? 26.248  37.384  17.684  1.00 65.88  ? 218 GLY A CA     1 
ATOM   3523 C  C      . GLY A 1 218 ? 27.737  37.293  17.980  1.00 66.95  ? 218 GLY A C      1 
ATOM   3524 O  O      . GLY A 1 218 ? 28.553  37.010  17.101  1.00 67.66  ? 218 GLY A O      1 
ATOM   3525 H  H      . GLY A 1 218 ? 26.156  38.520  16.082  1.00 88.86  ? 218 GLY A H      1 
ATOM   3526 H  HA2    . GLY A 1 218 ? 25.864  38.060  18.264  1.00 79.05  ? 218 GLY A HA2    1 
ATOM   3527 H  HA3    . GLY A 1 218 ? 25.842  36.531  17.902  1.00 79.05  ? 218 GLY A HA3    1 
ATOM   3528 N  N      . GLU A 1 219 ? 28.090  37.523  19.238  1.00 64.08  ? 219 GLU A N      1 
ATOM   3529 C  CA     . GLU A 1 219 ? 29.483  37.485  19.662  1.00 64.91  ? 219 GLU A CA     1 
ATOM   3530 C  C      . GLU A 1 219 ? 30.138  36.135  19.326  1.00 70.60  ? 219 GLU A C      1 
ATOM   3531 O  O      . GLU A 1 219 ? 31.170  36.081  18.651  1.00 65.96  ? 219 GLU A O      1 
ATOM   3532 C  CB     . GLU A 1 219 ? 29.561  37.762  21.165  1.00 68.56  ? 219 GLU A CB     1 
ATOM   3533 C  CG     . GLU A 1 219 ? 30.958  38.032  21.689  1.00 77.53  ? 219 GLU A CG     1 
ATOM   3534 C  CD     . GLU A 1 219 ? 30.975  38.315  23.186  1.00 84.10  ? 219 GLU A CD     1 
ATOM   3535 O  OE1    . GLU A 1 219 ? 29.970  38.016  23.870  1.00 80.16  ? 219 GLU A OE1    1 
ATOM   3536 O  OE2    . GLU A 1 219 ? 31.997  38.839  23.680  1.00 91.00  ? 219 GLU A OE2    1 
ATOM   3537 H  H      . GLU A 1 219 ? 27.538  37.707  19.870  1.00 76.89  ? 219 GLU A H      1 
ATOM   3538 H  HA     . GLU A 1 219 ? 29.981  38.189  19.196  1.00 77.90  ? 219 GLU A HA     1 
ATOM   3539 H  HB2    . GLU A 1 219 ? 29.018  38.541  21.364  1.00 82.27  ? 219 GLU A HB2    1 
ATOM   3540 H  HB3    . GLU A 1 219 ? 29.214  36.992  21.640  1.00 82.27  ? 219 GLU A HB3    1 
ATOM   3541 H  HG2    . GLU A 1 219 ? 31.514  37.255  21.524  1.00 93.03  ? 219 GLU A HG2    1 
ATOM   3542 H  HG3    . GLU A 1 219 ? 31.324  38.806  21.233  1.00 93.03  ? 219 GLU A HG3    1 
ATOM   3543 N  N      . ALA A 1 220 ? 29.526  35.050  19.794  1.00 60.35  ? 220 ALA A N      1 
ATOM   3544 C  CA     . ALA A 1 220 ? 30.070  33.710  19.616  1.00 65.61  ? 220 ALA A CA     1 
ATOM   3545 C  C      . ALA A 1 220 ? 30.284  33.344  18.146  1.00 54.63  ? 220 ALA A C      1 
ATOM   3546 O  O      . ALA A 1 220 ? 31.365  32.900  17.769  1.00 45.73  ? 220 ALA A O      1 
ATOM   3547 C  CB     . ALA A 1 220 ? 29.161  32.683  20.291  1.00 65.14  ? 220 ALA A CB     1 
ATOM   3548 H  H      . ALA A 1 220 ? 28.782  35.066  20.224  1.00 72.42  ? 220 ALA A H      1 
ATOM   3549 H  HA     . ALA A 1 220 ? 30.943  33.668  20.060  1.00 78.73  ? 220 ALA A HA     1 
ATOM   3550 H  HB1    . ALA A 1 220 ? 29.532  31.807  20.165  1.00 78.17  ? 220 ALA A HB1    1 
ATOM   3551 H  HB2    . ALA A 1 220 ? 29.104  32.884  21.228  1.00 78.17  ? 220 ALA A HB2    1 
ATOM   3552 H  HB3    . ALA A 1 220 ? 28.288  32.730  19.892  1.00 78.17  ? 220 ALA A HB3    1 
ATOM   3553 N  N      . LYS A 1 221 ? 29.261  33.516  17.315  1.00 60.04  ? 221 LYS A N      1 
ATOM   3554 C  CA     . LYS A 1 221 ? 29.375  33.129  15.908  1.00 58.10  ? 221 LYS A CA     1 
ATOM   3555 C  C      . LYS A 1 221 ? 30.379  34.030  15.176  1.00 56.49  ? 221 LYS A C      1 
ATOM   3556 O  O      . LYS A 1 221 ? 31.037  33.595  14.229  1.00 54.08  ? 221 LYS A O      1 
ATOM   3557 C  CB     . LYS A 1 221 ? 28.013  33.173  15.209  1.00 62.80  ? 221 LYS A CB     1 
ATOM   3558 C  CG     . LYS A 1 221 ? 27.721  31.960  14.328  1.00 63.56  ? 221 LYS A CG     1 
ATOM   3559 C  CD     . LYS A 1 221 ? 26.533  31.169  14.871  1.00 66.43  ? 221 LYS A CD     1 
ATOM   3560 C  CE     . LYS A 1 221 ? 26.272  29.918  14.058  1.00 73.53  ? 221 LYS A CE     1 
ATOM   3561 N  NZ     . LYS A 1 221 ? 25.278  29.009  14.711  1.00 79.50  ? 221 LYS A NZ     1 
ATOM   3562 H  H      . LYS A 1 221 ? 28.500  33.849  17.535  1.00 72.05  ? 221 LYS A H      1 
ATOM   3563 H  HA     . LYS A 1 221 ? 29.707  32.209  15.859  1.00 69.72  ? 221 LYS A HA     1 
ATOM   3564 H  HB2    . LYS A 1 221 ? 27.318  33.222  15.885  1.00 75.36  ? 221 LYS A HB2    1 
ATOM   3565 H  HB3    . LYS A 1 221 ? 27.978  33.962  14.646  1.00 75.36  ? 221 LYS A HB3    1 
ATOM   3566 H  HG2    . LYS A 1 221 ? 27.506  32.258  13.430  1.00 76.27  ? 221 LYS A HG2    1 
ATOM   3567 H  HG3    . LYS A 1 221 ? 28.496  31.377  14.314  1.00 76.27  ? 221 LYS A HG3    1 
ATOM   3568 H  HD2    . LYS A 1 221 ? 26.718  30.903  15.785  1.00 79.71  ? 221 LYS A HD2    1 
ATOM   3569 H  HD3    . LYS A 1 221 ? 25.738  31.724  14.838  1.00 79.71  ? 221 LYS A HD3    1 
ATOM   3570 H  HE2    . LYS A 1 221 ? 25.922  30.172  13.190  1.00 88.23  ? 221 LYS A HE2    1 
ATOM   3571 H  HE3    . LYS A 1 221 ? 27.103  29.429  13.952  1.00 88.23  ? 221 LYS A HE3    1 
ATOM   3572 H  HZ1    . LYS A 1 221 ? 25.577  28.755  15.509  1.00 95.41  ? 221 LYS A HZ1    1 
ATOM   3573 H  HZ2    . LYS A 1 221 ? 24.501  29.431  14.814  1.00 95.41  ? 221 LYS A HZ2    1 
ATOM   3574 H  HZ3    . LYS A 1 221 ? 25.149  28.287  14.206  1.00 95.41  ? 221 LYS A HZ3    1 
ATOM   3575 N  N      . ALA A 1 222 ? 30.502  35.277  15.620  1.00 52.23  ? 222 ALA A N      1 
ATOM   3576 C  CA     . ALA A 1 222 ? 31.436  36.208  15.001  1.00 62.40  ? 222 ALA A CA     1 
ATOM   3577 C  C      . ALA A 1 222 ? 32.870  35.775  15.301  1.00 57.28  ? 222 ALA A C      1 
ATOM   3578 O  O      . ALA A 1 222 ? 33.700  35.704  14.408  1.00 57.51  ? 222 ALA A O      1 
ATOM   3579 C  CB     . ALA A 1 222 ? 31.189  37.630  15.505  1.00 67.01  ? 222 ALA A CB     1 
ATOM   3580 H  H      . ALA A 1 222 ? 30.056  35.608  16.277  1.00 62.67  ? 222 ALA A H      1 
ATOM   3581 H  HA     . ALA A 1 222 ? 31.307  36.199  14.029  1.00 74.88  ? 222 ALA A HA     1 
ATOM   3582 H  HB1    . ALA A 1 222 ? 31.815  38.223  15.084  1.00 80.41  ? 222 ALA A HB1    1 
ATOM   3583 H  HB2    . ALA A 1 222 ? 30.292  37.888  15.283  1.00 80.41  ? 222 ALA A HB2    1 
ATOM   3584 H  HB3    . ALA A 1 222 ? 31.309  37.648  16.458  1.00 80.41  ? 222 ALA A HB3    1 
ATOM   3585 N  N      . LYS A 1 223 ? 33.143  35.482  16.568  1.00 53.21  ? 223 LYS A N      1 
ATOM   3586 C  CA     . LYS A 1 223 ? 34.464  35.044  16.990  1.00 59.86  ? 223 LYS A CA     1 
ATOM   3587 C  C      . LYS A 1 223 ? 34.844  33.768  16.263  1.00 51.86  ? 223 LYS A C      1 
ATOM   3588 O  O      . LYS A 1 223 ? 35.957  33.621  15.765  1.00 49.03  ? 223 LYS A O      1 
ATOM   3589 C  CB     . LYS A 1 223 ? 34.472  34.807  18.495  1.00 51.55  ? 223 LYS A CB     1 
ATOM   3590 C  CG     . LYS A 1 223 ? 34.748  36.053  19.305  1.00 70.15  ? 223 LYS A CG     1 
ATOM   3591 C  CD     . LYS A 1 223 ? 34.301  35.886  20.739  1.00 64.52  ? 223 LYS A CD     1 
ATOM   3592 C  CE     . LYS A 1 223 ? 34.571  37.145  21.550  1.00 84.90  ? 223 LYS A CE     1 
ATOM   3593 N  NZ     . LYS A 1 223 ? 34.152  36.993  22.976  1.00 83.02  ? 223 LYS A NZ     1 
ATOM   3594 H  H      . LYS A 1 223 ? 32.572  35.530  17.208  1.00 63.85  ? 223 LYS A H      1 
ATOM   3595 H  HA     . LYS A 1 223 ? 35.125  35.736  16.777  1.00 71.83  ? 223 LYS A HA     1 
ATOM   3596 H  HB2    . LYS A 1 223 ? 33.605  34.465  18.763  1.00 61.86  ? 223 LYS A HB2    1 
ATOM   3597 H  HB3    . LYS A 1 223 ? 35.161  34.157  18.706  1.00 61.86  ? 223 LYS A HB3    1 
ATOM   3598 H  HG2    . LYS A 1 223 ? 35.702  36.232  19.302  1.00 84.18  ? 223 LYS A HG2    1 
ATOM   3599 H  HG3    . LYS A 1 223 ? 34.264  36.799  18.920  1.00 84.18  ? 223 LYS A HG3    1 
ATOM   3600 H  HD2    . LYS A 1 223 ? 33.348  35.708  20.760  1.00 77.43  ? 223 LYS A HD2    1 
ATOM   3601 H  HD3    . LYS A 1 223 ? 34.790  35.152  21.144  1.00 77.43  ? 223 LYS A HD3    1 
ATOM   3602 H  HE2    . LYS A 1 223 ? 35.522  37.337  21.533  1.00 101.88 ? 223 LYS A HE2    1 
ATOM   3603 H  HE3    . LYS A 1 223 ? 34.074  37.884  21.166  1.00 101.88 ? 223 LYS A HE3    1 
ATOM   3604 H  HZ1    . LYS A 1 223 ? 33.280  36.821  23.019  1.00 99.63  ? 223 LYS A HZ1    1 
ATOM   3605 H  HZ2    . LYS A 1 223 ? 34.599  36.323  23.354  1.00 99.63  ? 223 LYS A HZ2    1 
ATOM   3606 H  HZ3    . LYS A 1 223 ? 34.322  37.743  23.424  1.00 99.63  ? 223 LYS A HZ3    1 
ATOM   3607 N  N      . TYR A 1 224 ? 33.898  32.842  16.219  1.00 43.40  ? 224 TYR A N      1 
ATOM   3608 C  CA     . TYR A 1 224 ? 34.065  31.581  15.509  1.00 50.72  ? 224 TYR A CA     1 
ATOM   3609 C  C      . TYR A 1 224 ? 34.505  31.825  14.071  1.00 53.90  ? 224 TYR A C      1 
ATOM   3610 O  O      . TYR A 1 224 ? 35.530  31.316  13.635  1.00 46.92  ? 224 TYR A O      1 
ATOM   3611 C  CB     . TYR A 1 224 ? 32.736  30.817  15.548  1.00 44.64  ? 224 TYR A CB     1 
ATOM   3612 C  CG     . TYR A 1 224 ? 32.649  29.590  14.663  1.00 49.12  ? 224 TYR A CG     1 
ATOM   3613 C  CD1    . TYR A 1 224 ? 33.389  28.450  14.938  1.00 53.02  ? 224 TYR A CD1    1 
ATOM   3614 C  CD2    . TYR A 1 224 ? 31.782  29.561  13.582  1.00 47.21  ? 224 TYR A CD2    1 
ATOM   3615 C  CE1    . TYR A 1 224 ? 33.287  27.329  14.136  1.00 57.56  ? 224 TYR A CE1    1 
ATOM   3616 C  CE2    . TYR A 1 224 ? 31.679  28.456  12.776  1.00 48.95  ? 224 TYR A CE2    1 
ATOM   3617 C  CZ     . TYR A 1 224 ? 32.424  27.345  13.056  1.00 55.40  ? 224 TYR A CZ     1 
ATOM   3618 O  OH     . TYR A 1 224 ? 32.304  26.254  12.252  1.00 48.68  ? 224 TYR A OH     1 
ATOM   3619 H  H      . TYR A 1 224 ? 33.132  32.921  16.602  1.00 52.08  ? 224 TYR A H      1 
ATOM   3620 H  HA     . TYR A 1 224 ? 34.749  31.041  15.956  1.00 60.86  ? 224 TYR A HA     1 
ATOM   3621 H  HB2    . TYR A 1 224 ? 32.578  30.526  16.460  1.00 53.57  ? 224 TYR A HB2    1 
ATOM   3622 H  HB3    . TYR A 1 224 ? 32.028  31.421  15.275  1.00 53.57  ? 224 TYR A HB3    1 
ATOM   3623 H  HD1    . TYR A 1 224 ? 33.970  28.444  15.664  1.00 63.62  ? 224 TYR A HD1    1 
ATOM   3624 H  HD2    . TYR A 1 224 ? 31.274  30.316  13.387  1.00 56.66  ? 224 TYR A HD2    1 
ATOM   3625 H  HE1    . TYR A 1 224 ? 33.794  26.572  14.320  1.00 69.07  ? 224 TYR A HE1    1 
ATOM   3626 H  HE2    . TYR A 1 224 ? 31.097  28.459  12.051  1.00 58.74  ? 224 TYR A HE2    1 
ATOM   3627 H  HH     . TYR A 1 224 ? 32.047  25.610  12.691  1.00 58.42  ? 224 TYR A HH     1 
ATOM   3628 N  N      . LEU A 1 225 ? 33.729  32.610  13.329  1.00 57.02  ? 225 LEU A N      1 
ATOM   3629 C  CA     . LEU A 1 225 ? 34.008  32.826  11.910  1.00 54.71  ? 225 LEU A CA     1 
ATOM   3630 C  C      . LEU A 1 225 ? 35.342  33.537  11.715  1.00 46.62  ? 225 LEU A C      1 
ATOM   3631 O  O      . LEU A 1 225 ? 36.132  33.178  10.843  1.00 45.09  ? 225 LEU A O      1 
ATOM   3632 C  CB     . LEU A 1 225 ? 32.873  33.628  11.268  1.00 57.00  ? 225 LEU A CB     1 
ATOM   3633 C  CG     . LEU A 1 225 ? 31.578  32.829  11.103  1.00 53.50  ? 225 LEU A CG     1 
ATOM   3634 C  CD1    . LEU A 1 225 ? 30.441  33.727  10.621  1.00 64.47  ? 225 LEU A CD1    1 
ATOM   3635 C  CD2    . LEU A 1 225 ? 31.793  31.657  10.159  1.00 52.58  ? 225 LEU A CD2    1 
ATOM   3636 H  H      . LEU A 1 225 ? 33.036  33.028  13.621  1.00 68.43  ? 225 LEU A H      1 
ATOM   3637 H  HA     . LEU A 1 225 ? 34.058  31.958  11.459  1.00 65.65  ? 225 LEU A HA     1 
ATOM   3638 H  HB2    . LEU A 1 225 ? 32.679  34.398  11.825  1.00 68.41  ? 225 LEU A HB2    1 
ATOM   3639 H  HB3    . LEU A 1 225 ? 33.156  33.921  10.387  1.00 68.41  ? 225 LEU A HB3    1 
ATOM   3640 H  HG     . LEU A 1 225 ? 31.323  32.468  11.967  1.00 64.20  ? 225 LEU A HG     1 
ATOM   3641 H  HD11   . LEU A 1 225 ? 29.644  33.200  10.527  1.00 77.36  ? 225 LEU A HD11   1 
ATOM   3642 H  HD12   . LEU A 1 225 ? 30.299  34.424  11.266  1.00 77.36  ? 225 LEU A HD12   1 
ATOM   3643 H  HD13   . LEU A 1 225 ? 30.683  34.109  9.774   1.00 77.36  ? 225 LEU A HD13   1 
ATOM   3644 H  HD21   . LEU A 1 225 ? 30.970  31.171  10.071  1.00 63.10  ? 225 LEU A HD21   1 
ATOM   3645 H  HD22   . LEU A 1 225 ? 32.069  31.993  9.303   1.00 63.10  ? 225 LEU A HD22   1 
ATOM   3646 H  HD23   . LEU A 1 225 ? 32.474  31.086  10.521  1.00 63.10  ? 225 LEU A HD23   1 
ATOM   3647 N  N      . ILE A 1 226 ? 35.603  34.536  12.546  1.00 51.26  ? 226 ILE A N      1 
ATOM   3648 C  CA     . ILE A 1 226 ? 36.852  35.267  12.451  1.00 54.28  ? 226 ILE A CA     1 
ATOM   3649 C  C      . ILE A 1 226 ? 38.050  34.335  12.709  1.00 58.31  ? 226 ILE A C      1 
ATOM   3650 O  O      . ILE A 1 226 ? 39.041  34.377  11.971  1.00 52.43  ? 226 ILE A O      1 
ATOM   3651 C  CB     . ILE A 1 226 ? 36.843  36.500  13.377  1.00 50.31  ? 226 ILE A CB     1 
ATOM   3652 C  CG1    . ILE A 1 226 ? 35.875  37.548  12.818  1.00 56.97  ? 226 ILE A CG1    1 
ATOM   3653 C  CG2    . ILE A 1 226 ? 38.232  37.100  13.481  1.00 60.93  ? 226 ILE A CG2    1 
ATOM   3654 C  CD1    . ILE A 1 226 ? 35.674  38.762  13.710  1.00 62.11  ? 226 ILE A CD1    1 
ATOM   3655 H  H      . ILE A 1 226 ? 35.076  34.808  13.169  1.00 61.52  ? 226 ILE A H      1 
ATOM   3656 H  HA     . ILE A 1 226 ? 36.941  35.599  11.533  1.00 65.13  ? 226 ILE A HA     1 
ATOM   3657 H  HB     . ILE A 1 226 ? 36.546  36.231  14.260  1.00 60.37  ? 226 ILE A HB     1 
ATOM   3658 H  HG12   . ILE A 1 226 ? 36.216  37.862  11.966  1.00 68.37  ? 226 ILE A HG12   1 
ATOM   3659 H  HG13   . ILE A 1 226 ? 35.008  37.132  12.689  1.00 68.37  ? 226 ILE A HG13   1 
ATOM   3660 H  HG21   . ILE A 1 226 ? 38.199  37.864  14.062  1.00 73.12  ? 226 ILE A HG21   1 
ATOM   3661 H  HG22   . ILE A 1 226 ? 38.831  36.441  13.840  1.00 73.12  ? 226 ILE A HG22   1 
ATOM   3662 H  HG23   . ILE A 1 226 ? 38.523  37.366  12.606  1.00 73.12  ? 226 ILE A HG23   1 
ATOM   3663 H  HD11   . ILE A 1 226 ? 35.057  39.363  13.285  1.00 74.53  ? 226 ILE A HD11   1 
ATOM   3664 H  HD12   . ILE A 1 226 ? 35.322  38.474  14.555  1.00 74.53  ? 226 ILE A HD12   1 
ATOM   3665 H  HD13   . ILE A 1 226 ? 36.520  39.198  13.838  1.00 74.53  ? 226 ILE A HD13   1 
ATOM   3666 N  N      . SER A 1 227 ? 37.952  33.462  13.713  1.00 49.02  ? 227 SER A N      1 
ATOM   3667 C  CA     . SER A 1 227 ? 39.057  32.538  14.000  1.00 47.81  ? 227 SER A CA     1 
ATOM   3668 C  C      . SER A 1 227 ? 39.287  31.566  12.847  1.00 50.66  ? 227 SER A C      1 
ATOM   3669 O  O      . SER A 1 227 ? 40.422  31.183  12.552  1.00 42.17  ? 227 SER A O      1 
ATOM   3670 C  CB     . SER A 1 227 ? 38.809  31.759  15.292  1.00 49.84  ? 227 SER A CB     1 
ATOM   3671 O  OG     . SER A 1 227 ? 37.809  30.769  15.119  1.00 58.73  ? 227 SER A OG     1 
ATOM   3672 H  H      . SER A 1 227 ? 37.273  33.383  14.234  1.00 58.83  ? 227 SER A H      1 
ATOM   3673 H  HA     . SER A 1 227 ? 39.879  33.059  14.119  1.00 57.37  ? 227 SER A HA     1 
ATOM   3674 H  HB2    . SER A 1 227 ? 39.635  31.327  15.561  1.00 59.81  ? 227 SER A HB2    1 
ATOM   3675 H  HB3    . SER A 1 227 ? 38.521  32.378  15.981  1.00 59.81  ? 227 SER A HB3    1 
ATOM   3676 H  HG     . SER A 1 227 ? 37.531  30.782  14.348  1.00 70.48  ? 227 SER A HG     1 
ATOM   3677 N  N      . LEU A 1 228 ? 38.219  31.157  12.179  1.00 46.65  ? 228 LEU A N      1 
ATOM   3678 C  CA     . LEU A 1 228 ? 38.394  30.265  11.045  1.00 43.21  ? 228 LEU A CA     1 
ATOM   3679 C  C      . LEU A 1 228 ? 39.105  31.035  9.952   1.00 50.17  ? 228 LEU A C      1 
ATOM   3680 O  O      . LEU A 1 228 ? 39.996  30.501  9.297   1.00 45.37  ? 228 LEU A O      1 
ATOM   3681 C  CB     . LEU A 1 228 ? 37.050  29.733  10.532  1.00 50.26  ? 228 LEU A CB     1 
ATOM   3682 C  CG     . LEU A 1 228 ? 36.439  28.582  11.335  1.00 53.29  ? 228 LEU A CG     1 
ATOM   3683 C  CD1    . LEU A 1 228 ? 34.971  28.392  10.974  1.00 61.02  ? 228 LEU A CD1    1 
ATOM   3684 C  CD2    . LEU A 1 228 ? 37.211  27.282  11.121  1.00 51.32  ? 228 LEU A CD2    1 
ATOM   3685 H  H      . LEU A 1 228 ? 37.405  31.374  12.354  1.00 55.97  ? 228 LEU A H      1 
ATOM   3686 H  HA     . LEU A 1 228 ? 38.953  29.504  11.307  1.00 51.85  ? 228 LEU A HA     1 
ATOM   3687 H  HB2    . LEU A 1 228 ? 36.411  30.462  10.537  1.00 60.32  ? 228 LEU A HB2    1 
ATOM   3688 H  HB3    . LEU A 1 228 ? 37.173  29.418  9.622   1.00 60.32  ? 228 LEU A HB3    1 
ATOM   3689 H  HG     . LEU A 1 228 ? 36.485  28.801  12.278  1.00 63.95  ? 228 LEU A HG     1 
ATOM   3690 H  HD11   . LEU A 1 228 ? 34.614  27.666  11.490  1.00 73.22  ? 228 LEU A HD11   1 
ATOM   3691 H  HD12   . LEU A 1 228 ? 34.494  29.202  11.172  1.00 73.22  ? 228 LEU A HD12   1 
ATOM   3692 H  HD13   . LEU A 1 228 ? 34.903  28.193  10.037  1.00 73.22  ? 228 LEU A HD13   1 
ATOM   3693 H  HD21   . LEU A 1 228 ? 36.799  26.586  11.639  1.00 61.59  ? 228 LEU A HD21   1 
ATOM   3694 H  HD22   . LEU A 1 228 ? 37.188  27.055  10.189  1.00 61.59  ? 228 LEU A HD22   1 
ATOM   3695 H  HD23   . LEU A 1 228 ? 38.119  27.409  11.406  1.00 61.59  ? 228 LEU A HD23   1 
ATOM   3696 N  N      . ALA A 1 229 ? 38.708  32.296  9.767   1.00 50.65  ? 229 ALA A N      1 
ATOM   3697 C  CA     . ALA A 1 229 ? 39.209  33.100  8.649   1.00 61.19  ? 229 ALA A CA     1 
ATOM   3698 C  C      . ALA A 1 229 ? 40.683  33.452  8.837   1.00 53.91  ? 229 ALA A C      1 
ATOM   3699 O  O      . ALA A 1 229 ? 41.406  33.626  7.857   1.00 61.07  ? 229 ALA A O      1 
ATOM   3700 C  CB     . ALA A 1 229 ? 38.360  34.377  8.465   1.00 49.76  ? 229 ALA A CB     1 
ATOM   3701 H  H      . ALA A 1 229 ? 38.150  32.708  10.274  1.00 60.78  ? 229 ALA A H      1 
ATOM   3702 H  HA     . ALA A 1 229 ? 39.133  32.573  7.827   1.00 73.43  ? 229 ALA A HA     1 
ATOM   3703 H  HB1    . ALA A 1 229 ? 38.711  34.882  7.727   1.00 59.72  ? 229 ALA A HB1    1 
ATOM   3704 H  HB2    . ALA A 1 229 ? 37.451  34.125  8.286   1.00 59.72  ? 229 ALA A HB2    1 
ATOM   3705 H  HB3    . ALA A 1 229 ? 38.402  34.899  9.269   1.00 59.72  ? 229 ALA A HB3    1 
ATOM   3706 N  N      . ARG A 1 230 ? 41.120  33.544  10.091  1.00 50.66  ? 230 ARG A N      1 
ATOM   3707 C  CA     . ARG A 1 230 ? 42.526  33.816  10.411  1.00 56.73  ? 230 ARG A CA     1 
ATOM   3708 C  C      . ARG A 1 230 ? 43.343  32.533  10.428  1.00 53.23  ? 230 ARG A C      1 
ATOM   3709 O  O      . ARG A 1 230 ? 44.532  32.548  10.751  1.00 54.19  ? 230 ARG A O      1 
ATOM   3710 C  CB     . ARG A 1 230 ? 42.660  34.474  11.786  1.00 51.68  ? 230 ARG A CB     1 
ATOM   3711 C  CG     . ARG A 1 230 ? 42.122  35.877  11.877  1.00 57.76  ? 230 ARG A CG     1 
ATOM   3712 C  CD     . ARG A 1 230 ? 42.227  36.396  13.296  1.00 67.94  ? 230 ARG A CD     1 
ATOM   3713 N  NE     . ARG A 1 230 ? 41.908  37.814  13.375  1.00 72.74  ? 230 ARG A NE     1 
ATOM   3714 C  CZ     . ARG A 1 230 ? 41.503  38.437  14.479  1.00 84.56  ? 230 ARG A CZ     1 
ATOM   3715 N  NH1    . ARG A 1 230 ? 41.353  37.767  15.618  1.00 82.67  ? 230 ARG A NH1    1 
ATOM   3716 N  NH2    . ARG A 1 230 ? 41.239  39.736  14.438  1.00 79.82  ? 230 ARG A NH2    1 
ATOM   3717 H  H      . ARG A 1 230 ? 40.619  33.453  10.784  1.00 60.80  ? 230 ARG A H      1 
ATOM   3718 H  HA     . ARG A 1 230 ? 42.906  34.419  9.738   1.00 68.08  ? 230 ARG A HA     1 
ATOM   3719 H  HB2    . ARG A 1 230 ? 42.180  33.934  12.434  1.00 62.01  ? 230 ARG A HB2    1 
ATOM   3720 H  HB3    . ARG A 1 230 ? 43.600  34.505  12.023  1.00 62.01  ? 230 ARG A HB3    1 
ATOM   3721 H  HG2    . ARG A 1 230 ? 42.639  36.459  11.298  1.00 69.32  ? 230 ARG A HG2    1 
ATOM   3722 H  HG3    . ARG A 1 230 ? 41.188  35.882  11.616  1.00 69.32  ? 230 ARG A HG3    1 
ATOM   3723 H  HD2    . ARG A 1 230 ? 41.603  35.913  13.860  1.00 81.53  ? 230 ARG A HD2    1 
ATOM   3724 H  HD3    . ARG A 1 230 ? 43.134  36.270  13.616  1.00 81.53  ? 230 ARG A HD3    1 
ATOM   3725 H  HE     . ARG A 1 230 ? 41.987  38.283  12.658  1.00 87.29  ? 230 ARG A HE     1 
ATOM   3726 H  HH11   . ARG A 1 230 ? 41.523  36.925  15.647  1.00 99.21  ? 230 ARG A HH11   1 
ATOM   3727 H  HH12   . ARG A 1 230 ? 41.090  38.178  16.326  1.00 99.21  ? 230 ARG A HH12   1 
ATOM   3728 H  HH21   . ARG A 1 230 ? 41.334  40.171  13.702  1.00 95.78  ? 230 ARG A HH21   1 
ATOM   3729 H  HH22   . ARG A 1 230 ? 40.975  40.144  15.148  1.00 95.78  ? 230 ARG A HH22   1 
ATOM   3730 N  N      . ASP A 1 231 ? 42.704  31.414  10.108  1.00 55.39  ? 231 ASP A N      1 
ATOM   3731 C  CA     . ASP A 1 231 ? 43.389  30.129  10.133  1.00 57.95  ? 231 ASP A CA     1 
ATOM   3732 C  C      . ASP A 1 231 ? 43.918  29.853  11.544  1.00 56.25  ? 231 ASP A C      1 
ATOM   3733 O  O      . ASP A 1 231 ? 44.989  29.281  11.709  1.00 56.74  ? 231 ASP A O      1 
ATOM   3734 C  CB     . ASP A 1 231 ? 44.548  30.138  9.133   1.00 62.54  ? 231 ASP A CB     1 
ATOM   3735 C  CG     . ASP A 1 231 ? 44.967  28.741  8.712   1.00 69.85  ? 231 ASP A CG     1 
ATOM   3736 O  OD1    . ASP A 1 231 ? 44.814  27.801  9.522   1.00 73.12  ? 231 ASP A OD1    1 
ATOM   3737 O  OD2    . ASP A 1 231 ? 45.443  28.579  7.567   1.00 72.88  ? 231 ASP A OD2    1 
ATOM   3738 H  H      . ASP A 1 231 ? 41.878  31.373  9.873   1.00 66.47  ? 231 ASP A H      1 
ATOM   3739 H  HA     . ASP A 1 231 ? 42.764  29.416  9.886   1.00 69.54  ? 231 ASP A HA     1 
ATOM   3740 H  HB2    . ASP A 1 231 ? 44.276  30.623  8.338   1.00 75.05  ? 231 ASP A HB2    1 
ATOM   3741 H  HB3    . ASP A 1 231 ? 45.314  30.571  9.541   1.00 75.05  ? 231 ASP A HB3    1 
ATOM   3742 N  N      . GLU A 1 232 ? 43.165  30.284  12.552  1.00 54.45  ? 232 GLU A N      1 
ATOM   3743 C  CA     . GLU A 1 232 ? 43.569  30.119  13.942  1.00 58.61  ? 232 GLU A CA     1 
ATOM   3744 C  C      . GLU A 1 232 ? 42.551  29.300  14.746  1.00 61.65  ? 232 GLU A C      1 
ATOM   3745 O  O      . GLU A 1 232 ? 42.639  29.223  15.971  1.00 62.84  ? 232 GLU A O      1 
ATOM   3746 C  CB     . GLU A 1 232 ? 43.784  31.497  14.595  1.00 60.74  ? 232 GLU A CB     1 
ATOM   3747 C  CG     . GLU A 1 232 ? 44.889  32.335  13.921  1.00 60.66  ? 232 GLU A CG     1 
ATOM   3748 C  CD     . GLU A 1 232 ? 45.146  33.687  14.596  1.00 70.06  ? 232 GLU A CD     1 
ATOM   3749 O  OE1    . GLU A 1 232 ? 44.377  34.075  15.506  1.00 59.77  ? 232 GLU A OE1    1 
ATOM   3750 O  OE2    . GLU A 1 232 ? 46.127  34.364  14.203  1.00 69.86  ? 232 GLU A OE2    1 
ATOM   3751 H  H      . GLU A 1 232 ? 42.408  30.679  12.455  1.00 65.34  ? 232 GLU A H      1 
ATOM   3752 H  HA     . GLU A 1 232 ? 44.423  29.640  13.966  1.00 70.34  ? 232 GLU A HA     1 
ATOM   3753 H  HB2    . GLU A 1 232 ? 42.957  32.001  14.545  1.00 72.89  ? 232 GLU A HB2    1 
ATOM   3754 H  HB3    . GLU A 1 232 ? 44.035  31.368  15.523  1.00 72.89  ? 232 GLU A HB3    1 
ATOM   3755 H  HG2    . GLU A 1 232 ? 45.718  31.831  13.941  1.00 72.79  ? 232 GLU A HG2    1 
ATOM   3756 H  HG3    . GLU A 1 232 ? 44.631  32.507  13.001  1.00 72.79  ? 232 GLU A HG3    1 
ATOM   3757 N  N      . TYR A 1 233 ? 41.587  28.686  14.069  1.00 56.47  ? 233 TYR A N      1 
ATOM   3758 C  CA     . TYR A 1 233 ? 40.590  27.894  14.772  1.00 57.63  ? 233 TYR A CA     1 
ATOM   3759 C  C      . TYR A 1 233 ? 41.262  26.692  15.410  1.00 60.61  ? 233 TYR A C      1 
ATOM   3760 O  O      . TYR A 1 233 ? 41.873  25.857  14.742  1.00 55.64  ? 233 TYR A O      1 
ATOM   3761 C  CB     . TYR A 1 233 ? 39.462  27.427  13.846  1.00 56.50  ? 233 TYR A CB     1 
ATOM   3762 C  CG     . TYR A 1 233 ? 38.465  26.491  14.516  1.00 48.68  ? 233 TYR A CG     1 
ATOM   3763 C  CD1    . TYR A 1 233 ? 37.307  26.983  15.111  1.00 45.11  ? 233 TYR A CD1    1 
ATOM   3764 C  CD2    . TYR A 1 233 ? 38.679  25.122  14.542  1.00 52.11  ? 233 TYR A CD2    1 
ATOM   3765 C  CE1    . TYR A 1 233 ? 36.394  26.134  15.717  1.00 56.30  ? 233 TYR A CE1    1 
ATOM   3766 C  CE2    . TYR A 1 233 ? 37.773  24.261  15.148  1.00 52.89  ? 233 TYR A CE2    1 
ATOM   3767 C  CZ     . TYR A 1 233 ? 36.629  24.770  15.731  1.00 53.11  ? 233 TYR A CZ     1 
ATOM   3768 O  OH     . TYR A 1 233 ? 35.723  23.914  16.337  1.00 48.58  ? 233 TYR A OH     1 
ATOM   3769 H  H      . TYR A 1 233 ? 41.490  28.713  13.215  1.00 67.76  ? 233 TYR A H      1 
ATOM   3770 H  HA     . TYR A 1 233 ? 40.193  28.436  15.485  1.00 69.16  ? 233 TYR A HA     1 
ATOM   3771 H  HB2    . TYR A 1 233 ? 38.974  28.204  13.531  1.00 67.80  ? 233 TYR A HB2    1 
ATOM   3772 H  HB3    . TYR A 1 233 ? 39.851  26.956  13.092  1.00 67.80  ? 233 TYR A HB3    1 
ATOM   3773 H  HD1    . TYR A 1 233 ? 37.143  27.898  15.102  1.00 54.13  ? 233 TYR A HD1    1 
ATOM   3774 H  HD2    . TYR A 1 233 ? 39.446  24.773  14.149  1.00 62.53  ? 233 TYR A HD2    1 
ATOM   3775 H  HE1    . TYR A 1 233 ? 35.625  26.479  16.111  1.00 67.56  ? 233 TYR A HE1    1 
ATOM   3776 H  HE2    . TYR A 1 233 ? 37.933  23.345  15.156  1.00 63.47  ? 233 TYR A HE2    1 
ATOM   3777 H  HH     . TYR A 1 233 ? 36.090  23.502  16.944  1.00 58.30  ? 233 TYR A HH     1 
ATOM   3778 N  N      . ASN A 1 234 ? 41.154  26.634  16.722  1.00 54.73  ? 234 ASN A N      1 
ATOM   3779 C  CA     . ASN A 1 234 ? 41.646  25.508  17.477  1.00 73.42  ? 234 ASN A CA     1 
ATOM   3780 C  C      . ASN A 1 234 ? 40.622  25.186  18.536  1.00 70.20  ? 234 ASN A C      1 
ATOM   3781 O  O      . ASN A 1 234 ? 40.235  26.043  19.343  1.00 71.02  ? 234 ASN A O      1 
ATOM   3782 C  CB     . ASN A 1 234 ? 42.991  25.812  18.134  1.00 68.77  ? 234 ASN A CB     1 
ATOM   3783 C  CG     . ASN A 1 234 ? 43.177  25.054  19.433  1.00 83.55  ? 234 ASN A CG     1 
ATOM   3784 O  OD1    . ASN A 1 234 ? 43.474  23.857  19.428  1.00 80.60  ? 234 ASN A OD1    1 
ATOM   3785 N  ND2    . ASN A 1 234 ? 42.983  25.743  20.559  1.00 88.41  ? 234 ASN A ND2    1 
ATOM   3786 H  H      . ASN A 1 234 ? 40.792  27.247  17.206  1.00 65.67  ? 234 ASN A H      1 
ATOM   3787 H  HA     . ASN A 1 234 ? 41.748  24.731  16.888  1.00 88.11  ? 234 ASN A HA     1 
ATOM   3788 H  HB2    . ASN A 1 234 ? 43.705  25.555  17.530  1.00 82.52  ? 234 ASN A HB2    1 
ATOM   3789 H  HB3    . ASN A 1 234 ? 43.042  26.761  18.328  1.00 82.52  ? 234 ASN A HB3    1 
ATOM   3790 H  HD21   . ASN A 1 234 ? 43.078  25.357  21.321  1.00 106.09 ? 234 ASN A HD21   1 
ATOM   3791 H  HD22   . ASN A 1 234 ? 42.764  26.574  20.522  1.00 106.09 ? 234 ASN A HD22   1 
ATOM   3792 N  N      . GLU A 1 235 ? 40.175  23.943  18.505  1.00 57.99  ? 235 GLU A N      1 
ATOM   3793 C  CA     . GLU A 1 235 ? 39.199  23.449  19.447  1.00 58.26  ? 235 GLU A CA     1 
ATOM   3794 C  C      . GLU A 1 235 ? 39.576  21.996  19.630  1.00 62.06  ? 235 GLU A C      1 
ATOM   3795 O  O      . GLU A 1 235 ? 39.653  21.239  18.661  1.00 48.31  ? 235 GLU A O      1 
ATOM   3796 C  CB     . GLU A 1 235 ? 37.783  23.607  18.891  1.00 55.39  ? 235 GLU A CB     1 
ATOM   3797 C  CG     . GLU A 1 235 ? 36.674  23.402  19.911  1.00 75.94  ? 235 GLU A CG     1 
ATOM   3798 C  CD     . GLU A 1 235 ? 36.622  24.494  20.984  1.00 86.80  ? 235 GLU A CD     1 
ATOM   3799 O  OE1    . GLU A 1 235 ? 35.770  24.378  21.895  1.00 82.48  ? 235 GLU A OE1    1 
ATOM   3800 O  OE2    . GLU A 1 235 ? 37.421  25.462  20.925  1.00 78.93  ? 235 GLU A OE2    1 
ATOM   3801 H  H      . GLU A 1 235 ? 40.430  23.354  17.932  1.00 69.59  ? 235 GLU A H      1 
ATOM   3802 H  HA     . GLU A 1 235 ? 39.273  23.921  20.303  1.00 69.91  ? 235 GLU A HA     1 
ATOM   3803 H  HB2    . GLU A 1 235 ? 37.689  24.503  18.531  1.00 66.47  ? 235 GLU A HB2    1 
ATOM   3804 H  HB3    . GLU A 1 235 ? 37.654  22.956  18.183  1.00 66.47  ? 235 GLU A HB3    1 
ATOM   3805 H  HG2    . GLU A 1 235 ? 35.821  23.396  19.450  1.00 91.12  ? 235 GLU A HG2    1 
ATOM   3806 H  HG3    . GLU A 1 235 ? 36.813  22.552  20.358  1.00 91.12  ? 235 GLU A HG3    1 
ATOM   3807 N  N      . PRO A 1 236 ? 39.864  21.602  20.870  1.00 61.98  ? 236 PRO A N      1 
ATOM   3808 C  CA     . PRO A 1 236 ? 40.345  20.235  21.037  1.00 56.35  ? 236 PRO A CA     1 
ATOM   3809 C  C      . PRO A 1 236 ? 39.218  19.210  20.903  1.00 60.87  ? 236 PRO A C      1 
ATOM   3810 O  O      . PRO A 1 236 ? 38.040  19.518  21.103  1.00 50.32  ? 236 PRO A O      1 
ATOM   3811 C  CB     . PRO A 1 236 ? 40.914  20.247  22.455  1.00 56.22  ? 236 PRO A CB     1 
ATOM   3812 C  CG     . PRO A 1 236 ? 40.082  21.259  23.167  1.00 67.12  ? 236 PRO A CG     1 
ATOM   3813 C  CD     . PRO A 1 236 ? 39.806  22.333  22.146  1.00 63.88  ? 236 PRO A CD     1 
ATOM   3814 H  HA     . PRO A 1 236 ? 41.057  20.035  20.394  1.00 67.62  ? 236 PRO A HA     1 
ATOM   3815 H  HB2    . PRO A 1 236 ? 40.813  19.370  22.858  1.00 67.46  ? 236 PRO A HB2    1 
ATOM   3816 H  HB3    . PRO A 1 236 ? 41.845  20.516  22.435  1.00 67.46  ? 236 PRO A HB3    1 
ATOM   3817 H  HG2    . PRO A 1 236 ? 39.255  20.850  23.467  1.00 80.55  ? 236 PRO A HG2    1 
ATOM   3818 H  HG3    . PRO A 1 236 ? 40.579  21.620  23.918  1.00 80.55  ? 236 PRO A HG3    1 
ATOM   3819 H  HD2    . PRO A 1 236 ? 38.923  22.710  22.281  1.00 76.66  ? 236 PRO A HD2    1 
ATOM   3820 H  HD3    . PRO A 1 236 ? 40.494  23.015  22.177  1.00 76.66  ? 236 PRO A HD3    1 
ATOM   3821 N  N      . ILE A 1 237 ? 39.598  17.994  20.538  1.00 47.98  ? 237 ILE A N      1 
ATOM   3822 C  CA     . ILE A 1 237 ? 38.701  16.860  20.604  1.00 58.45  ? 237 ILE A CA     1 
ATOM   3823 C  C      . ILE A 1 237 ? 38.422  16.550  22.062  1.00 64.49  ? 237 ILE A C      1 
ATOM   3824 O  O      . ILE A 1 237 ? 39.336  16.224  22.812  1.00 67.06  ? 237 ILE A O      1 
ATOM   3825 C  CB     . ILE A 1 237 ? 39.334  15.619  19.970  1.00 62.60  ? 237 ILE A CB     1 
ATOM   3826 C  CG1    . ILE A 1 237 ? 39.161  15.652  18.455  1.00 59.36  ? 237 ILE A CG1    1 
ATOM   3827 C  CG2    . ILE A 1 237 ? 38.705  14.362  20.543  1.00 60.64  ? 237 ILE A CG2    1 
ATOM   3828 C  CD1    . ILE A 1 237 ? 39.643  16.934  17.801  1.00 53.69  ? 237 ILE A CD1    1 
ATOM   3829 H  H      . ILE A 1 237 ? 40.383  17.801  20.244  1.00 57.58  ? 237 ILE A H      1 
ATOM   3830 H  HA     . ILE A 1 237 ? 37.858  17.064  20.148  1.00 70.14  ? 237 ILE A HA     1 
ATOM   3831 H  HB     . ILE A 1 237 ? 40.283  15.615  20.175  1.00 75.12  ? 237 ILE A HB     1 
ATOM   3832 H  HG12   . ILE A 1 237 ? 39.662  14.917  18.068  1.00 71.23  ? 237 ILE A HG12   1 
ATOM   3833 H  HG13   . ILE A 1 237 ? 38.219  15.552  18.248  1.00 71.23  ? 237 ILE A HG13   1 
ATOM   3834 H  HG21   . ILE A 1 237 ? 39.114  13.595  20.135  1.00 72.77  ? 237 ILE A HG21   1 
ATOM   3835 H  HG22   . ILE A 1 237 ? 38.851  14.345  21.492  1.00 72.77  ? 237 ILE A HG22   1 
ATOM   3836 H  HG23   . ILE A 1 237 ? 37.764  14.371  20.356  1.00 72.77  ? 237 ILE A HG23   1 
ATOM   3837 H  HD11   . ILE A 1 237 ? 39.499  16.874  16.854  1.00 64.43  ? 237 ILE A HD11   1 
ATOM   3838 H  HD12   . ILE A 1 237 ? 39.148  17.673  18.161  1.00 64.43  ? 237 ILE A HD12   1 
ATOM   3839 H  HD13   . ILE A 1 237 ? 40.579  17.045  17.984  1.00 64.43  ? 237 ILE A HD13   1 
ATOM   3840 N  N      . ARG A 1 238 ? 37.163  16.651  22.463  1.00 56.98  ? 238 ARG A N      1 
ATOM   3841 C  CA     . ARG A 1 238 ? 36.789  16.394  23.848  1.00 69.64  ? 238 ARG A CA     1 
ATOM   3842 C  C      . ARG A 1 238 ? 35.688  15.340  23.906  1.00 70.38  ? 238 ARG A C      1 
ATOM   3843 O  O      . ARG A 1 238 ? 34.803  15.300  23.048  1.00 55.53  ? 238 ARG A O      1 
ATOM   3844 C  CB     . ARG A 1 238 ? 36.337  17.697  24.536  1.00 70.01  ? 238 ARG A CB     1 
ATOM   3845 C  CG     . ARG A 1 238 ? 35.103  18.359  23.911  1.00 83.75  ? 238 ARG A CG     1 
ATOM   3846 C  CD     . ARG A 1 238 ? 34.808  19.750  24.507  1.00 91.48  ? 238 ARG A CD     1 
ATOM   3847 N  NE     . ARG A 1 238 ? 35.644  20.812  23.934  1.00 94.96  ? 238 ARG A NE     1 
ATOM   3848 C  CZ     . ARG A 1 238 ? 36.482  21.585  24.627  1.00 95.55  ? 238 ARG A CZ     1 
ATOM   3849 N  NH1    . ARG A 1 238 ? 37.188  22.513  24.000  1.00 92.47  ? 238 ARG A NH1    1 
ATOM   3850 N  NH2    . ARG A 1 238 ? 36.620  21.444  25.942  1.00 94.11  ? 238 ARG A NH2    1 
ATOM   3851 H  H      . ARG A 1 238 ? 36.504  16.868  21.954  1.00 68.38  ? 238 ARG A H      1 
ATOM   3852 H  HA     . ARG A 1 238 ? 37.568  16.048  24.332  1.00 83.57  ? 238 ARG A HA     1 
ATOM   3853 H  HB2    . ARG A 1 238 ? 36.127  17.501  25.462  1.00 84.01  ? 238 ARG A HB2    1 
ATOM   3854 H  HB3    . ARG A 1 238 ? 37.065  18.337  24.495  1.00 84.01  ? 238 ARG A HB3    1 
ATOM   3855 H  HG2    . ARG A 1 238 ? 35.250  18.465  22.958  1.00 100.50 ? 238 ARG A HG2    1 
ATOM   3856 H  HG3    . ARG A 1 238 ? 34.329  17.795  24.067  1.00 100.50 ? 238 ARG A HG3    1 
ATOM   3857 H  HD2    . ARG A 1 238 ? 33.880  19.976  24.335  1.00 109.77 ? 238 ARG A HD2    1 
ATOM   3858 H  HD3    . ARG A 1 238 ? 34.971  19.725  25.463  1.00 109.77 ? 238 ARG A HD3    1 
ATOM   3859 H  HE     . ARG A 1 238 ? 35.590  20.946  23.086  1.00 113.95 ? 238 ARG A HE     1 
ATOM   3860 H  HH11   . ARG A 1 238 ? 37.106  22.614  23.150  1.00 110.96 ? 238 ARG A HH11   1 
ATOM   3861 H  HH12   . ARG A 1 238 ? 37.728  23.015  24.443  1.00 110.96 ? 238 ARG A HH12   1 
ATOM   3862 H  HH21   . ARG A 1 238 ? 36.167  20.845  26.360  1.00 112.94 ? 238 ARG A HH21   1 
ATOM   3863 H  HH22   . ARG A 1 238 ? 37.164  21.951  26.374  1.00 112.94 ? 238 ARG A HH22   1 
ATOM   3864 N  N      . THR A 1 239 ? 35.753  14.477  24.914  1.00 72.67  ? 239 THR A N      1 
ATOM   3865 C  CA     . THR A 1 239 ? 34.726  13.463  25.106  1.00 77.38  ? 239 THR A CA     1 
ATOM   3866 C  C      . THR A 1 239 ? 33.429  14.190  25.412  1.00 72.74  ? 239 THR A C      1 
ATOM   3867 O  O      . THR A 1 239 ? 33.428  15.152  26.176  1.00 70.60  ? 239 THR A O      1 
ATOM   3868 C  CB     . THR A 1 239 ? 35.071  12.506  26.270  1.00 79.96  ? 239 THR A CB     1 
ATOM   3869 O  OG1    . THR A 1 239 ? 36.481  12.241  26.279  1.00 75.77  ? 239 THR A OG1    1 
ATOM   3870 C  CG2    . THR A 1 239 ? 34.304  11.191  26.132  1.00 78.81  ? 239 THR A CG2    1 
ATOM   3871 H  H      . THR A 1 239 ? 36.383  14.457  25.500  1.00 87.21  ? 239 THR A H      1 
ATOM   3872 H  HA     . THR A 1 239 ? 34.613  12.940  24.285  1.00 92.85  ? 239 THR A HA     1 
ATOM   3873 H  HB     . THR A 1 239 ? 34.817  12.920  27.110  1.00 95.95  ? 239 THR A HB     1 
ATOM   3874 H  HG1    . THR A 1 239 ? 36.667  11.734  26.896  1.00 90.92  ? 239 THR A HG1    1 
ATOM   3875 H  HG21   . THR A 1 239 ? 34.526  10.605  26.859  1.00 94.57  ? 239 THR A HG21   1 
ATOM   3876 H  HG22   . THR A 1 239 ? 33.359  11.360  26.143  1.00 94.57  ? 239 THR A HG22   1 
ATOM   3877 H  HG23   . THR A 1 239 ? 34.535  10.763  25.304  1.00 94.57  ? 239 THR A HG23   1 
ATOM   3878 N  N      . ARG A 1 240 ? 32.332  13.752  24.804  1.00 69.74  ? 240 ARG A N      1 
ATOM   3879 C  CA     . ARG A 1 240 ? 31.052  14.423  25.004  1.00 73.12  ? 240 ARG A CA     1 
ATOM   3880 C  C      . ARG A 1 240 ? 30.231  13.785  26.110  1.00 69.77  ? 240 ARG A C      1 
ATOM   3881 O  O      . ARG A 1 240 ? 30.223  12.571  26.285  1.00 71.12  ? 240 ARG A O      1 
ATOM   3882 C  CB     . ARG A 1 240 ? 30.250  14.454  23.706  1.00 72.47  ? 240 ARG A CB     1 
ATOM   3883 C  CG     . ARG A 1 240 ? 30.792  15.465  22.730  1.00 73.10  ? 240 ARG A CG     1 
ATOM   3884 C  CD     . ARG A 1 240 ? 29.829  15.763  21.605  1.00 70.95  ? 240 ARG A CD     1 
ATOM   3885 N  NE     . ARG A 1 240 ? 30.557  16.289  20.453  1.00 76.61  ? 240 ARG A NE     1 
ATOM   3886 C  CZ     . ARG A 1 240 ? 30.013  16.973  19.452  1.00 71.38  ? 240 ARG A CZ     1 
ATOM   3887 N  NH1    . ARG A 1 240 ? 28.708  17.236  19.443  1.00 76.36  ? 240 ARG A NH1    1 
ATOM   3888 N  NH2    . ARG A 1 240 ? 30.785  17.395  18.456  1.00 60.64  ? 240 ARG A NH2    1 
ATOM   3889 H  H      . ARG A 1 240 ? 32.301  13.075  24.275  1.00 83.69  ? 240 ARG A H      1 
ATOM   3890 H  HA     . ARG A 1 240 ? 31.226  15.351  25.264  1.00 87.74  ? 240 ARG A HA     1 
ATOM   3891 H  HB2    . ARG A 1 240 ? 30.288  13.579  23.288  1.00 86.96  ? 240 ARG A HB2    1 
ATOM   3892 H  HB3    . ARG A 1 240 ? 29.331  14.689  23.906  1.00 86.96  ? 240 ARG A HB3    1 
ATOM   3893 H  HG2    . ARG A 1 240 ? 30.970  16.294  23.200  1.00 87.71  ? 240 ARG A HG2    1 
ATOM   3894 H  HG3    . ARG A 1 240 ? 31.611  15.121  22.340  1.00 87.71  ? 240 ARG A HG3    1 
ATOM   3895 H  HD2    . ARG A 1 240 ? 29.377  14.947  21.338  1.00 85.14  ? 240 ARG A HD2    1 
ATOM   3896 H  HD3    . ARG A 1 240 ? 29.186  16.429  21.895  1.00 85.14  ? 240 ARG A HD3    1 
ATOM   3897 H  HE     . ARG A 1 240 ? 31.404  16.145  20.420  1.00 91.94  ? 240 ARG A HE     1 
ATOM   3898 H  HH11   . ARG A 1 240 ? 28.210  16.961  20.088  1.00 91.63  ? 240 ARG A HH11   1 
ATOM   3899 H  HH12   . ARG A 1 240 ? 28.363  17.680  18.792  1.00 91.63  ? 240 ARG A HH12   1 
ATOM   3900 H  HH21   . ARG A 1 240 ? 31.628  17.225  18.464  1.00 72.77  ? 240 ARG A HH21   1 
ATOM   3901 H  HH22   . ARG A 1 240 ? 30.442  17.840  17.805  1.00 72.77  ? 240 ARG A HH22   1 
ATOM   3902 N  N      . VAL A 1 241 ? 29.544  14.625  26.865  1.00 76.64  ? 241 VAL A N      1 
ATOM   3903 C  CA     . VAL A 1 241 ? 28.744  14.157  27.980  1.00 67.46  ? 241 VAL A CA     1 
ATOM   3904 C  C      . VAL A 1 241 ? 27.299  14.444  27.642  1.00 58.03  ? 241 VAL A C      1 
ATOM   3905 O  O      . VAL A 1 241 ? 26.967  15.578  27.316  1.00 59.37  ? 241 VAL A O      1 
ATOM   3906 C  CB     . VAL A 1 241 ? 29.139  14.891  29.283  1.00 76.96  ? 241 VAL A CB     1 
ATOM   3907 C  CG1    . VAL A 1 241 ? 30.597  14.620  29.616  1.00 75.16  ? 241 VAL A CG1    1 
ATOM   3908 C  CG2    . VAL A 1 241 ? 28.904  16.399  29.153  1.00 74.79  ? 241 VAL A CG2    1 
ATOM   3909 H  H      . VAL A 1 241 ? 29.524  15.477  26.751  1.00 91.97  ? 241 VAL A H      1 
ATOM   3910 H  HA     . VAL A 1 241 ? 28.863  13.192  28.103  1.00 80.95  ? 241 VAL A HA     1 
ATOM   3911 H  HB     . VAL A 1 241 ? 28.588  14.557  30.021  1.00 92.36  ? 241 VAL A HB     1 
ATOM   3912 H  HG11   . VAL A 1 241 ? 30.823  15.083  30.426  1.00 90.19  ? 241 VAL A HG11   1 
ATOM   3913 H  HG12   . VAL A 1 241 ? 30.720  13.675  29.733  1.00 90.19  ? 241 VAL A HG12   1 
ATOM   3914 H  HG13   . VAL A 1 241 ? 31.146  14.935  28.894  1.00 90.19  ? 241 VAL A HG13   1 
ATOM   3915 H  HG21   . VAL A 1 241 ? 29.157  16.827  29.974  1.00 89.75  ? 241 VAL A HG21   1 
ATOM   3916 H  HG22   . VAL A 1 241 ? 29.437  16.737  28.430  1.00 89.75  ? 241 VAL A HG22   1 
ATOM   3917 H  HG23   . VAL A 1 241 ? 27.973  16.556  28.976  1.00 89.75  ? 241 VAL A HG23   1 
ATOM   3918 N  N      . ARG A 1 242 ? 26.447  13.422  27.674  1.00 59.22  ? 242 ARG A N      1 
ATOM   3919 C  CA     . ARG A 1 242 ? 25.019  13.640  27.465  1.00 57.23  ? 242 ARG A CA     1 
ATOM   3920 C  C      . ARG A 1 242 ? 24.500  14.610  28.519  1.00 55.71  ? 242 ARG A C      1 
ATOM   3921 O  O      . ARG A 1 242 ? 24.688  14.402  29.716  1.00 61.77  ? 242 ARG A O      1 
ATOM   3922 C  CB     . ARG A 1 242 ? 24.244  12.325  27.516  1.00 65.11  ? 242 ARG A CB     1 
ATOM   3923 C  CG     . ARG A 1 242 ? 24.511  11.404  26.317  1.00 77.70  ? 242 ARG A CG     1 
ATOM   3924 C  CD     . ARG A 1 242 ? 23.981  9.989   26.558  1.00 80.41  ? 242 ARG A CD     1 
ATOM   3925 N  NE     . ARG A 1 242 ? 24.577  9.016   25.641  1.00 88.20  ? 242 ARG A NE     1 
ATOM   3926 C  CZ     . ARG A 1 242 ? 25.517  8.130   25.974  1.00 92.26  ? 242 ARG A CZ     1 
ATOM   3927 N  NH1    . ARG A 1 242 ? 25.987  8.065   27.216  1.00 83.57  ? 242 ARG A NH1    1 
ATOM   3928 N  NH2    . ARG A 1 242 ? 25.990  7.291   25.059  1.00 86.73  ? 242 ARG A NH2    1 
ATOM   3929 H  H      . ARG A 1 242 ? 26.668  12.602  27.812  1.00 71.06  ? 242 ARG A H      1 
ATOM   3930 H  HA     . ARG A 1 242 ? 24.880  14.043  26.583  1.00 68.67  ? 242 ARG A HA     1 
ATOM   3931 H  HB2    . ARG A 1 242 ? 24.495  11.845  28.321  1.00 78.13  ? 242 ARG A HB2    1 
ATOM   3932 H  HB3    . ARG A 1 242 ? 23.294  12.522  27.533  1.00 78.13  ? 242 ARG A HB3    1 
ATOM   3933 H  HG2    . ARG A 1 242 ? 24.068  11.765  25.533  1.00 93.24  ? 242 ARG A HG2    1 
ATOM   3934 H  HG3    . ARG A 1 242 ? 25.468  11.348  26.164  1.00 93.24  ? 242 ARG A HG3    1 
ATOM   3935 H  HD2    . ARG A 1 242 ? 24.195  9.719   27.465  1.00 96.49  ? 242 ARG A HD2    1 
ATOM   3936 H  HD3    . ARG A 1 242 ? 23.021  9.981   26.424  1.00 96.49  ? 242 ARG A HD3    1 
ATOM   3937 H  HE     . ARG A 1 242 ? 24.300  9.015   24.827  1.00 105.85 ? 242 ARG A HE     1 
ATOM   3938 H  HH11   . ARG A 1 242 ? 25.689  8.602   27.818  1.00 100.28 ? 242 ARG A HH11   1 
ATOM   3939 H  HH12   . ARG A 1 242 ? 26.593  7.488   27.417  1.00 100.28 ? 242 ARG A HH12   1 
ATOM   3940 H  HH21   . ARG A 1 242 ? 25.693  7.323   24.252  1.00 104.08 ? 242 ARG A HH21   1 
ATOM   3941 H  HH22   . ARG A 1 242 ? 26.595  6.718   25.272  1.00 104.08 ? 242 ARG A HH22   1 
ATOM   3942 N  N      . LYS A 1 243 ? 23.864  15.683  28.058  1.00 50.42  ? 243 LYS A N      1 
ATOM   3943 C  CA     . LYS A 1 243 ? 23.345  16.714  28.935  1.00 51.57  ? 243 LYS A CA     1 
ATOM   3944 C  C      . LYS A 1 243 ? 21.842  16.597  29.133  1.00 50.22  ? 243 LYS A C      1 
ATOM   3945 O  O      . LYS A 1 243 ? 21.312  17.089  30.123  1.00 48.37  ? 243 LYS A O      1 
ATOM   3946 C  CB     . LYS A 1 243 ? 23.698  18.094  28.388  1.00 58.20  ? 243 LYS A CB     1 
ATOM   3947 C  CG     . LYS A 1 243 ? 25.205  18.307  28.270  1.00 68.51  ? 243 LYS A CG     1 
ATOM   3948 C  CD     . LYS A 1 243 ? 25.574  19.776  28.404  1.00 82.92  ? 243 LYS A CD     1 
ATOM   3949 C  CE     . LYS A 1 243 ? 27.042  19.953  28.783  1.00 83.45  ? 243 LYS A CE     1 
ATOM   3950 N  NZ     . LYS A 1 243 ? 27.959  19.291  27.811  1.00 87.49  ? 243 LYS A NZ     1 
ATOM   3951 H  H      . LYS A 1 243 ? 23.720  15.834  27.224  1.00 60.50  ? 243 LYS A H      1 
ATOM   3952 H  HA     . LYS A 1 243 ? 23.769  16.623  29.814  1.00 61.89  ? 243 LYS A HA     1 
ATOM   3953 H  HB2    . LYS A 1 243 ? 23.310  18.194  27.504  1.00 69.84  ? 243 LYS A HB2    1 
ATOM   3954 H  HB3    . LYS A 1 243 ? 23.344  18.772  28.985  1.00 69.84  ? 243 LYS A HB3    1 
ATOM   3955 H  HG2    . LYS A 1 243 ? 25.654  17.816  28.976  1.00 82.22  ? 243 LYS A HG2    1 
ATOM   3956 H  HG3    . LYS A 1 243 ? 25.506  17.997  27.402  1.00 82.22  ? 243 LYS A HG3    1 
ATOM   3957 H  HD2    . LYS A 1 243 ? 25.423  20.223  27.556  1.00 99.51  ? 243 LYS A HD2    1 
ATOM   3958 H  HD3    . LYS A 1 243 ? 25.030  20.181  29.098  1.00 99.51  ? 243 LYS A HD3    1 
ATOM   3959 H  HE2    . LYS A 1 243 ? 27.254  20.899  28.801  1.00 100.14 ? 243 LYS A HE2    1 
ATOM   3960 H  HE3    . LYS A 1 243 ? 27.194  19.560  29.657  1.00 100.14 ? 243 LYS A HE3    1 
ATOM   3961 H  HZ1    . LYS A 1 243 ? 28.805  19.412  28.061  1.00 104.99 ? 243 LYS A HZ1    1 
ATOM   3962 H  HZ2    . LYS A 1 243 ? 27.789  18.418  27.779  1.00 104.99 ? 243 LYS A HZ2    1 
ATOM   3963 H  HZ3    . LYS A 1 243 ? 27.844  19.638  27.000  1.00 104.99 ? 243 LYS A HZ3    1 
ATOM   3964 N  N      . SER A 1 244 ? 21.138  15.959  28.204  1.00 44.61  ? 244 SER A N      1 
ATOM   3965 C  CA     . SER A 1 244 ? 19.704  15.773  28.401  1.00 44.48  ? 244 SER A CA     1 
ATOM   3966 C  C      . SER A 1 244 ? 19.195  14.517  27.719  1.00 47.78  ? 244 SER A C      1 
ATOM   3967 O  O      . SER A 1 244 ? 19.839  13.983  26.823  1.00 49.97  ? 244 SER A O      1 
ATOM   3968 C  CB     . SER A 1 244 ? 18.914  17.009  27.963  1.00 51.93  ? 244 SER A CB     1 
ATOM   3969 O  OG     . SER A 1 244 ? 18.731  17.042  26.569  1.00 55.14  ? 244 SER A OG     1 
ATOM   3970 H  H      . SER A 1 244 ? 21.454  15.634  27.473  1.00 53.53  ? 244 SER A H      1 
ATOM   3971 H  HA     . SER A 1 244 ? 19.545  15.659  29.362  1.00 53.38  ? 244 SER A HA     1 
ATOM   3972 H  HB2    . SER A 1 244 ? 18.044  16.992  28.393  1.00 62.31  ? 244 SER A HB2    1 
ATOM   3973 H  HB3    . SER A 1 244 ? 19.400  17.803  28.235  1.00 62.31  ? 244 SER A HB3    1 
ATOM   3974 H  HG     . SER A 1 244 ? 19.083  16.387  26.224  1.00 66.16  ? 244 SER A HG     1 
ATOM   3975 N  N      . ILE A 1 245 ? 18.052  14.036  28.200  1.00 41.48  ? 245 ILE A N      1 
ATOM   3976 C  CA     . ILE A 1 245 ? 17.423  12.813  27.720  1.00 41.32  ? 245 ILE A CA     1 
ATOM   3977 C  C      . ILE A 1 245 ? 15.924  13.010  27.857  1.00 40.83  ? 245 ILE A C      1 
ATOM   3978 O  O      . ILE A 1 245 ? 15.444  13.490  28.889  1.00 39.57  ? 245 ILE A O      1 
ATOM   3979 C  CB     . ILE A 1 245 ? 17.849  11.601  28.561  1.00 47.86  ? 245 ILE A CB     1 
ATOM   3980 C  CG1    . ILE A 1 245 ? 19.300  11.232  28.255  1.00 55.76  ? 245 ILE A CG1    1 
ATOM   3981 C  CG2    . ILE A 1 245 ? 16.945  10.415  28.285  1.00 50.68  ? 245 ILE A CG2    1 
ATOM   3982 C  CD1    . ILE A 1 245 ? 19.904  10.258  29.243  1.00 59.41  ? 245 ILE A CD1    1 
ATOM   3983 H  H      . ILE A 1 245 ? 17.607  14.417  28.829  1.00 49.78  ? 245 ILE A H      1 
ATOM   3984 H  HA     . ILE A 1 245 ? 17.648  12.655  26.780  1.00 49.58  ? 245 ILE A HA     1 
ATOM   3985 H  HB     . ILE A 1 245 ? 17.779  11.833  29.500  1.00 57.43  ? 245 ILE A HB     1 
ATOM   3986 H  HG12   . ILE A 1 245 ? 19.340  10.826  27.376  1.00 66.91  ? 245 ILE A HG12   1 
ATOM   3987 H  HG13   . ILE A 1 245 ? 19.837  12.040  28.269  1.00 66.91  ? 245 ILE A HG13   1 
ATOM   3988 H  HG21   . ILE A 1 245 ? 17.232  9.672   28.821  1.00 60.82  ? 245 ILE A HG21   1 
ATOM   3989 H  HG22   . ILE A 1 245 ? 16.042  10.653  28.509  1.00 60.82  ? 245 ILE A HG22   1 
ATOM   3990 H  HG23   . ILE A 1 245 ? 17.003  10.189  27.354  1.00 60.82  ? 245 ILE A HG23   1 
ATOM   3991 H  HD11   . ILE A 1 245 ? 20.811  10.076  28.987  1.00 71.29  ? 245 ILE A HD11   1 
ATOM   3992 H  HD12   . ILE A 1 245 ? 19.884  10.649  30.120  1.00 71.29  ? 245 ILE A HD12   1 
ATOM   3993 H  HD13   . ILE A 1 245 ? 19.392  9.446   29.235  1.00 71.29  ? 245 ILE A HD13   1 
ATOM   3994 N  N      . GLY A 1 246 ? 15.177  12.652  26.825  1.00 38.23  ? 246 GLY A N      1 
ATOM   3995 C  CA     . GLY A 1 246 ? 13.769  12.975  26.787  1.00 37.03  ? 246 GLY A CA     1 
ATOM   3996 C  C      . GLY A 1 246 ? 13.014  12.191  25.741  1.00 40.20  ? 246 GLY A C      1 
ATOM   3997 O  O      . GLY A 1 246 ? 13.537  11.245  25.148  1.00 44.19  ? 246 GLY A O      1 
ATOM   3998 H  H      . GLY A 1 246 ? 15.463  12.223  26.137  1.00 45.88  ? 246 GLY A H      1 
ATOM   3999 H  HA2    . GLY A 1 246 ? 13.373  12.789  27.653  1.00 44.43  ? 246 GLY A HA2    1 
ATOM   4000 H  HA3    . GLY A 1 246 ? 13.660  13.920  26.598  1.00 44.43  ? 246 GLY A HA3    1 
ATOM   4001 N  N      . ARG A 1 247 ? 11.771  12.586  25.531  1.00 38.77  ? 247 ARG A N      1 
ATOM   4002 C  CA     . ARG A 1 247 ? 10.874  11.917  24.592  1.00 38.97  ? 247 ARG A CA     1 
ATOM   4003 C  C      . ARG A 1 247 ? 9.725   12.868  24.378  1.00 43.07  ? 247 ARG A C      1 
ATOM   4004 O  O      . ARG A 1 247 ? 9.201   13.443  25.337  1.00 39.91  ? 247 ARG A O      1 
ATOM   4005 C  CB     . ARG A 1 247 ? 10.340  10.603  25.166  1.00 39.28  ? 247 ARG A CB     1 
ATOM   4006 C  CG     . ARG A 1 247 ? 9.252   9.932   24.329  1.00 44.73  ? 247 ARG A CG     1 
ATOM   4007 C  CD     . ARG A 1 247 ? 9.850   9.188   23.118  1.00 52.19  ? 247 ARG A CD     1 
ATOM   4008 N  NE     . ARG A 1 247 ? 8.844   8.418   22.380  1.00 56.86  ? 247 ARG A NE     1 
ATOM   4009 C  CZ     . ARG A 1 247 ? 8.820   8.259   21.056  1.00 66.95  ? 247 ARG A CZ     1 
ATOM   4010 N  NH1    . ARG A 1 247 ? 9.756   8.813   20.281  1.00 60.69  ? 247 ARG A NH1    1 
ATOM   4011 N  NH2    . ARG A 1 247 ? 7.850   7.535   20.500  1.00 60.35  ? 247 ARG A NH2    1 
ATOM   4012 H  H      . ARG A 1 247 ? 11.409  13.257  25.929  1.00 46.52  ? 247 ARG A H      1 
ATOM   4013 H  HA     . ARG A 1 247 ? 11.327  11.747  23.740  1.00 46.77  ? 247 ARG A HA     1 
ATOM   4014 H  HB2    . ARG A 1 247 ? 11.077  9.978   25.244  1.00 47.14  ? 247 ARG A HB2    1 
ATOM   4015 H  HB3    . ARG A 1 247 ? 9.968   10.779  26.044  1.00 47.14  ? 247 ARG A HB3    1 
ATOM   4016 H  HG2    . ARG A 1 247 ? 8.778   9.288   24.878  1.00 53.67  ? 247 ARG A HG2    1 
ATOM   4017 H  HG3    . ARG A 1 247 ? 8.639   10.607  23.999  1.00 53.67  ? 247 ARG A HG3    1 
ATOM   4018 H  HD2    . ARG A 1 247 ? 10.240  9.835   22.510  1.00 62.63  ? 247 ARG A HD2    1 
ATOM   4019 H  HD3    . ARG A 1 247 ? 10.531  8.571   23.430  1.00 62.63  ? 247 ARG A HD3    1 
ATOM   4020 H  HE     . ARG A 1 247 ? 8.220   8.040   22.836  1.00 68.23  ? 247 ARG A HE     1 
ATOM   4021 H  HH11   . ARG A 1 247 ? 10.384  9.282   20.634  1.00 72.83  ? 247 ARG A HH11   1 
ATOM   4022 H  HH12   . ARG A 1 247 ? 9.729   8.702   19.429  1.00 72.83  ? 247 ARG A HH12   1 
ATOM   4023 H  HH21   . ARG A 1 247 ? 7.246   7.175   20.995  1.00 72.42  ? 247 ARG A HH21   1 
ATOM   4024 H  HH22   . ARG A 1 247 ? 7.829   7.427   19.647  1.00 72.42  ? 247 ARG A HH22   1 
ATOM   4025 N  N      . ILE A 1 248 ? 9.372   13.066  23.116  1.00 37.74  ? 248 ILE A N      1 
ATOM   4026 C  CA     . ILE A 1 248 ? 8.261   13.918  22.726  1.00 48.86  ? 248 ILE A CA     1 
ATOM   4027 C  C      . ILE A 1 248 ? 7.461   13.108  21.714  1.00 43.63  ? 248 ILE A C      1 
ATOM   4028 O  O      . ILE A 1 248 ? 8.026   12.558  20.772  1.00 54.05  ? 248 ILE A O      1 
ATOM   4029 C  CB     . ILE A 1 248 ? 8.754   15.239  22.101  1.00 48.20  ? 248 ILE A CB     1 
ATOM   4030 C  CG1    . ILE A 1 248 ? 9.463   16.108  23.139  1.00 54.39  ? 248 ILE A CG1    1 
ATOM   4031 C  CG2    . ILE A 1 248 ? 7.600   16.052  21.545  1.00 46.95  ? 248 ILE A CG2    1 
ATOM   4032 C  CD1    . ILE A 1 248 ? 10.842  15.645  23.489  1.00 66.93  ? 248 ILE A CD1    1 
ATOM   4033 H  H      . ILE A 1 248 ? 9.774   12.705  22.448  1.00 45.28  ? 248 ILE A H      1 
ATOM   4034 H  HA     . ILE A 1 248 ? 7.695   14.117  23.502  1.00 58.63  ? 248 ILE A HA     1 
ATOM   4035 H  HB     . ILE A 1 248 ? 9.374   15.036  21.382  1.00 57.84  ? 248 ILE A HB     1 
ATOM   4036 H  HG12   . ILE A 1 248 ? 9.534   17.011  22.793  1.00 65.26  ? 248 ILE A HG12   1 
ATOM   4037 H  HG13   . ILE A 1 248 ? 8.937   16.110  23.954  1.00 65.26  ? 248 ILE A HG13   1 
ATOM   4038 H  HG21   . ILE A 1 248 ? 7.944   16.863  21.165  1.00 56.34  ? 248 ILE A HG21   1 
ATOM   4039 H  HG22   . ILE A 1 248 ? 7.153   15.537  20.868  1.00 56.34  ? 248 ILE A HG22   1 
ATOM   4040 H  HG23   . ILE A 1 248 ? 6.990   16.256  22.257  1.00 56.34  ? 248 ILE A HG23   1 
ATOM   4041 H  HD11   . ILE A 1 248 ? 11.214  16.241  24.143  1.00 80.31  ? 248 ILE A HD11   1 
ATOM   4042 H  HD12   . ILE A 1 248 ? 10.791  14.756  23.847  1.00 80.31  ? 248 ILE A HD12   1 
ATOM   4043 H  HD13   . ILE A 1 248 ? 11.383  15.649  22.696  1.00 80.31  ? 248 ILE A HD13   1 
ATOM   4044 N  N      . VAL A 1 249 ? 6.162   12.982  21.940  1.00 43.51  ? 249 VAL A N      1 
ATOM   4045 C  CA     . VAL A 1 249 ? 5.310   12.177  21.079  1.00 50.88  ? 249 VAL A CA     1 
ATOM   4046 C  C      . VAL A 1 249 ? 4.254   13.062  20.450  1.00 56.11  ? 249 VAL A C      1 
ATOM   4047 O  O      . VAL A 1 249 ? 3.984   14.164  20.929  1.00 55.36  ? 249 VAL A O      1 
ATOM   4048 C  CB     . VAL A 1 249 ? 4.597   11.029  21.853  1.00 55.74  ? 249 VAL A CB     1 
ATOM   4049 C  CG1    . VAL A 1 249 ? 5.606   10.156  22.577  1.00 55.42  ? 249 VAL A CG1    1 
ATOM   4050 C  CG2    . VAL A 1 249 ? 3.576   11.582  22.843  1.00 51.74  ? 249 VAL A CG2    1 
ATOM   4051 H  H      . VAL A 1 249 ? 5.746   13.356  22.593  1.00 52.21  ? 249 VAL A H      1 
ATOM   4052 H  HA     . VAL A 1 249 ? 5.850   11.781  20.364  1.00 61.05  ? 249 VAL A HA     1 
ATOM   4053 H  HB     . VAL A 1 249 ? 4.118   10.465  21.211  1.00 66.89  ? 249 VAL A HB     1 
ATOM   4054 H  HG11   . VAL A 1 249 ? 5.138   9.460   23.044  1.00 66.50  ? 249 VAL A HG11   1 
ATOM   4055 H  HG12   . VAL A 1 249 ? 6.207   9.774   21.934  1.00 66.50  ? 249 VAL A HG12   1 
ATOM   4056 H  HG13   . VAL A 1 249 ? 6.095   10.697  23.202  1.00 66.50  ? 249 VAL A HG13   1 
ATOM   4057 H  HG21   . VAL A 1 249 ? 3.157   10.850  23.301  1.00 62.09  ? 249 VAL A HG21   1 
ATOM   4058 H  HG22   . VAL A 1 249 ? 4.027   12.148  23.474  1.00 62.09  ? 249 VAL A HG22   1 
ATOM   4059 H  HG23   . VAL A 1 249 ? 2.917   12.088  22.362  1.00 62.09  ? 249 VAL A HG23   1 
ATOM   4060 N  N      . THR A 1 250 ? 3.659   12.569  19.372  1.00 53.38  ? 250 THR A N      1 
ATOM   4061 C  CA     . THR A 1 250 ? 2.616   13.296  18.672  1.00 55.19  ? 250 THR A CA     1 
ATOM   4062 C  C      . THR A 1 250 ? 1.255   12.821  19.137  1.00 58.51  ? 250 THR A C      1 
ATOM   4063 O  O      . THR A 1 250 ? 1.017   11.628  19.241  1.00 57.00  ? 250 THR A O      1 
ATOM   4064 C  CB     . THR A 1 250 ? 2.711   13.055  17.168  1.00 62.91  ? 250 THR A CB     1 
ATOM   4065 O  OG1    . THR A 1 250 ? 3.822   13.793  16.649  1.00 55.11  ? 250 THR A OG1    1 
ATOM   4066 C  CG2    . THR A 1 250 ? 1.430   13.502  16.467  1.00 55.91  ? 250 THR A CG2    1 
ATOM   4067 H  H      . THR A 1 250 ? 3.846   11.806  19.023  1.00 64.06  ? 250 THR A H      1 
ATOM   4068 H  HA     . THR A 1 250 ? 2.698   14.256  18.849  1.00 66.23  ? 250 THR A HA     1 
ATOM   4069 H  HB     . THR A 1 250 ? 2.843   12.109  16.998  1.00 75.49  ? 250 THR A HB     1 
ATOM   4070 H  HG1    . THR A 1 250 ? 4.515   13.547  17.010  1.00 66.13  ? 250 THR A HG1    1 
ATOM   4071 H  HG21   . THR A 1 250 ? 1.501   13.346  15.522  1.00 67.10  ? 250 THR A HG21   1 
ATOM   4072 H  HG22   . THR A 1 250 ? 0.680   13.009  16.808  1.00 67.10  ? 250 THR A HG22   1 
ATOM   4073 H  HG23   . THR A 1 250 ? 1.283   14.438  16.618  1.00 67.10  ? 250 THR A HG23   1 
ATOM   4074 N  N      . MET A 1 251 ? 0.359   13.758  19.409  1.00 57.37  ? 251 MET A N      1 
ATOM   4075 C  CA     . MET A 1 251 ? -0.988  13.407  19.822  1.00 65.02  ? 251 MET A CA     1 
ATOM   4076 C  C      . MET A 1 251 ? -1.861  13.143  18.598  1.00 62.94  ? 251 MET A C      1 
ATOM   4077 O  O      . MET A 1 251 ? -1.586  13.638  17.505  1.00 56.89  ? 251 MET A O      1 
ATOM   4078 C  CB     . MET A 1 251 ? -1.579  14.526  20.679  1.00 59.69  ? 251 MET A CB     1 
ATOM   4079 C  CG     . MET A 1 251 ? -0.844  14.724  21.999  1.00 61.51  ? 251 MET A CG     1 
ATOM   4080 S  SD     . MET A 1 251 ? -1.500  16.089  22.989  1.00 62.75  ? 251 MET A SD     1 
ATOM   4081 C  CE     . MET A 1 251 ? -3.266  15.811  22.811  1.00 85.46  ? 251 MET A CE     1 
ATOM   4082 H  H      . MET A 1 251 ? 0.506   14.604  19.361  1.00 68.84  ? 251 MET A H      1 
ATOM   4083 H  HA     . MET A 1 251 ? -0.952  12.594  20.369  1.00 78.03  ? 251 MET A HA     1 
ATOM   4084 H  HB2    . MET A 1 251 ? -1.532  15.358  20.183  1.00 71.63  ? 251 MET A HB2    1 
ATOM   4085 H  HB3    . MET A 1 251 ? -2.503  14.313  20.881  1.00 71.63  ? 251 MET A HB3    1 
ATOM   4086 H  HG2    . MET A 1 251 ? -0.919  13.912  22.524  1.00 73.82  ? 251 MET A HG2    1 
ATOM   4087 H  HG3    . MET A 1 251 ? 0.089   14.912  21.813  1.00 73.82  ? 251 MET A HG3    1 
ATOM   4088 H  HE1    . MET A 1 251 ? -3.739  16.486  23.303  1.00 102.55 ? 251 MET A HE1    1 
ATOM   4089 H  HE2    . MET A 1 251 ? -3.497  15.860  21.881  1.00 102.55 ? 251 MET A HE2    1 
ATOM   4090 H  HE3    . MET A 1 251 ? -3.481  14.942  23.157  1.00 102.55 ? 251 MET A HE3    1 
ATOM   4091 N  N      . LYS A 1 252 ? -2.913  12.361  18.791  1.00 66.92  ? 252 LYS A N      1 
ATOM   4092 C  CA     . LYS A 1 252 ? -3.787  11.967  17.691  1.00 78.56  ? 252 LYS A CA     1 
ATOM   4093 C  C      . LYS A 1 252 ? -4.487  13.179  17.089  1.00 76.56  ? 252 LYS A C      1 
ATOM   4094 O  O      . LYS A 1 252 ? -4.896  13.150  15.924  1.00 71.02  ? 252 LYS A O      1 
ATOM   4095 C  CB     . LYS A 1 252 ? -4.830  10.953  18.167  1.00 72.04  ? 252 LYS A CB     1 
ATOM   4096 C  CG     . LYS A 1 252 ? -5.190  9.920   17.120  1.00 87.81  ? 252 LYS A CG     1 
ATOM   4097 C  CD     . LYS A 1 252 ? -4.276  8.708   17.198  1.00 94.44  ? 252 LYS A CD     1 
ATOM   4098 C  CE     . LYS A 1 252 ? -4.284  7.917   15.894  1.00 97.37  ? 252 LYS A CE     1 
ATOM   4099 N  NZ     . LYS A 1 252 ? -5.623  7.879   15.238  1.00 101.32 ? 252 LYS A NZ     1 
ATOM   4100 H  H      . LYS A 1 252 ? -3.146  12.041  19.554  1.00 80.30  ? 252 LYS A H      1 
ATOM   4101 H  HA     . LYS A 1 252 ? -3.249  11.545  16.988  1.00 94.27  ? 252 LYS A HA     1 
ATOM   4102 H  HB2    . LYS A 1 252 ? -4.480  10.483  18.940  1.00 86.44  ? 252 LYS A HB2    1 
ATOM   4103 H  HB3    . LYS A 1 252 ? -5.641  11.427  18.408  1.00 86.44  ? 252 LYS A HB3    1 
ATOM   4104 H  HG2    . LYS A 1 252 ? -6.102  9.623   17.263  1.00 105.38 ? 252 LYS A HG2    1 
ATOM   4105 H  HG3    . LYS A 1 252 ? -5.099  10.313  16.238  1.00 105.38 ? 252 LYS A HG3    1 
ATOM   4106 H  HD2    . LYS A 1 252 ? -3.368  9.002   17.369  1.00 113.33 ? 252 LYS A HD2    1 
ATOM   4107 H  HD3    . LYS A 1 252 ? -4.580  8.123   17.910  1.00 113.33 ? 252 LYS A HD3    1 
ATOM   4108 H  HE2    . LYS A 1 252 ? -3.659  8.325   15.275  1.00 116.85 ? 252 LYS A HE2    1 
ATOM   4109 H  HE3    . LYS A 1 252 ? -4.016  7.003   16.079  1.00 116.85 ? 252 LYS A HE3    1 
ATOM   4110 H  HZ1    . LYS A 1 252 ? -6.217  7.500   15.782  1.00 121.58 ? 252 LYS A HZ1    1 
ATOM   4111 H  HZ2    . LYS A 1 252 ? -5.891  8.706   15.048  1.00 121.58 ? 252 LYS A HZ2    1 
ATOM   4112 H  HZ3    . LYS A 1 252 ? -5.579  7.408   14.484  1.00 121.58 ? 252 LYS A HZ3    1 
ATOM   4113 N  N      . ARG A 1 253 ? -4.618  14.239  17.887  1.00 71.54  ? 253 ARG A N      1 
ATOM   4114 C  CA     . ARG A 1 253 ? -5.252  15.476  17.438  1.00 65.10  ? 253 ARG A CA     1 
ATOM   4115 C  C      . ARG A 1 253 ? -4.883  16.627  18.367  1.00 70.81  ? 253 ARG A C      1 
ATOM   4116 O  O      . ARG A 1 253 ? -4.836  16.449  19.587  1.00 76.09  ? 253 ARG A O      1 
ATOM   4117 C  CB     . ARG A 1 253 ? -6.773  15.309  17.409  1.00 72.79  ? 253 ARG A CB     1 
ATOM   4118 C  CG     . ARG A 1 253 ? -7.409  15.122  18.789  1.00 81.81  ? 253 ARG A CG     1 
ATOM   4119 C  CD     . ARG A 1 253 ? -8.929  14.972  18.696  1.00 82.33  ? 253 ARG A CD     1 
ATOM   4120 N  NE     . ARG A 1 253 ? -9.582  15.160  19.990  1.00 89.80  ? 253 ARG A NE     1 
ATOM   4121 C  CZ     . ARG A 1 253 ? -10.898 15.112  20.181  1.00 96.99  ? 253 ARG A CZ     1 
ATOM   4122 N  NH1    . ARG A 1 253 ? -11.714 14.882  19.159  1.00 83.98  ? 253 ARG A NH1    1 
ATOM   4123 N  NH2    . ARG A 1 253 ? -11.400 15.296  21.394  1.00 91.30  ? 253 ARG A NH2    1 
ATOM   4124 H  H      . ARG A 1 253 ? -4.343  14.266  18.701  1.00 85.85  ? 253 ARG A H      1 
ATOM   4125 H  HA     . ARG A 1 253 ? -4.944  15.694  16.534  1.00 78.12  ? 253 ARG A HA     1 
ATOM   4126 H  HB2    . ARG A 1 253 ? -7.165  16.101  17.008  1.00 87.35  ? 253 ARG A HB2    1 
ATOM   4127 H  HB3    . ARG A 1 253 ? -6.990  14.529  16.875  1.00 87.35  ? 253 ARG A HB3    1 
ATOM   4128 H  HG2    . ARG A 1 253 ? -7.050  14.320  19.200  1.00 98.17  ? 253 ARG A HG2    1 
ATOM   4129 H  HG3    . ARG A 1 253 ? -7.214  15.897  19.339  1.00 98.17  ? 253 ARG A HG3    1 
ATOM   4130 H  HD2    . ARG A 1 253 ? -9.277  15.638  18.083  1.00 98.80  ? 253 ARG A HD2    1 
ATOM   4131 H  HD3    . ARG A 1 253 ? -9.142  14.081  18.378  1.00 98.80  ? 253 ARG A HD3    1 
ATOM   4132 H  HE     . ARG A 1 253 ? -9.083  15.312  20.674  1.00 107.76 ? 253 ARG A HE     1 
ATOM   4133 H  HH11   . ARG A 1 253 ? -11.392 14.762  18.371  1.00 100.78 ? 253 ARG A HH11   1 
ATOM   4134 H  HH12   . ARG A 1 253 ? -12.564 14.851  19.286  1.00 100.78 ? 253 ARG A HH12   1 
ATOM   4135 H  HH21   . ARG A 1 253 ? -10.875 15.445  22.059  1.00 109.56 ? 253 ARG A HH21   1 
ATOM   4136 H  HH22   . ARG A 1 253 ? -12.251 15.265  21.517  1.00 109.56 ? 253 ARG A HH22   1 
ATOM   4137 N  N      . ASN A 1 254 ? -4.618  17.802  17.800  1.00 68.12  ? 254 ASN A N      1 
ATOM   4138 C  CA     . ASN A 1 254 ? -4.327  18.975  18.613  1.00 68.01  ? 254 ASN A CA     1 
ATOM   4139 C  C      . ASN A 1 254 ? -5.330  19.053  19.758  1.00 72.88  ? 254 ASN A C      1 
ATOM   4140 O  O      . ASN A 1 254 ? -6.455  18.573  19.636  1.00 75.61  ? 254 ASN A O      1 
ATOM   4141 C  CB     . ASN A 1 254 ? -4.391  20.266  17.789  1.00 64.68  ? 254 ASN A CB     1 
ATOM   4142 C  CG     . ASN A 1 254 ? -3.327  20.335  16.700  1.00 74.92  ? 254 ASN A CG     1 
ATOM   4143 O  OD1    . ASN A 1 254 ? -2.353  19.584  16.710  1.00 71.99  ? 254 ASN A OD1    1 
ATOM   4144 N  ND2    . ASN A 1 254 ? -3.507  21.259  15.762  1.00 74.27  ? 254 ASN A ND2    1 
ATOM   4145 H  H      . ASN A 1 254 ? -4.600  17.944  16.952  1.00 81.74  ? 254 ASN A H      1 
ATOM   4146 H  HA     . ASN A 1 254 ? -3.427  18.894  18.993  1.00 81.62  ? 254 ASN A HA     1 
ATOM   4147 H  HB2    . ASN A 1 254 ? -5.260  20.324  17.362  1.00 77.62  ? 254 ASN A HB2    1 
ATOM   4148 H  HB3    . ASN A 1 254 ? -4.263  21.024  18.381  1.00 77.62  ? 254 ASN A HB3    1 
ATOM   4149 H  HD21   . ASN A 1 254 ? -2.936  21.341  15.125  1.00 89.12  ? 254 ASN A HD21   1 
ATOM   4150 H  HD22   . ASN A 1 254 ? -4.194  21.776  15.794  1.00 89.12  ? 254 ASN A HD22   1 
ATOM   4151 N  N      . SER A 1 255 ? -4.918  19.650  20.869  1.00 68.78  ? 255 SER A N      1 
ATOM   4152 C  CA     . SER A 1 255 ? -5.781  19.784  22.035  1.00 73.72  ? 255 SER A CA     1 
ATOM   4153 C  C      . SER A 1 255 ? -5.148  20.701  23.064  1.00 68.04  ? 255 SER A C      1 
ATOM   4154 O  O      . SER A 1 255 ? -3.926  20.855  23.096  1.00 62.48  ? 255 SER A O      1 
ATOM   4155 C  CB     . SER A 1 255 ? -6.028  18.410  22.669  1.00 75.81  ? 255 SER A CB     1 
ATOM   4156 O  OG     . SER A 1 255 ? -6.504  18.521  24.005  1.00 67.45  ? 255 SER A OG     1 
ATOM   4157 H  H      . SER A 1 255 ? -4.135  19.990  20.974  1.00 82.54  ? 255 SER A H      1 
ATOM   4158 H  HA     . SER A 1 255 ? -6.643  20.164  21.765  1.00 88.47  ? 255 SER A HA     1 
ATOM   4159 H  HB2    . SER A 1 255 ? -6.689  17.937  22.140  1.00 90.97  ? 255 SER A HB2    1 
ATOM   4160 H  HB3    . SER A 1 255 ? -5.195  17.914  22.674  1.00 90.97  ? 255 SER A HB3    1 
ATOM   4161 H  HG     . SER A 1 255 ? -6.628  17.774  24.321  1.00 80.94  ? 255 SER A HG     1 
ATOM   4162 N  N      . ARG A 1 256 ? -5.982  21.320  23.894  1.00 71.22  ? 256 ARG A N      1 
ATOM   4163 C  CA     . ARG A 1 256 ? -5.493  21.934  25.125  1.00 71.22  ? 256 ARG A CA     1 
ATOM   4164 C  C      . ARG A 1 256 ? -6.300  21.485  26.354  1.00 61.50  ? 256 ARG A C      1 
ATOM   4165 O  O      . ARG A 1 256 ? -6.312  22.160  27.375  1.00 63.37  ? 256 ARG A O      1 
ATOM   4166 C  CB     . ARG A 1 256 ? -5.398  23.468  25.025  1.00 70.96  ? 256 ARG A CB     1 
ATOM   4167 C  CG     . ARG A 1 256 ? -6.306  24.146  24.014  1.00 71.60  ? 256 ARG A CG     1 
ATOM   4168 C  CD     . ARG A 1 256 ? -5.899  25.617  23.793  1.00 75.74  ? 256 ARG A CD     1 
ATOM   4169 N  NE     . ARG A 1 256 ? -5.718  26.382  25.036  1.00 67.80  ? 256 ARG A NE     1 
ATOM   4170 C  CZ     . ARG A 1 256 ? -4.541  26.804  25.501  1.00 75.74  ? 256 ARG A CZ     1 
ATOM   4171 N  NH1    . ARG A 1 256 ? -3.423  26.535  24.838  1.00 73.96  ? 256 ARG A NH1    1 
ATOM   4172 N  NH2    . ARG A 1 256 ? -4.468  27.497  26.636  1.00 62.37  ? 256 ARG A NH2    1 
ATOM   4173 H  H      . ARG A 1 256 ? -6.829  21.399  23.769  1.00 85.46  ? 256 ARG A H      1 
ATOM   4174 H  HA     . ARG A 1 256 ? -4.579  21.612  25.266  1.00 85.47  ? 256 ARG A HA     1 
ATOM   4175 H  HB2    . ARG A 1 256 ? -5.610  23.841  25.895  1.00 85.15  ? 256 ARG A HB2    1 
ATOM   4176 H  HB3    . ARG A 1 256 ? -4.486  23.700  24.792  1.00 85.15  ? 256 ARG A HB3    1 
ATOM   4177 H  HG2    . ARG A 1 256 ? -6.242  23.681  23.165  1.00 85.92  ? 256 ARG A HG2    1 
ATOM   4178 H  HG3    . ARG A 1 256 ? -7.219  24.128  24.340  1.00 85.92  ? 256 ARG A HG3    1 
ATOM   4179 H  HD2    . ARG A 1 256 ? -5.060  25.639  23.307  1.00 90.89  ? 256 ARG A HD2    1 
ATOM   4180 H  HD3    . ARG A 1 256 ? -6.591  26.057  23.273  1.00 90.89  ? 256 ARG A HD3    1 
ATOM   4181 H  HE     . ARG A 1 256 ? -6.421  26.570  25.495  1.00 81.36  ? 256 ARG A HE     1 
ATOM   4182 H  HH11   . ARG A 1 256 ? -3.456  26.090  24.103  1.00 88.75  ? 256 ARG A HH11   1 
ATOM   4183 H  HH12   . ARG A 1 256 ? -2.667  26.808  25.142  1.00 88.75  ? 256 ARG A HH12   1 
ATOM   4184 H  HH21   . ARG A 1 256 ? -5.184  27.676  27.077  1.00 74.85  ? 256 ARG A HH21   1 
ATOM   4185 H  HH22   . ARG A 1 256 ? -3.704  27.762  26.929  1.00 74.85  ? 256 ARG A HH22   1 
ATOM   4186 N  N      . ASN A 1 257 ? -6.938  20.321  26.255  1.00 72.25  ? 257 ASN A N      1 
ATOM   4187 C  CA     . ASN A 1 257 ? -7.566  19.671  27.409  1.00 68.32  ? 257 ASN A CA     1 
ATOM   4188 C  C      . ASN A 1 257 ? -6.527  18.912  28.236  1.00 62.71  ? 257 ASN A C      1 
ATOM   4189 O  O      . ASN A 1 257 ? -5.846  18.031  27.725  1.00 65.35  ? 257 ASN A O      1 
ATOM   4190 C  CB     . ASN A 1 257 ? -8.648  18.700  26.929  1.00 70.10  ? 257 ASN A CB     1 
ATOM   4191 C  CG     . ASN A 1 257 ? -9.470  18.111  28.073  1.00 79.75  ? 257 ASN A CG     1 
ATOM   4192 O  OD1    . ASN A 1 257 ? -9.080  17.120  28.692  1.00 71.64  ? 257 ASN A OD1    1 
ATOM   4193 N  ND2    . ASN A 1 257 ? -10.626 18.713  28.342  1.00 86.51  ? 257 ASN A ND2    1 
ATOM   4194 H  H      . ASN A 1 257 ? -7.024  19.881  25.521  1.00 86.70  ? 257 ASN A H      1 
ATOM   4195 H  HA     . ASN A 1 257 ? -7.985  20.348  27.980  1.00 81.99  ? 257 ASN A HA     1 
ATOM   4196 H  HB2    . ASN A 1 257 ? -9.255  19.171  26.337  1.00 84.12  ? 257 ASN A HB2    1 
ATOM   4197 H  HB3    . ASN A 1 257 ? -8.226  17.966  26.456  1.00 84.12  ? 257 ASN A HB3    1 
ATOM   4198 H  HD21   . ASN A 1 257 ? -11.126 18.420  28.978  1.00 103.81 ? 257 ASN A HD21   1 
ATOM   4199 H  HD22   . ASN A 1 257 ? -10.873 19.396  27.881  1.00 103.81 ? 257 ASN A HD22   1 
ATOM   4200 N  N      . LEU A 1 258 ? -6.407  19.233  29.515  1.00 58.49  ? 258 LEU A N      1 
ATOM   4201 C  CA     . LEU A 1 258 ? -5.387  18.605  30.344  1.00 61.78  ? 258 LEU A CA     1 
ATOM   4202 C  C      . LEU A 1 258 ? -5.554  17.085  30.416  1.00 70.39  ? 258 LEU A C      1 
ATOM   4203 O  O      . LEU A 1 258 ? -4.573  16.343  30.318  1.00 59.64  ? 258 LEU A O      1 
ATOM   4204 C  CB     . LEU A 1 258 ? -5.390  19.190  31.757  1.00 65.34  ? 258 LEU A CB     1 
ATOM   4205 C  CG     . LEU A 1 258 ? -4.229  18.681  32.622  1.00 71.22  ? 258 LEU A CG     1 
ATOM   4206 C  CD1    . LEU A 1 258 ? -2.890  19.070  31.998  1.00 72.16  ? 258 LEU A CD1    1 
ATOM   4207 C  CD2    . LEU A 1 258 ? -4.318  19.201  34.039  1.00 66.28  ? 258 LEU A CD2    1 
ATOM   4208 H  H      . LEU A 1 258 ? -6.899  19.806  29.926  1.00 70.19  ? 258 LEU A H      1 
ATOM   4209 H  HA     . LEU A 1 258 ? -4.509  18.788  29.949  1.00 74.14  ? 258 LEU A HA     1 
ATOM   4210 H  HB2    . LEU A 1 258 ? -5.319  20.155  31.699  1.00 78.41  ? 258 LEU A HB2    1 
ATOM   4211 H  HB3    . LEU A 1 258 ? -6.220  18.945  32.197  1.00 78.41  ? 258 LEU A HB3    1 
ATOM   4212 H  HG     . LEU A 1 258 ? -4.268  17.713  32.659  1.00 85.47  ? 258 LEU A HG     1 
ATOM   4213 H  HD11   . LEU A 1 258 ? -2.180  18.743  32.554  1.00 86.59  ? 258 LEU A HD11   1 
ATOM   4214 H  HD12   . LEU A 1 258 ? -2.829  18.680  31.123  1.00 86.59  ? 258 LEU A HD12   1 
ATOM   4215 H  HD13   . LEU A 1 258 ? -2.842  20.027  31.934  1.00 86.59  ? 258 LEU A HD13   1 
ATOM   4216 H  HD21   . LEU A 1 258 ? -3.576  18.860  34.544  1.00 79.53  ? 258 LEU A HD21   1 
ATOM   4217 H  HD22   . LEU A 1 258 ? -4.291  20.160  34.022  1.00 79.53  ? 258 LEU A HD22   1 
ATOM   4218 H  HD23   . LEU A 1 258 ? -5.144  18.903  34.429  1.00 79.53  ? 258 LEU A HD23   1 
ATOM   4219 N  N      . GLU A 1 259 ? -6.787  16.615  30.585  1.00 67.46  ? 259 GLU A N      1 
ATOM   4220 C  CA     . GLU A 1 259 ? -7.015  15.182  30.753  1.00 68.74  ? 259 GLU A CA     1 
ATOM   4221 C  C      . GLU A 1 259 ? -6.765  14.409  29.462  1.00 66.09  ? 259 GLU A C      1 
ATOM   4222 O  O      . GLU A 1 259 ? -6.506  13.207  29.497  1.00 65.04  ? 259 GLU A O      1 
ATOM   4223 C  CB     . GLU A 1 259 ? -8.428  14.905  31.275  1.00 71.94  ? 259 GLU A CB     1 
ATOM   4224 C  CG     . GLU A 1 259 ? -8.613  15.240  32.749  1.00 72.35  ? 259 GLU A CG     1 
ATOM   4225 C  CD     . GLU A 1 259 ? -7.617  14.516  33.655  1.00 75.68  ? 259 GLU A CD     1 
ATOM   4226 O  OE1    . GLU A 1 259 ? -7.530  13.269  33.593  1.00 73.60  ? 259 GLU A OE1    1 
ATOM   4227 O  OE2    . GLU A 1 259 ? -6.916  15.198  34.434  1.00 72.64  ? 259 GLU A OE2    1 
ATOM   4228 H  H      . GLU A 1 259 ? -7.499  17.097  30.606  1.00 80.95  ? 259 GLU A H      1 
ATOM   4229 H  HA     . GLU A 1 259 ? -6.384  14.846  31.422  1.00 82.49  ? 259 GLU A HA     1 
ATOM   4230 H  HB2    . GLU A 1 259 ? -9.059  15.438  30.768  1.00 86.33  ? 259 GLU A HB2    1 
ATOM   4231 H  HB3    . GLU A 1 259 ? -8.624  13.962  31.159  1.00 86.33  ? 259 GLU A HB3    1 
ATOM   4232 H  HG2    . GLU A 1 259 ? -8.492  16.195  32.873  1.00 86.82  ? 259 GLU A HG2    1 
ATOM   4233 H  HG3    . GLU A 1 259 ? -9.508  14.982  33.021  1.00 86.82  ? 259 GLU A HG3    1 
ATOM   4234 N  N      . GLU A 1 260 ? -6.837  15.095  28.326  1.00 68.79  ? 260 GLU A N      1 
ATOM   4235 C  CA     . GLU A 1 260 ? -6.566  14.448  27.046  1.00 72.48  ? 260 GLU A CA     1 
ATOM   4236 C  C      . GLU A 1 260 ? -5.052  14.384  26.796  1.00 69.98  ? 260 GLU A C      1 
ATOM   4237 O  O      . GLU A 1 260 ? -4.532  13.381  26.312  1.00 66.48  ? 260 GLU A O      1 
ATOM   4238 C  CB     . GLU A 1 260 ? -7.263  15.190  25.904  1.00 69.79  ? 260 GLU A CB     1 
ATOM   4239 C  CG     . GLU A 1 260 ? -7.890  14.259  24.875  1.00 82.47  ? 260 GLU A CG     1 
ATOM   4240 C  CD     . GLU A 1 260 ? -8.065  14.911  23.511  1.00 82.18  ? 260 GLU A CD     1 
ATOM   4241 O  OE1    . GLU A 1 260 ? -8.414  16.111  23.454  1.00 77.08  ? 260 GLU A OE1    1 
ATOM   4242 O  OE2    . GLU A 1 260 ? -7.844  14.219  22.493  1.00 82.21  ? 260 GLU A OE2    1 
ATOM   4243 H  H      . GLU A 1 260 ? -7.038  15.929  28.268  1.00 82.54  ? 260 GLU A H      1 
ATOM   4244 H  HA     . GLU A 1 260 ? -6.910  13.531  27.070  1.00 86.98  ? 260 GLU A HA     1 
ATOM   4245 H  HB2    . GLU A 1 260 ? -7.968  15.744  26.274  1.00 83.74  ? 260 GLU A HB2    1 
ATOM   4246 H  HB3    . GLU A 1 260 ? -6.612  15.745  25.447  1.00 83.74  ? 260 GLU A HB3    1 
ATOM   4247 H  HG2    . GLU A 1 260 ? -7.321  13.482  24.765  1.00 98.96  ? 260 GLU A HG2    1 
ATOM   4248 H  HG3    . GLU A 1 260 ? -8.766  13.986  25.190  1.00 98.96  ? 260 GLU A HG3    1 
ATOM   4249 N  N      . ILE A 1 261 ? -4.351  15.456  27.142  1.00 58.95  ? 261 ILE A N      1 
ATOM   4250 C  CA     . ILE A 1 261 ? -2.908  15.520  26.954  1.00 66.84  ? 261 ILE A CA     1 
ATOM   4251 C  C      . ILE A 1 261 ? -2.192  14.557  27.906  1.00 61.10  ? 261 ILE A C      1 
ATOM   4252 O  O      . ILE A 1 261 ? -1.214  13.918  27.534  1.00 54.34  ? 261 ILE A O      1 
ATOM   4253 C  CB     . ILE A 1 261 ? -2.398  16.964  27.165  1.00 63.96  ? 261 ILE A CB     1 
ATOM   4254 C  CG1    . ILE A 1 261 ? -2.872  17.853  26.010  1.00 58.24  ? 261 ILE A CG1    1 
ATOM   4255 C  CG2    . ILE A 1 261 ? -0.881  16.993  27.258  1.00 60.76  ? 261 ILE A CG2    1 
ATOM   4256 C  CD1    . ILE A 1 261 ? -3.065  19.304  26.390  1.00 59.10  ? 261 ILE A CD1    1 
ATOM   4257 H  H      . ILE A 1 261 ? -4.690  16.165  27.490  1.00 70.74  ? 261 ILE A H      1 
ATOM   4258 H  HA     . ILE A 1 261 ? -2.694  15.254  26.035  1.00 80.21  ? 261 ILE A HA     1 
ATOM   4259 H  HB     . ILE A 1 261 ? -2.768  17.307  27.993  1.00 76.75  ? 261 ILE A HB     1 
ATOM   4260 H  HG12   . ILE A 1 261 ? -2.213  17.818  25.299  1.00 69.89  ? 261 ILE A HG12   1 
ATOM   4261 H  HG13   . ILE A 1 261 ? -3.722  17.517  25.685  1.00 69.89  ? 261 ILE A HG13   1 
ATOM   4262 H  HG21   . ILE A 1 261 ? -0.594  17.900  27.389  1.00 72.91  ? 261 ILE A HG21   1 
ATOM   4263 H  HG22   . ILE A 1 261 ? -0.604  16.451  28.001  1.00 72.91  ? 261 ILE A HG22   1 
ATOM   4264 H  HG23   . ILE A 1 261 ? -0.511  16.646  26.443  1.00 72.91  ? 261 ILE A HG23   1 
ATOM   4265 H  HD11   . ILE A 1 261 ? -3.360  19.792  25.618  1.00 70.92  ? 261 ILE A HD11   1 
ATOM   4266 H  HD12   . ILE A 1 261 ? -3.724  19.359  27.085  1.00 70.92  ? 261 ILE A HD12   1 
ATOM   4267 H  HD13   . ILE A 1 261 ? -2.229  19.658  26.702  1.00 70.92  ? 261 ILE A HD13   1 
ATOM   4268 N  N      . LYS A 1 262 ? -2.720  14.425  29.117  1.00 60.00  ? 262 LYS A N      1 
ATOM   4269 C  CA     . LYS A 1 262 ? -2.046  13.700  30.194  1.00 61.11  ? 262 LYS A CA     1 
ATOM   4270 C  C      . LYS A 1 262 ? -1.523  12.306  29.840  1.00 53.05  ? 262 LYS A C      1 
ATOM   4271 O  O      . LYS A 1 262 ? -0.407  11.962  30.228  1.00 53.49  ? 262 LYS A O      1 
ATOM   4272 C  CB     . LYS A 1 262 ? -2.960  13.604  31.418  1.00 64.21  ? 262 LYS A CB     1 
ATOM   4273 C  CG     . LYS A 1 262 ? -2.857  14.802  32.330  1.00 62.17  ? 262 LYS A CG     1 
ATOM   4274 C  CD     . LYS A 1 262 ? -3.947  14.792  33.379  1.00 66.56  ? 262 LYS A CD     1 
ATOM   4275 C  CE     . LYS A 1 262 ? -3.434  14.280  34.706  1.00 67.17  ? 262 LYS A CE     1 
ATOM   4276 N  NZ     . LYS A 1 262 ? -4.436  14.483  35.785  1.00 72.84  ? 262 LYS A NZ     1 
ATOM   4277 H  H      . LYS A 1 262 ? -3.481  14.753  29.346  1.00 72.00  ? 262 LYS A H      1 
ATOM   4278 H  HA     . LYS A 1 262 ? -1.268  14.230  30.465  1.00 73.33  ? 262 LYS A HA     1 
ATOM   4279 H  HB2    . LYS A 1 262 ? -3.880  13.534  31.119  1.00 77.06  ? 262 LYS A HB2    1 
ATOM   4280 H  HB3    . LYS A 1 262 ? -2.717  12.817  31.930  1.00 77.06  ? 262 LYS A HB3    1 
ATOM   4281 H  HG2    . LYS A 1 262 ? -1.999  14.788  32.782  1.00 74.61  ? 262 LYS A HG2    1 
ATOM   4282 H  HG3    . LYS A 1 262 ? -2.947  15.613  31.805  1.00 74.61  ? 262 LYS A HG3    1 
ATOM   4283 H  HD2    . LYS A 1 262 ? -4.275  15.695  33.509  1.00 79.88  ? 262 LYS A HD2    1 
ATOM   4284 H  HD3    . LYS A 1 262 ? -4.667  14.211  33.087  1.00 79.88  ? 262 LYS A HD3    1 
ATOM   4285 H  HE2    . LYS A 1 262 ? -3.250  13.330  34.634  1.00 80.60  ? 262 LYS A HE2    1 
ATOM   4286 H  HE3    . LYS A 1 262 ? -2.626  14.762  34.945  1.00 80.60  ? 262 LYS A HE3    1 
ATOM   4287 H  HZ1    . LYS A 1 262 ? -4.619  15.349  35.871  1.00 87.41  ? 262 LYS A HZ1    1 
ATOM   4288 H  HZ2    . LYS A 1 262 ? -5.187  14.047  35.588  1.00 87.41  ? 262 LYS A HZ2    1 
ATOM   4289 H  HZ3    . LYS A 1 262 ? -4.118  14.176  36.557  1.00 87.41  ? 262 LYS A HZ3    1 
ATOM   4290 N  N      . PRO A 1 263 ? -2.323  11.491  29.129  1.00 51.39  ? 263 PRO A N      1 
ATOM   4291 C  CA     . PRO A 1 263 ? -1.842  10.139  28.791  1.00 59.52  ? 263 PRO A CA     1 
ATOM   4292 C  C      . PRO A 1 263 ? -0.600  10.128  27.889  1.00 53.58  ? 263 PRO A C      1 
ATOM   4293 O  O      . PRO A 1 263 ? 0.217   9.207   27.984  1.00 52.27  ? 263 PRO A O      1 
ATOM   4294 C  CB     . PRO A 1 263 ? -3.044  9.500   28.075  1.00 61.21  ? 263 PRO A CB     1 
ATOM   4295 C  CG     . PRO A 1 263 ? -4.232  10.264  28.575  1.00 64.08  ? 263 PRO A CG     1 
ATOM   4296 C  CD     . PRO A 1 263 ? -3.741  11.675  28.780  1.00 61.36  ? 263 PRO A CD     1 
ATOM   4297 H  HA     . PRO A 1 263 ? -1.650  9.635   29.610  1.00 71.42  ? 263 PRO A HA     1 
ATOM   4298 H  HB2    . PRO A 1 263 ? -2.947  9.604   27.116  1.00 73.46  ? 263 PRO A HB2    1 
ATOM   4299 H  HB3    . PRO A 1 263 ? -3.110  8.563   28.317  1.00 73.46  ? 263 PRO A HB3    1 
ATOM   4300 H  HG2    . PRO A 1 263 ? -4.939  10.240  27.911  1.00 76.90  ? 263 PRO A HG2    1 
ATOM   4301 H  HG3    . PRO A 1 263 ? -4.536  9.882   29.414  1.00 76.90  ? 263 PRO A HG3    1 
ATOM   4302 H  HD2    . PRO A 1 263 ? -3.825  12.185  27.959  1.00 73.63  ? 263 PRO A HD2    1 
ATOM   4303 H  HD3    . PRO A 1 263 ? -4.218  12.097  29.512  1.00 73.63  ? 263 PRO A HD3    1 
ATOM   4304 N  N      . TYR A 1 264 ? -0.452  11.130  27.029  1.00 50.72  ? 264 TYR A N      1 
ATOM   4305 C  CA     . TYR A 1 264 ? 0.732   11.216  26.180  1.00 47.06  ? 264 TYR A CA     1 
ATOM   4306 C  C      . TYR A 1 264 ? 1.919   11.678  27.014  1.00 48.41  ? 264 TYR A C      1 
ATOM   4307 O  O      . TYR A 1 264 ? 3.046   11.229  26.818  1.00 41.09  ? 264 TYR A O      1 
ATOM   4308 C  CB     . TYR A 1 264 ? 0.515   12.194  25.021  1.00 50.66  ? 264 TYR A CB     1 
ATOM   4309 C  CG     . TYR A 1 264 ? -0.569  11.806  24.033  1.00 58.54  ? 264 TYR A CG     1 
ATOM   4310 C  CD1    . TYR A 1 264 ? -0.297  10.945  22.968  1.00 56.88  ? 264 TYR A CD1    1 
ATOM   4311 C  CD2    . TYR A 1 264 ? -1.856  12.325  24.146  1.00 55.92  ? 264 TYR A CD2    1 
ATOM   4312 C  CE1    . TYR A 1 264 ? -1.284  10.601  22.051  1.00 59.38  ? 264 TYR A CE1    1 
ATOM   4313 C  CE2    . TYR A 1 264 ? -2.846  11.992  23.239  1.00 58.49  ? 264 TYR A CE2    1 
ATOM   4314 C  CZ     . TYR A 1 264 ? -2.560  11.132  22.192  1.00 63.92  ? 264 TYR A CZ     1 
ATOM   4315 O  OH     . TYR A 1 264 ? -3.557  10.811  21.290  1.00 58.53  ? 264 TYR A OH     1 
ATOM   4316 H  H      . TYR A 1 264 ? -1.017  11.769  26.917  1.00 60.87  ? 264 TYR A H      1 
ATOM   4317 H  HA     . TYR A 1 264 ? 0.936   10.332  25.809  1.00 56.47  ? 264 TYR A HA     1 
ATOM   4318 H  HB2    . TYR A 1 264 ? 0.276   13.059  25.391  1.00 60.79  ? 264 TYR A HB2    1 
ATOM   4319 H  HB3    . TYR A 1 264 ? 1.346   12.273  24.526  1.00 60.79  ? 264 TYR A HB3    1 
ATOM   4320 H  HD1    . TYR A 1 264 ? 0.558   10.592  22.873  1.00 68.26  ? 264 TYR A HD1    1 
ATOM   4321 H  HD2    . TYR A 1 264 ? -2.055  12.905  24.845  1.00 67.11  ? 264 TYR A HD2    1 
ATOM   4322 H  HE1    . TYR A 1 264 ? -1.091  10.024  21.348  1.00 71.25  ? 264 TYR A HE1    1 
ATOM   4323 H  HE2    . TYR A 1 264 ? -3.701  12.345  23.331  1.00 70.19  ? 264 TYR A HE2    1 
ATOM   4324 H  HH     . TYR A 1 264 ? -3.831  11.490  20.922  1.00 70.24  ? 264 TYR A HH     1 
ATOM   4325 N  N      . LEU A 1 265 ? 1.664   12.584  27.952  1.00 42.06  ? 265 LEU A N      1 
ATOM   4326 C  CA     . LEU A 1 265 ? 2.737   13.122  28.773  1.00 45.76  ? 265 LEU A CA     1 
ATOM   4327 C  C      . LEU A 1 265 ? 3.329   12.006  29.636  1.00 52.46  ? 265 LEU A C      1 
ATOM   4328 O  O      . LEU A 1 265 ? 4.556   11.880  29.751  1.00 41.83  ? 265 LEU A O      1 
ATOM   4329 C  CB     . LEU A 1 265 ? 2.210   14.289  29.612  1.00 44.77  ? 265 LEU A CB     1 
ATOM   4330 C  CG     . LEU A 1 265 ? 3.142   14.987  30.605  1.00 55.38  ? 265 LEU A CG     1 
ATOM   4331 C  CD1    . LEU A 1 265 ? 4.266   15.706  29.910  1.00 42.73  ? 265 LEU A CD1    1 
ATOM   4332 C  CD2    . LEU A 1 265 ? 2.350   15.963  31.475  1.00 52.85  ? 265 LEU A CD2    1 
ATOM   4333 H  H      . LEU A 1 265 ? 0.884   12.900  28.131  1.00 50.47  ? 265 LEU A H      1 
ATOM   4334 H  HA     . LEU A 1 265 ? 3.446   13.463  28.189  1.00 54.91  ? 265 LEU A HA     1 
ATOM   4335 H  HB2    . LEU A 1 265 ? 1.898   14.972  28.998  1.00 53.72  ? 265 LEU A HB2    1 
ATOM   4336 H  HB3    . LEU A 1 265 ? 1.454   13.962  30.125  1.00 53.72  ? 265 LEU A HB3    1 
ATOM   4337 H  HG     . LEU A 1 265 ? 3.534   14.319  31.189  1.00 66.45  ? 265 LEU A HG     1 
ATOM   4338 H  HD11   . LEU A 1 265 ? 4.823   16.127  30.569  1.00 51.28  ? 265 LEU A HD11   1 
ATOM   4339 H  HD12   . LEU A 1 265 ? 4.779   15.071  29.405  1.00 51.28  ? 265 LEU A HD12   1 
ATOM   4340 H  HD13   . LEU A 1 265 ? 3.896   16.369  29.322  1.00 51.28  ? 265 LEU A HD13   1 
ATOM   4341 H  HD21   . LEU A 1 265 ? 2.950   16.391  32.091  1.00 63.42  ? 265 LEU A HD21   1 
ATOM   4342 H  HD22   . LEU A 1 265 ? 1.937   16.620  30.910  1.00 63.42  ? 265 LEU A HD22   1 
ATOM   4343 H  HD23   . LEU A 1 265 ? 1.677   15.476  31.958  1.00 63.42  ? 265 LEU A HD23   1 
ATOM   4344 N  N      . PHE A 1 266 ? 2.458   11.166  30.202  1.00 41.65  ? 266 PHE A N      1 
ATOM   4345 C  CA     . PHE A 1 266 ? 2.896   10.110  31.101  1.00 43.95  ? 266 PHE A CA     1 
ATOM   4346 C  C      . PHE A 1 266 ? 3.590   9.012   30.319  1.00 47.23  ? 266 PHE A C      1 
ATOM   4347 O  O      . PHE A 1 266 ? 4.510   8.375   30.817  1.00 46.07  ? 266 PHE A O      1 
ATOM   4348 C  CB     . PHE A 1 266 ? 1.708   9.518   31.868  1.00 53.61  ? 266 PHE A CB     1 
ATOM   4349 C  CG     . PHE A 1 266 ? 1.045   10.485  32.817  1.00 52.59  ? 266 PHE A CG     1 
ATOM   4350 C  CD1    . PHE A 1 266 ? 1.754   11.554  33.356  1.00 53.95  ? 266 PHE A CD1    1 
ATOM   4351 C  CD2    . PHE A 1 266 ? -0.285  10.313  33.181  1.00 55.07  ? 266 PHE A CD2    1 
ATOM   4352 C  CE1    . PHE A 1 266 ? 1.145   12.445  34.238  1.00 58.16  ? 266 PHE A CE1    1 
ATOM   4353 C  CE2    . PHE A 1 266 ? -0.902  11.194  34.062  1.00 59.39  ? 266 PHE A CE2    1 
ATOM   4354 C  CZ     . PHE A 1 266 ? -0.185  12.261  34.594  1.00 59.59  ? 266 PHE A CZ     1 
ATOM   4355 H  H      . PHE A 1 266 ? 1.608   11.191  30.079  1.00 49.99  ? 266 PHE A H      1 
ATOM   4356 H  HA     . PHE A 1 266 ? 3.532   10.478  31.750  1.00 52.74  ? 266 PHE A HA     1 
ATOM   4357 H  HB2    . PHE A 1 266 ? 1.039   9.226   31.229  1.00 64.33  ? 266 PHE A HB2    1 
ATOM   4358 H  HB3    . PHE A 1 266 ? 2.019   8.760   32.388  1.00 64.33  ? 266 PHE A HB3    1 
ATOM   4359 H  HD1    . PHE A 1 266 ? 2.645   11.678  33.121  1.00 64.74  ? 266 PHE A HD1    1 
ATOM   4360 H  HD2    . PHE A 1 266 ? -0.768  9.600   32.831  1.00 66.08  ? 266 PHE A HD2    1 
ATOM   4361 H  HE1    . PHE A 1 266 ? 1.628   13.157  34.590  1.00 69.79  ? 266 PHE A HE1    1 
ATOM   4362 H  HE2    . PHE A 1 266 ? -1.794  11.070  34.297  1.00 71.27  ? 266 PHE A HE2    1 
ATOM   4363 H  HZ     . PHE A 1 266 ? -0.597  12.853  35.180  1.00 71.50  ? 266 PHE A HZ     1 
ATOM   4364 N  N      . ARG A 1 267 ? 3.153   8.770   29.094  1.00 37.46  ? 267 ARG A N      1 
ATOM   4365 C  CA     . ARG A 1 267 ? 3.874   7.816   28.263  1.00 49.89  ? 267 ARG A CA     1 
ATOM   4366 C  C      . ARG A 1 267 ? 5.268   8.366   27.942  1.00 46.10  ? 267 ARG A C      1 
ATOM   4367 O  O      . ARG A 1 267 ? 6.236   7.623   27.907  1.00 46.67  ? 267 ARG A O      1 
ATOM   4368 C  CB     . ARG A 1 267 ? 3.104   7.495   26.981  1.00 57.06  ? 267 ARG A CB     1 
ATOM   4369 C  CG     . ARG A 1 267 ? 3.883   6.621   26.006  1.00 66.49  ? 267 ARG A CG     1 
ATOM   4370 C  CD     . ARG A 1 267 ? 2.958   5.783   25.122  1.00 76.93  ? 267 ARG A CD     1 
ATOM   4371 N  NE     . ARG A 1 267 ? 2.117   6.597   24.247  1.00 82.88  ? 267 ARG A NE     1 
ATOM   4372 C  CZ     . ARG A 1 267 ? 2.515   7.110   23.085  1.00 84.97  ? 267 ARG A CZ     1 
ATOM   4373 N  NH1    . ARG A 1 267 ? 3.759   6.907   22.652  1.00 80.19  ? 267 ARG A NH1    1 
ATOM   4374 N  NH2    . ARG A 1 267 ? 1.668   7.832   22.355  1.00 67.61  ? 267 ARG A NH2    1 
ATOM   4375 H  H      . ARG A 1 267 ? 2.464   9.130   28.727  1.00 44.96  ? 267 ARG A H      1 
ATOM   4376 H  HA     . ARG A 1 267 ? 3.987   6.981   28.764  1.00 59.87  ? 267 ARG A HA     1 
ATOM   4377 H  HB2    . ARG A 1 267 ? 2.288   7.026   27.214  1.00 68.47  ? 267 ARG A HB2    1 
ATOM   4378 H  HB3    . ARG A 1 267 ? 2.888   8.326   26.529  1.00 68.47  ? 267 ARG A HB3    1 
ATOM   4379 H  HG2    . ARG A 1 267 ? 4.420   7.188   25.430  1.00 79.79  ? 267 ARG A HG2    1 
ATOM   4380 H  HG3    . ARG A 1 267 ? 4.453   6.017   26.506  1.00 79.79  ? 267 ARG A HG3    1 
ATOM   4381 H  HD2    . ARG A 1 267 ? 3.498   5.202   24.563  1.00 92.32  ? 267 ARG A HD2    1 
ATOM   4382 H  HD3    . ARG A 1 267 ? 2.377   5.252   25.688  1.00 92.32  ? 267 ARG A HD3    1 
ATOM   4383 H  HE     . ARG A 1 267 ? 1.310   6.754   24.500  1.00 99.46  ? 267 ARG A HE     1 
ATOM   4384 H  HH11   . ARG A 1 267 ? 4.306   6.438   23.122  1.00 96.23  ? 267 ARG A HH11   1 
ATOM   4385 H  HH12   . ARG A 1 267 ? 4.013   7.241   21.902  1.00 96.23  ? 267 ARG A HH12   1 
ATOM   4386 H  HH21   . ARG A 1 267 ? 0.866   7.967   22.634  1.00 81.13  ? 267 ARG A HH21   1 
ATOM   4387 H  HH22   . ARG A 1 267 ? 1.924   8.169   21.606  1.00 81.13  ? 267 ARG A HH22   1 
ATOM   4388 N  N      . ALA A 1 268 ? 5.374   9.672   27.736  1.00 43.95  ? 268 ALA A N      1 
ATOM   4389 C  CA     . ALA A 1 268 ? 6.669   10.272  27.437  1.00 41.94  ? 268 ALA A CA     1 
ATOM   4390 C  C      . ALA A 1 268 ? 7.584   10.150  28.649  1.00 39.20  ? 268 ALA A C      1 
ATOM   4391 O  O      . ALA A 1 268 ? 8.785   9.926   28.517  1.00 38.82  ? 268 ALA A O      1 
ATOM   4392 C  CB     . ALA A 1 268 ? 6.509   11.714  27.044  1.00 35.04  ? 268 ALA A CB     1 
ATOM   4393 H  H      . ALA A 1 268 ? 4.720   10.229  27.764  1.00 52.74  ? 268 ALA A H      1 
ATOM   4394 H  HA     . ALA A 1 268 ? 7.083   9.793   26.689  1.00 50.33  ? 268 ALA A HA     1 
ATOM   4395 H  HB1    . ALA A 1 268 ? 7.375   12.083  26.853  1.00 42.05  ? 268 ALA A HB1    1 
ATOM   4396 H  HB2    . ALA A 1 268 ? 5.952   11.764  26.264  1.00 42.05  ? 268 ALA A HB2    1 
ATOM   4397 H  HB3    . ALA A 1 268 ? 6.102   12.192  27.770  1.00 42.05  ? 268 ALA A HB3    1 
ATOM   4398 N  N      . ILE A 1 269 ? 7.015   10.297  29.837  1.00 35.47  ? 269 ILE A N      1 
ATOM   4399 C  CA     . ILE A 1 269 ? 7.782   10.136  31.061  1.00 33.61  ? 269 ILE A CA     1 
ATOM   4400 C  C      . ILE A 1 269 ? 8.263   8.697   31.216  1.00 42.34  ? 269 ILE A C      1 
ATOM   4401 O  O      . ILE A 1 269 ? 9.440   8.455   31.530  1.00 39.31  ? 269 ILE A O      1 
ATOM   4402 C  CB     . ILE A 1 269 ? 6.948   10.530  32.299  1.00 39.92  ? 269 ILE A CB     1 
ATOM   4403 C  CG1    . ILE A 1 269 ? 6.752   12.047  32.339  1.00 44.26  ? 269 ILE A CG1    1 
ATOM   4404 C  CG2    . ILE A 1 269 ? 7.622   10.013  33.579  1.00 41.12  ? 269 ILE A CG2    1 
ATOM   4405 C  CD1    . ILE A 1 269 ? 5.820   12.531  33.488  1.00 44.14  ? 269 ILE A CD1    1 
ATOM   4406 H  H      . ILE A 1 269 ? 6.186   10.490  29.961  1.00 42.56  ? 269 ILE A H      1 
ATOM   4407 H  HA     . ILE A 1 269 ? 8.569   10.718  31.026  1.00 40.33  ? 269 ILE A HA     1 
ATOM   4408 H  HB     . ILE A 1 269 ? 6.076   10.113  32.224  1.00 47.90  ? 269 ILE A HB     1 
ATOM   4409 H  HG12   . ILE A 1 269 ? 7.617   12.470  32.460  1.00 53.11  ? 269 ILE A HG12   1 
ATOM   4410 H  HG13   . ILE A 1 269 ? 6.361   12.334  31.499  1.00 53.11  ? 269 ILE A HG13   1 
ATOM   4411 H  HG21   . ILE A 1 269 ? 7.090   10.267  34.336  1.00 49.34  ? 269 ILE A HG21   1 
ATOM   4412 H  HG22   . ILE A 1 269 ? 7.689   9.056   33.531  1.00 49.34  ? 269 ILE A HG22   1 
ATOM   4413 H  HG23   . ILE A 1 269 ? 8.498   10.400  33.648  1.00 49.34  ? 269 ILE A HG23   1 
ATOM   4414 H  HD11   . ILE A 1 269 ? 5.746   13.487  33.449  1.00 52.96  ? 269 ILE A HD11   1 
ATOM   4415 H  HD12   . ILE A 1 269 ? 4.954   12.131  33.378  1.00 52.96  ? 269 ILE A HD12   1 
ATOM   4416 H  HD13   . ILE A 1 269 ? 6.198   12.266  34.330  1.00 52.96  ? 269 ILE A HD13   1 
ATOM   4417 N  N      . GLU A 1 270 ? 7.357   7.742   31.005  1.00 41.94  ? 270 GLU A N      1 
ATOM   4418 C  CA     . GLU A 1 270 ? 7.711   6.323   31.113  1.00 47.60  ? 270 GLU A CA     1 
ATOM   4419 C  C      . GLU A 1 270 ? 8.860   5.997   30.168  1.00 55.48  ? 270 GLU A C      1 
ATOM   4420 O  O      . GLU A 1 270 ? 9.896   5.467   30.583  1.00 49.07  ? 270 GLU A O      1 
ATOM   4421 C  CB     . GLU A 1 270 ? 6.509   5.422   30.804  1.00 52.25  ? 270 GLU A CB     1 
ATOM   4422 C  CG     . GLU A 1 270 ? 5.382   5.501   31.846  1.00 55.81  ? 270 GLU A CG     1 
ATOM   4423 C  CD     . GLU A 1 270 ? 5.822   5.039   33.232  1.00 67.02  ? 270 GLU A CD     1 
ATOM   4424 O  OE1    . GLU A 1 270 ? 6.627   4.090   33.326  1.00 66.51  ? 270 GLU A OE1    1 
ATOM   4425 O  OE2    . GLU A 1 270 ? 5.365   5.628   34.234  1.00 71.82  ? 270 GLU A OE2    1 
ATOM   4426 H  H      . GLU A 1 270 ? 6.535   7.887   30.798  1.00 50.33  ? 270 GLU A H      1 
ATOM   4427 H  HA     . GLU A 1 270 ? 8.005   6.134   32.029  1.00 57.12  ? 270 GLU A HA     1 
ATOM   4428 H  HB2    . GLU A 1 270 ? 6.137   5.682   29.946  1.00 62.70  ? 270 GLU A HB2    1 
ATOM   4429 H  HB3    . GLU A 1 270 ? 6.811   4.501   30.764  1.00 62.70  ? 270 GLU A HB3    1 
ATOM   4430 H  HG2    . GLU A 1 270 ? 5.083   6.421   31.918  1.00 66.97  ? 270 GLU A HG2    1 
ATOM   4431 H  HG3    . GLU A 1 270 ? 4.648   4.935   31.561  1.00 66.97  ? 270 GLU A HG3    1 
ATOM   4432 N  N      . GLU A 1 271 ? 8.694   6.323   28.890  1.00 47.38  ? 271 GLU A N      1 
ATOM   4433 C  CA     . GLU A 1 271 ? 9.747   6.032   27.925  1.00 45.86  ? 271 GLU A CA     1 
ATOM   4434 C  C      . GLU A 1 271 ? 11.029  6.787   28.279  1.00 45.38  ? 271 GLU A C      1 
ATOM   4435 O  O      . GLU A 1 271 ? 12.131  6.289   28.046  1.00 50.96  ? 271 GLU A O      1 
ATOM   4436 C  CB     . GLU A 1 271 ? 9.270   6.344   26.501  1.00 46.15  ? 271 GLU A CB     1 
ATOM   4437 C  CG     . GLU A 1 271 ? 8.198   5.353   26.035  1.00 63.87  ? 271 GLU A CG     1 
ATOM   4438 C  CD     . GLU A 1 271 ? 7.576   5.696   24.687  1.00 73.13  ? 271 GLU A CD     1 
ATOM   4439 O  OE1    . GLU A 1 271 ? 8.270   6.305   23.846  1.00 69.07  ? 271 GLU A OE1    1 
ATOM   4440 O  OE2    . GLU A 1 271 ? 6.391   5.349   24.472  1.00 73.79  ? 271 GLU A OE2    1 
ATOM   4441 H  H      . GLU A 1 271 ? 7.997   6.706   28.563  1.00 56.86  ? 271 GLU A H      1 
ATOM   4442 H  HA     . GLU A 1 271 ? 9.949   5.073   27.964  1.00 55.03  ? 271 GLU A HA     1 
ATOM   4443 H  HB2    . GLU A 1 271 ? 8.890   7.236   26.479  1.00 55.38  ? 271 GLU A HB2    1 
ATOM   4444 H  HB3    . GLU A 1 271 ? 10.023  6.285   25.891  1.00 55.38  ? 271 GLU A HB3    1 
ATOM   4445 H  HG2    . GLU A 1 271 ? 8.598   4.472   25.960  1.00 76.65  ? 271 GLU A HG2    1 
ATOM   4446 H  HG3    . GLU A 1 271 ? 7.485   5.333   26.693  1.00 76.65  ? 271 GLU A HG3    1 
ATOM   4447 N  N      . SER A 1 272 ? 10.897  7.976   28.863  1.00 40.95  ? 272 SER A N      1 
ATOM   4448 C  CA     . SER A 1 272 ? 12.084  8.741   29.250  1.00 43.28  ? 272 SER A CA     1 
ATOM   4449 C  C      . SER A 1 272 ? 12.872  8.085   30.389  1.00 47.19  ? 272 SER A C      1 
ATOM   4450 O  O      . SER A 1 272 ? 14.107  8.086   30.370  1.00 40.62  ? 272 SER A O      1 
ATOM   4451 C  CB     . SER A 1 272 ? 11.714  10.175  29.625  1.00 45.58  ? 272 SER A CB     1 
ATOM   4452 O  OG     . SER A 1 272 ? 11.376  10.901  28.465  1.00 43.62  ? 272 SER A OG     1 
ATOM   4453 H  H      . SER A 1 272 ? 10.147  8.357   29.045  1.00 49.14  ? 272 SER A H      1 
ATOM   4454 H  HA     . SER A 1 272 ? 12.682  8.790   28.474  1.00 51.93  ? 272 SER A HA     1 
ATOM   4455 H  HB2    . SER A 1 272 ? 10.952  10.161  30.226  1.00 54.69  ? 272 SER A HB2    1 
ATOM   4456 H  HB3    . SER A 1 272 ? 12.472  10.598  30.057  1.00 54.69  ? 272 SER A HB3    1 
ATOM   4457 H  HG     . SER A 1 272 ? 11.441  10.420  27.804  1.00 52.34  ? 272 SER A HG     1 
ATOM   4458 N  N      . TYR A 1 273 ? 12.183  7.528   31.383  1.00 43.27  ? 273 TYR A N      1 
ATOM   4459 C  CA     . TYR A 1 273 ? 12.901  6.835   32.451  1.00 47.19  ? 273 TYR A CA     1 
ATOM   4460 C  C      . TYR A 1 273 ? 13.579  5.569   31.957  1.00 50.57  ? 273 TYR A C      1 
ATOM   4461 O  O      . TYR A 1 273 ? 14.660  5.215   32.422  1.00 50.71  ? 273 TYR A O      1 
ATOM   4462 C  CB     . TYR A 1 273 ? 11.998  6.545   33.643  1.00 56.99  ? 273 TYR A CB     1 
ATOM   4463 C  CG     . TYR A 1 273 ? 12.039  7.690   34.611  1.00 57.20  ? 273 TYR A CG     1 
ATOM   4464 C  CD1    . TYR A 1 273 ? 12.873  7.664   35.722  1.00 55.09  ? 273 TYR A CD1    1 
ATOM   4465 C  CD2    . TYR A 1 273 ? 11.286  8.819   34.384  1.00 47.01  ? 273 TYR A CD2    1 
ATOM   4466 C  CE1    . TYR A 1 273 ? 12.923  8.734   36.596  1.00 55.20  ? 273 TYR A CE1    1 
ATOM   4467 C  CE2    . TYR A 1 273 ? 11.332  9.892   35.245  1.00 57.85  ? 273 TYR A CE2    1 
ATOM   4468 C  CZ     . TYR A 1 273 ? 12.149  9.847   36.345  1.00 51.98  ? 273 TYR A CZ     1 
ATOM   4469 O  OH     . TYR A 1 273 ? 12.169  10.930  37.185  1.00 55.25  ? 273 TYR A OH     1 
ATOM   4470 H  H      . TYR A 1 273 ? 11.326  7.535   31.462  1.00 51.93  ? 273 TYR A H      1 
ATOM   4471 H  HA     . TYR A 1 273 ? 13.611  7.430   32.770  1.00 56.63  ? 273 TYR A HA     1 
ATOM   4472 H  HB2    . TYR A 1 273 ? 11.085  6.432   33.338  1.00 68.39  ? 273 TYR A HB2    1 
ATOM   4473 H  HB3    . TYR A 1 273 ? 12.307  5.746   34.097  1.00 68.39  ? 273 TYR A HB3    1 
ATOM   4474 H  HD1    . TYR A 1 273 ? 13.396  6.912   35.887  1.00 66.11  ? 273 TYR A HD1    1 
ATOM   4475 H  HD2    . TYR A 1 273 ? 10.732  8.856   33.638  1.00 56.41  ? 273 TYR A HD2    1 
ATOM   4476 H  HE1    . TYR A 1 273 ? 13.477  8.705   37.342  1.00 66.24  ? 273 TYR A HE1    1 
ATOM   4477 H  HE2    . TYR A 1 273 ? 10.809  10.644  35.083  1.00 69.42  ? 273 TYR A HE2    1 
ATOM   4478 H  HH     . TYR A 1 273 ? 12.928  11.238  37.227  1.00 66.30  ? 273 TYR A HH     1 
ATOM   4479 N  N      . TYR A 1 274 ? 12.974  4.900   30.986  1.00 51.84  ? 274 TYR A N      1 
ATOM   4480 C  CA     . TYR A 1 274 ? 13.629  3.745   30.404  1.00 48.43  ? 274 TYR A CA     1 
ATOM   4481 C  C      . TYR A 1 274 ? 14.967  4.189   29.800  1.00 57.64  ? 274 TYR A C      1 
ATOM   4482 O  O      . TYR A 1 274 ? 16.008  3.567   30.050  1.00 55.03  ? 274 TYR A O      1 
ATOM   4483 C  CB     . TYR A 1 274 ? 12.723  3.075   29.370  1.00 57.91  ? 274 TYR A CB     1 
ATOM   4484 C  CG     . TYR A 1 274 ? 13.410  1.995   28.562  1.00 66.76  ? 274 TYR A CG     1 
ATOM   4485 C  CD1    . TYR A 1 274 ? 13.469  0.683   29.024  1.00 71.29  ? 274 TYR A CD1    1 
ATOM   4486 C  CD2    . TYR A 1 274 ? 14.004  2.290   27.337  1.00 71.97  ? 274 TYR A CD2    1 
ATOM   4487 C  CE1    . TYR A 1 274 ? 14.101  -0.309  28.286  1.00 78.96  ? 274 TYR A CE1    1 
ATOM   4488 C  CE2    . TYR A 1 274 ? 14.641  1.305   26.591  1.00 78.17  ? 274 TYR A CE2    1 
ATOM   4489 C  CZ     . TYR A 1 274 ? 14.687  0.010   27.072  1.00 82.56  ? 274 TYR A CZ     1 
ATOM   4490 O  OH     . TYR A 1 274 ? 15.317  -0.966  26.337  1.00 88.18  ? 274 TYR A OH     1 
ATOM   4491 H  H      . TYR A 1 274 ? 12.204  5.089   30.654  1.00 62.21  ? 274 TYR A H      1 
ATOM   4492 H  HA     . TYR A 1 274 ? 13.816  3.093   31.112  1.00 58.12  ? 274 TYR A HA     1 
ATOM   4493 H  HB2    . TYR A 1 274 ? 11.972  2.668   29.829  1.00 69.49  ? 274 TYR A HB2    1 
ATOM   4494 H  HB3    . TYR A 1 274 ? 12.403  3.750   28.751  1.00 69.49  ? 274 TYR A HB3    1 
ATOM   4495 H  HD1    . TYR A 1 274 ? 13.078  0.467   29.840  1.00 85.55  ? 274 TYR A HD1    1 
ATOM   4496 H  HD2    . TYR A 1 274 ? 13.976  3.161   27.014  1.00 86.37  ? 274 TYR A HD2    1 
ATOM   4497 H  HE1    . TYR A 1 274 ? 14.134  -1.181  28.607  1.00 94.76  ? 274 TYR A HE1    1 
ATOM   4498 H  HE2    . TYR A 1 274 ? 15.035  1.516   25.775  1.00 93.81  ? 274 TYR A HE2    1 
ATOM   4499 H  HH     . TYR A 1 274 ? 16.106  -0.770  26.229  1.00 105.82 ? 274 TYR A HH     1 
ATOM   4500 N  N      . LYS A 1 275 ? 14.961  5.293   29.054  1.00 44.55  ? 275 LYS A N      1 
ATOM   4501 C  CA     . LYS A 1 275 ? 16.187  5.766   28.412  1.00 51.47  ? 275 LYS A CA     1 
ATOM   4502 C  C      . LYS A 1 275 ? 17.221  6.293   29.422  1.00 51.07  ? 275 LYS A C      1 
ATOM   4503 O  O      . LYS A 1 275 ? 18.434  6.198   29.192  1.00 50.84  ? 275 LYS A O      1 
ATOM   4504 C  CB     . LYS A 1 275 ? 15.868  6.835   27.360  1.00 49.53  ? 275 LYS A CB     1 
ATOM   4505 C  CG     . LYS A 1 275 ? 15.171  6.273   26.112  1.00 56.00  ? 275 LYS A CG     1 
ATOM   4506 C  CD     . LYS A 1 275 ? 14.235  7.287   25.441  1.00 60.14  ? 275 LYS A CD     1 
ATOM   4507 C  CE     . LYS A 1 275 ? 14.972  8.302   24.573  1.00 56.27  ? 275 LYS A CE     1 
ATOM   4508 N  NZ     . LYS A 1 275 ? 14.054  9.028   23.613  1.00 44.55  ? 275 LYS A NZ     1 
ATOM   4509 H  H      . LYS A 1 275 ? 14.269  5.781   28.905  1.00 53.46  ? 275 LYS A H      1 
ATOM   4510 H  HA     . LYS A 1 275 ? 16.599  5.010   27.943  1.00 61.76  ? 275 LYS A HA     1 
ATOM   4511 H  HB2    . LYS A 1 275 ? 15.281  7.499   27.755  1.00 59.44  ? 275 LYS A HB2    1 
ATOM   4512 H  HB3    . LYS A 1 275 ? 16.696  7.253   27.076  1.00 59.44  ? 275 LYS A HB3    1 
ATOM   4513 H  HG2    . LYS A 1 275 ? 15.845  6.014   25.464  1.00 67.19  ? 275 LYS A HG2    1 
ATOM   4514 H  HG3    . LYS A 1 275 ? 14.642  5.501   26.367  1.00 67.19  ? 275 LYS A HG3    1 
ATOM   4515 H  HD2    . LYS A 1 275 ? 13.608  6.810   24.875  1.00 72.17  ? 275 LYS A HD2    1 
ATOM   4516 H  HD3    . LYS A 1 275 ? 13.755  7.775   26.129  1.00 72.17  ? 275 LYS A HD3    1 
ATOM   4517 H  HE2    . LYS A 1 275 ? 15.390  8.963   25.147  1.00 67.53  ? 275 LYS A HE2    1 
ATOM   4518 H  HE3    . LYS A 1 275 ? 15.647  7.840   24.052  1.00 67.53  ? 275 LYS A HE3    1 
ATOM   4519 H  HZ1    . LYS A 1 275 ? 13.662  8.444   23.068  1.00 53.46  ? 275 LYS A HZ1    1 
ATOM   4520 H  HZ2    . LYS A 1 275 ? 13.427  9.468   24.066  1.00 53.46  ? 275 LYS A HZ2    1 
ATOM   4521 H  HZ3    . LYS A 1 275 ? 14.521  9.609   23.127  1.00 53.46  ? 275 LYS A HZ3    1 
ATOM   4522 N  N      . LEU A 1 276 ? 16.752  6.846   30.535  1.00 49.40  ? 276 LEU A N      1 
ATOM   4523 C  CA     . LEU A 1 276 ? 17.659  7.389   31.545  1.00 57.93  ? 276 LEU A CA     1 
ATOM   4524 C  C      . LEU A 1 276 ? 18.535  6.267   32.094  1.00 58.99  ? 276 LEU A C      1 
ATOM   4525 O  O      . LEU A 1 276 ? 19.724  6.452   32.358  1.00 54.09  ? 276 LEU A O      1 
ATOM   4526 C  CB     . LEU A 1 276 ? 16.880  8.046   32.694  1.00 52.90  ? 276 LEU A CB     1 
ATOM   4527 C  CG     . LEU A 1 276 ? 16.287  9.447   32.504  1.00 55.38  ? 276 LEU A CG     1 
ATOM   4528 C  CD1    . LEU A 1 276 ? 15.294  9.734   33.614  1.00 53.81  ? 276 LEU A CD1    1 
ATOM   4529 C  CD2    . LEU A 1 276 ? 17.363  10.519  32.480  1.00 47.84  ? 276 LEU A CD2    1 
ATOM   4530 H  H      . LEU A 1 276 ? 15.918  6.920   30.730  1.00 59.29  ? 276 LEU A H      1 
ATOM   4531 H  HA     . LEU A 1 276 ? 18.239  8.065   31.135  1.00 69.52  ? 276 LEU A HA     1 
ATOM   4532 H  HB2    . LEU A 1 276 ? 16.140  7.460   32.917  1.00 63.48  ? 276 LEU A HB2    1 
ATOM   4533 H  HB3    . LEU A 1 276 ? 17.476  8.099   33.458  1.00 63.48  ? 276 LEU A HB3    1 
ATOM   4534 H  HG     . LEU A 1 276 ? 15.812  9.478   31.659  1.00 66.45  ? 276 LEU A HG     1 
ATOM   4535 H  HD11   . LEU A 1 276 ? 14.929  10.613  33.486  1.00 64.57  ? 276 LEU A HD11   1 
ATOM   4536 H  HD12   . LEU A 1 276 ? 14.592  9.079   33.582  1.00 64.57  ? 276 LEU A HD12   1 
ATOM   4537 H  HD13   . LEU A 1 276 ? 15.748  9.687   34.458  1.00 64.57  ? 276 LEU A HD13   1 
ATOM   4538 H  HD21   . LEU A 1 276 ? 16.946  11.375  32.360  1.00 57.40  ? 276 LEU A HD21   1 
ATOM   4539 H  HD22   . LEU A 1 276 ? 17.840  10.500  33.313  1.00 57.40  ? 276 LEU A HD22   1 
ATOM   4540 H  HD23   . LEU A 1 276 ? 17.964  10.341  31.754  1.00 57.40  ? 276 LEU A HD23   1 
ATOM   4541 N  N      . ASP A 1 277 ? 17.932  5.096   32.247  1.00 57.69  ? 277 ASP A N      1 
ATOM   4542 C  CA     . ASP A 1 277 ? 18.609  3.943   32.830  1.00 70.10  ? 277 ASP A CA     1 
ATOM   4543 C  C      . ASP A 1 277 ? 19.070  4.262   34.257  1.00 71.09  ? 277 ASP A C      1 
ATOM   4544 O  O      . ASP A 1 277 ? 18.241  4.362   35.159  1.00 77.00  ? 277 ASP A O      1 
ATOM   4545 C  CB     . ASP A 1 277 ? 19.769  3.485   31.943  1.00 71.40  ? 277 ASP A CB     1 
ATOM   4546 C  CG     . ASP A 1 277 ? 20.084  2.002   32.118  1.00 85.82  ? 277 ASP A CG     1 
ATOM   4547 O  OD1    . ASP A 1 277 ? 19.887  1.476   33.234  1.00 86.23  ? 277 ASP A OD1    1 
ATOM   4548 O  OD2    . ASP A 1 277 ? 20.514  1.357   31.137  1.00 88.14  ? 277 ASP A OD2    1 
ATOM   4549 H  H      . ASP A 1 277 ? 17.118  4.940   32.017  1.00 69.23  ? 277 ASP A H      1 
ATOM   4550 H  HA     . ASP A 1 277 ? 17.970  3.202   32.885  1.00 84.12  ? 277 ASP A HA     1 
ATOM   4551 H  HB2    . ASP A 1 277 ? 19.537  3.635   31.013  1.00 85.68  ? 277 ASP A HB2    1 
ATOM   4552 H  HB3    . ASP A 1 277 ? 20.564  3.991   32.173  1.00 85.68  ? 277 ASP A HB3    1 
ATOM   4553 N  N      . LYS A 1 278 ? 20.374  4.438   34.468  1.00 64.16  ? 278 LYS A N      1 
ATOM   4554 C  CA     . LYS A 1 278 ? 20.893  4.652   35.816  1.00 66.50  ? 278 LYS A CA     1 
ATOM   4555 C  C      . LYS A 1 278 ? 21.134  6.124   36.113  1.00 67.66  ? 278 LYS A C      1 
ATOM   4556 O  O      . LYS A 1 278 ? 21.451  6.495   37.245  1.00 64.91  ? 278 LYS A O      1 
ATOM   4557 C  CB     . LYS A 1 278 ? 22.191  3.863   36.019  1.00 69.35  ? 278 LYS A CB     1 
ATOM   4558 C  CG     . LYS A 1 278 ? 21.981  2.373   36.292  1.00 81.53  ? 278 LYS A CG     1 
ATOM   4559 C  CD     . LYS A 1 278 ? 21.615  2.121   37.753  1.00 84.27  ? 278 LYS A CD     1 
ATOM   4560 C  CE     . LYS A 1 278 ? 21.312  0.650   38.023  1.00 89.57  ? 278 LYS A CE     1 
ATOM   4561 N  NZ     . LYS A 1 278 ? 19.949  0.255   37.561  1.00 85.06  ? 278 LYS A NZ     1 
ATOM   4562 H  H      . LYS A 1 278 ? 20.974  4.439   33.852  1.00 76.99  ? 278 LYS A H      1 
ATOM   4563 H  HA     . LYS A 1 278 ? 20.236  4.321   36.464  1.00 79.80  ? 278 LYS A HA     1 
ATOM   4564 H  HB2    . LYS A 1 278 ? 22.733  3.944   35.219  1.00 83.22  ? 278 LYS A HB2    1 
ATOM   4565 H  HB3    . LYS A 1 278 ? 22.668  4.238   36.776  1.00 83.22  ? 278 LYS A HB3    1 
ATOM   4566 H  HG2    . LYS A 1 278 ? 21.257  2.044   35.736  1.00 97.84  ? 278 LYS A HG2    1 
ATOM   4567 H  HG3    . LYS A 1 278 ? 22.800  1.892   36.095  1.00 97.84  ? 278 LYS A HG3    1 
ATOM   4568 H  HD2    . LYS A 1 278 ? 22.359  2.384   38.317  1.00 101.13 ? 278 LYS A HD2    1 
ATOM   4569 H  HD3    . LYS A 1 278 ? 20.826  2.638   37.978  1.00 101.13 ? 278 LYS A HD3    1 
ATOM   4570 H  HE2    . LYS A 1 278 ? 21.960  0.101   37.554  1.00 107.48 ? 278 LYS A HE2    1 
ATOM   4571 H  HE3    . LYS A 1 278 ? 21.366  0.485   38.978  1.00 107.48 ? 278 LYS A HE3    1 
ATOM   4572 H  HZ1    . LYS A 1 278 ? 19.807  -0.606  37.734  1.00 102.08 ? 278 LYS A HZ1    1 
ATOM   4573 H  HZ2    . LYS A 1 278 ? 19.333  0.740   37.982  1.00 102.08 ? 278 LYS A HZ2    1 
ATOM   4574 H  HZ3    . LYS A 1 278 ? 19.874  0.391   36.685  1.00 102.08 ? 278 LYS A HZ3    1 
ATOM   4575 N  N      . ARG A 1 279 ? 21.001  6.967   35.097  1.00 61.11  ? 279 ARG A N      1 
ATOM   4576 C  CA     . ARG A 1 279 ? 21.180  8.397   35.286  1.00 58.67  ? 279 ARG A CA     1 
ATOM   4577 C  C      . ARG A 1 279 ? 20.013  8.967   36.080  1.00 57.83  ? 279 ARG A C      1 
ATOM   4578 O  O      . ARG A 1 279 ? 18.854  8.726   35.755  1.00 52.34  ? 279 ARG A O      1 
ATOM   4579 C  CB     . ARG A 1 279 ? 21.301  9.109   33.937  1.00 56.06  ? 279 ARG A CB     1 
ATOM   4580 C  CG     . ARG A 1 279 ? 22.622  8.827   33.238  1.00 63.04  ? 279 ARG A CG     1 
ATOM   4581 C  CD     . ARG A 1 279 ? 22.863  9.784   32.096  1.00 60.50  ? 279 ARG A CD     1 
ATOM   4582 N  NE     . ARG A 1 279 ? 22.513  9.182   30.818  1.00 77.83  ? 279 ARG A NE     1 
ATOM   4583 C  CZ     . ARG A 1 279 ? 23.396  8.653   29.979  1.00 81.28  ? 279 ARG A CZ     1 
ATOM   4584 N  NH1    . ARG A 1 279 ? 24.694  8.663   30.276  1.00 76.37  ? 279 ARG A NH1    1 
ATOM   4585 N  NH2    . ARG A 1 279 ? 22.983  8.122   28.835  1.00 86.68  ? 279 ARG A NH2    1 
ATOM   4586 H  H      . ARG A 1 279 ? 20.808  6.736   34.291  1.00 73.33  ? 279 ARG A H      1 
ATOM   4587 H  HA     . ARG A 1 279 ? 22.004  8.556   35.792  1.00 70.41  ? 279 ARG A HA     1 
ATOM   4588 H  HB2    . ARG A 1 279 ? 20.584  8.808   33.356  1.00 67.27  ? 279 ARG A HB2    1 
ATOM   4589 H  HB3    . ARG A 1 279 ? 21.234  10.066  34.078  1.00 67.27  ? 279 ARG A HB3    1 
ATOM   4590 H  HG2    . ARG A 1 279 ? 23.348  8.924   33.875  1.00 75.65  ? 279 ARG A HG2    1 
ATOM   4591 H  HG3    . ARG A 1 279 ? 22.609  7.925   32.880  1.00 75.65  ? 279 ARG A HG3    1 
ATOM   4592 H  HD2    . ARG A 1 279 ? 22.316  10.576  32.220  1.00 72.60  ? 279 ARG A HD2    1 
ATOM   4593 H  HD3    . ARG A 1 279 ? 23.802  10.025  32.072  1.00 72.60  ? 279 ARG A HD3    1 
ATOM   4594 H  HE     . ARG A 1 279 ? 21.678  9.107   30.624  1.00 93.39  ? 279 ARG A HE     1 
ATOM   4595 H  HH11   . ARG A 1 279 ? 24.962  9.006   31.017  1.00 91.64  ? 279 ARG A HH11   1 
ATOM   4596 H  HH12   . ARG A 1 279 ? 25.262  8.321   29.729  1.00 91.64  ? 279 ARG A HH12   1 
ATOM   4597 H  HH21   . ARG A 1 279 ? 22.145  8.118   28.641  1.00 104.01 ? 279 ARG A HH21   1 
ATOM   4598 H  HH22   . ARG A 1 279 ? 23.553  7.783   28.288  1.00 104.01 ? 279 ARG A HH22   1 
ATOM   4599 N  N      . ILE A 1 280 ? 20.324  9.724   37.124  1.00 44.91  ? 280 ILE A N      1 
ATOM   4600 C  CA     . ILE A 1 280 ? 19.284  10.359  37.925  1.00 54.20  ? 280 ILE A CA     1 
ATOM   4601 C  C      . ILE A 1 280 ? 19.286  11.846  37.642  1.00 50.44  ? 280 ILE A C      1 
ATOM   4602 O  O      . ILE A 1 280 ? 20.275  12.520  37.907  1.00 51.37  ? 280 ILE A O      1 
ATOM   4603 C  CB     . ILE A 1 280 ? 19.510  10.171  39.446  1.00 59.30  ? 280 ILE A CB     1 
ATOM   4604 C  CG1    . ILE A 1 280 ? 19.794  8.703   39.785  1.00 61.20  ? 280 ILE A CG1    1 
ATOM   4605 C  CG2    . ILE A 1 280 ? 18.308  10.686  40.222  1.00 49.43  ? 280 ILE A CG2    1 
ATOM   4606 C  CD1    . ILE A 1 280 ? 18.731  7.745   39.300  1.00 63.45  ? 280 ILE A CD1    1 
ATOM   4607 H  H      . ILE A 1 280 ? 21.125  9.886   37.390  1.00 53.89  ? 280 ILE A H      1 
ATOM   4608 H  HA     . ILE A 1 280 ? 18.407  9.991   37.686  1.00 65.04  ? 280 ILE A HA     1 
ATOM   4609 H  HB     . ILE A 1 280 ? 20.284  10.696  39.704  1.00 71.15  ? 280 ILE A HB     1 
ATOM   4610 H  HG12   . ILE A 1 280 ? 20.634  8.445   39.375  1.00 73.44  ? 280 ILE A HG12   1 
ATOM   4611 H  HG13   . ILE A 1 280 ? 19.857  8.612   40.749  1.00 73.44  ? 280 ILE A HG13   1 
ATOM   4612 H  HG21   . ILE A 1 280 ? 18.466  10.562  41.161  1.00 59.31  ? 280 ILE A HG21   1 
ATOM   4613 H  HG22   . ILE A 1 280 ? 18.189  11.619  40.031  1.00 59.31  ? 280 ILE A HG22   1 
ATOM   4614 H  HG23   . ILE A 1 280 ? 17.528  10.194  39.953  1.00 59.31  ? 280 ILE A HG23   1 
ATOM   4615 H  HD11   . ILE A 1 280 ? 18.979  6.852   39.549  1.00 76.14  ? 280 ILE A HD11   1 
ATOM   4616 H  HD12   . ILE A 1 280 ? 17.892  7.978   39.706  1.00 76.14  ? 280 ILE A HD12   1 
ATOM   4617 H  HD13   . ILE A 1 280 ? 18.663  7.812   38.345  1.00 76.14  ? 280 ILE A HD13   1 
ATOM   4618 N  N      . PRO A 1 281 ? 18.177  12.369  37.106  1.00 41.10  ? 281 PRO A N      1 
ATOM   4619 C  CA     . PRO A 1 281 ? 18.168  13.802  36.791  1.00 46.57  ? 281 PRO A CA     1 
ATOM   4620 C  C      . PRO A 1 281 ? 17.699  14.656  37.973  1.00 50.03  ? 281 PRO A C      1 
ATOM   4621 O  O      . PRO A 1 281 ? 16.924  14.173  38.807  1.00 43.49  ? 281 PRO A O      1 
ATOM   4622 C  CB     . PRO A 1 281 ? 17.169  13.890  35.639  1.00 42.95  ? 281 PRO A CB     1 
ATOM   4623 C  CG     . PRO A 1 281 ? 16.157  12.808  35.957  1.00 41.32  ? 281 PRO A CG     1 
ATOM   4624 C  CD     . PRO A 1 281 ? 16.987  11.674  36.582  1.00 43.17  ? 281 PRO A CD     1 
ATOM   4625 H  HA     . PRO A 1 281 ? 19.052  14.100  36.490  1.00 55.88  ? 281 PRO A HA     1 
ATOM   4626 H  HB2    . PRO A 1 281 ? 16.751  14.765  35.630  1.00 51.54  ? 281 PRO A HB2    1 
ATOM   4627 H  HB3    . PRO A 1 281 ? 17.617  13.709  34.798  1.00 51.54  ? 281 PRO A HB3    1 
ATOM   4628 H  HG2    . PRO A 1 281 ? 15.504  13.146  36.589  1.00 49.58  ? 281 PRO A HG2    1 
ATOM   4629 H  HG3    . PRO A 1 281 ? 15.726  12.511  35.140  1.00 49.58  ? 281 PRO A HG3    1 
ATOM   4630 H  HD2    . PRO A 1 281 ? 16.495  11.254  37.304  1.00 51.81  ? 281 PRO A HD2    1 
ATOM   4631 H  HD3    . PRO A 1 281 ? 17.243  11.030  35.904  1.00 51.81  ? 281 PRO A HD3    1 
ATOM   4632 N  N      . LYS A 1 282 ? 18.162  15.904  38.037  1.00 48.52  ? 282 LYS A N      1 
ATOM   4633 C  CA     . LYS A 1 282 ? 17.680  16.859  39.039  1.00 49.95  ? 282 LYS A CA     1 
ATOM   4634 C  C      . LYS A 1 282 ? 16.765  17.889  38.399  1.00 47.15  ? 282 LYS A C      1 
ATOM   4635 O  O      . LYS A 1 282 ? 16.115  18.660  39.104  1.00 43.66  ? 282 LYS A O      1 
ATOM   4636 C  CB     . LYS A 1 282 ? 18.842  17.575  39.741  1.00 45.60  ? 282 LYS A CB     1 
ATOM   4637 C  CG     . LYS A 1 282 ? 19.837  16.636  40.427  1.00 56.56  ? 282 LYS A CG     1 
ATOM   4638 C  CD     . LYS A 1 282 ? 20.795  17.408  41.341  1.00 63.27  ? 282 LYS A CD     1 
ATOM   4639 C  CE     . LYS A 1 282 ? 21.719  18.338  40.560  1.00 64.64  ? 282 LYS A CE     1 
ATOM   4640 N  NZ     . LYS A 1 282 ? 22.708  17.584  39.733  1.00 66.03  ? 282 LYS A NZ     1 
ATOM   4641 H  H      . LYS A 1 282 ? 18.760  16.226  37.509  1.00 58.22  ? 282 LYS A H      1 
ATOM   4642 H  HA     . LYS A 1 282 ? 17.165  16.376  39.719  1.00 59.94  ? 282 LYS A HA     1 
ATOM   4643 H  HB2    . LYS A 1 282 ? 19.331  18.094  39.083  1.00 54.72  ? 282 LYS A HB2    1 
ATOM   4644 H  HB3    . LYS A 1 282 ? 18.478  18.166  40.419  1.00 54.72  ? 282 LYS A HB3    1 
ATOM   4645 H  HG2    . LYS A 1 282 ? 19.352  15.993  40.968  1.00 67.88  ? 282 LYS A HG2    1 
ATOM   4646 H  HG3    . LYS A 1 282 ? 20.363  16.178  39.753  1.00 67.88  ? 282 LYS A HG3    1 
ATOM   4647 H  HD2    . LYS A 1 282 ? 20.277  17.948  41.959  1.00 75.93  ? 282 LYS A HD2    1 
ATOM   4648 H  HD3    . LYS A 1 282 ? 21.346  16.777  41.830  1.00 75.93  ? 282 LYS A HD3    1 
ATOM   4649 H  HE2    . LYS A 1 282 ? 21.187  18.889  39.965  1.00 77.57  ? 282 LYS A HE2    1 
ATOM   4650 H  HE3    . LYS A 1 282 ? 22.210  18.896  41.183  1.00 77.57  ? 282 LYS A HE3    1 
ATOM   4651 H  HZ1    . LYS A 1 282 ? 22.283  17.066  39.147  1.00 79.24  ? 282 LYS A HZ1    1 
ATOM   4652 H  HZ2    . LYS A 1 282 ? 23.231  18.152  39.291  1.00 79.24  ? 282 LYS A HZ2    1 
ATOM   4653 H  HZ3    . LYS A 1 282 ? 23.215  17.072  40.256  1.00 79.24  ? 282 LYS A HZ3    1 
ATOM   4654 N  N      . ALA A 1 283 ? 16.709  17.901  37.066  1.00 38.29  ? 283 ALA A N      1 
ATOM   4655 C  CA     . ALA A 1 283 ? 15.860  18.864  36.353  1.00 34.68  ? 283 ALA A CA     1 
ATOM   4656 C  C      . ALA A 1 283 ? 14.907  18.179  35.373  1.00 40.42  ? 283 ALA A C      1 
ATOM   4657 O  O      . ALA A 1 283 ? 15.258  17.203  34.714  1.00 36.43  ? 283 ALA A O      1 
ATOM   4658 C  CB     . ALA A 1 283 ? 16.718  19.868  35.595  1.00 41.69  ? 283 ALA A CB     1 
ATOM   4659 H  H      . ALA A 1 283 ? 17.148  17.368  36.553  1.00 45.94  ? 283 ALA A H      1 
ATOM   4660 H  HA     . ALA A 1 283 ? 15.321  19.357  37.006  1.00 41.61  ? 283 ALA A HA     1 
ATOM   4661 H  HB1    . ALA A 1 283 ? 16.144  20.486  35.137  1.00 50.03  ? 283 ALA A HB1    1 
ATOM   4662 H  HB2    . ALA A 1 283 ? 17.274  20.338  36.220  1.00 50.03  ? 283 ALA A HB2    1 
ATOM   4663 H  HB3    . ALA A 1 283 ? 17.263  19.396  34.961  1.00 50.03  ? 283 ALA A HB3    1 
ATOM   4664 N  N      . ILE A 1 284 ? 13.709  18.729  35.253  1.00 38.33  ? 284 ILE A N      1 
ATOM   4665 C  CA     . ILE A 1 284 ? 12.723  18.195  34.340  1.00 37.25  ? 284 ILE A CA     1 
ATOM   4666 C  C      . ILE A 1 284 ? 12.058  19.347  33.602  1.00 39.09  ? 284 ILE A C      1 
ATOM   4667 O  O      . ILE A 1 284 ? 11.805  20.389  34.185  1.00 38.87  ? 284 ILE A O      1 
ATOM   4668 C  CB     . ILE A 1 284 ? 11.642  17.388  35.093  1.00 34.43  ? 284 ILE A CB     1 
ATOM   4669 C  CG1    . ILE A 1 284 ? 10.528  16.987  34.109  1.00 42.39  ? 284 ILE A CG1    1 
ATOM   4670 C  CG2    . ILE A 1 284 ? 11.055  18.212  36.236  1.00 32.44  ? 284 ILE A CG2    1 
ATOM   4671 C  CD1    . ILE A 1 284 ? 9.547   15.976  34.675  1.00 44.45  ? 284 ILE A CD1    1 
ATOM   4672 H  H      . ILE A 1 284 ? 13.444  19.418  35.694  1.00 45.99  ? 284 ILE A H      1 
ATOM   4673 H  HA     . ILE A 1 284 ? 13.158  17.608  33.686  1.00 44.70  ? 284 ILE A HA     1 
ATOM   4674 H  HB     . ILE A 1 284 ? 12.045  16.585  35.458  1.00 41.31  ? 284 ILE A HB     1 
ATOM   4675 H  HG12   . ILE A 1 284 ? 10.027  17.781  33.864  1.00 50.87  ? 284 ILE A HG12   1 
ATOM   4676 H  HG13   . ILE A 1 284 ? 10.933  16.597  33.319  1.00 50.87  ? 284 ILE A HG13   1 
ATOM   4677 H  HG21   . ILE A 1 284 ? 10.387  17.689  36.686  1.00 38.92  ? 284 ILE A HG21   1 
ATOM   4678 H  HG22   . ILE A 1 284 ? 11.758  18.443  36.847  1.00 38.92  ? 284 ILE A HG22   1 
ATOM   4679 H  HG23   . ILE A 1 284 ? 10.659  19.008  35.875  1.00 38.92  ? 284 ILE A HG23   1 
ATOM   4680 H  HD11   . ILE A 1 284 ? 8.886   15.776  34.008  1.00 53.34  ? 284 ILE A HD11   1 
ATOM   4681 H  HD12   . ILE A 1 284 ? 10.024  15.178  34.913  1.00 53.34  ? 284 ILE A HD12   1 
ATOM   4682 H  HD13   . ILE A 1 284 ? 9.126   16.350  35.452  1.00 53.34  ? 284 ILE A HD13   1 
ATOM   4683 N  N      . HIS A 1 285 ? 11.805  19.159  32.314  1.00 36.12  ? 285 HIS A N      1 
ATOM   4684 C  CA     . HIS A 1 285 ? 11.176  20.169  31.468  1.00 37.27  ? 285 HIS A CA     1 
ATOM   4685 C  C      . HIS A 1 285 ? 10.014  19.522  30.763  1.00 43.89  ? 285 HIS A C      1 
ATOM   4686 O  O      . HIS A 1 285 ? 10.166  18.441  30.177  1.00 42.74  ? 285 HIS A O      1 
ATOM   4687 C  CB     . HIS A 1 285 ? 12.151  20.641  30.395  1.00 43.84  ? 285 HIS A CB     1 
ATOM   4688 C  CG     . HIS A 1 285 ? 13.008  21.783  30.812  1.00 54.11  ? 285 HIS A CG     1 
ATOM   4689 N  ND1    . HIS A 1 285 ? 14.117  21.635  31.622  1.00 57.02  ? 285 HIS A ND1    1 
ATOM   4690 C  CD2    . HIS A 1 285 ? 12.931  23.108  30.528  1.00 53.66  ? 285 HIS A CD2    1 
ATOM   4691 C  CE1    . HIS A 1 285 ? 14.678  22.810  31.814  1.00 60.47  ? 285 HIS A CE1    1 
ATOM   4692 N  NE2    . HIS A 1 285 ? 13.975  23.723  31.164  1.00 54.82  ? 285 HIS A NE2    1 
ATOM   4693 H  H      . HIS A 1 285 ? 11.995  18.433  31.893  1.00 43.35  ? 285 HIS A H      1 
ATOM   4694 H  HA     . HIS A 1 285 ? 10.865  20.931  31.999  1.00 44.72  ? 285 HIS A HA     1 
ATOM   4695 H  HB2    . HIS A 1 285 ? 12.736  19.903  30.160  1.00 52.61  ? 285 HIS A HB2    1 
ATOM   4696 H  HB3    . HIS A 1 285 ? 11.646  20.919  29.615  1.00 52.61  ? 285 HIS A HB3    1 
ATOM   4697 H  HD1    . HIS A 1 285 ? 14.399  20.891  31.947  1.00 68.42  ? 285 HIS A HD1    1 
ATOM   4698 H  HD2    . HIS A 1 285 ? 12.286  23.522  30.001  1.00 64.39  ? 285 HIS A HD2    1 
ATOM   4699 H  HE1    . HIS A 1 285 ? 15.437  22.972  32.326  1.00 72.57  ? 285 HIS A HE1    1 
ATOM   4700 H  HE2    . HIS A 1 285 ? 14.148  24.565  31.141  1.00 65.79  ? 285 HIS A HE2    1 
ATOM   4701 N  N      . VAL A 1 286 ? 8.851   20.151  30.805  1.00 32.43  ? 286 VAL A N      1 
ATOM   4702 C  CA     . VAL A 1 286 ? 7.789   19.735  29.907  1.00 32.92  ? 286 VAL A CA     1 
ATOM   4703 C  C      . VAL A 1 286 ? 7.968   20.548  28.641  1.00 46.34  ? 286 VAL A C      1 
ATOM   4704 O  O      . VAL A 1 286 ? 8.276   21.724  28.711  1.00 43.17  ? 286 VAL A O      1 
ATOM   4705 C  CB     . VAL A 1 286 ? 6.412   19.953  30.508  1.00 38.10  ? 286 VAL A CB     1 
ATOM   4706 C  CG1    . VAL A 1 286 ? 5.340   19.870  29.424  1.00 33.29  ? 286 VAL A CG1    1 
ATOM   4707 C  CG2    . VAL A 1 286 ? 6.157   18.915  31.613  1.00 41.44  ? 286 VAL A CG2    1 
ATOM   4708 H  H      . VAL A 1 286 ? 8.653   20.804  31.329  1.00 38.91  ? 286 VAL A H      1 
ATOM   4709 H  HA     . VAL A 1 286 ? 7.892   18.785  29.689  1.00 39.50  ? 286 VAL A HA     1 
ATOM   4710 H  HB     . VAL A 1 286 ? 6.372   20.846  30.911  1.00 45.73  ? 286 VAL A HB     1 
ATOM   4711 H  HG11   . VAL A 1 286 ? 4.479   20.011  29.825  1.00 39.95  ? 286 VAL A HG11   1 
ATOM   4712 H  HG12   . VAL A 1 286 ? 5.510   20.548  28.765  1.00 39.95  ? 286 VAL A HG12   1 
ATOM   4713 H  HG13   . VAL A 1 286 ? 5.375   19.002  29.017  1.00 39.95  ? 286 VAL A HG13   1 
ATOM   4714 H  HG21   . VAL A 1 286 ? 5.284   19.062  31.985  1.00 49.73  ? 286 VAL A HG21   1 
ATOM   4715 H  HG22   . VAL A 1 286 ? 6.206   18.035  31.232  1.00 49.73  ? 286 VAL A HG22   1 
ATOM   4716 H  HG23   . VAL A 1 286 ? 6.825   19.014  32.295  1.00 49.73  ? 286 VAL A HG23   1 
ATOM   4717 N  N      . VAL A 1 287 ? 7.826   19.902  27.489  1.00 41.76  ? 287 VAL A N      1 
ATOM   4718 C  CA     . VAL A 1 287 ? 8.071   20.538  26.199  1.00 44.51  ? 287 VAL A CA     1 
ATOM   4719 C  C      . VAL A 1 287 ? 6.837   20.330  25.338  1.00 46.94  ? 287 VAL A C      1 
ATOM   4720 O  O      . VAL A 1 287 ? 6.391   19.204  25.151  1.00 45.73  ? 287 VAL A O      1 
ATOM   4721 C  CB     . VAL A 1 287 ? 9.300   19.925  25.469  1.00 48.65  ? 287 VAL A CB     1 
ATOM   4722 C  CG1    . VAL A 1 287 ? 9.469   20.525  24.071  1.00 46.33  ? 287 VAL A CG1    1 
ATOM   4723 C  CG2    . VAL A 1 287 ? 10.573  20.126  26.276  1.00 46.18  ? 287 VAL A CG2    1 
ATOM   4724 H  H      . VAL A 1 287 ? 7.584   19.079  27.428  1.00 50.12  ? 287 VAL A H      1 
ATOM   4725 H  HA     . VAL A 1 287 ? 8.217   21.499  26.321  1.00 53.41  ? 287 VAL A HA     1 
ATOM   4726 H  HB     . VAL A 1 287 ? 9.159   18.960  25.367  1.00 58.38  ? 287 VAL A HB     1 
ATOM   4727 H  HG11   . VAL A 1 287 ? 10.234  20.126  23.650  1.00 55.60  ? 287 VAL A HG11   1 
ATOM   4728 H  HG12   . VAL A 1 287 ? 8.680   20.343  23.556  1.00 55.60  ? 287 VAL A HG12   1 
ATOM   4729 H  HG13   . VAL A 1 287 ? 9.597   21.473  24.152  1.00 55.60  ? 287 VAL A HG13   1 
ATOM   4730 H  HG21   . VAL A 1 287 ? 11.310  19.738  25.799  1.00 55.41  ? 287 VAL A HG21   1 
ATOM   4731 H  HG22   . VAL A 1 287 ? 10.720  21.067  26.396  1.00 55.41  ? 287 VAL A HG22   1 
ATOM   4732 H  HG23   . VAL A 1 287 ? 10.472  19.698  27.129  1.00 55.41  ? 287 VAL A HG23   1 
ATOM   4733 N  N      . ALA A 1 288 ? 6.288   21.422  24.825  1.00 48.38  ? 288 ALA A N      1 
ATOM   4734 C  CA     . ALA A 1 288 ? 5.116   21.379  23.956  1.00 56.19  ? 288 ALA A CA     1 
ATOM   4735 C  C      . ALA A 1 288 ? 5.443   21.930  22.572  1.00 58.06  ? 288 ALA A C      1 
ATOM   4736 O  O      . ALA A 1 288 ? 6.081   22.968  22.438  1.00 53.78  ? 288 ALA A O      1 
ATOM   4737 C  CB     . ALA A 1 288 ? 3.986   22.191  24.579  1.00 55.68  ? 288 ALA A CB     1 
ATOM   4738 H  H      . ALA A 1 288 ? 6.580   22.218  24.969  1.00 58.06  ? 288 ALA A H      1 
ATOM   4739 H  HA     . ALA A 1 288 ? 4.815   20.452  23.858  1.00 67.43  ? 288 ALA A HA     1 
ATOM   4740 H  HB1    . ALA A 1 288 ? 3.221   22.157  24.000  1.00 66.82  ? 288 ALA A HB1    1 
ATOM   4741 H  HB2    . ALA A 1 288 ? 3.766   21.815  25.435  1.00 66.82  ? 288 ALA A HB2    1 
ATOM   4742 H  HB3    . ALA A 1 288 ? 4.276   23.100  24.685  1.00 66.82  ? 288 ALA A HB3    1 
ATOM   4743 N  N      . VAL A 1 289 ? 5.014   21.220  21.542  1.00 55.64  ? 289 VAL A N      1 
ATOM   4744 C  CA     . VAL A 1 289 ? 5.096   21.727  20.187  1.00 55.85  ? 289 VAL A CA     1 
ATOM   4745 C  C      . VAL A 1 289 ? 3.696   22.167  19.835  1.00 65.16  ? 289 VAL A C      1 
ATOM   4746 O  O      . VAL A 1 289 ? 2.774   21.363  19.899  1.00 56.67  ? 289 VAL A O      1 
ATOM   4747 C  CB     . VAL A 1 289 ? 5.560   20.640  19.211  1.00 67.73  ? 289 VAL A CB     1 
ATOM   4748 C  CG1    . VAL A 1 289 ? 5.408   21.097  17.762  1.00 65.39  ? 289 VAL A CG1    1 
ATOM   4749 C  CG2    . VAL A 1 289 ? 6.999   20.252  19.512  1.00 65.25  ? 289 VAL A CG2    1 
ATOM   4750 H  H      . VAL A 1 289 ? 4.669   20.435  21.602  1.00 66.76  ? 289 VAL A H      1 
ATOM   4751 H  HA     . VAL A 1 289 ? 5.704   22.494  20.141  1.00 67.02  ? 289 VAL A HA     1 
ATOM   4752 H  HB     . VAL A 1 289 ? 5.002   19.844  19.335  1.00 81.27  ? 289 VAL A HB     1 
ATOM   4753 H  HG11   . VAL A 1 289 ? 5.707   20.394  17.180  1.00 78.46  ? 289 VAL A HG11   1 
ATOM   4754 H  HG12   . VAL A 1 289 ? 4.484   21.292  17.591  1.00 78.46  ? 289 VAL A HG12   1 
ATOM   4755 H  HG13   . VAL A 1 289 ? 5.940   21.884  17.625  1.00 78.46  ? 289 VAL A HG13   1 
ATOM   4756 H  HG21   . VAL A 1 289 ? 7.275   19.572  18.894  1.00 78.30  ? 289 VAL A HG21   1 
ATOM   4757 H  HG22   . VAL A 1 289 ? 7.557   21.027  19.418  1.00 78.30  ? 289 VAL A HG22   1 
ATOM   4758 H  HG23   . VAL A 1 289 ? 7.050   19.918  20.411  1.00 78.30  ? 289 VAL A HG23   1 
ATOM   4759 N  N      . THR A 1 290 ? 3.532   23.448  19.505  1.00 67.89  ? 290 THR A N      1 
ATOM   4760 C  CA     . THR A 1 290 ? 2.218   24.004  19.174  1.00 71.29  ? 290 THR A CA     1 
ATOM   4761 C  C      . THR A 1 290 ? 1.764   23.595  17.774  1.00 67.92  ? 290 THR A C      1 
ATOM   4762 O  O      . THR A 1 290 ? 2.539   23.031  17.004  1.00 69.52  ? 290 THR A O      1 
ATOM   4763 C  CB     . THR A 1 290 ? 2.220   25.541  19.264  1.00 67.50  ? 290 THR A CB     1 
ATOM   4764 O  OG1    . THR A 1 290 ? 3.194   26.071  18.359  1.00 72.93  ? 290 THR A OG1    1 
ATOM   4765 C  CG2    . THR A 1 290 ? 2.546   25.995  20.682  1.00 70.84  ? 290 THR A CG2    1 
ATOM   4766 H  H      . THR A 1 290 ? 4.172   24.021  19.464  1.00 81.47  ? 290 THR A H      1 
ATOM   4767 H  HA     . THR A 1 290 ? 1.560   23.665  19.815  1.00 85.55  ? 290 THR A HA     1 
ATOM   4768 H  HB     . THR A 1 290 ? 1.342   25.879  19.028  1.00 81.00  ? 290 THR A HB     1 
ATOM   4769 H  HG1    . THR A 1 290 ? 3.200   26.890  18.402  1.00 87.52  ? 290 THR A HG1    1 
ATOM   4770 H  HG21   . THR A 1 290 ? 2.544   26.954  20.727  1.00 85.00  ? 290 THR A HG21   1 
ATOM   4771 H  HG22   . THR A 1 290 ? 1.890   25.653  21.294  1.00 85.00  ? 290 THR A HG22   1 
ATOM   4772 H  HG23   . THR A 1 290 ? 3.412   25.672  20.939  1.00 85.00  ? 290 THR A HG23   1 
ATOM   4773 N  N      . GLU A 1 291 ? 0.502   23.877  17.458  1.00 72.39  ? 291 GLU A N      1 
ATOM   4774 C  CA     . GLU A 1 291 ? -0.077  23.529  16.156  1.00 76.35  ? 291 GLU A CA     1 
ATOM   4775 C  C      . GLU A 1 291 ? 0.661   24.199  14.999  1.00 76.52  ? 291 GLU A C      1 
ATOM   4776 O  O      . GLU A 1 291 ? 0.714   23.665  13.893  1.00 75.90  ? 291 GLU A O      1 
ATOM   4777 C  CB     . GLU A 1 291 ? -1.569  23.889  16.112  1.00 77.79  ? 291 GLU A CB     1 
ATOM   4778 C  CG     . GLU A 1 291 ? -1.913  25.239  16.743  1.00 86.11  ? 291 GLU A CG     1 
ATOM   4779 C  CD     . GLU A 1 291 ? -3.414  25.528  16.761  1.00 92.17  ? 291 GLU A CD     1 
ATOM   4780 O  OE1    . GLU A 1 291 ? -4.161  24.898  15.975  1.00 87.63  ? 291 GLU A OE1    1 
ATOM   4781 O  OE2    . GLU A 1 291 ? -3.844  26.389  17.563  1.00 89.70  ? 291 GLU A OE2    1 
ATOM   4782 H  H      . GLU A 1 291 ? -0.048  24.276  17.986  1.00 86.87  ? 291 GLU A H      1 
ATOM   4783 H  HA     . GLU A 1 291 ? -0.003  22.559  16.032  1.00 91.62  ? 291 GLU A HA     1 
ATOM   4784 H  HB2    . GLU A 1 291 ? -1.854  23.917  15.186  1.00 93.34  ? 291 GLU A HB2    1 
ATOM   4785 H  HB3    . GLU A 1 291 ? -2.067  23.207  16.588  1.00 93.34  ? 291 GLU A HB3    1 
ATOM   4786 H  HG2    . GLU A 1 291 ? -1.597  25.247  17.660  1.00 103.34 ? 291 GLU A HG2    1 
ATOM   4787 H  HG3    . GLU A 1 291 ? -1.479  25.943  16.237  1.00 103.34 ? 291 GLU A HG3    1 
ATOM   4788 N  N      . ASP A 1 292 ? 1.236   25.367  15.266  1.00 76.31  ? 292 ASP A N      1 
ATOM   4789 C  CA     . ASP A 1 292 ? 2.022   26.083  14.266  1.00 80.92  ? 292 ASP A CA     1 
ATOM   4790 C  C      . ASP A 1 292 ? 3.509   25.724  14.370  1.00 80.77  ? 292 ASP A C      1 
ATOM   4791 O  O      . ASP A 1 292 ? 4.379   26.471  13.914  1.00 79.41  ? 292 ASP A O      1 
ATOM   4792 C  CB     . ASP A 1 292 ? 1.822   27.593  14.423  1.00 83.39  ? 292 ASP A CB     1 
ATOM   4793 C  CG     . ASP A 1 292 ? 1.917   28.048  15.867  1.00 89.96  ? 292 ASP A CG     1 
ATOM   4794 O  OD1    . ASP A 1 292 ? 0.862   28.349  16.472  1.00 85.46  ? 292 ASP A OD1    1 
ATOM   4795 O  OD2    . ASP A 1 292 ? 3.048   28.092  16.397  1.00 88.13  ? 292 ASP A OD2    1 
ATOM   4796 H  H      . ASP A 1 292 ? 1.187   25.769  16.024  1.00 91.57  ? 292 ASP A H      1 
ATOM   4797 H  HA     . ASP A 1 292 ? 1.711   25.828  13.372  1.00 97.10  ? 292 ASP A HA     1 
ATOM   4798 H  HB2    . ASP A 1 292 ? 2.506   28.058  13.916  1.00 100.07 ? 292 ASP A HB2    1 
ATOM   4799 H  HB3    . ASP A 1 292 ? 0.942   27.832  14.090  1.00 100.07 ? 292 ASP A HB3    1 
ATOM   4800 N  N      . LEU A 1 293 ? 3.777   24.576  14.987  1.00 78.19  ? 293 LEU A N      1 
ATOM   4801 C  CA     . LEU A 1 293 ? 5.118   23.995  15.084  1.00 66.34  ? 293 LEU A CA     1 
ATOM   4802 C  C      . LEU A 1 293 ? 6.133   24.823  15.886  1.00 72.52  ? 293 LEU A C      1 
ATOM   4803 O  O      . LEU A 1 293 ? 7.346   24.610  15.781  1.00 68.20  ? 293 LEU A O      1 
ATOM   4804 C  CB     . LEU A 1 293 ? 5.661   23.704  13.685  1.00 68.16  ? 293 LEU A CB     1 
ATOM   4805 C  CG     . LEU A 1 293 ? 4.643   23.143  12.679  1.00 81.64  ? 293 LEU A CG     1 
ATOM   4806 C  CD1    . LEU A 1 293 ? 5.265   23.027  11.287  1.00 73.97  ? 293 LEU A CD1    1 
ATOM   4807 C  CD2    . LEU A 1 293 ? 4.087   21.800  13.123  1.00 71.38  ? 293 LEU A CD2    1 
ATOM   4808 H  H      . LEU A 1 293 ? 3.176   24.097  15.373  1.00 93.83  ? 293 LEU A H      1 
ATOM   4809 H  HA     . LEU A 1 293 ? 5.036   23.132  15.541  1.00 79.61  ? 293 LEU A HA     1 
ATOM   4810 H  HB2    . LEU A 1 293 ? 6.011   24.530  13.315  1.00 81.80  ? 293 LEU A HB2    1 
ATOM   4811 H  HB3    . LEU A 1 293 ? 6.379   23.056  13.764  1.00 81.80  ? 293 LEU A HB3    1 
ATOM   4812 H  HG     . LEU A 1 293 ? 3.898   23.762  12.616  1.00 97.97  ? 293 LEU A HG     1 
ATOM   4813 H  HD11   . LEU A 1 293 ? 4.610   22.675  10.681  1.00 88.76  ? 293 LEU A HD11   1 
ATOM   4814 H  HD12   . LEU A 1 293 ? 5.546   23.897  10.997  1.00 88.76  ? 293 LEU A HD12   1 
ATOM   4815 H  HD13   . LEU A 1 293 ? 6.021   22.436  11.332  1.00 88.76  ? 293 LEU A HD13   1 
ATOM   4816 H  HD21   . LEU A 1 293 ? 3.459   21.490  12.467  1.00 85.66  ? 293 LEU A HD21   1 
ATOM   4817 H  HD22   . LEU A 1 293 ? 4.811   21.175  13.205  1.00 85.66  ? 293 LEU A HD22   1 
ATOM   4818 H  HD23   . LEU A 1 293 ? 3.650   21.909  13.971  1.00 85.66  ? 293 LEU A HD23   1 
ATOM   4819 N  N      . ASP A 1 294 ? 5.657   25.761  16.694  1.00 64.08  ? 294 ASP A N      1 
ATOM   4820 C  CA     . ASP A 1 294 ? 6.554   26.433  17.623  1.00 72.21  ? 294 ASP A CA     1 
ATOM   4821 C  C      . ASP A 1 294 ? 6.836   25.498  18.794  1.00 69.77  ? 294 ASP A C      1 
ATOM   4822 O  O      . ASP A 1 294 ? 6.200   24.456  18.930  1.00 74.48  ? 294 ASP A O      1 
ATOM   4823 C  CB     . ASP A 1 294 ? 5.962   27.754  18.116  1.00 73.84  ? 294 ASP A CB     1 
ATOM   4824 C  CG     . ASP A 1 294 ? 6.674   28.963  17.529  1.00 91.22  ? 294 ASP A CG     1 
ATOM   4825 O  OD1    . ASP A 1 294 ? 7.209   28.849  16.402  1.00 82.08  ? 294 ASP A OD1    1 
ATOM   4826 O  OD2    . ASP A 1 294 ? 6.704   30.023  18.196  1.00 93.86  ? 294 ASP A OD2    1 
ATOM   4827 H  H      . ASP A 1 294 ? 4.839   26.023  16.724  1.00 76.90  ? 294 ASP A H      1 
ATOM   4828 H  HA     . ASP A 1 294 ? 7.402   26.625  17.172  1.00 86.65  ? 294 ASP A HA     1 
ATOM   4829 H  HB2    . ASP A 1 294 ? 5.028   27.799  17.857  1.00 88.61  ? 294 ASP A HB2    1 
ATOM   4830 H  HB3    . ASP A 1 294 ? 6.043   27.797  19.082  1.00 88.61  ? 294 ASP A HB3    1 
ATOM   4831 N  N      . ILE A 1 295 ? 7.800   25.865  19.628  1.00 63.22  ? 295 ILE A N      1 
ATOM   4832 C  CA     . ILE A 1 295 ? 8.150   25.056  20.786  1.00 64.93  ? 295 ILE A CA     1 
ATOM   4833 C  C      . ILE A 1 295 ? 8.121   25.886  22.064  1.00 64.69  ? 295 ILE A C      1 
ATOM   4834 O  O      . ILE A 1 295 ? 8.809   26.899  22.180  1.00 63.78  ? 295 ILE A O      1 
ATOM   4835 C  CB     . ILE A 1 295 ? 9.535   24.415  20.615  1.00 63.59  ? 295 ILE A CB     1 
ATOM   4836 C  CG1    . ILE A 1 295 ? 9.431   23.185  19.714  1.00 69.40  ? 295 ILE A CG1    1 
ATOM   4837 C  CG2    . ILE A 1 295 ? 10.117  24.016  21.972  1.00 65.28  ? 295 ILE A CG2    1 
ATOM   4838 C  CD1    . ILE A 1 295 ? 10.549  23.077  18.702  1.00 71.26  ? 295 ILE A CD1    1 
ATOM   4839 H  H      . ILE A 1 295 ? 8.268   26.581  19.545  1.00 75.87  ? 295 ILE A H      1 
ATOM   4840 H  HA     . ILE A 1 295 ? 7.493   24.335  20.880  1.00 77.92  ? 295 ILE A HA     1 
ATOM   4841 H  HB     . ILE A 1 295 ? 10.128  25.059  20.198  1.00 76.31  ? 295 ILE A HB     1 
ATOM   4842 H  HG12   . ILE A 1 295 ? 9.454   22.388  20.268  1.00 83.28  ? 295 ILE A HG12   1 
ATOM   4843 H  HG13   . ILE A 1 295 ? 8.593   23.223  19.228  1.00 83.28  ? 295 ILE A HG13   1 
ATOM   4844 H  HG21   . ILE A 1 295 ? 10.981  23.619  21.837  1.00 78.34  ? 295 ILE A HG21   1 
ATOM   4845 H  HG22   . ILE A 1 295 ? 10.199  24.801  22.520  1.00 78.34  ? 295 ILE A HG22   1 
ATOM   4846 H  HG23   . ILE A 1 295 ? 9.528   23.384  22.391  1.00 78.34  ? 295 ILE A HG23   1 
ATOM   4847 H  HD11   . ILE A 1 295 ? 10.417  22.285  18.175  1.00 85.51  ? 295 ILE A HD11   1 
ATOM   4848 H  HD12   . ILE A 1 295 ? 10.534  23.853  18.136  1.00 85.51  ? 295 ILE A HD12   1 
ATOM   4849 H  HD13   . ILE A 1 295 ? 11.387  23.026  19.167  1.00 85.51  ? 295 ILE A HD13   1 
ATOM   4850 N  N      . VAL A 1 296 ? 7.307   25.447  23.017  1.00 61.01  ? 296 VAL A N      1 
ATOM   4851 C  CA     . VAL A 1 296 ? 7.231   26.077  24.322  1.00 59.49  ? 296 VAL A CA     1 
ATOM   4852 C  C      . VAL A 1 296 ? 7.693   25.063  25.357  1.00 60.49  ? 296 VAL A C      1 
ATOM   4853 O  O      . VAL A 1 296 ? 7.518   23.869  25.161  1.00 54.34  ? 296 VAL A O      1 
ATOM   4854 C  CB     . VAL A 1 296 ? 5.789   26.506  24.637  1.00 63.26  ? 296 VAL A CB     1 
ATOM   4855 C  CG1    . VAL A 1 296 ? 5.763   27.408  25.859  1.00 57.63  ? 296 VAL A CG1    1 
ATOM   4856 C  CG2    . VAL A 1 296 ? 5.176   27.200  23.426  1.00 65.12  ? 296 VAL A CG2    1 
ATOM   4857 H  H      . VAL A 1 296 ? 6.781   24.773  22.927  1.00 73.22  ? 296 VAL A H      1 
ATOM   4858 H  HA     . VAL A 1 296 ? 7.816   26.862  24.355  1.00 71.39  ? 296 VAL A HA     1 
ATOM   4859 H  HB     . VAL A 1 296 ? 5.254   25.710  24.835  1.00 75.91  ? 296 VAL A HB     1 
ATOM   4860 H  HG11   . VAL A 1 296 ? 4.855   27.664  26.038  1.00 69.16  ? 296 VAL A HG11   1 
ATOM   4861 H  HG12   . VAL A 1 296 ? 6.122   26.929  26.609  1.00 69.16  ? 296 VAL A HG12   1 
ATOM   4862 H  HG13   . VAL A 1 296 ? 6.294   28.188  25.683  1.00 69.16  ? 296 VAL A HG13   1 
ATOM   4863 H  HG21   . VAL A 1 296 ? 4.277   27.462  23.639  1.00 78.15  ? 296 VAL A HG21   1 
ATOM   4864 H  HG22   . VAL A 1 296 ? 5.701   27.975  23.212  1.00 78.15  ? 296 VAL A HG22   1 
ATOM   4865 H  HG23   . VAL A 1 296 ? 5.174   26.590  22.685  1.00 78.15  ? 296 VAL A HG23   1 
ATOM   4866 N  N      . SER A 1 297 ? 8.279   25.525  26.455  1.00 57.07  ? 297 SER A N      1 
ATOM   4867 C  CA     . SER A 1 297 ? 8.791   24.601  27.465  1.00 64.81  ? 297 SER A CA     1 
ATOM   4868 C  C      . SER A 1 297 ? 8.949   25.263  28.832  1.00 60.66  ? 297 SER A C      1 
ATOM   4869 O  O      . SER A 1 297 ? 9.316   26.437  28.925  1.00 55.59  ? 297 SER A O      1 
ATOM   4870 C  CB     . SER A 1 297 ? 10.140  24.035  27.020  1.00 59.80  ? 297 SER A CB     1 
ATOM   4871 O  OG     . SER A 1 297 ? 11.193  24.910  27.381  1.00 58.54  ? 297 SER A OG     1 
ATOM   4872 H  H      . SER A 1 297 ? 8.392   26.358  26.640  1.00 68.48  ? 297 SER A H      1 
ATOM   4873 H  HA     . SER A 1 297 ? 8.165   23.853  27.560  1.00 77.77  ? 297 SER A HA     1 
ATOM   4874 H  HB2    . SER A 1 297 ? 10.281  23.177  27.451  1.00 71.75  ? 297 SER A HB2    1 
ATOM   4875 H  HB3    . SER A 1 297 ? 10.136  23.926  26.057  1.00 71.75  ? 297 SER A HB3    1 
ATOM   4876 H  HG     . SER A 1 297 ? 11.912  24.598  27.138  1.00 70.25  ? 297 SER A HG     1 
ATOM   4877 N  N      . ARG A 1 298 ? 8.671   24.508  29.892  1.00 45.52  ? 298 ARG A N      1 
ATOM   4878 C  CA     . ARG A 1 298 ? 8.823   25.023  31.243  1.00 50.75  ? 298 ARG A CA     1 
ATOM   4879 C  C      . ARG A 1 298 ? 9.445   23.960  32.112  1.00 50.73  ? 298 ARG A C      1 
ATOM   4880 O  O      . ARG A 1 298 ? 9.148   22.779  31.959  1.00 39.49  ? 298 ARG A O      1 
ATOM   4881 C  CB     . ARG A 1 298 ? 7.476   25.445  31.823  1.00 56.03  ? 298 ARG A CB     1 
ATOM   4882 C  CG     . ARG A 1 298 ? 6.801   26.572  31.065  1.00 63.27  ? 298 ARG A CG     1 
ATOM   4883 C  CD     . ARG A 1 298 ? 7.419   27.950  31.348  1.00 67.81  ? 298 ARG A CD     1 
ATOM   4884 N  NE     . ARG A 1 298 ? 6.591   28.998  30.752  1.00 71.72  ? 298 ARG A NE     1 
ATOM   4885 C  CZ     . ARG A 1 298 ? 6.751   29.491  29.524  1.00 74.88  ? 298 ARG A CZ     1 
ATOM   4886 N  NH1    . ARG A 1 298 ? 7.737   29.063  28.747  1.00 65.63  ? 298 ARG A NH1    1 
ATOM   4887 N  NH2    . ARG A 1 298 ? 5.928   30.429  29.073  1.00 77.02  ? 298 ARG A NH2    1 
ATOM   4888 H  H      . ARG A 1 298 ? 8.393   23.695  29.852  1.00 54.63  ? 298 ARG A H      1 
ATOM   4889 H  HA     . ARG A 1 298 ? 9.415   25.804  31.233  1.00 60.90  ? 298 ARG A HA     1 
ATOM   4890 H  HB2    . ARG A 1 298 ? 6.878   24.681  31.810  1.00 67.23  ? 298 ARG A HB2    1 
ATOM   4891 H  HB3    . ARG A 1 298 ? 7.609   25.741  32.737  1.00 67.23  ? 298 ARG A HB3    1 
ATOM   4892 H  HG2    . ARG A 1 298 ? 6.878   26.400  30.114  1.00 75.93  ? 298 ARG A HG2    1 
ATOM   4893 H  HG3    . ARG A 1 298 ? 5.866   26.606  31.321  1.00 75.93  ? 298 ARG A HG3    1 
ATOM   4894 H  HD2    . ARG A 1 298 ? 7.462   28.097  32.306  1.00 81.37  ? 298 ARG A HD2    1 
ATOM   4895 H  HD3    . ARG A 1 298 ? 8.306   27.995  30.957  1.00 81.37  ? 298 ARG A HD3    1 
ATOM   4896 H  HE     . ARG A 1 298 ? 5.953   29.321  31.230  1.00 86.06  ? 298 ARG A HE     1 
ATOM   4897 H  HH11   . ARG A 1 298 ? 8.273   28.452  29.029  1.00 78.75  ? 298 ARG A HH11   1 
ATOM   4898 H  HH12   . ARG A 1 298 ? 7.836   29.390  27.958  1.00 78.75  ? 298 ARG A HH12   1 
ATOM   4899 H  HH21   . ARG A 1 298 ? 5.290   30.718  29.572  1.00 92.42  ? 298 ARG A HH21   1 
ATOM   4900 H  HH22   . ARG A 1 298 ? 6.039   30.756  28.285  1.00 92.42  ? 298 ARG A HH22   1 
ATOM   4901 N  N      . GLY A 1 299 ? 10.300  24.379  33.033  1.00 42.75  ? 299 GLY A N      1 
ATOM   4902 C  CA     . GLY A 1 299 ? 11.086  23.431  33.785  1.00 50.77  ? 299 GLY A CA     1 
ATOM   4903 C  C      . GLY A 1 299 ? 11.144  23.727  35.257  1.00 56.86  ? 299 GLY A C      1 
ATOM   4904 O  O      . GLY A 1 299 ? 10.689  24.775  35.727  1.00 48.92  ? 299 GLY A O      1 
ATOM   4905 H  H      . GLY A 1 299 ? 10.439  25.202  33.237  1.00 51.30  ? 299 GLY A H      1 
ATOM   4906 H  HA2    . GLY A 1 299 ? 10.712  22.544  33.669  1.00 60.92  ? 299 GLY A HA2    1 
ATOM   4907 H  HA3    . GLY A 1 299 ? 11.993  23.425  33.441  1.00 60.92  ? 299 GLY A HA3    1 
ATOM   4908 N  N      . ARG A 1 300 ? 11.702  22.777  35.994  1.00 46.44  ? 300 ARG A N      1 
ATOM   4909 C  CA     . ARG A 1 300 ? 11.980  22.981  37.398  1.00 54.01  ? 300 ARG A CA     1 
ATOM   4910 C  C      . ARG A 1 300 ? 13.200  22.170  37.763  1.00 53.83  ? 300 ARG A C      1 
ATOM   4911 O  O      . ARG A 1 300 ? 13.342  21.009  37.346  1.00 43.80  ? 300 ARG A O      1 
ATOM   4912 C  CB     . ARG A 1 300 ? 10.811  22.553  38.290  1.00 58.14  ? 300 ARG A CB     1 
ATOM   4913 C  CG     . ARG A 1 300 ? 11.033  22.932  39.765  1.00 71.31  ? 300 ARG A CG     1 
ATOM   4914 C  CD     . ARG A 1 300 ? 9.982   22.343  40.699  1.00 75.11  ? 300 ARG A CD     1 
ATOM   4915 N  NE     . ARG A 1 300 ? 9.835   23.133  41.925  1.00 78.73  ? 300 ARG A NE     1 
ATOM   4916 C  CZ     . ARG A 1 300 ? 9.054   22.801  42.954  1.00 84.70  ? 300 ARG A CZ     1 
ATOM   4917 N  NH1    . ARG A 1 300 ? 8.343   21.679  42.931  1.00 76.85  ? 300 ARG A NH1    1 
ATOM   4918 N  NH2    . ARG A 1 300 ? 8.983   23.596  44.017  1.00 80.31  ? 300 ARG A NH2    1 
ATOM   4919 H  H      . ARG A 1 300 ? 11.928  22.002  35.699  1.00 55.73  ? 300 ARG A H      1 
ATOM   4920 H  HA     . ARG A 1 300 ? 12.171  23.928  37.563  1.00 64.81  ? 300 ARG A HA     1 
ATOM   4921 H  HB2    . ARG A 1 300 ? 10.002  22.991  37.984  1.00 69.77  ? 300 ARG A HB2    1 
ATOM   4922 H  HB3    . ARG A 1 300 ? 10.709  21.590  38.238  1.00 69.77  ? 300 ARG A HB3    1 
ATOM   4923 H  HG2    . ARG A 1 300 ? 11.901  22.603  40.048  1.00 85.58  ? 300 ARG A HG2    1 
ATOM   4924 H  HG3    . ARG A 1 300 ? 11.002  23.897  39.851  1.00 85.58  ? 300 ARG A HG3    1 
ATOM   4925 H  HD2    . ARG A 1 300 ? 9.125   22.328  40.244  1.00 90.13  ? 300 ARG A HD2    1 
ATOM   4926 H  HD3    . ARG A 1 300 ? 10.245  21.444  40.948  1.00 90.13  ? 300 ARG A HD3    1 
ATOM   4927 H  HE     . ARG A 1 300 ? 10.285  23.863  41.985  1.00 94.47  ? 300 ARG A HE     1 
ATOM   4928 H  HH11   . ARG A 1 300 ? 8.380   21.160  42.246  1.00 92.22  ? 300 ARG A HH11   1 
ATOM   4929 H  HH12   . ARG A 1 300 ? 7.844   21.473  43.600  1.00 92.22  ? 300 ARG A HH12   1 
ATOM   4930 H  HH21   . ARG A 1 300 ? 9.442   24.322  44.042  1.00 96.37  ? 300 ARG A HH21   1 
ATOM   4931 H  HH22   . ARG A 1 300 ? 8.484   23.379  44.683  1.00 96.37  ? 300 ARG A HH22   1 
ATOM   4932 N  N      . THR A 1 301 ? 14.069  22.786  38.555  1.00 44.01  ? 301 THR A N      1 
ATOM   4933 C  CA     . THR A 1 301 ? 15.213  22.100  39.122  1.00 51.88  ? 301 THR A CA     1 
ATOM   4934 C  C      . THR A 1 301 ? 14.996  21.823  40.602  1.00 51.57  ? 301 THR A C      1 
ATOM   4935 O  O      . THR A 1 301 ? 14.438  22.646  41.316  1.00 47.09  ? 301 THR A O      1 
ATOM   4936 C  CB     . THR A 1 301 ? 16.464  22.945  38.964  1.00 47.39  ? 301 THR A CB     1 
ATOM   4937 O  OG1    . THR A 1 301 ? 16.712  23.131  37.569  1.00 49.69  ? 301 THR A OG1    1 
ATOM   4938 C  CG2    . THR A 1 301 ? 17.658  22.265  39.627  1.00 55.08  ? 301 THR A CG2    1 
ATOM   4939 H  H      . THR A 1 301 ? 14.013  23.614  38.781  1.00 52.81  ? 301 THR A H      1 
ATOM   4940 H  HA     . THR A 1 301 ? 15.349  21.247  38.660  1.00 62.25  ? 301 THR A HA     1 
ATOM   4941 H  HB     . THR A 1 301 ? 16.327  23.807  39.386  1.00 56.87  ? 301 THR A HB     1 
ATOM   4942 H  HG1    . THR A 1 301 ? 17.385  23.587  37.462  1.00 59.63  ? 301 THR A HG1    1 
ATOM   4943 H  HG21   . THR A 1 301 ? 18.444  22.807  39.522  1.00 66.09  ? 301 THR A HG21   1 
ATOM   4944 H  HG22   . THR A 1 301 ? 17.487  22.143  40.564  1.00 66.09  ? 301 THR A HG22   1 
ATOM   4945 H  HG23   . THR A 1 301 ? 17.814  21.408  39.223  1.00 66.09  ? 301 THR A HG23   1 
ATOM   4946 N  N      . PHE A 1 302 ? 15.456  20.659  41.041  1.00 50.38  ? 302 PHE A N      1 
ATOM   4947 C  CA     . PHE A 1 302 ? 15.301  20.195  42.414  1.00 56.66  ? 302 PHE A CA     1 
ATOM   4948 C  C      . PHE A 1 302 ? 16.689  20.058  43.027  1.00 51.87  ? 302 PHE A C      1 
ATOM   4949 O  O      . PHE A 1 302 ? 17.637  19.725  42.330  1.00 53.06  ? 302 PHE A O      1 
ATOM   4950 C  CB     . PHE A 1 302 ? 14.605  18.819  42.433  1.00 48.41  ? 302 PHE A CB     1 
ATOM   4951 C  CG     . PHE A 1 302 ? 13.137  18.866  42.085  1.00 60.22  ? 302 PHE A CG     1 
ATOM   4952 C  CD1    . PHE A 1 302 ? 12.712  18.712  40.769  1.00 53.90  ? 302 PHE A CD1    1 
ATOM   4953 C  CD2    . PHE A 1 302 ? 12.179  19.047  43.079  1.00 58.78  ? 302 PHE A CD2    1 
ATOM   4954 C  CE1    . PHE A 1 302 ? 11.359  18.752  40.455  1.00 62.93  ? 302 PHE A CE1    1 
ATOM   4955 C  CE2    . PHE A 1 302 ? 10.824  19.087  42.770  1.00 51.57  ? 302 PHE A CE2    1 
ATOM   4956 C  CZ     . PHE A 1 302 ? 10.414  18.937  41.459  1.00 58.83  ? 302 PHE A CZ     1 
ATOM   4957 H  H      . PHE A 1 302 ? 15.878  20.099  40.542  1.00 60.46  ? 302 PHE A H      1 
ATOM   4958 H  HA     . PHE A 1 302 ? 14.775  20.836  42.936  1.00 67.99  ? 302 PHE A HA     1 
ATOM   4959 H  HB2    . PHE A 1 302 ? 15.043  18.240  41.790  1.00 58.09  ? 302 PHE A HB2    1 
ATOM   4960 H  HB3    . PHE A 1 302 ? 14.686  18.441  43.323  1.00 58.09  ? 302 PHE A HB3    1 
ATOM   4961 H  HD1    . PHE A 1 302 ? 13.339  18.588  40.094  1.00 64.68  ? 302 PHE A HD1    1 
ATOM   4962 H  HD2    . PHE A 1 302 ? 12.449  19.149  43.963  1.00 70.53  ? 302 PHE A HD2    1 
ATOM   4963 H  HE1    . PHE A 1 302 ? 11.084  18.651  39.572  1.00 75.52  ? 302 PHE A HE1    1 
ATOM   4964 H  HE2    . PHE A 1 302 ? 10.195  19.211  43.444  1.00 61.89  ? 302 PHE A HE2    1 
ATOM   4965 H  HZ     . PHE A 1 302 ? 9.508   18.963  41.247  1.00 70.60  ? 302 PHE A HZ     1 
ATOM   4966 N  N      . PRO A 1 303 ? 16.819  20.303  44.337  1.00 60.53  ? 303 PRO A N      1 
ATOM   4967 C  CA     . PRO A 1 303 ? 18.136  20.087  44.956  1.00 64.59  ? 303 PRO A CA     1 
ATOM   4968 C  C      . PRO A 1 303 ? 18.446  18.607  45.143  1.00 62.62  ? 303 PRO A C      1 
ATOM   4969 O  O      . PRO A 1 303 ? 19.422  18.253  45.804  1.00 72.19  ? 303 PRO A O      1 
ATOM   4970 C  CB     . PRO A 1 303 ? 18.002  20.778  46.321  1.00 63.63  ? 303 PRO A CB     1 
ATOM   4971 C  CG     . PRO A 1 303 ? 16.528  20.767  46.612  1.00 61.90  ? 303 PRO A CG     1 
ATOM   4972 C  CD     . PRO A 1 303 ? 15.851  20.906  45.271  1.00 57.83  ? 303 PRO A CD     1 
ATOM   4973 H  HA     . PRO A 1 303 ? 18.845  20.516  44.432  1.00 77.51  ? 303 PRO A HA     1 
ATOM   4974 H  HB2    . PRO A 1 303 ? 18.489  20.276  46.992  1.00 76.36  ? 303 PRO A HB2    1 
ATOM   4975 H  HB3    . PRO A 1 303 ? 18.334  21.688  46.262  1.00 76.36  ? 303 PRO A HB3    1 
ATOM   4976 H  HG2    . PRO A 1 303 ? 16.286  19.926  47.032  1.00 74.29  ? 303 PRO A HG2    1 
ATOM   4977 H  HG3    . PRO A 1 303 ? 16.304  21.514  47.188  1.00 74.29  ? 303 PRO A HG3    1 
ATOM   4978 H  HD2    . PRO A 1 303 ? 15.017  20.411  45.260  1.00 69.40  ? 303 PRO A HD2    1 
ATOM   4979 H  HD3    . PRO A 1 303 ? 15.713  21.842  45.057  1.00 69.40  ? 303 PRO A HD3    1 
ATOM   4980 N  N      . HIS A 1 304 ? 17.600  17.755  44.573  1.00 52.06  ? 304 HIS A N      1 
ATOM   4981 C  CA     . HIS A 1 304 ? 17.757  16.309  44.676  1.00 54.53  ? 304 HIS A CA     1 
ATOM   4982 C  C      . HIS A 1 304 ? 17.304  15.649  43.374  1.00 55.53  ? 304 HIS A C      1 
ATOM   4983 O  O      . HIS A 1 304 ? 16.674  16.286  42.540  1.00 48.84  ? 304 HIS A O      1 
ATOM   4984 C  CB     . HIS A 1 304 ? 16.913  15.778  45.839  1.00 54.74  ? 304 HIS A CB     1 
ATOM   4985 C  CG     . HIS A 1 304 ? 15.480  16.216  45.792  1.00 51.29  ? 304 HIS A CG     1 
ATOM   4986 N  ND1    . HIS A 1 304 ? 14.535  15.607  44.996  1.00 48.00  ? 304 HIS A ND1    1 
ATOM   4987 C  CD2    . HIS A 1 304 ? 14.831  17.217  46.442  1.00 50.28  ? 304 HIS A CD2    1 
ATOM   4988 C  CE1    . HIS A 1 304 ? 13.371  16.205  45.158  1.00 54.96  ? 304 HIS A CE1    1 
ATOM   4989 N  NE2    . HIS A 1 304 ? 13.519  17.180  46.028  1.00 55.78  ? 304 HIS A NE2    1 
ATOM   4990 H  H      . HIS A 1 304 ? 16.915  17.995  44.112  1.00 62.48  ? 304 HIS A H      1 
ATOM   4991 H  HA     . HIS A 1 304 ? 18.697  16.085  44.837  1.00 65.44  ? 304 HIS A HA     1 
ATOM   4992 H  HB2    . HIS A 1 304 ? 16.928  14.808  45.819  1.00 65.69  ? 304 HIS A HB2    1 
ATOM   4993 H  HB3    . HIS A 1 304 ? 17.293  16.095  46.673  1.00 65.69  ? 304 HIS A HB3    1 
ATOM   4994 H  HD1    . HIS A 1 304 ? 14.681  14.939  44.475  1.00 57.60  ? 304 HIS A HD1    1 
ATOM   4995 H  HD2    . HIS A 1 304 ? 15.202  17.810  47.054  1.00 60.33  ? 304 HIS A HD2    1 
ATOM   4996 H  HE1    . HIS A 1 304 ? 12.578  15.975  44.730  1.00 65.96  ? 304 HIS A HE1    1 
ATOM   4997 H  HE2    . HIS A 1 304 ? 12.897  17.712  46.293  1.00 66.93  ? 304 HIS A HE2    1 
ATOM   4998 N  N      . GLY A 1 305 ? 17.628  14.372  43.211  1.00 52.15  ? 305 GLY A N      1 
ATOM   4999 C  CA     . GLY A 1 305 ? 17.177  13.605  42.064  1.00 55.46  ? 305 GLY A CA     1 
ATOM   5000 C  C      . GLY A 1 305 ? 15.666  13.522  41.994  1.00 53.78  ? 305 GLY A C      1 
ATOM   5001 O  O      . GLY A 1 305 ? 14.962  13.689  42.997  1.00 46.07  ? 305 GLY A O      1 
ATOM   5002 H  H      . GLY A 1 305 ? 18.115  13.924  43.760  1.00 62.58  ? 305 GLY A H      1 
ATOM   5003 H  HA2    . GLY A 1 305 ? 17.502  14.019  41.249  1.00 66.55  ? 305 GLY A HA2    1 
ATOM   5004 H  HA3    . GLY A 1 305 ? 17.534  12.704  42.116  1.00 66.55  ? 305 GLY A HA3    1 
ATOM   5005 N  N      . ILE A 1 306 ? 15.164  13.229  40.800  1.00 50.30  ? 306 ILE A N      1 
ATOM   5006 C  CA     . ILE A 1 306 ? 13.730  13.212  40.550  1.00 42.98  ? 306 ILE A CA     1 
ATOM   5007 C  C      . ILE A 1 306 ? 13.260  11.777  40.385  1.00 45.26  ? 306 ILE A C      1 
ATOM   5008 O  O      . ILE A 1 306 ? 13.660  11.105  39.437  1.00 48.88  ? 306 ILE A O      1 
ATOM   5009 C  CB     . ILE A 1 306 ? 13.385  14.000  39.264  1.00 45.75  ? 306 ILE A CB     1 
ATOM   5010 C  CG1    . ILE A 1 306 ? 13.750  15.474  39.433  1.00 51.71  ? 306 ILE A CG1    1 
ATOM   5011 C  CG2    . ILE A 1 306 ? 11.904  13.860  38.937  1.00 37.90  ? 306 ILE A CG2    1 
ATOM   5012 C  CD1    . ILE A 1 306 ? 13.424  16.337  38.217  1.00 43.88  ? 306 ILE A CD1    1 
ATOM   5013 H  H      . ILE A 1 306 ? 15.639  13.034  40.111  1.00 60.36  ? 306 ILE A H      1 
ATOM   5014 H  HA     . ILE A 1 306 ? 13.255  13.615  41.306  1.00 51.57  ? 306 ILE A HA     1 
ATOM   5015 H  HB     . ILE A 1 306 ? 13.901  13.635  38.528  1.00 54.90  ? 306 ILE A HB     1 
ATOM   5016 H  HG12   . ILE A 1 306 ? 13.259  15.832  40.190  1.00 62.05  ? 306 ILE A HG12   1 
ATOM   5017 H  HG13   . ILE A 1 306 ? 14.703  15.543  39.598  1.00 62.05  ? 306 ILE A HG13   1 
ATOM   5018 H  HG21   . ILE A 1 306 ? 11.712  14.355  38.138  1.00 45.48  ? 306 ILE A HG21   1 
ATOM   5019 H  HG22   . ILE A 1 306 ? 11.701  12.931  38.804  1.00 45.48  ? 306 ILE A HG22   1 
ATOM   5020 H  HG23   . ILE A 1 306 ? 11.389  14.207  39.670  1.00 45.48  ? 306 ILE A HG23   1 
ATOM   5021 H  HD11   . ILE A 1 306 ? 13.681  17.244  38.400  1.00 52.66  ? 306 ILE A HD11   1 
ATOM   5022 H  HD12   . ILE A 1 306 ? 13.911  16.005  37.460  1.00 52.66  ? 306 ILE A HD12   1 
ATOM   5023 H  HD13   . ILE A 1 306 ? 12.481  16.292  38.046  1.00 52.66  ? 306 ILE A HD13   1 
ATOM   5024 N  N      . SER A 1 307 ? 12.412  11.301  41.297  1.00 44.30  ? 307 SER A N      1 
ATOM   5025 C  CA     . SER A 1 307 ? 11.864  9.945   41.187  1.00 45.96  ? 307 SER A CA     1 
ATOM   5026 C  C      . SER A 1 307 ? 10.750  9.956   40.159  1.00 46.36  ? 307 SER A C      1 
ATOM   5027 O  O      . SER A 1 307 ? 10.120  10.992  39.946  1.00 42.38  ? 307 SER A O      1 
ATOM   5028 C  CB     . SER A 1 307 ? 11.270  9.487   42.512  1.00 46.72  ? 307 SER A CB     1 
ATOM   5029 O  OG     . SER A 1 307 ? 10.147  10.295  42.842  1.00 39.66  ? 307 SER A OG     1 
ATOM   5030 H  H      . SER A 1 307 ? 12.138  11.739  41.985  1.00 53.16  ? 307 SER A H      1 
ATOM   5031 H  HA     . SER A 1 307 ? 12.561  9.316   40.906  1.00 55.15  ? 307 SER A HA     1 
ATOM   5032 H  HB2    . SER A 1 307 ? 10.986  8.563   42.432  1.00 56.06  ? 307 SER A HB2    1 
ATOM   5033 H  HB3    . SER A 1 307 ? 11.940  9.572   43.209  1.00 56.06  ? 307 SER A HB3    1 
ATOM   5034 H  HG     . SER A 1 307 ? 9.825   10.050  43.555  1.00 47.59  ? 307 SER A HG     1 
ATOM   5035 N  N      . LYS A 1 308 ? 10.472  8.806   39.557  1.00 45.68  ? 308 LYS A N      1 
ATOM   5036 C  CA     . LYS A 1 308 ? 9.437   8.748   38.540  1.00 51.14  ? 308 LYS A CA     1 
ATOM   5037 C  C      . LYS A 1 308 ? 8.180   9.403   39.074  1.00 51.42  ? 308 LYS A C      1 
ATOM   5038 O  O      . LYS A 1 308 ? 7.502   10.138  38.356  1.00 44.66  ? 308 LYS A O      1 
ATOM   5039 C  CB     . LYS A 1 308 ? 9.136   7.312   38.109  1.00 48.89  ? 308 LYS A CB     1 
ATOM   5040 C  CG     . LYS A 1 308 ? 8.392   7.253   36.759  1.00 60.31  ? 308 LYS A CG     1 
ATOM   5041 C  CD     . LYS A 1 308 ? 7.814   5.879   36.463  1.00 63.85  ? 308 LYS A CD     1 
ATOM   5042 C  CE     . LYS A 1 308 ? 8.893   4.897   36.067  1.00 69.52  ? 308 LYS A CE     1 
ATOM   5043 N  NZ     . LYS A 1 308 ? 8.327   3.554   35.752  1.00 83.62  ? 308 LYS A NZ     1 
ATOM   5044 H  H      . LYS A 1 308 ? 10.863  8.056   39.716  1.00 54.81  ? 308 LYS A H      1 
ATOM   5045 H  HA     . LYS A 1 308 ? 9.733   9.249   37.752  1.00 61.37  ? 308 LYS A HA     1 
ATOM   5046 H  HB2    . LYS A 1 308 ? 9.971   6.827   38.015  1.00 58.67  ? 308 LYS A HB2    1 
ATOM   5047 H  HB3    . LYS A 1 308 ? 8.578   6.889   38.780  1.00 58.67  ? 308 LYS A HB3    1 
ATOM   5048 H  HG2    . LYS A 1 308 ? 7.660   7.889   36.774  1.00 72.38  ? 308 LYS A HG2    1 
ATOM   5049 H  HG3    . LYS A 1 308 ? 9.011   7.476   36.047  1.00 72.38  ? 308 LYS A HG3    1 
ATOM   5050 H  HD2    . LYS A 1 308 ? 7.372   5.540   37.258  1.00 76.62  ? 308 LYS A HD2    1 
ATOM   5051 H  HD3    . LYS A 1 308 ? 7.182   5.948   35.731  1.00 76.62  ? 308 LYS A HD3    1 
ATOM   5052 H  HE2    . LYS A 1 308 ? 9.350   5.226   35.277  1.00 83.42  ? 308 LYS A HE2    1 
ATOM   5053 H  HE3    . LYS A 1 308 ? 9.521   4.798   36.800  1.00 83.42  ? 308 LYS A HE3    1 
ATOM   5054 H  HZ1    . LYS A 1 308 ? 7.905   3.228   36.464  1.00 100.35 ? 308 LYS A HZ1    1 
ATOM   5055 H  HZ2    . LYS A 1 308 ? 7.750   3.618   35.078  1.00 100.35 ? 308 LYS A HZ2    1 
ATOM   5056 H  HZ3    . LYS A 1 308 ? 8.981   2.995   35.522  1.00 100.35 ? 308 LYS A HZ3    1 
ATOM   5057 N  N      . GLU A 1 309 ? 7.891   9.166   40.351  1.00 45.22  ? 309 GLU A N      1 
ATOM   5058 C  CA     . GLU A 1 309 ? 6.653   9.648   40.944  1.00 44.48  ? 309 GLU A CA     1 
ATOM   5059 C  C      . GLU A 1 309 ? 6.656   11.171  41.019  1.00 52.17  ? 309 GLU A C      1 
ATOM   5060 O  O      . GLU A 1 309 ? 5.655   11.808  40.694  1.00 48.57  ? 309 GLU A O      1 
ATOM   5061 C  CB     . GLU A 1 309 ? 6.418   9.010   42.330  1.00 58.46  ? 309 GLU A CB     1 
ATOM   5062 C  CG     . GLU A 1 309 ? 6.191   7.483   42.298  1.00 64.30  ? 309 GLU A CG     1 
ATOM   5063 C  CD     . GLU A 1 309 ? 7.496   6.664   42.313  1.00 77.90  ? 309 GLU A CD     1 
ATOM   5064 O  OE1    . GLU A 1 309 ? 8.596   7.265   42.271  1.00 61.53  ? 309 GLU A OE1    1 
ATOM   5065 O  OE2    . GLU A 1 309 ? 7.421   5.410   42.376  1.00 76.38  ? 309 GLU A OE2    1 
ATOM   5066 H  H      . GLU A 1 309 ? 8.396   8.729   40.893  1.00 54.27  ? 309 GLU A H      1 
ATOM   5067 H  HA     . GLU A 1 309 ? 5.907   9.383   40.366  1.00 53.38  ? 309 GLU A HA     1 
ATOM   5068 H  HB2    . GLU A 1 309 ? 7.195   9.181   42.885  1.00 70.15  ? 309 GLU A HB2    1 
ATOM   5069 H  HB3    . GLU A 1 309 ? 5.634   9.417   42.730  1.00 70.15  ? 309 GLU A HB3    1 
ATOM   5070 H  HG2    . GLU A 1 309 ? 5.671   7.228   43.076  1.00 77.16  ? 309 GLU A HG2    1 
ATOM   5071 H  HG3    . GLU A 1 309 ? 5.707   7.256   41.489  1.00 77.16  ? 309 GLU A HG3    1 
ATOM   5072 N  N      . THR A 1 310 ? 7.783   11.753  41.435  1.00 43.80  ? 310 THR A N      1 
ATOM   5073 C  CA     . THR A 1 310 ? 7.950   13.210  41.430  1.00 51.77  ? 310 THR A CA     1 
ATOM   5074 C  C      . THR A 1 310 ? 7.905   13.756  40.000  1.00 46.37  ? 310 THR A C      1 
ATOM   5075 O  O      . THR A 1 310 ? 7.374   14.839  39.770  1.00 42.92  ? 310 THR A O      1 
ATOM   5076 C  CB     . THR A 1 310 ? 9.283   13.654  42.102  1.00 54.80  ? 310 THR A CB     1 
ATOM   5077 O  OG1    . THR A 1 310 ? 9.339   13.160  43.449  1.00 48.27  ? 310 THR A OG1    1 
ATOM   5078 C  CG2    . THR A 1 310 ? 9.416   15.181  42.123  1.00 38.12  ? 310 THR A CG2    1 
ATOM   5079 H  H      . THR A 1 310 ? 8.470   11.324  41.725  1.00 52.57  ? 310 THR A H      1 
ATOM   5080 H  HA     . THR A 1 310 ? 7.211   13.614  41.930  1.00 62.12  ? 310 THR A HA     1 
ATOM   5081 H  HB     . THR A 1 310 ? 10.029  13.292  41.599  1.00 65.76  ? 310 THR A HB     1 
ATOM   5082 H  HG1    . THR A 1 310 ? 9.301   12.341  43.449  1.00 57.92  ? 310 THR A HG1    1 
ATOM   5083 H  HG21   . THR A 1 310 ? 10.243  15.432  42.541  1.00 45.75  ? 310 THR A HG21   1 
ATOM   5084 H  HG22   . THR A 1 310 ? 9.403   15.523  41.226  1.00 45.75  ? 310 THR A HG22   1 
ATOM   5085 H  HG23   . THR A 1 310 ? 8.688   15.567  42.615  1.00 45.75  ? 310 THR A HG23   1 
ATOM   5086 N  N      . ALA A 1 311 ? 8.452   13.015  39.037  1.00 35.41  ? 311 ALA A N      1 
ATOM   5087 C  CA     . ALA A 1 311 ? 8.356   13.439  37.633  1.00 47.28  ? 311 ALA A CA     1 
ATOM   5088 C  C      . ALA A 1 311 ? 6.886   13.538  37.192  1.00 40.54  ? 311 ALA A C      1 
ATOM   5089 O  O      . ALA A 1 311 ? 6.503   14.480  36.500  1.00 40.67  ? 311 ALA A O      1 
ATOM   5090 C  CB     . ALA A 1 311 ? 9.123   12.482  36.720  1.00 43.33  ? 311 ALA A CB     1 
ATOM   5091 H  H      . ALA A 1 311 ? 8.876   12.278  39.162  1.00 42.50  ? 311 ALA A H      1 
ATOM   5092 H  HA     . ALA A 1 311 ? 8.758   14.328  37.543  1.00 56.73  ? 311 ALA A HA     1 
ATOM   5093 H  HB1    . ALA A 1 311 ? 9.042   12.784  35.812  1.00 51.99  ? 311 ALA A HB1    1 
ATOM   5094 H  HB2    . ALA A 1 311 ? 10.047  12.474  36.981  1.00 51.99  ? 311 ALA A HB2    1 
ATOM   5095 H  HB3    . ALA A 1 311 ? 8.751   11.601  36.806  1.00 51.99  ? 311 ALA A HB3    1 
ATOM   5096 N  N      . TYR A 1 312 ? 6.066   12.574  37.620  1.00 46.33  ? 312 TYR A N      1 
ATOM   5097 C  CA     . TYR A 1 312 ? 4.653   12.525  37.247  1.00 43.12  ? 312 TYR A CA     1 
ATOM   5098 C  C      . TYR A 1 312 ? 3.881   13.736  37.774  1.00 54.55  ? 312 TYR A C      1 
ATOM   5099 O  O      . TYR A 1 312 ? 3.148   14.366  37.021  1.00 48.30  ? 312 TYR A O      1 
ATOM   5100 C  CB     . TYR A 1 312 ? 4.001   11.230  37.760  1.00 49.13  ? 312 TYR A CB     1 
ATOM   5101 C  CG     . TYR A 1 312 ? 3.899   10.113  36.738  1.00 49.93  ? 312 TYR A CG     1 
ATOM   5102 C  CD1    . TYR A 1 312 ? 2.717   9.887   36.046  1.00 60.35  ? 312 TYR A CD1    1 
ATOM   5103 C  CD2    . TYR A 1 312 ? 4.973   9.280   36.474  1.00 51.52  ? 312 TYR A CD2    1 
ATOM   5104 C  CE1    . TYR A 1 312 ? 2.612   8.856   35.116  1.00 62.22  ? 312 TYR A CE1    1 
ATOM   5105 C  CE2    . TYR A 1 312 ? 4.883   8.250   35.543  1.00 53.01  ? 312 TYR A CE2    1 
ATOM   5106 C  CZ     . TYR A 1 312 ? 3.700   8.040   34.870  1.00 65.22  ? 312 TYR A CZ     1 
ATOM   5107 O  OH     . TYR A 1 312 ? 3.598   7.021   33.940  1.00 66.14  ? 312 TYR A OH     1 
ATOM   5108 H  H      . TYR A 1 312 ? 6.310   11.929  38.134  1.00 55.60  ? 312 TYR A H      1 
ATOM   5109 H  HA     . TYR A 1 312 ? 4.585   12.528  36.269  1.00 51.74  ? 312 TYR A HA     1 
ATOM   5110 H  HB2    . TYR A 1 312 ? 4.523   10.896  38.506  1.00 58.95  ? 312 TYR A HB2    1 
ATOM   5111 H  HB3    . TYR A 1 312 ? 3.101   11.435  38.059  1.00 58.95  ? 312 TYR A HB3    1 
ATOM   5112 H  HD1    . TYR A 1 312 ? 1.981   10.431  36.211  1.00 72.42  ? 312 TYR A HD1    1 
ATOM   5113 H  HD2    . TYR A 1 312 ? 5.773   9.414   36.927  1.00 61.82  ? 312 TYR A HD2    1 
ATOM   5114 H  HE1    . TYR A 1 312 ? 1.813   8.719   34.659  1.00 74.66  ? 312 TYR A HE1    1 
ATOM   5115 H  HE2    . TYR A 1 312 ? 5.617   7.703   35.380  1.00 63.61  ? 312 TYR A HE2    1 
ATOM   5116 H  HH     . TYR A 1 312 ? 3.416   7.332   33.203  1.00 79.37  ? 312 TYR A HH     1 
ATOM   5117 N  N      . SER A 1 313 ? 4.025   14.079  39.057  1.00 43.46  ? 313 SER A N      1 
ATOM   5118 C  CA     . SER A 1 313 ? 3.265   15.222  39.572  1.00 51.22  ? 313 SER A CA     1 
ATOM   5119 C  C      . SER A 1 313 ? 3.818   16.540  39.059  1.00 53.13  ? 313 SER A C      1 
ATOM   5120 O  O      . SER A 1 313 ? 3.050   17.423  38.671  1.00 52.42  ? 313 SER A O      1 
ATOM   5121 C  CB     . SER A 1 313 ? 3.179   15.238  41.105  1.00 57.10  ? 313 SER A CB     1 
ATOM   5122 O  OG     . SER A 1 313 ? 4.451   15.172  41.709  1.00 56.06  ? 313 SER A OG     1 
ATOM   5123 H  H      . SER A 1 313 ? 4.534   13.686  39.628  1.00 52.15  ? 313 SER A H      1 
ATOM   5124 H  HA     . SER A 1 313 ? 2.347   15.148  39.236  1.00 61.47  ? 313 SER A HA     1 
ATOM   5125 H  HB2    . SER A 1 313 ? 2.744   16.059  41.384  1.00 68.52  ? 313 SER A HB2    1 
ATOM   5126 H  HB3    . SER A 1 313 ? 2.656   14.474  41.396  1.00 68.52  ? 313 SER A HB3    1 
ATOM   5127 H  HG     . SER A 1 313 ? 4.374   15.182  42.525  1.00 67.27  ? 313 SER A HG     1 
ATOM   5128 N  N      . GLU A 1 314 ? 5.142   16.681  39.034  1.00 49.82  ? 314 GLU A N      1 
ATOM   5129 C  CA     . GLU A 1 314 ? 5.723   17.963  38.642  1.00 49.04  ? 314 GLU A CA     1 
ATOM   5130 C  C      . GLU A 1 314 ? 5.414   18.280  37.191  1.00 46.66  ? 314 GLU A C      1 
ATOM   5131 O  O      . GLU A 1 314 ? 5.209   19.443  36.837  1.00 42.59  ? 314 GLU A O      1 
ATOM   5132 C  CB     . GLU A 1 314 ? 7.233   17.988  38.862  1.00 46.82  ? 314 GLU A CB     1 
ATOM   5133 C  CG     . GLU A 1 314 ? 7.827   19.394  38.737  1.00 55.82  ? 314 GLU A CG     1 
ATOM   5134 C  CD     . GLU A 1 314 ? 7.202   20.379  39.727  1.00 65.89  ? 314 GLU A CD     1 
ATOM   5135 O  OE1    . GLU A 1 314 ? 7.082   21.578  39.394  1.00 70.15  ? 314 GLU A OE1    1 
ATOM   5136 O  OE2    . GLU A 1 314 ? 6.822   19.950  40.837  1.00 68.63  ? 314 GLU A OE2    1 
ATOM   5137 H  H      . GLU A 1 314 ? 5.712   16.069  39.234  1.00 59.78  ? 314 GLU A H      1 
ATOM   5138 H  HA     . GLU A 1 314 ? 5.329   18.670  39.194  1.00 58.85  ? 314 GLU A HA     1 
ATOM   5139 H  HB2    . GLU A 1 314 ? 7.427   17.659  39.754  1.00 56.19  ? 314 GLU A HB2    1 
ATOM   5140 H  HB3    . GLU A 1 314 ? 7.659   17.422  38.199  1.00 56.19  ? 314 GLU A HB3    1 
ATOM   5141 H  HG2    . GLU A 1 314 ? 8.780   19.353  38.914  1.00 66.99  ? 314 GLU A HG2    1 
ATOM   5142 H  HG3    . GLU A 1 314 ? 7.669   19.727  37.840  1.00 66.99  ? 314 GLU A HG3    1 
ATOM   5143 N  N      . SER A 1 315 ? 5.363   17.247  36.350  1.00 44.15  ? 315 SER A N      1 
ATOM   5144 C  CA     . SER A 1 315 ? 5.135   17.444  34.916  1.00 42.17  ? 315 SER A CA     1 
ATOM   5145 C  C      . SER A 1 315 ? 3.747   18.017  34.632  1.00 47.83  ? 315 SER A C      1 
ATOM   5146 O  O      . SER A 1 315 ? 3.581   18.833  33.729  1.00 42.61  ? 315 SER A O      1 
ATOM   5147 C  CB     . SER A 1 315 ? 5.317   16.133  34.147  1.00 45.29  ? 315 SER A CB     1 
ATOM   5148 O  OG     . SER A 1 315 ? 4.395   15.141  34.578  1.00 43.04  ? 315 SER A OG     1 
ATOM   5149 H  H      . SER A 1 315 ? 5.457   16.425  36.583  1.00 52.98  ? 315 SER A H      1 
ATOM   5150 H  HA     . SER A 1 315 ? 5.796   18.083  34.577  1.00 50.61  ? 315 SER A HA     1 
ATOM   5151 H  HB2    . SER A 1 315 ? 5.178   16.301  33.202  1.00 54.35  ? 315 SER A HB2    1 
ATOM   5152 H  HB3    . SER A 1 315 ? 6.219   15.807  34.294  1.00 54.35  ? 315 SER A HB3    1 
ATOM   5153 H  HG     . SER A 1 315 ? 3.916   15.443  35.172  1.00 51.64  ? 315 SER A HG     1 
ATOM   5154 N  N      . VAL A 1 316 ? 2.747   17.589  35.399  1.00 47.49  ? 316 VAL A N      1 
ATOM   5155 C  CA     . VAL A 1 316 ? 1.402   18.147  35.258  1.00 50.97  ? 316 VAL A CA     1 
ATOM   5156 C  C      . VAL A 1 316 ? 1.407   19.638  35.624  1.00 53.38  ? 316 VAL A C      1 
ATOM   5157 O  O      . VAL A 1 316 ? 0.839   20.465  34.911  1.00 46.42  ? 316 VAL A O      1 
ATOM   5158 C  CB     . VAL A 1 316 ? 0.377   17.380  36.126  1.00 58.28  ? 316 VAL A CB     1 
ATOM   5159 C  CG1    . VAL A 1 316 ? -1.021  17.946  35.926  1.00 57.27  ? 316 VAL A CG1    1 
ATOM   5160 C  CG2    . VAL A 1 316 ? 0.414   15.873  35.784  1.00 49.81  ? 316 VAL A CG2    1 
ATOM   5161 H  H      . VAL A 1 316 ? 2.819   16.981  36.003  1.00 56.99  ? 316 VAL A H      1 
ATOM   5162 H  HA     . VAL A 1 316 ? 1.122   18.068  34.322  1.00 61.16  ? 316 VAL A HA     1 
ATOM   5163 H  HB     . VAL A 1 316 ? 0.615   17.484  37.070  1.00 69.93  ? 316 VAL A HB     1 
ATOM   5164 H  HG11   . VAL A 1 316 ? -1.637  17.455  36.474  1.00 68.73  ? 316 VAL A HG11   1 
ATOM   5165 H  HG12   . VAL A 1 316 ? -1.021  18.872  36.180  1.00 68.73  ? 316 VAL A HG12   1 
ATOM   5166 H  HG13   . VAL A 1 316 ? -1.263  17.860  35.001  1.00 68.73  ? 316 VAL A HG13   1 
ATOM   5167 H  HG21   . VAL A 1 316 ? -0.228  15.414  36.331  1.00 59.77  ? 316 VAL A HG21   1 
ATOM   5168 H  HG22   . VAL A 1 316 ? 0.195   15.758  34.856  1.00 59.77  ? 316 VAL A HG22   1 
ATOM   5169 H  HG23   . VAL A 1 316 ? 1.295   15.535  35.958  1.00 59.77  ? 316 VAL A HG23   1 
ATOM   5170 N  N      . LYS A 1 317 ? 2.081   19.984  36.717  1.00 51.86  ? 317 LYS A N      1 
ATOM   5171 C  CA     . LYS A 1 317 ? 2.161   21.378  37.144  1.00 48.87  ? 317 LYS A CA     1 
ATOM   5172 C  C      . LYS A 1 317 ? 2.866   22.211  36.082  1.00 58.44  ? 317 LYS A C      1 
ATOM   5173 O  O      . LYS A 1 317 ? 2.479   23.353  35.839  1.00 51.67  ? 317 LYS A O      1 
ATOM   5174 C  CB     . LYS A 1 317 ? 2.879   21.496  38.494  1.00 62.14  ? 317 LYS A CB     1 
ATOM   5175 C  CG     . LYS A 1 317 ? 2.152   20.773  39.635  1.00 62.74  ? 317 LYS A CG     1 
ATOM   5176 C  CD     . LYS A 1 317 ? 2.922   20.813  40.949  1.00 72.44  ? 317 LYS A CD     1 
ATOM   5177 C  CE     . LYS A 1 317 ? 2.242   19.940  42.012  1.00 81.38  ? 317 LYS A CE     1 
ATOM   5178 N  NZ     . LYS A 1 317 ? 3.152   19.539  43.129  1.00 80.97  ? 317 LYS A NZ     1 
ATOM   5179 H  H      . LYS A 1 317 ? 2.499   19.432  37.228  1.00 62.24  ? 317 LYS A H      1 
ATOM   5180 H  HA     . LYS A 1 317 ? 1.253   21.731  37.253  1.00 58.65  ? 317 LYS A HA     1 
ATOM   5181 H  HB2    . LYS A 1 317 ? 3.765   21.109  38.413  1.00 74.57  ? 317 LYS A HB2    1 
ATOM   5182 H  HB3    . LYS A 1 317 ? 2.949   22.434  38.732  1.00 74.57  ? 317 LYS A HB3    1 
ATOM   5183 H  HG2    . LYS A 1 317 ? 1.291   21.197  39.780  1.00 75.29  ? 317 LYS A HG2    1 
ATOM   5184 H  HG3    . LYS A 1 317 ? 2.026   19.843  39.390  1.00 75.29  ? 317 LYS A HG3    1 
ATOM   5185 H  HD2    . LYS A 1 317 ? 3.821   20.477  40.806  1.00 86.93  ? 317 LYS A HD2    1 
ATOM   5186 H  HD3    . LYS A 1 317 ? 2.952   21.726  41.277  1.00 86.93  ? 317 LYS A HD3    1 
ATOM   5187 H  HE2    . LYS A 1 317 ? 1.501   20.433  42.395  1.00 97.65  ? 317 LYS A HE2    1 
ATOM   5188 H  HE3    . LYS A 1 317 ? 1.916   19.130  41.590  1.00 97.65  ? 317 LYS A HE3    1 
ATOM   5189 H  HZ1    . LYS A 1 317 ? 2.710   19.036  43.715  1.00 97.17  ? 317 LYS A HZ1    1 
ATOM   5190 H  HZ2    . LYS A 1 317 ? 3.840   19.073  42.809  1.00 97.17  ? 317 LYS A HZ2    1 
ATOM   5191 H  HZ3    . LYS A 1 317 ? 3.461   20.263  43.544  1.00 97.17  ? 317 LYS A HZ3    1 
ATOM   5192 N  N      . LEU A 1 318 ? 3.890   21.643  35.441  1.00 47.63  ? 318 LEU A N      1 
ATOM   5193 C  CA     . LEU A 1 318 ? 4.617   22.361  34.392  1.00 54.82  ? 318 LEU A CA     1 
ATOM   5194 C  C      . LEU A 1 318 ? 3.773   22.460  33.123  1.00 51.08  ? 318 LEU A C      1 
ATOM   5195 O  O      . LEU A 1 318 ? 3.838   23.453  32.407  1.00 54.56  ? 318 LEU A O      1 
ATOM   5196 C  CB     . LEU A 1 318 ? 5.963   21.689  34.077  1.00 42.72  ? 318 LEU A CB     1 
ATOM   5197 C  CG     . LEU A 1 318 ? 7.000   21.764  35.201  1.00 53.95  ? 318 LEU A CG     1 
ATOM   5198 C  CD1    . LEU A 1 318 ? 8.238   20.946  34.860  1.00 44.52  ? 318 LEU A CD1    1 
ATOM   5199 C  CD2    . LEU A 1 318 ? 7.366   23.227  35.484  1.00 54.95  ? 318 LEU A CD2    1 
ATOM   5200 H  H      . LEU A 1 318 ? 4.181   20.848  35.593  1.00 57.16  ? 318 LEU A H      1 
ATOM   5201 H  HA     . LEU A 1 318 ? 4.802   23.273  34.701  1.00 65.78  ? 318 LEU A HA     1 
ATOM   5202 H  HB2    . LEU A 1 318 ? 5.804   20.751  33.888  1.00 51.27  ? 318 LEU A HB2    1 
ATOM   5203 H  HB3    . LEU A 1 318 ? 6.347   22.118  33.296  1.00 51.27  ? 318 LEU A HB3    1 
ATOM   5204 H  HG     . LEU A 1 318 ? 6.612   21.393  36.009  1.00 64.74  ? 318 LEU A HG     1 
ATOM   5205 H  HD11   . LEU A 1 318 ? 8.866   21.014  35.583  1.00 53.42  ? 318 LEU A HD11   1 
ATOM   5206 H  HD12   . LEU A 1 318 ? 7.982   20.030  34.733  1.00 53.42  ? 318 LEU A HD12   1 
ATOM   5207 H  HD13   . LEU A 1 318 ? 8.628   21.292  34.054  1.00 53.42  ? 318 LEU A HD13   1 
ATOM   5208 H  HD21   . LEU A 1 318 ? 8.015   23.256  36.190  1.00 65.94  ? 318 LEU A HD21   1 
ATOM   5209 H  HD22   . LEU A 1 318 ? 7.731   23.617  34.686  1.00 65.94  ? 318 LEU A HD22   1 
ATOM   5210 H  HD23   . LEU A 1 318 ? 6.574   23.702  35.747  1.00 65.94  ? 318 LEU A HD23   1 
ATOM   5211 N  N      . LEU A 1 319 ? 2.982   21.431  32.838  1.00 50.96  ? 319 LEU A N      1 
ATOM   5212 C  CA     . LEU A 1 319 ? 2.133   21.470  31.651  1.00 54.00  ? 319 LEU A CA     1 
ATOM   5213 C  C      . LEU A 1 319 ? 1.064   22.532  31.859  1.00 60.23  ? 319 LEU A C      1 
ATOM   5214 O  O      . LEU A 1 319 ? 0.697   23.251  30.936  1.00 59.37  ? 319 LEU A O      1 
ATOM   5215 C  CB     . LEU A 1 319 ? 1.486   20.111  31.391  1.00 51.61  ? 319 LEU A CB     1 
ATOM   5216 C  CG     . LEU A 1 319 ? 0.339   20.103  30.368  1.00 55.97  ? 319 LEU A CG     1 
ATOM   5217 C  CD1    . LEU A 1 319 ? 0.777   20.683  29.043  1.00 52.52  ? 319 LEU A CD1    1 
ATOM   5218 C  CD2    . LEU A 1 319 ? -0.184  18.703  30.185  1.00 57.01  ? 319 LEU A CD2    1 
ATOM   5219 H  H      . LEU A 1 319 ? 2.918   20.712  33.304  1.00 61.15  ? 319 LEU A H      1 
ATOM   5220 H  HA     . LEU A 1 319 ? 2.671   21.715  30.869  1.00 64.80  ? 319 LEU A HA     1 
ATOM   5221 H  HB2    . LEU A 1 319 ? 2.169   19.504  31.065  1.00 61.94  ? 319 LEU A HB2    1 
ATOM   5222 H  HB3    . LEU A 1 319 ? 1.129   19.776  32.229  1.00 61.94  ? 319 LEU A HB3    1 
ATOM   5223 H  HG     . LEU A 1 319 ? -0.387  20.650  30.707  1.00 67.16  ? 319 LEU A HG     1 
ATOM   5224 H  HD11   . LEU A 1 319 ? 0.036   20.661  28.433  1.00 63.02  ? 319 LEU A HD11   1 
ATOM   5225 H  HD12   . LEU A 1 319 ? 1.063   21.589  29.178  1.00 63.02  ? 319 LEU A HD12   1 
ATOM   5226 H  HD13   . LEU A 1 319 ? 1.502   20.157  28.697  1.00 63.02  ? 319 LEU A HD13   1 
ATOM   5227 H  HD21   . LEU A 1 319 ? -0.898  18.719  29.544  1.00 68.41  ? 319 LEU A HD21   1 
ATOM   5228 H  HD22   . LEU A 1 319 ? 0.529   18.143  29.869  1.00 68.41  ? 319 LEU A HD22   1 
ATOM   5229 H  HD23   . LEU A 1 319 ? -0.507  18.378  31.029  1.00 68.41  ? 319 LEU A HD23   1 
ATOM   5230 N  N      . GLN A 1 320 ? 0.570   22.630  33.088  1.00 56.12  ? 320 GLN A N      1 
ATOM   5231 C  CA     . GLN A 1 320 ? -0.449  23.614  33.408  1.00 69.18  ? 320 GLN A CA     1 
ATOM   5232 C  C      . GLN A 1 320 ? 0.094   25.021  33.216  1.00 66.97  ? 320 GLN A C      1 
ATOM   5233 O  O      . GLN A 1 320 ? -0.592  25.887  32.682  1.00 62.72  ? 320 GLN A O      1 
ATOM   5234 C  CB     . GLN A 1 320 ? -0.954  23.420  34.832  1.00 61.45  ? 320 GLN A CB     1 
ATOM   5235 C  CG     . GLN A 1 320 ? -1.800  22.184  34.982  1.00 69.85  ? 320 GLN A CG     1 
ATOM   5236 C  CD     . GLN A 1 320 ? -2.838  22.335  36.062  1.00 77.28  ? 320 GLN A CD     1 
ATOM   5237 O  OE1    . GLN A 1 320 ? -2.524  22.321  37.254  1.00 78.12  ? 320 GLN A OE1    1 
ATOM   5238 N  NE2    . GLN A 1 320 ? -4.090  22.493  35.653  1.00 72.54  ? 320 GLN A NE2    1 
ATOM   5239 H  H      . GLN A 1 320 ? 0.810   22.138  33.752  1.00 67.34  ? 320 GLN A H      1 
ATOM   5240 H  HA     . GLN A 1 320 ? -1.208  23.496  32.799  1.00 83.01  ? 320 GLN A HA     1 
ATOM   5241 H  HB2    . GLN A 1 320 ? -0.195  23.338  35.429  1.00 73.74  ? 320 GLN A HB2    1 
ATOM   5242 H  HB3    . GLN A 1 320 ? -1.494  24.186  35.083  1.00 73.74  ? 320 GLN A HB3    1 
ATOM   5243 H  HG2    . GLN A 1 320 ? -2.258  22.009  34.145  1.00 83.82  ? 320 GLN A HG2    1 
ATOM   5244 H  HG3    . GLN A 1 320 ? -1.229  21.435  35.213  1.00 83.82  ? 320 GLN A HG3    1 
ATOM   5245 H  HE21   . GLN A 1 320 ? -4.722  22.584  36.229  1.00 87.04  ? 320 GLN A HE21   1 
ATOM   5246 H  HE22   . GLN A 1 320 ? -4.269  22.505  34.812  1.00 87.04  ? 320 GLN A HE22   1 
ATOM   5247 N  N      . LYS A 1 321 ? 1.335   25.245  33.630  1.00 58.41  ? 321 LYS A N      1 
ATOM   5248 C  CA     . LYS A 1 321 ? 1.954   26.546  33.430  1.00 62.31  ? 321 LYS A CA     1 
ATOM   5249 C  C      . LYS A 1 321 ? 2.004   26.879  31.938  1.00 67.06  ? 321 LYS A C      1 
ATOM   5250 O  O      . LYS A 1 321 ? 1.787   28.022  31.548  1.00 65.59  ? 321 LYS A O      1 
ATOM   5251 C  CB     . LYS A 1 321 ? 3.356   26.577  34.043  1.00 60.49  ? 321 LYS A CB     1 
ATOM   5252 C  CG     . LYS A 1 321 ? 4.091   27.901  33.880  1.00 70.01  ? 321 LYS A CG     1 
ATOM   5253 C  CD     . LYS A 1 321 ? 5.510   27.831  34.449  1.00 73.74  ? 321 LYS A CD     1 
ATOM   5254 C  CE     . LYS A 1 321 ? 5.501   27.826  35.971  1.00 82.05  ? 321 LYS A CE     1 
ATOM   5255 N  NZ     . LYS A 1 321 ? 6.797   27.364  36.562  1.00 85.30  ? 321 LYS A NZ     1 
ATOM   5256 H  H      . LYS A 1 321 ? 1.834   24.667  34.025  1.00 70.09  ? 321 LYS A H      1 
ATOM   5257 H  HA     . LYS A 1 321 ? 1.412   27.230  33.876  1.00 74.78  ? 321 LYS A HA     1 
ATOM   5258 H  HB2    . LYS A 1 321 ? 3.282   26.397  34.994  1.00 72.59  ? 321 LYS A HB2    1 
ATOM   5259 H  HB3    . LYS A 1 321 ? 3.894   25.888  33.622  1.00 72.59  ? 321 LYS A HB3    1 
ATOM   5260 H  HG2    . LYS A 1 321 ? 4.153   28.119  32.937  1.00 84.01  ? 321 LYS A HG2    1 
ATOM   5261 H  HG3    . LYS A 1 321 ? 3.608   28.596  34.354  1.00 84.01  ? 321 LYS A HG3    1 
ATOM   5262 H  HD2    . LYS A 1 321 ? 5.936   27.014  34.146  1.00 88.49  ? 321 LYS A HD2    1 
ATOM   5263 H  HD3    . LYS A 1 321 ? 6.014   28.604  34.150  1.00 88.49  ? 321 LYS A HD3    1 
ATOM   5264 H  HE2    . LYS A 1 321 ? 5.332   28.728  36.288  1.00 98.46  ? 321 LYS A HE2    1 
ATOM   5265 H  HE3    . LYS A 1 321 ? 4.801   27.230  36.281  1.00 98.46  ? 321 LYS A HE3    1 
ATOM   5266 H  HZ1    . LYS A 1 321 ? 6.748   27.377  37.450  1.00 102.36 ? 321 LYS A HZ1    1 
ATOM   5267 H  HZ2    . LYS A 1 321 ? 6.975   26.534  36.294  1.00 102.36 ? 321 LYS A HZ2    1 
ATOM   5268 H  HZ3    . LYS A 1 321 ? 7.458   27.900  36.300  1.00 102.36 ? 321 LYS A HZ3    1 
ATOM   5269 N  N      . ILE A 1 322 ? 2.278   25.886  31.097  1.00 66.49  ? 322 ILE A N      1 
ATOM   5270 C  CA     . ILE A 1 322 ? 2.375   26.137  29.665  1.00 62.07  ? 322 ILE A CA     1 
ATOM   5271 C  C      . ILE A 1 322 ? 0.999   26.470  29.070  1.00 67.27  ? 322 ILE A C      1 
ATOM   5272 O  O      . ILE A 1 322 ? 0.893   27.266  28.139  1.00 62.21  ? 322 ILE A O      1 
ATOM   5273 C  CB     . ILE A 1 322 ? 3.020   24.950  28.911  1.00 61.91  ? 322 ILE A CB     1 
ATOM   5274 C  CG1    . ILE A 1 322 ? 4.506   24.847  29.259  1.00 63.68  ? 322 ILE A CG1    1 
ATOM   5275 C  CG2    . ILE A 1 322 ? 2.871   25.128  27.401  1.00 62.80  ? 322 ILE A CG2    1 
ATOM   5276 C  CD1    . ILE A 1 322 ? 5.155   23.558  28.796  1.00 60.84  ? 322 ILE A CD1    1 
ATOM   5277 H  H      . ILE A 1 322 ? 2.409   25.068  31.328  1.00 79.79  ? 322 ILE A H      1 
ATOM   5278 H  HA     . ILE A 1 322 ? 2.950   26.918  29.527  1.00 74.49  ? 322 ILE A HA     1 
ATOM   5279 H  HB     . ILE A 1 322 ? 2.577   24.130  29.177  1.00 74.29  ? 322 ILE A HB     1 
ATOM   5280 H  HG12   . ILE A 1 322 ? 4.978   25.584  28.839  1.00 76.42  ? 322 ILE A HG12   1 
ATOM   5281 H  HG13   . ILE A 1 322 ? 4.606   24.900  30.222  1.00 76.42  ? 322 ILE A HG13   1 
ATOM   5282 H  HG21   . ILE A 1 322 ? 3.279   24.380  26.957  1.00 75.36  ? 322 ILE A HG21   1 
ATOM   5283 H  HG22   . ILE A 1 322 ? 1.937   25.169  27.183  1.00 75.36  ? 322 ILE A HG22   1 
ATOM   5284 H  HG23   . ILE A 1 322 ? 3.306   25.942  27.138  1.00 75.36  ? 322 ILE A HG23   1 
ATOM   5285 H  HD11   . ILE A 1 322 ? 6.081   23.566  29.048  1.00 73.01  ? 322 ILE A HD11   1 
ATOM   5286 H  HD12   . ILE A 1 322 ? 4.708   22.817  29.212  1.00 73.01  ? 322 ILE A HD12   1 
ATOM   5287 H  HD13   . ILE A 1 322 ? 5.076   23.495  27.841  1.00 73.01  ? 322 ILE A HD13   1 
ATOM   5288 N  N      . LEU A 1 323 ? -0.053  25.876  29.617  1.00 67.95  ? 323 LEU A N      1 
ATOM   5289 C  CA     . LEU A 1 323 ? -1.398  26.120  29.108  1.00 71.94  ? 323 LEU A CA     1 
ATOM   5290 C  C      . LEU A 1 323 ? -1.894  27.528  29.461  1.00 74.22  ? 323 LEU A C      1 
ATOM   5291 O  O      . LEU A 1 323 ? -2.569  28.161  28.653  1.00 70.64  ? 323 LEU A O      1 
ATOM   5292 C  CB     . LEU A 1 323 ? -2.371  25.046  29.604  1.00 67.76  ? 323 LEU A CB     1 
ATOM   5293 C  CG     . LEU A 1 323 ? -2.277  23.714  28.850  1.00 68.11  ? 323 LEU A CG     1 
ATOM   5294 C  CD1    . LEU A 1 323 ? -2.855  22.578  29.684  1.00 65.39  ? 323 LEU A CD1    1 
ATOM   5295 C  CD2    . LEU A 1 323 ? -2.968  23.802  27.497  1.00 64.99  ? 323 LEU A CD2    1 
ATOM   5296 H  H      . LEU A 1 323 ? -0.018  25.329  30.280  1.00 81.54  ? 323 LEU A H      1 
ATOM   5297 H  HA     . LEU A 1 323 ? -1.371  26.058  28.130  1.00 86.33  ? 323 LEU A HA     1 
ATOM   5298 H  HB2    . LEU A 1 323 ? -2.187  24.869  30.540  1.00 81.31  ? 323 LEU A HB2    1 
ATOM   5299 H  HB3    . LEU A 1 323 ? -3.277  25.378  29.505  1.00 81.31  ? 323 LEU A HB3    1 
ATOM   5300 H  HG     . LEU A 1 323 ? -1.341  23.514  28.689  1.00 81.73  ? 323 LEU A HG     1 
ATOM   5301 H  HD11   . LEU A 1 323 ? -2.783  21.759  29.189  1.00 78.47  ? 323 LEU A HD11   1 
ATOM   5302 H  HD12   . LEU A 1 323 ? -2.360  22.510  30.504  1.00 78.47  ? 323 LEU A HD12   1 
ATOM   5303 H  HD13   . LEU A 1 323 ? -3.777  22.768  29.873  1.00 78.47  ? 323 LEU A HD13   1 
ATOM   5304 H  HD21   . LEU A 1 323 ? -2.892  22.955  27.052  1.00 77.99  ? 323 LEU A HD21   1 
ATOM   5305 H  HD22   . LEU A 1 323 ? -3.893  24.019  27.633  1.00 77.99  ? 323 LEU A HD22   1 
ATOM   5306 H  HD23   . LEU A 1 323 ? -2.545  24.487  26.974  1.00 77.99  ? 323 LEU A HD23   1 
ATOM   5307 N  N      . GLU A 1 324 ? -1.560  28.022  30.651  1.00 73.02  ? 324 GLU A N      1 
ATOM   5308 C  CA     . GLU A 1 324 ? -1.888  29.405  31.000  1.00 78.12  ? 324 GLU A CA     1 
ATOM   5309 C  C      . GLU A 1 324 ? -1.218  30.341  30.020  1.00 80.09  ? 324 GLU A C      1 
ATOM   5310 O  O      . GLU A 1 324 ? -1.867  31.115  29.315  1.00 86.44  ? 324 GLU A O      1 
ATOM   5311 C  CB     . GLU A 1 324 ? -1.341  29.798  32.371  1.00 73.21  ? 324 GLU A CB     1 
ATOM   5312 C  CG     . GLU A 1 324 ? -1.869  29.060  33.571  1.00 72.09  ? 324 GLU A CG     1 
ATOM   5313 C  CD     . GLU A 1 324 ? -1.204  29.567  34.844  1.00 83.24  ? 324 GLU A CD     1 
ATOM   5314 O  OE1    . GLU A 1 324 ? -0.932  28.758  35.757  1.00 78.80  ? 324 GLU A OE1    1 
ATOM   5315 O  OE2    . GLU A 1 324 ? -0.936  30.787  34.918  1.00 85.62  ? 324 GLU A OE2    1 
ATOM   5316 H  H      . GLU A 1 324 ? -1.149  27.586  31.267  1.00 87.62  ? 324 GLU A H      1 
ATOM   5317 H  HA     . GLU A 1 324 ? -2.857  29.546  30.980  1.00 93.75  ? 324 GLU A HA     1 
ATOM   5318 H  HB2    . GLU A 1 324 ? -0.380  29.667  32.359  1.00 87.86  ? 324 GLU A HB2    1 
ATOM   5319 H  HB3    . GLU A 1 324 ? -1.531  30.739  32.511  1.00 87.86  ? 324 GLU A HB3    1 
ATOM   5320 H  HG2    . GLU A 1 324 ? -2.825  29.206  33.645  1.00 86.51  ? 324 GLU A HG2    1 
ATOM   5321 H  HG3    . GLU A 1 324 ? -1.676  28.114  33.479  1.00 86.51  ? 324 GLU A HG3    1 
ATOM   5322 N  N      . GLU A 1 325 ? 0.108   30.242  29.996  1.00 72.98  ? 325 GLU A N      1 
ATOM   5323 C  CA     . GLU A 1 325 ? 0.979   31.270  29.440  1.00 76.45  ? 325 GLU A CA     1 
ATOM   5324 C  C      . GLU A 1 325 ? 1.104   31.227  27.919  1.00 70.01  ? 325 GLU A C      1 
ATOM   5325 O  O      . GLU A 1 325 ? 1.913   31.949  27.339  1.00 70.79  ? 325 GLU A O      1 
ATOM   5326 C  CB     . GLU A 1 325 ? 2.354   31.155  30.110  1.00 75.24  ? 325 GLU A CB     1 
ATOM   5327 C  CG     . GLU A 1 325 ? 2.245   31.174  31.643  1.00 72.04  ? 325 GLU A CG     1 
ATOM   5328 C  CD     . GLU A 1 325 ? 3.578   31.045  32.360  1.00 76.20  ? 325 GLU A CD     1 
ATOM   5329 O  OE1    . GLU A 1 325 ? 4.635   31.112  31.696  1.00 71.51  ? 325 GLU A OE1    1 
ATOM   5330 O  OE2    . GLU A 1 325 ? 3.563   30.878  33.600  1.00 75.64  ? 325 GLU A OE2    1 
ATOM   5331 H  H      . GLU A 1 325 ? 0.539   29.566  30.307  1.00 87.58  ? 325 GLU A H      1 
ATOM   5332 H  HA     . GLU A 1 325 ? 0.610   32.147  29.677  1.00 91.74  ? 325 GLU A HA     1 
ATOM   5333 H  HB2    . GLU A 1 325 ? 2.768   30.319  29.846  1.00 90.29  ? 325 GLU A HB2    1 
ATOM   5334 H  HB3    . GLU A 1 325 ? 2.906   31.904  29.836  1.00 90.29  ? 325 GLU A HB3    1 
ATOM   5335 H  HG2    . GLU A 1 325 ? 1.843   32.014  31.916  1.00 86.45  ? 325 GLU A HG2    1 
ATOM   5336 H  HG3    . GLU A 1 325 ? 1.685   30.435  31.925  1.00 86.45  ? 325 GLU A HG3    1 
ATOM   5337 N  N      . ASP A 1 326 ? 0.286   30.400  27.275  1.00 70.97  ? 326 ASP A N      1 
ATOM   5338 C  CA     . ASP A 1 326 ? 0.282   30.315  25.818  1.00 80.70  ? 326 ASP A CA     1 
ATOM   5339 C  C      . ASP A 1 326 ? -1.003  29.647  25.336  1.00 82.58  ? 326 ASP A C      1 
ATOM   5340 O  O      . ASP A 1 326 ? -1.305  28.519  25.732  1.00 84.80  ? 326 ASP A O      1 
ATOM   5341 C  CB     . ASP A 1 326 ? 1.503   29.526  25.345  1.00 81.29  ? 326 ASP A CB     1 
ATOM   5342 C  CG     . ASP A 1 326 ? 1.608   29.462  23.839  1.00 83.97  ? 326 ASP A CG     1 
ATOM   5343 O  OD1    . ASP A 1 326 ? 0.615   29.080  23.186  1.00 87.61  ? 326 ASP A OD1    1 
ATOM   5344 O  OD2    . ASP A 1 326 ? 2.687   29.802  23.310  1.00 85.00  ? 326 ASP A OD2    1 
ATOM   5345 H  H      . ASP A 1 326 ? -0.277  29.876  27.659  1.00 85.16  ? 326 ASP A H      1 
ATOM   5346 H  HA     . ASP A 1 326 ? 0.327   31.217  25.437  1.00 96.84  ? 326 ASP A HA     1 
ATOM   5347 H  HB2    . ASP A 1 326 ? 2.306   29.953  25.684  1.00 97.55  ? 326 ASP A HB2    1 
ATOM   5348 H  HB3    . ASP A 1 326 ? 1.442   28.618  25.681  1.00 97.55  ? 326 ASP A HB3    1 
ATOM   5349 N  N      . GLU A 1 327 ? -1.756  30.323  24.473  1.00 76.40  ? 327 GLU A N      1 
ATOM   5350 C  CA     . GLU A 1 327 ? -3.098  29.841  24.148  1.00 75.55  ? 327 GLU A CA     1 
ATOM   5351 C  C      . GLU A 1 327 ? -3.200  28.998  22.875  1.00 72.27  ? 327 GLU A C      1 
ATOM   5352 O  O      . GLU A 1 327 ? -4.256  28.439  22.587  1.00 68.33  ? 327 GLU A O      1 
ATOM   5353 C  CB     . GLU A 1 327 ? -4.104  30.996  24.120  1.00 79.66  ? 327 GLU A CB     1 
ATOM   5354 C  CG     . GLU A 1 327 ? -3.641  32.247  23.397  1.00 86.67  ? 327 GLU A CG     1 
ATOM   5355 C  CD     . GLU A 1 327 ? -4.674  33.366  23.482  1.00 99.06  ? 327 GLU A CD     1 
ATOM   5356 O  OE1    . GLU A 1 327 ? -5.378  33.449  24.515  1.00 96.64  ? 327 GLU A OE1    1 
ATOM   5357 O  OE2    . GLU A 1 327 ? -4.793  34.150  22.513  1.00 96.56  ? 327 GLU A OE2    1 
ATOM   5358 H  H      . GLU A 1 327 ? -1.522  31.046  24.069  1.00 91.68  ? 327 GLU A H      1 
ATOM   5359 H  HA     . GLU A 1 327 ? -3.376  29.255  24.882  1.00 90.66  ? 327 GLU A HA     1 
ATOM   5360 H  HB2    . GLU A 1 327 ? -4.912  30.688  23.681  1.00 95.59  ? 327 GLU A HB2    1 
ATOM   5361 H  HB3    . GLU A 1 327 ? -4.308  31.247  25.035  1.00 95.59  ? 327 GLU A HB3    1 
ATOM   5362 H  HG2    . GLU A 1 327 ? -2.818  32.563  23.802  1.00 104.01 ? 327 GLU A HG2    1 
ATOM   5363 H  HG3    . GLU A 1 327 ? -3.496  32.039  22.461  1.00 104.01 ? 327 GLU A HG3    1 
ATOM   5364 N  N      . ARG A 1 328 ? -2.113  28.882  22.126  1.00 75.98  ? 328 ARG A N      1 
ATOM   5365 C  CA     . ARG A 1 328 ? -2.097  27.975  20.984  1.00 76.67  ? 328 ARG A CA     1 
ATOM   5366 C  C      . ARG A 1 328 ? -2.370  26.548  21.454  1.00 78.28  ? 328 ARG A C      1 
ATOM   5367 O  O      . ARG A 1 328 ? -2.021  26.186  22.575  1.00 74.20  ? 328 ARG A O      1 
ATOM   5368 C  CB     . ARG A 1 328 ? -0.753  28.045  20.260  1.00 77.12  ? 328 ARG A CB     1 
ATOM   5369 C  CG     . ARG A 1 328 ? -0.490  29.379  19.581  1.00 69.85  ? 328 ARG A CG     1 
ATOM   5370 C  CD     . ARG A 1 328 ? 0.939   29.474  19.079  1.00 75.39  ? 328 ARG A CD     1 
ATOM   5371 N  NE     . ARG A 1 328 ? 1.868   29.912  20.118  1.00 77.84  ? 328 ARG A NE     1 
ATOM   5372 C  CZ     . ARG A 1 328 ? 3.170   30.093  19.917  1.00 83.98  ? 328 ARG A CZ     1 
ATOM   5373 N  NH1    . ARG A 1 328 ? 3.689   29.869  18.717  1.00 80.71  ? 328 ARG A NH1    1 
ATOM   5374 N  NH2    . ARG A 1 328 ? 3.956   30.492  20.909  1.00 79.26  ? 328 ARG A NH2    1 
ATOM   5375 H  H      . ARG A 1 328 ? -1.378  29.311  22.254  1.00 91.18  ? 328 ARG A H      1 
ATOM   5376 H  HA     . ARG A 1 328 ? -2.802  28.233  20.354  1.00 92.01  ? 328 ARG A HA     1 
ATOM   5377 H  HB2    . ARG A 1 328 ? -0.043  27.895  20.904  1.00 92.54  ? 328 ARG A HB2    1 
ATOM   5378 H  HB3    . ARG A 1 328 ? -0.729  27.356  19.578  1.00 92.54  ? 328 ARG A HB3    1 
ATOM   5379 H  HG2    . ARG A 1 328 ? -1.086  29.475  18.822  1.00 83.83  ? 328 ARG A HG2    1 
ATOM   5380 H  HG3    . ARG A 1 328 ? -0.637  30.097  20.216  1.00 83.83  ? 328 ARG A HG3    1 
ATOM   5381 H  HD2    . ARG A 1 328 ? 1.225   28.600  18.769  1.00 90.47  ? 328 ARG A HD2    1 
ATOM   5382 H  HD3    . ARG A 1 328 ? 0.978   30.114  18.351  1.00 90.47  ? 328 ARG A HD3    1 
ATOM   5383 H  HE     . ARG A 1 328 ? 1.574   29.962  20.925  1.00 93.40  ? 328 ARG A HE     1 
ATOM   5384 H  HH11   . ARG A 1 328 ? 3.184   29.610  18.072  1.00 96.86  ? 328 ARG A HH11   1 
ATOM   5385 H  HH12   . ARG A 1 328 ? 4.531   29.985  18.585  1.00 96.86  ? 328 ARG A HH12   1 
ATOM   5386 H  HH21   . ARG A 1 328 ? 3.624   30.638  21.689  1.00 95.11  ? 328 ARG A HH21   1 
ATOM   5387 H  HH22   . ARG A 1 328 ? 4.798   30.606  20.772  1.00 95.11  ? 328 ARG A HH22   1 
ATOM   5388 N  N      . LYS A 1 329 ? -3.004  25.747  20.601  1.00 78.47  ? 329 LYS A N      1 
ATOM   5389 C  CA     . LYS A 1 329 ? -3.270  24.343  20.910  1.00 78.41  ? 329 LYS A CA     1 
ATOM   5390 C  C      . LYS A 1 329 ? -1.994  23.508  20.759  1.00 74.04  ? 329 LYS A C      1 
ATOM   5391 O  O      . LYS A 1 329 ? -1.083  23.884  20.021  1.00 68.27  ? 329 LYS A O      1 
ATOM   5392 C  CB     . LYS A 1 329 ? -4.367  23.796  19.993  1.00 79.90  ? 329 LYS A CB     1 
ATOM   5393 C  CG     . LYS A 1 329 ? -5.676  24.577  20.058  1.00 85.59  ? 329 LYS A CG     1 
ATOM   5394 C  CD     . LYS A 1 329 ? -6.677  24.089  19.007  1.00 85.68  ? 329 LYS A CD     1 
ATOM   5395 C  CE     . LYS A 1 329 ? -7.378  22.802  19.435  1.00 82.51  ? 329 LYS A CE     1 
ATOM   5396 N  NZ     . LYS A 1 329 ? -8.079  22.133  18.290  1.00 87.45  ? 329 LYS A NZ     1 
ATOM   5397 H  H      . LYS A 1 329 ? -3.293  25.994  19.829  1.00 94.17  ? 329 LYS A H      1 
ATOM   5398 H  HA     . LYS A 1 329 ? -3.579  24.268  21.838  1.00 94.09  ? 329 LYS A HA     1 
ATOM   5399 H  HB2    . LYS A 1 329 ? -4.051  23.826  19.077  1.00 95.89  ? 329 LYS A HB2    1 
ATOM   5400 H  HB3    . LYS A 1 329 ? -4.557  22.879  20.246  1.00 95.89  ? 329 LYS A HB3    1 
ATOM   5401 H  HG2    . LYS A 1 329 ? -6.075  24.460  20.934  1.00 102.71 ? 329 LYS A HG2    1 
ATOM   5402 H  HG3    . LYS A 1 329 ? -5.497  25.516  19.894  1.00 102.71 ? 329 LYS A HG3    1 
ATOM   5403 H  HD2    . LYS A 1 329 ? -7.353  24.771  18.872  1.00 102.81 ? 329 LYS A HD2    1 
ATOM   5404 H  HD3    . LYS A 1 329 ? -6.206  23.916  18.177  1.00 102.81 ? 329 LYS A HD3    1 
ATOM   5405 H  HE2    . LYS A 1 329 ? -6.719  22.183  19.788  1.00 99.02  ? 329 LYS A HE2    1 
ATOM   5406 H  HE3    . LYS A 1 329 ? -8.039  23.010  20.114  1.00 99.02  ? 329 LYS A HE3    1 
ATOM   5407 H  HZ1    . LYS A 1 329 ? -8.476  21.388  18.571  1.00 104.94 ? 329 LYS A HZ1    1 
ATOM   5408 H  HZ2    . LYS A 1 329 ? -8.694  22.679  17.950  1.00 104.94 ? 329 LYS A HZ2    1 
ATOM   5409 H  HZ3    . LYS A 1 329 ? -7.492  21.926  17.654  1.00 104.94 ? 329 LYS A HZ3    1 
ATOM   5410 N  N      . ILE A 1 330 ? -1.930  22.373  21.452  1.00 71.49  ? 330 ILE A N      1 
ATOM   5411 C  CA     . ILE A 1 330 ? -0.720  21.550  21.439  1.00 64.29  ? 330 ILE A CA     1 
ATOM   5412 C  C      . ILE A 1 330 ? -0.827  20.364  20.485  1.00 60.53  ? 330 ILE A C      1 
ATOM   5413 O  O      . ILE A 1 330 ? -1.840  19.675  20.439  1.00 63.57  ? 330 ILE A O      1 
ATOM   5414 C  CB     . ILE A 1 330 ? -0.358  21.049  22.849  1.00 51.10  ? 330 ILE A CB     1 
ATOM   5415 C  CG1    . ILE A 1 330 ? -0.072  22.248  23.764  1.00 60.85  ? 330 ILE A CG1    1 
ATOM   5416 C  CG2    . ILE A 1 330 ? 0.858   20.124  22.784  1.00 56.21  ? 330 ILE A CG2    1 
ATOM   5417 C  CD1    . ILE A 1 330 ? 0.255   21.873  25.204  1.00 67.81  ? 330 ILE A CD1    1 
ATOM   5418 H  H      . ILE A 1 330 ? -2.569  22.058  21.934  1.00 85.78  ? 330 ILE A H      1 
ATOM   5419 H  HA     . ILE A 1 330 ? 0.024   22.106  21.128  1.00 77.15  ? 330 ILE A HA     1 
ATOM   5420 H  HB     . ILE A 1 330 ? -1.111  20.553  23.208  1.00 61.32  ? 330 ILE A HB     1 
ATOM   5421 H  HG12   . ILE A 1 330 ? 0.686   22.738  23.408  1.00 73.03  ? 330 ILE A HG12   1 
ATOM   5422 H  HG13   . ILE A 1 330 ? -0.854  22.822  23.779  1.00 73.03  ? 330 ILE A HG13   1 
ATOM   5423 H  HG21   . ILE A 1 330 ? 1.068   19.822  23.670  1.00 67.45  ? 330 ILE A HG21   1 
ATOM   5424 H  HG22   . ILE A 1 330 ? 0.649   19.373  22.223  1.00 67.45  ? 330 ILE A HG22   1 
ATOM   5425 H  HG23   . ILE A 1 330 ? 1.601   20.610  22.418  1.00 67.45  ? 330 ILE A HG23   1 
ATOM   5426 H  HD11   . ILE A 1 330 ? 0.419   22.675  25.706  1.00 81.37  ? 330 ILE A HD11   1 
ATOM   5427 H  HD12   . ILE A 1 330 ? -0.491  21.399  25.580  1.00 81.37  ? 330 ILE A HD12   1 
ATOM   5428 H  HD13   . ILE A 1 330 ? 1.036   21.315  25.212  1.00 81.37  ? 330 ILE A HD13   1 
ATOM   5429 N  N      . ARG A 1 331 ? 0.245   20.142  19.733  1.00 56.62  ? 331 ARG A N      1 
ATOM   5430 C  CA     . ARG A 1 331 ? 0.318   19.090  18.719  1.00 58.32  ? 331 ARG A CA     1 
ATOM   5431 C  C      . ARG A 1 331 ? 1.221   17.930  19.163  1.00 59.02  ? 331 ARG A C      1 
ATOM   5432 O  O      . ARG A 1 331 ? 0.941   16.768  18.885  1.00 56.43  ? 331 ARG A O      1 
ATOM   5433 C  CB     . ARG A 1 331 ? 0.852   19.695  17.421  1.00 62.38  ? 331 ARG A CB     1 
ATOM   5434 C  CG     . ARG A 1 331 ? 0.961   18.736  16.243  1.00 70.37  ? 331 ARG A CG     1 
ATOM   5435 C  CD     . ARG A 1 331 ? 1.500   19.475  15.028  1.00 74.38  ? 331 ARG A CD     1 
ATOM   5436 N  NE     . ARG A 1 331 ? 1.939   18.579  13.964  1.00 78.65  ? 331 ARG A NE     1 
ATOM   5437 C  CZ     . ARG A 1 331 ? 1.243   18.319  12.861  1.00 86.03  ? 331 ARG A CZ     1 
ATOM   5438 N  NH1    . ARG A 1 331 ? 0.058   18.884  12.659  1.00 84.76  ? 331 ARG A NH1    1 
ATOM   5439 N  NH2    . ARG A 1 331 ? 1.740   17.491  11.951  1.00 74.37  ? 331 ARG A NH2    1 
ATOM   5440 H  H      . ARG A 1 331 ? 0.969   20.604  19.792  1.00 67.94  ? 331 ARG A H      1 
ATOM   5441 H  HA     . ARG A 1 331 ? -0.580  18.736  18.551  1.00 69.99  ? 331 ARG A HA     1 
ATOM   5442 H  HB2    . ARG A 1 331 ? 0.261   20.416  17.154  1.00 74.86  ? 331 ARG A HB2    1 
ATOM   5443 H  HB3    . ARG A 1 331 ? 1.739   20.049  17.590  1.00 74.86  ? 331 ARG A HB3    1 
ATOM   5444 H  HG2    . ARG A 1 331 ? 1.573   18.017  16.464  1.00 84.44  ? 331 ARG A HG2    1 
ATOM   5445 H  HG3    . ARG A 1 331 ? 0.083   18.384  16.027  1.00 84.44  ? 331 ARG A HG3    1 
ATOM   5446 H  HD2    . ARG A 1 331 ? 0.801   20.045  14.671  1.00 89.25  ? 331 ARG A HD2    1 
ATOM   5447 H  HD3    . ARG A 1 331 ? 2.260   20.013  15.299  1.00 89.25  ? 331 ARG A HD3    1 
ATOM   5448 H  HE     . ARG A 1 331 ? 2.701   18.191  14.056  1.00 94.38  ? 331 ARG A HE     1 
ATOM   5449 H  HH11   . ARG A 1 331 ? -0.267  19.422  13.246  1.00 101.71 ? 331 ARG A HH11   1 
ATOM   5450 H  HH12   . ARG A 1 331 ? -0.385  18.710  11.943  1.00 101.71 ? 331 ARG A HH12   1 
ATOM   5451 H  HH21   . ARG A 1 331 ? 2.506   17.123  12.078  1.00 89.25  ? 331 ARG A HH21   1 
ATOM   5452 H  HH22   . ARG A 1 331 ? 1.292   17.319  11.237  1.00 89.25  ? 331 ARG A HH22   1 
ATOM   5453 N  N      . ARG A 1 332 ? 2.320   18.254  19.838  1.00 53.88  ? 332 ARG A N      1 
ATOM   5454 C  CA     . ARG A 1 332 ? 3.223   17.240  20.361  1.00 53.92  ? 332 ARG A CA     1 
ATOM   5455 C  C      . ARG A 1 332 ? 3.528   17.580  21.817  1.00 52.21  ? 332 ARG A C      1 
ATOM   5456 O  O      . ARG A 1 332 ? 3.549   18.752  22.212  1.00 44.44  ? 332 ARG A O      1 
ATOM   5457 C  CB     . ARG A 1 332 ? 4.513   17.179  19.528  1.00 60.77  ? 332 ARG A CB     1 
ATOM   5458 C  CG     . ARG A 1 332 ? 4.279   16.984  18.017  1.00 66.92  ? 332 ARG A CG     1 
ATOM   5459 C  CD     . ARG A 1 332 ? 5.584   17.028  17.201  1.00 70.52  ? 332 ARG A CD     1 
ATOM   5460 N  NE     . ARG A 1 332 ? 6.510   15.979  17.622  1.00 73.77  ? 332 ARG A NE     1 
ATOM   5461 C  CZ     . ARG A 1 332 ? 7.836   16.095  17.651  1.00 77.20  ? 332 ARG A CZ     1 
ATOM   5462 N  NH1    . ARG A 1 332 ? 8.431   17.220  17.269  1.00 78.04  ? 332 ARG A NH1    1 
ATOM   5463 N  NH2    . ARG A 1 332 ? 8.571   15.069  18.067  1.00 67.91  ? 332 ARG A NH2    1 
ATOM   5464 H  H      . ARG A 1 332 ? 2.565   19.061  20.006  1.00 64.65  ? 332 ARG A H      1 
ATOM   5465 H  HA     . ARG A 1 332 ? 2.787   16.362  20.329  1.00 64.71  ? 332 ARG A HA     1 
ATOM   5466 H  HB2    . ARG A 1 332 ? 4.999   18.010  19.647  1.00 72.92  ? 332 ARG A HB2    1 
ATOM   5467 H  HB3    . ARG A 1 332 ? 5.051   16.436  19.843  1.00 72.92  ? 332 ARG A HB3    1 
ATOM   5468 H  HG2    . ARG A 1 332 ? 3.864   16.120  17.871  1.00 80.31  ? 332 ARG A HG2    1 
ATOM   5469 H  HG3    . ARG A 1 332 ? 3.699   17.690  17.693  1.00 80.31  ? 332 ARG A HG3    1 
ATOM   5470 H  HD2    . ARG A 1 332 ? 5.379   16.895  16.262  1.00 84.62  ? 332 ARG A HD2    1 
ATOM   5471 H  HD3    . ARG A 1 332 ? 6.016   17.886  17.333  1.00 84.62  ? 332 ARG A HD3    1 
ATOM   5472 H  HE     . ARG A 1 332 ? 6.172   15.228  17.870  1.00 88.52  ? 332 ARG A HE     1 
ATOM   5473 H  HH11   . ARG A 1 332 ? 7.959   17.888  17.003  1.00 93.65  ? 332 ARG A HH11   1 
ATOM   5474 H  HH12   . ARG A 1 332 ? 9.289   17.282  17.291  1.00 93.65  ? 332 ARG A HH12   1 
ATOM   5475 H  HH21   . ARG A 1 332 ? 8.189   14.338  18.312  1.00 81.49  ? 332 ARG A HH21   1 
ATOM   5476 H  HH22   . ARG A 1 332 ? 9.428   15.133  18.084  1.00 81.49  ? 332 ARG A HH22   1 
ATOM   5477 N  N      . ILE A 1 333 ? 3.749   16.563  22.632  1.00 50.84  ? 333 ILE A N      1 
ATOM   5478 C  CA     . ILE A 1 333 ? 4.000   16.804  24.043  1.00 45.16  ? 333 ILE A CA     1 
ATOM   5479 C  C      . ILE A 1 333 ? 5.038   15.818  24.544  1.00 47.27  ? 333 ILE A C      1 
ATOM   5480 O  O      . ILE A 1 333 ? 5.037   14.647  24.151  1.00 46.79  ? 333 ILE A O      1 
ATOM   5481 C  CB     . ILE A 1 333 ? 2.688   16.690  24.861  1.00 49.88  ? 333 ILE A CB     1 
ATOM   5482 C  CG1    . ILE A 1 333 ? 2.900   17.185  26.292  1.00 51.18  ? 333 ILE A CG1    1 
ATOM   5483 C  CG2    . ILE A 1 333 ? 2.154   15.259  24.823  1.00 45.97  ? 333 ILE A CG2    1 
ATOM   5484 C  CD1    . ILE A 1 333 ? 3.389   18.637  26.373  1.00 48.45  ? 333 ILE A CD1    1 
ATOM   5485 H  H      . ILE A 1 333 ? 3.759   15.735  22.399  1.00 61.01  ? 333 ILE A H      1 
ATOM   5486 H  HA     . ILE A 1 333 ? 4.356   17.710  24.158  1.00 54.19  ? 333 ILE A HA     1 
ATOM   5487 H  HB     . ILE A 1 333 ? 2.027   17.264  24.443  1.00 59.85  ? 333 ILE A HB     1 
ATOM   5488 H  HG12   . ILE A 1 333 ? 2.059   17.127  26.771  1.00 61.42  ? 333 ILE A HG12   1 
ATOM   5489 H  HG13   . ILE A 1 333 ? 3.564   16.623  26.723  1.00 61.42  ? 333 ILE A HG13   1 
ATOM   5490 H  HG21   . ILE A 1 333 ? 1.343   15.215  25.335  1.00 55.16  ? 333 ILE A HG21   1 
ATOM   5491 H  HG22   . ILE A 1 333 ? 1.979   15.016  23.911  1.00 55.16  ? 333 ILE A HG22   1 
ATOM   5492 H  HG23   . ILE A 1 333 ? 2.812   14.670  25.199  1.00 55.16  ? 333 ILE A HG23   1 
ATOM   5493 H  HD11   . ILE A 1 333 ? 3.500   18.878  27.296  1.00 58.14  ? 333 ILE A HD11   1 
ATOM   5494 H  HD12   . ILE A 1 333 ? 4.228   18.710  25.912  1.00 58.14  ? 333 ILE A HD12   1 
ATOM   5495 H  HD13   . ILE A 1 333 ? 2.738   19.209  25.960  1.00 58.14  ? 333 ILE A HD13   1 
ATOM   5496 N  N      . GLY A 1 334 ? 5.948   16.288  25.390  1.00 39.47  ? 334 GLY A N      1 
ATOM   5497 C  CA     . GLY A 1 334 ? 6.958   15.401  25.929  1.00 44.45  ? 334 GLY A CA     1 
ATOM   5498 C  C      . GLY A 1 334 ? 7.690   16.019  27.091  1.00 46.33  ? 334 GLY A C      1 
ATOM   5499 O  O      . GLY A 1 334 ? 7.317   17.075  27.592  1.00 41.40  ? 334 GLY A O      1 
ATOM   5500 H  H      . GLY A 1 334 ? 5.999   17.102  25.661  1.00 47.37  ? 334 GLY A H      1 
ATOM   5501 H  HA2    . GLY A 1 334 ? 6.540   14.579  26.230  1.00 53.34  ? 334 GLY A HA2    1 
ATOM   5502 H  HA3    . GLY A 1 334 ? 7.603   15.185  25.238  1.00 53.34  ? 334 GLY A HA3    1 
ATOM   5503 N  N      . VAL A 1 335 ? 8.750   15.352  27.515  1.00 40.78  ? 335 VAL A N      1 
ATOM   5504 C  CA     . VAL A 1 335 ? 9.581   15.844  28.600  1.00 44.55  ? 335 VAL A CA     1 
ATOM   5505 C  C      . VAL A 1 335 ? 11.029  15.686  28.214  1.00 44.46  ? 335 VAL A C      1 
ATOM   5506 O  O      . VAL A 1 335 ? 11.355  14.872  27.336  1.00 36.80  ? 335 VAL A O      1 
ATOM   5507 C  CB     . VAL A 1 335 ? 9.345   15.040  29.905  1.00 46.42  ? 335 VAL A CB     1 
ATOM   5508 C  CG1    . VAL A 1 335 ? 7.988   15.340  30.461  1.00 36.60  ? 335 VAL A CG1    1 
ATOM   5509 C  CG2    . VAL A 1 335 ? 9.490   13.543  29.648  1.00 43.80  ? 335 VAL A CG2    1 
ATOM   5510 H  H      . VAL A 1 335 ? 9.013   14.602  27.186  1.00 48.93  ? 335 VAL A H      1 
ATOM   5511 H  HA     . VAL A 1 335 ? 9.394   16.792  28.766  1.00 53.46  ? 335 VAL A HA     1 
ATOM   5512 H  HB     . VAL A 1 335 ? 10.014  15.303  30.572  1.00 55.70  ? 335 VAL A HB     1 
ATOM   5513 H  HG11   . VAL A 1 335 ? 7.862   14.834  31.267  1.00 43.92  ? 335 VAL A HG11   1 
ATOM   5514 H  HG12   . VAL A 1 335 ? 7.929   16.280  30.651  1.00 43.92  ? 335 VAL A HG12   1 
ATOM   5515 H  HG13   . VAL A 1 335 ? 7.324   15.095  29.813  1.00 43.92  ? 335 VAL A HG13   1 
ATOM   5516 H  HG21   . VAL A 1 335 ? 9.340   13.069  30.469  1.00 52.55  ? 335 VAL A HG21   1 
ATOM   5517 H  HG22   . VAL A 1 335 ? 8.843   13.275  28.992  1.00 52.55  ? 335 VAL A HG22   1 
ATOM   5518 H  HG23   . VAL A 1 335 ? 10.377  13.366  29.325  1.00 52.55  ? 335 VAL A HG23   1 
ATOM   5519 N  N      . ARG A 1 336 ? 11.888  16.460  28.876  1.00 33.54  ? 336 ARG A N      1 
ATOM   5520 C  CA     . ARG A 1 336 ? 13.335  16.270  28.818  1.00 45.40  ? 336 ARG A CA     1 
ATOM   5521 C  C      . ARG A 1 336 ? 13.867  16.338  30.236  1.00 42.31  ? 336 ARG A C      1 
ATOM   5522 O  O      . ARG A 1 336 ? 13.414  17.159  31.024  1.00 38.92  ? 336 ARG A O      1 
ATOM   5523 C  CB     . ARG A 1 336 ? 14.054  17.387  28.054  1.00 43.25  ? 336 ARG A CB     1 
ATOM   5524 C  CG     . ARG A 1 336 ? 13.529  17.755  26.688  1.00 63.91  ? 336 ARG A CG     1 
ATOM   5525 C  CD     . ARG A 1 336 ? 14.494  18.781  26.053  1.00 80.97  ? 336 ARG A CD     1 
ATOM   5526 N  NE     . ARG A 1 336 ? 15.609  19.109  26.954  1.00 79.50  ? 336 ARG A NE     1 
ATOM   5527 C  CZ     . ARG A 1 336 ? 15.836  20.309  27.491  1.00 80.70  ? 336 ARG A CZ     1 
ATOM   5528 N  NH1    . ARG A 1 336 ? 15.043  21.342  27.213  1.00 75.28  ? 336 ARG A NH1    1 
ATOM   5529 N  NH2    . ARG A 1 336 ? 16.875  20.481  28.305  1.00 77.67  ? 336 ARG A NH2    1 
ATOM   5530 H  H      . ARG A 1 336 ? 11.649  17.117  29.376  1.00 40.25  ? 336 ARG A H      1 
ATOM   5531 H  HA     . ARG A 1 336 ? 13.556  15.401  28.422  1.00 54.48  ? 336 ARG A HA     1 
ATOM   5532 H  HB2    . ARG A 1 336 ? 14.019  18.190  28.596  1.00 51.90  ? 336 ARG A HB2    1 
ATOM   5533 H  HB3    . ARG A 1 336 ? 14.980  17.122  27.939  1.00 51.90  ? 336 ARG A HB3    1 
ATOM   5534 H  HG2    . ARG A 1 336 ? 13.495  16.966  26.124  1.00 76.70  ? 336 ARG A HG2    1 
ATOM   5535 H  HG3    . ARG A 1 336 ? 12.651  18.160  26.770  1.00 76.70  ? 336 ARG A HG3    1 
ATOM   5536 H  HD2    . ARG A 1 336 ? 14.863  18.409  25.236  1.00 97.16  ? 336 ARG A HD2    1 
ATOM   5537 H  HD3    . ARG A 1 336 ? 14.009  19.599  25.860  1.00 97.16  ? 336 ARG A HD3    1 
ATOM   5538 H  HE     . ARG A 1 336 ? 16.158  18.477  27.151  1.00 95.41  ? 336 ARG A HE     1 
ATOM   5539 H  HH11   . ARG A 1 336 ? 14.369  21.238  26.690  1.00 90.33  ? 336 ARG A HH11   1 
ATOM   5540 H  HH12   . ARG A 1 336 ? 15.202  22.111  27.562  1.00 90.33  ? 336 ARG A HH12   1 
ATOM   5541 H  HH21   . ARG A 1 336 ? 17.394  19.819  28.486  1.00 93.20  ? 336 ARG A HH21   1 
ATOM   5542 H  HH22   . ARG A 1 336 ? 17.029  21.255  28.647  1.00 93.20  ? 336 ARG A HH22   1 
ATOM   5543 N  N      . PHE A 1 337 ? 14.883  15.539  30.516  1.00 36.78  ? 337 PHE A N      1 
ATOM   5544 C  CA     . PHE A 1 337 ? 15.496  15.460  31.825  1.00 39.29  ? 337 PHE A CA     1 
ATOM   5545 C  C      . PHE A 1 337 ? 16.960  15.847  31.691  1.00 43.55  ? 337 PHE A C      1 
ATOM   5546 O  O      . PHE A 1 337 ? 17.592  15.527  30.686  1.00 37.76  ? 337 PHE A O      1 
ATOM   5547 C  CB     . PHE A 1 337 ? 15.359  14.029  32.361  1.00 36.05  ? 337 PHE A CB     1 
ATOM   5548 C  CG     . PHE A 1 337 ? 13.942  13.672  32.722  1.00 48.66  ? 337 PHE A CG     1 
ATOM   5549 C  CD1    . PHE A 1 337 ? 13.426  14.024  33.963  1.00 42.58  ? 337 PHE A CD1    1 
ATOM   5550 C  CD2    . PHE A 1 337 ? 13.111  13.024  31.805  1.00 42.66  ? 337 PHE A CD2    1 
ATOM   5551 C  CE1    . PHE A 1 337 ? 12.100  13.716  34.294  1.00 44.28  ? 337 PHE A CE1    1 
ATOM   5552 C  CE2    . PHE A 1 337 ? 11.791  12.716  32.123  1.00 43.23  ? 337 PHE A CE2    1 
ATOM   5553 C  CZ     . PHE A 1 337 ? 11.282  13.066  33.366  1.00 47.67  ? 337 PHE A CZ     1 
ATOM   5554 H  H      . PHE A 1 337 ? 15.248  15.015  29.940  1.00 44.14  ? 337 PHE A H      1 
ATOM   5555 H  HA     . PHE A 1 337 ? 15.054  16.079  32.443  1.00 47.15  ? 337 PHE A HA     1 
ATOM   5556 H  HB2    . PHE A 1 337 ? 15.660  13.406  31.681  1.00 43.26  ? 337 PHE A HB2    1 
ATOM   5557 H  HB3    . PHE A 1 337 ? 15.903  13.937  33.159  1.00 43.26  ? 337 PHE A HB3    1 
ATOM   5558 H  HD1    . PHE A 1 337 ? 13.965  14.463  34.580  1.00 51.09  ? 337 PHE A HD1    1 
ATOM   5559 H  HD2    . PHE A 1 337 ? 13.445  12.794  30.969  1.00 51.19  ? 337 PHE A HD2    1 
ATOM   5560 H  HE1    . PHE A 1 337 ? 11.763  13.950  35.129  1.00 53.14  ? 337 PHE A HE1    1 
ATOM   5561 H  HE2    . PHE A 1 337 ? 11.252  12.279  31.504  1.00 51.87  ? 337 PHE A HE2    1 
ATOM   5562 H  HZ     . PHE A 1 337 ? 10.403  12.854  33.586  1.00 57.21  ? 337 PHE A HZ     1 
ATOM   5563 N  N      . SER A 1 338 ? 17.493  16.533  32.699  1.00 38.60  ? 338 SER A N      1 
ATOM   5564 C  CA     . SER A 1 338 ? 18.875  17.004  32.658  1.00 45.19  ? 338 SER A CA     1 
ATOM   5565 C  C      . SER A 1 338 ? 19.462  17.236  34.063  1.00 48.72  ? 338 SER A C      1 
ATOM   5566 O  O      . SER A 1 338 ? 18.850  16.869  35.074  1.00 39.85  ? 338 SER A O      1 
ATOM   5567 C  CB     . SER A 1 338 ? 18.961  18.289  31.828  1.00 50.93  ? 338 SER A CB     1 
ATOM   5568 O  OG     . SER A 1 338 ? 18.059  19.261  32.319  1.00 48.45  ? 338 SER A OG     1 
ATOM   5569 H  H      . SER A 1 338 ? 17.074  16.739  33.421  1.00 46.31  ? 338 SER A H      1 
ATOM   5570 H  HA     . SER A 1 338 ? 19.425  16.325  32.214  1.00 54.23  ? 338 SER A HA     1 
ATOM   5571 H  HB2    . SER A 1 338 ? 19.864  18.640  31.882  1.00 61.12  ? 338 SER A HB2    1 
ATOM   5572 H  HB3    . SER A 1 338 ? 18.738  18.087  30.907  1.00 61.12  ? 338 SER A HB3    1 
ATOM   5573 H  HG     . SER A 1 338 ? 18.112  19.945  31.870  1.00 58.14  ? 338 SER A HG     1 
ATOM   5574 N  N      . LYS A 1 339 ? 20.651  17.839  34.105  1.00 48.12  ? 339 LYS A N      1 
ATOM   5575 C  CA     . LYS A 1 339 ? 21.365  18.120  35.352  1.00 53.69  ? 339 LYS A CA     1 
ATOM   5576 C  C      . LYS A 1 339 ? 21.505  16.843  36.167  1.00 54.11  ? 339 LYS A C      1 
ATOM   5577 O  O      . LYS A 1 339 ? 21.043  16.762  37.312  1.00 45.74  ? 339 LYS A O      1 
ATOM   5578 C  CB     . LYS A 1 339 ? 20.643  19.197  36.169  1.00 44.40  ? 339 LYS A CB     1 
ATOM   5579 C  CG     . LYS A 1 339 ? 20.284  20.453  35.384  1.00 52.90  ? 339 LYS A CG     1 
ATOM   5580 C  CD     . LYS A 1 339 ? 20.166  21.667  36.303  1.00 58.54  ? 339 LYS A CD     1 
ATOM   5581 C  CE     . LYS A 1 339 ? 19.535  22.854  35.581  1.00 64.84  ? 339 LYS A CE     1 
ATOM   5582 N  NZ     . LYS A 1 339 ? 19.466  24.046  36.464  1.00 58.18  ? 339 LYS A NZ     1 
ATOM   5583 H  H      . LYS A 1 339 ? 21.074  18.102  33.405  1.00 57.75  ? 339 LYS A H      1 
ATOM   5584 H  HA     . LYS A 1 339 ? 22.264  18.447  35.141  1.00 64.42  ? 339 LYS A HA     1 
ATOM   5585 H  HB2    . LYS A 1 339 ? 19.819  18.822  36.516  1.00 53.27  ? 339 LYS A HB2    1 
ATOM   5586 H  HB3    . LYS A 1 339 ? 21.216  19.463  36.905  1.00 53.27  ? 339 LYS A HB3    1 
ATOM   5587 H  HG2    . LYS A 1 339 ? 20.978  20.632  34.731  1.00 63.47  ? 339 LYS A HG2    1 
ATOM   5588 H  HG3    . LYS A 1 339 ? 19.431  20.322  34.942  1.00 63.47  ? 339 LYS A HG3    1 
ATOM   5589 H  HD2    . LYS A 1 339 ? 19.607  21.441  37.063  1.00 70.25  ? 339 LYS A HD2    1 
ATOM   5590 H  HD3    . LYS A 1 339 ? 21.050  21.929  36.603  1.00 70.25  ? 339 LYS A HD3    1 
ATOM   5591 H  HE2    . LYS A 1 339 ? 20.071  23.080  34.805  1.00 77.80  ? 339 LYS A HE2    1 
ATOM   5592 H  HE3    . LYS A 1 339 ? 18.633  22.622  35.310  1.00 77.80  ? 339 LYS A HE3    1 
ATOM   5593 H  HZ1    . LYS A 1 339 ? 18.975  23.863  37.184  1.00 69.82  ? 339 LYS A HZ1    1 
ATOM   5594 H  HZ2    . LYS A 1 339 ? 20.284  24.280  36.724  1.00 69.82  ? 339 LYS A HZ2    1 
ATOM   5595 H  HZ3    . LYS A 1 339 ? 19.096  24.728  36.027  1.00 69.82  ? 339 LYS A HZ3    1 
ATOM   5596 N  N      . PHE A 1 340 ? 22.132  15.842  35.559  1.00 47.38  ? 340 PHE A N      1 
ATOM   5597 C  CA     . PHE A 1 340 ? 22.258  14.525  36.166  1.00 55.28  ? 340 PHE A CA     1 
ATOM   5598 C  C      . PHE A 1 340 ? 23.229  14.545  37.351  1.00 61.48  ? 340 PHE A C      1 
ATOM   5599 O  O      . PHE A 1 340 ? 24.209  15.296  37.356  1.00 48.26  ? 340 PHE A O      1 
ATOM   5600 C  CB     . PHE A 1 340 ? 22.729  13.500  35.126  1.00 52.99  ? 340 PHE A CB     1 
ATOM   5601 C  CG     . PHE A 1 340 ? 21.882  13.459  33.876  1.00 52.72  ? 340 PHE A CG     1 
ATOM   5602 C  CD1    . PHE A 1 340 ? 20.538  13.128  33.936  1.00 49.87  ? 340 PHE A CD1    1 
ATOM   5603 C  CD2    . PHE A 1 340 ? 22.437  13.745  32.640  1.00 56.41  ? 340 PHE A CD2    1 
ATOM   5604 C  CE1    . PHE A 1 340 ? 19.757  13.092  32.781  1.00 51.30  ? 340 PHE A CE1    1 
ATOM   5605 C  CE2    . PHE A 1 340 ? 21.666  13.704  31.482  1.00 56.68  ? 340 PHE A CE2    1 
ATOM   5606 C  CZ     . PHE A 1 340 ? 20.327  13.379  31.552  1.00 47.22  ? 340 PHE A CZ     1 
ATOM   5607 H  H      . PHE A 1 340 ? 22.498  15.902  34.783  1.00 56.86  ? 340 PHE A H      1 
ATOM   5608 H  HA     . PHE A 1 340 ? 21.381  14.241  36.497  1.00 66.34  ? 340 PHE A HA     1 
ATOM   5609 H  HB2    . PHE A 1 340 ? 23.636  13.718  34.861  1.00 63.59  ? 340 PHE A HB2    1 
ATOM   5610 H  HB3    . PHE A 1 340 ? 22.707  12.617  35.526  1.00 63.59  ? 340 PHE A HB3    1 
ATOM   5611 H  HD1    . PHE A 1 340 ? 20.149  12.935  34.759  1.00 59.84  ? 340 PHE A HD1    1 
ATOM   5612 H  HD2    . PHE A 1 340 ? 23.339  13.965  32.582  1.00 67.69  ? 340 PHE A HD2    1 
ATOM   5613 H  HE1    . PHE A 1 340 ? 18.856  12.869  32.835  1.00 61.56  ? 340 PHE A HE1    1 
ATOM   5614 H  HE2    . PHE A 1 340 ? 22.054  13.901  30.660  1.00 68.02  ? 340 PHE A HE2    1 
ATOM   5615 H  HZ     . PHE A 1 340 ? 19.811  13.354  30.779  1.00 56.66  ? 340 PHE A HZ     1 
ATOM   5616 N  N      . ILE A 1 341 ? 22.949  13.710  38.349  1.00 51.98  ? 341 ILE A N      1 
ATOM   5617 C  CA     . ILE A 1 341 ? 23.807  13.585  39.520  1.00 65.33  ? 341 ILE A CA     1 
ATOM   5618 C  C      . ILE A 1 341 ? 25.163  13.005  39.133  1.00 61.44  ? 341 ILE A C      1 
ATOM   5619 O  O      . ILE A 1 341 ? 25.224  11.987  38.443  1.00 63.28  ? 341 ILE A O      1 
ATOM   5620 C  CB     . ILE A 1 341 ? 23.154  12.670  40.571  1.00 67.74  ? 341 ILE A CB     1 
ATOM   5621 C  CG1    . ILE A 1 341 ? 21.969  13.385  41.224  1.00 57.64  ? 341 ILE A CG1    1 
ATOM   5622 C  CG2    . ILE A 1 341 ? 24.165  12.255  41.628  1.00 65.52  ? 341 ILE A CG2    1 
ATOM   5623 C  CD1    . ILE A 1 341 ? 21.151  12.480  42.129  1.00 65.72  ? 341 ILE A CD1    1 
ATOM   5624 H  H      . ILE A 1 341 ? 22.258  13.198  38.369  1.00 62.37  ? 341 ILE A H      1 
ATOM   5625 H  HA     . ILE A 1 341 ? 23.948  14.469  39.919  1.00 78.40  ? 341 ILE A HA     1 
ATOM   5626 H  HB     . ILE A 1 341 ? 22.827  11.873  40.126  1.00 81.29  ? 341 ILE A HB     1 
ATOM   5627 H  HG12   . ILE A 1 341 ? 22.302  14.121  41.760  1.00 69.17  ? 341 ILE A HG12   1 
ATOM   5628 H  HG13   . ILE A 1 341 ? 21.382  13.721  40.529  1.00 69.17  ? 341 ILE A HG13   1 
ATOM   5629 H  HG21   . ILE A 1 341 ? 23.731  11.687  42.269  1.00 78.62  ? 341 ILE A HG21   1 
ATOM   5630 H  HG22   . ILE A 1 341 ? 24.883  11.782  41.204  1.00 78.62  ? 341 ILE A HG22   1 
ATOM   5631 H  HG23   . ILE A 1 341 ? 24.502  13.042  42.063  1.00 78.62  ? 341 ILE A HG23   1 
ATOM   5632 H  HD11   . ILE A 1 341 ? 20.427  12.987  42.504  1.00 78.86  ? 341 ILE A HD11   1 
ATOM   5633 H  HD12   . ILE A 1 341 ? 20.805  11.750  41.610  1.00 78.86  ? 341 ILE A HD12   1 
ATOM   5634 H  HD13   . ILE A 1 341 ? 21.716  12.146  42.829  1.00 78.86  ? 341 ILE A HD13   1 
ATOM   5635 O  "O5'"  . DG  B 2 1   ? 32.501  48.233  32.210  1.00 82.28  ? 1   DG  P "O5'"  1 
ATOM   5636 C  "C5'"  . DG  B 2 1   ? 31.318  48.002  32.989  1.00 71.98  ? 1   DG  P "C5'"  1 
ATOM   5637 C  "C4'"  . DG  B 2 1   ? 31.467  46.728  33.802  1.00 67.14  ? 1   DG  P "C4'"  1 
ATOM   5638 O  "O4'"  . DG  B 2 1   ? 30.515  46.695  34.891  1.00 58.45  ? 1   DG  P "O4'"  1 
ATOM   5639 C  "C3'"  . DG  B 2 1   ? 31.258  45.434  33.023  1.00 63.17  ? 1   DG  P "C3'"  1 
ATOM   5640 O  "O3'"  . DG  B 2 1   ? 32.479  44.714  33.109  1.00 67.88  ? 1   DG  P "O3'"  1 
ATOM   5641 C  "C2'"  . DG  B 2 1   ? 30.081  44.740  33.716  1.00 62.66  ? 1   DG  P "C2'"  1 
ATOM   5642 C  "C1'"  . DG  B 2 1   ? 30.116  45.366  35.107  1.00 62.41  ? 1   DG  P "C1'"  1 
ATOM   5643 N  N9     . DG  B 2 1   ? 28.842  45.416  35.812  1.00 55.20  ? 1   DG  P N9     1 
ATOM   5644 C  C8     . DG  B 2 1   ? 27.724  46.136  35.457  1.00 56.69  ? 1   DG  P C8     1 
ATOM   5645 N  N7     . DG  B 2 1   ? 26.731  45.994  36.279  1.00 52.79  ? 1   DG  P N7     1 
ATOM   5646 C  C5     . DG  B 2 1   ? 27.220  45.124  37.238  1.00 52.21  ? 1   DG  P C5     1 
ATOM   5647 C  C6     . DG  B 2 1   ? 26.584  44.612  38.380  1.00 55.11  ? 1   DG  P C6     1 
ATOM   5648 O  O6     . DG  B 2 1   ? 25.428  44.858  38.738  1.00 48.32  ? 1   DG  P O6     1 
ATOM   5649 N  N1     . DG  B 2 1   ? 27.423  43.755  39.100  1.00 52.82  ? 1   DG  P N1     1 
ATOM   5650 C  C2     . DG  B 2 1   ? 28.717  43.443  38.752  1.00 56.80  ? 1   DG  P C2     1 
ATOM   5651 N  N2     . DG  B 2 1   ? 29.399  42.605  39.557  1.00 54.26  ? 1   DG  P N2     1 
ATOM   5652 N  N3     . DG  B 2 1   ? 29.321  43.926  37.680  1.00 53.21  ? 1   DG  P N3     1 
ATOM   5653 C  C4     . DG  B 2 1   ? 28.517  44.759  36.974  1.00 56.40  ? 1   DG  P C4     1 
ATOM   5654 H  "H5'"  . DG  B 2 1   ? 30.547  47.917  32.391  1.00 86.37  ? 1   DG  P "H5'"  1 
ATOM   5655 H  "H5''" . DG  B 2 1   ? 31.176  48.759  33.596  1.00 86.37  ? 1   DG  P "H5''" 1 
ATOM   5656 H  "H4'"  . DG  B 2 1   ? 32.369  46.713  34.183  1.00 80.57  ? 1   DG  P "H4'"  1 
ATOM   5657 H  "H3'"  . DG  B 2 1   ? 31.039  45.630  32.088  1.00 75.80  ? 1   DG  P "H3'"  1 
ATOM   5658 H  "H2'"  . DG  B 2 1   ? 29.237  44.946  33.262  1.00 75.19  ? 1   DG  P "H2'"  1 
ATOM   5659 H  "H2''" . DG  B 2 1   ? 30.227  43.772  33.766  1.00 75.19  ? 1   DG  P "H2''" 1 
ATOM   5660 H  "H1'"  . DG  B 2 1   ? 30.782  44.907  35.660  1.00 74.90  ? 1   DG  P "H1'"  1 
ATOM   5661 H  H8     . DG  B 2 1   ? 27.683  46.705  34.659  1.00 68.02  ? 1   DG  P H8     1 
ATOM   5662 H  H1     . DG  B 2 1   ? 27.063  43.349  39.916  1.00 63.38  ? 1   DG  P H1     1 
ATOM   5663 H  H21    . DG  B 2 1   ? 30.324  42.364  39.341  1.00 65.11  ? 1   DG  P H21    1 
ATOM   5664 H  H22    . DG  B 2 1   ? 28.970  42.236  40.357  1.00 65.11  ? 1   DG  P H22    1 
ATOM   5665 H  "HO5'" . DG  B 2 1   ? 32.427  48.596  31.303  1.00 98.73  ? 1   DG  P "HO5'" 1 
ATOM   5666 P  P      . DG  B 2 2   ? 32.743  43.440  32.170  1.00 67.82  ? 2   DG  P P      1 
ATOM   5667 O  OP1    . DG  B 2 2   ? 34.208  43.308  31.998  1.00 75.49  ? 2   DG  P OP1    1 
ATOM   5668 O  OP2    . DG  B 2 2   ? 31.877  43.554  30.976  1.00 66.53  ? 2   DG  P OP2    1 
ATOM   5669 O  "O5'"  . DG  B 2 2   ? 32.164  42.224  33.029  1.00 64.26  ? 2   DG  P "O5'"  1 
ATOM   5670 C  "C5'"  . DG  B 2 2   ? 32.762  41.888  34.269  1.00 68.05  ? 2   DG  P "C5'"  1 
ATOM   5671 C  "C4'"  . DG  B 2 2   ? 31.984  40.755  34.900  1.00 76.35  ? 2   DG  P "C4'"  1 
ATOM   5672 O  "O4'"  . DG  B 2 2   ? 30.745  41.263  35.475  1.00 70.18  ? 2   DG  P "O4'"  1 
ATOM   5673 C  "C3'"  . DG  B 2 2   ? 31.541  39.670  33.920  1.00 75.88  ? 2   DG  P "C3'"  1 
ATOM   5674 O  "O3'"  . DG  B 2 2   ? 31.418  38.446  34.606  1.00 75.73  ? 2   DG  P "O3'"  1 
ATOM   5675 C  "C2'"  . DG  B 2 2   ? 30.170  40.187  33.516  1.00 74.02  ? 2   DG  P "C2'"  1 
ATOM   5676 C  "C1'"  . DG  B 2 2   ? 29.685  40.516  34.921  1.00 67.59  ? 2   DG  P "C1'"  1 
ATOM   5677 N  N9     . DG  B 2 2   ? 28.432  41.247  34.998  1.00 63.50  ? 2   DG  P N9     1 
ATOM   5678 C  C8     . DG  B 2 2   ? 27.873  42.105  34.075  1.00 63.26  ? 2   DG  P C8     1 
ATOM   5679 N  N7     . DG  B 2 2   ? 26.722  42.592  34.463  1.00 61.92  ? 2   DG  P N7     1 
ATOM   5680 C  C5     . DG  B 2 2   ? 26.505  42.014  35.718  1.00 62.70  ? 2   DG  P C5     1 
ATOM   5681 C  C6     . DG  B 2 2   ? 25.420  42.148  36.628  1.00 59.31  ? 2   DG  P C6     1 
ATOM   5682 O  O6     . DG  B 2 2   ? 24.394  42.848  36.507  1.00 56.22  ? 2   DG  P O6     1 
ATOM   5683 N  N1     . DG  B 2 2   ? 25.619  41.374  37.773  1.00 57.28  ? 2   DG  P N1     1 
ATOM   5684 C  C2     . DG  B 2 2   ? 26.720  40.575  38.008  1.00 61.72  ? 2   DG  P C2     1 
ATOM   5685 N  N2     . DG  B 2 2   ? 26.760  39.895  39.163  1.00 57.26  ? 2   DG  P N2     1 
ATOM   5686 N  N3     . DG  B 2 2   ? 27.732  40.442  37.164  1.00 62.03  ? 2   DG  P N3     1 
ATOM   5687 C  C4     . DG  B 2 2   ? 27.553  41.183  36.048  1.00 59.26  ? 2   DG  P C4     1 
ATOM   5688 H  "H5'"  . DG  B 2 2   ? 32.747  42.667  34.863  1.00 81.66  ? 2   DG  P "H5'"  1 
ATOM   5689 H  "H5''" . DG  B 2 2   ? 33.689  41.607  34.121  1.00 81.66  ? 2   DG  P "H5''" 1 
ATOM   5690 H  "H4'"  . DG  B 2 2   ? 32.524  40.347  35.609  1.00 91.62  ? 2   DG  P "H4'"  1 
ATOM   5691 H  "H3'"  . DG  B 2 2   ? 32.146  39.604  33.152  1.00 91.06  ? 2   DG  P "H3'"  1 
ATOM   5692 H  "H2'"  . DG  B 2 2   ? 30.235  40.989  32.957  1.00 88.82  ? 2   DG  P "H2'"  1 
ATOM   5693 H  "H2''" . DG  B 2 2   ? 29.627  39.486  33.099  1.00 88.82  ? 2   DG  P "H2''" 1 
ATOM   5694 H  "H1'"  . DG  B 2 2   ? 29.592  39.681  35.425  1.00 81.11  ? 2   DG  P "H1'"  1 
ATOM   5695 H  H8     . DG  B 2 2   ? 28.298  42.334  33.222  1.00 75.91  ? 2   DG  P H8     1 
ATOM   5696 H  H1     . DG  B 2 2   ? 24.928  41.407  38.467  1.00 68.74  ? 2   DG  P H1     1 
ATOM   5697 H  H21    . DG  B 2 2   ? 27.525  39.317  39.365  1.00 68.72  ? 2   DG  P H21    1 
ATOM   5698 H  H22    . DG  B 2 2   ? 26.024  39.976  39.805  1.00 68.72  ? 2   DG  P H22    1 
ATOM   5699 P  P      . DC  B 2 3   ? 32.077  37.105  34.013  1.00 95.17  ? 3   DC  P P      1 
ATOM   5700 O  OP1    . DC  B 2 3   ? 33.545  37.185  34.222  1.00 81.77  ? 3   DC  P OP1    1 
ATOM   5701 O  OP2    . DC  B 2 3   ? 31.513  36.874  32.654  1.00 57.44  ? 3   DC  P OP2    1 
ATOM   5702 O  "O5'"  . DC  B 2 3   ? 31.509  35.971  34.979  1.00 76.58  ? 3   DC  P "O5'"  1 
ATOM   5703 C  "C5'"  . DC  B 2 3   ? 31.747  36.101  36.369  1.00 71.76  ? 3   DC  P "C5'"  1 
ATOM   5704 C  "C4'"  . DC  B 2 3   ? 30.620  35.459  37.146  1.00 79.25  ? 3   DC  P "C4'"  1 
ATOM   5705 O  "O4'"  . DC  B 2 3   ? 29.475  36.351  37.198  1.00 71.27  ? 3   DC  P "O4'"  1 
ATOM   5706 C  "C3'"  . DC  B 2 3   ? 30.115  34.154  36.545  1.00 78.12  ? 3   DC  P "C3'"  1 
ATOM   5707 O  "O3'"  . DC  B 2 3   ? 29.861  33.232  37.593  1.00 88.44  ? 3   DC  P "O3'"  1 
ATOM   5708 C  "C2'"  . DC  B 2 3   ? 28.848  34.575  35.808  1.00 76.11  ? 3   DC  P "C2'"  1 
ATOM   5709 C  "C1'"  . DC  B 2 3   ? 28.326  35.691  36.705  1.00 76.84  ? 3   DC  P "C1'"  1 
ATOM   5710 N  N1     . DC  B 2 3   ? 27.476  36.701  36.010  1.00 68.10  ? 3   DC  P N1     1 
ATOM   5711 C  C2     . DC  B 2 3   ? 26.253  37.070  36.569  1.00 68.03  ? 3   DC  P C2     1 
ATOM   5712 O  O2     . DC  B 2 3   ? 25.912  36.535  37.634  1.00 63.46  ? 3   DC  P O2     1 
ATOM   5713 N  N3     . DC  B 2 3   ? 25.495  38.001  35.929  1.00 64.78  ? 3   DC  P N3     1 
ATOM   5714 C  C4     . DC  B 2 3   ? 25.920  38.538  34.782  1.00 67.50  ? 3   DC  P C4     1 
ATOM   5715 N  N4     . DC  B 2 3   ? 25.152  39.444  34.166  1.00 59.84  ? 3   DC  P N4     1 
ATOM   5716 C  C5     . DC  B 2 3   ? 27.164  38.166  34.201  1.00 66.55  ? 3   DC  P C5     1 
ATOM   5717 C  C6     . DC  B 2 3   ? 27.903  37.259  34.846  1.00 66.71  ? 3   DC  P C6     1 
ATOM   5718 H  "H5'"  . DC  B 2 3   ? 31.802  37.052  36.602  1.00 86.11  ? 3   DC  P "H5'"  1 
ATOM   5719 H  "H5''" . DC  B 2 3   ? 32.592  35.661  36.597  1.00 86.11  ? 3   DC  P "H5''" 1 
ATOM   5720 H  "H4'"  . DC  B 2 3   ? 30.927  35.286  38.061  1.00 95.10  ? 3   DC  P "H4'"  1 
ATOM   5721 H  "H3'"  . DC  B 2 3   ? 30.772  33.790  35.916  1.00 93.75  ? 3   DC  P "H3'"  1 
ATOM   5722 H  "H2'"  . DC  B 2 3   ? 29.060  34.915  34.914  1.00 91.33  ? 3   DC  P "H2'"  1 
ATOM   5723 H  "H2''" . DC  B 2 3   ? 28.208  33.835  35.762  1.00 91.33  ? 3   DC  P "H2''" 1 
ATOM   5724 H  "H1'"  . DC  B 2 3   ? 27.827  35.302  37.453  1.00 92.21  ? 3   DC  P "H1'"  1 
ATOM   5725 H  H41    . DC  B 2 3   ? 25.450  39.847  33.324  1.00 71.80  ? 3   DC  P H41    1 
ATOM   5726 H  H42    . DC  B 2 3   ? 24.292  39.704  34.557  1.00 71.80  ? 3   DC  P H42    1 
ATOM   5727 H  H5     . DC  B 2 3   ? 27.472  38.567  33.361  1.00 79.86  ? 3   DC  P H5     1 
ATOM   5728 H  H6     . DC  B 2 3   ? 28.765  36.985  34.469  1.00 80.05  ? 3   DC  P H6     1 
ATOM   5729 P  P      . DA  B 2 4   ? 29.608  31.682  37.264  1.00 88.80  ? 4   DA  P P      1 
ATOM   5730 O  OP1    . DA  B 2 4   ? 30.281  30.881  38.314  1.00 84.69  ? 4   DA  P OP1    1 
ATOM   5731 O  OP2    . DA  B 2 4   ? 29.907  31.467  35.825  1.00 78.72  ? 4   DA  P OP2    1 
ATOM   5732 O  "O5'"  . DA  B 2 4   ? 28.038  31.513  37.478  1.00 74.10  ? 4   DA  P "O5'"  1 
ATOM   5733 C  "C5'"  . DA  B 2 4   ? 27.518  31.784  38.770  1.00 77.03  ? 4   DA  P "C5'"  1 
ATOM   5734 C  "C4'"  . DA  B 2 4   ? 26.010  31.680  38.746  1.00 78.38  ? 4   DA  P "C4'"  1 
ATOM   5735 O  "O4'"  . DA  B 2 4   ? 25.420  32.810  38.041  1.00 78.53  ? 4   DA  P "O4'"  1 
ATOM   5736 C  "C3'"  . DA  B 2 4   ? 25.512  30.441  38.018  1.00 81.27  ? 4   DA  P "C3'"  1 
ATOM   5737 O  "O3'"  . DA  B 2 4   ? 24.388  29.950  38.717  1.00 86.83  ? 4   DA  P "O3'"  1 
ATOM   5738 C  "C2'"  . DA  B 2 4   ? 25.161  30.968  36.630  1.00 69.09  ? 4   DA  P "C2'"  1 
ATOM   5739 C  "C1'"  . DA  B 2 4   ? 24.591  32.332  36.996  1.00 75.46  ? 4   DA  P "C1'"  1 
ATOM   5740 N  N9     . DA  B 2 4   ? 24.614  33.307  35.918  1.00 70.67  ? 4   DA  P N9     1 
ATOM   5741 C  C8     . DA  B 2 4   ? 25.600  33.470  34.987  1.00 69.60  ? 4   DA  P C8     1 
ATOM   5742 N  N7     . DA  B 2 4   ? 25.360  34.434  34.134  1.00 65.41  ? 4   DA  P N7     1 
ATOM   5743 C  C5     . DA  B 2 4   ? 24.131  34.935  34.537  1.00 64.58  ? 4   DA  P C5     1 
ATOM   5744 C  C6     . DA  B 2 4   ? 23.330  35.981  34.033  1.00 62.04  ? 4   DA  P C6     1 
ATOM   5745 N  N6     . DA  B 2 4   ? 23.685  36.718  32.972  1.00 55.42  ? 4   DA  P N6     1 
ATOM   5746 N  N1     . DA  B 2 4   ? 22.161  36.232  34.661  1.00 54.25  ? 4   DA  P N1     1 
ATOM   5747 C  C2     . DA  B 2 4   ? 21.827  35.483  35.727  1.00 66.57  ? 4   DA  P C2     1 
ATOM   5748 N  N3     . DA  B 2 4   ? 22.501  34.475  36.292  1.00 63.99  ? 4   DA  P N3     1 
ATOM   5749 C  C4     . DA  B 2 4   ? 23.655  34.251  35.638  1.00 63.43  ? 4   DA  P C4     1 
ATOM   5750 H  "H5'"  . DA  B 2 4   ? 27.778  32.689  39.043  1.00 92.44  ? 4   DA  P "H5'"  1 
ATOM   5751 H  "H5''" . DA  B 2 4   ? 27.879  31.135  39.409  1.00 92.44  ? 4   DA  P "H5''" 1 
ATOM   5752 H  "H4'"  . DA  B 2 4   ? 25.675  31.667  39.667  1.00 94.06  ? 4   DA  P "H4'"  1 
ATOM   5753 H  "H3'"  . DA  B 2 4   ? 26.217  29.762  37.966  1.00 97.52  ? 4   DA  P "H3'"  1 
ATOM   5754 H  "H2'"  . DA  B 2 4   ? 25.961  31.057  36.072  1.00 82.91  ? 4   DA  P "H2'"  1 
ATOM   5755 H  "H2''" . DA  B 2 4   ? 24.484  30.406  36.198  1.00 82.91  ? 4   DA  P "H2''" 1 
ATOM   5756 H  "H1'"  . DA  B 2 4   ? 23.674  32.227  37.326  1.00 90.55  ? 4   DA  P "H1'"  1 
ATOM   5757 H  H8     . DA  B 2 4   ? 26.409  32.918  34.959  1.00 83.52  ? 4   DA  P H8     1 
ATOM   5758 H  H61    . DA  B 2 4   ? 23.098  37.435  32.654  1.00 66.50  ? 4   DA  P H61    1 
ATOM   5759 H  H62    . DA  B 2 4   ? 24.533  36.540  32.513  1.00 66.50  ? 4   DA  P H62    1 
ATOM   5760 H  H2     . DA  B 2 4   ? 20.969  35.705  36.146  1.00 79.88  ? 4   DA  P H2     1 
ATOM   5761 P  P      . DC  B 2 5   ? 23.996  28.396  38.630  1.00 79.67  ? 5   DC  P P      1 
ATOM   5762 O  OP1    . DC  B 2 5   ? 24.431  27.745  39.883  1.00 89.65  ? 5   DC  P OP1    1 
ATOM   5763 O  OP2    . DC  B 2 5   ? 24.465  27.879  37.320  1.00 66.95  ? 5   DC  P OP2    1 
ATOM   5764 O  "O5'"  . DC  B 2 5   ? 22.407  28.429  38.584  1.00 78.90  ? 5   DC  P "O5'"  1 
ATOM   5765 C  "C5'"  . DC  B 2 5   ? 21.860  28.483  37.293  1.00 79.52  ? 5   DC  P "C5'"  1 
ATOM   5766 C  "C4'"  . DC  B 2 5   ? 20.716  29.458  37.181  1.00 76.63  ? 5   DC  P "C4'"  1 
ATOM   5767 O  "O4'"  . DC  B 2 5   ? 21.186  30.698  36.595  1.00 68.41  ? 5   DC  P "O4'"  1 
ATOM   5768 C  "C3'"  . DC  B 2 5   ? 19.660  28.892  36.246  1.00 75.68  ? 5   DC  P "C3'"  1 
ATOM   5769 O  "O3'"  . DC  B 2 5   ? 18.438  28.665  36.911  1.00 73.21  ? 5   DC  P "O3'"  1 
ATOM   5770 C  "C2'"  . DC  B 2 5   ? 19.506  29.906  35.116  1.00 74.64  ? 5   DC  P "C2'"  1 
ATOM   5771 C  "C1'"  . DC  B 2 5   ? 20.265  31.128  35.610  1.00 72.97  ? 5   DC  P "C1'"  1 
ATOM   5772 N  N1     . DC  B 2 5   ? 21.001  31.784  34.510  1.00 69.96  ? 5   DC  P N1     1 
ATOM   5773 C  C2     . DC  B 2 5   ? 20.380  32.825  33.809  1.00 59.12  ? 5   DC  P C2     1 
ATOM   5774 O  O2     . DC  B 2 5   ? 19.236  33.171  34.129  1.00 59.15  ? 5   DC  P O2     1 
ATOM   5775 N  N3     . DC  B 2 5   ? 21.063  33.425  32.805  1.00 57.02  ? 5   DC  P N3     1 
ATOM   5776 C  C4     . DC  B 2 5   ? 22.295  33.022  32.499  1.00 62.24  ? 5   DC  P C4     1 
ATOM   5777 N  N4     . DC  B 2 5   ? 22.908  33.655  31.496  1.00 50.42  ? 5   DC  P N4     1 
ATOM   5778 C  C5     . DC  B 2 5   ? 22.942  31.955  33.202  1.00 58.81  ? 5   DC  P C5     1 
ATOM   5779 C  C6     . DC  B 2 5   ? 22.263  31.370  34.192  1.00 62.31  ? 5   DC  P C6     1 
ATOM   5780 H  "H5'"  . DC  B 2 5   ? 21.539  27.590  37.049  1.00 95.42  ? 5   DC  P "H5'"  1 
ATOM   5781 H  "H5''" . DC  B 2 5   ? 22.563  28.749  36.664  1.00 95.42  ? 5   DC  P "H5''" 1 
ATOM   5782 H  "H4'"  . DC  B 2 5   ? 20.328  29.627  38.065  1.00 91.96  ? 5   DC  P "H4'"  1 
ATOM   5783 H  "H3'"  . DC  B 2 5   ? 19.983  28.045  35.874  1.00 90.81  ? 5   DC  P "H3'"  1 
ATOM   5784 H  "H2'"  . DC  B 2 5   ? 19.908  29.562  34.290  1.00 89.57  ? 5   DC  P "H2'"  1 
ATOM   5785 H  "H2''" . DC  B 2 5   ? 18.560  30.122  34.975  1.00 89.57  ? 5   DC  P "H2''" 1 
ATOM   5786 H  "H1'"  . DC  B 2 5   ? 19.635  31.765  36.007  1.00 87.56  ? 5   DC  P "H1'"  1 
ATOM   5787 H  H41    . DC  B 2 5   ? 23.816  33.394  31.234  1.00 60.50  ? 5   DC  P H41    1 
ATOM   5788 H  H42    . DC  B 2 5   ? 22.451  34.381  31.022  1.00 60.50  ? 5   DC  P H42    1 
ATOM   5789 H  H5     . DC  B 2 5   ? 23.849  31.667  32.968  1.00 70.57  ? 5   DC  P H5     1 
ATOM   5790 H  H6     . DC  B 2 5   ? 22.676  30.639  34.698  1.00 74.77  ? 5   DC  P H6     1 
ATOM   5791 P  P      . DT  B 2 6   ? 17.456  27.520  36.379  1.00 82.07  ? 6   DT  P P      1 
ATOM   5792 O  OP1    . DT  B 2 6   ? 16.525  27.167  37.480  1.00 80.20  ? 6   DT  P OP1    1 
ATOM   5793 O  OP2    . DT  B 2 6   ? 18.282  26.516  35.680  1.00 64.19  ? 6   DT  P OP2    1 
ATOM   5794 O  "O5'"  . DT  B 2 6   ? 16.636  28.235  35.204  1.00 68.95  ? 6   DT  P "O5'"  1 
ATOM   5795 C  "C5'"  . DT  B 2 6   ? 15.776  29.350  35.441  1.00 71.67  ? 6   DT  P "C5'"  1 
ATOM   5796 C  "C4'"  . DT  B 2 6   ? 15.220  29.870  34.123  1.00 63.38  ? 6   DT  P "C4'"  1 
ATOM   5797 O  "O4'"  . DT  B 2 6   ? 16.240  30.615  33.422  1.00 58.60  ? 6   DT  P "O4'"  1 
ATOM   5798 C  "C3'"  . DT  B 2 6   ? 14.771  28.780  33.151  1.00 66.26  ? 6   DT  P "C3'"  1 
ATOM   5799 O  "O3'"  . DT  B 2 6   ? 13.363  28.774  33.074  1.00 61.55  ? 6   DT  P "O3'"  1 
ATOM   5800 C  "C2'"  . DT  B 2 6   ? 15.418  29.112  31.805  1.00 63.16  ? 6   DT  P "C2'"  1 
ATOM   5801 C  "C1'"  . DT  B 2 6   ? 16.030  30.485  32.037  1.00 63.31  ? 6   DT  P "C1'"  1 
ATOM   5802 N  N1     . DT  B 2 6   ? 17.362  30.683  31.469  1.00 60.81  ? 6   DT  P N1     1 
ATOM   5803 C  C2     . DT  B 2 6   ? 17.560  31.737  30.613  1.00 55.81  ? 6   DT  P C2     1 
ATOM   5804 O  O2     . DT  B 2 6   ? 16.679  32.505  30.285  1.00 59.21  ? 6   DT  P O2     1 
ATOM   5805 N  N3     . DT  B 2 6   ? 18.835  31.853  30.150  1.00 53.51  ? 6   DT  P N3     1 
ATOM   5806 C  C4     . DT  B 2 6   ? 19.916  31.055  30.460  1.00 58.85  ? 6   DT  P C4     1 
ATOM   5807 O  O4     . DT  B 2 6   ? 21.031  31.275  29.981  1.00 50.45  ? 6   DT  P O4     1 
ATOM   5808 C  C5     . DT  B 2 6   ? 19.631  29.971  31.374  1.00 58.46  ? 6   DT  P C5     1 
ATOM   5809 C  C7     . DT  B 2 6   ? 20.720  29.027  31.781  1.00 63.61  ? 6   DT  P C7     1 
ATOM   5810 C  C6     . DT  B 2 6   ? 18.383  29.840  31.835  1.00 52.93  ? 6   DT  P C6     1 
ATOM   5811 H  "H5'"  . DT  B 2 6   ? 16.283  30.063  35.884  1.00 86.01  ? 6   DT  P "H5'"  1 
ATOM   5812 H  "H5''" . DT  B 2 6   ? 15.035  29.072  36.019  1.00 86.01  ? 6   DT  P "H5''" 1 
ATOM   5813 H  "H4'"  . DT  B 2 6   ? 14.462  30.464  34.309  1.00 76.06  ? 6   DT  P "H4'"  1 
ATOM   5814 H  "H3'"  . DT  B 2 6   ? 15.088  27.908  33.464  1.00 79.51  ? 6   DT  P "H3'"  1 
ATOM   5815 H  "H2'"  . DT  B 2 6   ? 16.114  28.457  31.586  1.00 75.79  ? 6   DT  P "H2'"  1 
ATOM   5816 H  "H2''" . DT  B 2 6   ? 14.742  29.151  31.097  1.00 75.79  ? 6   DT  P "H2''" 1 
ATOM   5817 H  "H1'"  . DT  B 2 6   ? 15.421  31.185  31.723  1.00 75.97  ? 6   DT  P "H1'"  1 
ATOM   5818 H  H3     . DT  B 2 6   ? 19.008  32.598  29.537  1.00 64.22  ? 6   DT  P H3     1 
ATOM   5819 H  H71    . DT  B 2 6   ? 20.478  28.115  31.516  1.00 76.33  ? 6   DT  P H71    1 
ATOM   5820 H  H72    . DT  B 2 6   ? 21.557  29.284  31.342  1.00 76.33  ? 6   DT  P H72    1 
ATOM   5821 H  H73    . DT  B 2 6   ? 20.837  29.064  32.754  1.00 76.33  ? 6   DT  P H73    1 
ATOM   5822 H  H6     . DT  B 2 6   ? 18.187  29.107  32.455  1.00 63.52  ? 6   DT  P H6     1 
ATOM   5823 P  P      . DG  B 2 7   ? 12.617  27.699  32.143  1.00 82.51  ? 7   DG  P P      1 
ATOM   5824 O  OP1    . DG  B 2 7   ? 11.303  27.395  32.761  1.00 68.01  ? 7   DG  P OP1    1 
ATOM   5825 O  OP2    . DG  B 2 7   ? 13.588  26.632  31.820  1.00 58.21  ? 7   DG  P OP2    1 
ATOM   5826 O  "O5'"  . DG  B 2 7   ? 12.376  28.488  30.771  1.00 63.97  ? 7   DG  P "O5'"  1 
ATOM   5827 C  "C5'"  . DG  B 2 7   ? 11.449  29.563  30.726  1.00 59.48  ? 7   DG  P "C5'"  1 
ATOM   5828 C  "C4'"  . DG  B 2 7   ? 11.546  30.193  29.356  1.00 59.15  ? 7   DG  P "C4'"  1 
ATOM   5829 O  "O4'"  . DG  B 2 7   ? 12.927  30.517  29.061  1.00 47.09  ? 7   DG  P "O4'"  1 
ATOM   5830 C  "C3'"  . DG  B 2 7   ? 11.098  29.290  28.216  1.00 60.34  ? 7   DG  P "C3'"  1 
ATOM   5831 O  "O3'"  . DG  B 2 7   ? 10.384  30.114  27.337  1.00 63.25  ? 7   DG  P "O3'"  1 
ATOM   5832 C  "C2'"  . DG  B 2 7   ? 12.392  28.721  27.627  1.00 52.09  ? 7   DG  P "C2'"  1 
ATOM   5833 C  "C1'"  . DG  B 2 7   ? 13.359  29.862  27.874  1.00 52.63  ? 7   DG  P "C1'"  1 
ATOM   5834 N  N9     . DG  B 2 7   ? 14.746  29.462  28.045  1.00 53.90  ? 7   DG  P N9     1 
ATOM   5835 C  C8     . DG  B 2 7   ? 15.286  28.407  28.756  1.00 59.16  ? 7   DG  P C8     1 
ATOM   5836 N  N7     . DG  B 2 7   ? 16.594  28.361  28.700  1.00 56.76  ? 7   DG  P N7     1 
ATOM   5837 C  C5     . DG  B 2 7   ? 16.933  29.458  27.911  1.00 47.45  ? 7   DG  P C5     1 
ATOM   5838 C  C6     . DG  B 2 7   ? 18.191  29.943  27.477  1.00 58.36  ? 7   DG  P C6     1 
ATOM   5839 O  O6     . DG  B 2 7   ? 19.315  29.480  27.721  1.00 55.74  ? 7   DG  P O6     1 
ATOM   5840 N  N1     . DG  B 2 7   ? 18.061  31.083  26.674  1.00 52.38  ? 7   DG  P N1     1 
ATOM   5841 C  C2     . DG  B 2 7   ? 16.866  31.674  26.345  1.00 56.26  ? 7   DG  P C2     1 
ATOM   5842 N  N2     . DG  B 2 7   ? 16.905  32.765  25.574  1.00 50.19  ? 7   DG  P N2     1 
ATOM   5843 N  N3     . DG  B 2 7   ? 15.691  31.229  26.738  1.00 51.58  ? 7   DG  P N3     1 
ATOM   5844 C  C4     . DG  B 2 7   ? 15.805  30.131  27.508  1.00 54.50  ? 7   DG  P C4     1 
ATOM   5845 H  "H5'"  . DG  B 2 7   ? 11.674  30.224  31.413  1.00 71.38  ? 7   DG  P "H5'"  1 
ATOM   5846 H  "H5''" . DG  B 2 7   ? 10.541  29.224  30.873  1.00 71.38  ? 7   DG  P "H5''" 1 
ATOM   5847 H  "H4'"  . DG  B 2 7   ? 11.013  31.016  29.343  1.00 70.98  ? 7   DG  P "H4'"  1 
ATOM   5848 H  "H3'"  . DG  B 2 7   ? 10.527  28.569  28.554  1.00 72.41  ? 7   DG  P "H3'"  1 
ATOM   5849 H  "H2'"  . DG  B 2 7   ? 12.672  27.914  28.108  1.00 62.51  ? 7   DG  P "H2'"  1 
ATOM   5850 H  "H2''" . DG  B 2 7   ? 12.294  28.546  26.668  1.00 62.51  ? 7   DG  P "H2''" 1 
ATOM   5851 H  "H1'"  . DG  B 2 7   ? 13.302  30.493  27.126  1.00 63.15  ? 7   DG  P "H1'"  1 
ATOM   5852 H  H8     . DG  B 2 7   ? 14.745  27.760  29.254  1.00 70.99  ? 7   DG  P H8     1 
ATOM   5853 H  H1     . DG  B 2 7   ? 18.881  31.494  26.331  1.00 62.86  ? 7   DG  P H1     1 
ATOM   5854 H  H21    . DG  B 2 7   ? 16.072  33.212  25.316  1.00 60.23  ? 7   DG  P H21    1 
ATOM   5855 H  H22    . DG  B 2 7   ? 17.766  33.117  25.267  1.00 60.23  ? 7   DG  P H22    1 
ATOM   5856 P  P      . DA  B 2 8   ? 9.840   29.541  25.945  1.00 56.98  ? 8   DA  P P      1 
ATOM   5857 O  OP1    . DA  B 2 8   ? 8.466   30.070  25.747  1.00 62.52  ? 8   DA  P OP1    1 
ATOM   5858 O  OP2    . DA  B 2 8   ? 10.108  28.085  25.902  1.00 53.72  ? 8   DA  P OP2    1 
ATOM   5859 O  "O5'"  . DA  B 2 8   ? 10.829  30.182  24.872  1.00 60.60  ? 8   DA  P "O5'"  1 
ATOM   5860 C  "C5'"  . DA  B 2 8   ? 10.855  31.595  24.706  1.00 63.21  ? 8   DA  P "C5'"  1 
ATOM   5861 C  "C4'"  . DA  B 2 8   ? 11.824  31.953  23.598  1.00 56.75  ? 8   DA  P "C4'"  1 
ATOM   5862 O  "O4'"  . DA  B 2 8   ? 13.150  31.538  24.005  1.00 48.30  ? 8   DA  P "O4'"  1 
ATOM   5863 C  "C3'"  . DA  B 2 8   ? 11.558  31.284  22.250  1.00 57.28  ? 8   DA  P "C3'"  1 
ATOM   5864 O  "O3'"  . DA  B 2 8   ? 11.726  32.252  21.191  1.00 64.37  ? 8   DA  P "O3'"  1 
ATOM   5865 C  "C2'"  . DA  B 2 8   ? 12.590  30.160  22.200  1.00 43.56  ? 8   DA  P "C2'"  1 
ATOM   5866 C  "C1'"  . DA  B 2 8   ? 13.746  30.749  22.995  1.00 55.67  ? 8   DA  P "C1'"  1 
ATOM   5867 N  N9     . DA  B 2 8   ? 14.614  29.786  23.666  1.00 57.92  ? 8   DA  P N9     1 
ATOM   5868 C  C8     . DA  B 2 8   ? 14.243  28.766  24.505  1.00 54.17  ? 8   DA  P C8     1 
ATOM   5869 N  N7     . DA  B 2 8   ? 15.261  28.075  24.972  1.00 56.01  ? 8   DA  P N7     1 
ATOM   5870 C  C5     . DA  B 2 8   ? 16.376  28.685  24.409  1.00 48.93  ? 8   DA  P C5     1 
ATOM   5871 C  C6     . DA  B 2 8   ? 17.762  28.434  24.510  1.00 50.87  ? 8   DA  P C6     1 
ATOM   5872 N  N6     . DA  B 2 8   ? 18.292  27.444  25.248  1.00 49.75  ? 8   DA  P N6     1 
ATOM   5873 N  N1     . DA  B 2 8   ? 18.594  29.240  23.814  1.00 50.30  ? 8   DA  P N1     1 
ATOM   5874 C  C2     . DA  B 2 8   ? 18.075  30.232  23.076  1.00 51.67  ? 8   DA  P C2     1 
ATOM   5875 N  N3     . DA  B 2 8   ? 16.790  30.562  22.913  1.00 47.15  ? 8   DA  P N3     1 
ATOM   5876 C  C4     . DA  B 2 8   ? 15.988  29.745  23.606  1.00 53.24  ? 8   DA  P C4     1 
ATOM   5877 H  "H5'"  . DA  B 2 8   ? 11.144  32.017  25.542  1.00 75.85  ? 8   DA  P "H5'"  1 
ATOM   5878 H  "H5''" . DA  B 2 8   ? 9.959   31.913  24.472  1.00 75.85  ? 8   DA  P "H5''" 1 
ATOM   5879 H  "H4'"  . DA  B 2 8   ? 11.819  32.925  23.476  1.00 68.09  ? 8   DA  P "H4'"  1 
ATOM   5880 H  "H3'"  . DA  B 2 8   ? 10.652  30.913  22.230  1.00 68.74  ? 8   DA  P "H3'"  1 
ATOM   5881 H  "H2'"  . DA  B 2 8   ? 12.245  29.352  22.634  1.00 52.28  ? 8   DA  P "H2'"  1 
ATOM   5882 H  "H2''" . DA  B 2 8   ? 12.860  29.976  21.276  1.00 52.28  ? 8   DA  P "H2''" 1 
ATOM   5883 H  "H1'"  . DA  B 2 8   ? 14.285  31.322  22.410  1.00 66.81  ? 8   DA  P "H1'"  1 
ATOM   5884 H  H8     . DA  B 2 8   ? 13.310  28.566  24.728  1.00 65.00  ? 8   DA  P H8     1 
ATOM   5885 H  H61    . DA  B 2 8   ? 19.263  27.319  25.275  1.00 59.70  ? 8   DA  P H61    1 
ATOM   5886 H  H62    . DA  B 2 8   ? 17.707  26.848  25.761  1.00 59.70  ? 8   DA  P H62    1 
ATOM   5887 H  H2     . DA  B 2 8   ? 18.722  30.787  22.593  1.00 62.00  ? 8   DA  P H2     1 
ATOM   5888 P  P      . DT  B 2 9   ? 11.410  31.860  19.658  1.00 73.18  ? 9   DT  P P      1 
ATOM   5889 O  OP1    . DT  B 2 9   ? 10.816  33.046  18.997  1.00 82.86  ? 9   DT  P OP1    1 
ATOM   5890 O  OP2    . DT  B 2 9   ? 10.687  30.575  19.641  1.00 62.63  ? 9   DT  P OP2    1 
ATOM   5891 O  "O5'"  . DT  B 2 9   ? 12.850  31.596  19.044  1.00 68.14  ? 9   DT  P "O5'"  1 
ATOM   5892 C  "C5'"  . DT  B 2 9   ? 13.850  32.549  19.333  1.00 65.52  ? 9   DT  P "C5'"  1 
ATOM   5893 C  "C4'"  . DT  B 2 9   ? 15.190  32.082  18.804  1.00 67.47  ? 9   DT  P "C4'"  1 
ATOM   5894 O  "O4'"  . DT  B 2 9   ? 15.755  31.090  19.691  1.00 66.46  ? 9   DT  P "O4'"  1 
ATOM   5895 C  "C3'"  . DT  B 2 9   ? 15.155  31.440  17.420  1.00 72.22  ? 9   DT  P "C3'"  1 
ATOM   5896 O  "O3'"  . DT  B 2 9   ? 16.027  32.217  16.602  1.00 75.15  ? 9   DT  P "O3'"  1 
ATOM   5897 C  "C2'"  . DT  B 2 9   ? 15.614  29.994  17.649  1.00 65.22  ? 9   DT  P "C2'"  1 
ATOM   5898 C  "C1'"  . DT  B 2 9   ? 16.435  30.120  18.926  1.00 62.41  ? 9   DT  P "C1'"  1 
ATOM   5899 N  N1     . DT  B 2 9   ? 16.548  28.917  19.810  1.00 55.42  ? 9   DT  P N1     1 
ATOM   5900 C  C2     . DT  B 2 9   ? 17.801  28.470  20.146  1.00 54.66  ? 9   DT  P C2     1 
ATOM   5901 O  O2     . DT  B 2 9   ? 18.803  29.006  19.730  1.00 50.37  ? 9   DT  P O2     1 
ATOM   5902 N  N3     . DT  B 2 9   ? 17.833  27.375  20.980  1.00 50.70  ? 9   DT  P N3     1 
ATOM   5903 C  C4     . DT  B 2 9   ? 16.734  26.713  21.489  1.00 56.63  ? 9   DT  P C4     1 
ATOM   5904 O  O4     . DT  B 2 9   ? 16.853  25.745  22.225  1.00 54.15  ? 9   DT  P O4     1 
ATOM   5905 C  C5     . DT  B 2 9   ? 15.444  27.238  21.100  1.00 57.23  ? 9   DT  P C5     1 
ATOM   5906 C  C7     . DT  B 2 9   ? 14.186  26.595  21.608  1.00 58.02  ? 9   DT  P C7     1 
ATOM   5907 C  C6     . DT  B 2 9   ? 15.413  28.308  20.297  1.00 54.37  ? 9   DT  P C6     1 
ATOM   5908 H  "H5'"  . DT  B 2 9   ? 13.910  32.672  20.303  1.00 78.63  ? 9   DT  P "H5'"  1 
ATOM   5909 H  "H5''" . DT  B 2 9   ? 13.615  33.402  18.912  1.00 78.63  ? 9   DT  P "H5''" 1 
ATOM   5910 H  "H4'"  . DT  B 2 9   ? 15.796  32.852  18.773  1.00 80.97  ? 9   DT  P "H4'"  1 
ATOM   5911 H  "H3'"  . DT  B 2 9   ? 14.243  31.457  17.061  1.00 86.66  ? 9   DT  P "H3'"  1 
ATOM   5912 H  "H2'"  . DT  B 2 9   ? 14.845  29.401  17.786  1.00 78.27  ? 9   DT  P "H2'"  1 
ATOM   5913 H  "H2''" . DT  B 2 9   ? 16.170  29.682  16.905  1.00 78.27  ? 9   DT  P "H2''" 1 
ATOM   5914 H  "H1'"  . DT  B 2 9   ? 17.331  30.449  18.706  1.00 74.89  ? 9   DT  P "H1'"  1 
ATOM   5915 H  H3     . DT  B 2 9   ? 18.715  27.029  21.228  1.00 60.83  ? 9   DT  P H3     1 
ATOM   5916 H  H71    . DT  B 2 9   ? 13.667  27.251  22.119  1.00 69.62  ? 9   DT  P H71    1 
ATOM   5917 H  H72    . DT  B 2 9   ? 13.653  26.275  20.850  1.00 69.62  ? 9   DT  P H72    1 
ATOM   5918 H  H73    . DT  B 2 9   ? 14.417  25.838  22.187  1.00 69.62  ? 9   DT  P H73    1 
ATOM   5919 H  H6     . DT  B 2 9   ? 14.540  28.668  20.033  1.00 65.25  ? 9   DT  P H6     1 
ATOM   5920 P  P      . DC  B 2 10  ? 16.013  32.055  15.004  1.00 78.87  ? 10  DC  P P      1 
ATOM   5921 O  OP1    . DC  B 2 10  ? 16.174  33.401  14.419  1.00 71.83  ? 10  DC  P OP1    1 
ATOM   5922 O  OP2    . DC  B 2 10  ? 14.875  31.185  14.635  1.00 70.14  ? 10  DC  P OP2    1 
ATOM   5923 O  "O5'"  . DC  B 2 10  ? 17.320  31.191  14.710  1.00 65.66  ? 10  DC  P "O5'"  1 
ATOM   5924 C  "C5'"  . DC  B 2 10  ? 18.565  31.644  15.206  1.00 60.87  ? 10  DC  P "C5'"  1 
ATOM   5925 C  "C4'"  . DC  B 2 10  ? 19.557  30.509  15.117  1.00 64.59  ? 10  DC  P "C4'"  1 
ATOM   5926 O  "O4'"  . DC  B 2 10  ? 19.307  29.546  16.177  1.00 51.16  ? 10  DC  P "O4'"  1 
ATOM   5927 C  "C3'"  . DC  B 2 10  ? 19.476  29.752  13.795  1.00 59.33  ? 10  DC  P "C3'"  1 
ATOM   5928 O  "O3'"  . DC  B 2 10  ? 20.691  29.999  13.095  1.00 63.00  ? 10  DC  P "O3'"  1 
ATOM   5929 C  "C2'"  . DC  B 2 10  ? 19.239  28.287  14.201  1.00 59.71  ? 10  DC  P "C2'"  1 
ATOM   5930 C  "C1'"  . DC  B 2 10  ? 19.603  28.257  15.689  1.00 63.58  ? 10  DC  P "C1'"  1 
ATOM   5931 N  N1     . DC  B 2 10  ? 18.885  27.238  16.547  1.00 57.93  ? 10  DC  P N1     1 
ATOM   5932 C  C2     . DC  B 2 10  ? 19.655  26.401  17.370  1.00 58.48  ? 10  DC  P C2     1 
ATOM   5933 O  O2     . DC  B 2 10  ? 20.891  26.510  17.359  1.00 50.44  ? 10  DC  P O2     1 
ATOM   5934 N  N3     . DC  B 2 10  ? 19.033  25.481  18.149  1.00 51.18  ? 10  DC  P N3     1 
ATOM   5935 C  C4     . DC  B 2 10  ? 17.714  25.384  18.136  1.00 52.80  ? 10  DC  P C4     1 
ATOM   5936 N  N4     . DC  B 2 10  ? 17.187  24.453  18.928  1.00 54.67  ? 10  DC  P N4     1 
ATOM   5937 C  C5     . DC  B 2 10  ? 16.901  26.224  17.319  1.00 51.38  ? 10  DC  P C5     1 
ATOM   5938 C  C6     . DC  B 2 10  ? 17.526  27.127  16.544  1.00 55.74  ? 10  DC  P C6     1 
ATOM   5939 H  "H5'"  . DC  B 2 10  ? 18.465  31.923  16.140  1.00 73.04  ? 10  DC  P "H5'"  1 
ATOM   5940 H  "H5''" . DC  B 2 10  ? 18.879  32.400  14.667  1.00 73.04  ? 10  DC  P "H5''" 1 
ATOM   5941 H  "H4'"  . DC  B 2 10  ? 20.463  30.869  15.222  1.00 77.51  ? 10  DC  P "H4'"  1 
ATOM   5942 H  "H3'"  . DC  B 2 10  ? 18.716  30.080  13.271  1.00 71.20  ? 10  DC  P "H3'"  1 
ATOM   5943 H  "H2'"  . DC  B 2 10  ? 18.299  28.042  14.071  1.00 71.65  ? 10  DC  P "H2'"  1 
ATOM   5944 H  "H2''" . DC  B 2 10  ? 19.826  27.690  13.691  1.00 71.65  ? 10  DC  P "H2''" 1 
ATOM   5945 H  "H1'"  . DC  B 2 10  ? 20.568  28.106  15.770  1.00 76.30  ? 10  DC  P "H1'"  1 
ATOM   5946 H  H41    . DC  B 2 10  ? 16.215  24.331  18.963  1.00 65.61  ? 10  DC  P H41    1 
ATOM   5947 H  H42    . DC  B 2 10  ? 17.771  23.888  19.476  1.00 65.61  ? 10  DC  P H42    1 
ATOM   5948 H  H5     . DC  B 2 10  ? 15.925  26.139  17.316  1.00 61.66  ? 10  DC  P H5     1 
ATOM   5949 H  H6     . DC  B 2 10  ? 16.995  27.720  15.972  1.00 66.89  ? 10  DC  P H6     1 
ATOM   5950 P  P      . DG  B 2 11  ? 20.939  29.357  11.643  1.00 71.93  ? 11  DG  P P      1 
ATOM   5951 O  OP1    . DG  B 2 11  ? 22.038  30.102  11.000  1.00 70.32  ? 11  DG  P OP1    1 
ATOM   5952 O  OP2    . DG  B 2 11  ? 19.629  29.186  10.985  1.00 69.60  ? 11  DG  P OP2    1 
ATOM   5953 O  "O5'"  . DG  B 2 11  ? 21.545  27.920  11.972  1.00 59.90  ? 11  DG  P "O5'"  1 
ATOM   5954 C  "C5'"  . DG  B 2 11  ? 22.874  27.948  12.477  1.00 62.73  ? 11  DG  P "C5'"  1 
ATOM   5955 C  "C4'"  . DG  B 2 11  ? 23.372  26.548  12.719  1.00 65.67  ? 11  DG  P "C4'"  1 
ATOM   5956 O  "O4'"  . DG  B 2 11  ? 22.593  25.972  13.796  1.00 60.05  ? 11  DG  P "O4'"  1 
ATOM   5957 C  "C3'"  . DG  B 2 11  ? 23.224  25.646  11.499  1.00 65.03  ? 11  DG  P "C3'"  1 
ATOM   5958 O  "O3'"  . DG  B 2 11  ? 24.471  25.064  11.170  1.00 59.41  ? 11  DG  P "O3'"  1 
ATOM   5959 C  "C2'"  . DG  B 2 11  ? 22.184  24.615  11.918  1.00 63.82  ? 11  DG  P "C2'"  1 
ATOM   5960 C  "C1'"  . DG  B 2 11  ? 22.241  24.658  13.438  1.00 63.59  ? 11  DG  P "C1'"  1 
ATOM   5961 N  N9     . DG  B 2 11  ? 20.962  24.313  14.037  1.00 61.50  ? 11  DG  P N9     1 
ATOM   5962 C  C8     . DG  B 2 11  ? 19.722  24.795  13.695  1.00 68.45  ? 11  DG  P C8     1 
ATOM   5963 N  N7     . DG  B 2 11  ? 18.755  24.287  14.408  1.00 64.07  ? 11  DG  P N7     1 
ATOM   5964 C  C5     . DG  B 2 11  ? 19.400  23.412  15.269  1.00 52.45  ? 11  DG  P C5     1 
ATOM   5965 C  C6     . DG  B 2 11  ? 18.869  22.578  16.264  1.00 54.06  ? 11  DG  P C6     1 
ATOM   5966 O  O6     . DG  B 2 11  ? 17.676  22.470  16.562  1.00 56.59  ? 11  DG  P O6     1 
ATOM   5967 N  N1     . DG  B 2 11  ? 19.873  21.841  16.918  1.00 56.05  ? 11  DG  P N1     1 
ATOM   5968 C  C2     . DG  B 2 11  ? 21.220  21.921  16.618  1.00 60.05  ? 11  DG  P C2     1 
ATOM   5969 N  N2     . DG  B 2 11  ? 22.081  21.163  17.317  1.00 61.52  ? 11  DG  P N2     1 
ATOM   5970 N  N3     . DG  B 2 11  ? 21.718  22.706  15.680  1.00 54.02  ? 11  DG  P N3     1 
ATOM   5971 C  C4     . DG  B 2 11  ? 20.754  23.417  15.054  1.00 57.89  ? 11  DG  P C4     1 
ATOM   5972 H  "H5'"  . DG  B 2 11  ? 22.889  28.447  13.321  1.00 75.27  ? 11  DG  P "H5'"  1 
ATOM   5973 H  "H5''" . DG  B 2 11  ? 23.458  28.393  11.828  1.00 75.27  ? 11  DG  P "H5''" 1 
ATOM   5974 H  "H4'"  . DG  B 2 11  ? 24.315  26.582  12.984  1.00 78.80  ? 11  DG  P "H4'"  1 
ATOM   5975 H  "H3'"  . DG  B 2 11  ? 22.888  26.167  10.739  1.00 78.03  ? 11  DG  P "H3'"  1 
ATOM   5976 H  "H2'"  . DG  B 2 11  ? 21.294  24.872  11.599  1.00 76.59  ? 11  DG  P "H2'"  1 
ATOM   5977 H  "H2''" . DG  B 2 11  ? 22.428  23.725  11.589  1.00 76.59  ? 11  DG  P "H2''" 1 
ATOM   5978 H  "H1'"  . DG  B 2 11  ? 22.930  24.037  13.756  1.00 76.30  ? 11  DG  P "H1'"  1 
ATOM   5979 H  H8     . DG  B 2 11  ? 19.578  25.459  12.988  1.00 82.14  ? 11  DG  P H8     1 
ATOM   5980 H  H1     . DG  B 2 11  ? 19.599  21.229  17.633  1.00 67.26  ? 11  DG  P H1     1 
ATOM   5981 H  H21    . DG  B 2 11  ? 23.041  21.205  17.123  1.00 73.83  ? 11  DG  P H21    1 
ATOM   5982 H  H22    . DG  B 2 11  ? 21.749  20.568  18.022  1.00 73.83  ? 11  DG  P H22    1 
ATOM   5983 P  P      . DG  B 2 12  ? 24.567  23.967  10.002  1.00 65.01  ? 12  DG  P P      1 
ATOM   5984 O  OP1    . DG  B 2 12  ? 25.980  23.863  9.588   1.00 62.11  ? 12  DG  P OP1    1 
ATOM   5985 O  OP2    . DG  B 2 12  ? 23.497  24.246  9.021   1.00 74.73  ? 12  DG  P OP2    1 
ATOM   5986 O  "O5'"  . DG  B 2 12  ? 24.208  22.605  10.732  1.00 70.19  ? 12  DG  P "O5'"  1 
ATOM   5987 C  "C5'"  . DG  B 2 12  ? 25.177  22.068  11.600  1.00 69.47  ? 12  DG  P "C5'"  1 
ATOM   5988 C  "C4'"  . DG  B 2 12  ? 24.573  20.848  12.228  1.00 68.01  ? 12  DG  P "C4'"  1 
ATOM   5989 O  "O4'"  . DG  B 2 12  ? 23.331  21.230  12.860  1.00 68.60  ? 12  DG  P "O4'"  1 
ATOM   5990 C  "C3'"  . DG  B 2 12  ? 24.167  19.794  11.212  1.00 65.77  ? 12  DG  P "C3'"  1 
ATOM   5991 O  "O3'"  . DG  B 2 12  ? 25.239  18.892  10.952  1.00 65.73  ? 12  DG  P "O3'"  1 
ATOM   5992 C  "C2'"  . DG  B 2 12  ? 22.987  19.114  11.896  1.00 66.06  ? 12  DG  P "C2'"  1 
ATOM   5993 C  "C1'"  . DG  B 2 12  ? 22.651  20.023  13.076  1.00 62.72  ? 12  DG  P "C1'"  1 
ATOM   5994 N  N9     . DG  B 2 12  ? 21.215  20.223  13.200  1.00 55.90  ? 12  DG  P N9     1 
ATOM   5995 C  C8     . DG  B 2 12  ? 20.357  21.071  12.552  1.00 60.35  ? 12  DG  P C8     1 
ATOM   5996 N  N7     . DG  B 2 12  ? 19.115  20.929  12.937  1.00 58.62  ? 12  DG  P N7     1 
ATOM   5997 C  C5     . DG  B 2 12  ? 19.168  19.919  13.891  1.00 54.36  ? 12  DG  P C5     1 
ATOM   5998 C  C6     . DG  B 2 12  ? 18.163  19.312  14.669  1.00 50.05  ? 12  DG  P C6     1 
ATOM   5999 O  O6     . DG  B 2 12  ? 16.956  19.562  14.661  1.00 49.12  ? 12  DG  P O6     1 
ATOM   6000 N  N1     . DG  B 2 12  ? 18.679  18.319  15.500  1.00 45.61  ? 12  DG  P N1     1 
ATOM   6001 C  C2     . DG  B 2 12  ? 20.003  17.962  15.579  1.00 50.81  ? 12  DG  P C2     1 
ATOM   6002 N  N2     . DG  B 2 12  ? 20.364  16.990  16.427  1.00 50.93  ? 12  DG  P N2     1 
ATOM   6003 N  N3     . DG  B 2 12  ? 20.946  18.521  14.859  1.00 49.38  ? 12  DG  P N3     1 
ATOM   6004 C  C4     . DG  B 2 12  ? 20.451  19.478  14.048  1.00 55.09  ? 12  DG  P C4     1 
ATOM   6005 H  "H5'"  . DG  B 2 12  ? 25.404  22.722  12.293  1.00 83.37  ? 12  DG  P "H5'"  1 
ATOM   6006 H  "H5''" . DG  B 2 12  ? 25.979  21.822  11.095  1.00 83.37  ? 12  DG  P "H5''" 1 
ATOM   6007 H  "H4'"  . DG  B 2 12  ? 25.186  20.465  12.889  1.00 81.61  ? 12  DG  P "H4'"  1 
ATOM   6008 H  "H3'"  . DG  B 2 12  ? 23.874  20.222  10.381  1.00 78.92  ? 12  DG  P "H3'"  1 
ATOM   6009 H  "H2'"  . DG  B 2 12  ? 22.225  19.055  11.283  1.00 79.27  ? 12  DG  P "H2'"  1 
ATOM   6010 H  "H2''" . DG  B 2 12  ? 23.243  18.223  12.214  1.00 79.27  ? 12  DG  P "H2''" 1 
ATOM   6011 H  "H1'"  . DG  B 2 12  ? 22.987  19.612  13.900  1.00 75.27  ? 12  DG  P "H1'"  1 
ATOM   6012 H  H8     . DG  B 2 12  ? 20.645  21.722  11.878  1.00 72.42  ? 12  DG  P H8     1 
ATOM   6013 H  H1     . DG  B 2 12  ? 18.048  17.845  16.081  1.00 54.73  ? 12  DG  P H1     1 
ATOM   6014 H  H21    . DG  B 2 12  ? 21.304  16.720  16.492  1.00 61.12  ? 12  DG  P H21    1 
ATOM   6015 H  H22    . DG  B 2 12  ? 19.689  16.548  16.983  1.00 61.12  ? 12  DG  P H22    1 
ATOM   6016 P  P      . DG  B 2 13  ? 24.985  17.571  10.068  1.00 80.31  ? 13  DG  P P      1 
ATOM   6017 O  OP1    . DG  B 2 13  ? 26.292  17.105  9.549   1.00 69.20  ? 13  DG  P OP1    1 
ATOM   6018 O  OP2    . DG  B 2 13  ? 23.865  17.853  9.141   1.00 69.64  ? 13  DG  P OP2    1 
ATOM   6019 O  "O5'"  . DG  B 2 13  ? 24.407  16.511  11.120  1.00 70.47  ? 13  DG  P "O5'"  1 
ATOM   6020 C  "C5'"  . DG  B 2 13  ? 25.059  16.158  12.335  1.00 59.39  ? 13  DG  P "C5'"  1 
ATOM   6021 C  "C4'"  . DG  B 2 13  ? 24.203  15.097  12.996  1.00 65.36  ? 13  DG  P "C4'"  1 
ATOM   6022 O  "O4'"  . DG  B 2 13  ? 22.915  15.679  13.332  1.00 55.92  ? 13  DG  P "O4'"  1 
ATOM   6023 C  "C3'"  . DG  B 2 13  ? 23.887  13.878  12.130  1.00 59.40  ? 13  DG  P "C3'"  1 
ATOM   6024 O  "O3'"  . DG  B 2 13  ? 23.994  12.685  12.906  1.00 57.37  ? 13  DG  P "O3'"  1 
ATOM   6025 C  "C2'"  . DG  B 2 13  ? 22.446  14.118  11.671  1.00 56.25  ? 13  DG  P "C2'"  1 
ATOM   6026 C  "C1'"  . DG  B 2 13  ? 21.861  14.875  12.858  1.00 56.80  ? 13  DG  P "C1'"  1 
ATOM   6027 N  N9     . DG  B 2 13  ? 20.690  15.705  12.532  1.00 58.95  ? 13  DG  P N9     1 
ATOM   6028 C  C8     . DG  B 2 13  ? 20.601  16.839  11.755  1.00 52.91  ? 13  DG  P C8     1 
ATOM   6029 N  N7     . DG  B 2 13  ? 19.384  17.328  11.682  1.00 49.69  ? 13  DG  P N7     1 
ATOM   6030 C  C5     . DG  B 2 13  ? 18.616  16.452  12.451  1.00 46.37  ? 13  DG  P C5     1 
ATOM   6031 C  C6     . DG  B 2 13  ? 17.230  16.429  12.749  1.00 47.33  ? 13  DG  P C6     1 
ATOM   6032 O  O6     . DG  B 2 13  ? 16.341  17.214  12.391  1.00 49.23  ? 13  DG  P O6     1 
ATOM   6033 N  N1     . DG  B 2 13  ? 16.897  15.358  13.568  1.00 48.40  ? 13  DG  P N1     1 
ATOM   6034 C  C2     . DG  B 2 13  ? 17.780  14.428  14.040  1.00 47.69  ? 13  DG  P C2     1 
ATOM   6035 N  N2     . DG  B 2 13  ? 17.302  13.450  14.817  1.00 44.54  ? 13  DG  P N2     1 
ATOM   6036 N  N3     . DG  B 2 13  ? 19.065  14.434  13.765  1.00 49.16  ? 13  DG  P N3     1 
ATOM   6037 C  C4     . DG  B 2 13  ? 19.409  15.464  12.972  1.00 50.19  ? 13  DG  P C4     1 
ATOM   6038 H  "H5'"  . DG  B 2 13  ? 25.130  16.943  12.918  1.00 71.27  ? 13  DG  P "H5'"  1 
ATOM   6039 H  "H5''" . DG  B 2 13  ? 25.951  15.799  12.145  1.00 71.27  ? 13  DG  P "H5''" 1 
ATOM   6040 H  "H4'"  . DG  B 2 13  ? 24.643  14.799  13.819  1.00 78.43  ? 13  DG  P "H4'"  1 
ATOM   6041 H  "H3'"  . DG  B 2 13  ? 24.490  13.841  11.358  1.00 71.28  ? 13  DG  P "H3'"  1 
ATOM   6042 H  "HO3'" . DG  B 2 13  ? 23.215  12.099  13.015  1.00 68.84  ? 13  DG  P "HO3'" 1 
ATOM   6043 H  "H2'"  . DG  B 2 13  ? 22.424  14.668  10.860  1.00 67.51  ? 13  DG  P "H2'"  1 
ATOM   6044 H  "H2''" . DG  B 2 13  ? 21.977  13.268  11.533  1.00 67.51  ? 13  DG  P "H2''" 1 
ATOM   6045 H  "H1'"  . DG  B 2 13  ? 21.612  14.232  13.554  1.00 68.16  ? 13  DG  P "H1'"  1 
ATOM   6046 H  H8     . DG  B 2 13  ? 21.373  17.249  11.311  1.00 63.50  ? 13  DG  P H8     1 
ATOM   6047 H  H1     . DG  B 2 13  ? 15.959  15.266  13.834  1.00 58.08  ? 13  DG  P H1     1 
ATOM   6048 H  H21    . DG  B 2 13  ? 17.905  12.762  15.166  1.00 53.44  ? 13  DG  P H21    1 
ATOM   6049 H  H22    . DG  B 2 13  ? 16.347  13.422  15.037  1.00 53.44  ? 13  DG  P H22    1 
ATOM   6050 P  P      . DG  C 3 5   ? 6.004   16.509  11.887  1.00 92.64  ? 5   DG  T P      1 
ATOM   6051 O  OP1    . DG  C 3 5   ? 6.237   16.985  10.499  1.00 82.82  ? 5   DG  T OP1    1 
ATOM   6052 O  OP2    . DG  C 3 5   ? 6.205   17.423  13.038  1.00 67.18  ? 5   DG  T OP2    1 
ATOM   6053 O  "O5'"  . DG  C 3 5   ? 6.893   15.202  12.133  1.00 71.24  ? 5   DG  T "O5'"  1 
ATOM   6054 C  "C5'"  . DG  C 3 5   ? 6.354   13.915  11.890  1.00 61.43  ? 5   DG  T "C5'"  1 
ATOM   6055 C  "C4'"  . DG  C 3 5   ? 7.132   12.891  12.690  1.00 62.38  ? 5   DG  T "C4'"  1 
ATOM   6056 O  "O4'"  . DG  C 3 5   ? 8.515   12.809  12.236  1.00 53.15  ? 5   DG  T "O4'"  1 
ATOM   6057 C  "C3'"  . DG  C 3 5   ? 7.253   13.188  14.176  1.00 56.26  ? 5   DG  T "C3'"  1 
ATOM   6058 O  "O3'"  . DG  C 3 5   ? 7.379   11.937  14.841  1.00 51.91  ? 5   DG  T "O3'"  1 
ATOM   6059 C  "C2'"  . DG  C 3 5   ? 8.513   14.050  14.230  1.00 62.76  ? 5   DG  T "C2'"  1 
ATOM   6060 C  "C1'"  . DG  C 3 5   ? 9.393   13.320  13.223  1.00 56.73  ? 5   DG  T "C1'"  1 
ATOM   6061 N  N9     . DG  C 3 5   ? 10.358  14.092  12.461  1.00 51.24  ? 5   DG  T N9     1 
ATOM   6062 C  C8     . DG  C 3 5   ? 10.180  15.291  11.820  1.00 54.33  ? 5   DG  T C8     1 
ATOM   6063 N  N7     . DG  C 3 5   ? 11.251  15.697  11.186  1.00 56.91  ? 5   DG  T N7     1 
ATOM   6064 C  C5     . DG  C 3 5   ? 12.180  14.689  11.412  1.00 52.46  ? 5   DG  T C5     1 
ATOM   6065 C  C6     . DG  C 3 5   ? 13.519  14.573  10.974  1.00 48.55  ? 5   DG  T C6     1 
ATOM   6066 O  O6     . DG  C 3 5   ? 14.140  15.381  10.272  1.00 41.28  ? 5   DG  T O6     1 
ATOM   6067 N  N1     . DG  C 3 5   ? 14.118  13.394  11.426  1.00 39.60  ? 5   DG  T N1     1 
ATOM   6068 C  C2     . DG  C 3 5   ? 13.501  12.452  12.216  1.00 47.01  ? 5   DG  T C2     1 
ATOM   6069 N  N2     . DG  C 3 5   ? 14.248  11.386  12.558  1.00 35.63  ? 5   DG  T N2     1 
ATOM   6070 N  N3     . DG  C 3 5   ? 12.237  12.542  12.629  1.00 46.62  ? 5   DG  T N3     1 
ATOM   6071 C  C4     . DG  C 3 5   ? 11.646  13.688  12.189  1.00 53.61  ? 5   DG  T C4     1 
ATOM   6072 H  "H5'"  . DG  C 3 5   ? 6.422   13.706  10.935  1.00 73.71  ? 5   DG  T "H5'"  1 
ATOM   6073 H  "H5''" . DG  C 3 5   ? 5.412   13.897  12.163  1.00 73.71  ? 5   DG  T "H5''" 1 
ATOM   6074 H  "H4'"  . DG  C 3 5   ? 6.710   12.014  12.576  1.00 74.86  ? 5   DG  T "H4'"  1 
ATOM   6075 H  "H3'"  . DG  C 3 5   ? 6.472   13.685  14.498  1.00 67.52  ? 5   DG  T "H3'"  1 
ATOM   6076 H  "H2'"  . DG  C 3 5   ? 8.327   14.966  13.937  1.00 75.31  ? 5   DG  T "H2'"  1 
ATOM   6077 H  "H2''" . DG  C 3 5   ? 8.913   14.035  15.124  1.00 75.31  ? 5   DG  T "H2''" 1 
ATOM   6078 H  "H1'"  . DG  C 3 5   ? 9.850   12.576  13.668  1.00 68.08  ? 5   DG  T "H1'"  1 
ATOM   6079 H  H8     . DG  C 3 5   ? 9.340   15.794  11.837  1.00 65.20  ? 5   DG  T H8     1 
ATOM   6080 H  H1     . DG  C 3 5   ? 15.053  13.236  11.177  1.00 47.52  ? 5   DG  T H1     1 
ATOM   6081 H  H21    . DG  C 3 5   ? 13.863  10.675  13.111  1.00 42.75  ? 5   DG  T H21    1 
ATOM   6082 H  H22    . DG  C 3 5   ? 15.178  11.321  12.254  1.00 42.75  ? 5   DG  T H22    1 
ATOM   6083 P  P      . DC  C 3 6   ? 7.149   11.835  16.422  1.00 59.54  ? 6   DC  T P      1 
ATOM   6084 O  OP1    . DC  C 3 6   ? 6.678   10.465  16.726  1.00 57.17  ? 6   DC  T OP1    1 
ATOM   6085 O  OP2    . DC  C 3 6   ? 6.404   13.032  16.849  1.00 56.25  ? 6   DC  T OP2    1 
ATOM   6086 O  "O5'"  . DC  C 3 6   ? 8.623   11.951  17.020  1.00 55.61  ? 6   DC  T "O5'"  1 
ATOM   6087 C  "C5'"  . DC  C 3 6   ? 9.475   10.836  16.890  1.00 56.04  ? 6   DC  T "C5'"  1 
ATOM   6088 C  "C4'"  . DC  C 3 6   ? 10.902  11.280  17.107  1.00 54.21  ? 6   DC  T "C4'"  1 
ATOM   6089 O  "O4'"  . DC  C 3 6   ? 11.248  12.282  16.131  1.00 55.15  ? 6   DC  T "O4'"  1 
ATOM   6090 C  "C3'"  . DC  C 3 6   ? 11.173  11.921  18.470  1.00 54.99  ? 6   DC  T "C3'"  1 
ATOM   6091 O  "O3'"  . DC  C 3 6   ? 11.859  10.919  19.169  1.00 54.92  ? 6   DC  T "O3'"  1 
ATOM   6092 C  "C2'"  . DC  C 3 6   ? 11.999  13.165  18.162  1.00 52.68  ? 6   DC  T "C2'"  1 
ATOM   6093 C  "C1'"  . DC  C 3 6   ? 12.331  12.981  16.679  1.00 54.78  ? 6   DC  T "C1'"  1 
ATOM   6094 N  N1     . DC  C 3 6   ? 12.517  14.220  15.887  1.00 50.94  ? 6   DC  T N1     1 
ATOM   6095 C  C2     . DC  C 3 6   ? 13.745  14.361  15.251  1.00 52.18  ? 6   DC  T C2     1 
ATOM   6096 O  O2     . DC  C 3 6   ? 14.551  13.449  15.398  1.00 48.98  ? 6   DC  T O2     1 
ATOM   6097 N  N3     . DC  C 3 6   ? 13.996  15.453  14.498  1.00 47.01  ? 6   DC  T N3     1 
ATOM   6098 C  C4     . DC  C 3 6   ? 13.067  16.399  14.395  1.00 48.84  ? 6   DC  T C4     1 
ATOM   6099 N  N4     . DC  C 3 6   ? 13.369  17.466  13.653  1.00 55.74  ? 6   DC  T N4     1 
ATOM   6100 C  C5     . DC  C 3 6   ? 11.797  16.287  15.043  1.00 53.43  ? 6   DC  T C5     1 
ATOM   6101 C  C6     . DC  C 3 6   ? 11.561  15.187  15.777  1.00 52.21  ? 6   DC  T C6     1 
ATOM   6102 H  "H5'"  . DC  C 3 6   ? 9.383   10.456  15.991  1.00 67.25  ? 6   DC  T "H5'"  1 
ATOM   6103 H  "H5''" . DC  C 3 6   ? 9.237   10.160  17.558  1.00 67.25  ? 6   DC  T "H5''" 1 
ATOM   6104 H  "H4'"  . DC  C 3 6   ? 11.495  10.509  16.995  1.00 65.05  ? 6   DC  T "H4'"  1 
ATOM   6105 H  "H3'"  . DC  C 3 6   ? 10.333  12.155  18.919  1.00 65.99  ? 6   DC  T "H3'"  1 
ATOM   6106 H  "H2'"  . DC  C 3 6   ? 11.469  13.978  18.302  1.00 63.22  ? 6   DC  T "H2'"  1 
ATOM   6107 H  "H2''" . DC  C 3 6   ? 12.816  13.183  18.702  1.00 63.22  ? 6   DC  T "H2''" 1 
ATOM   6108 H  "H1'"  . DC  C 3 6   ? 13.137  12.429  16.600  1.00 65.73  ? 6   DC  T "H1'"  1 
ATOM   6109 H  H41    . DC  C 3 6   ? 12.717  18.190  13.547  1.00 66.89  ? 6   DC  T H41    1 
ATOM   6110 H  H42    . DC  C 3 6   ? 14.243  17.526  13.213  1.00 66.89  ? 6   DC  T H42    1 
ATOM   6111 H  H5     . DC  C 3 6   ? 11.120  16.989  14.953  1.00 64.12  ? 6   DC  T H5     1 
ATOM   6112 H  H6     . DC  C 3 6   ? 10.701  15.079  16.233  1.00 62.65  ? 6   DC  T H6     1 
ATOM   6113 P  P      . DC  C 3 7   ? 12.448  11.190  20.630  1.00 49.00  ? 7   DC  T P      1 
ATOM   6114 O  OP1    . DC  C 3 7   ? 12.631  9.866   21.281  1.00 53.98  ? 7   DC  T OP1    1 
ATOM   6115 O  OP2    . DC  C 3 7   ? 11.640  12.249  21.267  1.00 51.21  ? 7   DC  T OP2    1 
ATOM   6116 O  "O5'"  . DC  C 3 7   ? 13.894  11.809  20.346  1.00 51.87  ? 7   DC  T "O5'"  1 
ATOM   6117 C  "C5'"  . DC  C 3 7   ? 14.943  10.907  20.039  1.00 49.93  ? 7   DC  T "C5'"  1 
ATOM   6118 C  "C4'"  . DC  C 3 7   ? 16.234  11.660  19.886  1.00 56.82  ? 7   DC  T "C4'"  1 
ATOM   6119 O  "O4'"  . DC  C 3 7   ? 16.061  12.580  18.789  1.00 46.50  ? 7   DC  T "O4'"  1 
ATOM   6120 C  "C3'"  . DC  C 3 7   ? 16.594  12.491  21.116  1.00 56.28  ? 7   DC  T "C3'"  1 
ATOM   6121 O  "O3'"  . DC  C 3 7   ? 17.695  11.911  21.813  1.00 56.84  ? 7   DC  T "O3'"  1 
ATOM   6122 C  "C2'"  . DC  C 3 7   ? 16.889  13.887  20.580  1.00 57.01  ? 7   DC  T "C2'"  1 
ATOM   6123 C  "C1'"  . DC  C 3 7   ? 16.861  13.705  19.063  1.00 51.53  ? 7   DC  T "C1'"  1 
ATOM   6124 N  N1     . DC  C 3 7   ? 16.319  14.903  18.381  1.00 53.12  ? 7   DC  T N1     1 
ATOM   6125 C  C2     . DC  C 3 7   ? 17.230  15.679  17.673  1.00 51.73  ? 7   DC  T C2     1 
ATOM   6126 O  O2     . DC  C 3 7   ? 18.409  15.296  17.639  1.00 50.11  ? 7   DC  T O2     1 
ATOM   6127 N  N3     . DC  C 3 7   ? 16.792  16.791  17.044  1.00 43.67  ? 7   DC  T N3     1 
ATOM   6128 C  C4     . DC  C 3 7   ? 15.511  17.134  17.104  1.00 48.13  ? 7   DC  T C4     1 
ATOM   6129 N  N4     . DC  C 3 7   ? 15.151  18.251  16.461  1.00 48.68  ? 7   DC  T N4     1 
ATOM   6130 C  C5     . DC  C 3 7   ? 14.558  16.362  17.844  1.00 45.72  ? 7   DC  T C5     1 
ATOM   6131 C  C6     . DC  C 3 7   ? 14.999  15.257  18.460  1.00 44.02  ? 7   DC  T C6     1 
ATOM   6132 H  "H5'"  . DC  C 3 7   ? 14.737  10.441  19.202  1.00 59.92  ? 7   DC  T "H5'"  1 
ATOM   6133 H  "H5''" . DC  C 3 7   ? 15.032  10.253  20.763  1.00 59.92  ? 7   DC  T "H5''" 1 
ATOM   6134 H  "H4'"  . DC  C 3 7   ? 16.961  11.034  19.683  1.00 68.19  ? 7   DC  T "H4'"  1 
ATOM   6135 H  "H3'"  . DC  C 3 7   ? 15.820  12.532  21.715  1.00 67.53  ? 7   DC  T "H3'"  1 
ATOM   6136 H  "H2'"  . DC  C 3 7   ? 16.195  14.518  20.863  1.00 68.41  ? 7   DC  T "H2'"  1 
ATOM   6137 H  "H2''" . DC  C 3 7   ? 17.774  14.189  20.874  1.00 68.41  ? 7   DC  T "H2''" 1 
ATOM   6138 H  "H1'"  . DC  C 3 7   ? 17.772  13.537  18.742  1.00 61.83  ? 7   DC  T "H1'"  1 
ATOM   6139 H  H41    . DC  C 3 7   ? 14.216  18.545  16.477  1.00 58.42  ? 7   DC  T H41    1 
ATOM   6140 H  H42    . DC  C 3 7   ? 15.821  18.774  15.975  1.00 58.42  ? 7   DC  T H42    1 
ATOM   6141 H  H5     . DC  C 3 7   ? 13.615  16.625  17.886  1.00 54.86  ? 7   DC  T H5     1 
ATOM   6142 H  H6     . DC  C 3 7   ? 14.375  14.703  18.975  1.00 52.82  ? 7   DC  T H6     1 
ATOM   6143 P  P      . DT  C 3 8   ? 17.444  11.196  23.230  1.00 62.00  ? 8   DT  T P      1 
ATOM   6144 O  OP1    . DT  C 3 8   ? 16.643  9.965   22.977  1.00 51.66  ? 8   DT  T OP1    1 
ATOM   6145 O  OP2    . DT  C 3 8   ? 16.908  12.228  24.159  1.00 45.98  ? 8   DT  T OP2    1 
ATOM   6146 O  "O5'"  . DT  C 3 8   ? 18.897  10.629  23.649  1.00 61.68  ? 8   DT  T "O5'"  1 
ATOM   6147 C  "C5'"  . DT  C 3 8   ? 20.037  11.409  24.005  1.00 71.41  ? 8   DT  T "C5'"  1 
ATOM   6148 C  "C4'"  . DT  C 3 8   ? 21.339  10.785  23.498  1.00 75.74  ? 8   DT  T "C4'"  1 
ATOM   6149 O  "O4'"  . DT  C 3 8   ? 21.568  9.455   24.049  1.00 75.05  ? 8   DT  T "O4'"  1 
ATOM   6150 C  "C3'"  . DT  C 3 8   ? 21.427  10.602  21.981  1.00 78.11  ? 8   DT  T "C3'"  1 
ATOM   6151 O  "O3'"  . DT  C 3 8   ? 22.604  11.245  21.506  1.00 81.01  ? 8   DT  T "O3'"  1 
ATOM   6152 C  "C2'"  . DT  C 3 8   ? 21.494  9.089   21.789  1.00 78.67  ? 8   DT  T "C2'"  1 
ATOM   6153 C  "C1'"  . DT  C 3 8   ? 22.233  8.695   23.056  1.00 81.04  ? 8   DT  T "C1'"  1 
ATOM   6154 N  N1     . DT  C 3 8   ? 22.216  7.234   23.404  1.00 85.89  ? 8   DT  T N1     1 
ATOM   6155 C  C2     . DT  C 3 8   ? 21.019  6.598   23.680  1.00 89.13  ? 8   DT  T C2     1 
ATOM   6156 O  O2     . DT  C 3 8   ? 19.936  7.162   23.650  1.00 88.07  ? 8   DT  T O2     1 
ATOM   6157 N  N3     . DT  C 3 8   ? 21.137  5.263   23.994  1.00 85.31  ? 8   DT  T N3     1 
ATOM   6158 C  C4     . DT  C 3 8   ? 22.307  4.523   24.059  1.00 89.00  ? 8   DT  T C4     1 
ATOM   6159 O  O4     . DT  C 3 8   ? 22.311  3.328   24.352  1.00 88.65  ? 8   DT  T O4     1 
ATOM   6160 C  C5     . DT  C 3 8   ? 23.524  5.250   23.764  1.00 89.18  ? 8   DT  T C5     1 
ATOM   6161 C  C7     . DT  C 3 8   ? 24.856  4.547   23.805  1.00 81.59  ? 8   DT  T C7     1 
ATOM   6162 C  C6     . DT  C 3 8   ? 23.419  6.552   23.454  1.00 75.58  ? 8   DT  T C6     1 
ATOM   6163 H  "H5'"  . DT  C 3 8   ? 20.079  11.485  24.981  1.00 85.69  ? 8   DT  T "H5'"  1 
ATOM   6164 H  "H5''" . DT  C 3 8   ? 19.943  12.306  23.620  1.00 85.69  ? 8   DT  T "H5''" 1 
ATOM   6165 H  "H4'"  . DT  C 3 8   ? 22.081  11.361  23.778  1.00 90.89  ? 8   DT  T "H4'"  1 
ATOM   6166 H  "H3'"  . DT  C 3 8   ? 20.631  10.970  21.543  1.00 93.74  ? 8   DT  T "H3'"  1 
ATOM   6167 H  "H2'"  . DT  C 3 8   ? 20.597  8.695   21.765  1.00 94.40  ? 8   DT  T "H2'"  1 
ATOM   6168 H  "H2''" . DT  C 3 8   ? 22.011  8.855   20.990  1.00 94.40  ? 8   DT  T "H2''" 1 
ATOM   6169 H  "H1'"  . DT  C 3 8   ? 23.163  8.997   22.991  1.00 97.25  ? 8   DT  T "H1'"  1 
ATOM   6170 H  H3     . DT  C 3 8   ? 20.305  4.785   24.192  1.00 102.38 ? 8   DT  T H3     1 
ATOM   6171 H  H71    . DT  C 3 8   ? 25.281  4.600   22.924  1.00 97.91  ? 8   DT  T H71    1 
ATOM   6172 H  H72    . DT  C 3 8   ? 25.431  4.977   24.472  1.00 97.91  ? 8   DT  T H72    1 
ATOM   6173 H  H73    . DT  C 3 8   ? 24.721  3.607   24.047  1.00 97.91  ? 8   DT  T H73    1 
ATOM   6174 H  H6     . DT  C 3 8   ? 24.241  7.048   23.256  1.00 90.69  ? 8   DT  T H6     1 
ATOM   6175 P  P      . DC  C 3 9   ? 22.567  12.112  20.153  1.00 82.49  ? 9   DC  T P      1 
ATOM   6176 O  OP1    . DC  C 3 9   ? 22.420  11.175  19.016  1.00 79.66  ? 9   DC  T OP1    1 
ATOM   6177 O  OP2    . DC  C 3 9   ? 23.704  13.067  20.193  1.00 83.23  ? 9   DC  T OP2    1 
ATOM   6178 O  "O5'"  . DC  C 3 9   ? 21.203  12.950  20.275  1.00 79.91  ? 9   DC  T "O5'"  1 
ATOM   6179 C  "C5'"  . DC  C 3 9   ? 20.848  13.646  21.476  1.00 70.39  ? 9   DC  T "C5'"  1 
ATOM   6180 C  "C4'"  . DC  C 3 9   ? 21.183  15.117  21.352  1.00 75.37  ? 9   DC  T "C4'"  1 
ATOM   6181 O  "O4'"  . DC  C 3 9   ? 20.271  15.801  20.449  1.00 76.10  ? 9   DC  T "O4'"  1 
ATOM   6182 C  "C3'"  . DC  C 3 9   ? 21.111  15.897  22.661  1.00 68.22  ? 9   DC  T "C3'"  1 
ATOM   6183 O  "O3'"  . DC  C 3 9   ? 22.436  16.137  23.057  1.00 69.64  ? 9   DC  T "O3'"  1 
ATOM   6184 C  "C2'"  . DC  C 3 9   ? 20.371  17.186  22.306  1.00 64.99  ? 9   DC  T "C2'"  1 
ATOM   6185 C  "C1'"  . DC  C 3 9   ? 20.380  17.170  20.777  1.00 69.67  ? 9   DC  T "C1'"  1 
ATOM   6186 N  N1     . DC  C 3 9   ? 19.280  17.999  20.194  1.00 54.68  ? 9   DC  T N1     1 
ATOM   6187 C  C2     . DC  C 3 9   ? 19.607  19.001  19.274  1.00 57.77  ? 9   DC  T C2     1 
ATOM   6188 O  O2     . DC  C 3 9   ? 20.801  19.142  18.950  1.00 52.02  ? 9   DC  T O2     1 
ATOM   6189 N  N3     . DC  C 3 9   ? 18.606  19.771  18.762  1.00 50.99  ? 9   DC  T N3     1 
ATOM   6190 C  C4     . DC  C 3 9   ? 17.348  19.582  19.150  1.00 58.22  ? 9   DC  T C4     1 
ATOM   6191 N  N4     . DC  C 3 9   ? 16.406  20.369  18.619  1.00 63.34  ? 9   DC  T N4     1 
ATOM   6192 C  C5     . DC  C 3 9   ? 16.999  18.573  20.098  1.00 54.08  ? 9   DC  T C5     1 
ATOM   6193 C  C6     . DC  C 3 9   ? 17.987  17.815  20.593  1.00 56.82  ? 9   DC  T C6     1 
ATOM   6194 H  "H5'"  . DC  C 3 9   ? 21.344  13.263  22.230  1.00 84.46  ? 9   DC  T "H5'"  1 
ATOM   6195 H  "H5''" . DC  C 3 9   ? 19.887  13.545  21.637  1.00 84.46  ? 9   DC  T "H5''" 1 
ATOM   6196 H  "H4'"  . DC  C 3 9   ? 22.092  15.198  20.994  1.00 90.44  ? 9   DC  T "H4'"  1 
ATOM   6197 H  "H3'"  . DC  C 3 9   ? 20.626  15.389  23.344  1.00 81.87  ? 9   DC  T "H3'"  1 
ATOM   6198 H  "H2'"  . DC  C 3 9   ? 19.452  17.164  22.648  1.00 77.99  ? 9   DC  T "H2'"  1 
ATOM   6199 H  "H2''" . DC  C 3 9   ? 20.852  17.968  22.648  1.00 77.99  ? 9   DC  T "H2''" 1 
ATOM   6200 H  "H1'"  . DC  C 3 9   ? 21.242  17.509  20.458  1.00 83.61  ? 9   DC  T "H1'"  1 
ATOM   6201 H  H41    . DC  C 3 9   ? 15.469  20.257  18.882  1.00 76.00  ? 9   DC  T H41    1 
ATOM   6202 H  H42    . DC  C 3 9   ? 16.654  21.058  17.967  1.00 76.00  ? 9   DC  T H42    1 
ATOM   6203 H  H5     . DC  C 3 9   ? 16.069  18.437  20.375  1.00 64.89  ? 9   DC  T H5     1 
ATOM   6204 H  H6     . DC  C 3 9   ? 17.779  17.117  21.248  1.00 68.18  ? 9   DC  T H6     1 
ATOM   6205 P  P      . DG  C 3 10  ? 22.759  16.730  24.513  1.00 65.50  ? 10  DG  T P      1 
ATOM   6206 O  OP1    . DG  C 3 10  ? 23.527  15.709  25.249  1.00 66.71  ? 10  DG  T OP1    1 
ATOM   6207 O  OP2    . DG  C 3 10  ? 21.516  17.329  25.064  1.00 55.05  ? 10  DG  T OP2    1 
ATOM   6208 O  "O5'"  . DG  C 3 10  ? 23.714  17.958  24.200  1.00 58.47  ? 10  DG  T "O5'"  1 
ATOM   6209 C  "C5'"  . DG  C 3 10  ? 24.882  17.762  23.448  1.00 65.26  ? 10  DG  T "C5'"  1 
ATOM   6210 C  "C4'"  . DG  C 3 10  ? 25.308  19.116  22.927  1.00 65.85  ? 10  DG  T "C4'"  1 
ATOM   6211 O  "O4'"  . DG  C 3 10  ? 24.222  19.625  22.117  1.00 67.50  ? 10  DG  T "O4'"  1 
ATOM   6212 C  "C3'"  . DG  C 3 10  ? 25.566  20.152  24.021  1.00 67.99  ? 10  DG  T "C3'"  1 
ATOM   6213 O  "O3'"  . DG  C 3 10  ? 26.814  20.793  23.787  1.00 68.93  ? 10  DG  T "O3'"  1 
ATOM   6214 C  "C2'"  . DG  C 3 10  ? 24.371  21.099  23.938  1.00 55.50  ? 10  DG  T "C2'"  1 
ATOM   6215 C  "C1'"  . DG  C 3 10  ? 23.926  20.949  22.489  1.00 57.37  ? 10  DG  T "C1'"  1 
ATOM   6216 N  N9     . DG  C 3 10  ? 22.506  21.186  22.263  1.00 57.80  ? 10  DG  T N9     1 
ATOM   6217 C  C8     . DG  C 3 10  ? 21.421  20.621  22.897  1.00 61.32  ? 10  DG  T C8     1 
ATOM   6218 N  N7     . DG  C 3 10  ? 20.268  21.052  22.457  1.00 54.47  ? 10  DG  T N7     1 
ATOM   6219 C  C5     . DG  C 3 10  ? 20.626  21.961  21.468  1.00 54.20  ? 10  DG  T C5     1 
ATOM   6220 C  C6     . DG  C 3 10  ? 19.814  22.746  20.635  1.00 49.76  ? 10  DG  T C6     1 
ATOM   6221 O  O6     . DG  C 3 10  ? 18.575  22.759  20.643  1.00 52.58  ? 10  DG  T O6     1 
ATOM   6222 N  N1     . DG  C 3 10  ? 20.580  23.539  19.764  1.00 50.28  ? 10  DG  T N1     1 
ATOM   6223 C  C2     . DG  C 3 10  ? 21.965  23.552  19.717  1.00 55.78  ? 10  DG  T C2     1 
ATOM   6224 N  N2     . DG  C 3 10  ? 22.586  24.358  18.827  1.00 46.59  ? 10  DG  T N2     1 
ATOM   6225 N  N3     . DG  C 3 10  ? 22.726  22.806  20.500  1.00 51.94  ? 10  DG  T N3     1 
ATOM   6226 C  C4     . DG  C 3 10  ? 21.989  22.051  21.338  1.00 52.38  ? 10  DG  T C4     1 
ATOM   6227 H  "H5'"  . DG  C 3 10  ? 24.698  17.158  22.698  1.00 78.31  ? 10  DG  T "H5'"  1 
ATOM   6228 H  "H5''" . DG  C 3 10  ? 25.586  17.386  24.016  1.00 78.31  ? 10  DG  T "H5''" 1 
ATOM   6229 H  "H4'"  . DG  C 3 10  ? 26.111  19.016  22.373  1.00 79.03  ? 10  DG  T "H4'"  1 
ATOM   6230 H  "H3'"  . DG  C 3 10  ? 25.579  19.712  24.896  1.00 81.58  ? 10  DG  T "H3'"  1 
ATOM   6231 H  "H2'"  . DG  C 3 10  ? 23.661  20.815  24.550  1.00 66.60  ? 10  DG  T "H2'"  1 
ATOM   6232 H  "H2''" . DG  C 3 10  ? 24.646  22.021  24.123  1.00 66.60  ? 10  DG  T "H2''" 1 
ATOM   6233 H  "H1'"  . DG  C 3 10  ? 24.446  21.563  21.929  1.00 68.85  ? 10  DG  T "H1'"  1 
ATOM   6234 H  H8     . DG  C 3 10  ? 21.506  19.958  23.614  1.00 73.59  ? 10  DG  T H8     1 
ATOM   6235 H  H1     . DG  C 3 10  ? 20.099  24.121  19.139  1.00 60.34  ? 10  DG  T H1     1 
ATOM   6236 H  H21    . DG  C 3 10  ? 23.564  24.374  18.780  1.00 55.91  ? 10  DG  T H21    1 
ATOM   6237 H  H22    . DG  C 3 10  ? 22.057  24.926  18.229  1.00 55.91  ? 10  DG  T H22    1 
ATOM   6238 P  P      . DA  C 3 11  ? 27.291  22.013  24.719  1.00 74.54  ? 11  DA  T P      1 
ATOM   6239 O  OP1    . DA  C 3 11  ? 28.744  21.866  24.958  1.00 69.52  ? 11  DA  T OP1    1 
ATOM   6240 O  OP2    . DA  C 3 11  ? 26.352  22.122  25.861  1.00 69.48  ? 11  DA  T OP2    1 
ATOM   6241 O  "O5'"  . DA  C 3 11  ? 27.094  23.286  23.784  1.00 69.98  ? 11  DA  T "O5'"  1 
ATOM   6242 C  "C5'"  . DA  C 3 11  ? 27.830  23.347  22.578  1.00 60.90  ? 11  DA  T "C5'"  1 
ATOM   6243 C  "C4'"  . DA  C 3 11  ? 27.502  24.658  21.912  1.00 67.94  ? 11  DA  T "C4'"  1 
ATOM   6244 O  "O4'"  . DA  C 3 11  ? 26.086  24.657  21.601  1.00 58.80  ? 11  DA  T "O4'"  1 
ATOM   6245 C  "C3'"  . DA  C 3 11  ? 27.764  25.868  22.812  1.00 60.41  ? 11  DA  T "C3'"  1 
ATOM   6246 O  "O3'"  . DA  C 3 11  ? 28.380  26.919  22.060  1.00 70.84  ? 11  DA  T "O3'"  1 
ATOM   6247 C  "C2'"  . DA  C 3 11  ? 26.379  26.229  23.338  1.00 59.07  ? 11  DA  T "C2'"  1 
ATOM   6248 C  "C1'"  . DA  C 3 11  ? 25.470  25.773  22.202  1.00 58.20  ? 11  DA  T "C1'"  1 
ATOM   6249 N  N9     . DA  C 3 11  ? 24.144  25.387  22.655  1.00 59.80  ? 11  DA  T N9     1 
ATOM   6250 C  C8     . DA  C 3 11  ? 23.814  24.516  23.657  1.00 58.74  ? 11  DA  T C8     1 
ATOM   6251 N  N7     . DA  C 3 11  ? 22.517  24.384  23.831  1.00 55.27  ? 11  DA  T N7     1 
ATOM   6252 C  C5     . DA  C 3 11  ? 21.968  25.236  22.889  1.00 51.70  ? 11  DA  T C5     1 
ATOM   6253 C  C6     . DA  C 3 11  ? 20.639  25.562  22.559  1.00 50.89  ? 11  DA  T C6     1 
ATOM   6254 N  N6     . DA  C 3 11  ? 19.574  25.036  23.180  1.00 50.61  ? 11  DA  T N6     1 
ATOM   6255 N  N1     . DA  C 3 11  ? 20.451  26.451  21.563  1.00 46.58  ? 11  DA  T N1     1 
ATOM   6256 C  C2     . DA  C 3 11  ? 21.515  26.977  20.958  1.00 52.19  ? 11  DA  T C2     1 
ATOM   6257 N  N3     . DA  C 3 11  ? 22.809  26.749  21.178  1.00 52.08  ? 11  DA  T N3     1 
ATOM   6258 C  C4     . DA  C 3 11  ? 22.959  25.859  22.159  1.00 53.57  ? 11  DA  T C4     1 
ATOM   6259 H  "H5'"  . DA  C 3 11  ? 27.573  22.603  21.993  1.00 73.08  ? 11  DA  T "H5'"  1 
ATOM   6260 H  "H5''" . DA  C 3 11  ? 28.790  23.302  22.771  1.00 73.08  ? 11  DA  T "H5''" 1 
ATOM   6261 H  "H4'"  . DA  C 3 11  ? 28.020  24.746  21.085  1.00 81.53  ? 11  DA  T "H4'"  1 
ATOM   6262 H  "H3'"  . DA  C 3 11  ? 28.345  25.607  23.557  1.00 72.49  ? 11  DA  T "H3'"  1 
ATOM   6263 H  "H2'"  . DA  C 3 11  ? 26.180  25.736  24.162  1.00 70.88  ? 11  DA  T "H2'"  1 
ATOM   6264 H  "H2''" . DA  C 3 11  ? 26.301  27.195  23.480  1.00 70.88  ? 11  DA  T "H2''" 1 
ATOM   6265 H  "H1'"  . DA  C 3 11  ? 25.390  26.493  21.542  1.00 69.84  ? 11  DA  T "H1'"  1 
ATOM   6266 H  H8     . DA  C 3 11  ? 24.479  24.024  24.183  1.00 70.48  ? 11  DA  T H8     1 
ATOM   6267 H  H61    . DA  C 3 11  ? 18.670  25.298  22.909  1.00 60.73  ? 11  DA  T H61    1 
ATOM   6268 H  H62    . DA  C 3 11  ? 19.700  24.388  23.905  1.00 60.73  ? 11  DA  T H62    1 
ATOM   6269 H  H2     . DA  C 3 11  ? 21.318  27.616  20.241  1.00 62.62  ? 11  DA  T H2     1 
ATOM   6270 P  P      . DT  C 3 12  ? 28.838  28.276  22.790  1.00 76.77  ? 12  DT  T P      1 
ATOM   6271 O  OP1    . DT  C 3 12  ? 30.147  28.676  22.230  1.00 77.54  ? 12  DT  T OP1    1 
ATOM   6272 O  OP2    . DT  C 3 12  ? 28.687  28.087  24.254  1.00 74.58  ? 12  DT  T OP2    1 
ATOM   6273 O  "O5'"  . DT  C 3 12  ? 27.716  29.327  22.357  1.00 65.33  ? 12  DT  T "O5'"  1 
ATOM   6274 C  "C5'"  . DT  C 3 12  ? 27.299  29.470  21.018  1.00 65.36  ? 12  DT  T "C5'"  1 
ATOM   6275 C  "C4'"  . DT  C 3 12  ? 26.180  30.484  21.018  1.00 66.58  ? 12  DT  T "C4'"  1 
ATOM   6276 O  "O4'"  . DT  C 3 12  ? 24.968  29.837  21.483  1.00 61.64  ? 12  DT  T "O4'"  1 
ATOM   6277 C  "C3'"  . DT  C 3 12  ? 26.405  31.690  21.936  1.00 65.55  ? 12  DT  T "C3'"  1 
ATOM   6278 O  "O3'"  . DT  C 3 12  ? 25.993  32.864  21.217  1.00 72.64  ? 12  DT  T "O3'"  1 
ATOM   6279 C  "C2'"  . DT  C 3 12  ? 25.546  31.342  23.149  1.00 57.40  ? 12  DT  T "C2'"  1 
ATOM   6280 C  "C1'"  . DT  C 3 12  ? 24.373  30.630  22.482  1.00 60.28  ? 12  DT  T "C1'"  1 
ATOM   6281 N  N1     . DT  C 3 12  ? 23.528  29.742  23.346  1.00 55.20  ? 12  DT  T N1     1 
ATOM   6282 C  C2     . DT  C 3 12  ? 22.160  29.748  23.149  1.00 57.76  ? 12  DT  T C2     1 
ATOM   6283 O  O2     . DT  C 3 12  ? 21.582  30.427  22.322  1.00 57.62  ? 12  DT  T O2     1 
ATOM   6284 N  N3     . DT  C 3 12  ? 21.465  28.909  23.972  1.00 47.37  ? 12  DT  T N3     1 
ATOM   6285 C  C4     . DT  C 3 12  ? 21.979  28.087  24.948  1.00 51.10  ? 12  DT  T C4     1 
ATOM   6286 O  O4     . DT  C 3 12  ? 21.249  27.381  25.631  1.00 51.53  ? 12  DT  T O4     1 
ATOM   6287 C  C5     . DT  C 3 12  ? 23.405  28.123  25.111  1.00 56.77  ? 12  DT  T C5     1 
ATOM   6288 C  C7     . DT  C 3 12  ? 24.054  27.254  26.157  1.00 56.26  ? 12  DT  T C7     1 
ATOM   6289 C  C6     . DT  C 3 12  ? 24.107  28.939  24.309  1.00 57.10  ? 12  DT  T C6     1 
ATOM   6290 H  "H5'"  . DT  C 3 12  ? 26.973  28.611  20.675  1.00 78.44  ? 12  DT  T "H5'"  1 
ATOM   6291 H  "H5''" . DT  C 3 12  ? 28.043  29.791  20.467  1.00 78.44  ? 12  DT  T "H5''" 1 
ATOM   6292 H  "H4'"  . DT  C 3 12  ? 26.040  30.804  20.102  1.00 79.90  ? 12  DT  T "H4'"  1 
ATOM   6293 H  "H3'"  . DT  C 3 12  ? 27.350  31.754  22.191  1.00 78.66  ? 12  DT  T "H3'"  1 
ATOM   6294 H  "H2'"  . DT  C 3 12  ? 26.023  30.740  23.757  1.00 68.88  ? 12  DT  T "H2'"  1 
ATOM   6295 H  "H2''" . DT  C 3 12  ? 25.247  32.152  23.613  1.00 68.88  ? 12  DT  T "H2''" 1 
ATOM   6296 H  "H1'"  . DT  C 3 12  ? 23.797  31.298  22.055  1.00 72.34  ? 12  DT  T "H1'"  1 
ATOM   6297 H  H3     . DT  C 3 12  ? 20.492  28.894  23.857  1.00 56.85  ? 12  DT  T H3     1 
ATOM   6298 H  H71    . DT  C 3 12  ? 24.533  27.818  26.799  1.00 67.51  ? 12  DT  T H71    1 
ATOM   6299 H  H72    . DT  C 3 12  ? 23.365  26.738  26.626  1.00 67.51  ? 12  DT  T H72    1 
ATOM   6300 H  H73    . DT  C 3 12  ? 24.685  26.640  25.727  1.00 67.51  ? 12  DT  T H73    1 
ATOM   6301 H  H6     . DT  C 3 12  ? 25.081  28.967  24.413  1.00 68.52  ? 12  DT  T H6     1 
ATOM   6302 P  P      . DC  C 3 13  ? 26.275  34.342  21.800  1.00 64.01  ? 13  DC  T P      1 
ATOM   6303 O  OP1    . DC  C 3 13  ? 26.931  35.128  20.730  1.00 68.44  ? 13  DC  T OP1    1 
ATOM   6304 O  OP2    . DC  C 3 13  ? 26.916  34.211  23.126  1.00 63.51  ? 13  DC  T OP2    1 
ATOM   6305 O  "O5'"  . DC  C 3 13  ? 24.806  34.941  21.990  1.00 67.75  ? 13  DC  T "O5'"  1 
ATOM   6306 C  "C5'"  . DC  C 3 13  ? 23.994  35.007  20.817  1.00 70.17  ? 13  DC  T "C5'"  1 
ATOM   6307 C  "C4'"  . DC  C 3 13  ? 22.581  35.415  21.164  1.00 73.07  ? 13  DC  T "C4'"  1 
ATOM   6308 O  "O4'"  . DC  C 3 13  ? 21.939  34.255  21.739  1.00 70.81  ? 13  DC  T "O4'"  1 
ATOM   6309 C  "C3'"  . DC  C 3 13  ? 22.490  36.551  22.181  1.00 76.51  ? 13  DC  T "C3'"  1 
ATOM   6310 O  "O3'"  . DC  C 3 13  ? 21.945  37.735  21.596  1.00 85.24  ? 13  DC  T "O3'"  1 
ATOM   6311 C  "C2'"  . DC  C 3 13  ? 21.591  36.030  23.295  1.00 68.68  ? 13  DC  T "C2'"  1 
ATOM   6312 C  "C1'"  . DC  C 3 13  ? 21.177  34.628  22.863  1.00 69.93  ? 13  DC  T "C1'"  1 
ATOM   6313 N  N1     . DC  C 3 13  ? 21.411  33.631  23.931  1.00 60.37  ? 13  DC  T N1     1 
ATOM   6314 C  C2     . DC  C 3 13  ? 20.301  33.027  24.507  1.00 61.52  ? 13  DC  T C2     1 
ATOM   6315 O  O2     . DC  C 3 13  ? 19.191  33.358  24.067  1.00 59.26  ? 13  DC  T O2     1 
ATOM   6316 N  N3     . DC  C 3 13  ? 20.497  32.112  25.500  1.00 52.85  ? 13  DC  T N3     1 
ATOM   6317 C  C4     . DC  C 3 13  ? 21.739  31.807  25.900  1.00 52.99  ? 13  DC  T C4     1 
ATOM   6318 N  N4     . DC  C 3 13  ? 21.895  30.902  26.875  1.00 52.88  ? 13  DC  T N4     1 
ATOM   6319 C  C5     . DC  C 3 13  ? 22.885  32.428  25.324  1.00 55.44  ? 13  DC  T C5     1 
ATOM   6320 C  C6     . DC  C 3 13  ? 22.676  33.326  24.352  1.00 66.25  ? 13  DC  T C6     1 
ATOM   6321 H  "H5'"  . DC  C 3 13  ? 23.979  34.127  20.385  1.00 84.21  ? 13  DC  T "H5'"  1 
ATOM   6322 H  "H5''" . DC  C 3 13  ? 24.376  35.664  20.197  1.00 84.21  ? 13  DC  T "H5''" 1 
ATOM   6323 H  "H4'"  . DC  C 3 13  ? 22.109  35.674  20.346  1.00 87.69  ? 13  DC  T "H4'"  1 
ATOM   6324 H  "H3'"  . DC  C 3 13  ? 23.382  36.742  22.541  1.00 91.81  ? 13  DC  T "H3'"  1 
ATOM   6325 H  "H2'"  . DC  C 3 13  ? 22.086  35.991  24.140  1.00 82.42  ? 13  DC  T "H2'"  1 
ATOM   6326 H  "H2''" . DC  C 3 13  ? 20.802  36.603  23.390  1.00 82.42  ? 13  DC  T "H2''" 1 
ATOM   6327 H  "H1'"  . DC  C 3 13  ? 20.227  34.630  22.624  1.00 83.92  ? 13  DC  T "H1'"  1 
ATOM   6328 H  H41    . DC  C 3 13  ? 22.795  30.664  27.183  1.00 63.46  ? 13  DC  T H41    1 
ATOM   6329 H  H42    . DC  C 3 13  ? 21.110  30.479  27.281  1.00 63.46  ? 13  DC  T H42    1 
ATOM   6330 H  H5     . DC  C 3 13  ? 23.791  32.204  25.625  1.00 66.53  ? 13  DC  T H5     1 
ATOM   6331 H  H6     . DC  C 3 13  ? 23.443  33.770  23.933  1.00 79.50  ? 13  DC  T H6     1 
ATOM   6332 P  P      . DA  C 3 14  ? 21.953  39.126  22.414  1.00 79.08  ? 14  DA  T P      1 
ATOM   6333 O  OP1    . DA  C 3 14  ? 22.004  40.230  21.429  1.00 94.09  ? 14  DA  T OP1    1 
ATOM   6334 O  OP2    . DA  C 3 14  ? 22.957  39.024  23.502  1.00 59.28  ? 14  DA  T OP2    1 
ATOM   6335 O  "O5'"  . DA  C 3 14  ? 20.527  39.154  23.120  1.00 68.60  ? 14  DA  T "O5'"  1 
ATOM   6336 C  "C5'"  . DA  C 3 14  ? 19.364  39.094  22.318  1.00 71.98  ? 14  DA  T "C5'"  1 
ATOM   6337 C  "C4'"  . DA  C 3 14  ? 18.171  39.159  23.240  1.00 74.45  ? 14  DA  T "C4'"  1 
ATOM   6338 O  "O4'"  . DA  C 3 14  ? 18.190  37.964  24.059  1.00 63.10  ? 14  DA  T "O4'"  1 
ATOM   6339 C  "C3'"  . DA  C 3 14  ? 18.174  40.353  24.196  1.00 70.26  ? 14  DA  T "C3'"  1 
ATOM   6340 O  "O3'"  . DA  C 3 14  ? 16.851  40.861  24.289  1.00 71.39  ? 14  DA  T "O3'"  1 
ATOM   6341 C  "C2'"  . DA  C 3 14  ? 18.697  39.765  25.505  1.00 69.36  ? 14  DA  T "C2'"  1 
ATOM   6342 C  "C1'"  . DA  C 3 14  ? 18.295  38.294  25.426  1.00 65.66  ? 14  DA  T "C1'"  1 
ATOM   6343 N  N9     . DA  C 3 14  ? 19.251  37.374  26.039  1.00 63.32  ? 14  DA  T N9     1 
ATOM   6344 C  C8     . DA  C 3 14  ? 20.613  37.361  25.910  1.00 67.28  ? 14  DA  T C8     1 
ATOM   6345 N  N7     . DA  C 3 14  ? 21.201  36.399  26.597  1.00 65.29  ? 14  DA  T N7     1 
ATOM   6346 C  C5     . DA  C 3 14  ? 20.154  35.739  27.223  1.00 62.00  ? 14  DA  T C5     1 
ATOM   6347 C  C6     . DA  C 3 14  ? 20.103  34.622  28.093  1.00 58.56  ? 14  DA  T C6     1 
ATOM   6348 N  N6     . DA  C 3 14  ? 21.184  33.938  28.517  1.00 43.87  ? 14  DA  T N6     1 
ATOM   6349 N  N1     . DA  C 3 14  ? 18.877  34.239  28.515  1.00 53.13  ? 14  DA  T N1     1 
ATOM   6350 C  C2     . DA  C 3 14  ? 17.796  34.912  28.108  1.00 59.65  ? 14  DA  T C2     1 
ATOM   6351 N  N3     . DA  C 3 14  ? 17.724  35.968  27.294  1.00 57.04  ? 14  DA  T N3     1 
ATOM   6352 C  C4     . DA  C 3 14  ? 18.947  36.331  26.883  1.00 60.59  ? 14  DA  T C4     1 
ATOM   6353 H  "H5'"  . DA  C 3 14  ? 19.350  38.253  21.814  1.00 86.38  ? 14  DA  T "H5'"  1 
ATOM   6354 H  "H5''" . DA  C 3 14  ? 19.348  39.854  21.698  1.00 86.38  ? 14  DA  T "H5''" 1 
ATOM   6355 H  "H4'"  . DA  C 3 14  ? 17.349  39.173  22.706  1.00 89.33  ? 14  DA  T "H4'"  1 
ATOM   6356 H  "H3'"  . DA  C 3 14  ? 18.783  41.047  23.868  1.00 84.31  ? 14  DA  T "H3'"  1 
ATOM   6357 H  "H2'"  . DA  C 3 14  ? 19.671  39.854  25.557  1.00 83.23  ? 14  DA  T "H2'"  1 
ATOM   6358 H  "H2''" . DA  C 3 14  ? 18.268  40.199  26.272  1.00 83.23  ? 14  DA  T "H2''" 1 
ATOM   6359 H  "H1'"  . DA  C 3 14  ? 17.420  38.177  25.852  1.00 78.79  ? 14  DA  T "H1'"  1 
ATOM   6360 H  H8     . DA  C 3 14  ? 21.106  38.004  25.359  1.00 80.74  ? 14  DA  T H8     1 
ATOM   6361 H  H61    . DA  C 3 14  ? 21.075  33.176  29.123  1.00 52.65  ? 14  DA  T H61    1 
ATOM   6362 H  H62    . DA  C 3 14  ? 22.079  34.204  28.220  1.00 52.65  ? 14  DA  T H62    1 
ATOM   6363 H  H2     . DA  C 3 14  ? 16.939  34.583  28.451  1.00 71.58  ? 14  DA  T H2     1 
ATOM   6364 P  P      . DG  C 3 15  ? 16.473  41.942  25.412  1.00 84.93  ? 15  DG  T P      1 
ATOM   6365 O  OP1    . DG  C 3 15  ? 15.215  42.605  25.000  1.00 81.63  ? 15  DG  T OP1    1 
ATOM   6366 O  OP2    . DG  C 3 15  ? 17.690  42.724  25.722  1.00 72.93  ? 15  DG  T OP2    1 
ATOM   6367 O  "O5'"  . DG  C 3 15  ? 16.127  41.051  26.688  1.00 75.88  ? 15  DG  T "O5'"  1 
ATOM   6368 C  "C5'"  . DG  C 3 15  ? 14.855  40.449  26.760  1.00 70.86  ? 15  DG  T "C5'"  1 
ATOM   6369 C  "C4'"  . DG  C 3 15  ? 14.661  39.892  28.152  1.00 75.73  ? 15  DG  T "C4'"  1 
ATOM   6370 O  "O4'"  . DG  C 3 15  ? 15.716  38.945  28.450  1.00 64.85  ? 15  DG  T "O4'"  1 
ATOM   6371 C  "C3'"  . DG  C 3 15  ? 14.730  40.927  29.260  1.00 68.57  ? 15  DG  T "C3'"  1 
ATOM   6372 O  "O3'"  . DG  C 3 15  ? 13.706  40.658  30.173  1.00 66.81  ? 15  DG  T "O3'"  1 
ATOM   6373 C  "C2'"  . DG  C 3 15  ? 16.094  40.705  29.893  1.00 67.02  ? 15  DG  T "C2'"  1 
ATOM   6374 C  "C1'"  . DG  C 3 15  ? 16.206  39.199  29.746  1.00 62.62  ? 15  DG  T "C1'"  1 
ATOM   6375 N  N9     . DG  C 3 15  ? 17.562  38.684  29.821  1.00 66.61  ? 15  DG  T N9     1 
ATOM   6376 C  C8     . DG  C 3 15  ? 18.664  39.192  29.180  1.00 60.07  ? 15  DG  T C8     1 
ATOM   6377 N  N7     . DG  C 3 15  ? 19.753  38.521  29.429  1.00 63.04  ? 15  DG  T N7     1 
ATOM   6378 C  C5     . DG  C 3 15  ? 19.349  37.498  30.285  1.00 58.86  ? 15  DG  T C5     1 
ATOM   6379 C  C6     . DG  C 3 15  ? 20.094  36.455  30.888  1.00 56.84  ? 15  DG  T C6     1 
ATOM   6380 O  O6     . DG  C 3 15  ? 21.301  36.211  30.786  1.00 51.69  ? 15  DG  T O6     1 
ATOM   6381 N  N1     . DG  C 3 15  ? 19.299  35.643  31.686  1.00 51.62  ? 15  DG  T N1     1 
ATOM   6382 C  C2     . DG  C 3 15  ? 17.950  35.806  31.874  1.00 58.77  ? 15  DG  T C2     1 
ATOM   6383 N  N2     . DG  C 3 15  ? 17.348  34.912  32.681  1.00 53.48  ? 15  DG  T N2     1 
ATOM   6384 N  N3     . DG  C 3 15  ? 17.239  36.780  31.317  1.00 60.32  ? 15  DG  T N3     1 
ATOM   6385 C  C4     . DG  C 3 15  ? 18.000  37.585  30.537  1.00 64.07  ? 15  DG  T C4     1 
ATOM   6386 H  "H5'"  . DG  C 3 15  ? 14.797  39.723  26.104  1.00 85.03  ? 15  DG  T "H5'"  1 
ATOM   6387 H  "H5''" . DG  C 3 15  ? 14.163  41.117  26.573  1.00 85.03  ? 15  DG  T "H5''" 1 
ATOM   6388 H  "H4'"  . DG  C 3 15  ? 13.796  39.433  28.195  1.00 90.88  ? 15  DG  T "H4'"  1 
ATOM   6389 H  "H3'"  . DG  C 3 15  ? 14.653  41.834  28.899  1.00 82.28  ? 15  DG  T "H3'"  1 
ATOM   6390 H  "H2'"  . DG  C 3 15  ? 16.798  41.164  29.389  1.00 80.42  ? 15  DG  T "H2'"  1 
ATOM   6391 H  "H2''" . DG  C 3 15  ? 16.095  40.971  30.836  1.00 80.42  ? 15  DG  T "H2''" 1 
ATOM   6392 H  "H1'"  . DG  C 3 15  ? 15.640  38.754  30.411  1.00 75.15  ? 15  DG  T "H1'"  1 
ATOM   6393 H  H8     . DG  C 3 15  ? 18.635  39.981  28.599  1.00 72.08  ? 15  DG  T H8     1 
ATOM   6394 H  H1     . DG  C 3 15  ? 19.732  34.892  32.141  1.00 61.94  ? 15  DG  T H1     1 
ATOM   6395 H  H21    . DG  C 3 15  ? 16.387  34.981  32.857  1.00 64.17  ? 15  DG  T H21    1 
ATOM   6396 H  H22    . DG  C 3 15  ? 17.872  34.194  33.092  1.00 64.17  ? 15  DG  T H22    1 
ATOM   6397 P  P      . DT  C 3 16  ? 13.327  41.736  31.296  1.00 69.65  ? 16  DT  T P      1 
ATOM   6398 O  OP1    . DT  C 3 16  ? 11.875  41.634  31.549  1.00 71.86  ? 16  DT  T OP1    1 
ATOM   6399 O  OP2    . DT  C 3 16  ? 13.915  43.034  30.894  1.00 74.45  ? 16  DT  T OP2    1 
ATOM   6400 O  "O5'"  . DT  C 3 16  ? 14.103  41.206  32.598  1.00 75.57  ? 16  DT  T "O5'"  1 
ATOM   6401 C  "C5'"  . DT  C 3 16  ? 13.496  40.214  33.433  1.00 71.66  ? 16  DT  T "C5'"  1 
ATOM   6402 C  "C4'"  . DT  C 3 16  ? 14.487  39.616  34.419  1.00 73.66  ? 16  DT  T "C4'"  1 
ATOM   6403 O  "O4'"  . DT  C 3 16  ? 15.566  38.998  33.677  1.00 68.15  ? 16  DT  T "O4'"  1 
ATOM   6404 C  "C3'"  . DT  C 3 16  ? 15.269  40.574  35.320  1.00 70.81  ? 16  DT  T "C3'"  1 
ATOM   6405 O  "O3'"  . DT  C 3 16  ? 14.530  41.221  36.392  1.00 81.43  ? 16  DT  T "O3'"  1 
ATOM   6406 C  "C2'"  . DT  C 3 16  ? 16.368  39.639  35.807  1.00 70.60  ? 16  DT  T "C2'"  1 
ATOM   6407 C  "C1'"  . DT  C 3 16  ? 16.632  38.765  34.585  1.00 67.54  ? 16  DT  T "C1'"  1 
ATOM   6408 N  N1     . DT  C 3 16  ? 17.989  39.008  33.974  1.00 66.34  ? 16  DT  T N1     1 
ATOM   6409 C  C2     . DT  C 3 16  ? 18.991  38.136  34.346  1.00 66.34  ? 16  DT  T C2     1 
ATOM   6410 O  O2     . DT  C 3 16  ? 18.812  37.219  35.124  1.00 62.42  ? 16  DT  T O2     1 
ATOM   6411 N  N3     . DT  C 3 16  ? 20.217  38.370  33.779  1.00 57.57  ? 16  DT  T N3     1 
ATOM   6412 C  C4     . DT  C 3 16  ? 20.546  39.374  32.896  1.00 58.26  ? 16  DT  T C4     1 
ATOM   6413 O  O4     . DT  C 3 16  ? 21.689  39.485  32.456  1.00 61.84  ? 16  DT  T O4     1 
ATOM   6414 C  C5     . DT  C 3 16  ? 19.458  40.260  32.544  1.00 60.91  ? 16  DT  T C5     1 
ATOM   6415 C  C7     . DT  C 3 16  ? 19.712  41.387  31.584  1.00 56.31  ? 16  DT  T C7     1 
ATOM   6416 C  C6     . DT  C 3 16  ? 18.245  40.044  33.090  1.00 55.97  ? 16  DT  T C6     1 
ATOM   6417 H  "H5'"  . DT  C 3 16  ? 13.137  39.498  32.868  1.00 85.99  ? 16  DT  T "H5'"  1 
ATOM   6418 H  "H5''" . DT  C 3 16  ? 12.759  40.626  33.932  1.00 85.99  ? 16  DT  T "H5''" 1 
ATOM   6419 H  "H4'"  . DT  C 3 16  ? 14.038  38.940  34.969  1.00 88.39  ? 16  DT  T "H4'"  1 
ATOM   6420 H  "H3'"  . DT  C 3 16  ? 15.675  41.268  34.759  1.00 84.97  ? 16  DT  T "H3'"  1 
ATOM   6421 H  "H2'"  . DT  C 3 16  ? 17.171  40.145  36.051  1.00 84.71  ? 16  DT  T "H2'"  1 
ATOM   6422 H  "H2''" . DT  C 3 16  ? 16.054  39.097  36.560  1.00 84.71  ? 16  DT  T "H2''" 1 
ATOM   6423 H  "H1'"  . DT  C 3 16  ? 16.591  37.828  34.868  1.00 81.05  ? 16  DT  T "H1'"  1 
ATOM   6424 H  H3     . DT  C 3 16  ? 20.940  37.760  34.035  1.00 69.09  ? 16  DT  T H3     1 
ATOM   6425 H  H71    . DT  C 3 16  ? 19.134  41.284  30.799  1.00 67.57  ? 16  DT  T H71    1 
ATOM   6426 H  H72    . DT  C 3 16  ? 19.517  42.241  32.024  1.00 67.57  ? 16  DT  T H72    1 
ATOM   6427 H  H73    . DT  C 3 16  ? 20.651  41.371  31.303  1.00 67.57  ? 16  DT  T H73    1 
ATOM   6428 H  H6     . DT  C 3 16  ? 17.509  40.644  32.847  1.00 67.16  ? 16  DT  T H6     1 
ATOM   6429 P  P      . DG  C 3 17  ? 13.881  40.363  37.588  1.00 81.53  ? 17  DG  T P      1 
ATOM   6430 O  OP1    . DG  C 3 17  ? 12.983  39.346  36.989  1.00 88.08  ? 17  DG  T OP1    1 
ATOM   6431 O  OP2    . DG  C 3 17  ? 13.322  41.303  38.573  1.00 73.43  ? 17  DG  T OP2    1 
ATOM   6432 O  "O5'"  . DG  C 3 17  ? 15.136  39.656  38.285  1.00 80.62  ? 17  DG  T "O5'"  1 
ATOM   6433 C  "C5'"  . DG  C 3 17  ? 14.836  38.556  39.140  1.00 74.97  ? 17  DG  T "C5'"  1 
ATOM   6434 C  "C4'"  . DG  C 3 17  ? 16.060  37.934  39.792  1.00 74.14  ? 17  DG  T "C4'"  1 
ATOM   6435 O  "O4'"  . DG  C 3 17  ? 17.214  37.916  38.909  1.00 69.42  ? 17  DG  T "O4'"  1 
ATOM   6436 C  "C3'"  . DG  C 3 17  ? 16.535  38.630  41.058  1.00 73.13  ? 17  DG  T "C3'"  1 
ATOM   6437 O  "O3'"  . DG  C 3 17  ? 16.742  37.617  42.019  1.00 75.49  ? 17  DG  T "O3'"  1 
ATOM   6438 C  "C2'"  . DG  C 3 17  ? 17.829  39.338  40.660  1.00 64.58  ? 17  DG  T "C2'"  1 
ATOM   6439 C  "C1'"  . DG  C 3 17  ? 18.362  38.391  39.596  1.00 69.86  ? 17  DG  T "C1'"  1 
ATOM   6440 N  N9     . DG  C 3 17  ? 19.227  38.985  38.586  1.00 64.63  ? 17  DG  T N9     1 
ATOM   6441 C  C8     . DG  C 3 17  ? 18.903  39.996  37.719  1.00 65.70  ? 17  DG  T C8     1 
ATOM   6442 N  N7     . DG  C 3 17  ? 19.868  40.313  36.897  1.00 58.75  ? 17  DG  T N7     1 
ATOM   6443 C  C5     . DG  C 3 17  ? 20.896  39.451  37.239  1.00 64.28  ? 17  DG  T C5     1 
ATOM   6444 C  C6     . DG  C 3 17  ? 22.191  39.327  36.695  1.00 62.73  ? 17  DG  T C6     1 
ATOM   6445 O  O6     . DG  C 3 17  ? 22.697  39.978  35.772  1.00 57.43  ? 17  DG  T O6     1 
ATOM   6446 N  N1     . DG  C 3 17  ? 22.914  38.329  37.342  1.00 58.44  ? 17  DG  T N1     1 
ATOM   6447 C  C2     . DG  C 3 17  ? 22.440  37.550  38.366  1.00 57.12  ? 17  DG  T C2     1 
ATOM   6448 N  N2     . DG  C 3 17  ? 23.283  36.631  38.863  1.00 58.34  ? 17  DG  T N2     1 
ATOM   6449 N  N3     . DG  C 3 17  ? 21.229  37.660  38.886  1.00 59.27  ? 17  DG  T N3     1 
ATOM   6450 C  C4     . DG  C 3 17  ? 20.515  38.626  38.276  1.00 62.05  ? 17  DG  T C4     1 
ATOM   6451 H  "H5'"  . DG  C 3 17  ? 14.378  37.867  38.615  1.00 89.97  ? 17  DG  T "H5'"  1 
ATOM   6452 H  "H5''" . DG  C 3 17  ? 14.230  38.865  39.846  1.00 89.97  ? 17  DG  T "H5''" 1 
ATOM   6453 H  "H4'"  . DG  C 3 17  ? 15.840  37.007  40.021  1.00 88.96  ? 17  DG  T "H4'"  1 
ATOM   6454 H  "H3'"  . DG  C 3 17  ? 15.866  39.275  41.370  1.00 87.76  ? 17  DG  T "H3'"  1 
ATOM   6455 H  "H2'"  . DG  C 3 17  ? 17.644  40.224  40.282  1.00 77.50  ? 17  DG  T "H2'"  1 
ATOM   6456 H  "H2''" . DG  C 3 17  ? 18.445  39.397  41.420  1.00 77.50  ? 17  DG  T "H2''" 1 
ATOM   6457 H  "H1'"  . DG  C 3 17  ? 18.823  37.639  40.024  1.00 83.83  ? 17  DG  T "H1'"  1 
ATOM   6458 H  H8     . DG  C 3 17  ? 18.030  40.440  37.715  1.00 78.84  ? 17  DG  T H8     1 
ATOM   6459 H  H1     . DG  C 3 17  ? 23.829  38.162  37.034  1.00 70.13  ? 17  DG  T H1     1 
ATOM   6460 H  H21    . DG  C 3 17  ? 22.998  36.053  39.601  1.00 70.01  ? 17  DG  T H21    1 
ATOM   6461 H  H22    . DG  C 3 17  ? 24.184  36.539  38.488  1.00 70.01  ? 17  DG  T H22    1 
ATOM   6462 P  P      . DC  C 3 18  ? 17.015  38.001  43.549  1.00 79.68  ? 18  DC  T P      1 
ATOM   6463 O  OP1    . DC  C 3 18  ? 16.585  36.857  44.388  1.00 81.44  ? 18  DC  T OP1    1 
ATOM   6464 O  OP2    . DC  C 3 18  ? 16.423  39.333  43.797  1.00 66.99  ? 18  DC  T OP2    1 
ATOM   6465 O  "O5'"  . DC  C 3 18  ? 18.613  38.127  43.618  1.00 66.12  ? 18  DC  T "O5'"  1 
ATOM   6466 C  "C5'"  . DC  C 3 18  ? 19.412  36.982  43.368  1.00 67.46  ? 18  DC  T "C5'"  1 
ATOM   6467 C  "C4'"  . DC  C 3 18  ? 20.854  37.395  43.177  1.00 75.24  ? 18  DC  T "C4'"  1 
ATOM   6468 O  "O4'"  . DC  C 3 18  ? 20.978  38.162  41.957  1.00 68.60  ? 18  DC  T "O4'"  1 
ATOM   6469 C  "C3'"  . DC  C 3 18  ? 21.394  38.318  44.266  1.00 74.84  ? 18  DC  T "C3'"  1 
ATOM   6470 O  "O3'"  . DC  C 3 18  ? 22.028  37.549  45.299  1.00 75.66  ? 18  DC  T "O3'"  1 
ATOM   6471 C  "C2'"  . DC  C 3 18  ? 22.346  39.258  43.513  1.00 69.34  ? 18  DC  T "C2'"  1 
ATOM   6472 C  "C1'"  . DC  C 3 18  ? 22.192  38.875  42.042  1.00 72.44  ? 18  DC  T "C1'"  1 
ATOM   6473 N  N1     . DC  C 3 18  ? 22.120  40.009  41.071  1.00 67.44  ? 18  DC  T N1     1 
ATOM   6474 C  C2     . DC  C 3 18  ? 23.197  40.247  40.214  1.00 64.16  ? 18  DC  T C2     1 
ATOM   6475 O  O2     . DC  C 3 18  ? 24.192  39.516  40.296  1.00 61.32  ? 18  DC  T O2     1 
ATOM   6476 N  N3     . DC  C 3 18  ? 23.116  41.271  39.323  1.00 62.58  ? 18  DC  T N3     1 
ATOM   6477 C  C4     . DC  C 3 18  ? 22.025  42.034  39.271  1.00 65.47  ? 18  DC  T C4     1 
ATOM   6478 N  N4     . DC  C 3 18  ? 21.990  43.028  38.379  1.00 64.18  ? 18  DC  T N4     1 
ATOM   6479 C  C5     . DC  C 3 18  ? 20.916  41.805  40.134  1.00 65.11  ? 18  DC  T C5     1 
ATOM   6480 C  C6     . DC  C 3 18  ? 21.005  40.791  41.004  1.00 65.76  ? 18  DC  T C6     1 
ATOM   6481 H  "H5'"  . DC  C 3 18  ? 19.092  36.533  42.559  1.00 80.95  ? 18  DC  T "H5'"  1 
ATOM   6482 H  "H5''" . DC  C 3 18  ? 19.347  36.368  44.129  1.00 80.95  ? 18  DC  T "H5''" 1 
ATOM   6483 H  "H4'"  . DC  C 3 18  ? 21.417  36.596  43.118  1.00 90.29  ? 18  DC  T "H4'"  1 
ATOM   6484 H  "H3'"  . DC  C 3 18  ? 20.657  38.838  44.649  1.00 89.81  ? 18  DC  T "H3'"  1 
ATOM   6485 H  "H2'"  . DC  C 3 18  ? 22.083  40.192  43.651  1.00 83.21  ? 18  DC  T "H2'"  1 
ATOM   6486 H  "H2''" . DC  C 3 18  ? 23.270  39.115  43.807  1.00 83.21  ? 18  DC  T "H2''" 1 
ATOM   6487 H  "H1'"  . DC  C 3 18  ? 22.929  38.282  41.787  1.00 86.93  ? 18  DC  T "H1'"  1 
ATOM   6488 H  H41    . DC  C 3 18  ? 21.200  43.604  38.318  1.00 77.02  ? 18  DC  T H41    1 
ATOM   6489 H  H42    . DC  C 3 18  ? 22.754  43.180  37.785  1.00 77.02  ? 18  DC  T H42    1 
ATOM   6490 H  H5     . DC  C 3 18  ? 20.115  42.366  40.090  1.00 78.14  ? 18  DC  T H5     1 
ATOM   6491 H  H6     . DC  C 3 18  ? 20.255  40.610  41.609  1.00 78.91  ? 18  DC  T H6     1 
ATOM   6492 P  P      . DC  C 3 19  ? 22.457  38.249  46.685  1.00 82.90  ? 19  DC  T P      1 
ATOM   6493 O  OP1    . DC  C 3 19  ? 22.519  37.200  47.728  1.00 90.14  ? 19  DC  T OP1    1 
ATOM   6494 O  OP2    . DC  C 3 19  ? 21.579  39.424  46.895  1.00 65.73  ? 19  DC  T OP2    1 
ATOM   6495 O  "O5'"  . DC  C 3 19  ? 23.949  38.751  46.397  1.00 76.22  ? 19  DC  T "O5'"  1 
ATOM   6496 C  "C5'"  . DC  C 3 19  ? 24.946  37.811  45.993  1.00 68.37  ? 19  DC  T "C5'"  1 
ATOM   6497 C  "C4'"  . DC  C 3 19  ? 26.236  38.516  45.611  1.00 74.60  ? 19  DC  T "C4'"  1 
ATOM   6498 O  "O4'"  . DC  C 3 19  ? 26.108  39.058  44.272  1.00 61.82  ? 19  DC  T "O4'"  1 
ATOM   6499 C  "C3'"  . DC  C 3 19  ? 26.619  39.714  46.479  1.00 75.96  ? 19  DC  T "C3'"  1 
ATOM   6500 O  "O3'"  . DC  C 3 19  ? 27.439  39.317  47.570  1.00 71.21  ? 19  DC  T "O3'"  1 
ATOM   6501 C  "C2'"  . DC  C 3 19  ? 27.378  40.638  45.523  1.00 62.01  ? 19  DC  T "C2'"  1 
ATOM   6502 C  "C1'"  . DC  C 3 19  ? 26.940  40.196  44.128  1.00 60.28  ? 19  DC  T "C1'"  1 
ATOM   6503 N  N1     . DC  C 3 19  ? 26.180  41.233  43.361  1.00 51.78  ? 19  DC  T N1     1 
ATOM   6504 C  C2     . DC  C 3 19  ? 26.737  41.742  42.188  1.00 55.27  ? 19  DC  T C2     1 
ATOM   6505 O  O2     . DC  C 3 19  ? 27.843  41.319  41.825  1.00 52.34  ? 19  DC  T O2     1 
ATOM   6506 N  N3     . DC  C 3 19  ? 26.049  42.680  41.487  1.00 49.67  ? 19  DC  T N3     1 
ATOM   6507 C  C4     . DC  C 3 19  ? 24.859  43.101  41.917  1.00 59.96  ? 19  DC  T C4     1 
ATOM   6508 N  N4     . DC  C 3 19  ? 24.229  44.023  41.188  1.00 53.52  ? 19  DC  T N4     1 
ATOM   6509 C  C5     . DC  C 3 19  ? 24.266  42.592  43.114  1.00 55.93  ? 19  DC  T C5     1 
ATOM   6510 C  C6     . DC  C 3 19  ? 24.956  41.669  43.796  1.00 57.79  ? 19  DC  T C6     1 
ATOM   6511 H  "H5'"  . DC  C 3 19  ? 24.617  37.304  45.222  1.00 82.04  ? 19  DC  T "H5'"  1 
ATOM   6512 H  "H5''" . DC  C 3 19  ? 25.124  37.193  46.732  1.00 82.04  ? 19  DC  T "H5''" 1 
ATOM   6513 H  "H4'"  . DC  C 3 19  ? 26.969  37.867  45.623  1.00 89.52  ? 19  DC  T "H4'"  1 
ATOM   6514 H  "H3'"  . DC  C 3 19  ? 25.812  40.162  46.808  1.00 91.15  ? 19  DC  T "H3'"  1 
ATOM   6515 H  "HO3'" . DC  C 3 19  ? 28.340  39.690  47.666  1.00 85.45  ? 19  DC  T "HO3'" 1 
ATOM   6516 H  "H2'"  . DC  C 3 19  ? 27.127  41.572  45.680  1.00 74.41  ? 19  DC  T "H2'"  1 
ATOM   6517 H  "H2''" . DC  C 3 19  ? 28.345  40.520  45.631  1.00 74.41  ? 19  DC  T "H2''" 1 
ATOM   6518 H  "H1'"  . DC  C 3 19  ? 27.734  39.943  43.613  1.00 72.34  ? 19  DC  T "H1'"  1 
ATOM   6519 H  H41    . DC  C 3 19  ? 23.352  44.358  41.472  1.00 64.23  ? 19  DC  T H41    1 
ATOM   6520 H  H42    . DC  C 3 19  ? 24.641  44.365  40.367  1.00 64.23  ? 19  DC  T H42    1 
ATOM   6521 H  H5     . DC  C 3 19  ? 23.392  42.908  43.424  1.00 67.11  ? 19  DC  T H5     1 
ATOM   6522 H  H6     . DC  C 3 19  ? 24.580  41.298  44.622  1.00 69.35  ? 19  DC  T H6     1 
HETATM 6523 N  N1     . DCP D 4 .   ? 18.885  11.848  10.557  1.00 36.10  ? 361 DCP A N1     1 
HETATM 6524 C  C2     . DCP D 4 .   ? 17.517  12.062  10.963  1.00 39.77  ? 361 DCP A C2     1 
HETATM 6525 N  N3     . DCP D 4 .   ? 16.797  13.250  10.593  1.00 39.98  ? 361 DCP A N3     1 
HETATM 6526 C  C4     . DCP D 4 .   ? 17.438  14.243  9.807   1.00 43.28  ? 361 DCP A C4     1 
HETATM 6527 C  C5     . DCP D 4 .   ? 18.831  14.047  9.389   1.00 40.15  ? 361 DCP A C5     1 
HETATM 6528 C  C6     . DCP D 4 .   ? 19.553  12.834  9.775   1.00 39.48  ? 361 DCP A C6     1 
HETATM 6529 O  O2     . DCP D 4 .   ? 16.940  11.235  11.623  1.00 35.99  ? 361 DCP A O2     1 
HETATM 6530 N  N4     . DCP D 4 .   ? 16.697  15.426  9.451   1.00 38.31  ? 361 DCP A N4     1 
HETATM 6531 C  "C1'"  . DCP D 4 .   ? 19.583  10.626  10.942  1.00 39.11  ? 361 DCP A "C1'"  1 
HETATM 6532 C  "C2'"  . DCP D 4 .   ? 19.510  9.572   9.901   1.00 43.92  ? 361 DCP A "C2'"  1 
HETATM 6533 C  "C3'"  . DCP D 4 .   ? 20.811  9.659   9.196   1.00 47.38  ? 361 DCP A "C3'"  1 
HETATM 6534 C  "C4'"  . DCP D 4 .   ? 21.740  10.013  10.253  1.00 47.04  ? 361 DCP A "C4'"  1 
HETATM 6535 O  "O4'"  . DCP D 4 .   ? 20.941  10.850  11.169  1.00 39.17  ? 361 DCP A "O4'"  1 
HETATM 6536 O  "O3'"  . DCP D 4 .   ? 21.166  8.442   8.597   1.00 37.06  ? 361 DCP A "O3'"  1 
HETATM 6537 C  "C5'"  . DCP D 4 .   ? 23.018  10.656  9.719   1.00 39.43  ? 361 DCP A "C5'"  1 
HETATM 6538 O  "O5'"  . DCP D 4 .   ? 22.981  11.914  9.083   1.00 41.34  ? 361 DCP A "O5'"  1 
HETATM 6539 P  PA     . DCP D 4 .   ? 23.712  12.236  7.708   1.00 44.87  ? 361 DCP A PA     1 
HETATM 6540 O  O1A    . DCP D 4 .   ? 23.128  13.634  8.021   1.00 37.89  ? 361 DCP A O1A    1 
HETATM 6541 O  O2A    . DCP D 4 .   ? 25.023  11.748  8.333   1.00 40.65  ? 361 DCP A O2A    1 
HETATM 6542 O  O3A    . DCP D 4 .   ? 22.806  11.185  6.901   1.00 41.10  ? 361 DCP A O3A    1 
HETATM 6543 P  PB     . DCP D 4 .   ? 23.223  9.911   6.046   1.00 41.60  ? 361 DCP A PB     1 
HETATM 6544 O  O1B    . DCP D 4 .   ? 24.211  9.425   7.096   1.00 34.77  ? 361 DCP A O1B    1 
HETATM 6545 O  O2B    . DCP D 4 .   ? 21.722  9.515   6.207   1.00 37.64  ? 361 DCP A O2B    1 
HETATM 6546 O  O3B    . DCP D 4 .   ? 23.642  10.919  4.929   1.00 51.44  ? 361 DCP A O3B    1 
HETATM 6547 P  PG     . DCP D 4 .   ? 25.092  10.863  4.300   1.00 47.31  ? 361 DCP A PG     1 
HETATM 6548 O  O1G    . DCP D 4 .   ? 26.067  11.180  5.423   1.00 43.02  ? 361 DCP A O1G    1 
HETATM 6549 O  O2G    . DCP D 4 .   ? 25.034  11.996  3.319   1.00 44.06  ? 361 DCP A O2G    1 
HETATM 6550 O  O3G    . DCP D 4 .   ? 25.492  9.543   3.674   1.00 45.74  ? 361 DCP A O3G    1 
HETATM 6551 H  H5     . DCP D 4 .   ? 19.272  14.721  8.858   1.00 48.18  ? 361 DCP A H5     1 
HETATM 6552 H  H6     . DCP D 4 .   ? 20.463  12.700  9.497   1.00 47.38  ? 361 DCP A H6     1 
HETATM 6553 H  HN41   . DCP D 4 .   ? 17.274  16.134  9.397   1.00 45.98  ? 361 DCP A HN41   1 
HETATM 6554 H  HN42   . DCP D 4 .   ? 16.080  15.600  10.105  1.00 45.98  ? 361 DCP A HN42   1 
HETATM 6555 H  "H1'"  . DCP D 4 .   ? 19.183  10.274  11.751  1.00 46.94  ? 361 DCP A "H1'"  1 
HETATM 6556 H  "H2'1" . DCP D 4 .   ? 19.404  8.692   10.313  1.00 52.70  ? 361 DCP A "H2'1" 1 
HETATM 6557 H  "H2'2" . DCP D 4 .   ? 18.770  9.753   9.280   1.00 52.70  ? 361 DCP A "H2'2" 1 
HETATM 6558 H  "H3'"  . DCP D 4 .   ? 20.780  10.364  8.527   1.00 56.85  ? 361 DCP A "H3'"  1 
HETATM 6559 H  "H4'"  . DCP D 4 .   ? 21.987  9.192   10.724  1.00 56.45  ? 361 DCP A "H4'"  1 
HETATM 6560 H  "HO3'" . DCP D 4 .   ? 22.006  8.488   8.304   1.00 44.47  ? 361 DCP A "HO3'" 1 
HETATM 6561 H  "H5'1" . DCP D 4 .   ? 23.410  10.024  9.079   1.00 47.31  ? 361 DCP A "H5'1" 1 
HETATM 6562 H  "H5'2" . DCP D 4 .   ? 23.639  10.732  10.470  1.00 47.31  ? 361 DCP A "H5'2" 1 
HETATM 6563 CA CA     . CA  E 5 .   ? 26.317  10.140  7.509   1.00 38.60  ? 362 CA  A CA     1 
HETATM 6564 CA CA     . CA  F 5 .   ? 26.619  12.582  9.990   1.00 71.44  ? 363 CA  A CA     1 
HETATM 6565 CA CA     . CA  G 5 .   ? 25.206  24.645  5.006   1.00 94.49  ? 364 CA  A CA     1 
HETATM 6566 O  O      . HOH H 6 .   ? 12.109  13.215  43.749  1.00 43.37  ? 365 HOH A O      1 
HETATM 6567 O  O      . HOH H 6 .   ? 3.600   11.979  5.457   1.00 52.97  ? 366 HOH A O      1 
HETATM 6568 O  O      . HOH H 6 .   ? 8.996   4.109   -7.542  1.00 50.31  ? 367 HOH A O      1 
HETATM 6569 O  O      . HOH H 6 .   ? 12.867  -1.007  9.556   1.00 48.21  ? 368 HOH A O      1 
HETATM 6570 O  O      . HOH H 6 .   ? 32.879  11.291  23.079  1.00 53.57  ? 369 HOH A O      1 
HETATM 6571 O  O      . HOH H 6 .   ? 39.880  21.481  16.085  1.00 48.19  ? 370 HOH A O      1 
HETATM 6572 O  O      . HOH H 6 .   ? 22.342  18.434  31.950  1.00 48.00  ? 371 HOH A O      1 
HETATM 6573 O  O      . HOH H 6 .   ? 34.212  1.421   6.186   1.00 49.74  ? 372 HOH A O      1 
HETATM 6574 O  O      . HOH H 6 .   ? 27.038  -1.802  3.004   1.00 55.50  ? 373 HOH A O      1 
HETATM 6575 O  O      . HOH H 6 .   ? 12.842  16.737  -2.526  1.00 56.45  ? 374 HOH A O      1 
HETATM 6576 O  O      . HOH H 6 .   ? 16.351  -4.451  6.918   1.00 41.46  ? 375 HOH A O      1 
HETATM 6577 O  O      . HOH H 6 .   ? 38.083  35.134  17.130  1.00 50.23  ? 376 HOH A O      1 
HETATM 6578 O  O      . HOH H 6 .   ? 28.520  4.973   21.306  1.00 53.14  ? 377 HOH A O      1 
HETATM 6579 O  O      . HOH H 6 .   ? 24.993  -8.105  5.154   1.00 47.69  ? 378 HOH A O      1 
HETATM 6580 O  O      . HOH H 6 .   ? 7.318   7.633   15.730  1.00 53.08  ? 379 HOH A O      1 
HETATM 6581 O  O      . HOH H 6 .   ? 3.728   15.836  14.966  1.00 57.08  ? 380 HOH A O      1 
HETATM 6582 O  O      . HOH H 6 .   ? 13.802  -5.131  5.521   1.00 59.10  ? 381 HOH A O      1 
HETATM 6583 O  O      . HOH H 6 .   ? 42.656  17.553  20.681  1.00 49.65  ? 382 HOH A O      1 
HETATM 6584 O  O      . HOH H 6 .   ? 37.227  9.882   -1.967  1.00 57.31  ? 383 HOH A O      1 
HETATM 6585 O  O      . HOH H 6 .   ? 19.886  6.180   20.142  1.00 59.31  ? 384 HOH A O      1 
HETATM 6586 O  O      . HOH H 6 .   ? 12.915  24.991  24.786  1.00 59.95  ? 385 HOH A O      1 
HETATM 6587 O  O      . HOH H 6 .   ? 40.466  35.099  16.044  1.00 56.55  ? 386 HOH A O      1 
HETATM 6588 O  O      . HOH H 6 .   ? 17.953  17.254  7.717   1.00 51.14  ? 387 HOH A O      1 
HETATM 6589 O  O      . HOH H 6 .   ? 20.069  16.625  6.416   1.00 60.55  ? 388 HOH A O      1 
HETATM 6590 O  O      . HOH H 6 .   ? 8.752   26.426  35.204  1.00 58.58  ? 389 HOH A O      1 
HETATM 6591 O  O      . HOH H 6 .   ? 54.976  5.998   6.352   1.00 67.02  ? 390 HOH A O      1 
HETATM 6592 O  O      . HOH H 6 .   ? 33.331  -3.449  17.853  1.00 45.71  ? 391 HOH A O      1 
HETATM 6593 O  O      . HOH H 6 .   ? 27.066  5.916   19.264  1.00 52.25  ? 392 HOH A O      1 
HETATM 6594 O  O      . HOH H 6 .   ? 23.642  8.319   19.490  1.00 52.40  ? 393 HOH A O      1 
HETATM 6595 O  O      . HOH H 6 .   ? 17.315  10.122  14.226  1.00 44.05  ? 394 HOH A O      1 
HETATM 6596 O  O      . HOH H 6 .   ? 27.326  -8.941  6.718   1.00 52.27  ? 395 HOH A O      1 
HETATM 6597 O  O      . HOH H 6 .   ? 26.907  14.538  8.938   1.00 45.25  ? 396 HOH A O      1 
HETATM 6598 O  O      . HOH H 6 .   ? 7.556   -0.707  1.464   1.00 57.72  ? 397 HOH A O      1 
HETATM 6599 O  O      . HOH H 6 .   ? 32.308  47.656  8.155   1.00 61.63  ? 398 HOH A O      1 
HETATM 6600 O  O      . HOH H 6 .   ? 35.228  48.140  7.921   1.00 58.19  ? 399 HOH A O      1 
HETATM 6601 O  O      . HOH H 6 .   ? 42.599  33.920  16.871  1.00 56.18  ? 400 HOH A O      1 
HETATM 6602 O  O      . HOH H 6 .   ? 32.575  -4.702  15.479  1.00 66.69  ? 401 HOH A O      1 
HETATM 6603 O  O      . HOH H 6 .   ? 46.658  26.573  6.604   1.00 58.94  ? 402 HOH A O      1 
HETATM 6604 O  O      . HOH H 6 .   ? 37.893  33.366  19.550  1.00 72.86  ? 403 HOH A O      1 
HETATM 6605 O  O      . HOH H 6 .   ? 23.549  27.099  5.091   1.00 62.47  ? 404 HOH A O      1 
HETATM 6606 O  O      . HOH H 6 .   ? 36.919  29.788  17.977  1.00 72.44  ? 405 HOH A O      1 
HETATM 6607 O  O      . HOH H 6 .   ? 18.514  22.144  32.303  1.00 59.30  ? 406 HOH A O      1 
HETATM 6608 O  O      . HOH H 6 .   ? 15.523  10.493  16.242  1.00 63.36  ? 407 HOH A O      1 
HETATM 6609 O  O      . HOH H 6 .   ? 32.734  32.574  22.260  1.00 68.28  ? 408 HOH A O      1 
HETATM 6610 O  O      . HOH H 6 .   ? 33.365  31.282  19.543  1.00 58.78  ? 409 HOH A O      1 
HETATM 6611 O  O      . HOH H 6 .   ? 27.512  -5.629  10.539  1.00 56.86  ? 410 HOH A O      1 
HETATM 6612 O  O      . HOH H 6 .   ? -6.147  18.112  15.236  1.00 61.54  ? 411 HOH A O      1 
HETATM 6613 O  O      . HOH H 6 .   ? 32.175  36.434  -3.249  1.00 67.57  ? 412 HOH A O      1 
HETATM 6614 O  O      . HOH H 6 .   ? 25.015  -2.637  1.735   1.00 71.11  ? 413 HOH A O      1 
HETATM 6615 O  O      . HOH H 6 .   ? 7.310   14.926  44.361  1.00 74.97  ? 414 HOH A O      1 
HETATM 6616 O  O      . HOH H 6 .   ? 4.864   14.246  44.456  1.00 67.12  ? 415 HOH A O      1 
HETATM 6617 O  O      . HOH H 6 .   ? 19.010  13.312  2.707   1.00 58.57  ? 416 HOH A O      1 
HETATM 6618 O  O      . HOH H 6 .   ? 42.839  26.581  10.479  1.00 69.52  ? 417 HOH A O      1 
HETATM 6619 O  O      . HOH H 6 .   ? 6.077   15.393  46.483  1.00 68.01  ? 418 HOH A O      1 
HETATM 6620 O  O      . HOH H 6 .   ? -0.083  10.223  16.753  1.00 50.55  ? 419 HOH A O      1 
HETATM 6621 O  O      . HOH H 6 .   ? 30.289  17.637  14.318  1.00 62.61  ? 420 HOH A O      1 
HETATM 6622 O  O      . HOH I 6 .   ? 14.299  24.148  18.767  1.00 52.00  ? 14  HOH P O      1 
HETATM 6623 O  O      . HOH I 6 .   ? 22.665  42.923  34.282  1.00 53.67  ? 15  HOH P O      1 
HETATM 6624 O  O      . HOH I 6 .   ? 11.326  26.927  23.676  1.00 52.38  ? 18  HOH P O      1 
HETATM 6625 O  O      . HOH I 6 .   ? 19.975  26.809  28.762  1.00 56.74  ? 37  HOH P O      1 
HETATM 6626 O  O      . HOH I 6 .   ? 16.793  33.154  21.533  1.00 56.78  ? 38  HOH P O      1 
HETATM 6627 O  O      . HOH I 6 .   ? 23.880  26.702  16.395  1.00 62.88  ? 61  HOH P O      1 
HETATM 6628 O  O      . HOH J 6 .   ? 4.423   9.825   18.224  1.00 52.36  ? 20  HOH T O      1 
HETATM 6629 O  O      . HOH J 6 .   ? 13.689  17.938  9.633   1.00 50.37  ? 41  HOH T O      1 
HETATM 6630 O  O      . HOH J 6 .   ? 24.902  27.650  19.200  1.00 65.09  ? 46  HOH T O      1 
HETATM 6631 O  O      . HOH J 6 .   ? 20.017  42.841  35.302  1.00 49.63  ? 48  HOH T O      1 
HETATM 6632 O  O      . HOH J 6 .   ? 19.208  44.090  37.688  1.00 57.04  ? 51  HOH T O      1 
HETATM 6633 O  O      . HOH J 6 .   ? 13.653  10.367  15.140  1.00 54.89  ? 52  HOH T O      1 
HETATM 6634 O  O      . HOH J 6 .   ? 14.778  14.274  23.957  1.00 58.81  ? 68  HOH T O      1 
HETATM 6635 O  O      . HOH J 6 .   ? 13.414  14.630  22.793  1.00 66.15  ? 69  HOH T O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  MET 76  76  76  MET MET A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 MET 157 157 157 MET MET A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 MET 216 216 216 MET MET A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 TYR 224 224 224 TYR TYR A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 ARG 230 230 230 ARG ARG A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 GLU 232 232 232 GLU GLU A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 TYR 264 264 264 TYR TYR A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 ASP 294 294 294 ASP ASP A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 ARG 300 300 300 ARG ARG A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 HIS 304 304 304 HIS HIS A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 LYS 308 308 308 LYS LYS A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 SER 313 313 313 SER SER A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 SER 315 315 315 SER SER A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 LYS 321 321 321 LYS LYS A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 LYS 329 329 329 LYS LYS A . n 
A 1 330 ILE 330 330 330 ILE ILE A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 ARG 336 336 336 ARG ARG A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 GLU 342 342 ?   ?   ?   A . n 
A 1 343 ALA 343 343 ?   ?   ?   A . n 
A 1 344 ILE 344 344 ?   ?   ?   A . n 
A 1 345 GLY 345 345 ?   ?   ?   A . n 
A 1 346 LEU 346 346 ?   ?   ?   A . n 
A 1 347 ASP 347 347 ?   ?   ?   A . n 
A 1 348 LYS 348 348 ?   ?   ?   A . n 
A 1 349 PHE 349 349 ?   ?   ?   A . n 
A 1 350 PHE 350 350 ?   ?   ?   A . n 
A 1 351 ASP 351 351 ?   ?   ?   A . n 
A 1 352 THR 352 352 ?   ?   ?   A . n 
A 1 353 GLY 353 353 ?   ?   ?   A . n 
A 1 354 GLY 354 354 ?   ?   ?   A . n 
A 1 355 HIS 355 355 ?   ?   ?   A . n 
A 1 356 HIS 356 356 ?   ?   ?   A . n 
A 1 357 HIS 357 357 ?   ?   ?   A . n 
A 1 358 HIS 358 358 ?   ?   ?   A . n 
A 1 359 HIS 359 359 ?   ?   ?   A . n 
A 1 360 HIS 360 360 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DC  3   3   3   DC  DC  P . n 
B 2 4   DA  4   4   4   DA  DA  P . n 
B 2 5   DC  5   5   5   DC  DC  P . n 
B 2 6   DT  6   6   6   DT  DT  P . n 
B 2 7   DG  7   7   7   DG  DG  P . n 
B 2 8   DA  8   8   8   DA  DA  P . n 
B 2 9   DT  9   9   9   DT  DT  P . n 
B 2 10  DC  10  10  10  DC  DC  P . n 
B 2 11  DG  11  11  11  DG  DG  P . n 
B 2 12  DG  12  12  12  DG  DG  P . n 
B 2 13  DG  13  13  13  DG  DG  P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DT  2   2   ?   ?   ?   T . n 
C 3 3   DA  3   3   ?   ?   ?   T . n 
C 3 4   DC  4   4   ?   ?   ?   T . n 
C 3 5   DG  5   5   5   DG  DG  T . n 
C 3 6   DC  6   6   6   DC  DC  T . n 
C 3 7   DC  7   7   7   DC  DC  T . n 
C 3 8   DT  8   8   8   DT  DT  T . n 
C 3 9   DC  9   9   9   DC  DC  T . n 
C 3 10  DG  10  10  10  DG  DG  T . n 
C 3 11  DA  11  11  11  DA  DA  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DC  13  13  13  DC  DC  T . n 
C 3 14  DA  14  14  14  DA  DA  T . n 
C 3 15  DG  15  15  15  DG  DG  T . n 
C 3 16  DT  16  16  16  DT  DT  T . n 
C 3 17  DG  17  17  17  DG  DG  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
C 3 19  DC  19  19  19  DC  DC  T . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5280  ? 
1 MORE         -60   ? 
1 'SSA (A^2)'  20180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 OD1 ? A ASP 7   ? A ASP 7   ? 1_555 105.4 ? 
2  O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O   ? A PHE 8   ? A PHE 8   ? 1_555 161.1 ? 
3  OD1 ? A ASP 7   ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O   ? A PHE 8   ? A PHE 8   ? 1_555 83.0  ? 
4  O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1B ? D DCP .   ? A DCP 361 ? 1_555 75.8  ? 
5  OD1 ? A ASP 7   ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1B ? D DCP .   ? A DCP 361 ? 1_555 173.5 ? 
6  O   ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1B ? D DCP .   ? A DCP 361 ? 1_555 94.0  ? 
7  O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 75.5  ? 
8  OD1 ? A ASP 7   ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 86.2  ? 
9  O   ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 88.3  ? 
10 O1B ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 87.9  ? 
11 O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1G ? D DCP .   ? A DCP 361 ? 1_555 87.0  ? 
12 OD1 ? A ASP 7   ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1G ? D DCP .   ? A DCP 361 ? 1_555 103.4 ? 
13 O   ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1G ? D DCP .   ? A DCP 361 ? 1_555 107.9 ? 
14 O1B ? D DCP .   ? A DCP 361 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1G ? D DCP .   ? A DCP 361 ? 1_555 83.0  ? 
15 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 362 ? 1_555 O1G ? D DCP .   ? A DCP 361 ? 1_555 161.8 ? 
16 O   ? H HOH .   ? A HOH 396 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OE1 ? A GLU 106 ? A GLU 106 ? 1_555 53.8  ? 
17 O   ? H HOH .   ? A HOH 396 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 O2A ? D DCP .   ? A DCP 361 ? 1_555 93.6  ? 
18 OE1 ? A GLU 106 ? A GLU 106 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 O2A ? D DCP .   ? A DCP 361 ? 1_555 147.2 ? 
19 O   ? H HOH .   ? A HOH 396 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD1 ? A ASP 105 ? A ASP 105 ? 1_555 168.0 ? 
20 OE1 ? A GLU 106 ? A GLU 106 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD1 ? A ASP 105 ? A ASP 105 ? 1_555 118.4 ? 
21 O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD1 ? A ASP 105 ? A ASP 105 ? 1_555 92.8  ? 
22 O   ? H HOH .   ? A HOH 396 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 7   ? A ASP 7   ? 1_555 62.0  ? 
23 OE1 ? A GLU 106 ? A GLU 106 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 7   ? A ASP 7   ? 1_555 74.4  ? 
24 O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 7   ? A ASP 7   ? 1_555 95.2  ? 
25 OD1 ? A ASP 105 ? A ASP 105 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 7   ? A ASP 7   ? 1_555 127.5 ? 
26 O   ? H HOH .   ? A HOH 396 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 146.8 ? 
27 OE1 ? A GLU 106 ? A GLU 106 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 153.0 ? 
28 O2A ? D DCP .   ? A DCP 361 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 58.5  ? 
29 OD1 ? A ASP 105 ? A ASP 105 ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 44.2  ? 
30 OD2 ? A ASP 7   ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 363 ? 1_555 OD2 ? A ASP 105 ? A ASP 105 ? 1_555 100.1 ? 
31 O   ? A ALA 181 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 364 ? 1_555 O   ? H HOH .   ? A HOH 404 ? 1_555 72.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-04-06 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' . ? 1 
PHASER   phasing           . ? 2 
PHENIX   refinement        . ? 3 
HKL-2000 'data reduction'  . ? 4 
HKL-2000 'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   T HOH 68  ? ? O T HOH 69  ? ? 1.83 
2 1 OE1 A GLU 106 ? ? O A HOH 396 ? ? 2.12 
3 1 O   A HOH 407 ? ? O T HOH 52  ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" P DG 2  ? ? "C2'" P DG 2  ? ? "C1'" P DG 2  ? ? 96.64  102.40 -5.76 0.80 N 
2  1 "O4'" P DG 2  ? ? "C1'" P DG 2  ? ? N9    P DG 2  ? ? 111.16 108.30 2.86  0.30 N 
3  1 "O4'" P DT 6  ? ? "C1'" P DT 6  ? ? N1    P DT 6  ? ? 103.54 108.00 -4.46 0.70 N 
4  1 "O4'" P DG 12 ? ? "C1'" P DG 12 ? ? N9    P DG 12 ? ? 111.93 108.30 3.63  0.30 N 
5  1 "O4'" P DG 13 ? ? "C1'" P DG 13 ? ? N9    P DG 13 ? ? 110.37 108.30 2.07  0.30 N 
6  1 "O4'" T DG 5  ? ? "C1'" T DG 5  ? ? N9    T DG 5  ? ? 103.78 108.00 -4.22 0.70 N 
7  1 "O4'" T DC 7  ? ? "C1'" T DC 7  ? ? N1    T DC 7  ? ? 110.42 108.30 2.12  0.30 N 
8  1 "O4'" T DT 8  ? ? "C1'" T DT 8  ? ? N1    T DT 8  ? ? 110.75 108.30 2.45  0.30 N 
9  1 "O4'" T DC 9  ? ? "C1'" T DC 9  ? ? N1    T DC 9  ? ? 112.96 108.30 4.66  0.30 N 
10 1 "O4'" T DT 16 ? ? "C4'" T DT 16 ? ? "C3'" T DT 16 ? ? 100.84 104.50 -3.66 0.40 N 
11 1 "O4'" T DT 16 ? ? "C1'" T DT 16 ? ? N1    T DT 16 ? ? 112.96 108.30 4.66  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 17.92   61.25   
2  1 GLU A 38  ? ? -38.91  117.16  
3  1 ALA A 57  ? ? -38.84  133.45  
4  1 ARG A 77  ? ? -113.94 73.92   
5  1 SER A 96  ? ? -176.87 134.29  
6  1 SER A 103 ? ? -171.92 -171.41 
7  1 SER A 145 ? ? -169.39 -164.01 
8  1 ASN A 161 ? ? 32.32   62.57   
9  1 ASN A 200 ? ? -147.36 -15.88  
10 1 ASN A 254 ? ? -44.87  151.84  
11 1 ASP A 277 ? ? 59.88   -107.59 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 342 ? A GLU 342 
2  1 Y 1 A ALA 343 ? A ALA 343 
3  1 Y 1 A ILE 344 ? A ILE 344 
4  1 Y 1 A GLY 345 ? A GLY 345 
5  1 Y 1 A LEU 346 ? A LEU 346 
6  1 Y 1 A ASP 347 ? A ASP 347 
7  1 Y 1 A LYS 348 ? A LYS 348 
8  1 Y 1 A PHE 349 ? A PHE 349 
9  1 Y 1 A PHE 350 ? A PHE 350 
10 1 Y 1 A ASP 351 ? A ASP 351 
11 1 Y 1 A THR 352 ? A THR 352 
12 1 Y 1 A GLY 353 ? A GLY 353 
13 1 Y 1 A GLY 354 ? A GLY 354 
14 1 Y 1 A HIS 355 ? A HIS 355 
15 1 Y 1 A HIS 356 ? A HIS 356 
16 1 Y 1 A HIS 357 ? A HIS 357 
17 1 Y 1 A HIS 358 ? A HIS 358 
18 1 Y 1 A HIS 359 ? A HIS 359 
19 1 Y 1 A HIS 360 ? A HIS 360 
20 1 Y 1 T DT  1   ? C DT  1   
21 1 Y 1 T DT  2   ? C DT  2   
22 1 Y 1 T DA  3   ? C DA  3   
23 1 Y 1 T DC  4   ? C DC  4   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3QZ7 'double helix'        
3QZ7 'b-form double helix' 
3QZ7 'bulge loop'          
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 19 1_555 -0.316 -0.156 -0.021 -0.629 -7.288  -4.280 1  P_DG1:DC19_T  P 1  ? T 19 ? 19 1 
1 B DG 2  1_555 C DC 18 1_555 -0.565 -0.124 0.006  14.116 -8.926  3.210  2  P_DG2:DC18_T  P 2  ? T 18 ? 19 1 
1 B DC 3  1_555 C DG 17 1_555 0.580  -0.172 0.004  7.032  -8.685  -0.728 3  P_DC3:DG17_T  P 3  ? T 17 ? 19 1 
1 B DA 4  1_555 C DT 16 1_555 -0.219 0.104  0.292  6.102  -15.119 5.958  4  P_DA4:DT16_T  P 4  ? T 16 ? 20 1 
1 B DC 5  1_555 C DG 15 1_555 0.673  -0.095 0.272  -4.097 -13.667 0.116  5  P_DC5:DG15_T  P 5  ? T 15 ? 19 1 
1 B DT 6  1_555 C DA 14 1_555 0.395  -0.141 0.271  -1.829 -7.874  1.698  6  P_DT6:DA14_T  P 6  ? T 14 ? 20 1 
1 B DG 7  1_555 C DC 13 1_555 -0.277 -0.109 -0.021 3.717  -12.489 3.899  7  P_DG7:DC13_T  P 7  ? T 13 ? 19 1 
1 B DA 8  1_555 C DT 12 1_555 -0.054 -0.072 -0.221 -8.386 -9.765  -0.233 8  P_DA8:DT12_T  P 8  ? T 12 ? 20 1 
1 B DT 9  1_555 C DA 11 1_555 0.067  -0.136 0.005  -5.227 -9.686  -0.092 9  P_DT9:DA11_T  P 9  ? T 11 ? 20 1 
1 B DC 10 1_555 C DG 10 1_555 0.034  -0.114 -0.160 -3.031 -5.832  -5.151 10 P_DC10:DG10_T P 10 ? T 10 ? 19 1 
1 B DG 11 1_555 C DC 9  1_555 -0.644 -0.061 -0.165 6.146  -2.221  2.681  11 P_DG11:DC9_T  P 11 ? T 9  ? 19 1 
1 B DG 12 1_555 C DC 7  1_555 -0.098 -0.146 0.117  7.022  -7.808  0.137  12 P_DG12:DC7_T  P 12 ? T 7  ? 19 1 
1 B DG 13 1_555 C DC 6  1_555 -0.611 0.018  -0.014 -9.017 -9.452  5.772  13 P_DG13:DC6_T  P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 19 1_555 B DG 2  1_555 C DC 18 1_555 0.714  -0.082 3.069 -1.051 4.211  29.818 -0.959 -1.575 3.003 8.128  
2.028  30.126 1  PP_DG1DG2:DC18DC19_TT  P 1  ? T 19 ? P 2  ? T 18 ? 
1 B DG 2  1_555 C DC 18 1_555 B DC 3  1_555 C DG 17 1_555 -1.031 -0.082 3.456 -2.584 0.210  42.443 -0.136 1.142  3.510 0.290  
3.566  42.518 2  PP_DG2DC3:DG17DC18_TT  P 2  ? T 18 ? P 3  ? T 17 ? 
1 B DC 3  1_555 C DG 17 1_555 B DA 4  1_555 C DT 16 1_555 0.445  -0.162 3.273 -0.393 7.683  33.226 -1.493 -0.821 3.152 13.217 
0.676  34.081 3  PP_DC3DA4:DT16DG17_TT  P 3  ? T 17 ? P 4  ? T 16 ? 
1 B DA 4  1_555 C DT 16 1_555 B DC 5  1_555 C DG 15 1_555 -0.395 -0.724 3.499 -1.527 4.232  34.102 -1.925 0.415  3.401 7.178  
2.590  34.388 4  PP_DA4DC5:DG15DT16_TT  P 4  ? T 16 ? P 5  ? T 15 ? 
1 B DC 5  1_555 C DG 15 1_555 B DT 6  1_555 C DA 14 1_555 -0.090 -0.498 3.267 2.897  7.850  33.345 -2.049 0.597  3.056 13.419 
-4.952 34.350 5  PP_DC5DT6:DA14DG15_TT  P 5  ? T 15 ? P 6  ? T 14 ? 
1 B DT 6  1_555 C DA 14 1_555 B DG 7  1_555 C DC 13 1_555 0.216  0.870  3.295 1.512  8.965  31.855 -0.055 -0.113 3.414 15.933 
-2.687 33.094 6  PP_DT6DG7:DC13DA14_TT  P 6  ? T 14 ? P 7  ? T 13 ? 
1 B DG 7  1_555 C DC 13 1_555 B DA 8  1_555 C DT 12 1_555 -0.092 -0.054 3.469 0.522  2.237  41.827 -0.323 0.186  3.460 3.131  
-0.730 41.887 7  PP_DG7DA8:DT12DC13_TT  P 7  ? T 13 ? P 8  ? T 12 ? 
1 B DA 8  1_555 C DT 12 1_555 B DT 9  1_555 C DA 11 1_555 0.035  -0.595 3.313 -1.779 0.299  32.795 -1.104 -0.371 3.301 0.528  
3.148  32.843 8  PP_DA8DT9:DA11DT12_TT  P 8  ? T 12 ? P 9  ? T 11 ? 
1 B DT 9  1_555 C DA 11 1_555 B DC 10 1_555 C DG 10 1_555 0.128  -0.161 3.278 2.698  -0.142 35.446 -0.243 0.185  3.279 -0.232 
-4.424 35.546 9  PP_DT9DC10:DG10DA11_TT P 9  ? T 11 ? P 10 ? T 10 ? 
1 B DC 10 1_555 C DG 10 1_555 B DG 11 1_555 C DC 9  1_555 0.758  0.130  3.271 -1.375 7.787  29.680 -1.287 -1.703 3.165 14.872 
2.626  30.692 10 PP_DC10DG11:DC9DG10_TT P 10 ? T 10 ? P 11 ? T 9  ? 
1 B DG 11 1_555 C DC 9  1_555 B DG 12 1_555 C DC 7  1_555 0.073  -1.425 3.391 -4.693 4.725  25.630 -4.361 -1.400 3.023 10.429 
10.356 26.467 11 PP_DG11DG12:DC7DC9_TT  P 11 ? T 9  ? P 12 ? T 7  ? 
1 B DG 12 1_555 C DC 7  1_555 B DG 13 1_555 C DC 6  1_555 0.277  -1.148 3.630 0.931  8.441  31.862 -3.559 -0.319 3.235 15.044 
-1.659 32.946 12 PP_DG12DG13:DC6DC7_TT  P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
5 'CALCIUM ION'                      CA  
6 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DCP 1  361 1  DCP DCP A . 
E 5 CA  1  362 1  CA  CA  A . 
F 5 CA  1  363 2  CA  CA  A . 
G 5 CA  1  364 3  CA  CA  A . 
H 6 HOH 1  365 1  HOH HOH A . 
H 6 HOH 2  366 2  HOH HOH A . 
H 6 HOH 3  367 3  HOH HOH A . 
H 6 HOH 4  368 4  HOH HOH A . 
H 6 HOH 5  369 5  HOH HOH A . 
H 6 HOH 6  370 6  HOH HOH A . 
H 6 HOH 7  371 7  HOH HOH A . 
H 6 HOH 8  372 8  HOH HOH A . 
H 6 HOH 9  373 10 HOH HOH A . 
H 6 HOH 10 374 12 HOH HOH A . 
H 6 HOH 11 375 13 HOH HOH A . 
H 6 HOH 12 376 14 HOH HOH A . 
H 6 HOH 13 377 15 HOH HOH A . 
H 6 HOH 14 378 16 HOH HOH A . 
H 6 HOH 15 379 17 HOH HOH A . 
H 6 HOH 16 380 19 HOH HOH A . 
H 6 HOH 17 381 21 HOH HOH A . 
H 6 HOH 18 382 22 HOH HOH A . 
H 6 HOH 19 383 23 HOH HOH A . 
H 6 HOH 20 384 24 HOH HOH A . 
H 6 HOH 21 385 25 HOH HOH A . 
H 6 HOH 22 386 26 HOH HOH A . 
H 6 HOH 23 387 27 HOH HOH A . 
H 6 HOH 24 388 28 HOH HOH A . 
H 6 HOH 25 389 29 HOH HOH A . 
H 6 HOH 26 390 30 HOH HOH A . 
H 6 HOH 27 391 31 HOH HOH A . 
H 6 HOH 28 392 32 HOH HOH A . 
H 6 HOH 29 393 33 HOH HOH A . 
H 6 HOH 30 394 34 HOH HOH A . 
H 6 HOH 31 395 35 HOH HOH A . 
H 6 HOH 32 396 36 HOH HOH A . 
H 6 HOH 33 397 39 HOH HOH A . 
H 6 HOH 34 398 40 HOH HOH A . 
H 6 HOH 35 399 42 HOH HOH A . 
H 6 HOH 36 400 43 HOH HOH A . 
H 6 HOH 37 401 44 HOH HOH A . 
H 6 HOH 38 402 45 HOH HOH A . 
H 6 HOH 39 403 47 HOH HOH A . 
H 6 HOH 40 404 49 HOH HOH A . 
H 6 HOH 41 405 50 HOH HOH A . 
H 6 HOH 42 406 53 HOH HOH A . 
H 6 HOH 43 407 54 HOH HOH A . 
H 6 HOH 44 408 55 HOH HOH A . 
H 6 HOH 45 409 56 HOH HOH A . 
H 6 HOH 46 410 57 HOH HOH A . 
H 6 HOH 47 411 58 HOH HOH A . 
H 6 HOH 48 412 59 HOH HOH A . 
H 6 HOH 49 413 60 HOH HOH A . 
H 6 HOH 50 414 62 HOH HOH A . 
H 6 HOH 51 415 63 HOH HOH A . 
H 6 HOH 52 416 64 HOH HOH A . 
H 6 HOH 53 417 65 HOH HOH A . 
H 6 HOH 54 418 66 HOH HOH A . 
H 6 HOH 55 419 67 HOH HOH A . 
H 6 HOH 56 420 70 HOH HOH A . 
I 6 HOH 1  14  9  HOH HOH P . 
I 6 HOH 2  15  11 HOH HOH P . 
I 6 HOH 3  18  18 HOH HOH P . 
I 6 HOH 4  37  37 HOH HOH P . 
I 6 HOH 5  38  38 HOH HOH P . 
I 6 HOH 6  61  61 HOH HOH P . 
J 6 HOH 1  20  20 HOH HOH T . 
J 6 HOH 2  41  41 HOH HOH T . 
J 6 HOH 3  46  46 HOH HOH T . 
J 6 HOH 4  48  48 HOH HOH T . 
J 6 HOH 5  51  51 HOH HOH T . 
J 6 HOH 6  52  52 HOH HOH T . 
J 6 HOH 7  68  68 HOH HOH T . 
J 6 HOH 8  69  69 HOH HOH T . 
#